data_1COK
# 
_entry.id   1COK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1COK         
RCSB  RCSB001127   
WWPDB D_1000001127 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1COK 
_pdbx_database_status.recvd_initial_deposition_date   1999-05-28 
_pdbx_database_status.deposit_site                    BNL 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chi, S.-W.'       1 
'Ayed, A.'         2 
'Arrowsmith, C.H.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Solution structure of a conserved C-terminal domain of p73 with structural homology to the SAM domain.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            18 
_citation.page_first                4438 
_citation.page_last                 4445 
_citation.year                      1999 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10449409 
_citation.pdbx_database_id_DOI      10.1093/emboj/18.16.4438 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chi, S.W.'        1 
primary 'Ayed, A.'         2 
primary 'Arrowsmith, C.H.' 3 
# 
_cell.entry_id           1COK 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1COK 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'PROTEIN (SECOND SPLICE VARIANT P73)' 
_entity.formula_weight             7808.814 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'C-TERMINAL DOMAIN' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDY 
_entity_poly.pdbx_seq_one_letter_code_can   YHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMTIWRGLQDLKQGHDY 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  TYR n 
1 2  HIS n 
1 3  ALA n 
1 4  ASP n 
1 5  PRO n 
1 6  SER n 
1 7  LEU n 
1 8  VAL n 
1 9  SER n 
1 10 PHE n 
1 11 LEU n 
1 12 THR n 
1 13 GLY n 
1 14 LEU n 
1 15 GLY n 
1 16 CYS n 
1 17 PRO n 
1 18 ASN n 
1 19 CYS n 
1 20 ILE n 
1 21 GLU n 
1 22 TYR n 
1 23 PHE n 
1 24 THR n 
1 25 SER n 
1 26 GLN n 
1 27 GLY n 
1 28 LEU n 
1 29 GLN n 
1 30 SER n 
1 31 ILE n 
1 32 TYR n 
1 33 HIS n 
1 34 LEU n 
1 35 GLN n 
1 36 ASN n 
1 37 LEU n 
1 38 THR n 
1 39 ILE n 
1 40 GLU n 
1 41 ASP n 
1 42 LEU n 
1 43 GLY n 
1 44 ALA n 
1 45 LEU n 
1 46 LYS n 
1 47 ILE n 
1 48 PRO n 
1 49 GLU n 
1 50 GLN n 
1 51 TYR n 
1 52 ARG n 
1 53 MET n 
1 54 THR n 
1 55 ILE n 
1 56 TRP n 
1 57 ARG n 
1 58 GLY n 
1 59 LEU n 
1 60 GLN n 
1 61 ASP n 
1 62 LEU n 
1 63 LYS n 
1 64 GLN n 
1 65 GLY n 
1 66 HIS n 
1 67 ASP n 
1 68 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              P73ALPHA 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET15B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    P73_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O15350 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1COK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 68 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O15350 
_struct_ref_seq.db_align_beg                  439 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  506 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       68 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 C13                1 
2 1 'N15 EDITED NOESY' 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '150mM NACL, 25mM SODIUM PHOSPHATE' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '10% WATER/90% D2O' 
_pdbx_nmr_sample_details.solvent_system   ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 'UNITY 600'     Varian 500 ? 
2 'UNITYPLUS 500' Varian 600 ? 
# 
_pdbx_nmr_refine.entry_id           1COK 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'REFINEMENT DETAILS CAN BE FOUND IN J. MOL BIOL. 1997 JUN 13;269(3) : 408-22.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1COK 
_pdbx_nmr_details.text       
;THE STRUCTURE WAS DETERMINED USING TRIPLE- RESONANCE NMR SPECTROSCOPY ON C13, 
N15-LABELED P73 C- TERMINAL DOMAIN.
;
# 
_pdbx_nmr_ensemble.entry_id                                      1COK 
_pdbx_nmr_ensemble.conformers_calculated_total_number            30 
_pdbx_nmr_ensemble.conformers_submitted_total_number             18 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'LEAST RESTRAINT VIOLATION' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1COK 
_pdbx_nmr_representative.conformer_id         7 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           X-PLOR ? BRUNGER 1 
refinement           ARIA   ? NILGES  2 
'structure solution' X-PLOR ? ?       3 
'structure solution' ARIA   ? ?       4 
# 
_exptl.entry_id          1COK 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1COK 
_struct.title                     'STRUCTURE OF THE C-TERMINAL DOMAIN OF P73' 
_struct.pdbx_descriptor           'PROTEIN (SECOND SPLICE VARIANT P73)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1COK 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            'P73 SAM-LIKE DOMAIN, GENE REGULATION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 H1 PRO A 5  ? GLY A 13 ? PRO A 5  GLY A 13 1 ? 9  
HELX_P HELX_P2 H2 ILE A 20 ? THR A 24 ? ILE A 20 THR A 24 1 ? 5  
HELX_P HELX_P3 H4 ILE A 39 ? LEU A 45 ? ILE A 39 LEU A 45 1 ? 7  
HELX_P HELX_P4 H5 ARG A 52 ? GLN A 64 ? ARG A 52 GLN A 64 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           4 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            4 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    5 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     5 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     9 
_struct_mon_prot_cis.pdbx_omega_angle       5.69 
# 
_database_PDB_matrix.entry_id          1COK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1COK 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . TYR A 1 1  ? 3.706   17.670  -7.911  1.00 0.00 ? 1  TYR A N    1  
ATOM 2     C CA   . TYR A 1 1  ? 4.013   18.228  -6.568  1.00 0.00 ? 1  TYR A CA   1  
ATOM 3     C C    . TYR A 1 1  ? 5.470   17.983  -6.186  1.00 0.00 ? 1  TYR A C    1  
ATOM 4     O O    . TYR A 1 1  ? 5.818   17.980  -5.005  1.00 0.00 ? 1  TYR A O    1  
ATOM 5     C CB   . TYR A 1 1  ? 3.082   17.573  -5.546  1.00 0.00 ? 1  TYR A CB   1  
ATOM 6     C CG   . TYR A 1 1  ? 1.652   18.057  -5.630  1.00 0.00 ? 1  TYR A CG   1  
ATOM 7     C CD1  . TYR A 1 1  ? 1.330   19.379  -5.350  1.00 0.00 ? 1  TYR A CD1  1  
ATOM 8     C CD2  . TYR A 1 1  ? 0.625   17.193  -5.989  1.00 0.00 ? 1  TYR A CD2  1  
ATOM 9     C CE1  . TYR A 1 1  ? 0.025   19.827  -5.426  1.00 0.00 ? 1  TYR A CE1  1  
ATOM 10    C CE2  . TYR A 1 1  ? -0.682  17.633  -6.067  1.00 0.00 ? 1  TYR A CE2  1  
ATOM 11    C CZ   . TYR A 1 1  ? -0.977  18.950  -5.786  1.00 0.00 ? 1  TYR A CZ   1  
ATOM 12    O OH   . TYR A 1 1  ? -2.278  19.392  -5.862  1.00 0.00 ? 1  TYR A OH   1  
ATOM 13    H H1   . TYR A 1 1  ? 4.136   16.725  -7.967  1.00 0.00 ? 1  TYR A H1   1  
ATOM 14    H H2   . TYR A 1 1  ? 4.116   18.310  -8.621  1.00 0.00 ? 1  TYR A H2   1  
ATOM 15    H H3   . TYR A 1 1  ? 2.672   17.618  -8.003  1.00 0.00 ? 1  TYR A H3   1  
ATOM 16    H HA   . TYR A 1 1  ? 3.829   19.291  -6.588  1.00 0.00 ? 1  TYR A HA   1  
ATOM 17    H HB2  . TYR A 1 1  ? 3.080   16.504  -5.704  1.00 0.00 ? 1  TYR A HB2  1  
ATOM 18    H HB3  . TYR A 1 1  ? 3.446   17.784  -4.551  1.00 0.00 ? 1  TYR A HB3  1  
ATOM 19    H HD1  . TYR A 1 1  ? 2.117   20.063  -5.070  1.00 0.00 ? 1  TYR A HD1  1  
ATOM 20    H HD2  . TYR A 1 1  ? 0.860   16.162  -6.210  1.00 0.00 ? 1  TYR A HD2  1  
ATOM 21    H HE1  . TYR A 1 1  ? -0.206  20.858  -5.206  1.00 0.00 ? 1  TYR A HE1  1  
ATOM 22    H HE2  . TYR A 1 1  ? -1.467  16.946  -6.348  1.00 0.00 ? 1  TYR A HE2  1  
ATOM 23    H HH   . TYR A 1 1  ? -2.637  19.484  -4.976  1.00 0.00 ? 1  TYR A HH   1  
ATOM 24    N N    . HIS A 1 2  ? 6.316   17.779  -7.190  1.00 0.00 ? 2  HIS A N    1  
ATOM 25    C CA   . HIS A 1 2  ? 7.734   17.533  -6.956  1.00 0.00 ? 2  HIS A CA   1  
ATOM 26    C C    . HIS A 1 2  ? 7.933   16.432  -5.920  1.00 0.00 ? 2  HIS A C    1  
ATOM 27    O O    . HIS A 1 2  ? 7.923   16.689  -4.716  1.00 0.00 ? 2  HIS A O    1  
ATOM 28    C CB   . HIS A 1 2  ? 8.425   18.814  -6.488  1.00 0.00 ? 2  HIS A CB   1  
ATOM 29    C CG   . HIS A 1 2  ? 8.700   19.787  -7.593  1.00 0.00 ? 2  HIS A CG   1  
ATOM 30    N ND1  . HIS A 1 2  ? 8.747   21.152  -7.400  1.00 0.00 ? 2  HIS A ND1  1  
ATOM 31    C CD2  . HIS A 1 2  ? 8.943   19.587  -8.910  1.00 0.00 ? 2  HIS A CD2  1  
ATOM 32    C CE1  . HIS A 1 2  ? 9.008   21.749  -8.549  1.00 0.00 ? 2  HIS A CE1  1  
ATOM 33    N NE2  . HIS A 1 2  ? 9.130   20.822  -9.480  1.00 0.00 ? 2  HIS A NE2  1  
ATOM 34    H H    . HIS A 1 2  ? 5.980   17.794  -8.111  1.00 0.00 ? 2  HIS A H    1  
ATOM 35    H HA   . HIS A 1 2  ? 8.175   17.216  -7.891  1.00 0.00 ? 2  HIS A HA   1  
ATOM 36    H HB2  . HIS A 1 2  ? 7.797   19.304  -5.762  1.00 0.00 ? 2  HIS A HB2  1  
ATOM 37    H HB3  . HIS A 1 2  ? 9.368   18.558  -6.028  1.00 0.00 ? 2  HIS A HB3  1  
ATOM 38    H HD1  . HIS A 1 2  ? 8.610   21.614  -6.546  1.00 0.00 ? 2  HIS A HD1  1  
ATOM 39    H HD2  . HIS A 1 2  ? 8.984   18.633  -9.418  1.00 0.00 ? 2  HIS A HD2  1  
ATOM 40    H HE1  . HIS A 1 2  ? 9.103   22.813  -8.701  1.00 0.00 ? 2  HIS A HE1  1  
ATOM 41    H HE2  . HIS A 1 2  ? 9.325   20.991  -10.426 1.00 0.00 ? 2  HIS A HE2  1  
ATOM 42    N N    . ALA A 1 3  ? 8.111   15.207  -6.397  1.00 0.00 ? 3  ALA A N    1  
ATOM 43    C CA   . ALA A 1 3  ? 8.311   14.065  -5.515  1.00 0.00 ? 3  ALA A CA   1  
ATOM 44    C C    . ALA A 1 3  ? 7.050   13.763  -4.713  1.00 0.00 ? 3  ALA A C    1  
ATOM 45    O O    . ALA A 1 3  ? 6.282   14.666  -4.383  1.00 0.00 ? 3  ALA A O    1  
ATOM 46    C CB   . ALA A 1 3  ? 9.485   14.319  -4.582  1.00 0.00 ? 3  ALA A CB   1  
ATOM 47    H H    . ALA A 1 3  ? 8.110   15.070  -7.367  1.00 0.00 ? 3  ALA A H    1  
ATOM 48    H HA   . ALA A 1 3  ? 8.550   13.207  -6.128  1.00 0.00 ? 3  ALA A HA   1  
ATOM 49    H HB1  . ALA A 1 3  ? 10.111  15.095  -4.995  1.00 0.00 ? 3  ALA A HB1  1  
ATOM 50    H HB2  . ALA A 1 3  ? 10.061  13.411  -4.473  1.00 0.00 ? 3  ALA A HB2  1  
ATOM 51    H HB3  . ALA A 1 3  ? 9.116   14.629  -3.616  1.00 0.00 ? 3  ALA A HB3  1  
ATOM 52    N N    . ASP A 1 4  ? 6.843   12.487  -4.405  1.00 0.00 ? 4  ASP A N    1  
ATOM 53    C CA   . ASP A 1 4  ? 5.674   12.067  -3.640  1.00 0.00 ? 4  ASP A CA   1  
ATOM 54    C C    . ASP A 1 4  ? 6.043   10.977  -2.636  1.00 0.00 ? 4  ASP A C    1  
ATOM 55    O O    . ASP A 1 4  ? 5.747   9.802   -2.846  1.00 0.00 ? 4  ASP A O    1  
ATOM 56    C CB   . ASP A 1 4  ? 4.579   11.558  -4.582  1.00 0.00 ? 4  ASP A CB   1  
ATOM 57    C CG   . ASP A 1 4  ? 5.137   10.743  -5.732  1.00 0.00 ? 4  ASP A CG   1  
ATOM 58    O OD1  . ASP A 1 4  ? 6.289   10.271  -5.622  1.00 0.00 ? 4  ASP A OD1  1  
ATOM 59    O OD2  . ASP A 1 4  ? 4.422   10.578  -6.743  1.00 0.00 ? 4  ASP A OD2  1  
ATOM 60    H H    . ASP A 1 4  ? 7.491   11.813  -4.696  1.00 0.00 ? 4  ASP A H    1  
ATOM 61    H HA   . ASP A 1 4  ? 5.303   12.927  -3.101  1.00 0.00 ? 4  ASP A HA   1  
ATOM 62    H HB2  . ASP A 1 4  ? 3.893   10.937  -4.025  1.00 0.00 ? 4  ASP A HB2  1  
ATOM 63    H HB3  . ASP A 1 4  ? 4.043   12.403  -4.990  1.00 0.00 ? 4  ASP A HB3  1  
ATOM 64    N N    . PRO A 1 5  ? 6.702   11.357  -1.526  1.00 0.00 ? 5  PRO A N    1  
ATOM 65    C CA   . PRO A 1 5  ? 7.116   10.406  -0.489  1.00 0.00 ? 5  PRO A CA   1  
ATOM 66    C C    . PRO A 1 5  ? 5.932   9.664   0.121   1.00 0.00 ? 5  PRO A C    1  
ATOM 67    O O    . PRO A 1 5  ? 6.026   8.479   0.438   1.00 0.00 ? 5  PRO A O    1  
ATOM 68    C CB   . PRO A 1 5  ? 7.793   11.287  0.568   1.00 0.00 ? 5  PRO A CB   1  
ATOM 69    C CG   . PRO A 1 5  ? 8.151   12.545  -0.146  1.00 0.00 ? 5  PRO A CG   1  
ATOM 70    C CD   . PRO A 1 5  ? 7.098   12.737  -1.197  1.00 0.00 ? 5  PRO A CD   1  
ATOM 71    H HA   . PRO A 1 5  ? 7.829   9.690   -0.871  1.00 0.00 ? 5  PRO A HA   1  
ATOM 72    H HB2  . PRO A 1 5  ? 7.103   11.475  1.377   1.00 0.00 ? 5  PRO A HB2  1  
ATOM 73    H HB3  . PRO A 1 5  ? 8.671   10.786  0.949   1.00 0.00 ? 5  PRO A HB3  1  
ATOM 74    H HG2  . PRO A 1 5  ? 8.146   13.374  0.546   1.00 0.00 ? 5  PRO A HG2  1  
ATOM 75    H HG3  . PRO A 1 5  ? 9.124   12.444  -0.603  1.00 0.00 ? 5  PRO A HG3  1  
ATOM 76    H HD2  . PRO A 1 5  ? 6.262   13.293  -0.799  1.00 0.00 ? 5  PRO A HD2  1  
ATOM 77    H HD3  . PRO A 1 5  ? 7.511   13.237  -2.061  1.00 0.00 ? 5  PRO A HD3  1  
ATOM 78    N N    . SER A 1 6  ? 4.819   10.372  0.290   1.00 0.00 ? 6  SER A N    1  
ATOM 79    C CA   . SER A 1 6  ? 3.617   9.782   0.869   1.00 0.00 ? 6  SER A CA   1  
ATOM 80    C C    . SER A 1 6  ? 3.055   8.689   -0.032  1.00 0.00 ? 6  SER A C    1  
ATOM 81    O O    . SER A 1 6  ? 2.030   8.878   -0.688  1.00 0.00 ? 6  SER A O    1  
ATOM 82    C CB   . SER A 1 6  ? 2.556   10.859  1.105   1.00 0.00 ? 6  SER A CB   1  
ATOM 83    O OG   . SER A 1 6  ? 1.637   10.459  2.107   1.00 0.00 ? 6  SER A OG   1  
ATOM 84    H H    . SER A 1 6  ? 4.806   11.314  0.020   1.00 0.00 ? 6  SER A H    1  
ATOM 85    H HA   . SER A 1 6  ? 3.890   9.343   1.818   1.00 0.00 ? 6  SER A HA   1  
ATOM 86    H HB2  . SER A 1 6  ? 3.037   11.773  1.420   1.00 0.00 ? 6  SER A HB2  1  
ATOM 87    H HB3  . SER A 1 6  ? 2.015   11.035  0.187   1.00 0.00 ? 6  SER A HB3  1  
ATOM 88    H HG   . SER A 1 6  ? 1.560   11.152  2.767   1.00 0.00 ? 6  SER A HG   1  
ATOM 89    N N    . LEU A 1 7  ? 3.729   7.544   -0.055  1.00 0.00 ? 7  LEU A N    1  
ATOM 90    C CA   . LEU A 1 7  ? 3.294   6.415   -0.870  1.00 0.00 ? 7  LEU A CA   1  
ATOM 91    C C    . LEU A 1 7  ? 4.279   5.256   -0.763  1.00 0.00 ? 7  LEU A C    1  
ATOM 92    O O    . LEU A 1 7  ? 3.888   4.118   -0.509  1.00 0.00 ? 7  LEU A O    1  
ATOM 93    C CB   . LEU A 1 7  ? 3.148   6.838   -2.334  1.00 0.00 ? 7  LEU A CB   1  
ATOM 94    C CG   . LEU A 1 7  ? 2.847   5.700   -3.316  1.00 0.00 ? 7  LEU A CG   1  
ATOM 95    C CD1  . LEU A 1 7  ? 4.120   4.947   -3.667  1.00 0.00 ? 7  LEU A CD1  1  
ATOM 96    C CD2  . LEU A 1 7  ? 1.805   4.754   -2.739  1.00 0.00 ? 7  LEU A CD2  1  
ATOM 97    H H    . LEU A 1 7  ? 4.537   7.454   0.493   1.00 0.00 ? 7  LEU A H    1  
ATOM 98    H HA   . LEU A 1 7  ? 2.334   6.090   -0.500  1.00 0.00 ? 7  LEU A HA   1  
ATOM 99    H HB2  . LEU A 1 7  ? 2.349   7.562   -2.400  1.00 0.00 ? 7  LEU A HB2  1  
ATOM 100   H HB3  . LEU A 1 7  ? 4.067   7.315   -2.642  1.00 0.00 ? 7  LEU A HB3  1  
ATOM 101   H HG   . LEU A 1 7  ? 2.447   6.118   -4.228  1.00 0.00 ? 7  LEU A HG   1  
ATOM 102   H HD11 . LEU A 1 7  ? 4.956   5.631   -3.660  1.00 0.00 ? 7  LEU A HD11 1  
ATOM 103   H HD12 . LEU A 1 7  ? 4.020   4.510   -4.649  1.00 0.00 ? 7  LEU A HD12 1  
ATOM 104   H HD13 . LEU A 1 7  ? 4.289   4.166   -2.940  1.00 0.00 ? 7  LEU A HD13 1  
ATOM 105   H HD21 . LEU A 1 7  ? 2.274   4.095   -2.025  1.00 0.00 ? 7  LEU A HD21 1  
ATOM 106   H HD22 . LEU A 1 7  ? 1.370   4.170   -3.536  1.00 0.00 ? 7  LEU A HD22 1  
ATOM 107   H HD23 . LEU A 1 7  ? 1.032   5.326   -2.249  1.00 0.00 ? 7  LEU A HD23 1  
ATOM 108   N N    . VAL A 1 8  ? 5.558   5.556   -0.962  1.00 0.00 ? 8  VAL A N    1  
ATOM 109   C CA   . VAL A 1 8  ? 6.601   4.539   -0.894  1.00 0.00 ? 8  VAL A CA   1  
ATOM 110   C C    . VAL A 1 8  ? 6.770   4.018   0.529   1.00 0.00 ? 8  VAL A C    1  
ATOM 111   O O    . VAL A 1 8  ? 6.765   2.809   0.763   1.00 0.00 ? 8  VAL A O    1  
ATOM 112   C CB   . VAL A 1 8  ? 7.950   5.089   -1.393  1.00 0.00 ? 8  VAL A CB   1  
ATOM 113   C CG1  . VAL A 1 8  ? 9.005   3.994   -1.394  1.00 0.00 ? 8  VAL A CG1  1  
ATOM 114   C CG2  . VAL A 1 8  ? 7.800   5.696   -2.780  1.00 0.00 ? 8  VAL A CG2  1  
ATOM 115   H H    . VAL A 1 8  ? 5.806   6.481   -1.163  1.00 0.00 ? 8  VAL A H    1  
ATOM 116   H HA   . VAL A 1 8  ? 6.311   3.721   -1.536  1.00 0.00 ? 8  VAL A HA   1  
ATOM 117   H HB   . VAL A 1 8  ? 8.271   5.866   -0.716  1.00 0.00 ? 8  VAL A HB   1  
ATOM 118   H HG11 . VAL A 1 8  ? 9.986   4.440   -1.460  1.00 0.00 ? 8  VAL A HG11 1  
ATOM 119   H HG12 . VAL A 1 8  ? 8.848   3.343   -2.242  1.00 0.00 ? 8  VAL A HG12 1  
ATOM 120   H HG13 . VAL A 1 8  ? 8.931   3.420   -0.482  1.00 0.00 ? 8  VAL A HG13 1  
ATOM 121   H HG21 . VAL A 1 8  ? 8.568   5.303   -3.430  1.00 0.00 ? 8  VAL A HG21 1  
ATOM 122   H HG22 . VAL A 1 8  ? 7.897   6.770   -2.715  1.00 0.00 ? 8  VAL A HG22 1  
ATOM 123   H HG23 . VAL A 1 8  ? 6.829   5.446   -3.180  1.00 0.00 ? 8  VAL A HG23 1  
ATOM 124   N N    . SER A 1 9  ? 6.920   4.938   1.477   1.00 0.00 ? 9  SER A N    1  
ATOM 125   C CA   . SER A 1 9  ? 7.094   4.571   2.878   1.00 0.00 ? 9  SER A CA   1  
ATOM 126   C C    . SER A 1 9  ? 5.892   3.788   3.394   1.00 0.00 ? 9  SER A C    1  
ATOM 127   O O    . SER A 1 9  ? 6.007   3.018   4.347   1.00 0.00 ? 9  SER A O    1  
ATOM 128   C CB   . SER A 1 9  ? 7.302   5.827   3.729   1.00 0.00 ? 9  SER A CB   1  
ATOM 129   O OG   . SER A 1 9  ? 7.509   6.967   2.915   1.00 0.00 ? 9  SER A OG   1  
ATOM 130   H H    . SER A 1 9  ? 6.918   5.884   1.227   1.00 0.00 ? 9  SER A H    1  
ATOM 131   H HA   . SER A 1 9  ? 7.973   3.948   2.949   1.00 0.00 ? 9  SER A HA   1  
ATOM 132   H HB2  . SER A 1 9  ? 6.428   5.991   4.342   1.00 0.00 ? 9  SER A HB2  1  
ATOM 133   H HB3  . SER A 1 9  ? 8.166   5.689   4.363   1.00 0.00 ? 9  SER A HB3  1  
ATOM 134   H HG   . SER A 1 9  ? 8.451   7.083   2.760   1.00 0.00 ? 9  SER A HG   1  
ATOM 135   N N    . PHE A 1 10 ? 4.739   3.992   2.764   1.00 0.00 ? 10 PHE A N    1  
ATOM 136   C CA   . PHE A 1 10 ? 3.517   3.309   3.172   1.00 0.00 ? 10 PHE A CA   1  
ATOM 137   C C    . PHE A 1 10 ? 3.391   1.955   2.483   1.00 0.00 ? 10 PHE A C    1  
ATOM 138   O O    . PHE A 1 10 ? 3.164   0.936   3.135   1.00 0.00 ? 10 PHE A O    1  
ATOM 139   C CB   . PHE A 1 10 ? 2.295   4.172   2.854   1.00 0.00 ? 10 PHE A CB   1  
ATOM 140   C CG   . PHE A 1 10 ? 1.548   4.629   4.074   1.00 0.00 ? 10 PHE A CG   1  
ATOM 141   C CD1  . PHE A 1 10 ? 1.305   3.756   5.122   1.00 0.00 ? 10 PHE A CD1  1  
ATOM 142   C CD2  . PHE A 1 10 ? 1.088   5.932   4.171   1.00 0.00 ? 10 PHE A CD2  1  
ATOM 143   C CE1  . PHE A 1 10 ? 0.617   4.175   6.245   1.00 0.00 ? 10 PHE A CE1  1  
ATOM 144   C CE2  . PHE A 1 10 ? 0.399   6.356   5.292   1.00 0.00 ? 10 PHE A CE2  1  
ATOM 145   C CZ   . PHE A 1 10 ? 0.163   5.476   6.330   1.00 0.00 ? 10 PHE A CZ   1  
ATOM 146   H H    . PHE A 1 10 ? 4.708   4.622   2.014   1.00 0.00 ? 10 PHE A H    1  
ATOM 147   H HA   . PHE A 1 10 ? 3.570   3.149   4.239   1.00 0.00 ? 10 PHE A HA   1  
ATOM 148   H HB2  . PHE A 1 10 ? 2.615   5.050   2.311   1.00 0.00 ? 10 PHE A HB2  1  
ATOM 149   H HB3  . PHE A 1 10 ? 1.613   3.605   2.240   1.00 0.00 ? 10 PHE A HB3  1  
ATOM 150   H HD1  . PHE A 1 10 ? 1.659   2.737   5.056   1.00 0.00 ? 10 PHE A HD1  1  
ATOM 151   H HD2  . PHE A 1 10 ? 1.272   6.621   3.360   1.00 0.00 ? 10 PHE A HD2  1  
ATOM 152   H HE1  . PHE A 1 10 ? 0.435   3.484   7.055   1.00 0.00 ? 10 PHE A HE1  1  
ATOM 153   H HE2  . PHE A 1 10 ? 0.046   7.375   5.355   1.00 0.00 ? 10 PHE A HE2  1  
ATOM 154   H HZ   . PHE A 1 10 ? -0.374  5.806   7.207   1.00 0.00 ? 10 PHE A HZ   1  
ATOM 155   N N    . LEU A 1 11 ? 3.537   1.948   1.161   1.00 0.00 ? 11 LEU A N    1  
ATOM 156   C CA   . LEU A 1 11 ? 3.443   0.715   0.387   1.00 0.00 ? 11 LEU A CA   1  
ATOM 157   C C    . LEU A 1 11 ? 4.305   -0.379  1.003   1.00 0.00 ? 11 LEU A C    1  
ATOM 158   O O    . LEU A 1 11 ? 3.830   -1.479  1.281   1.00 0.00 ? 11 LEU A O    1  
ATOM 159   C CB   . LEU A 1 11 ? 3.875   0.967   -1.057  1.00 0.00 ? 11 LEU A CB   1  
ATOM 160   C CG   . LEU A 1 11 ? 3.416   -0.088  -2.065  1.00 0.00 ? 11 LEU A CG   1  
ATOM 161   C CD1  . LEU A 1 11 ? 4.216   -1.371  -1.896  1.00 0.00 ? 11 LEU A CD1  1  
ATOM 162   C CD2  . LEU A 1 11 ? 1.928   -0.359  -1.911  1.00 0.00 ? 11 LEU A CD2  1  
ATOM 163   H H    . LEU A 1 11 ? 3.718   2.791   0.695   1.00 0.00 ? 11 LEU A H    1  
ATOM 164   H HA   . LEU A 1 11 ? 2.415   0.394   0.399   1.00 0.00 ? 11 LEU A HA   1  
ATOM 165   H HB2  . LEU A 1 11 ? 3.484   1.924   -1.367  1.00 0.00 ? 11 LEU A HB2  1  
ATOM 166   H HB3  . LEU A 1 11 ? 4.955   1.013   -1.083  1.00 0.00 ? 11 LEU A HB3  1  
ATOM 167   H HG   . LEU A 1 11 ? 3.587   0.282   -3.066  1.00 0.00 ? 11 LEU A HG   1  
ATOM 168   H HD11 . LEU A 1 11 ? 3.643   -2.079  -1.315  1.00 0.00 ? 11 LEU A HD11 1  
ATOM 169   H HD12 . LEU A 1 11 ? 5.143   -1.154  -1.387  1.00 0.00 ? 11 LEU A HD12 1  
ATOM 170   H HD13 . LEU A 1 11 ? 4.429   -1.793  -2.867  1.00 0.00 ? 11 LEU A HD13 1  
ATOM 171   H HD21 . LEU A 1 11 ? 1.575   -0.929  -2.759  1.00 0.00 ? 11 LEU A HD21 1  
ATOM 172   H HD22 . LEU A 1 11 ? 1.394   0.578   -1.862  1.00 0.00 ? 11 LEU A HD22 1  
ATOM 173   H HD23 . LEU A 1 11 ? 1.755   -0.920  -1.005  1.00 0.00 ? 11 LEU A HD23 1  
ATOM 174   N N    . THR A 1 12 ? 5.573   -0.061  1.219   1.00 0.00 ? 12 THR A N    1  
ATOM 175   C CA   . THR A 1 12 ? 6.507   -1.005  1.814   1.00 0.00 ? 12 THR A CA   1  
ATOM 176   C C    . THR A 1 12 ? 6.250   -1.149  3.309   1.00 0.00 ? 12 THR A C    1  
ATOM 177   O O    . THR A 1 12 ? 6.186   -2.262  3.834   1.00 0.00 ? 12 THR A O    1  
ATOM 178   C CB   . THR A 1 12 ? 7.947   -0.547  1.573   1.00 0.00 ? 12 THR A CB   1  
ATOM 179   O OG1  . THR A 1 12 ? 8.249   -0.553  0.190   1.00 0.00 ? 12 THR A OG1  1  
ATOM 180   C CG2  . THR A 1 12 ? 8.976   -1.408  2.274   1.00 0.00 ? 12 THR A CG2  1  
ATOM 181   H H    . THR A 1 12 ? 5.886   0.835   0.978   1.00 0.00 ? 12 THR A H    1  
ATOM 182   H HA   . THR A 1 12 ? 6.357   -1.964  1.340   1.00 0.00 ? 12 THR A HA   1  
ATOM 183   H HB   . THR A 1 12 ? 8.058   0.462   1.942   1.00 0.00 ? 12 THR A HB   1  
ATOM 184   H HG1  . THR A 1 12 ? 7.499   -0.213  -0.304  1.00 0.00 ? 12 THR A HG1  1  
ATOM 185   H HG21 . THR A 1 12 ? 9.243   -0.953  3.216   1.00 0.00 ? 12 THR A HG21 1  
ATOM 186   H HG22 . THR A 1 12 ? 9.854   -1.494  1.652   1.00 0.00 ? 12 THR A HG22 1  
ATOM 187   H HG23 . THR A 1 12 ? 8.563   -2.390  2.452   1.00 0.00 ? 12 THR A HG23 1  
ATOM 188   N N    . GLY A 1 13 ? 6.096   -0.014  3.989   1.00 0.00 ? 13 GLY A N    1  
ATOM 189   C CA   . GLY A 1 13 ? 5.843   -0.033  5.418   1.00 0.00 ? 13 GLY A CA   1  
ATOM 190   C C    . GLY A 1 13 ? 4.706   -0.964  5.788   1.00 0.00 ? 13 GLY A C    1  
ATOM 191   O O    . GLY A 1 13 ? 4.687   -1.535  6.878   1.00 0.00 ? 13 GLY A O    1  
ATOM 192   H H    . GLY A 1 13 ? 6.147   0.843   3.514   1.00 0.00 ? 13 GLY A H    1  
ATOM 193   H HA2  . GLY A 1 13 ? 6.739   -0.356  5.929   1.00 0.00 ? 13 GLY A HA2  1  
ATOM 194   H HA3  . GLY A 1 13 ? 5.596   0.967   5.744   1.00 0.00 ? 13 GLY A HA3  1  
ATOM 195   N N    . LEU A 1 14 ? 3.760   -1.121  4.869   1.00 0.00 ? 14 LEU A N    1  
ATOM 196   C CA   . LEU A 1 14 ? 2.622   -1.997  5.081   1.00 0.00 ? 14 LEU A CA   1  
ATOM 197   C C    . LEU A 1 14 ? 3.065   -3.448  5.259   1.00 0.00 ? 14 LEU A C    1  
ATOM 198   O O    . LEU A 1 14 ? 2.292   -4.288  5.720   1.00 0.00 ? 14 LEU A O    1  
ATOM 199   C CB   . LEU A 1 14 ? 1.677   -1.886  3.883   1.00 0.00 ? 14 LEU A CB   1  
ATOM 200   C CG   . LEU A 1 14 ? 0.194   -1.711  4.216   1.00 0.00 ? 14 LEU A CG   1  
ATOM 201   C CD1  . LEU A 1 14 ? 0.006   -0.707  5.343   1.00 0.00 ? 14 LEU A CD1  1  
ATOM 202   C CD2  . LEU A 1 14 ? -0.568  -1.266  2.980   1.00 0.00 ? 14 LEU A CD2  1  
ATOM 203   H H    . LEU A 1 14 ? 3.837   -0.646  4.016   1.00 0.00 ? 14 LEU A H    1  
ATOM 204   H HA   . LEU A 1 14 ? 2.113   -1.674  5.975   1.00 0.00 ? 14 LEU A HA   1  
ATOM 205   H HB2  . LEU A 1 14 ? 1.988   -1.041  3.288   1.00 0.00 ? 14 LEU A HB2  1  
ATOM 206   H HB3  . LEU A 1 14 ? 1.787   -2.778  3.287   1.00 0.00 ? 14 LEU A HB3  1  
ATOM 207   H HG   . LEU A 1 14 ? -0.210  -2.658  4.539   1.00 0.00 ? 14 LEU A HG   1  
ATOM 208   H HD11 . LEU A 1 14 ? 0.865   -0.053  5.388   1.00 0.00 ? 14 LEU A HD11 1  
ATOM 209   H HD12 . LEU A 1 14 ? -0.093  -1.234  6.282   1.00 0.00 ? 14 LEU A HD12 1  
ATOM 210   H HD13 . LEU A 1 14 ? -0.883  -0.123  5.161   1.00 0.00 ? 14 LEU A HD13 1  
ATOM 211   H HD21 . LEU A 1 14 ? -1.590  -1.610  3.044   1.00 0.00 ? 14 LEU A HD21 1  
ATOM 212   H HD22 . LEU A 1 14 ? -0.099  -1.682  2.101   1.00 0.00 ? 14 LEU A HD22 1  
ATOM 213   H HD23 . LEU A 1 14 ? -0.555  -0.188  2.918   1.00 0.00 ? 14 LEU A HD23 1  
ATOM 214   N N    . GLY A 1 15 ? 4.311   -3.736  4.895   1.00 0.00 ? 15 GLY A N    1  
ATOM 215   C CA   . GLY A 1 15 ? 4.823   -5.086  5.007   1.00 0.00 ? 15 GLY A CA   1  
ATOM 216   C C    . GLY A 1 15 ? 5.183   -5.682  3.659   1.00 0.00 ? 15 GLY A C    1  
ATOM 217   O O    . GLY A 1 15 ? 5.406   -6.888  3.548   1.00 0.00 ? 15 GLY A O    1  
ATOM 218   H H    . GLY A 1 15 ? 4.881   -3.033  4.522   1.00 0.00 ? 15 GLY A H    1  
ATOM 219   H HA2  . GLY A 1 15 ? 5.705   -5.075  5.630   1.00 0.00 ? 15 GLY A HA2  1  
ATOM 220   H HA3  . GLY A 1 15 ? 4.072   -5.707  5.474   1.00 0.00 ? 15 GLY A HA3  1  
ATOM 221   N N    . CYS A 1 16 ? 5.239   -4.839  2.629   1.00 0.00 ? 16 CYS A N    1  
ATOM 222   C CA   . CYS A 1 16 ? 5.572   -5.302  1.286   1.00 0.00 ? 16 CYS A CA   1  
ATOM 223   C C    . CYS A 1 16 ? 6.882   -4.683  0.801   1.00 0.00 ? 16 CYS A C    1  
ATOM 224   O O    . CYS A 1 16 ? 6.891   -3.888  -0.138  1.00 0.00 ? 16 CYS A O    1  
ATOM 225   C CB   . CYS A 1 16 ? 4.442   -4.960  0.313   1.00 0.00 ? 16 CYS A CB   1  
ATOM 226   S SG   . CYS A 1 16 ? 3.021   -6.073  0.413   1.00 0.00 ? 16 CYS A SG   1  
ATOM 227   H H    . CYS A 1 16 ? 5.050   -3.886  2.773   1.00 0.00 ? 16 CYS A H    1  
ATOM 228   H HA   . CYS A 1 16 ? 5.689   -6.375  1.327   1.00 0.00 ? 16 CYS A HA   1  
ATOM 229   H HB2  . CYS A 1 16 ? 4.091   -3.960  0.518   1.00 0.00 ? 16 CYS A HB2  1  
ATOM 230   H HB3  . CYS A 1 16 ? 4.822   -5.003  -0.697  1.00 0.00 ? 16 CYS A HB3  1  
ATOM 231   H HG   . CYS A 1 16 ? 3.285   -6.845  0.919   1.00 0.00 ? 16 CYS A HG   1  
ATOM 232   N N    . PRO A 1 17 ? 8.010   -5.049  1.435   1.00 0.00 ? 17 PRO A N    1  
ATOM 233   C CA   . PRO A 1 17 ? 9.329   -4.530  1.060   1.00 0.00 ? 17 PRO A CA   1  
ATOM 234   C C    . PRO A 1 17 ? 9.832   -5.110  -0.259  1.00 0.00 ? 17 PRO A C    1  
ATOM 235   O O    . PRO A 1 17 ? 10.748  -4.566  -0.876  1.00 0.00 ? 17 PRO A O    1  
ATOM 236   C CB   . PRO A 1 17 ? 10.224  -4.976  2.216   1.00 0.00 ? 17 PRO A CB   1  
ATOM 237   C CG   . PRO A 1 17 ? 9.566   -6.198  2.755   1.00 0.00 ? 17 PRO A CG   1  
ATOM 238   C CD   . PRO A 1 17 ? 8.087   -5.995  2.564   1.00 0.00 ? 17 PRO A CD   1  
ATOM 239   H HA   . PRO A 1 17 ? 9.326   -3.452  1.000   1.00 0.00 ? 17 PRO A HA   1  
ATOM 240   H HB2  . PRO A 1 17 ? 11.215  -5.191  1.845   1.00 0.00 ? 17 PRO A HB2  1  
ATOM 241   H HB3  . PRO A 1 17 ? 10.275  -4.194  2.959   1.00 0.00 ? 17 PRO A HB3  1  
ATOM 242   H HG2  . PRO A 1 17 ? 9.898   -7.066  2.204   1.00 0.00 ? 17 PRO A HG2  1  
ATOM 243   H HG3  . PRO A 1 17 ? 9.797   -6.308  3.804   1.00 0.00 ? 17 PRO A HG3  1  
ATOM 244   H HD2  . PRO A 1 17 ? 7.606   -6.930  2.317   1.00 0.00 ? 17 PRO A HD2  1  
ATOM 245   H HD3  . PRO A 1 17 ? 7.647   -5.568  3.454   1.00 0.00 ? 17 PRO A HD3  1  
ATOM 246   N N    . ASN A 1 18 ? 9.232   -6.218  -0.685  1.00 0.00 ? 18 ASN A N    1  
ATOM 247   C CA   . ASN A 1 18 ? 9.618   -6.861  -1.935  1.00 0.00 ? 18 ASN A CA   1  
ATOM 248   C C    . ASN A 1 18 ? 8.396   -7.147  -2.804  1.00 0.00 ? 18 ASN A C    1  
ATOM 249   O O    . ASN A 1 18 ? 8.438   -8.004  -3.687  1.00 0.00 ? 18 ASN A O    1  
ATOM 250   C CB   . ASN A 1 18 ? 10.371  -8.163  -1.652  1.00 0.00 ? 18 ASN A CB   1  
ATOM 251   C CG   . ASN A 1 18 ? 11.208  -8.615  -2.833  1.00 0.00 ? 18 ASN A CG   1  
ATOM 252   O OD1  . ASN A 1 18 ? 11.934  -7.822  -3.433  1.00 0.00 ? 18 ASN A OD1  1  
ATOM 253   N ND2  . ASN A 1 18 ? 11.108  -9.894  -3.176  1.00 0.00 ? 18 ASN A ND2  1  
ATOM 254   H H    . ASN A 1 18 ? 8.505   -6.606  -0.155  1.00 0.00 ? 18 ASN A H    1  
ATOM 255   H HA   . ASN A 1 18 ? 10.273  -6.186  -2.466  1.00 0.00 ? 18 ASN A HA   1  
ATOM 256   H HB2  . ASN A 1 18 ? 11.025  -8.017  -0.806  1.00 0.00 ? 18 ASN A HB2  1  
ATOM 257   H HB3  . ASN A 1 18 ? 9.658   -8.942  -1.422  1.00 0.00 ? 18 ASN A HB3  1  
ATOM 258   H HD21 . ASN A 1 18 ? 10.509  -10.467 -2.654  1.00 0.00 ? 18 ASN A HD21 1  
ATOM 259   H HD22 . ASN A 1 18 ? 11.638  -10.212 -3.937  1.00 0.00 ? 18 ASN A HD22 1  
ATOM 260   N N    . CYS A 1 19 ? 7.309   -6.423  -2.550  1.00 0.00 ? 19 CYS A N    1  
ATOM 261   C CA   . CYS A 1 19 ? 6.081   -6.594  -3.316  1.00 0.00 ? 19 CYS A CA   1  
ATOM 262   C C    . CYS A 1 19 ? 5.808   -5.370  -4.180  1.00 0.00 ? 19 CYS A C    1  
ATOM 263   O O    . CYS A 1 19 ? 5.185   -5.469  -5.236  1.00 0.00 ? 19 CYS A O    1  
ATOM 264   C CB   . CYS A 1 19 ? 4.898   -6.846  -2.378  1.00 0.00 ? 19 CYS A CB   1  
ATOM 265   S SG   . CYS A 1 19 ? 4.080   -8.438  -2.635  1.00 0.00 ? 19 CYS A SG   1  
ATOM 266   H H    . CYS A 1 19 ? 7.336   -5.752  -1.838  1.00 0.00 ? 19 CYS A H    1  
ATOM 267   H HA   . CYS A 1 19 ? 6.210   -7.450  -3.960  1.00 0.00 ? 19 CYS A HA   1  
ATOM 268   H HB2  . CYS A 1 19 ? 5.247   -6.819  -1.356  1.00 0.00 ? 19 CYS A HB2  1  
ATOM 269   H HB3  . CYS A 1 19 ? 4.161   -6.071  -2.523  1.00 0.00 ? 19 CYS A HB3  1  
ATOM 270   H HG   . CYS A 1 19 ? 4.724   -9.047  -3.003  1.00 0.00 ? 19 CYS A HG   1  
ATOM 271   N N    . ILE A 1 20 ? 6.287   -4.219  -3.726  1.00 0.00 ? 20 ILE A N    1  
ATOM 272   C CA   . ILE A 1 20 ? 6.110   -2.975  -4.461  1.00 0.00 ? 20 ILE A CA   1  
ATOM 273   C C    . ILE A 1 20 ? 6.574   -3.128  -5.904  1.00 0.00 ? 20 ILE A C    1  
ATOM 274   O O    . ILE A 1 20 ? 6.003   -2.534  -6.815  1.00 0.00 ? 20 ILE A O    1  
ATOM 275   C CB   . ILE A 1 20 ? 6.889   -1.825  -3.803  1.00 0.00 ? 20 ILE A CB   1  
ATOM 276   C CG1  . ILE A 1 20 ? 6.673   -0.523  -4.577  1.00 0.00 ? 20 ILE A CG1  1  
ATOM 277   C CG2  . ILE A 1 20 ? 8.367   -2.171  -3.736  1.00 0.00 ? 20 ILE A CG2  1  
ATOM 278   C CD1  . ILE A 1 20 ? 6.556   0.696   -3.689  1.00 0.00 ? 20 ILE A CD1  1  
ATOM 279   H H    . ILE A 1 20 ? 6.781   -4.208  -2.879  1.00 0.00 ? 20 ILE A H    1  
ATOM 280   H HA   . ILE A 1 20 ? 5.060   -2.727  -4.453  1.00 0.00 ? 20 ILE A HA   1  
ATOM 281   H HB   . ILE A 1 20 ? 6.526   -1.704  -2.793  1.00 0.00 ? 20 ILE A HB   1  
ATOM 282   H HG12 . ILE A 1 20 ? 7.506   -0.367  -5.246  1.00 0.00 ? 20 ILE A HG12 1  
ATOM 283   H HG13 . ILE A 1 20 ? 5.763   -0.602  -5.152  1.00 0.00 ? 20 ILE A HG13 1  
ATOM 284   H HG21 . ILE A 1 20 ? 8.482   -3.245  -3.702  1.00 0.00 ? 20 ILE A HG21 1  
ATOM 285   H HG22 . ILE A 1 20 ? 8.799   -1.734  -2.848  1.00 0.00 ? 20 ILE A HG22 1  
ATOM 286   H HG23 . ILE A 1 20 ? 8.868   -1.783  -4.611  1.00 0.00 ? 20 ILE A HG23 1  
ATOM 287   H HD11 . ILE A 1 20 ? 7.477   0.832   -3.140  1.00 0.00 ? 20 ILE A HD11 1  
ATOM 288   H HD12 . ILE A 1 20 ? 5.740   0.560   -2.995  1.00 0.00 ? 20 ILE A HD12 1  
ATOM 289   H HD13 . ILE A 1 20 ? 6.370   1.569   -4.298  1.00 0.00 ? 20 ILE A HD13 1  
ATOM 290   N N    . GLU A 1 21 ? 7.619   -3.924  -6.104  1.00 0.00 ? 21 GLU A N    1  
ATOM 291   C CA   . GLU A 1 21 ? 8.154   -4.161  -7.438  1.00 0.00 ? 21 GLU A CA   1  
ATOM 292   C C    . GLU A 1 21 ? 7.080   -4.736  -8.354  1.00 0.00 ? 21 GLU A C    1  
ATOM 293   O O    . GLU A 1 21 ? 6.938   -4.317  -9.502  1.00 0.00 ? 21 GLU A O    1  
ATOM 294   C CB   . GLU A 1 21 ? 9.344   -5.118  -7.368  1.00 0.00 ? 21 GLU A CB   1  
ATOM 295   C CG   . GLU A 1 21 ? 10.503  -4.590  -6.540  1.00 0.00 ? 21 GLU A CG   1  
ATOM 296   C CD   . GLU A 1 21 ? 11.698  -4.202  -7.387  1.00 0.00 ? 21 GLU A CD   1  
ATOM 297   O OE1  . GLU A 1 21 ? 11.578  -3.243  -8.178  1.00 0.00 ? 21 GLU A OE1  1  
ATOM 298   O OE2  . GLU A 1 21 ? 12.753  -4.859  -7.262  1.00 0.00 ? 21 GLU A OE2  1  
ATOM 299   H H    . GLU A 1 21 ? 8.032   -4.373  -5.336  1.00 0.00 ? 21 GLU A H    1  
ATOM 300   H HA   . GLU A 1 21 ? 8.485   -3.213  -7.838  1.00 0.00 ? 21 GLU A HA   1  
ATOM 301   H HB2  . GLU A 1 21 ? 9.013   -6.050  -6.934  1.00 0.00 ? 21 GLU A HB2  1  
ATOM 302   H HB3  . GLU A 1 21 ? 9.701   -5.304  -8.371  1.00 0.00 ? 21 GLU A HB3  1  
ATOM 303   H HG2  . GLU A 1 21 ? 10.171  -3.721  -5.992  1.00 0.00 ? 21 GLU A HG2  1  
ATOM 304   H HG3  . GLU A 1 21 ? 10.809  -5.358  -5.844  1.00 0.00 ? 21 GLU A HG3  1  
ATOM 305   N N    . TYR A 1 22 ? 6.324   -5.698  -7.833  1.00 0.00 ? 22 TYR A N    1  
ATOM 306   C CA   . TYR A 1 22 ? 5.252   -6.324  -8.597  1.00 0.00 ? 22 TYR A CA   1  
ATOM 307   C C    . TYR A 1 22 ? 4.083   -5.361  -8.763  1.00 0.00 ? 22 TYR A C    1  
ATOM 308   O O    . TYR A 1 22 ? 3.400   -5.366  -9.786  1.00 0.00 ? 22 TYR A O    1  
ATOM 309   C CB   . TYR A 1 22 ? 4.781   -7.604  -7.903  1.00 0.00 ? 22 TYR A CB   1  
ATOM 310   C CG   . TYR A 1 22 ? 5.883   -8.617  -7.692  1.00 0.00 ? 22 TYR A CG   1  
ATOM 311   C CD1  . TYR A 1 22 ? 6.772   -8.494  -6.632  1.00 0.00 ? 22 TYR A CD1  1  
ATOM 312   C CD2  . TYR A 1 22 ? 6.037   -9.695  -8.556  1.00 0.00 ? 22 TYR A CD2  1  
ATOM 313   C CE1  . TYR A 1 22 ? 7.782   -9.417  -6.437  1.00 0.00 ? 22 TYR A CE1  1  
ATOM 314   C CE2  . TYR A 1 22 ? 7.044   -10.622 -8.367  1.00 0.00 ? 22 TYR A CE2  1  
ATOM 315   C CZ   . TYR A 1 22 ? 7.914   -10.478 -7.306  1.00 0.00 ? 22 TYR A CZ   1  
ATOM 316   O OH   . TYR A 1 22 ? 8.919   -11.398 -7.115  1.00 0.00 ? 22 TYR A OH   1  
ATOM 317   H H    . TYR A 1 22 ? 6.481   -5.982  -6.909  1.00 0.00 ? 22 TYR A H    1  
ATOM 318   H HA   . TYR A 1 22 ? 5.640   -6.573  -9.574  1.00 0.00 ? 22 TYR A HA   1  
ATOM 319   H HB2  . TYR A 1 22 ? 4.373   -7.351  -6.935  1.00 0.00 ? 22 TYR A HB2  1  
ATOM 320   H HB3  . TYR A 1 22 ? 4.012   -8.068  -8.502  1.00 0.00 ? 22 TYR A HB3  1  
ATOM 321   H HD1  . TYR A 1 22 ? 6.667   -7.661  -5.952  1.00 0.00 ? 22 TYR A HD1  1  
ATOM 322   H HD2  . TYR A 1 22 ? 5.354   -9.804  -9.386  1.00 0.00 ? 22 TYR A HD2  1  
ATOM 323   H HE1  . TYR A 1 22 ? 8.462   -9.302  -5.607  1.00 0.00 ? 22 TYR A HE1  1  
ATOM 324   H HE2  . TYR A 1 22 ? 7.148   -11.454 -9.048  1.00 0.00 ? 22 TYR A HE2  1  
ATOM 325   H HH   . TYR A 1 22 ? 9.759   -11.016 -7.380  1.00 0.00 ? 22 TYR A HH   1  
ATOM 326   N N    . PHE A 1 23 ? 3.866   -4.529  -7.750  1.00 0.00 ? 23 PHE A N    1  
ATOM 327   C CA   . PHE A 1 23 ? 2.789   -3.549  -7.786  1.00 0.00 ? 23 PHE A CA   1  
ATOM 328   C C    . PHE A 1 23 ? 3.138   -2.403  -8.731  1.00 0.00 ? 23 PHE A C    1  
ATOM 329   O O    . PHE A 1 23 ? 2.316   -1.984  -9.545  1.00 0.00 ? 23 PHE A O    1  
ATOM 330   C CB   . PHE A 1 23 ? 2.517   -3.007  -6.382  1.00 0.00 ? 23 PHE A CB   1  
ATOM 331   C CG   . PHE A 1 23 ? 1.478   -3.787  -5.628  1.00 0.00 ? 23 PHE A CG   1  
ATOM 332   C CD1  . PHE A 1 23 ? 0.130   -3.520  -5.803  1.00 0.00 ? 23 PHE A CD1  1  
ATOM 333   C CD2  . PHE A 1 23 ? 1.849   -4.790  -4.746  1.00 0.00 ? 23 PHE A CD2  1  
ATOM 334   C CE1  . PHE A 1 23 ? -0.829  -4.237  -5.113  1.00 0.00 ? 23 PHE A CE1  1  
ATOM 335   C CE2  . PHE A 1 23 ? 0.896   -5.509  -4.052  1.00 0.00 ? 23 PHE A CE2  1  
ATOM 336   C CZ   . PHE A 1 23 ? -0.445  -5.234  -4.236  1.00 0.00 ? 23 PHE A CZ   1  
ATOM 337   H H    . PHE A 1 23 ? 4.449   -4.571  -6.963  1.00 0.00 ? 23 PHE A H    1  
ATOM 338   H HA   . PHE A 1 23 ? 1.901   -4.044  -8.152  1.00 0.00 ? 23 PHE A HA   1  
ATOM 339   H HB2  . PHE A 1 23 ? 3.433   -3.033  -5.809  1.00 0.00 ? 23 PHE A HB2  1  
ATOM 340   H HB3  . PHE A 1 23 ? 2.175   -1.985  -6.458  1.00 0.00 ? 23 PHE A HB3  1  
ATOM 341   H HD1  . PHE A 1 23 ? -0.171  -2.742  -6.490  1.00 0.00 ? 23 PHE A HD1  1  
ATOM 342   H HD2  . PHE A 1 23 ? 2.898   -5.007  -4.602  1.00 0.00 ? 23 PHE A HD2  1  
ATOM 343   H HE1  . PHE A 1 23 ? -1.876  -4.019  -5.259  1.00 0.00 ? 23 PHE A HE1  1  
ATOM 344   H HE2  . PHE A 1 23 ? 1.198   -6.288  -3.367  1.00 0.00 ? 23 PHE A HE2  1  
ATOM 345   H HZ   . PHE A 1 23 ? -1.192  -5.795  -3.695  1.00 0.00 ? 23 PHE A HZ   1  
ATOM 346   N N    . THR A 1 24 ? 4.370   -1.910  -8.626  1.00 0.00 ? 24 THR A N    1  
ATOM 347   C CA   . THR A 1 24 ? 4.832   -0.822  -9.480  1.00 0.00 ? 24 THR A CA   1  
ATOM 348   C C    . THR A 1 24 ? 4.669   -1.183  -10.952 1.00 0.00 ? 24 THR A C    1  
ATOM 349   O O    . THR A 1 24 ? 4.423   -0.317  -11.791 1.00 0.00 ? 24 THR A O    1  
ATOM 350   C CB   . THR A 1 24 ? 6.297   -0.500  -9.184  1.00 0.00 ? 24 THR A CB   1  
ATOM 351   O OG1  . THR A 1 24 ? 7.108   -1.648  -9.356  1.00 0.00 ? 24 THR A OG1  1  
ATOM 352   C CG2  . THR A 1 24 ? 6.527   0.020   -7.782  1.00 0.00 ? 24 THR A CG2  1  
ATOM 353   H H    . THR A 1 24 ? 4.982   -2.290  -7.959  1.00 0.00 ? 24 THR A H    1  
ATOM 354   H HA   . THR A 1 24 ? 4.231   0.046   -9.265  1.00 0.00 ? 24 THR A HA   1  
ATOM 355   H HB   . THR A 1 24 ? 6.635   0.260   -9.875  1.00 0.00 ? 24 THR A HB   1  
ATOM 356   H HG1  . THR A 1 24 ? 8.024   -1.424  -9.175  1.00 0.00 ? 24 THR A HG1  1  
ATOM 357   H HG21 . THR A 1 24 ? 7.325   -0.538  -7.317  1.00 0.00 ? 24 THR A HG21 1  
ATOM 358   H HG22 . THR A 1 24 ? 5.622   -0.096  -7.203  1.00 0.00 ? 24 THR A HG22 1  
ATOM 359   H HG23 . THR A 1 24 ? 6.795   1.066   -7.825  1.00 0.00 ? 24 THR A HG23 1  
ATOM 360   N N    . SER A 1 25 ? 4.805   -2.470  -11.259 1.00 0.00 ? 25 SER A N    1  
ATOM 361   C CA   . SER A 1 25 ? 4.673   -2.950  -12.631 1.00 0.00 ? 25 SER A CA   1  
ATOM 362   C C    . SER A 1 25 ? 3.399   -2.415  -13.277 1.00 0.00 ? 25 SER A C    1  
ATOM 363   O O    . SER A 1 25 ? 3.319   -2.281  -14.498 1.00 0.00 ? 25 SER A O    1  
ATOM 364   C CB   . SER A 1 25 ? 4.667   -4.479  -12.658 1.00 0.00 ? 25 SER A CB   1  
ATOM 365   O OG   . SER A 1 25 ? 5.985   -4.996  -12.584 1.00 0.00 ? 25 SER A OG   1  
ATOM 366   H H    . SER A 1 25 ? 5.001   -3.113  -10.545 1.00 0.00 ? 25 SER A H    1  
ATOM 367   H HA   . SER A 1 25 ? 5.525   -2.590  -13.190 1.00 0.00 ? 25 SER A HA   1  
ATOM 368   H HB2  . SER A 1 25 ? 4.101   -4.850  -11.817 1.00 0.00 ? 25 SER A HB2  1  
ATOM 369   H HB3  . SER A 1 25 ? 4.212   -4.818  -13.577 1.00 0.00 ? 25 SER A HB3  1  
ATOM 370   H HG   . SER A 1 25 ? 6.047   -5.611  -11.849 1.00 0.00 ? 25 SER A HG   1  
ATOM 371   N N    . GLN A 1 26 ? 2.407   -2.104  -12.448 1.00 0.00 ? 26 GLN A N    1  
ATOM 372   C CA   . GLN A 1 26 ? 1.136   -1.581  -12.940 1.00 0.00 ? 26 GLN A CA   1  
ATOM 373   C C    . GLN A 1 26 ? 1.081   -0.067  -12.787 1.00 0.00 ? 26 GLN A C    1  
ATOM 374   O O    . GLN A 1 26 ? 0.720   0.650   -13.721 1.00 0.00 ? 26 GLN A O    1  
ATOM 375   C CB   . GLN A 1 26 ? -0.038  -2.221  -12.193 1.00 0.00 ? 26 GLN A CB   1  
ATOM 376   C CG   . GLN A 1 26 ? 0.233   -3.639  -11.717 1.00 0.00 ? 26 GLN A CG   1  
ATOM 377   C CD   . GLN A 1 26 ? 0.258   -4.640  -12.855 1.00 0.00 ? 26 GLN A CD   1  
ATOM 378   O OE1  . GLN A 1 26 ? -0.125  -4.327  -13.983 1.00 0.00 ? 26 GLN A OE1  1  
ATOM 379   N NE2  . GLN A 1 26 ? 0.711   -5.853  -12.564 1.00 0.00 ? 26 GLN A NE2  1  
ATOM 380   H H    . GLN A 1 26 ? 2.531   -2.232  -11.485 1.00 0.00 ? 26 GLN A H    1  
ATOM 381   H HA   . GLN A 1 26 ? 1.062   -1.830  -13.989 1.00 0.00 ? 26 GLN A HA   1  
ATOM 382   H HB2  . GLN A 1 26 ? -0.272  -1.615  -11.329 1.00 0.00 ? 26 GLN A HB2  1  
ATOM 383   H HB3  . GLN A 1 26 ? -0.896  -2.242  -12.848 1.00 0.00 ? 26 GLN A HB3  1  
ATOM 384   H HG2  . GLN A 1 26 ? 1.190   -3.660  -11.217 1.00 0.00 ? 26 GLN A HG2  1  
ATOM 385   H HG3  . GLN A 1 26 ? -0.543  -3.927  -11.022 1.00 0.00 ? 26 GLN A HG3  1  
ATOM 386   H HE21 . GLN A 1 26 ? 1.000   -6.031  -11.646 1.00 0.00 ? 26 GLN A HE21 1  
ATOM 387   H HE22 . GLN A 1 26 ? 0.738   -6.522  -13.280 1.00 0.00 ? 26 GLN A HE22 1  
ATOM 388   N N    . GLY A 1 27 ? 1.439   0.416   -11.601 1.00 0.00 ? 27 GLY A N    1  
ATOM 389   C CA   . GLY A 1 27 ? 1.422   1.843   -11.344 1.00 0.00 ? 27 GLY A CA   1  
ATOM 390   C C    . GLY A 1 27 ? 1.127   2.167   -9.892  1.00 0.00 ? 27 GLY A C    1  
ATOM 391   O O    . GLY A 1 27 ? 0.307   3.034   -9.598  1.00 0.00 ? 27 GLY A O    1  
ATOM 392   H H    . GLY A 1 27 ? 1.717   -0.204  -10.895 1.00 0.00 ? 27 GLY A H    1  
ATOM 393   H HA2  . GLY A 1 27 ? 2.385   2.257   -11.604 1.00 0.00 ? 27 GLY A HA2  1  
ATOM 394   H HA3  . GLY A 1 27 ? 0.666   2.301   -11.964 1.00 0.00 ? 27 GLY A HA3  1  
ATOM 395   N N    . LEU A 1 28 ? 1.818   1.485   -8.985  1.00 0.00 ? 28 LEU A N    1  
ATOM 396   C CA   . LEU A 1 28 ? 1.620   1.700   -7.558  1.00 0.00 ? 28 LEU A CA   1  
ATOM 397   C C    . LEU A 1 28 ? 2.698   2.615   -6.985  1.00 0.00 ? 28 LEU A C    1  
ATOM 398   O O    . LEU A 1 28 ? 3.179   2.401   -5.873  1.00 0.00 ? 28 LEU A O    1  
ATOM 399   C CB   . LEU A 1 28 ? 1.623   0.363   -6.817  1.00 0.00 ? 28 LEU A CB   1  
ATOM 400   C CG   . LEU A 1 28 ? 0.378   0.090   -5.974  1.00 0.00 ? 28 LEU A CG   1  
ATOM 401   C CD1  . LEU A 1 28 ? 0.341   1.010   -4.760  1.00 0.00 ? 28 LEU A CD1  1  
ATOM 402   C CD2  . LEU A 1 28 ? -0.880  0.255   -6.811  1.00 0.00 ? 28 LEU A CD2  1  
ATOM 403   H H    . LEU A 1 28 ? 2.451   0.799   -9.280  1.00 0.00 ? 28 LEU A H    1  
ATOM 404   H HA   . LEU A 1 28 ? 0.657   2.173   -7.427  1.00 0.00 ? 28 LEU A HA   1  
ATOM 405   H HB2  . LEU A 1 28 ? 1.718   -0.428  -7.546  1.00 0.00 ? 28 LEU A HB2  1  
ATOM 406   H HB3  . LEU A 1 28 ? 2.486   0.336   -6.167  1.00 0.00 ? 28 LEU A HB3  1  
ATOM 407   H HG   . LEU A 1 28 ? 0.410   -0.929  -5.619  1.00 0.00 ? 28 LEU A HG   1  
ATOM 408   H HD11 . LEU A 1 28 ? -0.685  1.211   -4.493  1.00 0.00 ? 28 LEU A HD11 1  
ATOM 409   H HD12 . LEU A 1 28 ? 0.840   1.938   -4.997  1.00 0.00 ? 28 LEU A HD12 1  
ATOM 410   H HD13 . LEU A 1 28 ? 0.843   0.533   -3.932  1.00 0.00 ? 28 LEU A HD13 1  
ATOM 411   H HD21 . LEU A 1 28 ? -1.597  0.856   -6.271  1.00 0.00 ? 28 LEU A HD21 1  
ATOM 412   H HD22 . LEU A 1 28 ? -1.306  -0.715  -7.017  1.00 0.00 ? 28 LEU A HD22 1  
ATOM 413   H HD23 . LEU A 1 28 ? -0.631  0.744   -7.742  1.00 0.00 ? 28 LEU A HD23 1  
ATOM 414   N N    . GLN A 1 29 ? 3.062   3.642   -7.746  1.00 0.00 ? 29 GLN A N    1  
ATOM 415   C CA   . GLN A 1 29 ? 4.060   4.606   -7.298  1.00 0.00 ? 29 GLN A CA   1  
ATOM 416   C C    . GLN A 1 29 ? 3.374   5.859   -6.766  1.00 0.00 ? 29 GLN A C    1  
ATOM 417   O O    . GLN A 1 29 ? 3.879   6.523   -5.861  1.00 0.00 ? 29 GLN A O    1  
ATOM 418   C CB   . GLN A 1 29 ? 5.011   4.968   -8.439  1.00 0.00 ? 29 GLN A CB   1  
ATOM 419   C CG   . GLN A 1 29 ? 4.327   5.650   -9.612  1.00 0.00 ? 29 GLN A CG   1  
ATOM 420   C CD   . GLN A 1 29 ? 4.961   6.982   -9.963  1.00 0.00 ? 29 GLN A CD   1  
ATOM 421   O OE1  . GLN A 1 29 ? 5.871   7.050   -10.789 1.00 0.00 ? 29 GLN A OE1  1  
ATOM 422   N NE2  . GLN A 1 29 ? 4.482   8.049   -9.335  1.00 0.00 ? 29 GLN A NE2  1  
ATOM 423   H H    . GLN A 1 29 ? 2.632   3.768   -8.618  1.00 0.00 ? 29 GLN A H    1  
ATOM 424   H HA   . GLN A 1 29 ? 4.624   4.151   -6.497  1.00 0.00 ? 29 GLN A HA   1  
ATOM 425   H HB2  . GLN A 1 29 ? 5.773   5.633   -8.059  1.00 0.00 ? 29 GLN A HB2  1  
ATOM 426   H HB3  . GLN A 1 29 ? 5.482   4.065   -8.800  1.00 0.00 ? 29 GLN A HB3  1  
ATOM 427   H HG2  . GLN A 1 29 ? 4.387   5.002   -10.474 1.00 0.00 ? 29 GLN A HG2  1  
ATOM 428   H HG3  . GLN A 1 29 ? 3.290   5.818   -9.361  1.00 0.00 ? 29 GLN A HG3  1  
ATOM 429   H HE21 . GLN A 1 29 ? 3.756   7.919   -8.690  1.00 0.00 ? 29 GLN A HE21 1  
ATOM 430   H HE22 . GLN A 1 29 ? 4.873   8.923   -9.543  1.00 0.00 ? 29 GLN A HE22 1  
ATOM 431   N N    . SER A 1 30 ? 2.205   6.158   -7.323  1.00 0.00 ? 30 SER A N    1  
ATOM 432   C CA   . SER A 1 30 ? 1.414   7.301   -6.888  1.00 0.00 ? 30 SER A CA   1  
ATOM 433   C C    . SER A 1 30 ? 0.207   6.828   -6.091  1.00 0.00 ? 30 SER A C    1  
ATOM 434   O O    . SER A 1 30 ? -0.707  6.221   -6.645  1.00 0.00 ? 30 SER A O    1  
ATOM 435   C CB   . SER A 1 30 ? 0.955   8.124   -8.094  1.00 0.00 ? 30 SER A CB   1  
ATOM 436   O OG   . SER A 1 30 ? 1.846   7.972   -9.186  1.00 0.00 ? 30 SER A OG   1  
ATOM 437   H H    . SER A 1 30 ? 1.851   5.573   -8.027  1.00 0.00 ? 30 SER A H    1  
ATOM 438   H HA   . SER A 1 30 ? 2.032   7.915   -6.254  1.00 0.00 ? 30 SER A HA   1  
ATOM 439   H HB2  . SER A 1 30 ? -0.027  7.795   -8.399  1.00 0.00 ? 30 SER A HB2  1  
ATOM 440   H HB3  . SER A 1 30 ? 0.916   9.168   -7.820  1.00 0.00 ? 30 SER A HB3  1  
ATOM 441   H HG   . SER A 1 30 ? 1.792   8.744   -9.753  1.00 0.00 ? 30 SER A HG   1  
ATOM 442   N N    . ILE A 1 31 ? 0.214   7.095   -4.787  1.00 0.00 ? 31 ILE A N    1  
ATOM 443   C CA   . ILE A 1 31 ? -0.876  6.665   -3.916  1.00 0.00 ? 31 ILE A CA   1  
ATOM 444   C C    . ILE A 1 31 ? -2.239  6.983   -4.534  1.00 0.00 ? 31 ILE A C    1  
ATOM 445   O O    . ILE A 1 31 ? -3.230  6.303   -4.268  1.00 0.00 ? 31 ILE A O    1  
ATOM 446   C CB   . ILE A 1 31 ? -0.770  7.295   -2.509  1.00 0.00 ? 31 ILE A CB   1  
ATOM 447   C CG1  . ILE A 1 31 ? -1.595  6.483   -1.511  1.00 0.00 ? 31 ILE A CG1  1  
ATOM 448   C CG2  . ILE A 1 31 ? -1.218  8.750   -2.518  1.00 0.00 ? 31 ILE A CG2  1  
ATOM 449   C CD1  . ILE A 1 31 ? -0.766  5.852   -0.414  1.00 0.00 ? 31 ILE A CD1  1  
ATOM 450   H H    . ILE A 1 31 ? 0.977   7.572   -4.400  1.00 0.00 ? 31 ILE A H    1  
ATOM 451   H HA   . ILE A 1 31 ? -0.795  5.595   -3.799  1.00 0.00 ? 31 ILE A HA   1  
ATOM 452   H HB   . ILE A 1 31 ? 0.268   7.271   -2.210  1.00 0.00 ? 31 ILE A HB   1  
ATOM 453   H HG12 . ILE A 1 31 ? -2.326  7.127   -1.047  1.00 0.00 ? 31 ILE A HG12 1  
ATOM 454   H HG13 . ILE A 1 31 ? -2.104  5.688   -2.039  1.00 0.00 ? 31 ILE A HG13 1  
ATOM 455   H HG21 . ILE A 1 31 ? -0.547  9.330   -3.134  1.00 0.00 ? 31 ILE A HG21 1  
ATOM 456   H HG22 . ILE A 1 31 ? -1.208  9.137   -1.509  1.00 0.00 ? 31 ILE A HG22 1  
ATOM 457   H HG23 . ILE A 1 31 ? -2.219  8.813   -2.919  1.00 0.00 ? 31 ILE A HG23 1  
ATOM 458   H HD11 . ILE A 1 31 ? -1.106  6.212   0.546   1.00 0.00 ? 31 ILE A HD11 1  
ATOM 459   H HD12 . ILE A 1 31 ? 0.272   6.116   -0.551  1.00 0.00 ? 31 ILE A HD12 1  
ATOM 460   H HD13 . ILE A 1 31 ? -0.873  4.778   -0.456  1.00 0.00 ? 31 ILE A HD13 1  
ATOM 461   N N    . TYR A 1 32 ? -2.278  8.018   -5.365  1.00 0.00 ? 32 TYR A N    1  
ATOM 462   C CA   . TYR A 1 32 ? -3.508  8.399   -6.039  1.00 0.00 ? 32 TYR A CA   1  
ATOM 463   C C    . TYR A 1 32 ? -4.044  7.240   -6.876  1.00 0.00 ? 32 TYR A C    1  
ATOM 464   O O    . TYR A 1 32 ? -5.233  7.185   -7.189  1.00 0.00 ? 32 TYR A O    1  
ATOM 465   C CB   . TYR A 1 32 ? -3.268  9.620   -6.929  1.00 0.00 ? 32 TYR A CB   1  
ATOM 466   C CG   . TYR A 1 32 ? -4.179  10.785  -6.613  1.00 0.00 ? 32 TYR A CG   1  
ATOM 467   C CD1  . TYR A 1 32 ? -5.543  10.593  -6.432  1.00 0.00 ? 32 TYR A CD1  1  
ATOM 468   C CD2  . TYR A 1 32 ? -3.674  12.073  -6.491  1.00 0.00 ? 32 TYR A CD2  1  
ATOM 469   C CE1  . TYR A 1 32 ? -6.379  11.655  -6.142  1.00 0.00 ? 32 TYR A CE1  1  
ATOM 470   C CE2  . TYR A 1 32 ? -4.504  13.140  -6.201  1.00 0.00 ? 32 TYR A CE2  1  
ATOM 471   C CZ   . TYR A 1 32 ? -5.855  12.925  -6.027  1.00 0.00 ? 32 TYR A CZ   1  
ATOM 472   O OH   . TYR A 1 32 ? -6.684  13.985  -5.739  1.00 0.00 ? 32 TYR A OH   1  
ATOM 473   H H    . TYR A 1 32 ? -1.456  8.516   -5.548  1.00 0.00 ? 32 TYR A H    1  
ATOM 474   H HA   . TYR A 1 32 ? -4.238  8.650   -5.284  1.00 0.00 ? 32 TYR A HA   1  
ATOM 475   H HB2  . TYR A 1 32 ? -2.248  9.952   -6.804  1.00 0.00 ? 32 TYR A HB2  1  
ATOM 476   H HB3  . TYR A 1 32 ? -3.428  9.344   -7.960  1.00 0.00 ? 32 TYR A HB3  1  
ATOM 477   H HD1  . TYR A 1 32 ? -5.948  9.597   -6.521  1.00 0.00 ? 32 TYR A HD1  1  
ATOM 478   H HD2  . TYR A 1 32 ? -2.615  12.237  -6.628  1.00 0.00 ? 32 TYR A HD2  1  
ATOM 479   H HE1  . TYR A 1 32 ? -7.437  11.486  -6.006  1.00 0.00 ? 32 TYR A HE1  1  
ATOM 480   H HE2  . TYR A 1 32 ? -4.093  14.134  -6.111  1.00 0.00 ? 32 TYR A HE2  1  
ATOM 481   H HH   . TYR A 1 32 ? -7.335  13.714  -5.088  1.00 0.00 ? 32 TYR A HH   1  
ATOM 482   N N    . HIS A 1 33 ? -3.158  6.309   -7.226  1.00 0.00 ? 33 HIS A N    1  
ATOM 483   C CA   . HIS A 1 33 ? -3.537  5.146   -8.017  1.00 0.00 ? 33 HIS A CA   1  
ATOM 484   C C    . HIS A 1 33 ? -4.130  4.049   -7.137  1.00 0.00 ? 33 HIS A C    1  
ATOM 485   O O    . HIS A 1 33 ? -4.843  3.171   -7.622  1.00 0.00 ? 33 HIS A O    1  
ATOM 486   C CB   . HIS A 1 33 ? -2.321  4.603   -8.771  1.00 0.00 ? 33 HIS A CB   1  
ATOM 487   C CG   . HIS A 1 33 ? -2.599  4.280   -10.205 1.00 0.00 ? 33 HIS A CG   1  
ATOM 488   N ND1  . HIS A 1 33 ? -2.257  3.075   -10.784 1.00 0.00 ? 33 HIS A ND1  1  
ATOM 489   C CD2  . HIS A 1 33 ? -3.182  5.013   -11.183 1.00 0.00 ? 33 HIS A CD2  1  
ATOM 490   C CE1  . HIS A 1 33 ? -2.622  3.081   -12.055 1.00 0.00 ? 33 HIS A CE1  1  
ATOM 491   N NE2  . HIS A 1 33 ? -3.185  4.244   -12.320 1.00 0.00 ? 33 HIS A NE2  1  
ATOM 492   H H    . HIS A 1 33 ? -2.222  6.407   -6.945  1.00 0.00 ? 33 HIS A H    1  
ATOM 493   H HA   . HIS A 1 33 ? -4.284  5.461   -8.732  1.00 0.00 ? 33 HIS A HA   1  
ATOM 494   H HB2  . HIS A 1 33 ? -1.532  5.340   -8.743  1.00 0.00 ? 33 HIS A HB2  1  
ATOM 495   H HB3  . HIS A 1 33 ? -1.982  3.700   -8.287  1.00 0.00 ? 33 HIS A HB3  1  
ATOM 496   H HD1  . HIS A 1 33 ? -1.814  2.328   -10.332 1.00 0.00 ? 33 HIS A HD1  1  
ATOM 497   H HD2  . HIS A 1 33 ? -3.575  6.015   -11.085 1.00 0.00 ? 33 HIS A HD2  1  
ATOM 498   H HE1  . HIS A 1 33 ? -2.482  2.271   -12.755 1.00 0.00 ? 33 HIS A HE1  1  
ATOM 499   H HE2  . HIS A 1 33 ? -3.545  4.513   -13.191 1.00 0.00 ? 33 HIS A HE2  1  
ATOM 500   N N    . LEU A 1 34 ? -3.820  4.093   -5.844  1.00 0.00 ? 34 LEU A N    1  
ATOM 501   C CA   . LEU A 1 34 ? -4.323  3.099   -4.905  1.00 0.00 ? 34 LEU A CA   1  
ATOM 502   C C    . LEU A 1 34 ? -5.346  3.703   -3.948  1.00 0.00 ? 34 LEU A C    1  
ATOM 503   O O    . LEU A 1 34 ? -5.626  3.145   -2.888  1.00 0.00 ? 34 LEU A O    1  
ATOM 504   C CB   . LEU A 1 34 ? -3.168  2.491   -4.113  1.00 0.00 ? 34 LEU A CB   1  
ATOM 505   C CG   . LEU A 1 34 ? -2.000  3.438   -3.832  1.00 0.00 ? 34 LEU A CG   1  
ATOM 506   C CD1  . LEU A 1 34 ? -1.212  2.966   -2.620  1.00 0.00 ? 34 LEU A CD1  1  
ATOM 507   C CD2  . LEU A 1 34 ? -1.097  3.547   -5.052  1.00 0.00 ? 34 LEU A CD2  1  
ATOM 508   H H    . LEU A 1 34 ? -3.250  4.817   -5.510  1.00 0.00 ? 34 LEU A H    1  
ATOM 509   H HA   . LEU A 1 34 ? -4.803  2.320   -5.479  1.00 0.00 ? 34 LEU A HA   1  
ATOM 510   H HB2  . LEU A 1 34 ? -3.554  2.136   -3.169  1.00 0.00 ? 34 LEU A HB2  1  
ATOM 511   H HB3  . LEU A 1 34 ? -2.794  1.649   -4.669  1.00 0.00 ? 34 LEU A HB3  1  
ATOM 512   H HG   . LEU A 1 34 ? -2.385  4.423   -3.612  1.00 0.00 ? 34 LEU A HG   1  
ATOM 513   H HD11 . LEU A 1 34 ? -1.786  3.148   -1.724  1.00 0.00 ? 34 LEU A HD11 1  
ATOM 514   H HD12 . LEU A 1 34 ? -0.278  3.507   -2.565  1.00 0.00 ? 34 LEU A HD12 1  
ATOM 515   H HD13 . LEU A 1 34 ? -1.010  1.909   -2.710  1.00 0.00 ? 34 LEU A HD13 1  
ATOM 516   H HD21 . LEU A 1 34 ? -0.070  3.631   -4.733  1.00 0.00 ? 34 LEU A HD21 1  
ATOM 517   H HD22 . LEU A 1 34 ? -1.368  4.421   -5.624  1.00 0.00 ? 34 LEU A HD22 1  
ATOM 518   H HD23 . LEU A 1 34 ? -1.213  2.667   -5.666  1.00 0.00 ? 34 LEU A HD23 1  
ATOM 519   N N    . GLN A 1 35 ? -5.904  4.841   -4.334  1.00 0.00 ? 35 GLN A N    1  
ATOM 520   C CA   . GLN A 1 35 ? -6.892  5.532   -3.514  1.00 0.00 ? 35 GLN A CA   1  
ATOM 521   C C    . GLN A 1 35 ? -8.189  4.741   -3.426  1.00 0.00 ? 35 GLN A C    1  
ATOM 522   O O    . GLN A 1 35 ? -8.935  4.853   -2.453  1.00 0.00 ? 35 GLN A O    1  
ATOM 523   C CB   . GLN A 1 35 ? -7.184  6.912   -4.103  1.00 0.00 ? 35 GLN A CB   1  
ATOM 524   C CG   . GLN A 1 35 ? -8.154  7.735   -3.274  1.00 0.00 ? 35 GLN A CG   1  
ATOM 525   C CD   . GLN A 1 35 ? -7.504  8.960   -2.661  1.00 0.00 ? 35 GLN A CD   1  
ATOM 526   O OE1  . GLN A 1 35 ? -7.501  10.038  -3.256  1.00 0.00 ? 35 GLN A OE1  1  
ATOM 527   N NE2  . GLN A 1 35 ? -6.950  8.800   -1.466  1.00 0.00 ? 35 GLN A NE2  1  
ATOM 528   H H    . GLN A 1 35 ? -5.635  5.236   -5.187  1.00 0.00 ? 35 GLN A H    1  
ATOM 529   H HA   . GLN A 1 35 ? -6.483  5.642   -2.524  1.00 0.00 ? 35 GLN A HA   1  
ATOM 530   H HB2  . GLN A 1 35 ? -6.258  7.460   -4.187  1.00 0.00 ? 35 GLN A HB2  1  
ATOM 531   H HB3  . GLN A 1 35 ? -7.611  6.783   -5.089  1.00 0.00 ? 35 GLN A HB3  1  
ATOM 532   H HG2  . GLN A 1 35 ? -8.965  8.056   -3.910  1.00 0.00 ? 35 GLN A HG2  1  
ATOM 533   H HG3  . GLN A 1 35 ? -8.543  7.116   -2.480  1.00 0.00 ? 35 GLN A HG3  1  
ATOM 534   H HE21 . GLN A 1 35 ? -6.990  7.913   -1.052  1.00 0.00 ? 35 GLN A HE21 1  
ATOM 535   H HE22 . GLN A 1 35 ? -6.523  9.576   -1.045  1.00 0.00 ? 35 GLN A HE22 1  
ATOM 536   N N    . ASN A 1 36 ? -8.463  3.967   -4.463  1.00 0.00 ? 36 ASN A N    1  
ATOM 537   C CA   . ASN A 1 36 ? -9.692  3.189   -4.538  1.00 0.00 ? 36 ASN A CA   1  
ATOM 538   C C    . ASN A 1 36 ? -9.408  1.692   -4.515  1.00 0.00 ? 36 ASN A C    1  
ATOM 539   O O    . ASN A 1 36 ? -10.285 0.887   -4.198  1.00 0.00 ? 36 ASN A O    1  
ATOM 540   C CB   . ASN A 1 36 ? -10.443 3.556   -5.813  1.00 0.00 ? 36 ASN A CB   1  
ATOM 541   C CG   . ASN A 1 36 ? -9.523  3.692   -7.000  1.00 0.00 ? 36 ASN A CG   1  
ATOM 542   O OD1  . ASN A 1 36 ? -9.384  2.778   -7.813  1.00 0.00 ? 36 ASN A OD1  1  
ATOM 543   N ND2  . ASN A 1 36 ? -8.884  4.846   -7.093  1.00 0.00 ? 36 ASN A ND2  1  
ATOM 544   H H    . ASN A 1 36 ? -7.836  3.938   -5.215  1.00 0.00 ? 36 ASN A H    1  
ATOM 545   H HA   . ASN A 1 36 ? -10.299 3.445   -3.687  1.00 0.00 ? 36 ASN A HA   1  
ATOM 546   H HB2  . ASN A 1 36 ? -11.180 2.802   -6.030  1.00 0.00 ? 36 ASN A HB2  1  
ATOM 547   H HB3  . ASN A 1 36 ? -10.926 4.502   -5.664  1.00 0.00 ? 36 ASN A HB3  1  
ATOM 548   H HD21 . ASN A 1 36 ? -9.052  5.519   -6.404  1.00 0.00 ? 36 ASN A HD21 1  
ATOM 549   H HD22 . ASN A 1 36 ? -8.278  4.978   -7.842  1.00 0.00 ? 36 ASN A HD22 1  
ATOM 550   N N    . LEU A 1 37 ? -8.179  1.329   -4.853  1.00 0.00 ? 37 LEU A N    1  
ATOM 551   C CA   . LEU A 1 37 ? -7.770  -0.075  -4.889  1.00 0.00 ? 37 LEU A CA   1  
ATOM 552   C C    . LEU A 1 37 ? -8.254  -0.834  -3.656  1.00 0.00 ? 37 LEU A C    1  
ATOM 553   O O    . LEU A 1 37 ? -8.366  -0.270  -2.568  1.00 0.00 ? 37 LEU A O    1  
ATOM 554   C CB   . LEU A 1 37 ? -6.247  -0.178  -4.997  1.00 0.00 ? 37 LEU A CB   1  
ATOM 555   C CG   . LEU A 1 37 ? -5.730  -0.752  -6.316  1.00 0.00 ? 37 LEU A CG   1  
ATOM 556   C CD1  . LEU A 1 37 ? -4.446  -0.052  -6.735  1.00 0.00 ? 37 LEU A CD1  1  
ATOM 557   C CD2  . LEU A 1 37 ? -5.506  -2.250  -6.192  1.00 0.00 ? 37 LEU A CD2  1  
ATOM 558   H H    . LEU A 1 37 ? -7.533  2.021   -5.103  1.00 0.00 ? 37 LEU A H    1  
ATOM 559   H HA   . LEU A 1 37 ? -8.213  -0.522  -5.766  1.00 0.00 ? 37 LEU A HA   1  
ATOM 560   H HB2  . LEU A 1 37 ? -5.832  0.809   -4.870  1.00 0.00 ? 37 LEU A HB2  1  
ATOM 561   H HB3  . LEU A 1 37 ? -5.891  -0.804  -4.193  1.00 0.00 ? 37 LEU A HB3  1  
ATOM 562   H HG   . LEU A 1 37 ? -6.467  -0.586  -7.088  1.00 0.00 ? 37 LEU A HG   1  
ATOM 563   H HD11 . LEU A 1 37 ? -4.674  0.713   -7.462  1.00 0.00 ? 37 LEU A HD11 1  
ATOM 564   H HD12 . LEU A 1 37 ? -3.768  -0.772  -7.169  1.00 0.00 ? 37 LEU A HD12 1  
ATOM 565   H HD13 . LEU A 1 37 ? -3.985  0.401   -5.870  1.00 0.00 ? 37 LEU A HD13 1  
ATOM 566   H HD21 . LEU A 1 37 ? -4.599  -2.435  -5.636  1.00 0.00 ? 37 LEU A HD21 1  
ATOM 567   H HD22 . LEU A 1 37 ? -5.420  -2.685  -7.177  1.00 0.00 ? 37 LEU A HD22 1  
ATOM 568   H HD23 . LEU A 1 37 ? -6.343  -2.697  -5.675  1.00 0.00 ? 37 LEU A HD23 1  
ATOM 569   N N    . THR A 1 38 ? -8.541  -2.119  -3.838  1.00 0.00 ? 38 THR A N    1  
ATOM 570   C CA   . THR A 1 38 ? -9.009  -2.965  -2.746  1.00 0.00 ? 38 THR A CA   1  
ATOM 571   C C    . THR A 1 38 ? -8.390  -4.351  -2.823  1.00 0.00 ? 38 THR A C    1  
ATOM 572   O O    . THR A 1 38 ? -7.657  -4.663  -3.761  1.00 0.00 ? 38 THR A O    1  
ATOM 573   C CB   . THR A 1 38 ? -10.531 -3.100  -2.791  1.00 0.00 ? 38 THR A CB   1  
ATOM 574   O OG1  . THR A 1 38 ? -11.091 -2.165  -3.696  1.00 0.00 ? 38 THR A OG1  1  
ATOM 575   C CG2  . THR A 1 38 ? -11.186 -2.895  -1.445  1.00 0.00 ? 38 THR A CG2  1  
ATOM 576   H H    . THR A 1 38 ? -8.430  -2.512  -4.729  1.00 0.00 ? 38 THR A H    1  
ATOM 577   H HA   . THR A 1 38 ? -8.720  -2.501  -1.814  1.00 0.00 ? 38 THR A HA   1  
ATOM 578   H HB   . THR A 1 38 ? -10.782 -4.099  -3.131  1.00 0.00 ? 38 THR A HB   1  
ATOM 579   H HG1  . THR A 1 38 ? -11.470 -2.630  -4.445  1.00 0.00 ? 38 THR A HG1  1  
ATOM 580   H HG21 . THR A 1 38 ? -12.206 -2.571  -1.588  1.00 0.00 ? 38 THR A HG21 1  
ATOM 581   H HG22 . THR A 1 38 ? -10.642 -2.143  -0.893  1.00 0.00 ? 38 THR A HG22 1  
ATOM 582   H HG23 . THR A 1 38 ? -11.176 -3.825  -0.896  1.00 0.00 ? 38 THR A HG23 1  
ATOM 583   N N    . ILE A 1 39 ? -8.729  -5.194  -1.856  1.00 0.00 ? 39 ILE A N    1  
ATOM 584   C CA   . ILE A 1 39 ? -8.266  -6.570  -1.862  1.00 0.00 ? 39 ILE A CA   1  
ATOM 585   C C    . ILE A 1 39 ? -8.753  -7.256  -3.126  1.00 0.00 ? 39 ILE A C    1  
ATOM 586   O O    . ILE A 1 39 ? -8.069  -8.101  -3.703  1.00 0.00 ? 39 ILE A O    1  
ATOM 587   C CB   . ILE A 1 39 ? -8.775  -7.348  -0.636  1.00 0.00 ? 39 ILE A CB   1  
ATOM 588   C CG1  . ILE A 1 39 ? -8.165  -8.751  -0.602  1.00 0.00 ? 39 ILE A CG1  1  
ATOM 589   C CG2  . ILE A 1 39 ? -10.293 -7.428  -0.648  1.00 0.00 ? 39 ILE A CG2  1  
ATOM 590   C CD1  . ILE A 1 39 ? -6.660  -8.757  -0.455  1.00 0.00 ? 39 ILE A CD1  1  
ATOM 591   H H    . ILE A 1 39 ? -9.348  -4.900  -1.157  1.00 0.00 ? 39 ILE A H    1  
ATOM 592   H HA   . ILE A 1 39 ? -7.188  -6.567  -1.849  1.00 0.00 ? 39 ILE A HA   1  
ATOM 593   H HB   . ILE A 1 39 ? -8.478  -6.808  0.248   1.00 0.00 ? 39 ILE A HB   1  
ATOM 594   H HG12 . ILE A 1 39 ? -8.581  -9.297  0.232   1.00 0.00 ? 39 ILE A HG12 1  
ATOM 595   H HG13 . ILE A 1 39 ? -8.410  -9.265  -1.521  1.00 0.00 ? 39 ILE A HG13 1  
ATOM 596   H HG21 . ILE A 1 39 ? -10.605 -8.241  -1.285  1.00 0.00 ? 39 ILE A HG21 1  
ATOM 597   H HG22 . ILE A 1 39 ? -10.699 -6.500  -1.022  1.00 0.00 ? 39 ILE A HG22 1  
ATOM 598   H HG23 . ILE A 1 39 ? -10.650 -7.599  0.356   1.00 0.00 ? 39 ILE A HG23 1  
ATOM 599   H HD11 . ILE A 1 39 ? -6.298  -7.740  -0.411  1.00 0.00 ? 39 ILE A HD11 1  
ATOM 600   H HD12 . ILE A 1 39 ? -6.217  -9.259  -1.303  1.00 0.00 ? 39 ILE A HD12 1  
ATOM 601   H HD13 . ILE A 1 39 ? -6.388  -9.276  0.453   1.00 0.00 ? 39 ILE A HD13 1  
ATOM 602   N N    . GLU A 1 40 ? -9.936  -6.845  -3.566  1.00 0.00 ? 40 GLU A N    1  
ATOM 603   C CA   . GLU A 1 40 ? -10.536 -7.381  -4.778  1.00 0.00 ? 40 GLU A CA   1  
ATOM 604   C C    . GLU A 1 40 ? -9.607  -7.183  -5.971  1.00 0.00 ? 40 GLU A C    1  
ATOM 605   O O    . GLU A 1 40 ? -9.316  -8.123  -6.709  1.00 0.00 ? 40 GLU A O    1  
ATOM 606   C CB   . GLU A 1 40 ? -11.882 -6.707  -5.049  1.00 0.00 ? 40 GLU A CB   1  
ATOM 607   C CG   . GLU A 1 40 ? -12.796 -6.658  -3.835  1.00 0.00 ? 40 GLU A CG   1  
ATOM 608   C CD   . GLU A 1 40 ? -14.204 -7.128  -4.146  1.00 0.00 ? 40 GLU A CD   1  
ATOM 609   O OE1  . GLU A 1 40 ? -14.966 -6.354  -4.761  1.00 0.00 ? 40 GLU A OE1  1  
ATOM 610   O OE2  . GLU A 1 40 ? -14.543 -8.271  -3.775  1.00 0.00 ? 40 GLU A OE2  1  
ATOM 611   H H    . GLU A 1 40 ? -10.418 -6.160  -3.057  1.00 0.00 ? 40 GLU A H    1  
ATOM 612   H HA   . GLU A 1 40 ? -10.694 -8.435  -4.629  1.00 0.00 ? 40 GLU A HA   1  
ATOM 613   H HB2  . GLU A 1 40 ? -11.705 -5.694  -5.380  1.00 0.00 ? 40 GLU A HB2  1  
ATOM 614   H HB3  . GLU A 1 40 ? -12.391 -7.248  -5.833  1.00 0.00 ? 40 GLU A HB3  1  
ATOM 615   H HG2  . GLU A 1 40 ? -12.383 -7.292  -3.065  1.00 0.00 ? 40 GLU A HG2  1  
ATOM 616   H HG3  . GLU A 1 40 ? -12.844 -5.641  -3.476  1.00 0.00 ? 40 GLU A HG3  1  
ATOM 617   N N    . ASP A 1 41 ? -9.140  -5.950  -6.148  1.00 0.00 ? 41 ASP A N    1  
ATOM 618   C CA   . ASP A 1 41 ? -8.232  -5.625  -7.243  1.00 0.00 ? 41 ASP A CA   1  
ATOM 619   C C    . ASP A 1 41 ? -6.810  -6.081  -6.925  1.00 0.00 ? 41 ASP A C    1  
ATOM 620   O O    . ASP A 1 41 ? -6.005  -6.311  -7.825  1.00 0.00 ? 41 ASP A O    1  
ATOM 621   C CB   . ASP A 1 41 ? -8.245  -4.119  -7.515  1.00 0.00 ? 41 ASP A CB   1  
ATOM 622   C CG   . ASP A 1 41 ? -8.918  -3.774  -8.830  1.00 0.00 ? 41 ASP A CG   1  
ATOM 623   O OD1  . ASP A 1 41 ? -8.344  -4.093  -9.892  1.00 0.00 ? 41 ASP A OD1  1  
ATOM 624   O OD2  . ASP A 1 41 ? -10.018 -3.184  -8.796  1.00 0.00 ? 41 ASP A OD2  1  
ATOM 625   H H    . ASP A 1 41 ? -9.406  -5.244  -5.522  1.00 0.00 ? 41 ASP A H    1  
ATOM 626   H HA   . ASP A 1 41 ? -8.575  -6.146  -8.125  1.00 0.00 ? 41 ASP A HA   1  
ATOM 627   H HB2  . ASP A 1 41 ? -8.777  -3.620  -6.718  1.00 0.00 ? 41 ASP A HB2  1  
ATOM 628   H HB3  . ASP A 1 41 ? -7.228  -3.757  -7.547  1.00 0.00 ? 41 ASP A HB3  1  
ATOM 629   N N    . LEU A 1 42 ? -6.510  -6.204  -5.636  1.00 0.00 ? 42 LEU A N    1  
ATOM 630   C CA   . LEU A 1 42 ? -5.189  -6.635  -5.196  1.00 0.00 ? 42 LEU A CA   1  
ATOM 631   C C    . LEU A 1 42 ? -4.869  -8.018  -5.745  1.00 0.00 ? 42 LEU A C    1  
ATOM 632   O O    . LEU A 1 42 ? -3.800  -8.243  -6.314  1.00 0.00 ? 42 LEU A O    1  
ATOM 633   C CB   . LEU A 1 42 ? -5.120  -6.652  -3.661  1.00 0.00 ? 42 LEU A CB   1  
ATOM 634   C CG   . LEU A 1 42 ? -4.971  -5.289  -2.945  1.00 0.00 ? 42 LEU A CG   1  
ATOM 635   C CD1  . LEU A 1 42 ? -3.683  -5.261  -2.141  1.00 0.00 ? 42 LEU A CD1  1  
ATOM 636   C CD2  . LEU A 1 42 ? -5.013  -4.105  -3.910  1.00 0.00 ? 42 LEU A CD2  1  
ATOM 637   H H    . LEU A 1 42 ? -7.193  -6.007  -4.966  1.00 0.00 ? 42 LEU A H    1  
ATOM 638   H HA   . LEU A 1 42 ? -4.464  -5.930  -5.577  1.00 0.00 ? 42 LEU A HA   1  
ATOM 639   H HB2  . LEU A 1 42 ? -6.022  -7.120  -3.296  1.00 0.00 ? 42 LEU A HB2  1  
ATOM 640   H HB3  . LEU A 1 42 ? -4.282  -7.270  -3.375  1.00 0.00 ? 42 LEU A HB3  1  
ATOM 641   H HG   . LEU A 1 42 ? -5.789  -5.172  -2.249  1.00 0.00 ? 42 LEU A HG   1  
ATOM 642   H HD11 . LEU A 1 42 ? -2.913  -4.762  -2.711  1.00 0.00 ? 42 LEU A HD11 1  
ATOM 643   H HD12 . LEU A 1 42 ? -3.372  -6.272  -1.923  1.00 0.00 ? 42 LEU A HD12 1  
ATOM 644   H HD13 . LEU A 1 42 ? -3.850  -4.728  -1.217  1.00 0.00 ? 42 LEU A HD13 1  
ATOM 645   H HD21 . LEU A 1 42 ? -5.313  -3.216  -3.374  1.00 0.00 ? 42 LEU A HD21 1  
ATOM 646   H HD22 . LEU A 1 42 ? -5.721  -4.304  -4.699  1.00 0.00 ? 42 LEU A HD22 1  
ATOM 647   H HD23 . LEU A 1 42 ? -4.032  -3.954  -4.337  1.00 0.00 ? 42 LEU A HD23 1  
ATOM 648   N N    . GLY A 1 43 ? -5.812  -8.942  -5.584  1.00 0.00 ? 43 GLY A N    1  
ATOM 649   C CA   . GLY A 1 43 ? -5.625  -10.287 -6.090  1.00 0.00 ? 43 GLY A CA   1  
ATOM 650   C C    . GLY A 1 43 ? -5.676  -10.356 -7.606  1.00 0.00 ? 43 GLY A C    1  
ATOM 651   O O    . GLY A 1 43 ? -5.413  -11.406 -8.192  1.00 0.00 ? 43 GLY A O    1  
ATOM 652   H H    . GLY A 1 43 ? -6.649  -8.702  -5.133  1.00 0.00 ? 43 GLY A H    1  
ATOM 653   H HA2  . GLY A 1 43 ? -4.665  -10.655 -5.756  1.00 0.00 ? 43 GLY A HA2  1  
ATOM 654   H HA3  . GLY A 1 43 ? -6.400  -10.922 -5.685  1.00 0.00 ? 43 GLY A HA3  1  
ATOM 655   N N    . ALA A 1 44 ? -6.019  -9.239  -8.245  1.00 0.00 ? 44 ALA A N    1  
ATOM 656   C CA   . ALA A 1 44 ? -6.086  -9.183  -9.701  1.00 0.00 ? 44 ALA A CA   1  
ATOM 657   C C    . ALA A 1 44 ? -4.687  -9.078  -10.294 1.00 0.00 ? 44 ALA A C    1  
ATOM 658   O O    . ALA A 1 44 ? -4.355  -9.766  -11.258 1.00 0.00 ? 44 ALA A O    1  
ATOM 659   C CB   . ALA A 1 44 ? -6.944  -8.011  -10.151 1.00 0.00 ? 44 ALA A CB   1  
ATOM 660   H H    . ALA A 1 44 ? -6.209  -8.428  -7.731  1.00 0.00 ? 44 ALA A H    1  
ATOM 661   H HA   . ALA A 1 44 ? -6.549  -10.094 -10.051 1.00 0.00 ? 44 ALA A HA   1  
ATOM 662   H HB1  . ALA A 1 44 ? -6.504  -7.088  -9.803  1.00 0.00 ? 44 ALA A HB1  1  
ATOM 663   H HB2  . ALA A 1 44 ? -7.937  -8.113  -9.738  1.00 0.00 ? 44 ALA A HB2  1  
ATOM 664   H HB3  . ALA A 1 44 ? -7.000  -7.999  -11.229 1.00 0.00 ? 44 ALA A HB3  1  
ATOM 665   N N    . LEU A 1 45 ? -3.861  -8.227  -9.689  1.00 0.00 ? 45 LEU A N    1  
ATOM 666   C CA   . LEU A 1 45 ? -2.487  -8.047  -10.128 1.00 0.00 ? 45 LEU A CA   1  
ATOM 667   C C    . LEU A 1 45 ? -1.798  -9.387  -10.341 1.00 0.00 ? 45 LEU A C    1  
ATOM 668   O O    . LEU A 1 45 ? -0.902  -9.515  -11.174 1.00 0.00 ? 45 LEU A O    1  
ATOM 669   C CB   . LEU A 1 45 ? -1.727  -7.243  -9.084  1.00 0.00 ? 45 LEU A CB   1  
ATOM 670   C CG   . LEU A 1 45 ? -1.953  -5.734  -9.149  1.00 0.00 ? 45 LEU A CG   1  
ATOM 671   C CD1  . LEU A 1 45 ? -3.436  -5.411  -9.058  1.00 0.00 ? 45 LEU A CD1  1  
ATOM 672   C CD2  . LEU A 1 45 ? -1.185  -5.036  -8.039  1.00 0.00 ? 45 LEU A CD2  1  
ATOM 673   H H    . LEU A 1 45 ? -4.181  -7.715  -8.915  1.00 0.00 ? 45 LEU A H    1  
ATOM 674   H HA   . LEU A 1 45 ? -2.497  -7.505  -11.058 1.00 0.00 ? 45 LEU A HA   1  
ATOM 675   H HB2  . LEU A 1 45 ? -2.028  -7.588  -8.105  1.00 0.00 ? 45 LEU A HB2  1  
ATOM 676   H HB3  . LEU A 1 45 ? -0.676  -7.440  -9.207  1.00 0.00 ? 45 LEU A HB3  1  
ATOM 677   H HG   . LEU A 1 45 ? -1.590  -5.367  -10.094 1.00 0.00 ? 45 LEU A HG   1  
ATOM 678   H HD11 . LEU A 1 45 ? -3.568  -4.342  -8.984  1.00 0.00 ? 45 LEU A HD11 1  
ATOM 679   H HD12 . LEU A 1 45 ? -3.855  -5.887  -8.184  1.00 0.00 ? 45 LEU A HD12 1  
ATOM 680   H HD13 . LEU A 1 45 ? -3.938  -5.776  -9.942  1.00 0.00 ? 45 LEU A HD13 1  
ATOM 681   H HD21 . LEU A 1 45 ? -0.139  -4.990  -8.299  1.00 0.00 ? 45 LEU A HD21 1  
ATOM 682   H HD22 . LEU A 1 45 ? -1.305  -5.589  -7.119  1.00 0.00 ? 45 LEU A HD22 1  
ATOM 683   H HD23 . LEU A 1 45 ? -1.570  -4.036  -7.911  1.00 0.00 ? 45 LEU A HD23 1  
ATOM 684   N N    . LYS A 1 46 ? -2.244  -10.378 -9.581  1.00 0.00 ? 46 LYS A N    1  
ATOM 685   C CA   . LYS A 1 46 ? -1.693  -11.730 -9.633  1.00 0.00 ? 46 LYS A CA   1  
ATOM 686   C C    . LYS A 1 46 ? -0.429  -11.850 -8.791  1.00 0.00 ? 46 LYS A C    1  
ATOM 687   O O    . LYS A 1 46 ? 0.382   -12.756 -8.985  1.00 0.00 ? 46 LYS A O    1  
ATOM 688   C CB   . LYS A 1 46 ? -1.397  -12.167 -11.061 1.00 0.00 ? 46 LYS A CB   1  
ATOM 689   C CG   . LYS A 1 46 ? -1.085  -13.642 -11.139 1.00 0.00 ? 46 LYS A CG   1  
ATOM 690   C CD   . LYS A 1 46 ? -2.192  -14.412 -11.837 1.00 0.00 ? 46 LYS A CD   1  
ATOM 691   C CE   . LYS A 1 46 ? -1.753  -14.892 -13.210 1.00 0.00 ? 46 LYS A CE   1  
ATOM 692   N NZ   . LYS A 1 46 ? -1.273  -16.301 -13.177 1.00 0.00 ? 46 LYS A NZ   1  
ATOM 693   H H    . LYS A 1 46 ? -2.950  -10.184 -8.933  1.00 0.00 ? 46 LYS A H    1  
ATOM 694   H HA   . LYS A 1 46 ? -2.438  -12.396 -9.222  1.00 0.00 ? 46 LYS A HA   1  
ATOM 695   H HB2  . LYS A 1 46 ? -2.255  -11.961 -11.683 1.00 0.00 ? 46 LYS A HB2  1  
ATOM 696   H HB3  . LYS A 1 46 ? -0.545  -11.620 -11.433 1.00 0.00 ? 46 LYS A HB3  1  
ATOM 697   H HG2  . LYS A 1 46 ? -0.161  -13.778 -11.678 1.00 0.00 ? 46 LYS A HG2  1  
ATOM 698   H HG3  . LYS A 1 46 ? -0.977  -14.014 -10.129 1.00 0.00 ? 46 LYS A HG3  1  
ATOM 699   H HD2  . LYS A 1 46 ? -2.457  -15.268 -11.235 1.00 0.00 ? 46 LYS A HD2  1  
ATOM 700   H HD3  . LYS A 1 46 ? -3.051  -13.767 -11.950 1.00 0.00 ? 46 LYS A HD3  1  
ATOM 701   H HE2  . LYS A 1 46 ? -2.591  -14.821 -13.886 1.00 0.00 ? 46 LYS A HE2  1  
ATOM 702   H HE3  . LYS A 1 46 ? -0.954  -14.255 -13.559 1.00 0.00 ? 46 LYS A HE3  1  
ATOM 703   H HZ1  . LYS A 1 46 ? -0.235  -16.325 -13.231 1.00 0.00 ? 46 LYS A HZ1  1  
ATOM 704   H HZ2  . LYS A 1 46 ? -1.662  -16.830 -13.984 1.00 0.00 ? 46 LYS A HZ2  1  
ATOM 705   H HZ3  . LYS A 1 46 ? -1.575  -16.761 -12.296 1.00 0.00 ? 46 LYS A HZ3  1  
ATOM 706   N N    . ILE A 1 47 ? -0.277  -10.940 -7.846  1.00 0.00 ? 47 ILE A N    1  
ATOM 707   C CA   . ILE A 1 47 ? 0.867   -10.955 -6.941  1.00 0.00 ? 47 ILE A CA   1  
ATOM 708   C C    . ILE A 1 47 ? 0.634   -11.951 -5.810  1.00 0.00 ? 47 ILE A C    1  
ATOM 709   O O    . ILE A 1 47 ? -0.467  -12.036 -5.268  1.00 0.00 ? 47 ILE A O    1  
ATOM 710   C CB   . ILE A 1 47 ? 1.130   -9.561  -6.334  1.00 0.00 ? 47 ILE A CB   1  
ATOM 711   C CG1  . ILE A 1 47 ? 0.888   -8.468  -7.377  1.00 0.00 ? 47 ILE A CG1  1  
ATOM 712   C CG2  . ILE A 1 47 ? 2.548   -9.475  -5.792  1.00 0.00 ? 47 ILE A CG2  1  
ATOM 713   C CD1  . ILE A 1 47 ? 1.162   -7.069  -6.866  1.00 0.00 ? 47 ILE A CD1  1  
ATOM 714   H H    . ILE A 1 47 ? -0.966  -10.260 -7.735  1.00 0.00 ? 47 ILE A H    1  
ATOM 715   H HA   . ILE A 1 47 ? 1.739   -11.252 -7.504  1.00 0.00 ? 47 ILE A HA   1  
ATOM 716   H HB   . ILE A 1 47 ? 0.448   -9.419  -5.508  1.00 0.00 ? 47 ILE A HB   1  
ATOM 717   H HG12 . ILE A 1 47 ? 1.528   -8.643  -8.228  1.00 0.00 ? 47 ILE A HG12 1  
ATOM 718   H HG13 . ILE A 1 47 ? -0.144  -8.507  -7.692  1.00 0.00 ? 47 ILE A HG13 1  
ATOM 719   H HG21 . ILE A 1 47 ? 2.676   -10.200 -5.002  1.00 0.00 ? 47 ILE A HG21 1  
ATOM 720   H HG22 . ILE A 1 47 ? 2.726   -8.484  -5.403  1.00 0.00 ? 47 ILE A HG22 1  
ATOM 721   H HG23 . ILE A 1 47 ? 3.250   -9.681  -6.586  1.00 0.00 ? 47 ILE A HG23 1  
ATOM 722   H HD11 . ILE A 1 47 ? 2.129   -7.044  -6.387  1.00 0.00 ? 47 ILE A HD11 1  
ATOM 723   H HD12 . ILE A 1 47 ? 0.399   -6.790  -6.156  1.00 0.00 ? 47 ILE A HD12 1  
ATOM 724   H HD13 . ILE A 1 47 ? 1.153   -6.377  -7.695  1.00 0.00 ? 47 ILE A HD13 1  
ATOM 725   N N    . PRO A 1 48 ? 1.666   -12.730 -5.440  1.00 0.00 ? 48 PRO A N    1  
ATOM 726   C CA   . PRO A 1 48 ? 1.560   -13.719 -4.367  1.00 0.00 ? 48 PRO A CA   1  
ATOM 727   C C    . PRO A 1 48 ? 0.735   -13.210 -3.191  1.00 0.00 ? 48 PRO A C    1  
ATOM 728   O O    . PRO A 1 48 ? 0.874   -12.060 -2.773  1.00 0.00 ? 48 PRO A O    1  
ATOM 729   C CB   . PRO A 1 48 ? 3.014   -13.930 -3.959  1.00 0.00 ? 48 PRO A CB   1  
ATOM 730   C CG   . PRO A 1 48 ? 3.788   -13.717 -5.217  1.00 0.00 ? 48 PRO A CG   1  
ATOM 731   C CD   . PRO A 1 48 ? 3.020   -12.701 -6.027  1.00 0.00 ? 48 PRO A CD   1  
ATOM 732   H HA   . PRO A 1 48 ? 1.144   -14.649 -4.724  1.00 0.00 ? 48 PRO A HA   1  
ATOM 733   H HB2  . PRO A 1 48 ? 3.286   -13.211 -3.199  1.00 0.00 ? 48 PRO A HB2  1  
ATOM 734   H HB3  . PRO A 1 48 ? 3.143   -14.932 -3.578  1.00 0.00 ? 48 PRO A HB3  1  
ATOM 735   H HG2  . PRO A 1 48 ? 4.772   -13.340 -4.981  1.00 0.00 ? 48 PRO A HG2  1  
ATOM 736   H HG3  . PRO A 1 48 ? 3.864   -14.648 -5.760  1.00 0.00 ? 48 PRO A HG3  1  
ATOM 737   H HD2  . PRO A 1 48 ? 3.465   -11.722 -5.920  1.00 0.00 ? 48 PRO A HD2  1  
ATOM 738   H HD3  . PRO A 1 48 ? 2.994   -12.991 -7.068  1.00 0.00 ? 48 PRO A HD3  1  
ATOM 739   N N    . GLU A 1 49 ? -0.135  -14.068 -2.668  1.00 0.00 ? 49 GLU A N    1  
ATOM 740   C CA   . GLU A 1 49 ? -1.001  -13.697 -1.554  1.00 0.00 ? 49 GLU A CA   1  
ATOM 741   C C    . GLU A 1 49 ? -0.249  -13.737 -0.227  1.00 0.00 ? 49 GLU A C    1  
ATOM 742   O O    . GLU A 1 49 ? -0.664  -14.420 0.710   1.00 0.00 ? 49 GLU A O    1  
ATOM 743   C CB   . GLU A 1 49 ? -2.209  -14.633 -1.493  1.00 0.00 ? 49 GLU A CB   1  
ATOM 744   C CG   . GLU A 1 49 ? -3.341  -14.111 -0.623  1.00 0.00 ? 49 GLU A CG   1  
ATOM 745   C CD   . GLU A 1 49 ? -4.208  -15.222 -0.067  1.00 0.00 ? 49 GLU A CD   1  
ATOM 746   O OE1  . GLU A 1 49 ? -4.504  -16.175 -0.817  1.00 0.00 ? 49 GLU A OE1  1  
ATOM 747   O OE2  . GLU A 1 49 ? -4.592  -15.138 1.119   1.00 0.00 ? 49 GLU A OE2  1  
ATOM 748   H H    . GLU A 1 49 ? -0.207  -14.967 -3.049  1.00 0.00 ? 49 GLU A H    1  
ATOM 749   H HA   . GLU A 1 49 ? -1.346  -12.688 -1.725  1.00 0.00 ? 49 GLU A HA   1  
ATOM 750   H HB2  . GLU A 1 49 ? -2.589  -14.776 -2.494  1.00 0.00 ? 49 GLU A HB2  1  
ATOM 751   H HB3  . GLU A 1 49 ? -1.891  -15.586 -1.099  1.00 0.00 ? 49 GLU A HB3  1  
ATOM 752   H HG2  . GLU A 1 49 ? -2.917  -13.557 0.202   1.00 0.00 ? 49 GLU A HG2  1  
ATOM 753   H HG3  . GLU A 1 49 ? -3.960  -13.453 -1.217  1.00 0.00 ? 49 GLU A HG3  1  
ATOM 754   N N    . GLN A 1 50 ? 0.858   -13.006 -0.152  1.00 0.00 ? 50 GLN A N    1  
ATOM 755   C CA   . GLN A 1 50 ? 1.651   -12.948 1.068   1.00 0.00 ? 50 GLN A CA   1  
ATOM 756   C C    . GLN A 1 50 ? 1.106   -11.882 2.012   1.00 0.00 ? 50 GLN A C    1  
ATOM 757   O O    . GLN A 1 50 ? 0.994   -12.103 3.218   1.00 0.00 ? 50 GLN A O    1  
ATOM 758   C CB   . GLN A 1 50 ? 3.116   -12.657 0.735   1.00 0.00 ? 50 GLN A CB   1  
ATOM 759   C CG   . GLN A 1 50 ? 3.659   -13.507 -0.402  1.00 0.00 ? 50 GLN A CG   1  
ATOM 760   C CD   . GLN A 1 50 ? 4.849   -14.344 0.011   1.00 0.00 ? 50 GLN A CD   1  
ATOM 761   O OE1  . GLN A 1 50 ? 4.903   -14.867 1.124   1.00 0.00 ? 50 GLN A OE1  1  
ATOM 762   N NE2  . GLN A 1 50 ? 5.815   -14.474 -0.889  1.00 0.00 ? 50 GLN A NE2  1  
ATOM 763   H H    . GLN A 1 50 ? 1.133   -12.472 -0.924  1.00 0.00 ? 50 GLN A H    1  
ATOM 764   H HA   . GLN A 1 50 ? 1.583   -13.910 1.553   1.00 0.00 ? 50 GLN A HA   1  
ATOM 765   H HB2  . GLN A 1 50 ? 3.210   -11.617 0.456   1.00 0.00 ? 50 GLN A HB2  1  
ATOM 766   H HB3  . GLN A 1 50 ? 3.716   -12.842 1.613   1.00 0.00 ? 50 GLN A HB3  1  
ATOM 767   H HG2  . GLN A 1 50 ? 2.877   -14.169 -0.747  1.00 0.00 ? 50 GLN A HG2  1  
ATOM 768   H HG3  . GLN A 1 50 ? 3.961   -12.858 -1.209  1.00 0.00 ? 50 GLN A HG3  1  
ATOM 769   H HE21 . GLN A 1 50 ? 5.703   -14.029 -1.756  1.00 0.00 ? 50 GLN A HE21 1  
ATOM 770   H HE22 . GLN A 1 50 ? 6.597   -15.009 -0.652  1.00 0.00 ? 50 GLN A HE22 1  
ATOM 771   N N    . TYR A 1 51 ? 0.763   -10.726 1.452   1.00 0.00 ? 51 TYR A N    1  
ATOM 772   C CA   . TYR A 1 51 ? 0.227   -9.623  2.240   1.00 0.00 ? 51 TYR A CA   1  
ATOM 773   C C    . TYR A 1 51 ? -0.900  -8.915  1.494   1.00 0.00 ? 51 TYR A C    1  
ATOM 774   O O    . TYR A 1 51 ? -1.110  -7.713  1.664   1.00 0.00 ? 51 TYR A O    1  
ATOM 775   C CB   . TYR A 1 51 ? 1.338   -8.626  2.576   1.00 0.00 ? 51 TYR A CB   1  
ATOM 776   C CG   . TYR A 1 51 ? 2.669   -9.280  2.874   1.00 0.00 ? 51 TYR A CG   1  
ATOM 777   C CD1  . TYR A 1 51 ? 2.922   -9.849  4.116   1.00 0.00 ? 51 TYR A CD1  1  
ATOM 778   C CD2  . TYR A 1 51 ? 3.670   -9.330  1.913   1.00 0.00 ? 51 TYR A CD2  1  
ATOM 779   C CE1  . TYR A 1 51 ? 4.137   -10.448 4.393   1.00 0.00 ? 51 TYR A CE1  1  
ATOM 780   C CE2  . TYR A 1 51 ? 4.888   -9.928  2.182   1.00 0.00 ? 51 TYR A CE2  1  
ATOM 781   C CZ   . TYR A 1 51 ? 5.115   -10.486 3.423   1.00 0.00 ? 51 TYR A CZ   1  
ATOM 782   O OH   . TYR A 1 51 ? 6.325   -11.082 3.694   1.00 0.00 ? 51 TYR A OH   1  
ATOM 783   H H    . TYR A 1 51 ? 0.875   -10.612 0.486   1.00 0.00 ? 51 TYR A H    1  
ATOM 784   H HA   . TYR A 1 51 ? -0.167  -10.032 3.158   1.00 0.00 ? 51 TYR A HA   1  
ATOM 785   H HB2  . TYR A 1 51 ? 1.478   -7.957  1.739   1.00 0.00 ? 51 TYR A HB2  1  
ATOM 786   H HB3  . TYR A 1 51 ? 1.048   -8.053  3.444   1.00 0.00 ? 51 TYR A HB3  1  
ATOM 787   H HD1  . TYR A 1 51 ? 2.153   -9.819  4.875   1.00 0.00 ? 51 TYR A HD1  1  
ATOM 788   H HD2  . TYR A 1 51 ? 3.490   -8.893  0.943   1.00 0.00 ? 51 TYR A HD2  1  
ATOM 789   H HE1  . TYR A 1 51 ? 4.314   -10.885 5.364   1.00 0.00 ? 51 TYR A HE1  1  
ATOM 790   H HE2  . TYR A 1 51 ? 5.655   -9.956  1.422   1.00 0.00 ? 51 TYR A HE2  1  
ATOM 791   H HH   . TYR A 1 51 ? 6.552   -10.943 4.617   1.00 0.00 ? 51 TYR A HH   1  
ATOM 792   N N    . ARG A 1 52 ? -1.624  -9.663  0.665   1.00 0.00 ? 52 ARG A N    1  
ATOM 793   C CA   . ARG A 1 52 ? -2.730  -9.104  -0.102  1.00 0.00 ? 52 ARG A CA   1  
ATOM 794   C C    . ARG A 1 52 ? -3.680  -8.328  0.804   1.00 0.00 ? 52 ARG A C    1  
ATOM 795   O O    . ARG A 1 52 ? -3.899  -7.133  0.612   1.00 0.00 ? 52 ARG A O    1  
ATOM 796   C CB   . ARG A 1 52 ? -3.490  -10.224 -0.814  1.00 0.00 ? 52 ARG A CB   1  
ATOM 797   C CG   . ARG A 1 52 ? -3.816  -9.920  -2.267  1.00 0.00 ? 52 ARG A CG   1  
ATOM 798   C CD   . ARG A 1 52 ? -4.497  -11.102 -2.935  1.00 0.00 ? 52 ARG A CD   1  
ATOM 799   N NE   . ARG A 1 52 ? -3.623  -11.767 -3.897  1.00 0.00 ? 52 ARG A NE   1  
ATOM 800   C CZ   . ARG A 1 52 ? -3.995  -12.814 -4.626  1.00 0.00 ? 52 ARG A CZ   1  
ATOM 801   N NH1  . ARG A 1 52 ? -5.219  -13.310 -4.502  1.00 0.00 ? 52 ARG A NH1  1  
ATOM 802   N NH2  . ARG A 1 52 ? -3.144  -13.366 -5.480  1.00 0.00 ? 52 ARG A NH2  1  
ATOM 803   H H    . ARG A 1 52 ? -1.415  -10.616 0.572   1.00 0.00 ? 52 ARG A H    1  
ATOM 804   H HA   . ARG A 1 52 ? -2.319  -8.430  -0.838  1.00 0.00 ? 52 ARG A HA   1  
ATOM 805   H HB2  . ARG A 1 52 ? -2.894  -11.123 -0.784  1.00 0.00 ? 52 ARG A HB2  1  
ATOM 806   H HB3  . ARG A 1 52 ? -4.416  -10.402 -0.290  1.00 0.00 ? 52 ARG A HB3  1  
ATOM 807   H HG2  . ARG A 1 52 ? -4.476  -9.065  -2.311  1.00 0.00 ? 52 ARG A HG2  1  
ATOM 808   H HG3  . ARG A 1 52 ? -2.901  -9.699  -2.795  1.00 0.00 ? 52 ARG A HG3  1  
ATOM 809   H HD2  . ARG A 1 52 ? -4.780  -11.812 -2.172  1.00 0.00 ? 52 ARG A HD2  1  
ATOM 810   H HD3  . ARG A 1 52 ? -5.380  -10.751 -3.446  1.00 0.00 ? 52 ARG A HD3  1  
ATOM 811   H HE   . ARG A 1 52 ? -2.715  -11.416 -4.003  1.00 0.00 ? 52 ARG A HE   1  
ATOM 812   H HH11 . ARG A 1 52 ? -5.863  -12.896 -3.859  1.00 0.00 ? 52 ARG A HH11 1  
ATOM 813   H HH12 . ARG A 1 52 ? -5.496  -14.098 -5.052  1.00 0.00 ? 52 ARG A HH12 1  
ATOM 814   H HH21 . ARG A 1 52 ? -2.220  -12.995 -5.575  1.00 0.00 ? 52 ARG A HH21 1  
ATOM 815   H HH22 . ARG A 1 52 ? -3.426  -14.154 -6.028  1.00 0.00 ? 52 ARG A HH22 1  
ATOM 816   N N    . MET A 1 53 ? -4.238  -9.017  1.793   1.00 0.00 ? 53 MET A N    1  
ATOM 817   C CA   . MET A 1 53 ? -5.163  -8.393  2.731   1.00 0.00 ? 53 MET A CA   1  
ATOM 818   C C    . MET A 1 53 ? -4.493  -7.237  3.465   1.00 0.00 ? 53 MET A C    1  
ATOM 819   O O    . MET A 1 53 ? -5.079  -6.166  3.621   1.00 0.00 ? 53 MET A O    1  
ATOM 820   C CB   . MET A 1 53 ? -5.674  -9.424  3.741   1.00 0.00 ? 53 MET A CB   1  
ATOM 821   C CG   . MET A 1 53 ? -4.585  -9.985  4.640   1.00 0.00 ? 53 MET A CG   1  
ATOM 822   S SD   . MET A 1 53 ? -5.013  -11.594 5.329   1.00 0.00 ? 53 MET A SD   1  
ATOM 823   C CE   . MET A 1 53 ? -5.589  -11.122 6.958   1.00 0.00 ? 53 MET A CE   1  
ATOM 824   H H    . MET A 1 53 ? -4.023  -9.968  1.895   1.00 0.00 ? 53 MET A H    1  
ATOM 825   H HA   . MET A 1 53 ? -6.000  -8.008  2.164   1.00 0.00 ? 53 MET A HA   1  
ATOM 826   H HB2  . MET A 1 53 ? -6.421  -8.957  4.365   1.00 0.00 ? 53 MET A HB2  1  
ATOM 827   H HB3  . MET A 1 53 ? -6.126  -10.244 3.204   1.00 0.00 ? 53 MET A HB3  1  
ATOM 828   H HG2  . MET A 1 53 ? -3.676  -10.087 4.063   1.00 0.00 ? 53 MET A HG2  1  
ATOM 829   H HG3  . MET A 1 53 ? -4.416  -9.295  5.454   1.00 0.00 ? 53 MET A HG3  1  
ATOM 830   H HE1  . MET A 1 53 ? -5.213  -10.139 7.201   1.00 0.00 ? 53 MET A HE1  1  
ATOM 831   H HE2  . MET A 1 53 ? -5.232  -11.834 7.687   1.00 0.00 ? 53 MET A HE2  1  
ATOM 832   H HE3  . MET A 1 53 ? -6.669  -11.108 6.968   1.00 0.00 ? 53 MET A HE3  1  
ATOM 833   N N    . THR A 1 54 ? -3.261  -7.460  3.918   1.00 0.00 ? 54 THR A N    1  
ATOM 834   C CA   . THR A 1 54 ? -2.512  -6.429  4.625   1.00 0.00 ? 54 THR A CA   1  
ATOM 835   C C    . THR A 1 54 ? -2.497  -5.135  3.820   1.00 0.00 ? 54 THR A C    1  
ATOM 836   O O    . THR A 1 54 ? -2.806  -4.063  4.341   1.00 0.00 ? 54 THR A O    1  
ATOM 837   C CB   . THR A 1 54 ? -1.077  -6.894  4.888   1.00 0.00 ? 54 THR A CB   1  
ATOM 838   O OG1  . THR A 1 54 ? -1.063  -7.994  5.780   1.00 0.00 ? 54 THR A OG1  1  
ATOM 839   C CG2  . THR A 1 54 ? -0.191  -5.814  5.476   1.00 0.00 ? 54 THR A CG2  1  
ATOM 840   H H    . THR A 1 54 ? -2.843  -8.332  3.760   1.00 0.00 ? 54 THR A H    1  
ATOM 841   H HA   . THR A 1 54 ? -3.002  -6.248  5.570   1.00 0.00 ? 54 THR A HA   1  
ATOM 842   H HB   . THR A 1 54 ? -0.634  -7.208  3.955   1.00 0.00 ? 54 THR A HB   1  
ATOM 843   H HG1  . THR A 1 54 ? -1.441  -7.729  6.621   1.00 0.00 ? 54 THR A HG1  1  
ATOM 844   H HG21 . THR A 1 54 ? -0.359  -4.884  4.953   1.00 0.00 ? 54 THR A HG21 1  
ATOM 845   H HG22 . THR A 1 54 ? 0.844   -6.102  5.371   1.00 0.00 ? 54 THR A HG22 1  
ATOM 846   H HG23 . THR A 1 54 ? -0.425  -5.688  6.522   1.00 0.00 ? 54 THR A HG23 1  
ATOM 847   N N    . ILE A 1 55 ? -2.139  -5.247  2.547   1.00 0.00 ? 55 ILE A N    1  
ATOM 848   C CA   . ILE A 1 55 ? -2.090  -4.090  1.665   1.00 0.00 ? 55 ILE A CA   1  
ATOM 849   C C    . ILE A 1 55 ? -3.461  -3.428  1.565   1.00 0.00 ? 55 ILE A C    1  
ATOM 850   O O    . ILE A 1 55 ? -3.581  -2.207  1.675   1.00 0.00 ? 55 ILE A O    1  
ATOM 851   C CB   . ILE A 1 55 ? -1.604  -4.478  0.257   1.00 0.00 ? 55 ILE A CB   1  
ATOM 852   C CG1  . ILE A 1 55 ? -0.215  -5.114  0.332   1.00 0.00 ? 55 ILE A CG1  1  
ATOM 853   C CG2  . ILE A 1 55 ? -1.583  -3.260  -0.656  1.00 0.00 ? 55 ILE A CG2  1  
ATOM 854   C CD1  . ILE A 1 55 ? 0.044   -6.129  -0.760  1.00 0.00 ? 55 ILE A CD1  1  
ATOM 855   H H    . ILE A 1 55 ? -1.909  -6.130  2.190   1.00 0.00 ? 55 ILE A H    1  
ATOM 856   H HA   . ILE A 1 55 ? -1.389  -3.386  2.081   1.00 0.00 ? 55 ILE A HA   1  
ATOM 857   H HB   . ILE A 1 55 ? -2.297  -5.194  -0.153  1.00 0.00 ? 55 ILE A HB   1  
ATOM 858   H HG12 . ILE A 1 55 ? 0.534   -4.339  0.249   1.00 0.00 ? 55 ILE A HG12 1  
ATOM 859   H HG13 . ILE A 1 55 ? -0.106  -5.615  1.283   1.00 0.00 ? 55 ILE A HG13 1  
ATOM 860   H HG21 . ILE A 1 55 ? -2.575  -2.838  -0.714  1.00 0.00 ? 55 ILE A HG21 1  
ATOM 861   H HG22 . ILE A 1 55 ? -1.259  -3.556  -1.643  1.00 0.00 ? 55 ILE A HG22 1  
ATOM 862   H HG23 . ILE A 1 55 ? -0.901  -2.525  -0.259  1.00 0.00 ? 55 ILE A HG23 1  
ATOM 863   H HD11 . ILE A 1 55 ? 0.674   -6.918  -0.376  1.00 0.00 ? 55 ILE A HD11 1  
ATOM 864   H HD12 . ILE A 1 55 ? 0.537   -5.646  -1.591  1.00 0.00 ? 55 ILE A HD12 1  
ATOM 865   H HD13 . ILE A 1 55 ? -0.895  -6.546  -1.092  1.00 0.00 ? 55 ILE A HD13 1  
ATOM 866   N N    . TRP A 1 56 ? -4.493  -4.242  1.370   1.00 0.00 ? 56 TRP A N    1  
ATOM 867   C CA   . TRP A 1 56 ? -5.856  -3.740  1.274   1.00 0.00 ? 56 TRP A CA   1  
ATOM 868   C C    . TRP A 1 56 ? -6.232  -2.962  2.536   1.00 0.00 ? 56 TRP A C    1  
ATOM 869   O O    . TRP A 1 56 ? -6.526  -1.768  2.474   1.00 0.00 ? 56 TRP A O    1  
ATOM 870   C CB   . TRP A 1 56 ? -6.821  -4.908  1.045   1.00 0.00 ? 56 TRP A CB   1  
ATOM 871   C CG   . TRP A 1 56 ? -8.264  -4.570  1.271   1.00 0.00 ? 56 TRP A CG   1  
ATOM 872   C CD1  . TRP A 1 56 ? -8.946  -3.492  0.785   1.00 0.00 ? 56 TRP A CD1  1  
ATOM 873   C CD2  . TRP A 1 56 ? -9.198  -5.319  2.052   1.00 0.00 ? 56 TRP A CD2  1  
ATOM 874   N NE1  . TRP A 1 56 ? -10.251 -3.530  1.215   1.00 0.00 ? 56 TRP A NE1  1  
ATOM 875   C CE2  . TRP A 1 56 ? -10.428 -4.640  1.991   1.00 0.00 ? 56 TRP A CE2  1  
ATOM 876   C CE3  . TRP A 1 56 ? -9.115  -6.498  2.792   1.00 0.00 ? 56 TRP A CE3  1  
ATOM 877   C CZ2  . TRP A 1 56 ? -11.564 -5.097  2.643   1.00 0.00 ? 56 TRP A CZ2  1  
ATOM 878   C CZ3  . TRP A 1 56 ? -10.245 -6.956  3.443   1.00 0.00 ? 56 TRP A CZ3  1  
ATOM 879   C CH2  . TRP A 1 56 ? -11.458 -6.255  3.365   1.00 0.00 ? 56 TRP A CH2  1  
ATOM 880   H H    . TRP A 1 56 ? -4.336  -5.207  1.297   1.00 0.00 ? 56 TRP A H    1  
ATOM 881   H HA   . TRP A 1 56 ? -5.905  -3.072  0.427   1.00 0.00 ? 56 TRP A HA   1  
ATOM 882   H HB2  . TRP A 1 56 ? -6.720  -5.252  0.026   1.00 0.00 ? 56 TRP A HB2  1  
ATOM 883   H HB3  . TRP A 1 56 ? -6.562  -5.713  1.715   1.00 0.00 ? 56 TRP A HB3  1  
ATOM 884   H HD1  . TRP A 1 56 ? -8.511  -2.731  0.154   1.00 0.00 ? 56 TRP A HD1  1  
ATOM 885   H HE1  . TRP A 1 56 ? -10.943 -2.871  1.001   1.00 0.00 ? 56 TRP A HE1  1  
ATOM 886   H HE3  . TRP A 1 56 ? -8.187  -7.048  2.863   1.00 0.00 ? 56 TRP A HE3  1  
ATOM 887   H HZ2  . TRP A 1 56 ? -12.502 -4.565  2.589   1.00 0.00 ? 56 TRP A HZ2  1  
ATOM 888   H HZ3  . TRP A 1 56 ? -10.201 -7.866  4.022   1.00 0.00 ? 56 TRP A HZ3  1  
ATOM 889   H HH2  . TRP A 1 56 ? -12.317 -6.649  3.888   1.00 0.00 ? 56 TRP A HH2  1  
ATOM 890   N N    . ARG A 1 57 ? -6.220  -3.645  3.677   1.00 0.00 ? 57 ARG A N    1  
ATOM 891   C CA   . ARG A 1 57 ? -6.560  -3.009  4.945   1.00 0.00 ? 57 ARG A CA   1  
ATOM 892   C C    . ARG A 1 57 ? -5.744  -1.737  5.146   1.00 0.00 ? 57 ARG A C    1  
ATOM 893   O O    . ARG A 1 57 ? -6.211  -0.777  5.760   1.00 0.00 ? 57 ARG A O    1  
ATOM 894   C CB   . ARG A 1 57 ? -6.334  -3.974  6.112   1.00 0.00 ? 57 ARG A CB   1  
ATOM 895   C CG   . ARG A 1 57 ? -4.873  -4.320  6.351   1.00 0.00 ? 57 ARG A CG   1  
ATOM 896   C CD   . ARG A 1 57 ? -4.594  -4.566  7.825   1.00 0.00 ? 57 ARG A CD   1  
ATOM 897   N NE   . ARG A 1 57 ? -4.660  -3.335  8.608   1.00 0.00 ? 57 ARG A NE   1  
ATOM 898   C CZ   . ARG A 1 57 ? -3.661  -2.462  8.694   1.00 0.00 ? 57 ARG A CZ   1  
ATOM 899   N NH1  . ARG A 1 57 ? -2.524  -2.685  8.048   1.00 0.00 ? 57 ARG A NH1  1  
ATOM 900   N NH2  . ARG A 1 57 ? -3.797  -1.366  9.427   1.00 0.00 ? 57 ARG A NH2  1  
ATOM 901   H H    . ARG A 1 57 ? -5.979  -4.594  3.666   1.00 0.00 ? 57 ARG A H    1  
ATOM 902   H HA   . ARG A 1 57 ? -7.606  -2.744  4.909   1.00 0.00 ? 57 ARG A HA   1  
ATOM 903   H HB2  . ARG A 1 57 ? -6.726  -3.527  7.014   1.00 0.00 ? 57 ARG A HB2  1  
ATOM 904   H HB3  . ARG A 1 57 ? -6.869  -4.891  5.914   1.00 0.00 ? 57 ARG A HB3  1  
ATOM 905   H HG2  . ARG A 1 57 ? -4.630  -5.213  5.795   1.00 0.00 ? 57 ARG A HG2  1  
ATOM 906   H HG3  . ARG A 1 57 ? -4.258  -3.502  6.010   1.00 0.00 ? 57 ARG A HG3  1  
ATOM 907   H HD2  . ARG A 1 57 ? -5.328  -5.262  8.205   1.00 0.00 ? 57 ARG A HD2  1  
ATOM 908   H HD3  . ARG A 1 57 ? -3.607  -4.993  7.926   1.00 0.00 ? 57 ARG A HD3  1  
ATOM 909   H HE   . ARG A 1 57 ? -5.491  -3.149  9.094   1.00 0.00 ? 57 ARG A HE   1  
ATOM 910   H HH11 . ARG A 1 57 ? -2.419  -3.511  7.494   1.00 0.00 ? 57 ARG A HH11 1  
ATOM 911   H HH12 . ARG A 1 57 ? -1.774  -2.028  8.114   1.00 0.00 ? 57 ARG A HH12 1  
ATOM 912   H HH21 . ARG A 1 57 ? -4.653  -1.194  9.915   1.00 0.00 ? 57 ARG A HH21 1  
ATOM 913   H HH22 . ARG A 1 57 ? -3.044  -0.710  9.491   1.00 0.00 ? 57 ARG A HH22 1  
ATOM 914   N N    . GLY A 1 58 ? -4.527  -1.727  4.608   1.00 0.00 ? 58 GLY A N    1  
ATOM 915   C CA   . GLY A 1 58 ? -3.681  -0.555  4.713   1.00 0.00 ? 58 GLY A CA   1  
ATOM 916   C C    . GLY A 1 58 ? -4.137  0.550   3.784   1.00 0.00 ? 58 GLY A C    1  
ATOM 917   O O    . GLY A 1 58 ? -4.078  1.729   4.131   1.00 0.00 ? 58 GLY A O    1  
ATOM 918   H H    . GLY A 1 58 ? -4.212  -2.514  4.117   1.00 0.00 ? 58 GLY A H    1  
ATOM 919   H HA2  . GLY A 1 58 ? -3.709  -0.192  5.731   1.00 0.00 ? 58 GLY A HA2  1  
ATOM 920   H HA3  . GLY A 1 58 ? -2.667  -0.828  4.464   1.00 0.00 ? 58 GLY A HA3  1  
ATOM 921   N N    . LEU A 1 59 ? -4.610  0.161   2.603   1.00 0.00 ? 59 LEU A N    1  
ATOM 922   C CA   . LEU A 1 59 ? -5.109  1.117   1.627   1.00 0.00 ? 59 LEU A CA   1  
ATOM 923   C C    . LEU A 1 59 ? -6.387  1.772   2.136   1.00 0.00 ? 59 LEU A C    1  
ATOM 924   O O    . LEU A 1 59 ? -6.573  2.981   2.006   1.00 0.00 ? 59 LEU A O    1  
ATOM 925   C CB   . LEU A 1 59 ? -5.374  0.421   0.291   1.00 0.00 ? 59 LEU A CB   1  
ATOM 926   C CG   . LEU A 1 59 ? -4.771  1.116   -0.929  1.00 0.00 ? 59 LEU A CG   1  
ATOM 927   C CD1  . LEU A 1 59 ? -3.268  1.274   -0.765  1.00 0.00 ? 59 LEU A CD1  1  
ATOM 928   C CD2  . LEU A 1 59 ? -5.093  0.341   -2.197  1.00 0.00 ? 59 LEU A CD2  1  
ATOM 929   H H    . LEU A 1 59 ? -4.643  -0.796  2.394   1.00 0.00 ? 59 LEU A H    1  
ATOM 930   H HA   . LEU A 1 59 ? -4.357  1.880   1.490   1.00 0.00 ? 59 LEU A HA   1  
ATOM 931   H HB2  . LEU A 1 59 ? -4.970  -0.579  0.344   1.00 0.00 ? 59 LEU A HB2  1  
ATOM 932   H HB3  . LEU A 1 59 ? -6.442  0.352   0.150   1.00 0.00 ? 59 LEU A HB3  1  
ATOM 933   H HG   . LEU A 1 59 ? -5.202  2.102   -1.020  1.00 0.00 ? 59 LEU A HG   1  
ATOM 934   H HD11 . LEU A 1 59 ? -3.039  2.296   -0.502  1.00 0.00 ? 59 LEU A HD11 1  
ATOM 935   H HD12 . LEU A 1 59 ? -2.776  1.023   -1.693  1.00 0.00 ? 59 LEU A HD12 1  
ATOM 936   H HD13 . LEU A 1 59 ? -2.921  0.614   0.017   1.00 0.00 ? 59 LEU A HD13 1  
ATOM 937   H HD21 . LEU A 1 59 ? -5.368  -0.671  -1.941  1.00 0.00 ? 59 LEU A HD21 1  
ATOM 938   H HD22 . LEU A 1 59 ? -4.225  0.327   -2.840  1.00 0.00 ? 59 LEU A HD22 1  
ATOM 939   H HD23 . LEU A 1 59 ? -5.915  0.818   -2.712  1.00 0.00 ? 59 LEU A HD23 1  
ATOM 940   N N    . GLN A 1 60 ? -7.258  0.963   2.729   1.00 0.00 ? 60 GLN A N    1  
ATOM 941   C CA   . GLN A 1 60 ? -8.506  1.464   3.288   1.00 0.00 ? 60 GLN A CA   1  
ATOM 942   C C    . GLN A 1 60 ? -8.222  2.479   4.388   1.00 0.00 ? 60 GLN A C    1  
ATOM 943   O O    . GLN A 1 60 ? -9.022  3.380   4.639   1.00 0.00 ? 60 GLN A O    1  
ATOM 944   C CB   . GLN A 1 60 ? -9.338  0.308   3.843   1.00 0.00 ? 60 GLN A CB   1  
ATOM 945   C CG   . GLN A 1 60 ? -9.921  -0.592  2.766   1.00 0.00 ? 60 GLN A CG   1  
ATOM 946   C CD   . GLN A 1 60 ? -10.925 -1.580  3.321   1.00 0.00 ? 60 GLN A CD   1  
ATOM 947   O OE1  . GLN A 1 60 ? -12.135 -1.378  3.218   1.00 0.00 ? 60 GLN A OE1  1  
ATOM 948   N NE2  . GLN A 1 60 ? -10.425 -2.651  3.925   1.00 0.00 ? 60 GLN A NE2  1  
ATOM 949   H H    . GLN A 1 60 ? -7.045  0.009   2.815   1.00 0.00 ? 60 GLN A H    1  
ATOM 950   H HA   . GLN A 1 60 ? -9.055  1.950   2.496   1.00 0.00 ? 60 GLN A HA   1  
ATOM 951   H HB2  . GLN A 1 60 ? -8.712  -0.295  4.485   1.00 0.00 ? 60 GLN A HB2  1  
ATOM 952   H HB3  . GLN A 1 60 ? -10.153 0.711   4.425   1.00 0.00 ? 60 GLN A HB3  1  
ATOM 953   H HG2  . GLN A 1 60 ? -10.412 0.024   2.028   1.00 0.00 ? 60 GLN A HG2  1  
ATOM 954   H HG3  . GLN A 1 60 ? -9.116  -1.141  2.300   1.00 0.00 ? 60 GLN A HG3  1  
ATOM 955   H HE21 . GLN A 1 60 ? -9.450  -2.744  3.970   1.00 0.00 ? 60 GLN A HE21 1  
ATOM 956   H HE22 . GLN A 1 60 ? -11.050 -3.307  4.297   1.00 0.00 ? 60 GLN A HE22 1  
ATOM 957   N N    . ASP A 1 61 ? -7.068  2.330   5.034   1.00 0.00 ? 61 ASP A N    1  
ATOM 958   C CA   . ASP A 1 61 ? -6.663  3.245   6.091   1.00 0.00 ? 61 ASP A CA   1  
ATOM 959   C C    . ASP A 1 61 ? -6.618  4.675   5.564   1.00 0.00 ? 61 ASP A C    1  
ATOM 960   O O    . ASP A 1 61 ? -7.032  5.613   6.246   1.00 0.00 ? 61 ASP A O    1  
ATOM 961   C CB   . ASP A 1 61 ? -5.290  2.847   6.639   1.00 0.00 ? 61 ASP A CB   1  
ATOM 962   C CG   . ASP A 1 61 ? -5.135  3.181   8.110   1.00 0.00 ? 61 ASP A CG   1  
ATOM 963   O OD1  . ASP A 1 61 ? -5.842  4.093   8.589   1.00 0.00 ? 61 ASP A OD1  1  
ATOM 964   O OD2  . ASP A 1 61 ? -4.307  2.532   8.781   1.00 0.00 ? 61 ASP A OD2  1  
ATOM 965   H H    . ASP A 1 61 ? -6.470  1.598   4.780   1.00 0.00 ? 61 ASP A H    1  
ATOM 966   H HA   . ASP A 1 61 ? -7.393  3.187   6.884   1.00 0.00 ? 61 ASP A HA   1  
ATOM 967   H HB2  . ASP A 1 61 ? -5.156  1.782   6.514   1.00 0.00 ? 61 ASP A HB2  1  
ATOM 968   H HB3  . ASP A 1 61 ? -4.524  3.370   6.087   1.00 0.00 ? 61 ASP A HB3  1  
ATOM 969   N N    . LEU A 1 62 ? -6.122  4.830   4.340   1.00 0.00 ? 62 LEU A N    1  
ATOM 970   C CA   . LEU A 1 62 ? -6.045  6.141   3.709   1.00 0.00 ? 62 LEU A CA   1  
ATOM 971   C C    . LEU A 1 62 ? -7.430  6.761   3.599   1.00 0.00 ? 62 LEU A C    1  
ATOM 972   O O    . LEU A 1 62 ? -7.654  7.895   4.025   1.00 0.00 ? 62 LEU A O    1  
ATOM 973   C CB   . LEU A 1 62 ? -5.417  6.025   2.319   1.00 0.00 ? 62 LEU A CB   1  
ATOM 974   C CG   . LEU A 1 62 ? -4.046  5.347   2.280   1.00 0.00 ? 62 LEU A CG   1  
ATOM 975   C CD1  . LEU A 1 62 ? -3.886  4.536   1.003   1.00 0.00 ? 62 LEU A CD1  1  
ATOM 976   C CD2  . LEU A 1 62 ? -2.941  6.384   2.398   1.00 0.00 ? 62 LEU A CD2  1  
ATOM 977   H H    . LEU A 1 62 ? -5.817  4.041   3.844   1.00 0.00 ? 62 LEU A H    1  
ATOM 978   H HA   . LEU A 1 62 ? -5.425  6.773   4.328   1.00 0.00 ? 62 LEU A HA   1  
ATOM 979   H HB2  . LEU A 1 62 ? -6.091  5.462   1.689   1.00 0.00 ? 62 LEU A HB2  1  
ATOM 980   H HB3  . LEU A 1 62 ? -5.315  7.019   1.909   1.00 0.00 ? 62 LEU A HB3  1  
ATOM 981   H HG   . LEU A 1 62 ? -3.961  4.672   3.119   1.00 0.00 ? 62 LEU A HG   1  
ATOM 982   H HD11 . LEU A 1 62 ? -3.910  5.197   0.150   1.00 0.00 ? 62 LEU A HD11 1  
ATOM 983   H HD12 . LEU A 1 62 ? -4.691  3.820   0.928   1.00 0.00 ? 62 LEU A HD12 1  
ATOM 984   H HD13 . LEU A 1 62 ? -2.941  4.013   1.026   1.00 0.00 ? 62 LEU A HD13 1  
ATOM 985   H HD21 . LEU A 1 62 ? -2.886  6.957   1.484   1.00 0.00 ? 62 LEU A HD21 1  
ATOM 986   H HD22 . LEU A 1 62 ? -1.997  5.887   2.568   1.00 0.00 ? 62 LEU A HD22 1  
ATOM 987   H HD23 . LEU A 1 62 ? -3.154  7.045   3.224   1.00 0.00 ? 62 LEU A HD23 1  
ATOM 988   N N    . LYS A 1 63 ? -8.361  6.003   3.031   1.00 0.00 ? 63 LYS A N    1  
ATOM 989   C CA   . LYS A 1 63 ? -9.734  6.464   2.871   1.00 0.00 ? 63 LYS A CA   1  
ATOM 990   C C    . LYS A 1 63 ? -10.363 6.767   4.226   1.00 0.00 ? 63 LYS A C    1  
ATOM 991   O O    . LYS A 1 63 ? -11.121 7.726   4.369   1.00 0.00 ? 63 LYS A O    1  
ATOM 992   C CB   . LYS A 1 63 ? -10.561 5.410   2.130   1.00 0.00 ? 63 LYS A CB   1  
ATOM 993   C CG   . LYS A 1 63 ? -11.261 5.946   0.891   1.00 0.00 ? 63 LYS A CG   1  
ATOM 994   C CD   . LYS A 1 63 ? -12.118 7.159   1.215   1.00 0.00 ? 63 LYS A CD   1  
ATOM 995   C CE   . LYS A 1 63 ? -11.549 8.424   0.594   1.00 0.00 ? 63 LYS A CE   1  
ATOM 996   N NZ   . LYS A 1 63 ? -11.967 8.584   -0.825  1.00 0.00 ? 63 LYS A NZ   1  
ATOM 997   H H    . LYS A 1 63 ? -8.119  5.106   2.717   1.00 0.00 ? 63 LYS A H    1  
ATOM 998   H HA   . LYS A 1 63 ? -9.712  7.372   2.285   1.00 0.00 ? 63 LYS A HA   1  
ATOM 999   H HB2  . LYS A 1 63 ? -9.906  4.606   1.826   1.00 0.00 ? 63 LYS A HB2  1  
ATOM 1000  H HB3  . LYS A 1 63 ? -11.310 5.018   2.801   1.00 0.00 ? 63 LYS A HB3  1  
ATOM 1001  H HG2  . LYS A 1 63 ? -10.516 6.228   0.162   1.00 0.00 ? 63 LYS A HG2  1  
ATOM 1002  H HG3  . LYS A 1 63 ? -11.892 5.170   0.483   1.00 0.00 ? 63 LYS A HG3  1  
ATOM 1003  H HD2  . LYS A 1 63 ? -13.114 6.997   0.828   1.00 0.00 ? 63 LYS A HD2  1  
ATOM 1004  H HD3  . LYS A 1 63 ? -12.161 7.281   2.286   1.00 0.00 ? 63 LYS A HD3  1  
ATOM 1005  H HE2  . LYS A 1 63 ? -11.895 9.275   1.161   1.00 0.00 ? 63 LYS A HE2  1  
ATOM 1006  H HE3  . LYS A 1 63 ? -10.471 8.378   0.639   1.00 0.00 ? 63 LYS A HE3  1  
ATOM 1007  H HZ1  . LYS A 1 63 ? -13.004 8.624   -0.890  1.00 0.00 ? 63 LYS A HZ1  1  
ATOM 1008  H HZ2  . LYS A 1 63 ? -11.626 7.782   -1.393  1.00 0.00 ? 63 LYS A HZ2  1  
ATOM 1009  H HZ3  . LYS A 1 63 ? -11.573 9.463   -1.217  1.00 0.00 ? 63 LYS A HZ3  1  
ATOM 1010  N N    . GLN A 1 64 ? -10.036 5.947   5.221   1.00 0.00 ? 64 GLN A N    1  
ATOM 1011  C CA   . GLN A 1 64 ? -10.561 6.134   6.568   1.00 0.00 ? 64 GLN A CA   1  
ATOM 1012  C C    . GLN A 1 64 ? -10.134 7.485   7.131   1.00 0.00 ? 64 GLN A C    1  
ATOM 1013  O O    . GLN A 1 64 ? -10.902 8.447   7.114   1.00 0.00 ? 64 GLN A O    1  
ATOM 1014  C CB   . GLN A 1 64 ? -10.077 5.011   7.488   1.00 0.00 ? 64 GLN A CB   1  
ATOM 1015  C CG   . GLN A 1 64 ? -10.828 3.704   7.300   1.00 0.00 ? 64 GLN A CG   1  
ATOM 1016  C CD   . GLN A 1 64 ? -11.423 3.179   8.593   1.00 0.00 ? 64 GLN A CD   1  
ATOM 1017  O OE1  . GLN A 1 64 ? -12.112 3.904   9.311   1.00 0.00 ? 64 GLN A OE1  1  
ATOM 1018  N NE2  . GLN A 1 64 ? -11.158 1.913   8.896   1.00 0.00 ? 64 GLN A NE2  1  
ATOM 1019  H H    . GLN A 1 64 ? -9.423  5.204   5.046   1.00 0.00 ? 64 GLN A H    1  
ATOM 1020  H HA   . GLN A 1 64 ? -11.639 6.104   6.512   1.00 0.00 ? 64 GLN A HA   1  
ATOM 1021  H HB2  . GLN A 1 64 ? -9.029  4.829   7.294   1.00 0.00 ? 64 GLN A HB2  1  
ATOM 1022  H HB3  . GLN A 1 64 ? -10.194 5.324   8.514   1.00 0.00 ? 64 GLN A HB3  1  
ATOM 1023  H HG2  . GLN A 1 64 ? -11.629 3.861   6.592   1.00 0.00 ? 64 GLN A HG2  1  
ATOM 1024  H HG3  . GLN A 1 64 ? -10.145 2.963   6.910   1.00 0.00 ? 64 GLN A HG3  1  
ATOM 1025  H HE21 . GLN A 1 64 ? -10.602 1.396   8.277   1.00 0.00 ? 64 GLN A HE21 1  
ATOM 1026  H HE22 . GLN A 1 64 ? -11.531 1.549   9.726   1.00 0.00 ? 64 GLN A HE22 1  
ATOM 1027  N N    . GLY A 1 65 ? -8.900  7.554   7.623   1.00 0.00 ? 65 GLY A N    1  
ATOM 1028  C CA   . GLY A 1 65 ? -8.389  8.794   8.174   1.00 0.00 ? 65 GLY A CA   1  
ATOM 1029  C C    . GLY A 1 65 ? -8.201  8.732   9.677   1.00 0.00 ? 65 GLY A C    1  
ATOM 1030  O O    . GLY A 1 65 ? -9.028  8.164   10.391  1.00 0.00 ? 65 GLY A O    1  
ATOM 1031  H H    . GLY A 1 65 ? -8.332  6.756   7.606   1.00 0.00 ? 65 GLY A H    1  
ATOM 1032  H HA2  . GLY A 1 65 ? -7.437  9.013   7.713   1.00 0.00 ? 65 GLY A HA2  1  
ATOM 1033  H HA3  . GLY A 1 65 ? -9.081  9.590   7.942   1.00 0.00 ? 65 GLY A HA3  1  
ATOM 1034  N N    . HIS A 1 66 ? -7.110  9.320   10.158  1.00 0.00 ? 66 HIS A N    1  
ATOM 1035  C CA   . HIS A 1 66 ? -6.814  9.334   11.585  1.00 0.00 ? 66 HIS A CA   1  
ATOM 1036  C C    . HIS A 1 66 ? -6.720  10.765  12.103  1.00 0.00 ? 66 HIS A C    1  
ATOM 1037  O O    . HIS A 1 66 ? -5.718  11.448  11.890  1.00 0.00 ? 66 HIS A O    1  
ATOM 1038  C CB   . HIS A 1 66 ? -5.506  8.592   11.863  1.00 0.00 ? 66 HIS A CB   1  
ATOM 1039  C CG   . HIS A 1 66 ? -4.453  8.828   10.825  1.00 0.00 ? 66 HIS A CG   1  
ATOM 1040  N ND1  . HIS A 1 66 ? -4.548  8.350   9.534   1.00 0.00 ? 66 HIS A ND1  1  
ATOM 1041  C CD2  . HIS A 1 66 ? -3.278  9.498   10.892  1.00 0.00 ? 66 HIS A CD2  1  
ATOM 1042  C CE1  . HIS A 1 66 ? -3.476  8.715   8.853   1.00 0.00 ? 66 HIS A CE1  1  
ATOM 1043  N NE2  . HIS A 1 66 ? -2.692  9.412   9.653   1.00 0.00 ? 66 HIS A NE2  1  
ATOM 1044  H H    . HIS A 1 66 ? -6.490  9.756   9.537   1.00 0.00 ? 66 HIS A H    1  
ATOM 1045  H HA   . HIS A 1 66 ? -7.621  8.830   12.096  1.00 0.00 ? 66 HIS A HA   1  
ATOM 1046  H HB2  . HIS A 1 66 ? -5.112  8.916   12.815  1.00 0.00 ? 66 HIS A HB2  1  
ATOM 1047  H HB3  . HIS A 1 66 ? -5.703  7.530   11.902  1.00 0.00 ? 66 HIS A HB3  1  
ATOM 1048  H HD1  . HIS A 1 66 ? -5.289  7.822   9.173   1.00 0.00 ? 66 HIS A HD1  1  
ATOM 1049  H HD2  . HIS A 1 66 ? -2.877  10.005  11.758  1.00 0.00 ? 66 HIS A HD2  1  
ATOM 1050  H HE1  . HIS A 1 66 ? -3.277  8.483   7.817   1.00 0.00 ? 66 HIS A HE1  1  
ATOM 1051  H HE2  . HIS A 1 66 ? -1.829  9.804   9.401   1.00 0.00 ? 66 HIS A HE2  1  
ATOM 1052  N N    . ASP A 1 67 ? -7.772  11.214  12.779  1.00 0.00 ? 67 ASP A N    1  
ATOM 1053  C CA   . ASP A 1 67 ? -7.807  12.563  13.328  1.00 0.00 ? 67 ASP A CA   1  
ATOM 1054  C C    . ASP A 1 67 ? -8.688  12.621  14.568  1.00 0.00 ? 67 ASP A C    1  
ATOM 1055  O O    . ASP A 1 67 ? -9.879  12.313  14.516  1.00 0.00 ? 67 ASP A O    1  
ATOM 1056  C CB   . ASP A 1 67 ? -8.312  13.563  12.284  1.00 0.00 ? 67 ASP A CB   1  
ATOM 1057  C CG   . ASP A 1 67 ? -9.363  12.971  11.362  1.00 0.00 ? 67 ASP A CG   1  
ATOM 1058  O OD1  . ASP A 1 67 ? -10.515 12.795  11.812  1.00 0.00 ? 67 ASP A OD1  1  
ATOM 1059  O OD2  . ASP A 1 67 ? -9.033  12.685  10.192  1.00 0.00 ? 67 ASP A OD2  1  
ATOM 1060  H H    . ASP A 1 67 ? -8.539  10.623  12.919  1.00 0.00 ? 67 ASP A H    1  
ATOM 1061  H HA   . ASP A 1 67 ? -6.799  12.831  13.608  1.00 0.00 ? 67 ASP A HA   1  
ATOM 1062  H HB2  . ASP A 1 67 ? -8.744  14.413  12.789  1.00 0.00 ? 67 ASP A HB2  1  
ATOM 1063  H HB3  . ASP A 1 67 ? -7.479  13.893  11.683  1.00 0.00 ? 67 ASP A HB3  1  
ATOM 1064  N N    . TYR A 1 68 ? -8.090  13.015  15.683  1.00 0.00 ? 68 TYR A N    1  
ATOM 1065  C CA   . TYR A 1 68 ? -8.809  13.115  16.946  1.00 0.00 ? 68 TYR A CA   1  
ATOM 1066  C C    . TYR A 1 68 ? -9.544  11.816  17.259  1.00 0.00 ? 68 TYR A C    1  
ATOM 1067  O O    . TYR A 1 68 ? -10.372 11.816  18.194  1.00 0.00 ? 68 TYR A O    1  
ATOM 1068  C CB   . TYR A 1 68 ? -9.801  14.279  16.901  1.00 0.00 ? 68 TYR A CB   1  
ATOM 1069  C CG   . TYR A 1 68 ? -9.173  15.625  17.186  1.00 0.00 ? 68 TYR A CG   1  
ATOM 1070  C CD1  . TYR A 1 68 ? -8.622  16.386  16.163  1.00 0.00 ? 68 TYR A CD1  1  
ATOM 1071  C CD2  . TYR A 1 68 ? -9.134  16.135  18.477  1.00 0.00 ? 68 TYR A CD2  1  
ATOM 1072  C CE1  . TYR A 1 68 ? -8.048  17.617  16.419  1.00 0.00 ? 68 TYR A CE1  1  
ATOM 1073  C CE2  . TYR A 1 68 ? -8.562  17.365  18.741  1.00 0.00 ? 68 TYR A CE2  1  
ATOM 1074  C CZ   . TYR A 1 68 ? -8.021  18.103  17.709  1.00 0.00 ? 68 TYR A CZ   1  
ATOM 1075  O OH   . TYR A 1 68 ? -7.450  19.327  17.968  1.00 0.00 ? 68 TYR A OH   1  
ATOM 1076  O OXT  . TYR A 1 68 ? -9.287  10.811  16.565  1.00 0.00 ? 68 TYR A OXT  1  
ATOM 1077  H H    . TYR A 1 68 ? -7.139  13.245  15.653  1.00 0.00 ? 68 TYR A H    1  
ATOM 1078  H HA   . TYR A 1 68 ? -8.084  13.300  17.725  1.00 0.00 ? 68 TYR A HA   1  
ATOM 1079  H HB2  . TYR A 1 68 ? -10.249 14.323  15.919  1.00 0.00 ? 68 TYR A HB2  1  
ATOM 1080  H HB3  . TYR A 1 68 ? -10.573 14.111  17.637  1.00 0.00 ? 68 TYR A HB3  1  
ATOM 1081  H HD1  . TYR A 1 68 ? -8.645  16.004  15.153  1.00 0.00 ? 68 TYR A HD1  1  
ATOM 1082  H HD2  . TYR A 1 68 ? -9.558  15.556  19.283  1.00 0.00 ? 68 TYR A HD2  1  
ATOM 1083  H HE1  . TYR A 1 68 ? -7.624  18.193  15.610  1.00 0.00 ? 68 TYR A HE1  1  
ATOM 1084  H HE2  . TYR A 1 68 ? -8.541  17.744  19.753  1.00 0.00 ? 68 TYR A HE2  1  
ATOM 1085  H HH   . TYR A 1 68 ? -7.917  19.752  18.691  1.00 0.00 ? 68 TYR A HH   1  
ATOM 1086  N N    . TYR A 1 1  ? 11.367  13.515  -11.457 1.00 0.00 ? 1  TYR A N    2  
ATOM 1087  C CA   . TYR A 1 1  ? 11.683  14.824  -10.831 1.00 0.00 ? 1  TYR A CA   2  
ATOM 1088  C C    . TYR A 1 1  ? 10.901  15.023  -9.539  1.00 0.00 ? 1  TYR A C    2  
ATOM 1089  O O    . TYR A 1 1  ? 11.479  15.096  -8.455  1.00 0.00 ? 1  TYR A O    2  
ATOM 1090  C CB   . TYR A 1 1  ? 11.342  15.936  -11.827 1.00 0.00 ? 1  TYR A CB   2  
ATOM 1091  C CG   . TYR A 1 1  ? 12.522  16.809  -12.189 1.00 0.00 ? 1  TYR A CG   2  
ATOM 1092  C CD1  . TYR A 1 1  ? 13.702  16.252  -12.665 1.00 0.00 ? 1  TYR A CD1  2  
ATOM 1093  C CD2  . TYR A 1 1  ? 12.457  18.190  -12.052 1.00 0.00 ? 1  TYR A CD2  2  
ATOM 1094  C CE1  . TYR A 1 1  ? 14.784  17.048  -12.996 1.00 0.00 ? 1  TYR A CE1  2  
ATOM 1095  C CE2  . TYR A 1 1  ? 13.534  18.991  -12.380 1.00 0.00 ? 1  TYR A CE2  2  
ATOM 1096  C CZ   . TYR A 1 1  ? 14.694  18.415  -12.853 1.00 0.00 ? 1  TYR A CZ   2  
ATOM 1097  O OH   . TYR A 1 1  ? 15.769  19.210  -13.180 1.00 0.00 ? 1  TYR A OH   2  
ATOM 1098  H H1   . TYR A 1 1  ? 10.422  13.588  -11.886 1.00 0.00 ? 1  TYR A H1   2  
ATOM 1099  H H2   . TYR A 1 1  ? 11.385  12.793  -10.709 1.00 0.00 ? 1  TYR A H2   2  
ATOM 1100  H H3   . TYR A 1 1  ? 12.093  13.324  -12.178 1.00 0.00 ? 1  TYR A H3   2  
ATOM 1101  H HA   . TYR A 1 1  ? 12.737  14.856  -10.611 1.00 0.00 ? 1  TYR A HA   2  
ATOM 1102  H HB2  . TYR A 1 1  ? 10.965  15.493  -12.735 1.00 0.00 ? 1  TYR A HB2  2  
ATOM 1103  H HB3  . TYR A 1 1  ? 10.580  16.571  -11.398 1.00 0.00 ? 1  TYR A HB3  2  
ATOM 1104  H HD1  . TYR A 1 1  ? 13.770  15.181  -12.778 1.00 0.00 ? 1  TYR A HD1  2  
ATOM 1105  H HD2  . TYR A 1 1  ? 11.546  18.639  -11.682 1.00 0.00 ? 1  TYR A HD2  2  
ATOM 1106  H HE1  . TYR A 1 1  ? 15.693  16.596  -13.366 1.00 0.00 ? 1  TYR A HE1  2  
ATOM 1107  H HE2  . TYR A 1 1  ? 13.463  20.063  -12.267 1.00 0.00 ? 1  TYR A HE2  2  
ATOM 1108  H HH   . TYR A 1 1  ? 16.453  19.113  -12.514 1.00 0.00 ? 1  TYR A HH   2  
ATOM 1109  N N    . HIS A 1 2  ? 9.585   15.114  -9.666  1.00 0.00 ? 2  HIS A N    2  
ATOM 1110  C CA   . HIS A 1 2  ? 8.717   15.312  -8.512  1.00 0.00 ? 2  HIS A CA   2  
ATOM 1111  C C    . HIS A 1 2  ? 8.268   13.976  -7.930  1.00 0.00 ? 2  HIS A C    2  
ATOM 1112  O O    . HIS A 1 2  ? 7.120   13.565  -8.103  1.00 0.00 ? 2  HIS A O    2  
ATOM 1113  C CB   . HIS A 1 2  ? 7.497   16.146  -8.907  1.00 0.00 ? 2  HIS A CB   2  
ATOM 1114  C CG   . HIS A 1 2  ? 7.850   17.468  -9.515  1.00 0.00 ? 2  HIS A CG   2  
ATOM 1115  N ND1  . HIS A 1 2  ? 8.922   18.226  -9.097  1.00 0.00 ? 2  HIS A ND1  2  
ATOM 1116  C CD2  . HIS A 1 2  ? 7.267   18.165  -10.520 1.00 0.00 ? 2  HIS A CD2  2  
ATOM 1117  C CE1  . HIS A 1 2  ? 8.984   19.333  -9.815  1.00 0.00 ? 2  HIS A CE1  2  
ATOM 1118  N NE2  . HIS A 1 2  ? 7.991   19.320  -10.685 1.00 0.00 ? 2  HIS A NE2  2  
ATOM 1119  H H    . HIS A 1 2  ? 9.188   15.051  -10.559 1.00 0.00 ? 2  HIS A H    2  
ATOM 1120  H HA   . HIS A 1 2  ? 9.281   15.845  -7.762  1.00 0.00 ? 2  HIS A HA   2  
ATOM 1121  H HB2  . HIS A 1 2  ? 6.910   15.595  -9.627  1.00 0.00 ? 2  HIS A HB2  2  
ATOM 1122  H HB3  . HIS A 1 2  ? 6.898   16.334  -8.028  1.00 0.00 ? 2  HIS A HB3  2  
ATOM 1123  H HD1  . HIS A 1 2  ? 9.545   17.989  -8.379  1.00 0.00 ? 2  HIS A HD1  2  
ATOM 1124  H HD2  . HIS A 1 2  ? 6.395   17.868  -11.085 1.00 0.00 ? 2  HIS A HD2  2  
ATOM 1125  H HE1  . HIS A 1 2  ? 9.721   20.116  -9.709  1.00 0.00 ? 2  HIS A HE1  2  
ATOM 1126  H HE2  . HIS A 1 2  ? 7.804   20.022  -11.341 1.00 0.00 ? 2  HIS A HE2  2  
ATOM 1127  N N    . ALA A 1 3  ? 9.180   13.303  -7.236  1.00 0.00 ? 3  ALA A N    2  
ATOM 1128  C CA   . ALA A 1 3  ? 8.880   12.014  -6.625  1.00 0.00 ? 3  ALA A CA   2  
ATOM 1129  C C    . ALA A 1 3  ? 7.669   12.112  -5.704  1.00 0.00 ? 3  ALA A C    2  
ATOM 1130  O O    . ALA A 1 3  ? 7.170   13.204  -5.432  1.00 0.00 ? 3  ALA A O    2  
ATOM 1131  C CB   . ALA A 1 3  ? 10.088  11.500  -5.857  1.00 0.00 ? 3  ALA A CB   2  
ATOM 1132  H H    . ALA A 1 3  ? 10.077  13.683  -7.132  1.00 0.00 ? 3  ALA A H    2  
ATOM 1133  H HA   . ALA A 1 3  ? 8.662   11.312  -7.417  1.00 0.00 ? 3  ALA A HA   2  
ATOM 1134  H HB1  . ALA A 1 3  ? 10.563  12.322  -5.343  1.00 0.00 ? 3  ALA A HB1  2  
ATOM 1135  H HB2  . ALA A 1 3  ? 10.789  11.052  -6.546  1.00 0.00 ? 3  ALA A HB2  2  
ATOM 1136  H HB3  . ALA A 1 3  ? 9.769   10.761  -5.137  1.00 0.00 ? 3  ALA A HB3  2  
ATOM 1137  N N    . ASP A 1 4  ? 7.202   10.964  -5.225  1.00 0.00 ? 4  ASP A N    2  
ATOM 1138  C CA   . ASP A 1 4  ? 6.051   10.920  -4.330  1.00 0.00 ? 4  ASP A CA   2  
ATOM 1139  C C    . ASP A 1 4  ? 6.307   9.967   -3.165  1.00 0.00 ? 4  ASP A C    2  
ATOM 1140  O O    . ASP A 1 4  ? 5.686   8.909   -3.069  1.00 0.00 ? 4  ASP A O    2  
ATOM 1141  C CB   . ASP A 1 4  ? 4.799   10.486  -5.097  1.00 0.00 ? 4  ASP A CB   2  
ATOM 1142  C CG   . ASP A 1 4  ? 3.829   11.631  -5.325  1.00 0.00 ? 4  ASP A CG   2  
ATOM 1143  O OD1  . ASP A 1 4  ? 4.076   12.735  -4.795  1.00 0.00 ? 4  ASP A OD1  2  
ATOM 1144  O OD2  . ASP A 1 4  ? 2.821   11.422  -6.033  1.00 0.00 ? 4  ASP A OD2  2  
ATOM 1145  H H    . ASP A 1 4  ? 7.643   10.126  -5.477  1.00 0.00 ? 4  ASP A H    2  
ATOM 1146  H HA   . ASP A 1 4  ? 5.901   11.915  -3.938  1.00 0.00 ? 4  ASP A HA   2  
ATOM 1147  H HB2  . ASP A 1 4  ? 5.092   10.092  -6.058  1.00 0.00 ? 4  ASP A HB2  2  
ATOM 1148  H HB3  . ASP A 1 4  ? 4.290   9.717   -4.536  1.00 0.00 ? 4  ASP A HB3  2  
ATOM 1149  N N    . PRO A 1 5  ? 7.234   10.331  -2.261  1.00 0.00 ? 5  PRO A N    2  
ATOM 1150  C CA   . PRO A 1 5  ? 7.569   9.504   -1.099  1.00 0.00 ? 5  PRO A CA   2  
ATOM 1151  C C    . PRO A 1 5  ? 6.333   9.090   -0.308  1.00 0.00 ? 5  PRO A C    2  
ATOM 1152  O O    . PRO A 1 5  ? 6.316   8.040   0.334   1.00 0.00 ? 5  PRO A O    2  
ATOM 1153  C CB   . PRO A 1 5  ? 8.459   10.417  -0.256  1.00 0.00 ? 5  PRO A CB   2  
ATOM 1154  C CG   . PRO A 1 5  ? 9.063   11.363  -1.235  1.00 0.00 ? 5  PRO A CG   2  
ATOM 1155  C CD   . PRO A 1 5  ? 8.022   11.577  -2.299  1.00 0.00 ? 5  PRO A CD   2  
ATOM 1156  H HA   . PRO A 1 5  ? 8.123   8.622   -1.386  1.00 0.00 ? 5  PRO A HA   2  
ATOM 1157  H HB2  . PRO A 1 5  ? 7.857   10.936  0.476   1.00 0.00 ? 5  PRO A HB2  2  
ATOM 1158  H HB3  . PRO A 1 5  ? 9.214   9.829   0.245   1.00 0.00 ? 5  PRO A HB3  2  
ATOM 1159  H HG2  . PRO A 1 5  ? 9.297   12.297  -0.747  1.00 0.00 ? 5  PRO A HG2  2  
ATOM 1160  H HG3  . PRO A 1 5  ? 9.954   10.929  -1.664  1.00 0.00 ? 5  PRO A HG3  2  
ATOM 1161  H HD2  . PRO A 1 5  ? 7.405   12.430  -2.057  1.00 0.00 ? 5  PRO A HD2  2  
ATOM 1162  H HD3  . PRO A 1 5  ? 8.490   11.708  -3.264  1.00 0.00 ? 5  PRO A HD3  2  
ATOM 1163  N N    . SER A 1 6  ? 5.300   9.926   -0.355  1.00 0.00 ? 6  SER A N    2  
ATOM 1164  C CA   . SER A 1 6  ? 4.059   9.648   0.357   1.00 0.00 ? 6  SER A CA   2  
ATOM 1165  C C    . SER A 1 6  ? 3.275   8.536   -0.331  1.00 0.00 ? 6  SER A C    2  
ATOM 1166  O O    . SER A 1 6  ? 2.153   8.747   -0.792  1.00 0.00 ? 6  SER A O    2  
ATOM 1167  C CB   . SER A 1 6  ? 3.203   10.912  0.444   1.00 0.00 ? 6  SER A CB   2  
ATOM 1168  O OG   . SER A 1 6  ? 2.496   10.966  1.671   1.00 0.00 ? 6  SER A OG   2  
ATOM 1169  H H    . SER A 1 6  ? 5.374   10.748  -0.884  1.00 0.00 ? 6  SER A H    2  
ATOM 1170  H HA   . SER A 1 6  ? 4.316   9.326   1.356   1.00 0.00 ? 6  SER A HA   2  
ATOM 1171  H HB2  . SER A 1 6  ? 3.840   11.782  0.373   1.00 0.00 ? 6  SER A HB2  2  
ATOM 1172  H HB3  . SER A 1 6  ? 2.491   10.920  -0.367  1.00 0.00 ? 6  SER A HB3  2  
ATOM 1173  H HG   . SER A 1 6  ? 3.054   11.358  2.347   1.00 0.00 ? 6  SER A HG   2  
ATOM 1174  N N    . LEU A 1 7  ? 3.874   7.352   -0.397  1.00 0.00 ? 7  LEU A N    2  
ATOM 1175  C CA   . LEU A 1 7  ? 3.232   6.205   -1.025  1.00 0.00 ? 7  LEU A CA   2  
ATOM 1176  C C    . LEU A 1 7  ? 4.128   4.974   -0.944  1.00 0.00 ? 7  LEU A C    2  
ATOM 1177  O O    . LEU A 1 7  ? 3.694   3.905   -0.516  1.00 0.00 ? 7  LEU A O    2  
ATOM 1178  C CB   . LEU A 1 7  ? 2.892   6.522   -2.487  1.00 0.00 ? 7  LEU A CB   2  
ATOM 1179  C CG   . LEU A 1 7  ? 2.515   5.320   -3.365  1.00 0.00 ? 7  LEU A CG   2  
ATOM 1180  C CD1  . LEU A 1 7  ? 3.757   4.556   -3.795  1.00 0.00 ? 7  LEU A CD1  2  
ATOM 1181  C CD2  . LEU A 1 7  ? 1.539   4.396   -2.650  1.00 0.00 ? 7  LEU A CD2  2  
ATOM 1182  H H    . LEU A 1 7  ? 4.767   7.247   -0.009  1.00 0.00 ? 7  LEU A H    2  
ATOM 1183  H HA   . LEU A 1 7  ? 2.318   6.004   -0.488  1.00 0.00 ? 7  LEU A HA   2  
ATOM 1184  H HB2  . LEU A 1 7  ? 2.066   7.217   -2.496  1.00 0.00 ? 7  LEU A HB2  2  
ATOM 1185  H HB3  . LEU A 1 7  ? 3.749   7.007   -2.932  1.00 0.00 ? 7  LEU A HB3  2  
ATOM 1186  H HG   . LEU A 1 7  ? 2.027   5.681   -4.258  1.00 0.00 ? 7  LEU A HG   2  
ATOM 1187  H HD11 . LEU A 1 7  ? 3.697   4.339   -4.849  1.00 0.00 ? 7  LEU A HD11 2  
ATOM 1188  H HD12 . LEU A 1 7  ? 3.822   3.633   -3.239  1.00 0.00 ? 7  LEU A HD12 2  
ATOM 1189  H HD13 . LEU A 1 7  ? 4.634   5.156   -3.601  1.00 0.00 ? 7  LEU A HD13 2  
ATOM 1190  H HD21 . LEU A 1 7  ? 1.878   3.375   -2.743  1.00 0.00 ? 7  LEU A HD21 2  
ATOM 1191  H HD22 . LEU A 1 7  ? 0.561   4.491   -3.097  1.00 0.00 ? 7  LEU A HD22 2  
ATOM 1192  H HD23 . LEU A 1 7  ? 1.482   4.660   -1.606  1.00 0.00 ? 7  LEU A HD23 2  
ATOM 1193  N N    . VAL A 1 8  ? 5.382   5.131   -1.358  1.00 0.00 ? 8  VAL A N    2  
ATOM 1194  C CA   . VAL A 1 8  ? 6.340   4.033   -1.324  1.00 0.00 ? 8  VAL A CA   2  
ATOM 1195  C C    . VAL A 1 8  ? 6.644   3.625   0.114   1.00 0.00 ? 8  VAL A C    2  
ATOM 1196  O O    . VAL A 1 8  ? 6.871   2.450   0.401   1.00 0.00 ? 8  VAL A O    2  
ATOM 1197  C CB   . VAL A 1 8  ? 7.655   4.408   -2.031  1.00 0.00 ? 8  VAL A CB   2  
ATOM 1198  C CG1  . VAL A 1 8  ? 8.292   5.621   -1.369  1.00 0.00 ? 8  VAL A CG1  2  
ATOM 1199  C CG2  . VAL A 1 8  ? 8.616   3.229   -2.039  1.00 0.00 ? 8  VAL A CG2  2  
ATOM 1200  H H    . VAL A 1 8  ? 5.671   6.008   -1.686  1.00 0.00 ? 8  VAL A H    2  
ATOM 1201  H HA   . VAL A 1 8  ? 5.904   3.192   -1.844  1.00 0.00 ? 8  VAL A HA   2  
ATOM 1202  H HB   . VAL A 1 8  ? 7.429   4.664   -3.056  1.00 0.00 ? 8  VAL A HB   2  
ATOM 1203  H HG11 . VAL A 1 8  ? 8.753   6.243   -2.123  1.00 0.00 ? 8  VAL A HG11 2  
ATOM 1204  H HG12 . VAL A 1 8  ? 9.042   5.294   -0.664  1.00 0.00 ? 8  VAL A HG12 2  
ATOM 1205  H HG13 . VAL A 1 8  ? 7.533   6.187   -0.850  1.00 0.00 ? 8  VAL A HG13 2  
ATOM 1206  H HG21 . VAL A 1 8  ? 9.087   3.153   -3.008  1.00 0.00 ? 8  VAL A HG21 2  
ATOM 1207  H HG22 . VAL A 1 8  ? 8.072   2.319   -1.831  1.00 0.00 ? 8  VAL A HG22 2  
ATOM 1208  H HG23 . VAL A 1 8  ? 9.372   3.376   -1.282  1.00 0.00 ? 8  VAL A HG23 2  
ATOM 1209  N N    . SER A 1 9  ? 6.639   4.603   1.013   1.00 0.00 ? 9  SER A N    2  
ATOM 1210  C CA   . SER A 1 9  ? 6.905   4.347   2.423   1.00 0.00 ? 9  SER A CA   2  
ATOM 1211  C C    . SER A 1 9  ? 5.747   3.587   3.061   1.00 0.00 ? 9  SER A C    2  
ATOM 1212  O O    . SER A 1 9  ? 5.937   2.838   4.021   1.00 0.00 ? 9  SER A O    2  
ATOM 1213  C CB   . SER A 1 9  ? 7.139   5.664   3.166   1.00 0.00 ? 9  SER A CB   2  
ATOM 1214  O OG   . SER A 1 9  ? 7.464   6.709   2.264   1.00 0.00 ? 9  SER A OG   2  
ATOM 1215  H H    . SER A 1 9  ? 6.445   5.519   0.721   1.00 0.00 ? 9  SER A H    2  
ATOM 1216  H HA   . SER A 1 9  ? 7.797   3.742   2.487   1.00 0.00 ? 9  SER A HA   2  
ATOM 1217  H HB2  . SER A 1 9  ? 6.244   5.936   3.704   1.00 0.00 ? 9  SER A HB2  2  
ATOM 1218  H HB3  . SER A 1 9  ? 7.955   5.541   3.863   1.00 0.00 ? 9  SER A HB3  2  
ATOM 1219  H HG   . SER A 1 9  ? 8.301   7.103   2.519   1.00 0.00 ? 9  SER A HG   2  
ATOM 1220  N N    . PHE A 1 10 ? 4.549   3.780   2.518   1.00 0.00 ? 10 PHE A N    2  
ATOM 1221  C CA   . PHE A 1 10 ? 3.361   3.108   3.028   1.00 0.00 ? 10 PHE A CA   2  
ATOM 1222  C C    . PHE A 1 10 ? 3.209   1.727   2.400   1.00 0.00 ? 10 PHE A C    2  
ATOM 1223  O O    . PHE A 1 10 ? 2.980   0.739   3.097   1.00 0.00 ? 10 PHE A O    2  
ATOM 1224  C CB   . PHE A 1 10 ? 2.115   3.951   2.749   1.00 0.00 ? 10 PHE A CB   2  
ATOM 1225  C CG   . PHE A 1 10 ? 1.727   4.844   3.892   1.00 0.00 ? 10 PHE A CG   2  
ATOM 1226  C CD1  . PHE A 1 10 ? 2.463   5.982   4.180   1.00 0.00 ? 10 PHE A CD1  2  
ATOM 1227  C CD2  . PHE A 1 10 ? 0.629   4.543   4.681   1.00 0.00 ? 10 PHE A CD2  2  
ATOM 1228  C CE1  . PHE A 1 10 ? 2.110   6.803   5.233   1.00 0.00 ? 10 PHE A CE1  2  
ATOM 1229  C CE2  . PHE A 1 10 ? 0.270   5.362   5.734   1.00 0.00 ? 10 PHE A CE2  2  
ATOM 1230  C CZ   . PHE A 1 10 ? 1.012   6.493   6.011   1.00 0.00 ? 10 PHE A CZ   2  
ATOM 1231  H H    . PHE A 1 10 ? 4.464   4.386   1.753   1.00 0.00 ? 10 PHE A H    2  
ATOM 1232  H HA   . PHE A 1 10 ? 3.477   2.994   4.096   1.00 0.00 ? 10 PHE A HA   2  
ATOM 1233  H HB2  . PHE A 1 10 ? 2.296   4.575   1.887   1.00 0.00 ? 10 PHE A HB2  2  
ATOM 1234  H HB3  . PHE A 1 10 ? 1.283   3.294   2.543   1.00 0.00 ? 10 PHE A HB3  2  
ATOM 1235  H HD1  . PHE A 1 10 ? 3.323   6.225   3.572   1.00 0.00 ? 10 PHE A HD1  2  
ATOM 1236  H HD2  . PHE A 1 10 ? 0.048   3.659   4.465   1.00 0.00 ? 10 PHE A HD2  2  
ATOM 1237  H HE1  . PHE A 1 10 ? 2.692   7.689   5.447   1.00 0.00 ? 10 PHE A HE1  2  
ATOM 1238  H HE2  . PHE A 1 10 ? -0.589  5.117   6.341   1.00 0.00 ? 10 PHE A HE2  2  
ATOM 1239  H HZ   . PHE A 1 10 ? 0.733   7.135   6.835   1.00 0.00 ? 10 PHE A HZ   2  
ATOM 1240  N N    . LEU A 1 11 ? 3.346   1.665   1.078   1.00 0.00 ? 11 LEU A N    2  
ATOM 1241  C CA   . LEU A 1 11 ? 3.238   0.401   0.359   1.00 0.00 ? 11 LEU A CA   2  
ATOM 1242  C C    . LEU A 1 11 ? 4.175   -0.634  0.964   1.00 0.00 ? 11 LEU A C    2  
ATOM 1243  O O    . LEU A 1 11 ? 3.774   -1.762  1.247   1.00 0.00 ? 11 LEU A O    2  
ATOM 1244  C CB   . LEU A 1 11 ? 3.566   0.606   -1.125  1.00 0.00 ? 11 LEU A CB   2  
ATOM 1245  C CG   . LEU A 1 11 ? 2.882   -0.364  -2.095  1.00 0.00 ? 11 LEU A CG   2  
ATOM 1246  C CD1  . LEU A 1 11 ? 3.585   -1.713  -2.089  1.00 0.00 ? 11 LEU A CD1  2  
ATOM 1247  C CD2  . LEU A 1 11 ? 1.410   -0.524  -1.748  1.00 0.00 ? 11 LEU A CD2  2  
ATOM 1248  H H    . LEU A 1 11 ? 3.534   2.486   0.577   1.00 0.00 ? 11 LEU A H    2  
ATOM 1249  H HA   . LEU A 1 11 ? 2.225   0.049   0.459   1.00 0.00 ? 11 LEU A HA   2  
ATOM 1250  H HB2  . LEU A 1 11 ? 3.280   1.611   -1.397  1.00 0.00 ? 11 LEU A HB2  2  
ATOM 1251  H HB3  . LEU A 1 11 ? 4.635   0.510   -1.249  1.00 0.00 ? 11 LEU A HB3  2  
ATOM 1252  H HG   . LEU A 1 11 ? 2.947   0.036   -3.096  1.00 0.00 ? 11 LEU A HG   2  
ATOM 1253  H HD11 . LEU A 1 11 ? 4.378   -1.708  -2.823  1.00 0.00 ? 11 LEU A HD11 2  
ATOM 1254  H HD12 . LEU A 1 11 ? 2.875   -2.489  -2.330  1.00 0.00 ? 11 LEU A HD12 2  
ATOM 1255  H HD13 . LEU A 1 11 ? 4.002   -1.898  -1.110  1.00 0.00 ? 11 LEU A HD13 2  
ATOM 1256  H HD21 . LEU A 1 11 ? 0.883   -0.928  -2.599  1.00 0.00 ? 11 LEU A HD21 2  
ATOM 1257  H HD22 . LEU A 1 11 ? 0.995   0.439   -1.491  1.00 0.00 ? 11 LEU A HD22 2  
ATOM 1258  H HD23 . LEU A 1 11 ? 1.308   -1.196  -0.909  1.00 0.00 ? 11 LEU A HD23 2  
ATOM 1259  N N    . THR A 1 12 ? 5.422   -0.233  1.170   1.00 0.00 ? 12 THR A N    2  
ATOM 1260  C CA   . THR A 1 12 ? 6.412   -1.109  1.776   1.00 0.00 ? 12 THR A CA   2  
ATOM 1261  C C    . THR A 1 12 ? 6.252   -1.111  3.289   1.00 0.00 ? 12 THR A C    2  
ATOM 1262  O O    . THR A 1 12 ? 6.335   -2.157  3.936   1.00 0.00 ? 12 THR A O    2  
ATOM 1263  C CB   . THR A 1 12 ? 7.824   -0.657  1.403   1.00 0.00 ? 12 THR A CB   2  
ATOM 1264  O OG1  . THR A 1 12 ? 8.037   -0.778  0.007   1.00 0.00 ? 12 THR A OG1  2  
ATOM 1265  C CG2  . THR A 1 12 ? 8.910   -1.440  2.106   1.00 0.00 ? 12 THR A CG2  2  
ATOM 1266  H H    . THR A 1 12 ? 5.671   0.684   0.939   1.00 0.00 ? 12 THR A H    2  
ATOM 1267  H HA   . THR A 1 12 ? 6.249   -2.110  1.403   1.00 0.00 ? 12 THR A HA   2  
ATOM 1268  H HB   . THR A 1 12 ? 7.941   0.382   1.675   1.00 0.00 ? 12 THR A HB   2  
ATOM 1269  H HG1  . THR A 1 12 ? 8.118   0.095   -0.383  1.00 0.00 ? 12 THR A HG1  2  
ATOM 1270  H HG21 . THR A 1 12 ? 8.487   -2.336  2.537   1.00 0.00 ? 12 THR A HG21 2  
ATOM 1271  H HG22 . THR A 1 12 ? 9.342   -0.834  2.889   1.00 0.00 ? 12 THR A HG22 2  
ATOM 1272  H HG23 . THR A 1 12 ? 9.678   -1.710  1.395   1.00 0.00 ? 12 THR A HG23 2  
ATOM 1273  N N    . GLY A 1 13 ? 5.998   0.072   3.846   1.00 0.00 ? 13 GLY A N    2  
ATOM 1274  C CA   . GLY A 1 13 ? 5.811   0.199   5.279   1.00 0.00 ? 13 GLY A CA   2  
ATOM 1275  C C    . GLY A 1 13 ? 4.828   -0.818  5.820   1.00 0.00 ? 13 GLY A C    2  
ATOM 1276  O O    . GLY A 1 13 ? 4.946   -1.257  6.964   1.00 0.00 ? 13 GLY A O    2  
ATOM 1277  H H    . GLY A 1 13 ? 5.934   0.867   3.275   1.00 0.00 ? 13 GLY A H    2  
ATOM 1278  H HA2  . GLY A 1 13 ? 6.764   0.060   5.769   1.00 0.00 ? 13 GLY A HA2  2  
ATOM 1279  H HA3  . GLY A 1 13 ? 5.445   1.190   5.498   1.00 0.00 ? 13 GLY A HA3  2  
ATOM 1280  N N    . LEU A 1 14 ? 3.859   -1.198  4.993   1.00 0.00 ? 14 LEU A N    2  
ATOM 1281  C CA   . LEU A 1 14 ? 2.875   -2.190  5.384   1.00 0.00 ? 14 LEU A CA   2  
ATOM 1282  C C    . LEU A 1 14 ? 3.552   -3.495  5.796   1.00 0.00 ? 14 LEU A C    2  
ATOM 1283  O O    . LEU A 1 14 ? 2.962   -4.319  6.493   1.00 0.00 ? 14 LEU A O    2  
ATOM 1284  C CB   . LEU A 1 14 ? 1.917   -2.451  4.218   1.00 0.00 ? 14 LEU A CB   2  
ATOM 1285  C CG   . LEU A 1 14 ? 0.420   -2.487  4.559   1.00 0.00 ? 14 LEU A CG   2  
ATOM 1286  C CD1  . LEU A 1 14 ? 0.178   -2.939  5.995   1.00 0.00 ? 14 LEU A CD1  2  
ATOM 1287  C CD2  . LEU A 1 14 ? -0.210  -1.126  4.314   1.00 0.00 ? 14 LEU A CD2  2  
ATOM 1288  H H    . LEU A 1 14 ? 3.824   -0.827  4.085   1.00 0.00 ? 14 LEU A H    2  
ATOM 1289  H HA   . LEU A 1 14 ? 2.319   -1.800  6.223   1.00 0.00 ? 14 LEU A HA   2  
ATOM 1290  H HB2  . LEU A 1 14 ? 2.072   -1.678  3.480   1.00 0.00 ? 14 LEU A HB2  2  
ATOM 1291  H HB3  . LEU A 1 14 ? 2.185   -3.397  3.773   1.00 0.00 ? 14 LEU A HB3  2  
ATOM 1292  H HG   . LEU A 1 14 ? -0.066  -3.195  3.908   1.00 0.00 ? 14 LEU A HG   2  
ATOM 1293  H HD11 . LEU A 1 14 ? -0.829  -3.315  6.091   1.00 0.00 ? 14 LEU A HD11 2  
ATOM 1294  H HD12 . LEU A 1 14 ? 0.316   -2.102  6.663   1.00 0.00 ? 14 LEU A HD12 2  
ATOM 1295  H HD13 . LEU A 1 14 ? 0.880   -3.720  6.249   1.00 0.00 ? 14 LEU A HD13 2  
ATOM 1296  H HD21 . LEU A 1 14 ? -0.732  -0.805  5.204   1.00 0.00 ? 14 LEU A HD21 2  
ATOM 1297  H HD22 . LEU A 1 14 ? -0.909  -1.197  3.492   1.00 0.00 ? 14 LEU A HD22 2  
ATOM 1298  H HD23 . LEU A 1 14 ? 0.561   -0.412  4.070   1.00 0.00 ? 14 LEU A HD23 2  
ATOM 1299  N N    . GLY A 1 15 ? 4.794   -3.678  5.352   1.00 0.00 ? 15 GLY A N    2  
ATOM 1300  C CA   . GLY A 1 15 ? 5.524   -4.890  5.662   1.00 0.00 ? 15 GLY A CA   2  
ATOM 1301  C C    . GLY A 1 15 ? 5.820   -5.713  4.423   1.00 0.00 ? 15 GLY A C    2  
ATOM 1302  O O    . GLY A 1 15 ? 6.106   -6.907  4.516   1.00 0.00 ? 15 GLY A O    2  
ATOM 1303  H H    . GLY A 1 15 ? 5.210   -2.992  4.791   1.00 0.00 ? 15 GLY A H    2  
ATOM 1304  H HA2  . GLY A 1 15 ? 6.455   -4.626  6.139   1.00 0.00 ? 15 GLY A HA2  2  
ATOM 1305  H HA3  . GLY A 1 15 ? 4.937   -5.487  6.346   1.00 0.00 ? 15 GLY A HA3  2  
ATOM 1306  N N    . CYS A 1 16 ? 5.748   -5.074  3.258   1.00 0.00 ? 16 CYS A N    2  
ATOM 1307  C CA   . CYS A 1 16 ? 6.004   -5.756  1.994   1.00 0.00 ? 16 CYS A CA   2  
ATOM 1308  C C    . CYS A 1 16 ? 7.154   -5.094  1.239   1.00 0.00 ? 16 CYS A C    2  
ATOM 1309  O O    . CYS A 1 16 ? 6.931   -4.341  0.291   1.00 0.00 ? 16 CYS A O    2  
ATOM 1310  C CB   . CYS A 1 16 ? 4.745   -5.755  1.120   1.00 0.00 ? 16 CYS A CB   2  
ATOM 1311  S SG   . CYS A 1 16 ? 3.195   -5.896  2.044   1.00 0.00 ? 16 CYS A SG   2  
ATOM 1312  H H    . CYS A 1 16 ? 5.513   -4.121  3.246   1.00 0.00 ? 16 CYS A H    2  
ATOM 1313  H HA   . CYS A 1 16 ? 6.276   -6.777  2.217   1.00 0.00 ? 16 CYS A HA   2  
ATOM 1314  H HB2  . CYS A 1 16 ? 4.708   -4.832  0.559   1.00 0.00 ? 16 CYS A HB2  2  
ATOM 1315  H HB3  . CYS A 1 16 ? 4.792   -6.586  0.433   1.00 0.00 ? 16 CYS A HB3  2  
ATOM 1316  H HG   . CYS A 1 16 ? 3.174   -6.764  2.453   1.00 0.00 ? 16 CYS A HG   2  
ATOM 1317  N N    . PRO A 1 17 ? 8.404   -5.381  1.640   1.00 0.00 ? 17 PRO A N    2  
ATOM 1318  C CA   . PRO A 1 17 ? 9.588   -4.806  1.004   1.00 0.00 ? 17 PRO A CA   2  
ATOM 1319  C C    . PRO A 1 17 ? 10.035  -5.582  -0.233  1.00 0.00 ? 17 PRO A C    2  
ATOM 1320  O O    . PRO A 1 17 ? 11.146  -5.387  -0.728  1.00 0.00 ? 17 PRO A O    2  
ATOM 1321  C CB   . PRO A 1 17 ? 10.639  -4.912  2.105   1.00 0.00 ? 17 PRO A CB   2  
ATOM 1322  C CG   . PRO A 1 17 ? 10.263  -6.141  2.863   1.00 0.00 ? 17 PRO A CG   2  
ATOM 1323  C CD   . PRO A 1 17 ? 8.762   -6.266  2.765   1.00 0.00 ? 17 PRO A CD   2  
ATOM 1324  H HA   . PRO A 1 17 ? 9.437   -3.768  0.745   1.00 0.00 ? 17 PRO A HA   2  
ATOM 1325  H HB2  . PRO A 1 17 ? 11.621  -5.004  1.663   1.00 0.00 ? 17 PRO A HB2  2  
ATOM 1326  H HB3  . PRO A 1 17 ? 10.600  -4.033  2.731   1.00 0.00 ? 17 PRO A HB3  2  
ATOM 1327  H HG2  . PRO A 1 17 ? 10.739  -7.003  2.420   1.00 0.00 ? 17 PRO A HG2  2  
ATOM 1328  H HG3  . PRO A 1 17 ? 10.562  -6.039  3.896   1.00 0.00 ? 17 PRO A HG3  2  
ATOM 1329  H HD2  . PRO A 1 17 ? 8.483   -7.288  2.553   1.00 0.00 ? 17 PRO A HD2  2  
ATOM 1330  H HD3  . PRO A 1 17 ? 8.295   -5.930  3.680   1.00 0.00 ? 17 PRO A HD3  2  
ATOM 1331  N N    . ASN A 1 18 ? 9.170   -6.463  -0.729  1.00 0.00 ? 18 ASN A N    2  
ATOM 1332  C CA   . ASN A 1 18 ? 9.488   -7.263  -1.906  1.00 0.00 ? 18 ASN A CA   2  
ATOM 1333  C C    . ASN A 1 18 ? 8.257   -7.455  -2.786  1.00 0.00 ? 18 ASN A C    2  
ATOM 1334  O O    . ASN A 1 18 ? 8.167   -8.422  -3.541  1.00 0.00 ? 18 ASN A O    2  
ATOM 1335  C CB   . ASN A 1 18 ? 10.043  -8.627  -1.483  1.00 0.00 ? 18 ASN A CB   2  
ATOM 1336  C CG   . ASN A 1 18 ? 10.755  -9.339  -2.617  1.00 0.00 ? 18 ASN A CG   2  
ATOM 1337  O OD1  . ASN A 1 18 ? 10.119  -9.935  -3.486  1.00 0.00 ? 18 ASN A OD1  2  
ATOM 1338  N ND2  . ASN A 1 18 ? 12.081  -9.280  -2.612  1.00 0.00 ? 18 ASN A ND2  2  
ATOM 1339  H H    . ASN A 1 18 ? 8.301   -6.580  -0.295  1.00 0.00 ? 18 ASN A H    2  
ATOM 1340  H HA   . ASN A 1 18 ? 10.242  -6.737  -2.472  1.00 0.00 ? 18 ASN A HA   2  
ATOM 1341  H HB2  . ASN A 1 18 ? 10.743  -8.487  -0.674  1.00 0.00 ? 18 ASN A HB2  2  
ATOM 1342  H HB3  . ASN A 1 18 ? 9.228   -9.250  -1.146  1.00 0.00 ? 18 ASN A HB3  2  
ATOM 1343  H HD21 . ASN A 1 18 ? 12.520  -8.787  -1.887  1.00 0.00 ? 18 ASN A HD21 2  
ATOM 1344  H HD22 . ASN A 1 18 ? 12.566  -9.732  -3.333  1.00 0.00 ? 18 ASN A HD22 2  
ATOM 1345  N N    . CYS A 1 19 ? 7.312   -6.525  -2.686  1.00 0.00 ? 19 CYS A N    2  
ATOM 1346  C CA   . CYS A 1 19 ? 6.085   -6.599  -3.470  1.00 0.00 ? 19 CYS A CA   2  
ATOM 1347  C C    . CYS A 1 19 ? 5.928   -5.378  -4.369  1.00 0.00 ? 19 CYS A C    2  
ATOM 1348  O O    . CYS A 1 19 ? 5.404   -5.476  -5.480  1.00 0.00 ? 19 CYS A O    2  
ATOM 1349  C CB   . CYS A 1 19 ? 4.873   -6.724  -2.546  1.00 0.00 ? 19 CYS A CB   2  
ATOM 1350  S SG   . CYS A 1 19 ? 3.641   -7.926  -3.099  1.00 0.00 ? 19 CYS A SG   2  
ATOM 1351  H H    . CYS A 1 19 ? 7.438   -5.780  -2.064  1.00 0.00 ? 19 CYS A H    2  
ATOM 1352  H HA   . CYS A 1 19 ? 6.145   -7.479  -4.092  1.00 0.00 ? 19 CYS A HA   2  
ATOM 1353  H HB2  . CYS A 1 19 ? 5.209   -7.026  -1.564  1.00 0.00 ? 19 CYS A HB2  2  
ATOM 1354  H HB3  . CYS A 1 19 ? 4.384   -5.764  -2.474  1.00 0.00 ? 19 CYS A HB3  2  
ATOM 1355  H HG   . CYS A 1 19 ? 3.423   -8.491  -2.354  1.00 0.00 ? 19 CYS A HG   2  
ATOM 1356  N N    . ILE A 1 20 ? 6.384   -4.225  -3.886  1.00 0.00 ? 20 ILE A N    2  
ATOM 1357  C CA   . ILE A 1 20 ? 6.293   -2.984  -4.648  1.00 0.00 ? 20 ILE A CA   2  
ATOM 1358  C C    . ILE A 1 20 ? 6.760   -3.183  -6.087  1.00 0.00 ? 20 ILE A C    2  
ATOM 1359  O O    . ILE A 1 20 ? 6.306   -2.494  -6.999  1.00 0.00 ? 20 ILE A O    2  
ATOM 1360  C CB   . ILE A 1 20 ? 7.132   -1.869  -3.994  1.00 0.00 ? 20 ILE A CB   2  
ATOM 1361  C CG1  . ILE A 1 20 ? 7.038   -0.574  -4.806  1.00 0.00 ? 20 ILE A CG1  2  
ATOM 1362  C CG2  . ILE A 1 20 ? 8.578   -2.315  -3.860  1.00 0.00 ? 20 ILE A CG2  2  
ATOM 1363  C CD1  . ILE A 1 20 ? 6.386   0.566   -4.056  1.00 0.00 ? 20 ILE A CD1  2  
ATOM 1364  H H    . ILE A 1 20 ? 6.790   -4.209  -2.996  1.00 0.00 ? 20 ILE A H    2  
ATOM 1365  H HA   . ILE A 1 20 ? 5.260   -2.672  -4.656  1.00 0.00 ? 20 ILE A HA   2  
ATOM 1366  H HB   . ILE A 1 20 ? 6.743   -1.693  -3.002  1.00 0.00 ? 20 ILE A HB   2  
ATOM 1367  H HG12 . ILE A 1 20 ? 8.033   -0.261  -5.087  1.00 0.00 ? 20 ILE A HG12 2  
ATOM 1368  H HG13 . ILE A 1 20 ? 6.458   -0.756  -5.698  1.00 0.00 ? 20 ILE A HG13 2  
ATOM 1369  H HG21 . ILE A 1 20 ? 8.616   -3.394  -3.798  1.00 0.00 ? 20 ILE A HG21 2  
ATOM 1370  H HG22 . ILE A 1 20 ? 9.006   -1.888  -2.965  1.00 0.00 ? 20 ILE A HG22 2  
ATOM 1371  H HG23 . ILE A 1 20 ? 9.138   -1.985  -4.722  1.00 0.00 ? 20 ILE A HG23 2  
ATOM 1372  H HD11 . ILE A 1 20 ? 5.374   0.293   -3.794  1.00 0.00 ? 20 ILE A HD11 2  
ATOM 1373  H HD12 . ILE A 1 20 ? 6.372   1.447   -4.682  1.00 0.00 ? 20 ILE A HD12 2  
ATOM 1374  H HD13 . ILE A 1 20 ? 6.948   0.774   -3.157  1.00 0.00 ? 20 ILE A HD13 2  
ATOM 1375  N N    . GLU A 1 21 ? 7.658   -4.138  -6.287  1.00 0.00 ? 21 GLU A N    2  
ATOM 1376  C CA   . GLU A 1 21 ? 8.169   -4.435  -7.618  1.00 0.00 ? 21 GLU A CA   2  
ATOM 1377  C C    . GLU A 1 21 ? 7.036   -4.846  -8.548  1.00 0.00 ? 21 GLU A C    2  
ATOM 1378  O O    . GLU A 1 21 ? 6.942   -4.376  -9.682  1.00 0.00 ? 21 GLU A O    2  
ATOM 1379  C CB   . GLU A 1 21 ? 9.204   -5.556  -7.546  1.00 0.00 ? 21 GLU A CB   2  
ATOM 1380  C CG   . GLU A 1 21 ? 10.294  -5.312  -6.517  1.00 0.00 ? 21 GLU A CG   2  
ATOM 1381  C CD   . GLU A 1 21 ? 11.641  -5.858  -6.948  1.00 0.00 ? 21 GLU A CD   2  
ATOM 1382  O OE1  . GLU A 1 21 ? 11.739  -7.082  -7.175  1.00 0.00 ? 21 GLU A OE1  2  
ATOM 1383  O OE2  . GLU A 1 21 ? 12.597  -5.063  -7.055  1.00 0.00 ? 21 GLU A OE2  2  
ATOM 1384  H H    . GLU A 1 21 ? 7.980   -4.661  -5.523  1.00 0.00 ? 21 GLU A H    2  
ATOM 1385  H HA   . GLU A 1 21 ? 8.633   -3.540  -8.007  1.00 0.00 ? 21 GLU A HA   2  
ATOM 1386  H HB2  . GLU A 1 21 ? 8.701   -6.477  -7.294  1.00 0.00 ? 21 GLU A HB2  2  
ATOM 1387  H HB3  . GLU A 1 21 ? 9.668   -5.663  -8.514  1.00 0.00 ? 21 GLU A HB3  2  
ATOM 1388  H HG2  . GLU A 1 21 ? 10.387  -4.247  -6.358  1.00 0.00 ? 21 GLU A HG2  2  
ATOM 1389  H HG3  . GLU A 1 21 ? 10.010  -5.788  -5.590  1.00 0.00 ? 21 GLU A HG3  2  
ATOM 1390  N N    . TYR A 1 22 ? 6.183   -5.736  -8.058  1.00 0.00 ? 22 TYR A N    2  
ATOM 1391  C CA   . TYR A 1 22 ? 5.051   -6.223  -8.835  1.00 0.00 ? 22 TYR A CA   2  
ATOM 1392  C C    . TYR A 1 22 ? 3.915   -5.207  -8.834  1.00 0.00 ? 22 TYR A C    2  
ATOM 1393  O O    . TYR A 1 22 ? 3.128   -5.139  -9.779  1.00 0.00 ? 22 TYR A O    2  
ATOM 1394  C CB   . TYR A 1 22 ? 4.558   -7.558  -8.274  1.00 0.00 ? 22 TYR A CB   2  
ATOM 1395  C CG   . TYR A 1 22 ? 5.653   -8.590  -8.118  1.00 0.00 ? 22 TYR A CG   2  
ATOM 1396  C CD1  . TYR A 1 22 ? 6.477   -8.594  -6.999  1.00 0.00 ? 22 TYR A CD1  2  
ATOM 1397  C CD2  . TYR A 1 22 ? 5.866   -9.558  -9.092  1.00 0.00 ? 22 TYR A CD2  2  
ATOM 1398  C CE1  . TYR A 1 22 ? 7.481   -9.533  -6.854  1.00 0.00 ? 22 TYR A CE1  2  
ATOM 1399  C CE2  . TYR A 1 22 ? 6.867   -10.501 -8.955  1.00 0.00 ? 22 TYR A CE2  2  
ATOM 1400  C CZ   . TYR A 1 22 ? 7.671   -10.484 -7.835  1.00 0.00 ? 22 TYR A CZ   2  
ATOM 1401  O OH   . TYR A 1 22 ? 8.669   -11.421 -7.694  1.00 0.00 ? 22 TYR A OH   2  
ATOM 1402  H H    . TYR A 1 22 ? 6.318   -6.068  -7.145  1.00 0.00 ? 22 TYR A H    2  
ATOM 1403  H HA   . TYR A 1 22 ? 5.386   -6.370  -9.852  1.00 0.00 ? 22 TYR A HA   2  
ATOM 1404  H HB2  . TYR A 1 22 ? 4.117   -7.393  -7.302  1.00 0.00 ? 22 TYR A HB2  2  
ATOM 1405  H HB3  . TYR A 1 22 ? 3.810   -7.966  -8.938  1.00 0.00 ? 22 TYR A HB3  2  
ATOM 1406  H HD1  . TYR A 1 22 ? 6.325   -7.847  -6.233  1.00 0.00 ? 22 TYR A HD1  2  
ATOM 1407  H HD2  . TYR A 1 22 ? 5.234   -9.569  -9.968  1.00 0.00 ? 22 TYR A HD2  2  
ATOM 1408  H HE1  . TYR A 1 22 ? 8.110   -9.519  -5.978  1.00 0.00 ? 22 TYR A HE1  2  
ATOM 1409  H HE2  . TYR A 1 22 ? 7.015   -11.246 -9.722  1.00 0.00 ? 22 TYR A HE2  2  
ATOM 1410  H HH   . TYR A 1 22 ? 8.435   -12.037 -6.996  1.00 0.00 ? 22 TYR A HH   2  
ATOM 1411  N N    . PHE A 1 23 ? 3.834   -4.420  -7.767  1.00 0.00 ? 23 PHE A N    2  
ATOM 1412  C CA   . PHE A 1 23 ? 2.796   -3.406  -7.643  1.00 0.00 ? 23 PHE A CA   2  
ATOM 1413  C C    . PHE A 1 23 ? 3.127   -2.184  -8.493  1.00 0.00 ? 23 PHE A C    2  
ATOM 1414  O O    . PHE A 1 23 ? 2.265   -1.645  -9.186  1.00 0.00 ? 23 PHE A O    2  
ATOM 1415  C CB   . PHE A 1 23 ? 2.629   -2.996  -6.177  1.00 0.00 ? 23 PHE A CB   2  
ATOM 1416  C CG   . PHE A 1 23 ? 1.630   -3.833  -5.430  1.00 0.00 ? 23 PHE A CG   2  
ATOM 1417  C CD1  . PHE A 1 23 ? 0.270   -3.626  -5.594  1.00 0.00 ? 23 PHE A CD1  2  
ATOM 1418  C CD2  . PHE A 1 23 ? 2.051   -4.829  -4.562  1.00 0.00 ? 23 PHE A CD2  2  
ATOM 1419  C CE1  . PHE A 1 23 ? -0.651  -4.394  -4.908  1.00 0.00 ? 23 PHE A CE1  2  
ATOM 1420  C CE2  . PHE A 1 23 ? 1.135   -5.601  -3.873  1.00 0.00 ? 23 PHE A CE2  2  
ATOM 1421  C CZ   . PHE A 1 23 ? -0.218  -5.383  -4.046  1.00 0.00 ? 23 PHE A CZ   2  
ATOM 1422  H H    . PHE A 1 23 ? 4.492   -4.522  -7.047  1.00 0.00 ? 23 PHE A H    2  
ATOM 1423  H HA   . PHE A 1 23 ? 1.871   -3.836  -7.998  1.00 0.00 ? 23 PHE A HA   2  
ATOM 1424  H HB2  . PHE A 1 23 ? 3.581   -3.086  -5.676  1.00 0.00 ? 23 PHE A HB2  2  
ATOM 1425  H HB3  . PHE A 1 23 ? 2.300   -1.968  -6.134  1.00 0.00 ? 23 PHE A HB3  2  
ATOM 1426  H HD1  . PHE A 1 23 ? -0.070  -2.853  -6.267  1.00 0.00 ? 23 PHE A HD1  2  
ATOM 1427  H HD2  . PHE A 1 23 ? 3.109   -5.000  -4.426  1.00 0.00 ? 23 PHE A HD2  2  
ATOM 1428  H HE1  . PHE A 1 23 ? -1.708  -4.223  -5.044  1.00 0.00 ? 23 PHE A HE1  2  
ATOM 1429  H HE2  . PHE A 1 23 ? 1.477   -6.373  -3.200  1.00 0.00 ? 23 PHE A HE2  2  
ATOM 1430  H HZ   . PHE A 1 23 ? -0.935  -5.985  -3.509  1.00 0.00 ? 23 PHE A HZ   2  
ATOM 1431  N N    . THR A 1 24 ? 4.386   -1.756  -8.443  1.00 0.00 ? 24 THR A N    2  
ATOM 1432  C CA   . THR A 1 24 ? 4.830   -0.602  -9.216  1.00 0.00 ? 24 THR A CA   2  
ATOM 1433  C C    . THR A 1 24 ? 4.800   -0.908  -10.709 1.00 0.00 ? 24 THR A C    2  
ATOM 1434  O O    . THR A 1 24 ? 4.611   -0.013  -11.534 1.00 0.00 ? 24 THR A O    2  
ATOM 1435  C CB   . THR A 1 24 ? 6.242   -0.190  -8.795  1.00 0.00 ? 24 THR A CB   2  
ATOM 1436  O OG1  . THR A 1 24 ? 6.603   1.043   -9.393  1.00 0.00 ? 24 THR A OG1  2  
ATOM 1437  C CG2  . THR A 1 24 ? 7.299   -1.208  -9.162  1.00 0.00 ? 24 THR A CG2  2  
ATOM 1438  H H    . THR A 1 24 ? 5.033   -2.230  -7.875  1.00 0.00 ? 24 THR A H    2  
ATOM 1439  H HA   . THR A 1 24 ? 4.150   0.213   -9.015  1.00 0.00 ? 24 THR A HA   2  
ATOM 1440  H HB   . THR A 1 24 ? 6.266   -0.068  -7.722  1.00 0.00 ? 24 THR A HB   2  
ATOM 1441  H HG1  . THR A 1 24 ? 6.939   1.640   -8.719  1.00 0.00 ? 24 THR A HG1  2  
ATOM 1442  H HG21 . THR A 1 24 ? 6.824   -2.106  -9.527  1.00 0.00 ? 24 THR A HG21 2  
ATOM 1443  H HG22 . THR A 1 24 ? 7.892   -1.442  -8.291  1.00 0.00 ? 24 THR A HG22 2  
ATOM 1444  H HG23 . THR A 1 24 ? 7.938   -0.800  -9.934  1.00 0.00 ? 24 THR A HG23 2  
ATOM 1445  N N    . SER A 1 25 ? 4.981   -2.180  -11.049 1.00 0.00 ? 25 SER A N    2  
ATOM 1446  C CA   . SER A 1 25 ? 4.964   -2.609  -12.442 1.00 0.00 ? 25 SER A CA   2  
ATOM 1447  C C    . SER A 1 25 ? 3.680   -2.163  -13.135 1.00 0.00 ? 25 SER A C    2  
ATOM 1448  O O    . SER A 1 25 ? 3.633   -2.047  -14.360 1.00 0.00 ? 25 SER A O    2  
ATOM 1449  C CB   . SER A 1 25 ? 5.102   -4.130  -12.530 1.00 0.00 ? 25 SER A CB   2  
ATOM 1450  O OG   . SER A 1 25 ? 6.417   -4.543  -12.199 1.00 0.00 ? 25 SER A OG   2  
ATOM 1451  H H    . SER A 1 25 ? 5.121   -2.848  -10.345 1.00 0.00 ? 25 SER A H    2  
ATOM 1452  H HA   . SER A 1 25 ? 5.805   -2.150  -12.940 1.00 0.00 ? 25 SER A HA   2  
ATOM 1453  H HB2  . SER A 1 25 ? 4.409   -4.592  -11.842 1.00 0.00 ? 25 SER A HB2  2  
ATOM 1454  H HB3  . SER A 1 25 ? 4.879   -4.453  -13.536 1.00 0.00 ? 25 SER A HB3  2  
ATOM 1455  H HG   . SER A 1 25 ? 6.603   -5.386  -12.620 1.00 0.00 ? 25 SER A HG   2  
ATOM 1456  N N    . GLN A 1 26 ? 2.641   -1.909  -12.344 1.00 0.00 ? 26 GLN A N    2  
ATOM 1457  C CA   . GLN A 1 26 ? 1.356   -1.474  -12.883 1.00 0.00 ? 26 GLN A CA   2  
ATOM 1458  C C    . GLN A 1 26 ? 1.202   0.036   -12.750 1.00 0.00 ? 26 GLN A C    2  
ATOM 1459  O O    . GLN A 1 26 ? 0.981   0.740   -13.736 1.00 0.00 ? 26 GLN A O    2  
ATOM 1460  C CB   . GLN A 1 26 ? 0.206   -2.173  -12.155 1.00 0.00 ? 26 GLN A CB   2  
ATOM 1461  C CG   . GLN A 1 26 ? 0.537   -3.585  -11.705 1.00 0.00 ? 26 GLN A CG   2  
ATOM 1462  C CD   . GLN A 1 26 ? 0.903   -4.492  -12.858 1.00 0.00 ? 26 GLN A CD   2  
ATOM 1463  O OE1  . GLN A 1 26 ? 1.625   -4.095  -13.773 1.00 0.00 ? 26 GLN A OE1  2  
ATOM 1464  N NE2  . GLN A 1 26 ? 0.407   -5.719  -12.818 1.00 0.00 ? 26 GLN A NE2  2  
ATOM 1465  H H    . GLN A 1 26 ? 2.737   -2.019  -11.376 1.00 0.00 ? 26 GLN A H    2  
ATOM 1466  H HA   . GLN A 1 26 ? 1.327   -1.742  -13.928 1.00 0.00 ? 26 GLN A HA   2  
ATOM 1467  H HB2  . GLN A 1 26 ? -0.058  -1.592  -11.284 1.00 0.00 ? 26 GLN A HB2  2  
ATOM 1468  H HB3  . GLN A 1 26 ? -0.645  -2.220  -12.816 1.00 0.00 ? 26 GLN A HB3  2  
ATOM 1469  H HG2  . GLN A 1 26 ? 1.370   -3.547  -11.020 1.00 0.00 ? 26 GLN A HG2  2  
ATOM 1470  H HG3  . GLN A 1 26 ? -0.324  -3.999  -11.201 1.00 0.00 ? 26 GLN A HG3  2  
ATOM 1471  H HE21 . GLN A 1 26 ? -0.159  -5.962  -12.058 1.00 0.00 ? 26 GLN A HE21 2  
ATOM 1472  H HE22 . GLN A 1 26 ? 0.626   -6.331  -13.549 1.00 0.00 ? 26 GLN A HE22 2  
ATOM 1473  N N    . GLY A 1 27 ? 1.317   0.523   -11.520 1.00 0.00 ? 27 GLY A N    2  
ATOM 1474  C CA   . GLY A 1 27 ? 1.187   1.943   -11.265 1.00 0.00 ? 27 GLY A CA   2  
ATOM 1475  C C    . GLY A 1 27 ? 0.948   2.242   -9.800  1.00 0.00 ? 27 GLY A C    2  
ATOM 1476  O O    . GLY A 1 27 ? 0.110   3.076   -9.458  1.00 0.00 ? 27 GLY A O    2  
ATOM 1477  H H    . GLY A 1 27 ? 1.491   -0.091  -10.776 1.00 0.00 ? 27 GLY A H    2  
ATOM 1478  H HA2  . GLY A 1 27 ? 2.094   2.440   -11.577 1.00 0.00 ? 27 GLY A HA2  2  
ATOM 1479  H HA3  . GLY A 1 27 ? 0.360   2.330   -11.840 1.00 0.00 ? 27 GLY A HA3  2  
ATOM 1480  N N    . LEU A 1 28 ? 1.693   1.565   -8.931  1.00 0.00 ? 28 LEU A N    2  
ATOM 1481  C CA   . LEU A 1 28 ? 1.553   1.764   -7.495  1.00 0.00 ? 28 LEU A CA   2  
ATOM 1482  C C    . LEU A 1 28 ? 2.637   2.696   -6.969  1.00 0.00 ? 28 LEU A C    2  
ATOM 1483  O O    . LEU A 1 28 ? 3.188   2.482   -5.889  1.00 0.00 ? 28 LEU A O    2  
ATOM 1484  C CB   . LEU A 1 28 ? 1.606   0.422   -6.760  1.00 0.00 ? 28 LEU A CB   2  
ATOM 1485  C CG   . LEU A 1 28 ? 0.334   0.058   -5.992  1.00 0.00 ? 28 LEU A CG   2  
ATOM 1486  C CD1  . LEU A 1 28 ? 0.169   0.959   -4.779  1.00 0.00 ? 28 LEU A CD1  2  
ATOM 1487  C CD2  . LEU A 1 28 ? -0.884  0.154   -6.900  1.00 0.00 ? 28 LEU A CD2  2  
ATOM 1488  H H    . LEU A 1 28 ? 2.342   0.911   -9.262  1.00 0.00 ? 28 LEU A H    2  
ATOM 1489  H HA   . LEU A 1 28 ? 0.589   2.221   -7.320  1.00 0.00 ? 28 LEU A HA   2  
ATOM 1490  H HB2  . LEU A 1 28 ? 1.798   -0.354  -7.485  1.00 0.00 ? 28 LEU A HB2  2  
ATOM 1491  H HB3  . LEU A 1 28 ? 2.427   0.448   -6.061  1.00 0.00 ? 28 LEU A HB3  2  
ATOM 1492  H HG   . LEU A 1 28 ? 0.411   -0.961  -5.644  1.00 0.00 ? 28 LEU A HG   2  
ATOM 1493  H HD11 . LEU A 1 28 ? -0.883  1.101   -4.578  1.00 0.00 ? 28 LEU A HD11 2  
ATOM 1494  H HD12 . LEU A 1 28 ? 0.630   1.916   -4.976  1.00 0.00 ? 28 LEU A HD12 2  
ATOM 1495  H HD13 . LEU A 1 28 ? 0.641   0.500   -3.923  1.00 0.00 ? 28 LEU A HD13 2  
ATOM 1496  H HD21 . LEU A 1 28 ? -1.750  -0.229  -6.381  1.00 0.00 ? 28 LEU A HD21 2  
ATOM 1497  H HD22 . LEU A 1 28 ? -0.713  -0.429  -7.793  1.00 0.00 ? 28 LEU A HD22 2  
ATOM 1498  H HD23 . LEU A 1 28 ? -1.052  1.186   -7.170  1.00 0.00 ? 28 LEU A HD23 2  
ATOM 1499  N N    . GLN A 1 29 ? 2.924   3.743   -7.734  1.00 0.00 ? 29 GLN A N    2  
ATOM 1500  C CA   . GLN A 1 29 ? 3.913   4.735   -7.336  1.00 0.00 ? 29 GLN A CA   2  
ATOM 1501  C C    . GLN A 1 29 ? 3.217   5.957   -6.748  1.00 0.00 ? 29 GLN A C    2  
ATOM 1502  O O    . GLN A 1 29 ? 3.771   6.658   -5.904  1.00 0.00 ? 29 GLN A O    2  
ATOM 1503  C CB   . GLN A 1 29 ? 4.774   5.146   -8.532  1.00 0.00 ? 29 GLN A CB   2  
ATOM 1504  C CG   . GLN A 1 29 ? 3.969   5.700   -9.697  1.00 0.00 ? 29 GLN A CG   2  
ATOM 1505  C CD   . GLN A 1 29 ? 4.804   6.566   -10.621 1.00 0.00 ? 29 GLN A CD   2  
ATOM 1506  O OE1  . GLN A 1 29 ? 6.022   6.659   -10.471 1.00 0.00 ? 29 GLN A OE1  2  
ATOM 1507  N NE2  . GLN A 1 29 ? 4.149   7.205   -11.583 1.00 0.00 ? 29 GLN A NE2  2  
ATOM 1508  H H    . GLN A 1 29 ? 2.436   3.867   -8.575  1.00 0.00 ? 29 GLN A H    2  
ATOM 1509  H HA   . GLN A 1 29 ? 4.546   4.293   -6.581  1.00 0.00 ? 29 GLN A HA   2  
ATOM 1510  H HB2  . GLN A 1 29 ? 5.473   5.903   -8.213  1.00 0.00 ? 29 GLN A HB2  2  
ATOM 1511  H HB3  . GLN A 1 29 ? 5.323   4.283   -8.878  1.00 0.00 ? 29 GLN A HB3  2  
ATOM 1512  H HG2  . GLN A 1 29 ? 3.570   4.874   -10.266 1.00 0.00 ? 29 GLN A HG2  2  
ATOM 1513  H HG3  . GLN A 1 29 ? 3.157   6.295   -9.306  1.00 0.00 ? 29 GLN A HG3  2  
ATOM 1514  H HE21 . GLN A 1 29 ? 3.179   7.082   -11.642 1.00 0.00 ? 29 GLN A HE21 2  
ATOM 1515  H HE22 . GLN A 1 29 ? 4.664   7.771   -12.195 1.00 0.00 ? 29 GLN A HE22 2  
ATOM 1516  N N    . SER A 1 30 ? 1.984   6.186   -7.190  1.00 0.00 ? 30 SER A N    2  
ATOM 1517  C CA   . SER A 1 30 ? 1.181   7.295   -6.694  1.00 0.00 ? 30 SER A CA   2  
ATOM 1518  C C    . SER A 1 30 ? -0.038  6.767   -5.949  1.00 0.00 ? 30 SER A C    2  
ATOM 1519  O O    . SER A 1 30 ? -0.947  6.201   -6.554  1.00 0.00 ? 30 SER A O    2  
ATOM 1520  C CB   . SER A 1 30 ? 0.742   8.193   -7.852  1.00 0.00 ? 30 SER A CB   2  
ATOM 1521  O OG   . SER A 1 30 ? 1.617   8.062   -8.959  1.00 0.00 ? 30 SER A OG   2  
ATOM 1522  H H    . SER A 1 30 ? 1.594   5.579   -7.855  1.00 0.00 ? 30 SER A H    2  
ATOM 1523  H HA   . SER A 1 30 ? 1.785   7.867   -6.011  1.00 0.00 ? 30 SER A HA   2  
ATOM 1524  H HB2  . SER A 1 30 ? -0.255  7.916   -8.163  1.00 0.00 ? 30 SER A HB2  2  
ATOM 1525  H HB3  . SER A 1 30 ? 0.745   9.223   -7.527  1.00 0.00 ? 30 SER A HB3  2  
ATOM 1526  H HG   . SER A 1 30 ? 1.103   7.995   -9.768  1.00 0.00 ? 30 SER A HG   2  
ATOM 1527  N N    . ILE A 1 31 ? -0.048  6.939   -4.628  1.00 0.00 ? 31 ILE A N    2  
ATOM 1528  C CA   . ILE A 1 31 ? -1.152  6.455   -3.803  1.00 0.00 ? 31 ILE A CA   2  
ATOM 1529  C C    . ILE A 1 31 ? -2.504  6.829   -4.417  1.00 0.00 ? 31 ILE A C    2  
ATOM 1530  O O    . ILE A 1 31 ? -3.503  6.140   -4.215  1.00 0.00 ? 31 ILE A O    2  
ATOM 1531  C CB   . ILE A 1 31 ? -1.064  6.991   -2.356  1.00 0.00 ? 31 ILE A CB   2  
ATOM 1532  C CG1  . ILE A 1 31 ? -1.942  6.149   -1.427  1.00 0.00 ? 31 ILE A CG1  2  
ATOM 1533  C CG2  . ILE A 1 31 ? -1.467  8.457   -2.285  1.00 0.00 ? 31 ILE A CG2  2  
ATOM 1534  C CD1  . ILE A 1 31 ? -1.160  5.404   -0.368  1.00 0.00 ? 31 ILE A CD1  2  
ATOM 1535  H H    . ILE A 1 31 ? 0.710   7.389   -4.198  1.00 0.00 ? 31 ILE A H    2  
ATOM 1536  H HA   . ILE A 1 31 ? -1.079  5.379   -3.761  1.00 0.00 ? 31 ILE A HA   2  
ATOM 1537  H HB   . ILE A 1 31 ? -0.036  6.914   -2.033  1.00 0.00 ? 31 ILE A HB   2  
ATOM 1538  H HG12 . ILE A 1 31 ? -2.648  6.794   -0.926  1.00 0.00 ? 31 ILE A HG12 2  
ATOM 1539  H HG13 . ILE A 1 31 ? -2.481  5.420   -2.015  1.00 0.00 ? 31 ILE A HG13 2  
ATOM 1540  H HG21 . ILE A 1 31 ? -0.777  9.049   -2.866  1.00 0.00 ? 31 ILE A HG21 2  
ATOM 1541  H HG22 . ILE A 1 31 ? -1.452  8.786   -1.257  1.00 0.00 ? 31 ILE A HG22 2  
ATOM 1542  H HG23 . ILE A 1 31 ? -2.464  8.570   -2.684  1.00 0.00 ? 31 ILE A HG23 2  
ATOM 1543  H HD11 . ILE A 1 31 ? -1.079  6.017   0.517   1.00 0.00 ? 31 ILE A HD11 2  
ATOM 1544  H HD12 . ILE A 1 31 ? -0.172  5.180   -0.741  1.00 0.00 ? 31 ILE A HD12 2  
ATOM 1545  H HD13 . ILE A 1 31 ? -1.669  4.484   -0.125  1.00 0.00 ? 31 ILE A HD13 2  
ATOM 1546  N N    . TYR A 1 32 ? -2.518  7.921   -5.173  1.00 0.00 ? 32 TYR A N    2  
ATOM 1547  C CA   . TYR A 1 32 ? -3.732  8.368   -5.842  1.00 0.00 ? 32 TYR A CA   2  
ATOM 1548  C C    . TYR A 1 32 ? -4.268  7.279   -6.766  1.00 0.00 ? 32 TYR A C    2  
ATOM 1549  O O    . TYR A 1 32 ? -5.453  7.264   -7.099  1.00 0.00 ? 32 TYR A O    2  
ATOM 1550  C CB   . TYR A 1 32 ? -3.456  9.645   -6.639  1.00 0.00 ? 32 TYR A CB   2  
ATOM 1551  C CG   . TYR A 1 32 ? -3.781  10.913  -5.881  1.00 0.00 ? 32 TYR A CG   2  
ATOM 1552  C CD1  . TYR A 1 32 ? -3.132  11.220  -4.692  1.00 0.00 ? 32 TYR A CD1  2  
ATOM 1553  C CD2  . TYR A 1 32 ? -4.742  11.798  -6.354  1.00 0.00 ? 32 TYR A CD2  2  
ATOM 1554  C CE1  . TYR A 1 32 ? -3.430  12.378  -3.997  1.00 0.00 ? 32 TYR A CE1  2  
ATOM 1555  C CE2  . TYR A 1 32 ? -5.044  12.957  -5.664  1.00 0.00 ? 32 TYR A CE2  2  
ATOM 1556  C CZ   . TYR A 1 32 ? -4.387  13.241  -4.486  1.00 0.00 ? 32 TYR A CZ   2  
ATOM 1557  O OH   . TYR A 1 32 ? -4.685  14.394  -3.797  1.00 0.00 ? 32 TYR A OH   2  
ATOM 1558  H H    . TYR A 1 32 ? -1.687  8.423   -5.306  1.00 0.00 ? 32 TYR A H    2  
ATOM 1559  H HA   . TYR A 1 32 ? -4.471  8.578   -5.083  1.00 0.00 ? 32 TYR A HA   2  
ATOM 1560  H HB2  . TYR A 1 32 ? -2.410  9.676   -6.906  1.00 0.00 ? 32 TYR A HB2  2  
ATOM 1561  H HB3  . TYR A 1 32 ? -4.053  9.634   -7.540  1.00 0.00 ? 32 TYR A HB3  2  
ATOM 1562  H HD1  . TYR A 1 32 ? -2.383  10.542  -4.311  1.00 0.00 ? 32 TYR A HD1  2  
ATOM 1563  H HD2  . TYR A 1 32 ? -5.256  11.572  -7.276  1.00 0.00 ? 32 TYR A HD2  2  
ATOM 1564  H HE1  . TYR A 1 32 ? -2.915  12.601  -3.074  1.00 0.00 ? 32 TYR A HE1  2  
ATOM 1565  H HE2  . TYR A 1 32 ? -5.794  13.632  -6.048  1.00 0.00 ? 32 TYR A HE2  2  
ATOM 1566  H HH   . TYR A 1 32 ? -3.903  14.701  -3.334  1.00 0.00 ? 32 TYR A HH   2  
ATOM 1567  N N    . HIS A 1 33 ? -3.389  6.364   -7.172  1.00 0.00 ? 33 HIS A N    2  
ATOM 1568  C CA   . HIS A 1 33 ? -3.779  5.267   -8.048  1.00 0.00 ? 33 HIS A CA   2  
ATOM 1569  C C    . HIS A 1 33 ? -4.368  4.105   -7.248  1.00 0.00 ? 33 HIS A C    2  
ATOM 1570  O O    . HIS A 1 33 ? -5.065  3.253   -7.799  1.00 0.00 ? 33 HIS A O    2  
ATOM 1571  C CB   . HIS A 1 33 ? -2.574  4.786   -8.858  1.00 0.00 ? 33 HIS A CB   2  
ATOM 1572  C CG   . HIS A 1 33 ? -2.896  3.685   -9.820  1.00 0.00 ? 33 HIS A CG   2  
ATOM 1573  N ND1  . HIS A 1 33 ? -3.363  3.915   -11.098 1.00 0.00 ? 33 HIS A ND1  2  
ATOM 1574  C CD2  . HIS A 1 33 ? -2.810  2.340   -9.689  1.00 0.00 ? 33 HIS A CD2  2  
ATOM 1575  C CE1  . HIS A 1 33 ? -3.554  2.758   -11.708 1.00 0.00 ? 33 HIS A CE1  2  
ATOM 1576  N NE2  . HIS A 1 33 ? -3.227  1.789   -10.875 1.00 0.00 ? 33 HIS A NE2  2  
ATOM 1577  H H    . HIS A 1 33 ? -2.455  6.424   -6.870  1.00 0.00 ? 33 HIS A H    2  
ATOM 1578  H HA   . HIS A 1 33 ? -4.533  5.639   -8.726  1.00 0.00 ? 33 HIS A HA   2  
ATOM 1579  H HB2  . HIS A 1 33 ? -2.175  5.615   -9.425  1.00 0.00 ? 33 HIS A HB2  2  
ATOM 1580  H HB3  . HIS A 1 33 ? -1.816  4.422   -8.180  1.00 0.00 ? 33 HIS A HB3  2  
ATOM 1581  H HD1  . HIS A 1 33 ? -3.531  4.793   -11.497 1.00 0.00 ? 33 HIS A HD1  2  
ATOM 1582  H HD2  . HIS A 1 33 ? -2.479  1.801   -8.813  1.00 0.00 ? 33 HIS A HD2  2  
ATOM 1583  H HE1  . HIS A 1 33 ? -3.917  2.630   -12.718 1.00 0.00 ? 33 HIS A HE1  2  
ATOM 1584  H HE2  . HIS A 1 33 ? -3.274  0.831   -11.074 1.00 0.00 ? 33 HIS A HE2  2  
ATOM 1585  N N    . LEU A 1 34 ? -4.084  4.075   -5.947  1.00 0.00 ? 34 LEU A N    2  
ATOM 1586  C CA   . LEU A 1 34 ? -4.588  3.016   -5.080  1.00 0.00 ? 34 LEU A CA   2  
ATOM 1587  C C    . LEU A 1 34 ? -5.576  3.552   -4.043  1.00 0.00 ? 34 LEU A C    2  
ATOM 1588  O O    . LEU A 1 34 ? -6.035  2.810   -3.176  1.00 0.00 ? 34 LEU A O    2  
ATOM 1589  C CB   . LEU A 1 34 ? -3.424  2.327   -4.371  1.00 0.00 ? 34 LEU A CB   2  
ATOM 1590  C CG   . LEU A 1 34 ? -2.251  3.242   -4.003  1.00 0.00 ? 34 LEU A CG   2  
ATOM 1591  C CD1  . LEU A 1 34 ? -1.480  2.674   -2.821  1.00 0.00 ? 34 LEU A CD1  2  
ATOM 1592  C CD2  . LEU A 1 34 ? -1.330  3.436   -5.198  1.00 0.00 ? 34 LEU A CD2  2  
ATOM 1593  H H    . LEU A 1 34 ? -3.524  4.780   -5.561  1.00 0.00 ? 34 LEU A H    2  
ATOM 1594  H HA   . LEU A 1 34 ? -5.096  2.296   -5.702  1.00 0.00 ? 34 LEU A HA   2  
ATOM 1595  H HB2  . LEU A 1 34 ? -3.798  1.874   -3.464  1.00 0.00 ? 34 LEU A HB2  2  
ATOM 1596  H HB3  . LEU A 1 34 ? -3.055  1.546   -5.016  1.00 0.00 ? 34 LEU A HB3  2  
ATOM 1597  H HG   . LEU A 1 34 ? -2.633  4.212   -3.714  1.00 0.00 ? 34 LEU A HG   2  
ATOM 1598  H HD11 . LEU A 1 34 ? -1.691  1.619   -2.728  1.00 0.00 ? 34 LEU A HD11 2  
ATOM 1599  H HD12 . LEU A 1 34 ? -1.780  3.182   -1.917  1.00 0.00 ? 34 LEU A HD12 2  
ATOM 1600  H HD13 . LEU A 1 34 ? -0.422  2.816   -2.981  1.00 0.00 ? 34 LEU A HD13 2  
ATOM 1601  H HD21 . LEU A 1 34 ? -0.322  3.609   -4.851  1.00 0.00 ? 34 LEU A HD21 2  
ATOM 1602  H HD22 . LEU A 1 34 ? -1.662  4.285   -5.777  1.00 0.00 ? 34 LEU A HD22 2  
ATOM 1603  H HD23 . LEU A 1 34 ? -1.352  2.550   -5.815  1.00 0.00 ? 34 LEU A HD23 2  
ATOM 1604  N N    . GLN A 1 35 ? -5.898  4.839   -4.132  1.00 0.00 ? 35 GLN A N    2  
ATOM 1605  C CA   . GLN A 1 35 ? -6.823  5.458   -3.193  1.00 0.00 ? 35 GLN A CA   2  
ATOM 1606  C C    . GLN A 1 35 ? -8.134  4.684   -3.120  1.00 0.00 ? 35 GLN A C    2  
ATOM 1607  O O    . GLN A 1 35 ? -8.739  4.570   -2.053  1.00 0.00 ? 35 GLN A O    2  
ATOM 1608  C CB   . GLN A 1 35 ? -7.098  6.907   -3.600  1.00 0.00 ? 35 GLN A CB   2  
ATOM 1609  C CG   . GLN A 1 35 ? -7.493  7.799   -2.436  1.00 0.00 ? 35 GLN A CG   2  
ATOM 1610  C CD   . GLN A 1 35 ? -6.329  8.612   -1.904  1.00 0.00 ? 35 GLN A CD   2  
ATOM 1611  O OE1  . GLN A 1 35 ? -5.512  9.121   -2.671  1.00 0.00 ? 35 GLN A OE1  2  
ATOM 1612  N NE2  . GLN A 1 35 ? -6.249  8.739   -0.585  1.00 0.00 ? 35 GLN A NE2  2  
ATOM 1613  H H    . GLN A 1 35 ? -5.500  5.387   -4.838  1.00 0.00 ? 35 GLN A H    2  
ATOM 1614  H HA   . GLN A 1 35 ? -6.359  5.450   -2.217  1.00 0.00 ? 35 GLN A HA   2  
ATOM 1615  H HB2  . GLN A 1 35 ? -6.208  7.316   -4.054  1.00 0.00 ? 35 GLN A HB2  2  
ATOM 1616  H HB3  . GLN A 1 35 ? -7.900  6.919   -4.324  1.00 0.00 ? 35 GLN A HB3  2  
ATOM 1617  H HG2  . GLN A 1 35 ? -8.267  8.477   -2.765  1.00 0.00 ? 35 GLN A HG2  2  
ATOM 1618  H HG3  . GLN A 1 35 ? -7.875  7.179   -1.638  1.00 0.00 ? 35 GLN A HG3  2  
ATOM 1619  H HE21 . GLN A 1 35 ? -6.936  8.307   -0.036  1.00 0.00 ? 35 GLN A HE21 2  
ATOM 1620  H HE22 . GLN A 1 35 ? -5.506  9.259   -0.215  1.00 0.00 ? 35 GLN A HE22 2  
ATOM 1621  N N    . ASN A 1 36 ? -8.572  4.158   -4.258  1.00 0.00 ? 36 ASN A N    2  
ATOM 1622  C CA   . ASN A 1 36 ? -9.827  3.417   -4.320  1.00 0.00 ? 36 ASN A CA   2  
ATOM 1623  C C    . ASN A 1 36 ? -9.593  1.936   -4.617  1.00 0.00 ? 36 ASN A C    2  
ATOM 1624  O O    . ASN A 1 36 ? -10.508 1.232   -5.042  1.00 0.00 ? 36 ASN A O    2  
ATOM 1625  C CB   . ASN A 1 36 ? -10.742 4.023   -5.386  1.00 0.00 ? 36 ASN A CB   2  
ATOM 1626  C CG   . ASN A 1 36 ? -11.618 5.129   -4.834  1.00 0.00 ? 36 ASN A CG   2  
ATOM 1627  O OD1  . ASN A 1 36 ? -12.540 4.880   -4.058  1.00 0.00 ? 36 ASN A OD1  2  
ATOM 1628  N ND2  . ASN A 1 36 ? -11.330 6.361   -5.234  1.00 0.00 ? 36 ASN A ND2  2  
ATOM 1629  H H    . ASN A 1 36 ? -8.054  4.293   -5.079  1.00 0.00 ? 36 ASN A H    2  
ATOM 1630  H HA   . ASN A 1 36 ? -10.308 3.503   -3.357  1.00 0.00 ? 36 ASN A HA   2  
ATOM 1631  H HB2  . ASN A 1 36 ? -10.137 4.434   -6.181  1.00 0.00 ? 36 ASN A HB2  2  
ATOM 1632  H HB3  . ASN A 1 36 ? -11.380 3.249   -5.788  1.00 0.00 ? 36 ASN A HB3  2  
ATOM 1633  H HD21 . ASN A 1 36 ? -10.581 6.484   -5.854  1.00 0.00 ? 36 ASN A HD21 2  
ATOM 1634  H HD22 . ASN A 1 36 ? -11.878 7.097   -4.894  1.00 0.00 ? 36 ASN A HD22 2  
ATOM 1635  N N    . LEU A 1 37 ? -8.371  1.464   -4.381  1.00 0.00 ? 37 LEU A N    2  
ATOM 1636  C CA   . LEU A 1 37 ? -8.042  0.061   -4.615  1.00 0.00 ? 37 LEU A CA   2  
ATOM 1637  C C    . LEU A 1 37 ? -8.419  -0.792  -3.408  1.00 0.00 ? 37 LEU A C    2  
ATOM 1638  O O    . LEU A 1 37 ? -8.509  -0.293  -2.287  1.00 0.00 ? 37 LEU A O    2  
ATOM 1639  C CB   . LEU A 1 37 ? -6.551  -0.101  -4.921  1.00 0.00 ? 37 LEU A CB   2  
ATOM 1640  C CG   . LEU A 1 37 ? -6.178  -1.399  -5.642  1.00 0.00 ? 37 LEU A CG   2  
ATOM 1641  C CD1  . LEU A 1 37 ? -6.659  -1.363  -7.086  1.00 0.00 ? 37 LEU A CD1  2  
ATOM 1642  C CD2  . LEU A 1 37 ? -4.677  -1.632  -5.584  1.00 0.00 ? 37 LEU A CD2  2  
ATOM 1643  H H    . LEU A 1 37 ? -7.681  2.067   -4.036  1.00 0.00 ? 37 LEU A H    2  
ATOM 1644  H HA   . LEU A 1 37 ? -8.614  -0.274  -5.468  1.00 0.00 ? 37 LEU A HA   2  
ATOM 1645  H HB2  . LEU A 1 37 ? -6.235  0.731   -5.532  1.00 0.00 ? 37 LEU A HB2  2  
ATOM 1646  H HB3  . LEU A 1 37 ? -6.009  -0.065  -3.988  1.00 0.00 ? 37 LEU A HB3  2  
ATOM 1647  H HG   . LEU A 1 37 ? -6.664  -2.228  -5.151  1.00 0.00 ? 37 LEU A HG   2  
ATOM 1648  H HD11 . LEU A 1 37 ? -6.540  -0.365  -7.480  1.00 0.00 ? 37 LEU A HD11 2  
ATOM 1649  H HD12 . LEU A 1 37 ? -7.700  -1.646  -7.126  1.00 0.00 ? 37 LEU A HD12 2  
ATOM 1650  H HD13 . LEU A 1 37 ? -6.075  -2.056  -7.676  1.00 0.00 ? 37 LEU A HD13 2  
ATOM 1651  H HD21 . LEU A 1 37 ? -4.461  -2.658  -5.850  1.00 0.00 ? 37 LEU A HD21 2  
ATOM 1652  H HD22 . LEU A 1 37 ? -4.321  -1.439  -4.583  1.00 0.00 ? 37 LEU A HD22 2  
ATOM 1653  H HD23 . LEU A 1 37 ? -4.181  -0.968  -6.276  1.00 0.00 ? 37 LEU A HD23 2  
ATOM 1654  N N    . THR A 1 38 ? -8.641  -2.081  -3.645  1.00 0.00 ? 38 THR A N    2  
ATOM 1655  C CA   . THR A 1 38 ? -9.019  -3.001  -2.579  1.00 0.00 ? 38 THR A CA   2  
ATOM 1656  C C    . THR A 1 38 ? -8.310  -4.336  -2.725  1.00 0.00 ? 38 THR A C    2  
ATOM 1657  O O    . THR A 1 38 ? -7.602  -4.572  -3.702  1.00 0.00 ? 38 THR A O    2  
ATOM 1658  C CB   . THR A 1 38 ? -10.528 -3.242  -2.600  1.00 0.00 ? 38 THR A CB   2  
ATOM 1659  O OG1  . THR A 1 38 ? -11.172 -2.322  -3.463  1.00 0.00 ? 38 THR A OG1  2  
ATOM 1660  C CG2  . THR A 1 38 ? -11.169 -3.124  -1.236  1.00 0.00 ? 38 THR A CG2  2  
ATOM 1661  H H    . THR A 1 38 ? -8.557  -2.420  -4.561  1.00 0.00 ? 38 THR A H    2  
ATOM 1662  H HA   . THR A 1 38 ? -8.742  -2.555  -1.634  1.00 0.00 ? 38 THR A HA   2  
ATOM 1663  H HB   . THR A 1 38 ? -10.716 -4.246  -2.966  1.00 0.00 ? 38 THR A HB   2  
ATOM 1664  H HG1  . THR A 1 38 ? -11.957 -2.728  -3.837  1.00 0.00 ? 38 THR A HG1  2  
ATOM 1665  H HG21 . THR A 1 38 ? -11.181 -4.093  -0.761  1.00 0.00 ? 38 THR A HG21 2  
ATOM 1666  H HG22 . THR A 1 38 ? -12.181 -2.762  -1.343  1.00 0.00 ? 38 THR A HG22 2  
ATOM 1667  H HG23 . THR A 1 38 ? -10.600 -2.433  -0.632  1.00 0.00 ? 38 THR A HG23 2  
ATOM 1668  N N    . ILE A 1 39 ? -8.548  -5.225  -1.769  1.00 0.00 ? 39 ILE A N    2  
ATOM 1669  C CA   . ILE A 1 39 ? -7.991  -6.563  -1.832  1.00 0.00 ? 39 ILE A CA   2  
ATOM 1670  C C    . ILE A 1 39 ? -8.452  -7.242  -3.109  1.00 0.00 ? 39 ILE A C    2  
ATOM 1671  O O    . ILE A 1 39 ? -7.719  -8.016  -3.725  1.00 0.00 ? 39 ILE A O    2  
ATOM 1672  C CB   . ILE A 1 39 ? -8.424  -7.413  -0.625  1.00 0.00 ? 39 ILE A CB   2  
ATOM 1673  C CG1  . ILE A 1 39 ? -7.710  -8.767  -0.642  1.00 0.00 ? 39 ILE A CG1  2  
ATOM 1674  C CG2  . ILE A 1 39 ? -9.933  -7.606  -0.623  1.00 0.00 ? 39 ILE A CG2  2  
ATOM 1675  C CD1  . ILE A 1 39 ? -6.217  -8.665  -0.425  1.00 0.00 ? 39 ILE A CD1  2  
ATOM 1676  H H    . ILE A 1 39 ? -9.152  -4.990  -1.035  1.00 0.00 ? 39 ILE A H    2  
ATOM 1677  H HA   . ILE A 1 39 ? -6.916  -6.484  -1.833  1.00 0.00 ? 39 ILE A HA   2  
ATOM 1678  H HB   . ILE A 1 39 ? -8.156  -6.880  0.272   1.00 0.00 ? 39 ILE A HB   2  
ATOM 1679  H HG12 . ILE A 1 39 ? -8.117  -9.390  0.141   1.00 0.00 ? 39 ILE A HG12 2  
ATOM 1680  H HG13 . ILE A 1 39 ? -7.875  -9.241  -1.598  1.00 0.00 ? 39 ILE A HG13 2  
ATOM 1681  H HG21 . ILE A 1 39 ? -10.192 -8.423  -1.281  1.00 0.00 ? 39 ILE A HG21 2  
ATOM 1682  H HG22 . ILE A 1 39 ? -10.412 -6.701  -0.968  1.00 0.00 ? 39 ILE A HG22 2  
ATOM 1683  H HG23 . ILE A 1 39 ? -10.266 -7.829  0.379   1.00 0.00 ? 39 ILE A HG23 2  
ATOM 1684  H HD11 . ILE A 1 39 ? -5.975  -7.690  -0.029  1.00 0.00 ? 39 ILE A HD11 2  
ATOM 1685  H HD12 . ILE A 1 39 ? -5.706  -8.809  -1.366  1.00 0.00 ? 39 ILE A HD12 2  
ATOM 1686  H HD13 . ILE A 1 39 ? -5.902  -9.426  0.275   1.00 0.00 ? 39 ILE A HD13 2  
ATOM 1687  N N    . GLU A 1 40 ? -9.676  -6.916  -3.505  1.00 0.00 ? 40 GLU A N    2  
ATOM 1688  C CA   . GLU A 1 40 ? -10.264 -7.462  -4.718  1.00 0.00 ? 40 GLU A CA   2  
ATOM 1689  C C    . GLU A 1 40 ? -9.374  -7.181  -5.922  1.00 0.00 ? 40 GLU A C    2  
ATOM 1690  O O    . GLU A 1 40 ? -9.094  -8.074  -6.723  1.00 0.00 ? 40 GLU A O    2  
ATOM 1691  C CB   . GLU A 1 40 ? -11.654 -6.867  -4.946  1.00 0.00 ? 40 GLU A CB   2  
ATOM 1692  C CG   . GLU A 1 40 ? -12.601 -7.063  -3.773  1.00 0.00 ? 40 GLU A CG   2  
ATOM 1693  C CD   . GLU A 1 40 ? -13.714 -8.045  -4.080  1.00 0.00 ? 40 GLU A CD   2  
ATOM 1694  O OE1  . GLU A 1 40 ? -14.395 -7.866  -5.112  1.00 0.00 ? 40 GLU A OE1  2  
ATOM 1695  O OE2  . GLU A 1 40 ? -13.907 -8.990  -3.288  1.00 0.00 ? 40 GLU A OE2  2  
ATOM 1696  H H    . GLU A 1 40 ? -10.195 -6.287  -2.963  1.00 0.00 ? 40 GLU A H    2  
ATOM 1697  H HA   . GLU A 1 40 ? -10.354 -8.526  -4.588  1.00 0.00 ? 40 GLU A HA   2  
ATOM 1698  H HB2  . GLU A 1 40 ? -11.554 -5.806  -5.127  1.00 0.00 ? 40 GLU A HB2  2  
ATOM 1699  H HB3  . GLU A 1 40 ? -12.093 -7.331  -5.817  1.00 0.00 ? 40 GLU A HB3  2  
ATOM 1700  H HG2  . GLU A 1 40 ? -12.037 -7.435  -2.930  1.00 0.00 ? 40 GLU A HG2  2  
ATOM 1701  H HG3  . GLU A 1 40 ? -13.041 -6.111  -3.519  1.00 0.00 ? 40 GLU A HG3  2  
ATOM 1702  N N    . ASP A 1 41 ? -8.927  -5.935  -6.040  1.00 0.00 ? 41 ASP A N    2  
ATOM 1703  C CA   . ASP A 1 41 ? -8.057  -5.538  -7.139  1.00 0.00 ? 41 ASP A CA   2  
ATOM 1704  C C    . ASP A 1 41 ? -6.614  -5.934  -6.849  1.00 0.00 ? 41 ASP A C    2  
ATOM 1705  O O    . ASP A 1 41 ? -5.844  -6.236  -7.762  1.00 0.00 ? 41 ASP A O    2  
ATOM 1706  C CB   . ASP A 1 41 ? -8.147  -4.028  -7.370  1.00 0.00 ? 41 ASP A CB   2  
ATOM 1707  C CG   . ASP A 1 41 ? -9.210  -3.662  -8.388  1.00 0.00 ? 41 ASP A CG   2  
ATOM 1708  O OD1  . ASP A 1 41 ? -9.745  -4.579  -9.045  1.00 0.00 ? 41 ASP A OD1  2  
ATOM 1709  O OD2  . ASP A 1 41 ? -9.507  -2.456  -8.528  1.00 0.00 ? 41 ASP A OD2  2  
ATOM 1710  H H    . ASP A 1 41 ? -9.180  -5.270  -5.363  1.00 0.00 ? 41 ASP A H    2  
ATOM 1711  H HA   . ASP A 1 41 ? -8.387  -6.053  -8.029  1.00 0.00 ? 41 ASP A HA   2  
ATOM 1712  H HB2  . ASP A 1 41 ? -8.387  -3.541  -6.437  1.00 0.00 ? 41 ASP A HB2  2  
ATOM 1713  H HB3  . ASP A 1 41 ? -7.194  -3.667  -7.726  1.00 0.00 ? 41 ASP A HB3  2  
ATOM 1714  N N    . LEU A 1 42 ? -6.258  -5.939  -5.569  1.00 0.00 ? 42 LEU A N    2  
ATOM 1715  C CA   . LEU A 1 42 ? -4.915  -6.313  -5.144  1.00 0.00 ? 42 LEU A CA   2  
ATOM 1716  C C    . LEU A 1 42 ? -4.521  -7.651  -5.756  1.00 0.00 ? 42 LEU A C    2  
ATOM 1717  O O    . LEU A 1 42 ? -3.458  -7.786  -6.362  1.00 0.00 ? 42 LEU A O    2  
ATOM 1718  C CB   . LEU A 1 42 ? -4.847  -6.410  -3.611  1.00 0.00 ? 42 LEU A CB   2  
ATOM 1719  C CG   . LEU A 1 42 ? -4.776  -5.086  -2.816  1.00 0.00 ? 42 LEU A CG   2  
ATOM 1720  C CD1  . LEU A 1 42 ? -3.477  -5.017  -2.030  1.00 0.00 ? 42 LEU A CD1  2  
ATOM 1721  C CD2  . LEU A 1 42 ? -4.916  -3.855  -3.707  1.00 0.00 ? 42 LEU A CD2  2  
ATOM 1722  H H    . LEU A 1 42 ? -6.920  -5.697  -4.892  1.00 0.00 ? 42 LEU A H    2  
ATOM 1723  H HA   . LEU A 1 42 ? -4.229  -5.552  -5.487  1.00 0.00 ? 42 LEU A HA   2  
ATOM 1724  H HB2  . LEU A 1 42 ? -5.721  -6.949  -3.278  1.00 0.00 ? 42 LEU A HB2  2  
ATOM 1725  H HB3  . LEU A 1 42 ? -3.975  -6.994  -3.358  1.00 0.00 ? 42 LEU A HB3  2  
ATOM 1726  H HG   . LEU A 1 42 ? -5.588  -5.066  -2.104  1.00 0.00 ? 42 LEU A HG   2  
ATOM 1727  H HD11 . LEU A 1 42 ? -3.048  -4.031  -2.129  1.00 0.00 ? 42 LEU A HD11 2  
ATOM 1728  H HD12 . LEU A 1 42 ? -2.784  -5.752  -2.414  1.00 0.00 ? 42 LEU A HD12 2  
ATOM 1729  H HD13 . LEU A 1 42 ? -3.675  -5.221  -0.988  1.00 0.00 ? 42 LEU A HD13 2  
ATOM 1730  H HD21 . LEU A 1 42 ? -5.245  -3.016  -3.112  1.00 0.00 ? 42 LEU A HD21 2  
ATOM 1731  H HD22 . LEU A 1 42 ? -5.638  -4.048  -4.484  1.00 0.00 ? 42 LEU A HD22 2  
ATOM 1732  H HD23 . LEU A 1 42 ? -3.960  -3.624  -4.155  1.00 0.00 ? 42 LEU A HD23 2  
ATOM 1733  N N    . GLY A 1 43 ? -5.394  -8.640  -5.589  1.00 0.00 ? 43 GLY A N    2  
ATOM 1734  C CA   . GLY A 1 43 ? -5.141  -9.958  -6.136  1.00 0.00 ? 43 GLY A CA   2  
ATOM 1735  C C    . GLY A 1 43 ? -5.256  -9.986  -7.648  1.00 0.00 ? 43 GLY A C    2  
ATOM 1736  O O    . GLY A 1 43 ? -4.730  -10.887 -8.299  1.00 0.00 ? 43 GLY A O    2  
ATOM 1737  H H    . GLY A 1 43 ? -6.227  -8.466  -5.102  1.00 0.00 ? 43 GLY A H    2  
ATOM 1738  H HA2  . GLY A 1 43 ? -4.146  -10.267 -5.855  1.00 0.00 ? 43 GLY A HA2  2  
ATOM 1739  H HA3  . GLY A 1 43 ? -5.855  -10.652 -5.719  1.00 0.00 ? 43 GLY A HA3  2  
ATOM 1740  N N    . ALA A 1 44 ? -5.949  -8.998  -8.207  1.00 0.00 ? 44 ALA A N    2  
ATOM 1741  C CA   . ALA A 1 44 ? -6.108  -8.906  -9.652  1.00 0.00 ? 44 ALA A CA   2  
ATOM 1742  C C    . ALA A 1 44 ? -4.746  -8.833  -10.327 1.00 0.00 ? 44 ALA A C    2  
ATOM 1743  O O    . ALA A 1 44 ? -4.489  -9.517  -11.317 1.00 0.00 ? 44 ALA A O    2  
ATOM 1744  C CB   . ALA A 1 44 ? -6.952  -7.695  -10.019 1.00 0.00 ? 44 ALA A CB   2  
ATOM 1745  H H    . ALA A 1 44 ? -6.333  -8.299  -7.636  1.00 0.00 ? 44 ALA A H    2  
ATOM 1746  H HA   . ALA A 1 44 ? -6.624  -9.792  -9.992  1.00 0.00 ? 44 ALA A HA   2  
ATOM 1747  H HB1  . ALA A 1 44 ? -6.317  -6.826  -10.109 1.00 0.00 ? 44 ALA A HB1  2  
ATOM 1748  H HB2  . ALA A 1 44 ? -7.689  -7.523  -9.249  1.00 0.00 ? 44 ALA A HB2  2  
ATOM 1749  H HB3  . ALA A 1 44 ? -7.452  -7.875  -10.960 1.00 0.00 ? 44 ALA A HB3  2  
ATOM 1750  N N    . LEU A 1 45 ? -3.867  -8.015  -9.758  1.00 0.00 ? 45 LEU A N    2  
ATOM 1751  C CA   . LEU A 1 45 ? -2.515  -7.858  -10.266 1.00 0.00 ? 45 LEU A CA   2  
ATOM 1752  C C    . LEU A 1 45 ? -1.856  -9.208  -10.512 1.00 0.00 ? 45 LEU A C    2  
ATOM 1753  O O    . LEU A 1 45 ? -1.002  -9.341  -11.386 1.00 0.00 ? 45 LEU A O    2  
ATOM 1754  C CB   . LEU A 1 45 ? -1.691  -7.066  -9.258  1.00 0.00 ? 45 LEU A CB   2  
ATOM 1755  C CG   . LEU A 1 45 ? -1.903  -5.554  -9.305  1.00 0.00 ? 45 LEU A CG   2  
ATOM 1756  C CD1  . LEU A 1 45 ? -3.383  -5.216  -9.206  1.00 0.00 ? 45 LEU A CD1  2  
ATOM 1757  C CD2  . LEU A 1 45 ? -1.126  -4.873  -8.190  1.00 0.00 ? 45 LEU A CD2  2  
ATOM 1758  H H    . LEU A 1 45 ? -4.135  -7.506  -8.962  1.00 0.00 ? 45 LEU A H    2  
ATOM 1759  H HA   . LEU A 1 45 ? -2.563  -7.315  -11.194 1.00 0.00 ? 45 LEU A HA   2  
ATOM 1760  H HB2  . LEU A 1 45 ? -1.944  -7.413  -8.268  1.00 0.00 ? 45 LEU A HB2  2  
ATOM 1761  H HB3  . LEU A 1 45 ? -0.649  -7.275  -9.438  1.00 0.00 ? 45 LEU A HB3  2  
ATOM 1762  H HG   . LEU A 1 45 ? -1.542  -5.179  -10.247 1.00 0.00 ? 45 LEU A HG   2  
ATOM 1763  H HD11 . LEU A 1 45 ? -3.899  -5.606  -10.071 1.00 0.00 ? 45 LEU A HD11 2  
ATOM 1764  H HD12 . LEU A 1 45 ? -3.505  -4.145  -9.166  1.00 0.00 ? 45 LEU A HD12 2  
ATOM 1765  H HD13 . LEU A 1 45 ? -3.794  -5.659  -8.310  1.00 0.00 ? 45 LEU A HD13 2  
ATOM 1766  H HD21 . LEU A 1 45 ? -0.078  -4.846  -8.447  1.00 0.00 ? 45 LEU A HD21 2  
ATOM 1767  H HD22 . LEU A 1 45 ? -1.259  -5.425  -7.272  1.00 0.00 ? 45 LEU A HD22 2  
ATOM 1768  H HD23 . LEU A 1 45 ? -1.491  -3.865  -8.062  1.00 0.00 ? 45 LEU A HD23 2  
ATOM 1769  N N    . LYS A 1 46 ? -2.271  -10.193 -9.724  1.00 0.00 ? 46 LYS A N    2  
ATOM 1770  C CA   . LYS A 1 46 ? -1.730  -11.553 -9.781  1.00 0.00 ? 46 LYS A CA   2  
ATOM 1771  C C    . LYS A 1 46 ? -0.489  -11.693 -8.906  1.00 0.00 ? 46 LYS A C    2  
ATOM 1772  O O    . LYS A 1 46 ? 0.300   -12.624 -9.069  1.00 0.00 ? 46 LYS A O    2  
ATOM 1773  C CB   . LYS A 1 46 ? -1.398  -11.993 -11.205 1.00 0.00 ? 46 LYS A CB   2  
ATOM 1774  C CG   . LYS A 1 46 ? -0.997  -13.448 -11.264 1.00 0.00 ? 46 LYS A CG   2  
ATOM 1775  C CD   . LYS A 1 46 ? -1.908  -14.251 -12.177 1.00 0.00 ? 46 LYS A CD   2  
ATOM 1776  C CE   . LYS A 1 46 ? -1.875  -13.728 -13.603 1.00 0.00 ? 46 LYS A CE   2  
ATOM 1777  N NZ   . LYS A 1 46 ? -2.381  -14.735 -14.575 1.00 0.00 ? 46 LYS A NZ   2  
ATOM 1778  H H    . LYS A 1 46 ? -2.935  -9.985  -9.039  1.00 0.00 ? 46 LYS A H    2  
ATOM 1779  H HA   . LYS A 1 46 ? -2.491  -12.213 -9.392  1.00 0.00 ? 46 LYS A HA   2  
ATOM 1780  H HB2  . LYS A 1 46 ? -2.263  -11.844 -11.836 1.00 0.00 ? 46 LYS A HB2  2  
ATOM 1781  H HB3  . LYS A 1 46 ? -0.576  -11.404 -11.580 1.00 0.00 ? 46 LYS A HB3  2  
ATOM 1782  H HG2  . LYS A 1 46 ? 0.017   -13.517 -11.627 1.00 0.00 ? 46 LYS A HG2  2  
ATOM 1783  H HG3  . LYS A 1 46 ? -1.052  -13.852 -10.263 1.00 0.00 ? 46 LYS A HG3  2  
ATOM 1784  H HD2  . LYS A 1 46 ? -1.585  -15.281 -12.177 1.00 0.00 ? 46 LYS A HD2  2  
ATOM 1785  H HD3  . LYS A 1 46 ? -2.920  -14.190 -11.804 1.00 0.00 ? 46 LYS A HD3  2  
ATOM 1786  H HE2  . LYS A 1 46 ? -2.490  -12.841 -13.662 1.00 0.00 ? 46 LYS A HE2  2  
ATOM 1787  H HE3  . LYS A 1 46 ? -0.856  -13.477 -13.855 1.00 0.00 ? 46 LYS A HE3  2  
ATOM 1788  H HZ1  . LYS A 1 46 ? -1.632  -15.420 -14.804 1.00 0.00 ? 46 LYS A HZ1  2  
ATOM 1789  H HZ2  . LYS A 1 46 ? -2.684  -14.265 -15.453 1.00 0.00 ? 46 LYS A HZ2  2  
ATOM 1790  H HZ3  . LYS A 1 46 ? -3.192  -15.246 -14.173 1.00 0.00 ? 46 LYS A HZ3  2  
ATOM 1791  N N    . ILE A 1 47 ? -0.335  -10.772 -7.970  1.00 0.00 ? 47 ILE A N    2  
ATOM 1792  C CA   . ILE A 1 47 ? 0.787   -10.797 -7.039  1.00 0.00 ? 47 ILE A CA   2  
ATOM 1793  C C    . ILE A 1 47 ? 0.478   -11.720 -5.865  1.00 0.00 ? 47 ILE A C    2  
ATOM 1794  O O    . ILE A 1 47 ? -0.643  -11.730 -5.359  1.00 0.00 ? 47 ILE A O    2  
ATOM 1795  C CB   . ILE A 1 47 ? 1.103   -9.386  -6.499  1.00 0.00 ? 47 ILE A CB   2  
ATOM 1796  C CG1  . ILE A 1 47 ? 0.920   -8.338  -7.597  1.00 0.00 ? 47 ILE A CG1  2  
ATOM 1797  C CG2  . ILE A 1 47 ? 2.515   -9.326  -5.942  1.00 0.00 ? 47 ILE A CG2  2  
ATOM 1798  C CD1  . ILE A 1 47 ? 1.267   -6.934  -7.153  1.00 0.00 ? 47 ILE A CD1  2  
ATOM 1799  H H    . ILE A 1 47 ? -1.005  -10.069 -7.888  1.00 0.00 ? 47 ILE A H    2  
ATOM 1800  H HA   . ILE A 1 47 ? 1.655   -11.166 -7.565  1.00 0.00 ? 47 ILE A HA   2  
ATOM 1801  H HB   . ILE A 1 47 ? 0.418   -9.174  -5.691  1.00 0.00 ? 47 ILE A HB   2  
ATOM 1802  H HG12 . ILE A 1 47 ? 1.557   -8.587  -8.434  1.00 0.00 ? 47 ILE A HG12 2  
ATOM 1803  H HG13 . ILE A 1 47 ? -0.109  -8.340  -7.918  1.00 0.00 ? 47 ILE A HG13 2  
ATOM 1804  H HG21 . ILE A 1 47 ? 3.217   -9.613  -6.711  1.00 0.00 ? 47 ILE A HG21 2  
ATOM 1805  H HG22 . ILE A 1 47 ? 2.601   -10.002 -5.105  1.00 0.00 ? 47 ILE A HG22 2  
ATOM 1806  H HG23 . ILE A 1 47 ? 2.730   -8.319  -5.616  1.00 0.00 ? 47 ILE A HG23 2  
ATOM 1807  H HD11 . ILE A 1 47 ? 2.274   -6.917  -6.765  1.00 0.00 ? 47 ILE A HD11 2  
ATOM 1808  H HD12 . ILE A 1 47 ? 0.579   -6.621  -6.382  1.00 0.00 ? 47 ILE A HD12 2  
ATOM 1809  H HD13 . ILE A 1 47 ? 1.195   -6.262  -7.995  1.00 0.00 ? 47 ILE A HD13 2  
ATOM 1810  N N    . PRO A 1 48 ? 1.465   -12.522 -5.422  1.00 0.00 ? 48 PRO A N    2  
ATOM 1811  C CA   . PRO A 1 48 ? 1.290   -13.454 -4.307  1.00 0.00 ? 48 PRO A CA   2  
ATOM 1812  C C    . PRO A 1 48 ? 0.394   -12.893 -3.205  1.00 0.00 ? 48 PRO A C    2  
ATOM 1813  O O    . PRO A 1 48 ? 0.310   -11.679 -3.018  1.00 0.00 ? 48 PRO A O    2  
ATOM 1814  C CB   . PRO A 1 48 ? 2.718   -13.635 -3.806  1.00 0.00 ? 48 PRO A CB   2  
ATOM 1815  C CG   . PRO A 1 48 ? 3.559   -13.520 -5.034  1.00 0.00 ? 48 PRO A CG   2  
ATOM 1816  C CD   . PRO A 1 48 ? 2.833   -12.583 -5.971  1.00 0.00 ? 48 PRO A CD   2  
ATOM 1817  H HA   . PRO A 1 48 ? 0.899   -14.404 -4.641  1.00 0.00 ? 48 PRO A HA   2  
ATOM 1818  H HB2  . PRO A 1 48 ? 2.954   -12.862 -3.090  1.00 0.00 ? 48 PRO A HB2  2  
ATOM 1819  H HB3  . PRO A 1 48 ? 2.821   -14.606 -3.345  1.00 0.00 ? 48 PRO A HB3  2  
ATOM 1820  H HG2  . PRO A 1 48 ? 4.526   -13.115 -4.776  1.00 0.00 ? 48 PRO A HG2  2  
ATOM 1821  H HG3  . PRO A 1 48 ? 3.672   -14.492 -5.492  1.00 0.00 ? 48 PRO A HG3  2  
ATOM 1822  H HD2  . PRO A 1 48 ? 3.297   -11.610 -5.959  1.00 0.00 ? 48 PRO A HD2  2  
ATOM 1823  H HD3  . PRO A 1 48 ? 2.828   -12.985 -6.973  1.00 0.00 ? 48 PRO A HD3  2  
ATOM 1824  N N    . GLU A 1 49 ? -0.289  -13.784 -2.493  1.00 0.00 ? 49 GLU A N    2  
ATOM 1825  C CA   . GLU A 1 49 ? -1.204  -13.376 -1.432  1.00 0.00 ? 49 GLU A CA   2  
ATOM 1826  C C    . GLU A 1 49 ? -0.501  -13.322 -0.079  1.00 0.00 ? 49 GLU A C    2  
ATOM 1827  O O    . GLU A 1 49 ? -1.147  -13.402 0.967   1.00 0.00 ? 49 GLU A O    2  
ATOM 1828  C CB   . GLU A 1 49 ? -2.392  -14.337 -1.362  1.00 0.00 ? 49 GLU A CB   2  
ATOM 1829  C CG   . GLU A 1 49 ? -2.042  -15.698 -0.785  1.00 0.00 ? 49 GLU A CG   2  
ATOM 1830  C CD   . GLU A 1 49 ? -2.647  -16.841 -1.578  1.00 0.00 ? 49 GLU A CD   2  
ATOM 1831  O OE1  . GLU A 1 49 ? -3.587  -16.590 -2.360  1.00 0.00 ? 49 GLU A OE1  2  
ATOM 1832  O OE2  . GLU A 1 49 ? -2.180  -17.988 -1.416  1.00 0.00 ? 49 GLU A OE2  2  
ATOM 1833  H H    . GLU A 1 49 ? -0.190  -14.738 -2.699  1.00 0.00 ? 49 GLU A H    2  
ATOM 1834  H HA   . GLU A 1 49 ? -1.564  -12.388 -1.673  1.00 0.00 ? 49 GLU A HA   2  
ATOM 1835  H HB2  . GLU A 1 49 ? -3.161  -13.896 -0.745  1.00 0.00 ? 49 GLU A HB2  2  
ATOM 1836  H HB3  . GLU A 1 49 ? -2.783  -14.482 -2.359  1.00 0.00 ? 49 GLU A HB3  2  
ATOM 1837  H HG2  . GLU A 1 49 ? -0.968  -15.809 -0.785  1.00 0.00 ? 49 GLU A HG2  2  
ATOM 1838  H HG3  . GLU A 1 49 ? -2.409  -15.750 0.229   1.00 0.00 ? 49 GLU A HG3  2  
ATOM 1839  N N    . GLN A 1 50 ? 0.818   -13.181 -0.101  1.00 0.00 ? 50 GLN A N    2  
ATOM 1840  C CA   . GLN A 1 50 ? 1.597   -13.115 1.128   1.00 0.00 ? 50 GLN A CA   2  
ATOM 1841  C C    . GLN A 1 50 ? 1.081   -12.006 2.039   1.00 0.00 ? 50 GLN A C    2  
ATOM 1842  O O    . GLN A 1 50 ? 0.901   -12.209 3.240   1.00 0.00 ? 50 GLN A O    2  
ATOM 1843  C CB   . GLN A 1 50 ? 3.073   -12.881 0.807   1.00 0.00 ? 50 GLN A CB   2  
ATOM 1844  C CG   . GLN A 1 50 ? 3.664   -13.926 -0.122  1.00 0.00 ? 50 GLN A CG   2  
ATOM 1845  C CD   . GLN A 1 50 ? 5.059   -13.574 -0.589  1.00 0.00 ? 50 GLN A CD   2  
ATOM 1846  O OE1  . GLN A 1 50 ? 5.365   -12.411 -0.855  1.00 0.00 ? 50 GLN A OE1  2  
ATOM 1847  N NE2  . GLN A 1 50 ? 5.914   -14.582 -0.694  1.00 0.00 ? 50 GLN A NE2  2  
ATOM 1848  H H    . GLN A 1 50 ? 1.281   -13.123 -0.962  1.00 0.00 ? 50 GLN A H    2  
ATOM 1849  H HA   . GLN A 1 50 ? 1.491   -14.061 1.639   1.00 0.00 ? 50 GLN A HA   2  
ATOM 1850  H HB2  . GLN A 1 50 ? 3.180   -11.912 0.340   1.00 0.00 ? 50 GLN A HB2  2  
ATOM 1851  H HB3  . GLN A 1 50 ? 3.636   -12.889 1.729   1.00 0.00 ? 50 GLN A HB3  2  
ATOM 1852  H HG2  . GLN A 1 50 ? 3.708   -14.870 0.399   1.00 0.00 ? 50 GLN A HG2  2  
ATOM 1853  H HG3  . GLN A 1 50 ? 3.026   -14.023 -0.988  1.00 0.00 ? 50 GLN A HG3  2  
ATOM 1854  H HE21 . GLN A 1 50 ? 5.598   -15.480 -0.466  1.00 0.00 ? 50 GLN A HE21 2  
ATOM 1855  H HE22 . GLN A 1 50 ? 6.823   -14.386 -0.994  1.00 0.00 ? 50 GLN A HE22 2  
ATOM 1856  N N    . TYR A 1 51 ? 0.864   -10.826 1.465   1.00 0.00 ? 51 TYR A N    2  
ATOM 1857  C CA   . TYR A 1 51 ? 0.380   -9.682  2.231   1.00 0.00 ? 51 TYR A CA   2  
ATOM 1858  C C    . TYR A 1 51 ? -0.641  -8.874  1.434   1.00 0.00 ? 51 TYR A C    2  
ATOM 1859  O O    . TYR A 1 51 ? -0.710  -7.651  1.559   1.00 0.00 ? 51 TYR A O    2  
ATOM 1860  C CB   . TYR A 1 51 ? 1.548   -8.778  2.642   1.00 0.00 ? 51 TYR A CB   2  
ATOM 1861  C CG   . TYR A 1 51 ? 2.858   -9.510  2.836   1.00 0.00 ? 51 TYR A CG   2  
ATOM 1862  C CD1  . TYR A 1 51 ? 3.116   -10.216 4.007   1.00 0.00 ? 51 TYR A CD1  2  
ATOM 1863  C CD2  . TYR A 1 51 ? 3.835   -9.499  1.849   1.00 0.00 ? 51 TYR A CD2  2  
ATOM 1864  C CE1  . TYR A 1 51 ? 4.311   -10.887 4.185   1.00 0.00 ? 51 TYR A CE1  2  
ATOM 1865  C CE2  . TYR A 1 51 ? 5.032   -10.167 2.021   1.00 0.00 ? 51 TYR A CE2  2  
ATOM 1866  C CZ   . TYR A 1 51 ? 5.265   -10.859 3.191   1.00 0.00 ? 51 TYR A CZ   2  
ATOM 1867  O OH   . TYR A 1 51 ? 6.456   -11.525 3.366   1.00 0.00 ? 51 TYR A OH   2  
ATOM 1868  H H    . TYR A 1 51 ? 1.029   -10.725 0.504   1.00 0.00 ? 51 TYR A H    2  
ATOM 1869  H HA   . TYR A 1 51 ? -0.099  -10.062 3.122   1.00 0.00 ? 51 TYR A HA   2  
ATOM 1870  H HB2  . TYR A 1 51 ? 1.698   -8.030  1.877   1.00 0.00 ? 51 TYR A HB2  2  
ATOM 1871  H HB3  . TYR A 1 51 ? 1.303   -8.287  3.573   1.00 0.00 ? 51 TYR A HB3  2  
ATOM 1872  H HD1  . TYR A 1 51 ? 2.366   -10.236 4.783   1.00 0.00 ? 51 TYR A HD1  2  
ATOM 1873  H HD2  . TYR A 1 51 ? 3.650   -8.956  0.935   1.00 0.00 ? 51 TYR A HD2  2  
ATOM 1874  H HE1  . TYR A 1 51 ? 4.493   -11.429 5.102   1.00 0.00 ? 51 TYR A HE1  2  
ATOM 1875  H HE2  . TYR A 1 51 ? 5.779   -10.145 1.241   1.00 0.00 ? 51 TYR A HE2  2  
ATOM 1876  H HH   . TYR A 1 51 ? 6.781   -11.370 4.256   1.00 0.00 ? 51 TYR A HH   2  
ATOM 1877  N N    . ARG A 1 52 ? -1.430  -9.561  0.613   1.00 0.00 ? 52 ARG A N    2  
ATOM 1878  C CA   . ARG A 1 52 ? -2.442  -8.897  -0.203  1.00 0.00 ? 52 ARG A CA   2  
ATOM 1879  C C    . ARG A 1 52 ? -3.481  -8.203  0.672   1.00 0.00 ? 52 ARG A C    2  
ATOM 1880  O O    . ARG A 1 52 ? -3.784  -7.025  0.480   1.00 0.00 ? 52 ARG A O    2  
ATOM 1881  C CB   . ARG A 1 52 ? -3.130  -9.906  -1.124  1.00 0.00 ? 52 ARG A CB   2  
ATOM 1882  C CG   . ARG A 1 52 ? -3.265  -9.427  -2.560  1.00 0.00 ? 52 ARG A CG   2  
ATOM 1883  C CD   . ARG A 1 52 ? -2.956  -10.540 -3.549  1.00 0.00 ? 52 ARG A CD   2  
ATOM 1884  N NE   . ARG A 1 52 ? -4.105  -11.415 -3.763  1.00 0.00 ? 52 ARG A NE   2  
ATOM 1885  C CZ   . ARG A 1 52 ? -4.045  -12.558 -4.439  1.00 0.00 ? 52 ARG A CZ   2  
ATOM 1886  N NH1  . ARG A 1 52 ? -2.896  -12.961 -4.962  1.00 0.00 ? 52 ARG A NH1  2  
ATOM 1887  N NH2  . ARG A 1 52 ? -5.136  -13.297 -4.591  1.00 0.00 ? 52 ARG A NH2  2  
ATOM 1888  H H    . ARG A 1 52 ? -1.329  -10.533 0.552   1.00 0.00 ? 52 ARG A H    2  
ATOM 1889  H HA   . ARG A 1 52 ? -1.944  -8.152  -0.806  1.00 0.00 ? 52 ARG A HA   2  
ATOM 1890  H HB2  . ARG A 1 52 ? -2.559  -10.822 -1.124  1.00 0.00 ? 52 ARG A HB2  2  
ATOM 1891  H HB3  . ARG A 1 52 ? -4.118  -10.109 -0.740  1.00 0.00 ? 52 ARG A HB3  2  
ATOM 1892  H HG2  . ARG A 1 52 ? -4.276  -9.086  -2.723  1.00 0.00 ? 52 ARG A HG2  2  
ATOM 1893  H HG3  . ARG A 1 52 ? -2.575  -8.612  -2.724  1.00 0.00 ? 52 ARG A HG3  2  
ATOM 1894  H HD2  . ARG A 1 52 ? -2.671  -10.098 -4.492  1.00 0.00 ? 52 ARG A HD2  2  
ATOM 1895  H HD3  . ARG A 1 52 ? -2.135  -11.128 -3.165  1.00 0.00 ? 52 ARG A HD3  2  
ATOM 1896  H HE   . ARG A 1 52 ? -4.965  -11.136 -3.386  1.00 0.00 ? 52 ARG A HE   2  
ATOM 1897  H HH11 . ARG A 1 52 ? -2.072  -12.406 -4.848  1.00 0.00 ? 52 ARG A HH11 2  
ATOM 1898  H HH12 . ARG A 1 52 ? -2.853  -13.823 -5.470  1.00 0.00 ? 52 ARG A HH12 2  
ATOM 1899  H HH21 . ARG A 1 52 ? -6.003  -12.994 -4.198  1.00 0.00 ? 52 ARG A HH21 2  
ATOM 1900  H HH22 . ARG A 1 52 ? -5.090  -14.157 -5.100  1.00 0.00 ? 52 ARG A HH22 2  
ATOM 1901  N N    . MET A 1 53 ? -4.033  -8.945  1.627   1.00 0.00 ? 53 MET A N    2  
ATOM 1902  C CA   . MET A 1 53 ? -5.032  -8.403  2.530   1.00 0.00 ? 53 MET A CA   2  
ATOM 1903  C C    . MET A 1 53 ? -4.407  -7.329  3.423   1.00 0.00 ? 53 MET A C    2  
ATOM 1904  O O    . MET A 1 53 ? -5.065  -6.359  3.797   1.00 0.00 ? 53 MET A O    2  
ATOM 1905  C CB   . MET A 1 53 ? -5.647  -9.551  3.355   1.00 0.00 ? 53 MET A CB   2  
ATOM 1906  C CG   . MET A 1 53 ? -6.142  -9.157  4.737   1.00 0.00 ? 53 MET A CG   2  
ATOM 1907  S SD   . MET A 1 53 ? -7.439  -10.248 5.352   1.00 0.00 ? 53 MET A SD   2  
ATOM 1908  C CE   . MET A 1 53 ? -6.469  -11.449 6.261   1.00 0.00 ? 53 MET A CE   2  
ATOM 1909  H H    . MET A 1 53 ? -3.750  -9.874  1.740   1.00 0.00 ? 53 MET A H    2  
ATOM 1910  H HA   . MET A 1 53 ? -5.807  -7.947  1.931   1.00 0.00 ? 53 MET A HA   2  
ATOM 1911  H HB2  . MET A 1 53 ? -6.483  -9.958  2.806   1.00 0.00 ? 53 MET A HB2  2  
ATOM 1912  H HB3  . MET A 1 53 ? -4.902  -10.324 3.475   1.00 0.00 ? 53 MET A HB3  2  
ATOM 1913  H HG2  . MET A 1 53 ? -5.306  -9.192  5.419   1.00 0.00 ? 53 MET A HG2  2  
ATOM 1914  H HG3  . MET A 1 53 ? -6.525  -8.151  4.691   1.00 0.00 ? 53 MET A HG3  2  
ATOM 1915  H HE1  . MET A 1 53 ? -7.057  -12.341 6.418   1.00 0.00 ? 53 MET A HE1  2  
ATOM 1916  H HE2  . MET A 1 53 ? -6.183  -11.033 7.216   1.00 0.00 ? 53 MET A HE2  2  
ATOM 1917  H HE3  . MET A 1 53 ? -5.583  -11.696 5.695   1.00 0.00 ? 53 MET A HE3  2  
ATOM 1918  N N    . THR A 1 54 ? -3.131  -7.506  3.743   1.00 0.00 ? 54 THR A N    2  
ATOM 1919  C CA   . THR A 1 54 ? -2.412  -6.548  4.573   1.00 0.00 ? 54 THR A CA   2  
ATOM 1920  C C    . THR A 1 54 ? -2.403  -5.171  3.920   1.00 0.00 ? 54 THR A C    2  
ATOM 1921  O O    . THR A 1 54 ? -2.748  -4.169  4.549   1.00 0.00 ? 54 THR A O    2  
ATOM 1922  C CB   . THR A 1 54 ? -0.979  -7.028  4.810   1.00 0.00 ? 54 THR A CB   2  
ATOM 1923  O OG1  . THR A 1 54 ? -0.972  -8.237  5.550   1.00 0.00 ? 54 THR A OG1  2  
ATOM 1924  C CG2  . THR A 1 54 ? -0.126  -6.026  5.557   1.00 0.00 ? 54 THR A CG2  2  
ATOM 1925  H H    . THR A 1 54 ? -2.659  -8.296  3.408   1.00 0.00 ? 54 THR A H    2  
ATOM 1926  H HA   . THR A 1 54 ? -2.924  -6.482  5.522   1.00 0.00 ? 54 THR A HA   2  
ATOM 1927  H HB   . THR A 1 54 ? -0.509  -7.211  3.856   1.00 0.00 ? 54 THR A HB   2  
ATOM 1928  H HG1  . THR A 1 54 ? -0.232  -8.780  5.269   1.00 0.00 ? 54 THR A HG1  2  
ATOM 1929  H HG21 . THR A 1 54 ? -0.665  -5.670  6.422   1.00 0.00 ? 54 THR A HG21 2  
ATOM 1930  H HG22 . THR A 1 54 ? 0.102   -5.193  4.906   1.00 0.00 ? 54 THR A HG22 2  
ATOM 1931  H HG23 . THR A 1 54 ? 0.792   -6.499  5.872   1.00 0.00 ? 54 THR A HG23 2  
ATOM 1932  N N    . ILE A 1 55 ? -2.017  -5.130  2.649   1.00 0.00 ? 55 ILE A N    2  
ATOM 1933  C CA   . ILE A 1 55 ? -1.975  -3.878  1.906   1.00 0.00 ? 55 ILE A CA   2  
ATOM 1934  C C    . ILE A 1 55 ? -3.368  -3.271  1.789   1.00 0.00 ? 55 ILE A C    2  
ATOM 1935  O O    . ILE A 1 55 ? -3.542  -2.062  1.937   1.00 0.00 ? 55 ILE A O    2  
ATOM 1936  C CB   . ILE A 1 55 ? -1.387  -4.075  0.496   1.00 0.00 ? 55 ILE A CB   2  
ATOM 1937  C CG1  . ILE A 1 55 ? 0.012   -4.689  0.585   1.00 0.00 ? 55 ILE A CG1  2  
ATOM 1938  C CG2  . ILE A 1 55 ? -1.342  -2.750  -0.249  1.00 0.00 ? 55 ILE A CG2  2  
ATOM 1939  C CD1  . ILE A 1 55 ? 0.473   -5.340  -0.700  1.00 0.00 ? 55 ILE A CD1  2  
ATOM 1940  H H    . ILE A 1 55 ? -1.763  -5.963  2.199   1.00 0.00 ? 55 ILE A H    2  
ATOM 1941  H HA   . ILE A 1 55 ? -1.338  -3.192  2.443   1.00 0.00 ? 55 ILE A HA   2  
ATOM 1942  H HB   . ILE A 1 55 ? -2.034  -4.745  -0.048  1.00 0.00 ? 55 ILE A HB   2  
ATOM 1943  H HG12 . ILE A 1 55 ? 0.722   -3.915  0.838   1.00 0.00 ? 55 ILE A HG12 2  
ATOM 1944  H HG13 . ILE A 1 55 ? 0.019   -5.443  1.359   1.00 0.00 ? 55 ILE A HG13 2  
ATOM 1945  H HG21 . ILE A 1 55 ? -0.776  -2.869  -1.160  1.00 0.00 ? 55 ILE A HG21 2  
ATOM 1946  H HG22 . ILE A 1 55 ? -0.871  -2.004  0.373   1.00 0.00 ? 55 ILE A HG22 2  
ATOM 1947  H HG23 . ILE A 1 55 ? -2.348  -2.437  -0.488  1.00 0.00 ? 55 ILE A HG23 2  
ATOM 1948  H HD11 . ILE A 1 55 ? -0.365  -5.819  -1.182  1.00 0.00 ? 55 ILE A HD11 2  
ATOM 1949  H HD12 . ILE A 1 55 ? 1.231   -6.077  -0.479  1.00 0.00 ? 55 ILE A HD12 2  
ATOM 1950  H HD13 . ILE A 1 55 ? 0.885   -4.588  -1.357  1.00 0.00 ? 55 ILE A HD13 2  
ATOM 1951  N N    . TRP A 1 56 ? -4.361  -4.118  1.533   1.00 0.00 ? 56 TRP A N    2  
ATOM 1952  C CA   . TRP A 1 56 ? -5.738  -3.661  1.428   1.00 0.00 ? 56 TRP A CA   2  
ATOM 1953  C C    . TRP A 1 56 ? -6.154  -2.949  2.713   1.00 0.00 ? 56 TRP A C    2  
ATOM 1954  O O    . TRP A 1 56 ? -6.649  -1.822  2.679   1.00 0.00 ? 56 TRP A O    2  
ATOM 1955  C CB   . TRP A 1 56 ? -6.660  -4.851  1.138   1.00 0.00 ? 56 TRP A CB   2  
ATOM 1956  C CG   . TRP A 1 56 ? -8.113  -4.576  1.378   1.00 0.00 ? 56 TRP A CG   2  
ATOM 1957  C CD1  . TRP A 1 56 ? -8.806  -3.449  1.043   1.00 0.00 ? 56 TRP A CD1  2  
ATOM 1958  C CD2  . TRP A 1 56 ? -9.046  -5.446  2.020   1.00 0.00 ? 56 TRP A CD2  2  
ATOM 1959  N NE1  . TRP A 1 56 ? -10.118 -3.573  1.434   1.00 0.00 ? 56 TRP A NE1  2  
ATOM 1960  C CE2  . TRP A 1 56 ? -10.288 -4.789  2.034   1.00 0.00 ? 56 TRP A CE2  2  
ATOM 1961  C CE3  . TRP A 1 56 ? -8.950  -6.722  2.578   1.00 0.00 ? 56 TRP A CE3  2  
ATOM 1962  C CZ2  . TRP A 1 56 ? -11.426 -5.359  2.586   1.00 0.00 ? 56 TRP A CZ2  2  
ATOM 1963  C CZ3  . TRP A 1 56 ? -10.084 -7.292  3.128   1.00 0.00 ? 56 TRP A CZ3  2  
ATOM 1964  C CH2  . TRP A 1 56 ? -11.308 -6.611  3.129   1.00 0.00 ? 56 TRP A CH2  2  
ATOM 1965  H H    . TRP A 1 56 ? -4.168  -5.076  1.438   1.00 0.00 ? 56 TRP A H    2  
ATOM 1966  H HA   . TRP A 1 56 ? -5.794  -2.962  0.607   1.00 0.00 ? 56 TRP A HA   2  
ATOM 1967  H HB2  . TRP A 1 56 ? -6.545  -5.140  0.103   1.00 0.00 ? 56 TRP A HB2  2  
ATOM 1968  H HB3  . TRP A 1 56 ? -6.372  -5.680  1.768   1.00 0.00 ? 56 TRP A HB3  2  
ATOM 1969  H HD1  . TRP A 1 56 ? -8.374  -2.596  0.544   1.00 0.00 ? 56 TRP A HD1  2  
ATOM 1970  H HE1  . TRP A 1 56 ? -10.820 -2.901  1.306   1.00 0.00 ? 56 TRP A HE1  2  
ATOM 1971  H HE3  . TRP A 1 56 ? -8.010  -7.258  2.585   1.00 0.00 ? 56 TRP A HE3  2  
ATOM 1972  H HZ2  . TRP A 1 56 ? -12.373 -4.843  2.592   1.00 0.00 ? 56 TRP A HZ2  2  
ATOM 1973  H HZ3  . TRP A 1 56 ? -10.030 -8.278  3.566   1.00 0.00 ? 56 TRP A HZ3  2  
ATOM 1974  H HH2  . TRP A 1 56 ? -12.169 -7.093  3.569   1.00 0.00 ? 56 TRP A HH2  2  
ATOM 1975  N N    . ARG A 1 57 ? -5.935  -3.611  3.846   1.00 0.00 ? 57 ARG A N    2  
ATOM 1976  C CA   . ARG A 1 57 ? -6.267  -3.032  5.145   1.00 0.00 ? 57 ARG A CA   2  
ATOM 1977  C C    . ARG A 1 57 ? -5.676  -1.635  5.271   1.00 0.00 ? 57 ARG A C    2  
ATOM 1978  O O    . ARG A 1 57 ? -6.359  -0.691  5.669   1.00 0.00 ? 57 ARG A O    2  
ATOM 1979  C CB   . ARG A 1 57 ? -5.751  -3.925  6.276   1.00 0.00 ? 57 ARG A CB   2  
ATOM 1980  C CG   . ARG A 1 57 ? -6.109  -5.393  6.109   1.00 0.00 ? 57 ARG A CG   2  
ATOM 1981  C CD   . ARG A 1 57 ? -7.020  -5.875  7.228   1.00 0.00 ? 57 ARG A CD   2  
ATOM 1982  N NE   . ARG A 1 57 ? -6.285  -6.604  8.257   1.00 0.00 ? 57 ARG A NE   2  
ATOM 1983  C CZ   . ARG A 1 57 ? -6.782  -6.885  9.458   1.00 0.00 ? 57 ARG A CZ   2  
ATOM 1984  N NH1  . ARG A 1 57 ? -8.010  -6.498  9.775   1.00 0.00 ? 57 ARG A NH1  2  
ATOM 1985  N NH2  . ARG A 1 57 ? -6.052  -7.552  10.341  1.00 0.00 ? 57 ARG A NH2  2  
ATOM 1986  H H    . ARG A 1 57 ? -5.531  -4.501  3.809   1.00 0.00 ? 57 ARG A H    2  
ATOM 1987  H HA   . ARG A 1 57 ? -7.341  -2.963  5.211   1.00 0.00 ? 57 ARG A HA   2  
ATOM 1988  H HB2  . ARG A 1 57 ? -4.676  -3.842  6.323   1.00 0.00 ? 57 ARG A HB2  2  
ATOM 1989  H HB3  . ARG A 1 57 ? -6.171  -3.579  7.210   1.00 0.00 ? 57 ARG A HB3  2  
ATOM 1990  H HG2  . ARG A 1 57 ? -6.614  -5.525  5.164   1.00 0.00 ? 57 ARG A HG2  2  
ATOM 1991  H HG3  . ARG A 1 57 ? -5.201  -5.979  6.120   1.00 0.00 ? 57 ARG A HG3  2  
ATOM 1992  H HD2  . ARG A 1 57 ? -7.498  -5.019  7.679   1.00 0.00 ? 57 ARG A HD2  2  
ATOM 1993  H HD3  . ARG A 1 57 ? -7.772  -6.526  6.807   1.00 0.00 ? 57 ARG A HD3  2  
ATOM 1994  H HE   . ARG A 1 57 ? -5.375  -6.898  8.043   1.00 0.00 ? 57 ARG A HE   2  
ATOM 1995  H HH11 . ARG A 1 57 ? -8.563  -5.996  9.112   1.00 0.00 ? 57 ARG A HH11 2  
ATOM 1996  H HH12 . ARG A 1 57 ? -8.383  -6.711  10.679  1.00 0.00 ? 57 ARG A HH12 2  
ATOM 1997  H HH21 . ARG A 1 57 ? -5.125  -7.845  10.105  1.00 0.00 ? 57 ARG A HH21 2  
ATOM 1998  H HH22 . ARG A 1 57 ? -6.428  -7.762  11.244  1.00 0.00 ? 57 ARG A HH22 2  
ATOM 1999  N N    . GLY A 1 58 ? -4.406  -1.508  4.906   1.00 0.00 ? 58 GLY A N    2  
ATOM 2000  C CA   . GLY A 1 58 ? -3.750  -0.216  4.947   1.00 0.00 ? 58 GLY A CA   2  
ATOM 2001  C C    . GLY A 1 58 ? -4.352  0.746   3.946   1.00 0.00 ? 58 GLY A C    2  
ATOM 2002  O O    . GLY A 1 58 ? -4.507  1.934   4.227   1.00 0.00 ? 58 GLY A O    2  
ATOM 2003  H H    . GLY A 1 58 ? -3.920  -2.292  4.579   1.00 0.00 ? 58 GLY A H    2  
ATOM 2004  H HA2  . GLY A 1 58 ? -3.850  0.199   5.938   1.00 0.00 ? 58 GLY A HA2  2  
ATOM 2005  H HA3  . GLY A 1 58 ? -2.702  -0.346  4.724   1.00 0.00 ? 58 GLY A HA3  2  
ATOM 2006  N N    . LEU A 1 59 ? -4.711  0.223   2.777   1.00 0.00 ? 59 LEU A N    2  
ATOM 2007  C CA   . LEU A 1 59 ? -5.334  1.029   1.737   1.00 0.00 ? 59 LEU A CA   2  
ATOM 2008  C C    . LEU A 1 59 ? -6.658  1.596   2.233   1.00 0.00 ? 59 LEU A C    2  
ATOM 2009  O O    . LEU A 1 59 ? -7.024  2.727   1.912   1.00 0.00 ? 59 LEU A O    2  
ATOM 2010  C CB   . LEU A 1 59 ? -5.559  0.188   0.477   1.00 0.00 ? 59 LEU A CB   2  
ATOM 2011  C CG   . LEU A 1 59 ? -4.870  0.707   -0.788  1.00 0.00 ? 59 LEU A CG   2  
ATOM 2012  C CD1  . LEU A 1 59 ? -3.448  1.156   -0.484  1.00 0.00 ? 59 LEU A CD1  2  
ATOM 2013  C CD2  . LEU A 1 59 ? -4.869  -0.367  -1.865  1.00 0.00 ? 59 LEU A CD2  2  
ATOM 2014  H H    . LEU A 1 59 ? -4.575  -0.736  2.620   1.00 0.00 ? 59 LEU A H    2  
ATOM 2015  H HA   . LEU A 1 59 ? -4.667  1.847   1.506   1.00 0.00 ? 59 LEU A HA   2  
ATOM 2016  H HB2  . LEU A 1 59 ? -5.202  -0.812  0.671   1.00 0.00 ? 59 LEU A HB2  2  
ATOM 2017  H HB3  . LEU A 1 59 ? -6.621  0.141   0.288   1.00 0.00 ? 59 LEU A HB3  2  
ATOM 2018  H HG   . LEU A 1 59 ? -5.416  1.559   -1.166  1.00 0.00 ? 59 LEU A HG   2  
ATOM 2019  H HD11 . LEU A 1 59 ? -3.389  2.231   -0.551  1.00 0.00 ? 59 LEU A HD11 2  
ATOM 2020  H HD12 . LEU A 1 59 ? -2.771  0.713   -1.199  1.00 0.00 ? 59 LEU A HD12 2  
ATOM 2021  H HD13 . LEU A 1 59 ? -3.177  0.840   0.513   1.00 0.00 ? 59 LEU A HD13 2  
ATOM 2022  H HD21 . LEU A 1 59 ? -4.373  0.011   -2.747  1.00 0.00 ? 59 LEU A HD21 2  
ATOM 2023  H HD22 . LEU A 1 59 ? -5.886  -0.631  -2.110  1.00 0.00 ? 59 LEU A HD22 2  
ATOM 2024  H HD23 . LEU A 1 59 ? -4.346  -1.240  -1.503  1.00 0.00 ? 59 LEU A HD23 2  
ATOM 2025  N N    . GLN A 1 60 ? -7.371  0.801   3.026   1.00 0.00 ? 60 GLN A N    2  
ATOM 2026  C CA   . GLN A 1 60 ? -8.643  1.229   3.593   1.00 0.00 ? 60 GLN A CA   2  
ATOM 2027  C C    . GLN A 1 60 ? -8.422  2.367   4.582   1.00 0.00 ? 60 GLN A C    2  
ATOM 2028  O O    . GLN A 1 60 ? -9.291  3.216   4.774   1.00 0.00 ? 60 GLN A O    2  
ATOM 2029  C CB   . GLN A 1 60 ? -9.337  0.056   4.290   1.00 0.00 ? 60 GLN A CB   2  
ATOM 2030  C CG   . GLN A 1 60 ? -9.719  -1.073  3.346   1.00 0.00 ? 60 GLN A CG   2  
ATOM 2031  C CD   . GLN A 1 60 ? -10.517 -2.165  4.033   1.00 0.00 ? 60 GLN A CD   2  
ATOM 2032  O OE1  . GLN A 1 60 ? -11.711 -2.009  4.290   1.00 0.00 ? 60 GLN A OE1  2  
ATOM 2033  N NE2  . GLN A 1 60 ? -9.859  -3.279  4.333   1.00 0.00 ? 60 GLN A NE2  2  
ATOM 2034  H H    . GLN A 1 60 ? -7.017  -0.085  3.256   1.00 0.00 ? 60 GLN A H    2  
ATOM 2035  H HA   . GLN A 1 60 ? -9.268  1.581   2.785   1.00 0.00 ? 60 GLN A HA   2  
ATOM 2036  H HB2  . GLN A 1 60 ? -8.674  -0.344  5.043   1.00 0.00 ? 60 GLN A HB2  2  
ATOM 2037  H HB3  . GLN A 1 60 ? -10.236 0.416   4.768   1.00 0.00 ? 60 GLN A HB3  2  
ATOM 2038  H HG2  . GLN A 1 60 ? -10.315 -0.666  2.542   1.00 0.00 ? 60 GLN A HG2  2  
ATOM 2039  H HG3  . GLN A 1 60 ? -8.817  -1.508  2.941   1.00 0.00 ? 60 GLN A HG3  2  
ATOM 2040  H HE21 . GLN A 1 60 ? -8.909  -3.333  4.099   1.00 0.00 ? 60 GLN A HE21 2  
ATOM 2041  H HE22 . GLN A 1 60 ? -10.350 -4.002  4.777   1.00 0.00 ? 60 GLN A HE22 2  
ATOM 2042  N N    . ASP A 1 61 ? -7.244  2.378   5.196   1.00 0.00 ? 61 ASP A N    2  
ATOM 2043  C CA   . ASP A 1 61 ? -6.888  3.416   6.153   1.00 0.00 ? 61 ASP A CA   2  
ATOM 2044  C C    . ASP A 1 61 ? -6.820  4.776   5.468   1.00 0.00 ? 61 ASP A C    2  
ATOM 2045  O O    . ASP A 1 61 ? -7.120  5.806   6.072   1.00 0.00 ? 61 ASP A O    2  
ATOM 2046  C CB   . ASP A 1 61 ? -5.541  3.092   6.804   1.00 0.00 ? 61 ASP A CB   2  
ATOM 2047  C CG   . ASP A 1 61 ? -5.476  3.536   8.251   1.00 0.00 ? 61 ASP A CG   2  
ATOM 2048  O OD1  . ASP A 1 61 ? -6.243  4.446   8.629   1.00 0.00 ? 61 ASP A OD1  2  
ATOM 2049  O OD2  . ASP A 1 61 ? -4.656  2.975   9.008   1.00 0.00 ? 61 ASP A OD2  2  
ATOM 2050  H H    . ASP A 1 61 ? -6.592  1.676   4.992   1.00 0.00 ? 61 ASP A H    2  
ATOM 2051  H HA   . ASP A 1 61 ? -7.653  3.446   6.915   1.00 0.00 ? 61 ASP A HA   2  
ATOM 2052  H HB2  . ASP A 1 61 ? -5.376  2.024   6.764   1.00 0.00 ? 61 ASP A HB2  2  
ATOM 2053  H HB3  . ASP A 1 61 ? -4.755  3.594   6.257   1.00 0.00 ? 61 ASP A HB3  2  
ATOM 2054  N N    . LEU A 1 62 ? -6.423  4.769   4.199   1.00 0.00 ? 62 LEU A N    2  
ATOM 2055  C CA   . LEU A 1 62 ? -6.318  5.995   3.421   1.00 0.00 ? 62 LEU A CA   2  
ATOM 2056  C C    . LEU A 1 62 ? -7.698  6.577   3.137   1.00 0.00 ? 62 LEU A C    2  
ATOM 2057  O O    . LEU A 1 62 ? -7.924  7.776   3.299   1.00 0.00 ? 62 LEU A O    2  
ATOM 2058  C CB   . LEU A 1 62 ? -5.584  5.722   2.105   1.00 0.00 ? 62 LEU A CB   2  
ATOM 2059  C CG   . LEU A 1 62 ? -4.260  4.971   2.250   1.00 0.00 ? 62 LEU A CG   2  
ATOM 2060  C CD1  . LEU A 1 62 ? -3.926  4.224   0.969   1.00 0.00 ? 62 LEU A CD1  2  
ATOM 2061  C CD2  . LEU A 1 62 ? -3.142  5.935   2.618   1.00 0.00 ? 62 LEU A CD2  2  
ATOM 2062  H H    . LEU A 1 62 ? -6.201  3.914   3.774   1.00 0.00 ? 62 LEU A H    2  
ATOM 2063  H HA   . LEU A 1 62 ? -5.750  6.709   4.000   1.00 0.00 ? 62 LEU A HA   2  
ATOM 2064  H HB2  . LEU A 1 62 ? -6.234  5.140   1.468   1.00 0.00 ? 62 LEU A HB2  2  
ATOM 2065  H HB3  . LEU A 1 62 ? -5.387  6.668   1.624   1.00 0.00 ? 62 LEU A HB3  2  
ATOM 2066  H HG   . LEU A 1 62 ? -4.350  4.246   3.046   1.00 0.00 ? 62 LEU A HG   2  
ATOM 2067  H HD11 . LEU A 1 62 ? -4.820  3.759   0.580   1.00 0.00 ? 62 LEU A HD11 2  
ATOM 2068  H HD12 . LEU A 1 62 ? -3.186  3.465   1.177   1.00 0.00 ? 62 LEU A HD12 2  
ATOM 2069  H HD13 . LEU A 1 62 ? -3.536  4.917   0.239   1.00 0.00 ? 62 LEU A HD13 2  
ATOM 2070  H HD21 . LEU A 1 62 ? -3.482  6.598   3.399   1.00 0.00 ? 62 LEU A HD21 2  
ATOM 2071  H HD22 . LEU A 1 62 ? -2.865  6.513   1.749   1.00 0.00 ? 62 LEU A HD22 2  
ATOM 2072  H HD23 . LEU A 1 62 ? -2.286  5.377   2.967   1.00 0.00 ? 62 LEU A HD23 2  
ATOM 2073  N N    . LYS A 1 63 ? -8.618  5.717   2.716   1.00 0.00 ? 63 LYS A N    2  
ATOM 2074  C CA   . LYS A 1 63 ? -9.979  6.139   2.409   1.00 0.00 ? 63 LYS A CA   2  
ATOM 2075  C C    . LYS A 1 63 ? -10.669 6.699   3.648   1.00 0.00 ? 63 LYS A C    2  
ATOM 2076  O O    . LYS A 1 63 ? -11.198 7.810   3.628   1.00 0.00 ? 63 LYS A O    2  
ATOM 2077  C CB   . LYS A 1 63 ? -10.784 4.965   1.848   1.00 0.00 ? 63 LYS A CB   2  
ATOM 2078  C CG   . LYS A 1 63 ? -11.521 5.291   0.560   1.00 0.00 ? 63 LYS A CG   2  
ATOM 2079  C CD   . LYS A 1 63 ? -12.342 6.565   0.692   1.00 0.00 ? 63 LYS A CD   2  
ATOM 2080  C CE   . LYS A 1 63 ? -11.845 7.648   -0.251  1.00 0.00 ? 63 LYS A CE   2  
ATOM 2081  N NZ   . LYS A 1 63 ? -12.530 7.593   -1.572  1.00 0.00 ? 63 LYS A NZ   2  
ATOM 2082  H H    . LYS A 1 63 ? -8.374  4.774   2.606   1.00 0.00 ? 63 LYS A H    2  
ATOM 2083  H HA   . LYS A 1 63 ? -9.923  6.918   1.661   1.00 0.00 ? 63 LYS A HA   2  
ATOM 2084  H HB2  . LYS A 1 63 ? -10.110 4.144   1.652   1.00 0.00 ? 63 LYS A HB2  2  
ATOM 2085  H HB3  . LYS A 1 63 ? -11.509 4.655   2.586   1.00 0.00 ? 63 LYS A HB3  2  
ATOM 2086  H HG2  . LYS A 1 63 ? -10.800 5.421   -0.234  1.00 0.00 ? 63 LYS A HG2  2  
ATOM 2087  H HG3  . LYS A 1 63 ? -12.183 4.473   0.318   1.00 0.00 ? 63 LYS A HG3  2  
ATOM 2088  H HD2  . LYS A 1 63 ? -13.373 6.343   0.458   1.00 0.00 ? 63 LYS A HD2  2  
ATOM 2089  H HD3  . LYS A 1 63 ? -12.270 6.924   1.708   1.00 0.00 ? 63 LYS A HD3  2  
ATOM 2090  H HE2  . LYS A 1 63 ? -12.030 8.612   0.199   1.00 0.00 ? 63 LYS A HE2  2  
ATOM 2091  H HE3  . LYS A 1 63 ? -10.783 7.519   -0.400  1.00 0.00 ? 63 LYS A HE3  2  
ATOM 2092  H HZ1  . LYS A 1 63 ? -11.839 7.727   -2.339  1.00 0.00 ? 63 LYS A HZ1  2  
ATOM 2093  H HZ2  . LYS A 1 63 ? -13.249 8.341   -1.633  1.00 0.00 ? 63 LYS A HZ2  2  
ATOM 2094  H HZ3  . LYS A 1 63 ? -12.993 6.670   -1.696  1.00 0.00 ? 63 LYS A HZ3  2  
ATOM 2095  N N    . GLN A 1 64 ? -10.663 5.920   4.725   1.00 0.00 ? 64 GLN A N    2  
ATOM 2096  C CA   . GLN A 1 64 ? -11.293 6.336   5.973   1.00 0.00 ? 64 GLN A CA   2  
ATOM 2097  C C    . GLN A 1 64 ? -10.581 7.546   6.569   1.00 0.00 ? 64 GLN A C    2  
ATOM 2098  O O    . GLN A 1 64 ? -11.221 8.471   7.068   1.00 0.00 ? 64 GLN A O    2  
ATOM 2099  C CB   . GLN A 1 64 ? -11.289 5.182   6.979   1.00 0.00 ? 64 GLN A CB   2  
ATOM 2100  C CG   . GLN A 1 64 ? -9.912  4.873   7.544   1.00 0.00 ? 64 GLN A CG   2  
ATOM 2101  C CD   . GLN A 1 64 ? -9.874  3.561   8.303   1.00 0.00 ? 64 GLN A CD   2  
ATOM 2102  O OE1  . GLN A 1 64 ? -10.655 2.651   8.031   1.00 0.00 ? 64 GLN A OE1  2  
ATOM 2103  N NE2  . GLN A 1 64 ? -8.961  3.459   9.262   1.00 0.00 ? 64 GLN A NE2  2  
ATOM 2104  H H    . GLN A 1 64 ? -10.227 5.043   4.679   1.00 0.00 ? 64 GLN A H    2  
ATOM 2105  H HA   . GLN A 1 64 ? -12.315 6.608   5.752   1.00 0.00 ? 64 GLN A HA   2  
ATOM 2106  H HB2  . GLN A 1 64 ? -11.944 5.433   7.799   1.00 0.00 ? 64 GLN A HB2  2  
ATOM 2107  H HB3  . GLN A 1 64 ? -11.661 4.293   6.490   1.00 0.00 ? 64 GLN A HB3  2  
ATOM 2108  H HG2  . GLN A 1 64 ? -9.206  4.821   6.729   1.00 0.00 ? 64 GLN A HG2  2  
ATOM 2109  H HG3  . GLN A 1 64 ? -9.627  5.669   8.217   1.00 0.00 ? 64 GLN A HG3  2  
ATOM 2110  H HE21 . GLN A 1 64 ? -8.372  4.226   9.423   1.00 0.00 ? 64 GLN A HE21 2  
ATOM 2111  H HE22 . GLN A 1 64 ? -8.914  2.623   9.768   1.00 0.00 ? 64 GLN A HE22 2  
ATOM 2112  N N    . GLY A 1 65 ? -9.253  7.529   6.519   1.00 0.00 ? 65 GLY A N    2  
ATOM 2113  C CA   . GLY A 1 65 ? -8.477  8.627   7.064   1.00 0.00 ? 65 GLY A CA   2  
ATOM 2114  C C    . GLY A 1 65 ? -7.403  9.110   6.110   1.00 0.00 ? 65 GLY A C    2  
ATOM 2115  O O    . GLY A 1 65 ? -6.803  8.316   5.386   1.00 0.00 ? 65 GLY A O    2  
ATOM 2116  H H    . GLY A 1 65 ? -8.796  6.763   6.112   1.00 0.00 ? 65 GLY A H    2  
ATOM 2117  H HA2  . GLY A 1 65 ? -9.143  9.448   7.286   1.00 0.00 ? 65 GLY A HA2  2  
ATOM 2118  H HA3  . GLY A 1 65 ? -8.009  8.300   7.981   1.00 0.00 ? 65 GLY A HA3  2  
ATOM 2119  N N    . HIS A 1 66 ? -7.157  10.418  6.111   1.00 0.00 ? 66 HIS A N    2  
ATOM 2120  C CA   . HIS A 1 66 ? -6.146  11.007  5.240   1.00 0.00 ? 66 HIS A CA   2  
ATOM 2121  C C    . HIS A 1 66 ? -5.167  11.858  6.041   1.00 0.00 ? 66 HIS A C    2  
ATOM 2122  O O    . HIS A 1 66 ? -5.386  12.130  7.221   1.00 0.00 ? 66 HIS A O    2  
ATOM 2123  C CB   . HIS A 1 66 ? -6.808  11.860  4.157   1.00 0.00 ? 66 HIS A CB   2  
ATOM 2124  C CG   . HIS A 1 66 ? -8.070  11.268  3.614   1.00 0.00 ? 66 HIS A CG   2  
ATOM 2125  N ND1  . HIS A 1 66 ? -8.189  10.802  2.321   1.00 0.00 ? 66 HIS A ND1  2  
ATOM 2126  C CD2  . HIS A 1 66 ? -9.277  11.068  4.196   1.00 0.00 ? 66 HIS A CD2  2  
ATOM 2127  C CE1  . HIS A 1 66 ? -9.412  10.340  2.132   1.00 0.00 ? 66 HIS A CE1  2  
ATOM 2128  N NE2  . HIS A 1 66 ? -10.091 10.490  3.253   1.00 0.00 ? 66 HIS A NE2  2  
ATOM 2129  H H    . HIS A 1 66 ? -7.667  11.000  6.712   1.00 0.00 ? 66 HIS A H    2  
ATOM 2130  H HA   . HIS A 1 66 ? -5.602  10.200  4.771   1.00 0.00 ? 66 HIS A HA   2  
ATOM 2131  H HB2  . HIS A 1 66 ? -7.046  12.830  4.568   1.00 0.00 ? 66 HIS A HB2  2  
ATOM 2132  H HB3  . HIS A 1 66 ? -6.118  11.982  3.334   1.00 0.00 ? 66 HIS A HB3  2  
ATOM 2133  H HD1  . HIS A 1 66 ? -7.480  10.807  1.644   1.00 0.00 ? 66 HIS A HD1  2  
ATOM 2134  H HD2  . HIS A 1 66 ? -9.548  11.316  5.212   1.00 0.00 ? 66 HIS A HD2  2  
ATOM 2135  H HE1  . HIS A 1 66 ? -9.791  9.913   1.215   1.00 0.00 ? 66 HIS A HE1  2  
ATOM 2136  H HE2  . HIS A 1 66 ? -11.026 10.231  3.388   1.00 0.00 ? 66 HIS A HE2  2  
ATOM 2137  N N    . ASP A 1 67 ? -4.087  12.282  5.390   1.00 0.00 ? 67 ASP A N    2  
ATOM 2138  C CA   . ASP A 1 67 ? -3.078  13.106  6.044   1.00 0.00 ? 67 ASP A CA   2  
ATOM 2139  C C    . ASP A 1 67 ? -1.961  13.479  5.075   1.00 0.00 ? 67 ASP A C    2  
ATOM 2140  O O    . ASP A 1 67 ? -1.389  12.616  4.409   1.00 0.00 ? 67 ASP A O    2  
ATOM 2141  C CB   . ASP A 1 67 ? -2.495  12.369  7.252   1.00 0.00 ? 67 ASP A CB   2  
ATOM 2142  C CG   . ASP A 1 67 ? -2.292  10.890  6.987   1.00 0.00 ? 67 ASP A CG   2  
ATOM 2143  O OD1  . ASP A 1 67 ? -2.136  10.515  5.806   1.00 0.00 ? 67 ASP A OD1  2  
ATOM 2144  O OD2  . ASP A 1 67 ? -2.290  10.108  7.961   1.00 0.00 ? 67 ASP A OD2  2  
ATOM 2145  H H    . ASP A 1 67 ? -3.967  12.035  4.450   1.00 0.00 ? 67 ASP A H    2  
ATOM 2146  H HA   . ASP A 1 67 ? -3.560  14.010  6.383   1.00 0.00 ? 67 ASP A HA   2  
ATOM 2147  H HB2  . ASP A 1 67 ? -1.539  12.806  7.505   1.00 0.00 ? 67 ASP A HB2  2  
ATOM 2148  H HB3  . ASP A 1 67 ? -3.167  12.477  8.091   1.00 0.00 ? 67 ASP A HB3  2  
ATOM 2149  N N    . TYR A 1 68 ? -1.656  14.770  5.003   1.00 0.00 ? 68 TYR A N    2  
ATOM 2150  C CA   . TYR A 1 68 ? -0.607  15.261  4.119   1.00 0.00 ? 68 TYR A CA   2  
ATOM 2151  C C    . TYR A 1 68 ? -0.868  14.841  2.677   1.00 0.00 ? 68 TYR A C    2  
ATOM 2152  O O    . TYR A 1 68 ? -0.485  13.710  2.312   1.00 0.00 ? 68 TYR A O    2  
ATOM 2153  C CB   . TYR A 1 68 ? 0.757   14.740  4.576   1.00 0.00 ? 68 TYR A CB   2  
ATOM 2154  C CG   . TYR A 1 68 ? 1.506   15.703  5.468   1.00 0.00 ? 68 TYR A CG   2  
ATOM 2155  C CD1  . TYR A 1 68 ? 2.067   16.865  4.954   1.00 0.00 ? 68 TYR A CD1  2  
ATOM 2156  C CD2  . TYR A 1 68 ? 1.650   15.451  6.828   1.00 0.00 ? 68 TYR A CD2  2  
ATOM 2157  C CE1  . TYR A 1 68 ? 2.752   17.747  5.767   1.00 0.00 ? 68 TYR A CE1  2  
ATOM 2158  C CE2  . TYR A 1 68 ? 2.333   16.330  7.647   1.00 0.00 ? 68 TYR A CE2  2  
ATOM 2159  C CZ   . TYR A 1 68 ? 2.882   17.477  7.112   1.00 0.00 ? 68 TYR A CZ   2  
ATOM 2160  O OH   . TYR A 1 68 ? 3.563   18.354  7.924   1.00 0.00 ? 68 TYR A OH   2  
ATOM 2161  O OXT  . TYR A 1 68 ? -1.454  15.647  1.924   1.00 0.00 ? 68 TYR A OXT  2  
ATOM 2162  H H    . TYR A 1 68 ? -2.148  15.408  5.561   1.00 0.00 ? 68 TYR A H    2  
ATOM 2163  H HA   . TYR A 1 68 ? -0.607  16.340  4.173   1.00 0.00 ? 68 TYR A HA   2  
ATOM 2164  H HB2  . TYR A 1 68 ? 0.618   13.820  5.123   1.00 0.00 ? 68 TYR A HB2  2  
ATOM 2165  H HB3  . TYR A 1 68 ? 1.370   14.548  3.708   1.00 0.00 ? 68 TYR A HB3  2  
ATOM 2166  H HD1  . TYR A 1 68 ? 1.963   17.074  3.899   1.00 0.00 ? 68 TYR A HD1  2  
ATOM 2167  H HD2  . TYR A 1 68 ? 1.219   14.553  7.244   1.00 0.00 ? 68 TYR A HD2  2  
ATOM 2168  H HE1  . TYR A 1 68 ? 3.181   18.646  5.346   1.00 0.00 ? 68 TYR A HE1  2  
ATOM 2169  H HE2  . TYR A 1 68 ? 2.435   16.117  8.702   1.00 0.00 ? 68 TYR A HE2  2  
ATOM 2170  H HH   . TYR A 1 68 ? 3.175   19.228  7.849   1.00 0.00 ? 68 TYR A HH   2  
ATOM 2171  N N    . TYR A 1 1  ? 6.569   19.265  -8.667  1.00 0.00 ? 1  TYR A N    3  
ATOM 2172  C CA   . TYR A 1 1  ? 5.090   19.279  -8.519  1.00 0.00 ? 1  TYR A CA   3  
ATOM 2173  C C    . TYR A 1 1  ? 4.563   17.910  -8.107  1.00 0.00 ? 1  TYR A C    3  
ATOM 2174  O O    . TYR A 1 1  ? 3.893   17.771  -7.083  1.00 0.00 ? 1  TYR A O    3  
ATOM 2175  C CB   . TYR A 1 1  ? 4.472   19.704  -9.853  1.00 0.00 ? 1  TYR A CB   3  
ATOM 2176  C CG   . TYR A 1 1  ? 3.451   20.810  -9.724  1.00 0.00 ? 1  TYR A CG   3  
ATOM 2177  C CD1  . TYR A 1 1  ? 3.771   22.009  -9.101  1.00 0.00 ? 1  TYR A CD1  3  
ATOM 2178  C CD2  . TYR A 1 1  ? 2.166   20.656  -10.228 1.00 0.00 ? 1  TYR A CD2  3  
ATOM 2179  C CE1  . TYR A 1 1  ? 2.840   23.022  -8.981  1.00 0.00 ? 1  TYR A CE1  3  
ATOM 2180  C CE2  . TYR A 1 1  ? 1.228   21.663  -10.111 1.00 0.00 ? 1  TYR A CE2  3  
ATOM 2181  C CZ   . TYR A 1 1  ? 1.570   22.845  -9.488  1.00 0.00 ? 1  TYR A CZ   3  
ATOM 2182  O OH   . TYR A 1 1  ? 0.639   23.850  -9.371  1.00 0.00 ? 1  TYR A OH   3  
ATOM 2183  H H1   . TYR A 1 1  ? 6.982   19.412  -7.724  1.00 0.00 ? 1  TYR A H1   3  
ATOM 2184  H H2   . TYR A 1 1  ? 6.830   20.036  -9.315  1.00 0.00 ? 1  TYR A H2   3  
ATOM 2185  H H3   . TYR A 1 1  ? 6.839   18.340  -9.056  1.00 0.00 ? 1  TYR A H3   3  
ATOM 2186  H HA   . TYR A 1 1  ? 4.827   19.999  -7.761  1.00 0.00 ? 1  TYR A HA   3  
ATOM 2187  H HB2  . TYR A 1 1  ? 5.257   20.050  -10.511 1.00 0.00 ? 1  TYR A HB2  3  
ATOM 2188  H HB3  . TYR A 1 1  ? 3.983   18.851  -10.303 1.00 0.00 ? 1  TYR A HB3  3  
ATOM 2189  H HD1  . TYR A 1 1  ? 4.767   22.145  -8.704  1.00 0.00 ? 1  TYR A HD1  3  
ATOM 2190  H HD2  . TYR A 1 1  ? 1.901   19.729  -10.716 1.00 0.00 ? 1  TYR A HD2  3  
ATOM 2191  H HE1  . TYR A 1 1  ? 3.108   23.948  -8.492  1.00 0.00 ? 1  TYR A HE1  3  
ATOM 2192  H HE2  . TYR A 1 1  ? 0.233   21.524  -10.509 1.00 0.00 ? 1  TYR A HE2  3  
ATOM 2193  H HH   . TYR A 1 1  ? 0.573   24.119  -8.451  1.00 0.00 ? 1  TYR A HH   3  
ATOM 2194  N N    . HIS A 1 2  ? 4.869   16.903  -8.914  1.00 0.00 ? 2  HIS A N    3  
ATOM 2195  C CA   . HIS A 1 2  ? 4.430   15.540  -8.641  1.00 0.00 ? 2  HIS A CA   3  
ATOM 2196  C C    . HIS A 1 2  ? 5.264   14.912  -7.530  1.00 0.00 ? 2  HIS A C    3  
ATOM 2197  O O    . HIS A 1 2  ? 6.025   13.973  -7.766  1.00 0.00 ? 2  HIS A O    3  
ATOM 2198  C CB   . HIS A 1 2  ? 4.529   14.689  -9.907  1.00 0.00 ? 2  HIS A CB   3  
ATOM 2199  C CG   . HIS A 1 2  ? 3.331   14.799  -10.798 1.00 0.00 ? 2  HIS A CG   3  
ATOM 2200  N ND1  . HIS A 1 2  ? 3.310   15.574  -11.939 1.00 0.00 ? 2  HIS A ND1  3  
ATOM 2201  C CD2  . HIS A 1 2  ? 2.108   14.222  -10.715 1.00 0.00 ? 2  HIS A CD2  3  
ATOM 2202  C CE1  . HIS A 1 2  ? 2.126   15.472  -12.517 1.00 0.00 ? 2  HIS A CE1  3  
ATOM 2203  N NE2  . HIS A 1 2  ? 1.380   14.657  -11.794 1.00 0.00 ? 2  HIS A NE2  3  
ATOM 2204  H H    . HIS A 1 2  ? 5.405   17.083  -9.713  1.00 0.00 ? 2  HIS A H    3  
ATOM 2205  H HA   . HIS A 1 2  ? 3.399   15.580  -8.322  1.00 0.00 ? 2  HIS A HA   3  
ATOM 2206  H HB2  . HIS A 1 2  ? 5.394   15.000  -10.472 1.00 0.00 ? 2  HIS A HB2  3  
ATOM 2207  H HB3  . HIS A 1 2  ? 4.641   13.652  -9.628  1.00 0.00 ? 2  HIS A HB3  3  
ATOM 2208  H HD1  . HIS A 1 2  ? 4.052   16.120  -12.275 1.00 0.00 ? 2  HIS A HD1  3  
ATOM 2209  H HD2  . HIS A 1 2  ? 1.769   13.546  -9.942  1.00 0.00 ? 2  HIS A HD2  3  
ATOM 2210  H HE1  . HIS A 1 2  ? 1.820   15.968  -13.426 1.00 0.00 ? 2  HIS A HE1  3  
ATOM 2211  H HE2  . HIS A 1 2  ? 0.455   14.406  -11.997 1.00 0.00 ? 2  HIS A HE2  3  
ATOM 2212  N N    . ALA A 1 3  ? 5.116   15.436  -6.319  1.00 0.00 ? 3  ALA A N    3  
ATOM 2213  C CA   . ALA A 1 3  ? 5.855   14.928  -5.171  1.00 0.00 ? 3  ALA A CA   3  
ATOM 2214  C C    . ALA A 1 3  ? 4.924   14.225  -4.188  1.00 0.00 ? 3  ALA A C    3  
ATOM 2215  O O    . ALA A 1 3  ? 3.998   14.832  -3.651  1.00 0.00 ? 3  ALA A O    3  
ATOM 2216  C CB   . ALA A 1 3  ? 6.597   16.061  -4.478  1.00 0.00 ? 3  ALA A CB   3  
ATOM 2217  H H    . ALA A 1 3  ? 4.494   16.183  -6.197  1.00 0.00 ? 3  ALA A H    3  
ATOM 2218  H HA   . ALA A 1 3  ? 6.585   14.219  -5.530  1.00 0.00 ? 3  ALA A HA   3  
ATOM 2219  H HB1  . ALA A 1 3  ? 6.773   16.860  -5.184  1.00 0.00 ? 3  ALA A HB1  3  
ATOM 2220  H HB2  . ALA A 1 3  ? 7.543   15.697  -4.105  1.00 0.00 ? 3  ALA A HB2  3  
ATOM 2221  H HB3  . ALA A 1 3  ? 6.004   16.431  -3.656  1.00 0.00 ? 3  ALA A HB3  3  
ATOM 2222  N N    . ASP A 1 4  ? 5.178   12.940  -3.958  1.00 0.00 ? 4  ASP A N    3  
ATOM 2223  C CA   . ASP A 1 4  ? 4.364   12.153  -3.040  1.00 0.00 ? 4  ASP A CA   3  
ATOM 2224  C C    . ASP A 1 4  ? 5.122   10.916  -2.562  1.00 0.00 ? 4  ASP A C    3  
ATOM 2225  O O    . ASP A 1 4  ? 4.726   9.787   -2.848  1.00 0.00 ? 4  ASP A O    3  
ATOM 2226  C CB   . ASP A 1 4  ? 3.057   11.733  -3.716  1.00 0.00 ? 4  ASP A CB   3  
ATOM 2227  C CG   . ASP A 1 4  ? 3.286   10.808  -4.893  1.00 0.00 ? 4  ASP A CG   3  
ATOM 2228  O OD1  . ASP A 1 4  ? 4.180   11.102  -5.715  1.00 0.00 ? 4  ASP A OD1  3  
ATOM 2229  O OD2  . ASP A 1 4  ? 2.572   9.788   -4.995  1.00 0.00 ? 4  ASP A OD2  3  
ATOM 2230  H H    . ASP A 1 4  ? 5.930   12.513  -4.417  1.00 0.00 ? 4  ASP A H    3  
ATOM 2231  H HA   . ASP A 1 4  ? 4.135   12.773  -2.186  1.00 0.00 ? 4  ASP A HA   3  
ATOM 2232  H HB2  . ASP A 1 4  ? 2.435   11.222  -2.996  1.00 0.00 ? 4  ASP A HB2  3  
ATOM 2233  H HB3  . ASP A 1 4  ? 2.542   12.615  -4.069  1.00 0.00 ? 4  ASP A HB3  3  
ATOM 2234  N N    . PRO A 1 5  ? 6.228   11.116  -1.824  1.00 0.00 ? 5  PRO A N    3  
ATOM 2235  C CA   . PRO A 1 5  ? 7.042   10.011  -1.304  1.00 0.00 ? 5  PRO A CA   3  
ATOM 2236  C C    . PRO A 1 5  ? 6.287   9.168   -0.281  1.00 0.00 ? 5  PRO A C    3  
ATOM 2237  O O    . PRO A 1 5  ? 6.645   8.017   -0.025  1.00 0.00 ? 5  PRO A O    3  
ATOM 2238  C CB   . PRO A 1 5  ? 8.230   10.717  -0.643  1.00 0.00 ? 5  PRO A CB   3  
ATOM 2239  C CG   . PRO A 1 5  ? 7.737   12.090  -0.339  1.00 0.00 ? 5  PRO A CG   3  
ATOM 2240  C CD   . PRO A 1 5  ? 6.768   12.431  -1.435  1.00 0.00 ? 5  PRO A CD   3  
ATOM 2241  H HA   . PRO A 1 5  ? 7.396   9.374   -2.100  1.00 0.00 ? 5  PRO A HA   3  
ATOM 2242  H HB2  . PRO A 1 5  ? 8.511   10.189  0.256   1.00 0.00 ? 5  PRO A HB2  3  
ATOM 2243  H HB3  . PRO A 1 5  ? 9.065   10.740  -1.329  1.00 0.00 ? 5  PRO A HB3  3  
ATOM 2244  H HG2  . PRO A 1 5  ? 7.238   12.097  0.619   1.00 0.00 ? 5  PRO A HG2  3  
ATOM 2245  H HG3  . PRO A 1 5  ? 8.563   12.785  -0.338  1.00 0.00 ? 5  PRO A HG3  3  
ATOM 2246  H HD2  . PRO A 1 5  ? 5.986   13.075  -1.062  1.00 0.00 ? 5  PRO A HD2  3  
ATOM 2247  H HD3  . PRO A 1 5  ? 7.282   12.897  -2.262  1.00 0.00 ? 5  PRO A HD3  3  
ATOM 2248  N N    . SER A 1 6  ? 5.239   9.745   0.299   1.00 0.00 ? 6  SER A N    3  
ATOM 2249  C CA   . SER A 1 6  ? 4.431   9.045   1.292   1.00 0.00 ? 6  SER A CA   3  
ATOM 2250  C C    . SER A 1 6  ? 3.953   7.698   0.759   1.00 0.00 ? 6  SER A C    3  
ATOM 2251  O O    . SER A 1 6  ? 3.636   6.792   1.531   1.00 0.00 ? 6  SER A O    3  
ATOM 2252  C CB   . SER A 1 6  ? 3.230   9.901   1.695   1.00 0.00 ? 6  SER A CB   3  
ATOM 2253  O OG   . SER A 1 6  ? 3.635   11.018  2.468   1.00 0.00 ? 6  SER A OG   3  
ATOM 2254  H H    . SER A 1 6  ? 5.002   10.663  0.053   1.00 0.00 ? 6  SER A H    3  
ATOM 2255  H HA   . SER A 1 6  ? 5.050   8.875   2.160   1.00 0.00 ? 6  SER A HA   3  
ATOM 2256  H HB2  . SER A 1 6  ? 2.729   10.257  0.807   1.00 0.00 ? 6  SER A HB2  3  
ATOM 2257  H HB3  . SER A 1 6  ? 2.545   9.304   2.280   1.00 0.00 ? 6  SER A HB3  3  
ATOM 2258  H HG   . SER A 1 6  ? 3.261   10.949  3.350   1.00 0.00 ? 6  SER A HG   3  
ATOM 2259  N N    . LEU A 1 7  ? 3.904   7.569   -0.563  1.00 0.00 ? 7  LEU A N    3  
ATOM 2260  C CA   . LEU A 1 7  ? 3.458   6.334   -1.194  1.00 0.00 ? 7  LEU A CA   3  
ATOM 2261  C C    . LEU A 1 7  ? 4.434   5.193   -0.927  1.00 0.00 ? 7  LEU A C    3  
ATOM 2262  O O    . LEU A 1 7  ? 4.058   4.160   -0.378  1.00 0.00 ? 7  LEU A O    3  
ATOM 2263  C CB   . LEU A 1 7  ? 3.293   6.539   -2.702  1.00 0.00 ? 7  LEU A CB   3  
ATOM 2264  C CG   . LEU A 1 7  ? 3.042   5.264   -3.514  1.00 0.00 ? 7  LEU A CG   3  
ATOM 2265  C CD1  . LEU A 1 7  ? 4.350   4.530   -3.770  1.00 0.00 ? 7  LEU A CD1  3  
ATOM 2266  C CD2  . LEU A 1 7  ? 2.049   4.358   -2.803  1.00 0.00 ? 7  LEU A CD2  3  
ATOM 2267  H H    . LEU A 1 7  ? 4.164   8.327   -1.128  1.00 0.00 ? 7  LEU A H    3  
ATOM 2268  H HA   . LEU A 1 7  ? 2.499   6.076   -0.769  1.00 0.00 ? 7  LEU A HA   3  
ATOM 2269  H HB2  . LEU A 1 7  ? 2.463   7.210   -2.863  1.00 0.00 ? 7  LEU A HB2  3  
ATOM 2270  H HB3  . LEU A 1 7  ? 4.190   7.009   -3.079  1.00 0.00 ? 7  LEU A HB3  3  
ATOM 2271  H HG   . LEU A 1 7  ? 2.621   5.533   -4.471  1.00 0.00 ? 7  LEU A HG   3  
ATOM 2272  H HD11 . LEU A 1 7  ? 4.274   3.970   -4.691  1.00 0.00 ? 7  LEU A HD11 3  
ATOM 2273  H HD12 . LEU A 1 7  ? 4.547   3.851   -2.954  1.00 0.00 ? 7  LEU A HD12 3  
ATOM 2274  H HD13 . LEU A 1 7  ? 5.155   5.244   -3.847  1.00 0.00 ? 7  LEU A HD13 3  
ATOM 2275  H HD21 . LEU A 1 7  ? 2.373   4.194   -1.786  1.00 0.00 ? 7  LEU A HD21 3  
ATOM 2276  H HD22 . LEU A 1 7  ? 1.990   3.411   -3.320  1.00 0.00 ? 7  LEU A HD22 3  
ATOM 2277  H HD23 . LEU A 1 7  ? 1.074   4.825   -2.799  1.00 0.00 ? 7  LEU A HD23 3  
ATOM 2278  N N    . VAL A 1 8  ? 5.687   5.383   -1.328  1.00 0.00 ? 8  VAL A N    3  
ATOM 2279  C CA   . VAL A 1 8  ? 6.713   4.362   -1.143  1.00 0.00 ? 8  VAL A CA   3  
ATOM 2280  C C    . VAL A 1 8  ? 6.888   4.008   0.331   1.00 0.00 ? 8  VAL A C    3  
ATOM 2281  O O    . VAL A 1 8  ? 6.980   2.834   0.691   1.00 0.00 ? 8  VAL A O    3  
ATOM 2282  C CB   . VAL A 1 8  ? 8.070   4.822   -1.709  1.00 0.00 ? 8  VAL A CB   3  
ATOM 2283  C CG1  . VAL A 1 8  ? 9.054   3.662   -1.749  1.00 0.00 ? 8  VAL A CG1  3  
ATOM 2284  C CG2  . VAL A 1 8  ? 7.895   5.430   -3.092  1.00 0.00 ? 8  VAL A CG2  3  
ATOM 2285  H H    . VAL A 1 8  ? 5.926   6.227   -1.767  1.00 0.00 ? 8  VAL A H    3  
ATOM 2286  H HA   . VAL A 1 8  ? 6.405   3.478   -1.681  1.00 0.00 ? 8  VAL A HA   3  
ATOM 2287  H HB   . VAL A 1 8  ? 8.472   5.581   -1.055  1.00 0.00 ? 8  VAL A HB   3  
ATOM 2288  H HG11 . VAL A 1 8  ? 8.595   2.785   -1.316  1.00 0.00 ? 8  VAL A HG11 3  
ATOM 2289  H HG12 . VAL A 1 8  ? 9.938   3.921   -1.187  1.00 0.00 ? 8  VAL A HG12 3  
ATOM 2290  H HG13 . VAL A 1 8  ? 9.325   3.456   -2.774  1.00 0.00 ? 8  VAL A HG13 3  
ATOM 2291  H HG21 . VAL A 1 8  ? 7.489   6.427   -2.998  1.00 0.00 ? 8  VAL A HG21 3  
ATOM 2292  H HG22 . VAL A 1 8  ? 7.217   4.819   -3.670  1.00 0.00 ? 8  VAL A HG22 3  
ATOM 2293  H HG23 . VAL A 1 8  ? 8.851   5.476   -3.589  1.00 0.00 ? 8  VAL A HG23 3  
ATOM 2294  N N    . SER A 1 9  ? 6.943   5.031   1.178   1.00 0.00 ? 9  SER A N    3  
ATOM 2295  C CA   . SER A 1 9  ? 7.129   4.831   2.611   1.00 0.00 ? 9  SER A CA   3  
ATOM 2296  C C    . SER A 1 9  ? 6.010   3.980   3.207   1.00 0.00 ? 9  SER A C    3  
ATOM 2297  O O    . SER A 1 9  ? 6.221   3.258   4.181   1.00 0.00 ? 9  SER A O    3  
ATOM 2298  C CB   . SER A 1 9  ? 7.196   6.181   3.326   1.00 0.00 ? 9  SER A CB   3  
ATOM 2299  O OG   . SER A 1 9  ? 6.790   6.067   4.680   1.00 0.00 ? 9  SER A OG   3  
ATOM 2300  H H    . SER A 1 9  ? 6.873   5.943   0.829   1.00 0.00 ? 9  SER A H    3  
ATOM 2301  H HA   . SER A 1 9  ? 8.068   4.316   2.752   1.00 0.00 ? 9  SER A HA   3  
ATOM 2302  H HB2  . SER A 1 9  ? 8.211   6.548   3.300   1.00 0.00 ? 9  SER A HB2  3  
ATOM 2303  H HB3  . SER A 1 9  ? 6.545   6.884   2.828   1.00 0.00 ? 9  SER A HB3  3  
ATOM 2304  H HG   . SER A 1 9  ? 7.133   6.810   5.181   1.00 0.00 ? 9  SER A HG   3  
ATOM 2305  N N    . PHE A 1 10 ? 4.819   4.076   2.624   1.00 0.00 ? 10 PHE A N    3  
ATOM 2306  C CA   . PHE A 1 10 ? 3.669   3.325   3.118   1.00 0.00 ? 10 PHE A CA   3  
ATOM 2307  C C    . PHE A 1 10 ? 3.593   1.943   2.479   1.00 0.00 ? 10 PHE A C    3  
ATOM 2308  O O    . PHE A 1 10 ? 3.485   0.933   3.175   1.00 0.00 ? 10 PHE A O    3  
ATOM 2309  C CB   . PHE A 1 10 ? 2.376   4.095   2.843   1.00 0.00 ? 10 PHE A CB   3  
ATOM 2310  C CG   . PHE A 1 10 ? 2.112   5.198   3.829   1.00 0.00 ? 10 PHE A CG   3  
ATOM 2311  C CD1  . PHE A 1 10 ? 3.097   6.123   4.132   1.00 0.00 ? 10 PHE A CD1  3  
ATOM 2312  C CD2  . PHE A 1 10 ? 0.879   5.307   4.452   1.00 0.00 ? 10 PHE A CD2  3  
ATOM 2313  C CE1  . PHE A 1 10 ? 2.857   7.138   5.039   1.00 0.00 ? 10 PHE A CE1  3  
ATOM 2314  C CE2  . PHE A 1 10 ? 0.634   6.319   5.359   1.00 0.00 ? 10 PHE A CE2  3  
ATOM 2315  C CZ   . PHE A 1 10 ? 1.624   7.237   5.654   1.00 0.00 ? 10 PHE A CZ   3  
ATOM 2316  H H    . PHE A 1 10 ? 4.707   4.673   1.855   1.00 0.00 ? 10 PHE A H    3  
ATOM 2317  H HA   . PHE A 1 10 ? 3.789   3.205   4.185   1.00 0.00 ? 10 PHE A HA   3  
ATOM 2318  H HB2  . PHE A 1 10 ? 2.430   4.536   1.858   1.00 0.00 ? 10 PHE A HB2  3  
ATOM 2319  H HB3  . PHE A 1 10 ? 1.542   3.409   2.881   1.00 0.00 ? 10 PHE A HB3  3  
ATOM 2320  H HD1  . PHE A 1 10 ? 4.061   6.047   3.652   1.00 0.00 ? 10 PHE A HD1  3  
ATOM 2321  H HD2  . PHE A 1 10 ? 0.104   4.591   4.222   1.00 0.00 ? 10 PHE A HD2  3  
ATOM 2322  H HE1  . PHE A 1 10 ? 3.634   7.853   5.267   1.00 0.00 ? 10 PHE A HE1  3  
ATOM 2323  H HE2  . PHE A 1 10 ? -0.332  6.394   5.838   1.00 0.00 ? 10 PHE A HE2  3  
ATOM 2324  H HZ   . PHE A 1 10 ? 1.434   8.028   6.363   1.00 0.00 ? 10 PHE A HZ   3  
ATOM 2325  N N    . LEU A 1 11 ? 3.646   1.905   1.150   1.00 0.00 ? 11 LEU A N    3  
ATOM 2326  C CA   . LEU A 1 11 ? 3.579   0.647   0.413   1.00 0.00 ? 11 LEU A CA   3  
ATOM 2327  C C    . LEU A 1 11 ? 4.491   -0.403  1.034   1.00 0.00 ? 11 LEU A C    3  
ATOM 2328  O O    . LEU A 1 11 ? 4.058   -1.508  1.354   1.00 0.00 ? 11 LEU A O    3  
ATOM 2329  C CB   . LEU A 1 11 ? 3.973   0.874   -1.048  1.00 0.00 ? 11 LEU A CB   3  
ATOM 2330  C CG   . LEU A 1 11 ? 3.573   -0.247  -2.010  1.00 0.00 ? 11 LEU A CG   3  
ATOM 2331  C CD1  . LEU A 1 11 ? 4.499   -1.443  -1.850  1.00 0.00 ? 11 LEU A CD1  3  
ATOM 2332  C CD2  . LEU A 1 11 ? 2.125   -0.657  -1.781  1.00 0.00 ? 11 LEU A CD2  3  
ATOM 2333  H H    . LEU A 1 11 ? 3.729   2.743   0.651   1.00 0.00 ? 11 LEU A H    3  
ATOM 2334  H HA   . LEU A 1 11 ? 2.563   0.291   0.456   1.00 0.00 ? 11 LEU A HA   3  
ATOM 2335  H HB2  . LEU A 1 11 ? 3.511   1.790   -1.384  1.00 0.00 ? 11 LEU A HB2  3  
ATOM 2336  H HB3  . LEU A 1 11 ? 5.045   0.992   -1.092  1.00 0.00 ? 11 LEU A HB3  3  
ATOM 2337  H HG   . LEU A 1 11 ? 3.662   0.110   -3.026  1.00 0.00 ? 11 LEU A HG   3  
ATOM 2338  H HD11 . LEU A 1 11 ? 4.105   -2.106  -1.094  1.00 0.00 ? 11 LEU A HD11 3  
ATOM 2339  H HD12 . LEU A 1 11 ? 5.479   -1.102  -1.554  1.00 0.00 ? 11 LEU A HD12 3  
ATOM 2340  H HD13 . LEU A 1 11 ? 4.570   -1.972  -2.789  1.00 0.00 ? 11 LEU A HD13 3  
ATOM 2341  H HD21 . LEU A 1 11 ? 1.534   0.221   -1.564  1.00 0.00 ? 11 LEU A HD21 3  
ATOM 2342  H HD22 . LEU A 1 11 ? 2.073   -1.342  -0.948  1.00 0.00 ? 11 LEU A HD22 3  
ATOM 2343  H HD23 . LEU A 1 11 ? 1.743   -1.139  -2.668  1.00 0.00 ? 11 LEU A HD23 3  
ATOM 2344  N N    . THR A 1 12 ? 5.755   -0.043  1.209   1.00 0.00 ? 12 THR A N    3  
ATOM 2345  C CA   . THR A 1 12 ? 6.733   -0.949  1.793   1.00 0.00 ? 12 THR A CA   3  
ATOM 2346  C C    . THR A 1 12 ? 6.521   -1.085  3.297   1.00 0.00 ? 12 THR A C    3  
ATOM 2347  O O    . THR A 1 12 ? 6.502   -2.195  3.833   1.00 0.00 ? 12 THR A O    3  
ATOM 2348  C CB   . THR A 1 12 ? 8.150   -0.447  1.510   1.00 0.00 ? 12 THR A CB   3  
ATOM 2349  O OG1  . THR A 1 12 ? 8.347   -0.265  0.119   1.00 0.00 ? 12 THR A OG1  3  
ATOM 2350  C CG2  . THR A 1 12 ? 9.227   -1.383  2.009   1.00 0.00 ? 12 THR A CG2  3  
ATOM 2351  H H    . THR A 1 12 ? 6.035   0.855   0.933   1.00 0.00 ? 12 THR A H    3  
ATOM 2352  H HA   . THR A 1 12 ? 6.602   -1.917  1.333   1.00 0.00 ? 12 THR A HA   3  
ATOM 2353  H HB   . THR A 1 12 ? 8.289   0.504   2.001   1.00 0.00 ? 12 THR A HB   3  
ATOM 2354  H HG1  . THR A 1 12 ? 8.074   0.621   -0.130  1.00 0.00 ? 12 THR A HG1  3  
ATOM 2355  H HG21 . THR A 1 12 ? 9.803   -0.893  2.779   1.00 0.00 ? 12 THR A HG21 3  
ATOM 2356  H HG22 . THR A 1 12 ? 9.877   -1.654  1.189   1.00 0.00 ? 12 THR A HG22 3  
ATOM 2357  H HG23 . THR A 1 12 ? 8.769   -2.273  2.412   1.00 0.00 ? 12 THR A HG23 3  
ATOM 2358  N N    . GLY A 1 13 ? 6.365   0.052   3.971   1.00 0.00 ? 13 GLY A N    3  
ATOM 2359  C CA   . GLY A 1 13 ? 6.165   0.045   5.410   1.00 0.00 ? 13 GLY A CA   3  
ATOM 2360  C C    . GLY A 1 13 ? 5.020   -0.852  5.831   1.00 0.00 ? 13 GLY A C    3  
ATOM 2361  O O    . GLY A 1 13 ? 4.975   -1.327  6.965   1.00 0.00 ? 13 GLY A O    3  
ATOM 2362  H H    . GLY A 1 13 ? 6.384   0.905   3.486   1.00 0.00 ? 13 GLY A H    3  
ATOM 2363  H HA2  . GLY A 1 13 ? 7.071   -0.299  5.887   1.00 0.00 ? 13 GLY A HA2  3  
ATOM 2364  H HA3  . GLY A 1 13 ? 5.958   1.053   5.739   1.00 0.00 ? 13 GLY A HA3  3  
ATOM 2365  N N    . LEU A 1 14 ? 4.090   -1.080  4.913   1.00 0.00 ? 14 LEU A N    3  
ATOM 2366  C CA   . LEU A 1 14 ? 2.941   -1.927  5.177   1.00 0.00 ? 14 LEU A CA   3  
ATOM 2367  C C    . LEU A 1 14 ? 3.368   -3.354  5.509   1.00 0.00 ? 14 LEU A C    3  
ATOM 2368  O O    . LEU A 1 14 ? 2.591   -4.130  6.064   1.00 0.00 ? 14 LEU A O    3  
ATOM 2369  C CB   . LEU A 1 14 ? 2.032   -1.934  3.950   1.00 0.00 ? 14 LEU A CB   3  
ATOM 2370  C CG   . LEU A 1 14 ? 0.550   -1.697  4.229   1.00 0.00 ? 14 LEU A CG   3  
ATOM 2371  C CD1  . LEU A 1 14 ? 0.363   -0.531  5.186   1.00 0.00 ? 14 LEU A CD1  3  
ATOM 2372  C CD2  . LEU A 1 14 ? -0.187  -1.442  2.927   1.00 0.00 ? 14 LEU A CD2  3  
ATOM 2373  H H    . LEU A 1 14 ? 4.185   -0.677  4.025   1.00 0.00 ? 14 LEU A H    3  
ATOM 2374  H HA   . LEU A 1 14 ? 2.407   -1.515  6.019   1.00 0.00 ? 14 LEU A HA   3  
ATOM 2375  H HB2  . LEU A 1 14 ? 2.373   -1.164  3.276   1.00 0.00 ? 14 LEU A HB2  3  
ATOM 2376  H HB3  . LEU A 1 14 ? 2.139   -2.887  3.458   1.00 0.00 ? 14 LEU A HB3  3  
ATOM 2377  H HG   . LEU A 1 14 ? 0.129   -2.580  4.687   1.00 0.00 ? 14 LEU A HG   3  
ATOM 2378  H HD11 . LEU A 1 14 ? 0.181   -0.910  6.181   1.00 0.00 ? 14 LEU A HD11 3  
ATOM 2379  H HD12 . LEU A 1 14 ? -0.480  0.065   4.867   1.00 0.00 ? 14 LEU A HD12 3  
ATOM 2380  H HD13 . LEU A 1 14 ? 1.255   0.077   5.189   1.00 0.00 ? 14 LEU A HD13 3  
ATOM 2381  H HD21 . LEU A 1 14 ? -1.234  -1.668  3.054   1.00 0.00 ? 14 LEU A HD21 3  
ATOM 2382  H HD22 . LEU A 1 14 ? 0.230   -2.070  2.151   1.00 0.00 ? 14 LEU A HD22 3  
ATOM 2383  H HD23 . LEU A 1 14 ? -0.073  -0.405  2.647   1.00 0.00 ? 14 LEU A HD23 3  
ATOM 2384  N N    . GLY A 1 15 ? 4.601   -3.698  5.152   1.00 0.00 ? 15 GLY A N    3  
ATOM 2385  C CA   . GLY A 1 15 ? 5.099   -5.036  5.403   1.00 0.00 ? 15 GLY A CA   3  
ATOM 2386  C C    . GLY A 1 15 ? 5.405   -5.786  4.121   1.00 0.00 ? 15 GLY A C    3  
ATOM 2387  O O    . GLY A 1 15 ? 5.496   -7.014  4.119   1.00 0.00 ? 15 GLY A O    3  
ATOM 2388  H H    . GLY A 1 15 ? 5.175   -3.045  4.704   1.00 0.00 ? 15 GLY A H    3  
ATOM 2389  H HA2  . GLY A 1 15 ? 5.999   -4.970  5.994   1.00 0.00 ? 15 GLY A HA2  3  
ATOM 2390  H HA3  . GLY A 1 15 ? 4.355   -5.587  5.960   1.00 0.00 ? 15 GLY A HA3  3  
ATOM 2391  N N    . CYS A 1 16 ? 5.556   -5.046  3.024   1.00 0.00 ? 16 CYS A N    3  
ATOM 2392  C CA   . CYS A 1 16 ? 5.859   -5.654  1.733   1.00 0.00 ? 16 CYS A CA   3  
ATOM 2393  C C    . CYS A 1 16 ? 6.976   -4.892  1.025   1.00 0.00 ? 16 CYS A C    3  
ATOM 2394  O O    . CYS A 1 16 ? 6.730   -4.151  0.073   1.00 0.00 ? 16 CYS A O    3  
ATOM 2395  C CB   . CYS A 1 16 ? 4.610   -5.695  0.847   1.00 0.00 ? 16 CYS A CB   3  
ATOM 2396  S SG   . CYS A 1 16 ? 3.502   -4.282  1.054   1.00 0.00 ? 16 CYS A SG   3  
ATOM 2397  H H    . CYS A 1 16 ? 5.476   -4.069  3.088   1.00 0.00 ? 16 CYS A H    3  
ATOM 2398  H HA   . CYS A 1 16 ? 6.192   -6.665  1.914   1.00 0.00 ? 16 CYS A HA   3  
ATOM 2399  H HB2  . CYS A 1 16 ? 4.915   -5.722  -0.189  1.00 0.00 ? 16 CYS A HB2  3  
ATOM 2400  H HB3  . CYS A 1 16 ? 4.048   -6.588  1.075   1.00 0.00 ? 16 CYS A HB3  3  
ATOM 2401  H HG   . CYS A 1 16 ? 3.245   -3.976  0.181   1.00 0.00 ? 16 CYS A HG   3  
ATOM 2402  N N    . PRO A 1 17 ? 8.225   -5.064  1.489   1.00 0.00 ? 17 PRO A N    3  
ATOM 2403  C CA   . PRO A 1 17 ? 9.383   -4.393  0.909   1.00 0.00 ? 17 PRO A CA   3  
ATOM 2404  C C    . PRO A 1 17 ? 9.955   -5.135  -0.297  1.00 0.00 ? 17 PRO A C    3  
ATOM 2405  O O    . PRO A 1 17 ? 11.033  -4.797  -0.787  1.00 0.00 ? 17 PRO A O    3  
ATOM 2406  C CB   . PRO A 1 17 ? 10.384  -4.389  2.062   1.00 0.00 ? 17 PRO A CB   3  
ATOM 2407  C CG   . PRO A 1 17 ? 10.057  -5.606  2.865   1.00 0.00 ? 17 PRO A CG   3  
ATOM 2408  C CD   . PRO A 1 17 ? 8.603   -5.927  2.622   1.00 0.00 ? 17 PRO A CD   3  
ATOM 2409  H HA   . PRO A 1 17 ? 9.150   -3.378  0.625   1.00 0.00 ? 17 PRO A HA   3  
ATOM 2410  H HB2  . PRO A 1 17 ? 11.388  -4.433  1.668   1.00 0.00 ? 17 PRO A HB2  3  
ATOM 2411  H HB3  . PRO A 1 17 ? 10.261  -3.489  2.645   1.00 0.00 ? 17 PRO A HB3  3  
ATOM 2412  H HG2  . PRO A 1 17 ? 10.678  -6.429  2.545   1.00 0.00 ? 17 PRO A HG2  3  
ATOM 2413  H HG3  . PRO A 1 17 ? 10.218  -5.402  3.913   1.00 0.00 ? 17 PRO A HG3  3  
ATOM 2414  H HD2  . PRO A 1 17 ? 8.488   -6.970  2.364   1.00 0.00 ? 17 PRO A HD2  3  
ATOM 2415  H HD3  . PRO A 1 17 ? 8.015   -5.690  3.496   1.00 0.00 ? 17 PRO A HD3  3  
ATOM 2416  N N    . ASN A 1 18 ? 9.229   -6.140  -0.777  1.00 0.00 ? 18 ASN A N    3  
ATOM 2417  C CA   . ASN A 1 18 ? 9.663   -6.909  -1.935  1.00 0.00 ? 18 ASN A CA   3  
ATOM 2418  C C    . ASN A 1 18 ? 8.495   -7.197  -2.877  1.00 0.00 ? 18 ASN A C    3  
ATOM 2419  O O    . ASN A 1 18 ? 8.589   -8.061  -3.749  1.00 0.00 ? 18 ASN A O    3  
ATOM 2420  C CB   . ASN A 1 18 ? 10.309  -8.223  -1.488  1.00 0.00 ? 18 ASN A CB   3  
ATOM 2421  C CG   . ASN A 1 18 ? 11.767  -8.315  -1.891  1.00 0.00 ? 18 ASN A CG   3  
ATOM 2422  O OD1  . ASN A 1 18 ? 12.631  -7.672  -1.294  1.00 0.00 ? 18 ASN A OD1  3  
ATOM 2423  N ND2  . ASN A 1 18 ? 12.049  -9.115  -2.913  1.00 0.00 ? 18 ASN A ND2  3  
ATOM 2424  H H    . ASN A 1 18 ? 8.374   -6.360  -0.354  1.00 0.00 ? 18 ASN A H    3  
ATOM 2425  H HA   . ASN A 1 18 ? 10.398  -6.321  -2.464  1.00 0.00 ? 18 ASN A HA   3  
ATOM 2426  H HB2  . ASN A 1 18 ? 10.246  -8.300  -0.412  1.00 0.00 ? 18 ASN A HB2  3  
ATOM 2427  H HB3  . ASN A 1 18 ? 9.777   -9.049  -1.936  1.00 0.00 ? 18 ASN A HB3  3  
ATOM 2428  H HD21 . ASN A 1 18 ? 11.311  -9.596  -3.342  1.00 0.00 ? 18 ASN A HD21 3  
ATOM 2429  H HD22 . ASN A 1 18 ? 12.985  -9.193  -3.194  1.00 0.00 ? 18 ASN A HD22 3  
ATOM 2430  N N    . CYS A 1 19 ? 7.396   -6.464  -2.703  1.00 0.00 ? 19 CYS A N    3  
ATOM 2431  C CA   . CYS A 1 19 ? 6.217   -6.644  -3.541  1.00 0.00 ? 19 CYS A CA   3  
ATOM 2432  C C    . CYS A 1 19 ? 5.940   -5.397  -4.375  1.00 0.00 ? 19 CYS A C    3  
ATOM 2433  O O    . CYS A 1 19 ? 5.278   -5.467  -5.411  1.00 0.00 ? 19 CYS A O    3  
ATOM 2434  C CB   . CYS A 1 19 ? 4.997   -6.975  -2.679  1.00 0.00 ? 19 CYS A CB   3  
ATOM 2435  S SG   . CYS A 1 19 ? 5.352   -8.083  -1.294  1.00 0.00 ? 19 CYS A SG   3  
ATOM 2436  H H    . CYS A 1 19 ? 7.374   -5.790  -1.994  1.00 0.00 ? 19 CYS A H    3  
ATOM 2437  H HA   . CYS A 1 19 ? 6.409   -7.470  -4.210  1.00 0.00 ? 19 CYS A HA   3  
ATOM 2438  H HB2  . CYS A 1 19 ? 4.595   -6.060  -2.271  1.00 0.00 ? 19 CYS A HB2  3  
ATOM 2439  H HB3  . CYS A 1 19 ? 4.247   -7.449  -3.294  1.00 0.00 ? 19 CYS A HB3  3  
ATOM 2440  H HG   . CYS A 1 19 ? 4.531   -8.234  -0.819  1.00 0.00 ? 19 CYS A HG   3  
ATOM 2441  N N    . ILE A 1 20 ? 6.451   -4.254  -3.923  1.00 0.00 ? 20 ILE A N    3  
ATOM 2442  C CA   . ILE A 1 20 ? 6.259   -2.998  -4.636  1.00 0.00 ? 20 ILE A CA   3  
ATOM 2443  C C    . ILE A 1 20 ? 6.617   -3.147  -6.109  1.00 0.00 ? 20 ILE A C    3  
ATOM 2444  O O    . ILE A 1 20 ? 5.968   -2.564  -6.976  1.00 0.00 ? 20 ILE A O    3  
ATOM 2445  C CB   . ILE A 1 20 ? 7.106   -1.867  -4.025  1.00 0.00 ? 20 ILE A CB   3  
ATOM 2446  C CG1  . ILE A 1 20 ? 6.861   -0.556  -4.775  1.00 0.00 ? 20 ILE A CG1  3  
ATOM 2447  C CG2  . ILE A 1 20 ? 8.581   -2.236  -4.061  1.00 0.00 ? 20 ILE A CG2  3  
ATOM 2448  C CD1  . ILE A 1 20 ? 6.895   0.668   -3.886  1.00 0.00 ? 20 ILE A CD1  3  
ATOM 2449  H H    . ILE A 1 20 ? 6.972   -4.257  -3.094  1.00 0.00 ? 20 ILE A H    3  
ATOM 2450  H HA   . ILE A 1 20 ? 5.218   -2.725  -4.554  1.00 0.00 ? 20 ILE A HA   3  
ATOM 2451  H HB   . ILE A 1 20 ? 6.816   -1.746  -2.992  1.00 0.00 ? 20 ILE A HB   3  
ATOM 2452  H HG12 . ILE A 1 20 ? 7.620   -0.436  -5.534  1.00 0.00 ? 20 ILE A HG12 3  
ATOM 2453  H HG13 . ILE A 1 20 ? 5.890   -0.595  -5.247  1.00 0.00 ? 20 ILE A HG13 3  
ATOM 2454  H HG21 . ILE A 1 20 ? 8.694   -3.287  -3.838  1.00 0.00 ? 20 ILE A HG21 3  
ATOM 2455  H HG22 . ILE A 1 20 ? 9.116   -1.653  -3.326  1.00 0.00 ? 20 ILE A HG22 3  
ATOM 2456  H HG23 . ILE A 1 20 ? 8.979   -2.032  -5.044  1.00 0.00 ? 20 ILE A HG23 3  
ATOM 2457  H HD11 . ILE A 1 20 ? 6.197   0.541   -3.071  1.00 0.00 ? 20 ILE A HD11 3  
ATOM 2458  H HD12 . ILE A 1 20 ? 6.619   1.539   -4.462  1.00 0.00 ? 20 ILE A HD12 3  
ATOM 2459  H HD13 . ILE A 1 20 ? 7.891   0.799   -3.490  1.00 0.00 ? 20 ILE A HD13 3  
ATOM 2460  N N    . GLU A 1 21 ? 7.650   -3.935  -6.388  1.00 0.00 ? 21 GLU A N    3  
ATOM 2461  C CA   . GLU A 1 21 ? 8.075   -4.171  -7.761  1.00 0.00 ? 21 GLU A CA   3  
ATOM 2462  C C    . GLU A 1 21 ? 6.929   -4.750  -8.580  1.00 0.00 ? 21 GLU A C    3  
ATOM 2463  O O    . GLU A 1 21 ? 6.684   -4.329  -9.710  1.00 0.00 ? 21 GLU A O    3  
ATOM 2464  C CB   . GLU A 1 21 ? 9.273   -5.121  -7.793  1.00 0.00 ? 21 GLU A CB   3  
ATOM 2465  C CG   . GLU A 1 21 ? 9.000   -6.470  -7.150  1.00 0.00 ? 21 GLU A CG   3  
ATOM 2466  C CD   . GLU A 1 21 ? 10.271  -7.226  -6.816  1.00 0.00 ? 21 GLU A CD   3  
ATOM 2467  O OE1  . GLU A 1 21 ? 11.137  -7.351  -7.708  1.00 0.00 ? 21 GLU A OE1  3  
ATOM 2468  O OE2  . GLU A 1 21 ? 10.400  -7.693  -5.666  1.00 0.00 ? 21 GLU A OE2  3  
ATOM 2469  H H    . GLU A 1 21 ? 8.124   -4.382  -5.655  1.00 0.00 ? 21 GLU A H    3  
ATOM 2470  H HA   . GLU A 1 21 ? 8.365   -3.222  -8.187  1.00 0.00 ? 21 GLU A HA   3  
ATOM 2471  H HB2  . GLU A 1 21 ? 9.555   -5.288  -8.822  1.00 0.00 ? 21 GLU A HB2  3  
ATOM 2472  H HB3  . GLU A 1 21 ? 10.098  -4.657  -7.274  1.00 0.00 ? 21 GLU A HB3  3  
ATOM 2473  H HG2  . GLU A 1 21 ? 8.443   -6.312  -6.238  1.00 0.00 ? 21 GLU A HG2  3  
ATOM 2474  H HG3  . GLU A 1 21 ? 8.412   -7.067  -7.832  1.00 0.00 ? 21 GLU A HG3  3  
ATOM 2475  N N    . TYR A 1 22 ? 6.221   -5.709  -7.993  1.00 0.00 ? 22 TYR A N    3  
ATOM 2476  C CA   . TYR A 1 22 ? 5.083   -6.334  -8.658  1.00 0.00 ? 22 TYR A CA   3  
ATOM 2477  C C    . TYR A 1 22 ? 3.917   -5.358  -8.748  1.00 0.00 ? 22 TYR A C    3  
ATOM 2478  O O    . TYR A 1 22 ? 3.142   -5.386  -9.703  1.00 0.00 ? 22 TYR A O    3  
ATOM 2479  C CB   . TYR A 1 22 ? 4.651   -7.593  -7.905  1.00 0.00 ? 22 TYR A CB   3  
ATOM 2480  C CG   . TYR A 1 22 ? 5.740   -8.633  -7.789  1.00 0.00 ? 22 TYR A CG   3  
ATOM 2481  C CD1  . TYR A 1 22 ? 6.731   -8.520  -6.823  1.00 0.00 ? 22 TYR A CD1  3  
ATOM 2482  C CD2  . TYR A 1 22 ? 5.781   -9.723  -8.648  1.00 0.00 ? 22 TYR A CD2  3  
ATOM 2483  C CE1  . TYR A 1 22 ? 7.730   -9.468  -6.714  1.00 0.00 ? 22 TYR A CE1  3  
ATOM 2484  C CE2  . TYR A 1 22 ? 6.777   -10.675 -8.546  1.00 0.00 ? 22 TYR A CE2  3  
ATOM 2485  C CZ   . TYR A 1 22 ? 7.748   -10.542 -7.578  1.00 0.00 ? 22 TYR A CZ   3  
ATOM 2486  O OH   . TYR A 1 22 ? 8.743   -11.489 -7.471  1.00 0.00 ? 22 TYR A OH   3  
ATOM 2487  H H    . TYR A 1 22 ? 6.461   -5.994  -7.086  1.00 0.00 ? 22 TYR A H    3  
ATOM 2488  H HA   . TYR A 1 22 ? 5.390   -6.605  -9.656  1.00 0.00 ? 22 TYR A HA   3  
ATOM 2489  H HB2  . TYR A 1 22 ? 4.345   -7.320  -6.906  1.00 0.00 ? 22 TYR A HB2  3  
ATOM 2490  H HB3  . TYR A 1 22 ? 3.817   -8.043  -8.422  1.00 0.00 ? 22 TYR A HB3  3  
ATOM 2491  H HD1  . TYR A 1 22 ? 6.713   -7.678  -6.147  1.00 0.00 ? 22 TYR A HD1  3  
ATOM 2492  H HD2  . TYR A 1 22 ? 5.017   -9.823  -9.406  1.00 0.00 ? 22 TYR A HD2  3  
ATOM 2493  H HE1  . TYR A 1 22 ? 8.491   -9.363  -5.956  1.00 0.00 ? 22 TYR A HE1  3  
ATOM 2494  H HE2  . TYR A 1 22 ? 6.791   -11.516 -9.223  1.00 0.00 ? 22 TYR A HE2  3  
ATOM 2495  H HH   . TYR A 1 22 ? 8.981   -11.601 -6.549  1.00 0.00 ? 22 TYR A HH   3  
ATOM 2496  N N    . PHE A 1 23 ? 3.803   -4.493  -7.747  1.00 0.00 ? 23 PHE A N    3  
ATOM 2497  C CA   . PHE A 1 23 ? 2.742   -3.495  -7.718  1.00 0.00 ? 23 PHE A CA   3  
ATOM 2498  C C    . PHE A 1 23 ? 3.026   -2.383  -8.722  1.00 0.00 ? 23 PHE A C    3  
ATOM 2499  O O    . PHE A 1 23 ? 2.192   -2.068  -9.570  1.00 0.00 ? 23 PHE A O    3  
ATOM 2500  C CB   . PHE A 1 23 ? 2.604   -2.908  -6.311  1.00 0.00 ? 23 PHE A CB   3  
ATOM 2501  C CG   . PHE A 1 23 ? 1.735   -3.726  -5.400  1.00 0.00 ? 23 PHE A CG   3  
ATOM 2502  C CD1  . PHE A 1 23 ? 0.364   -3.786  -5.599  1.00 0.00 ? 23 PHE A CD1  3  
ATOM 2503  C CD2  . PHE A 1 23 ? 2.286   -4.432  -4.343  1.00 0.00 ? 23 PHE A CD2  3  
ATOM 2504  C CE1  . PHE A 1 23 ? -0.439  -4.537  -4.762  1.00 0.00 ? 23 PHE A CE1  3  
ATOM 2505  C CE2  . PHE A 1 23 ? 1.488   -5.185  -3.503  1.00 0.00 ? 23 PHE A CE2  3  
ATOM 2506  C CZ   . PHE A 1 23 ? 0.123   -5.238  -3.713  1.00 0.00 ? 23 PHE A CZ   3  
ATOM 2507  H H    . PHE A 1 23 ? 4.457   -4.518  -7.016  1.00 0.00 ? 23 PHE A H    3  
ATOM 2508  H HA   . PHE A 1 23 ? 1.818   -3.984  -7.989  1.00 0.00 ? 23 PHE A HA   3  
ATOM 2509  H HB2  . PHE A 1 23 ? 3.584   -2.837  -5.861  1.00 0.00 ? 23 PHE A HB2  3  
ATOM 2510  H HB3  . PHE A 1 23 ? 2.175   -1.921  -6.382  1.00 0.00 ? 23 PHE A HB3  3  
ATOM 2511  H HD1  . PHE A 1 23 ? -0.076  -3.239  -6.419  1.00 0.00 ? 23 PHE A HD1  3  
ATOM 2512  H HD2  . PHE A 1 23 ? 3.353   -4.392  -4.178  1.00 0.00 ? 23 PHE A HD2  3  
ATOM 2513  H HE1  . PHE A 1 23 ? -1.505  -4.576  -4.929  1.00 0.00 ? 23 PHE A HE1  3  
ATOM 2514  H HE2  . PHE A 1 23 ? 1.931   -5.733  -2.683  1.00 0.00 ? 23 PHE A HE2  3  
ATOM 2515  H HZ   . PHE A 1 23 ? -0.502  -5.826  -3.058  1.00 0.00 ? 23 PHE A HZ   3  
ATOM 2516  N N    . THR A 1 24 ? 4.220   -1.805  -8.630  1.00 0.00 ? 24 THR A N    3  
ATOM 2517  C CA   . THR A 1 24 ? 4.626   -0.732  -9.532  1.00 0.00 ? 24 THR A CA   3  
ATOM 2518  C C    . THR A 1 24 ? 4.395   -1.123  -10.989 1.00 0.00 ? 24 THR A C    3  
ATOM 2519  O O    . THR A 1 24 ? 4.159   -0.268  -11.841 1.00 0.00 ? 24 THR A O    3  
ATOM 2520  C CB   . THR A 1 24 ? 6.102   -0.391  -9.317  1.00 0.00 ? 24 THR A CB   3  
ATOM 2521  O OG1  . THR A 1 24 ? 6.906   -1.553  -9.427  1.00 0.00 ? 24 THR A OG1  3  
ATOM 2522  C CG2  . THR A 1 24 ? 6.381   0.237   -7.970  1.00 0.00 ? 24 THR A CG2  3  
ATOM 2523  H H    . THR A 1 24 ? 4.842   -2.102  -7.930  1.00 0.00 ? 24 THR A H    3  
ATOM 2524  H HA   . THR A 1 24 ? 4.028   0.136   -9.305  1.00 0.00 ? 24 THR A HA   3  
ATOM 2525  H HB   . THR A 1 24 ? 6.413   0.309   -10.077 1.00 0.00 ? 24 THR A HB   3  
ATOM 2526  H HG1  . THR A 1 24 ? 6.730   -2.136  -8.683  1.00 0.00 ? 24 THR A HG1  3  
ATOM 2527  H HG21 . THR A 1 24 ? 6.075   1.273   -7.986  1.00 0.00 ? 24 THR A HG21 3  
ATOM 2528  H HG22 . THR A 1 24 ? 7.438   0.177   -7.756  1.00 0.00 ? 24 THR A HG22 3  
ATOM 2529  H HG23 . THR A 1 24 ? 5.828   -0.289  -7.206  1.00 0.00 ? 24 THR A HG23 3  
ATOM 2530  N N    . SER A 1 25 ? 4.471   -2.421  -11.268 1.00 0.00 ? 25 SER A N    3  
ATOM 2531  C CA   . SER A 1 25 ? 4.282   -2.923  -12.625 1.00 0.00 ? 25 SER A CA   3  
ATOM 2532  C C    . SER A 1 25 ? 3.001   -2.373  -13.244 1.00 0.00 ? 25 SER A C    3  
ATOM 2533  O O    . SER A 1 25 ? 2.898   -2.243  -14.464 1.00 0.00 ? 25 SER A O    3  
ATOM 2534  C CB   . SER A 1 25 ? 4.243   -4.453  -12.622 1.00 0.00 ? 25 SER A CB   3  
ATOM 2535  O OG   . SER A 1 25 ? 5.509   -4.997  -12.951 1.00 0.00 ? 25 SER A OG   3  
ATOM 2536  H H    . SER A 1 25 ? 4.667   -3.054  -10.547 1.00 0.00 ? 25 SER A H    3  
ATOM 2537  H HA   . SER A 1 25 ? 5.123   -2.595  -13.218 1.00 0.00 ? 25 SER A HA   3  
ATOM 2538  H HB2  . SER A 1 25 ? 3.961   -4.801  -11.640 1.00 0.00 ? 25 SER A HB2  3  
ATOM 2539  H HB3  . SER A 1 25 ? 3.519   -4.793  -13.346 1.00 0.00 ? 25 SER A HB3  3  
ATOM 2540  H HG   . SER A 1 25 ? 5.943   -5.304  -12.153 1.00 0.00 ? 25 SER A HG   3  
ATOM 2541  N N    . GLN A 1 26 ? 2.027   -2.055  -12.399 1.00 0.00 ? 26 GLN A N    3  
ATOM 2542  C CA   . GLN A 1 26 ? 0.748   -1.529  -12.872 1.00 0.00 ? 26 GLN A CA   3  
ATOM 2543  C C    . GLN A 1 26 ? 0.692   -0.012  -12.722 1.00 0.00 ? 26 GLN A C    3  
ATOM 2544  O O    . GLN A 1 26 ? 0.213   0.693   -13.610 1.00 0.00 ? 26 GLN A O    3  
ATOM 2545  C CB   . GLN A 1 26 ? -0.415  -2.166  -12.103 1.00 0.00 ? 26 GLN A CB   3  
ATOM 2546  C CG   . GLN A 1 26 ? -0.139  -3.584  -11.624 1.00 0.00 ? 26 GLN A CG   3  
ATOM 2547  C CD   . GLN A 1 26 ? -0.197  -4.602  -12.745 1.00 0.00 ? 26 GLN A CD   3  
ATOM 2548  O OE1  . GLN A 1 26 ? -0.744  -4.336  -13.815 1.00 0.00 ? 26 GLN A OE1  3  
ATOM 2549  N NE2  . GLN A 1 26 ? 0.368   -5.780  -12.504 1.00 0.00 ? 26 GLN A NE2  3  
ATOM 2550  H H    . GLN A 1 26 ? 2.164   -2.185  -11.437 1.00 0.00 ? 26 GLN A H    3  
ATOM 2551  H HA   . GLN A 1 26 ? 0.657   -1.777  -13.918 1.00 0.00 ? 26 GLN A HA   3  
ATOM 2552  H HB2  . GLN A 1 26 ? -0.637  -1.556  -11.241 1.00 0.00 ? 26 GLN A HB2  3  
ATOM 2553  H HB3  . GLN A 1 26 ? -1.281  -2.192  -12.747 1.00 0.00 ? 26 GLN A HB3  3  
ATOM 2554  H HG2  . GLN A 1 26 ? 0.846   -3.615  -11.181 1.00 0.00 ? 26 GLN A HG2  3  
ATOM 2555  H HG3  . GLN A 1 26 ? -0.875  -3.848  -10.881 1.00 0.00 ? 26 GLN A HG3  3  
ATOM 2556  H HE21 . GLN A 1 26 ? 0.784   -5.922  -11.628 1.00 0.00 ? 26 GLN A HE21 3  
ATOM 2557  H HE22 . GLN A 1 26 ? 0.344   -6.458  -13.209 1.00 0.00 ? 26 GLN A HE22 3  
ATOM 2558  N N    . GLY A 1 27 ? 1.175   0.483   -11.588 1.00 0.00 ? 27 GLY A N    3  
ATOM 2559  C CA   . GLY A 1 27 ? 1.158   1.911   -11.332 1.00 0.00 ? 27 GLY A CA   3  
ATOM 2560  C C    . GLY A 1 27 ? 0.917   2.227   -9.871  1.00 0.00 ? 27 GLY A C    3  
ATOM 2561  O O    . GLY A 1 27 ? 0.121   3.103   -9.538  1.00 0.00 ? 27 GLY A O    3  
ATOM 2562  H H    . GLY A 1 27 ? 1.537   -0.128  -10.914 1.00 0.00 ? 27 GLY A H    3  
ATOM 2563  H HA2  . GLY A 1 27 ? 2.107   2.333   -11.628 1.00 0.00 ? 27 GLY A HA2  3  
ATOM 2564  H HA3  . GLY A 1 27 ? 0.374   2.365   -11.921 1.00 0.00 ? 27 GLY A HA3  3  
ATOM 2565  N N    . LEU A 1 28 ? 1.614   1.508   -8.998  1.00 0.00 ? 28 LEU A N    3  
ATOM 2566  C CA   . LEU A 1 28 ? 1.474   1.703   -7.562  1.00 0.00 ? 28 LEU A CA   3  
ATOM 2567  C C    . LEU A 1 28 ? 2.608   2.566   -7.017  1.00 0.00 ? 28 LEU A C    3  
ATOM 2568  O O    . LEU A 1 28 ? 3.121   2.323   -5.925  1.00 0.00 ? 28 LEU A O    3  
ATOM 2569  C CB   . LEU A 1 28 ? 1.447   0.350   -6.847  1.00 0.00 ? 28 LEU A CB   3  
ATOM 2570  C CG   . LEU A 1 28 ? 0.113   -0.006  -6.191  1.00 0.00 ? 28 LEU A CG   3  
ATOM 2571  C CD1  . LEU A 1 28 ? -0.066  0.767   -4.893  1.00 0.00 ? 28 LEU A CD1  3  
ATOM 2572  C CD2  . LEU A 1 28 ? -1.041  0.273   -7.143  1.00 0.00 ? 28 LEU A CD2  3  
ATOM 2573  H H    . LEU A 1 28 ? 2.227   0.822   -9.329  1.00 0.00 ? 28 LEU A H    3  
ATOM 2574  H HA   . LEU A 1 28 ? 0.537   2.211   -7.388  1.00 0.00 ? 28 LEU A HA   3  
ATOM 2575  H HB2  . LEU A 1 28 ? 1.686   -0.418  -7.567  1.00 0.00 ? 28 LEU A HB2  3  
ATOM 2576  H HB3  . LEU A 1 28 ? 2.211   0.352   -6.083  1.00 0.00 ? 28 LEU A HB3  3  
ATOM 2577  H HG   . LEU A 1 28 ? 0.104   -1.060  -5.955  1.00 0.00 ? 28 LEU A HG   3  
ATOM 2578  H HD11 . LEU A 1 28 ? -1.094  1.084   -4.801  1.00 0.00 ? 28 LEU A HD11 3  
ATOM 2579  H HD12 . LEU A 1 28 ? 0.579   1.633   -4.897  1.00 0.00 ? 28 LEU A HD12 3  
ATOM 2580  H HD13 . LEU A 1 28 ? 0.191   0.132   -4.057  1.00 0.00 ? 28 LEU A HD13 3  
ATOM 2581  H HD21 . LEU A 1 28 ? -1.939  -0.196  -6.767  1.00 0.00 ? 28 LEU A HD21 3  
ATOM 2582  H HD22 . LEU A 1 28 ? -0.807  -0.126  -8.118  1.00 0.00 ? 28 LEU A HD22 3  
ATOM 2583  H HD23 . LEU A 1 28 ? -1.197  1.339   -7.217  1.00 0.00 ? 28 LEU A HD23 3  
ATOM 2584  N N    . GLN A 1 29 ? 2.973   3.591   -7.778  1.00 0.00 ? 29 GLN A N    3  
ATOM 2585  C CA   . GLN A 1 29 ? 4.019   4.516   -7.364  1.00 0.00 ? 29 GLN A CA   3  
ATOM 2586  C C    . GLN A 1 29 ? 3.397   5.778   -6.780  1.00 0.00 ? 29 GLN A C    3  
ATOM 2587  O O    . GLN A 1 29 ? 3.984   6.438   -5.922  1.00 0.00 ? 29 GLN A O    3  
ATOM 2588  C CB   . GLN A 1 29 ? 4.917   4.873   -8.550  1.00 0.00 ? 29 GLN A CB   3  
ATOM 2589  C CG   . GLN A 1 29 ? 4.173   5.537   -9.698  1.00 0.00 ? 29 GLN A CG   3  
ATOM 2590  C CD   . GLN A 1 29 ? 5.108   6.132   -10.732 1.00 0.00 ? 29 GLN A CD   3  
ATOM 2591  O OE1  . GLN A 1 29 ? 5.008   7.311   -11.072 1.00 0.00 ? 29 GLN A OE1  3  
ATOM 2592  N NE2  . GLN A 1 29 ? 6.025   5.316   -11.240 1.00 0.00 ? 29 GLN A NE2  3  
ATOM 2593  H H    . GLN A 1 29 ? 2.514   3.740   -8.631  1.00 0.00 ? 29 GLN A H    3  
ATOM 2594  H HA   . GLN A 1 29 ? 4.613   4.033   -6.603  1.00 0.00 ? 29 GLN A HA   3  
ATOM 2595  H HB2  . GLN A 1 29 ? 5.689   5.548   -8.212  1.00 0.00 ? 29 GLN A HB2  3  
ATOM 2596  H HB3  . GLN A 1 29 ? 5.379   3.970   -8.923  1.00 0.00 ? 29 GLN A HB3  3  
ATOM 2597  H HG2  . GLN A 1 29 ? 3.550   4.799   -10.180 1.00 0.00 ? 29 GLN A HG2  3  
ATOM 2598  H HG3  . GLN A 1 29 ? 3.553   6.326   -9.300  1.00 0.00 ? 29 GLN A HG3  3  
ATOM 2599  H HE21 . GLN A 1 29 ? 6.046   4.388   -10.923 1.00 0.00 ? 29 GLN A HE21 3  
ATOM 2600  H HE22 . GLN A 1 29 ? 6.643   5.674   -11.912 1.00 0.00 ? 29 GLN A HE22 3  
ATOM 2601  N N    . SER A 1 30 ? 2.187   6.090   -7.236  1.00 0.00 ? 30 SER A N    3  
ATOM 2602  C CA   . SER A 1 30 ? 1.450   7.242   -6.735  1.00 0.00 ? 30 SER A CA   3  
ATOM 2603  C C    . SER A 1 30 ? 0.226   6.780   -5.959  1.00 0.00 ? 30 SER A C    3  
ATOM 2604  O O    . SER A 1 30 ? -0.741  6.294   -6.544  1.00 0.00 ? 30 SER A O    3  
ATOM 2605  C CB   . SER A 1 30 ? 1.027   8.152   -7.890  1.00 0.00 ? 30 SER A CB   3  
ATOM 2606  O OG   . SER A 1 30 ? 0.977   7.436   -9.112  1.00 0.00 ? 30 SER A OG   3  
ATOM 2607  H H    . SER A 1 30 ? 1.766   5.512   -7.906  1.00 0.00 ? 30 SER A H    3  
ATOM 2608  H HA   . SER A 1 30 ? 2.094   7.790   -6.070  1.00 0.00 ? 30 SER A HA   3  
ATOM 2609  H HB2  . SER A 1 30 ? 0.048   8.559   -7.686  1.00 0.00 ? 30 SER A HB2  3  
ATOM 2610  H HB3  . SER A 1 30 ? 1.739   8.958   -7.990  1.00 0.00 ? 30 SER A HB3  3  
ATOM 2611  H HG   . SER A 1 30 ? 1.867   7.316   -9.451  1.00 0.00 ? 30 SER A HG   3  
ATOM 2612  N N    . ILE A 1 31 ? 0.277   6.918   -4.635  1.00 0.00 ? 31 ILE A N    3  
ATOM 2613  C CA   . ILE A 1 31 ? -0.823  6.484   -3.779  1.00 0.00 ? 31 ILE A CA   3  
ATOM 2614  C C    . ILE A 1 31 ? -2.174  6.940   -4.334  1.00 0.00 ? 31 ILE A C    3  
ATOM 2615  O O    . ILE A 1 31 ? -3.201  6.301   -4.109  1.00 0.00 ? 31 ILE A O    3  
ATOM 2616  C CB   . ILE A 1 31 ? -0.650  6.985   -2.328  1.00 0.00 ? 31 ILE A CB   3  
ATOM 2617  C CG1  . ILE A 1 31 ? -1.542  6.176   -1.384  1.00 0.00 ? 31 ILE A CG1  3  
ATOM 2618  C CG2  . ILE A 1 31 ? -0.963  8.469   -2.216  1.00 0.00 ? 31 ILE A CG2  3  
ATOM 2619  C CD1  . ILE A 1 31 ? -0.770  5.411   -0.331  1.00 0.00 ? 31 ILE A CD1  3  
ATOM 2620  H H    . ILE A 1 31 ? 1.080   7.301   -4.226  1.00 0.00 ? 31 ILE A H    3  
ATOM 2621  H HA   . ILE A 1 31 ? -0.809  5.406   -3.755  1.00 0.00 ? 31 ILE A HA   3  
ATOM 2622  H HB   . ILE A 1 31 ? 0.382   6.842   -2.046  1.00 0.00 ? 31 ILE A HB   3  
ATOM 2623  H HG12 . ILE A 1 31 ? -2.221  6.845   -0.878  1.00 0.00 ? 31 ILE A HG12 3  
ATOM 2624  H HG13 . ILE A 1 31 ? -2.109  5.461   -1.962  1.00 0.00 ? 31 ILE A HG13 3  
ATOM 2625  H HG21 . ILE A 1 31 ? -0.927  8.917   -3.199  1.00 0.00 ? 31 ILE A HG21 3  
ATOM 2626  H HG22 . ILE A 1 31 ? -0.235  8.945   -1.576  1.00 0.00 ? 31 ILE A HG22 3  
ATOM 2627  H HG23 . ILE A 1 31 ? -1.950  8.596   -1.799  1.00 0.00 ? 31 ILE A HG23 3  
ATOM 2628  H HD11 . ILE A 1 31 ? -0.236  6.106   0.298   1.00 0.00 ? 31 ILE A HD11 3  
ATOM 2629  H HD12 . ILE A 1 31 ? -0.067  4.747   -0.811  1.00 0.00 ? 31 ILE A HD12 3  
ATOM 2630  H HD13 . ILE A 1 31 ? -1.457  4.835   0.270   1.00 0.00 ? 31 ILE A HD13 3  
ATOM 2631  N N    . TYR A 1 32 ? -2.160  8.043   -5.073  1.00 0.00 ? 32 TYR A N    3  
ATOM 2632  C CA   . TYR A 1 32 ? -3.374  8.557   -5.687  1.00 0.00 ? 32 TYR A CA   3  
ATOM 2633  C C    . TYR A 1 32 ? -4.007  7.504   -6.594  1.00 0.00 ? 32 TYR A C    3  
ATOM 2634  O O    . TYR A 1 32 ? -5.199  7.564   -6.893  1.00 0.00 ? 32 TYR A O    3  
ATOM 2635  C CB   . TYR A 1 32 ? -3.065  9.822   -6.491  1.00 0.00 ? 32 TYR A CB   3  
ATOM 2636  C CG   . TYR A 1 32 ? -3.910  11.010  -6.095  1.00 0.00 ? 32 TYR A CG   3  
ATOM 2637  C CD1  . TYR A 1 32 ? -5.240  10.850  -5.729  1.00 0.00 ? 32 TYR A CD1  3  
ATOM 2638  C CD2  . TYR A 1 32 ? -3.376  12.294  -6.085  1.00 0.00 ? 32 TYR A CD2  3  
ATOM 2639  C CE1  . TYR A 1 32 ? -6.016  11.933  -5.365  1.00 0.00 ? 32 TYR A CE1  3  
ATOM 2640  C CE2  . TYR A 1 32 ? -4.147  13.383  -5.723  1.00 0.00 ? 32 TYR A CE2  3  
ATOM 2641  C CZ   . TYR A 1 32 ? -5.464  13.197  -5.363  1.00 0.00 ? 32 TYR A CZ   3  
ATOM 2642  O OH   . TYR A 1 32 ? -6.234  14.279  -5.002  1.00 0.00 ? 32 TYR A OH   3  
ATOM 2643  H H    . TYR A 1 32 ? -1.312  8.506   -5.229  1.00 0.00 ? 32 TYR A H    3  
ATOM 2644  H HA   . TYR A 1 32 ? -4.068  8.800   -4.897  1.00 0.00 ? 32 TYR A HA   3  
ATOM 2645  H HB2  . TYR A 1 32 ? -2.029  10.088  -6.344  1.00 0.00 ? 32 TYR A HB2  3  
ATOM 2646  H HB3  . TYR A 1 32 ? -3.236  9.625   -7.538  1.00 0.00 ? 32 TYR A HB3  3  
ATOM 2647  H HD1  . TYR A 1 32 ? -5.668  9.858   -5.730  1.00 0.00 ? 32 TYR A HD1  3  
ATOM 2648  H HD2  . TYR A 1 32 ? -2.344  12.435  -6.367  1.00 0.00 ? 32 TYR A HD2  3  
ATOM 2649  H HE1  . TYR A 1 32 ? -7.048  11.788  -5.083  1.00 0.00 ? 32 TYR A HE1  3  
ATOM 2650  H HE2  . TYR A 1 32 ? -3.714  14.372  -5.722  1.00 0.00 ? 32 TYR A HE2  3  
ATOM 2651  H HH   . TYR A 1 32 ? -6.754  14.056  -4.226  1.00 0.00 ? 32 TYR A HH   3  
ATOM 2652  N N    . HIS A 1 33 ? -3.201  6.532   -7.022  1.00 0.00 ? 33 HIS A N    3  
ATOM 2653  C CA   . HIS A 1 33 ? -3.686  5.466   -7.893  1.00 0.00 ? 33 HIS A CA   3  
ATOM 2654  C C    . HIS A 1 33 ? -4.316  4.334   -7.084  1.00 0.00 ? 33 HIS A C    3  
ATOM 2655  O O    . HIS A 1 33 ? -5.115  3.558   -7.608  1.00 0.00 ? 33 HIS A O    3  
ATOM 2656  C CB   . HIS A 1 33 ? -2.541  4.918   -8.745  1.00 0.00 ? 33 HIS A CB   3  
ATOM 2657  C CG   . HIS A 1 33 ? -2.849  4.881   -10.210 1.00 0.00 ? 33 HIS A CG   3  
ATOM 2658  N ND1  . HIS A 1 33 ? -2.629  5.949   -11.053 1.00 0.00 ? 33 HIS A ND1  3  
ATOM 2659  C CD2  . HIS A 1 33 ? -3.365  3.894   -10.982 1.00 0.00 ? 33 HIS A CD2  3  
ATOM 2660  C CE1  . HIS A 1 33 ? -2.995  5.622   -12.280 1.00 0.00 ? 33 HIS A CE1  3  
ATOM 2661  N NE2  . HIS A 1 33 ? -3.444  4.381   -12.263 1.00 0.00 ? 33 HIS A NE2  3  
ATOM 2662  H H    . HIS A 1 33 ? -2.256  6.534   -6.754  1.00 0.00 ? 33 HIS A H    3  
ATOM 2663  H HA   . HIS A 1 33 ? -4.439  5.888   -8.544  1.00 0.00 ? 33 HIS A HA   3  
ATOM 2664  H HB2  . HIS A 1 33 ? -1.668  5.539   -8.606  1.00 0.00 ? 33 HIS A HB2  3  
ATOM 2665  H HB3  . HIS A 1 33 ? -2.315  3.911   -8.428  1.00 0.00 ? 33 HIS A HB3  3  
ATOM 2666  H HD1  . HIS A 1 33 ? -2.258  6.818   -10.792 1.00 0.00 ? 33 HIS A HD1  3  
ATOM 2667  H HD2  . HIS A 1 33 ? -3.658  2.908   -10.651 1.00 0.00 ? 33 HIS A HD2  3  
ATOM 2668  H HE1  . HIS A 1 33 ? -2.937  6.261   -13.149 1.00 0.00 ? 33 HIS A HE1  3  
ATOM 2669  H HE2  . HIS A 1 33 ? -3.781  3.889   -13.041 1.00 0.00 ? 33 HIS A HE2  3  
ATOM 2670  N N    . LEU A 1 34 ? -3.942  4.235   -5.812  1.00 0.00 ? 34 LEU A N    3  
ATOM 2671  C CA   . LEU A 1 34 ? -4.475  3.192   -4.940  1.00 0.00 ? 34 LEU A CA   3  
ATOM 2672  C C    . LEU A 1 34 ? -5.465  3.760   -3.930  1.00 0.00 ? 34 LEU A C    3  
ATOM 2673  O O    . LEU A 1 34 ? -5.764  3.130   -2.917  1.00 0.00 ? 34 LEU A O    3  
ATOM 2674  C CB   . LEU A 1 34 ? -3.338  2.486   -4.207  1.00 0.00 ? 34 LEU A CB   3  
ATOM 2675  C CG   . LEU A 1 34 ? -2.108  3.351   -3.918  1.00 0.00 ? 34 LEU A CG   3  
ATOM 2676  C CD1  . LEU A 1 34 ? -1.300  2.758   -2.775  1.00 0.00 ? 34 LEU A CD1  3  
ATOM 2677  C CD2  . LEU A 1 34 ? -1.248  3.485   -5.165  1.00 0.00 ? 34 LEU A CD2  3  
ATOM 2678  H H    . LEU A 1 34 ? -3.305  4.883   -5.447  1.00 0.00 ? 34 LEU A H    3  
ATOM 2679  H HA   . LEU A 1 34 ? -4.989  2.476   -5.562  1.00 0.00 ? 34 LEU A HA   3  
ATOM 2680  H HB2  . LEU A 1 34 ? -3.719  2.113   -3.268  1.00 0.00 ? 34 LEU A HB2  3  
ATOM 2681  H HB3  . LEU A 1 34 ? -3.028  1.649   -4.807  1.00 0.00 ? 34 LEU A HB3  3  
ATOM 2682  H HG   . LEU A 1 34 ? -2.428  4.340   -3.621  1.00 0.00 ? 34 LEU A HG   3  
ATOM 2683  H HD11 . LEU A 1 34 ? -1.713  3.087   -1.833  1.00 0.00 ? 34 LEU A HD11 3  
ATOM 2684  H HD12 . LEU A 1 34 ? -0.274  3.087   -2.851  1.00 0.00 ? 34 LEU A HD12 3  
ATOM 2685  H HD13 . LEU A 1 34 ? -1.337  1.680   -2.829  1.00 0.00 ? 34 LEU A HD13 3  
ATOM 2686  H HD21 . LEU A 1 34 ? -1.497  2.697   -5.859  1.00 0.00 ? 34 LEU A HD21 3  
ATOM 2687  H HD22 . LEU A 1 34 ? -0.206  3.411   -4.894  1.00 0.00 ? 34 LEU A HD22 3  
ATOM 2688  H HD23 . LEU A 1 34 ? -1.431  4.442   -5.628  1.00 0.00 ? 34 LEU A HD23 3  
ATOM 2689  N N    . GLN A 1 35 ? -5.978  4.948   -4.218  1.00 0.00 ? 35 GLN A N    3  
ATOM 2690  C CA   . GLN A 1 35 ? -6.938  5.601   -3.338  1.00 0.00 ? 35 GLN A CA   3  
ATOM 2691  C C    . GLN A 1 35 ? -8.278  4.865   -3.336  1.00 0.00 ? 35 GLN A C    3  
ATOM 2692  O O    . GLN A 1 35 ? -9.083  5.033   -2.420  1.00 0.00 ? 35 GLN A O    3  
ATOM 2693  C CB   . GLN A 1 35 ? -7.145  7.054   -3.771  1.00 0.00 ? 35 GLN A CB   3  
ATOM 2694  C CG   . GLN A 1 35 ? -8.037  7.849   -2.832  1.00 0.00 ? 35 GLN A CG   3  
ATOM 2695  C CD   . GLN A 1 35 ? -7.300  8.988   -2.153  1.00 0.00 ? 35 GLN A CD   3  
ATOM 2696  O OE1  . GLN A 1 35 ? -7.393  10.141  -2.574  1.00 0.00 ? 35 GLN A OE1  3  
ATOM 2697  N NE2  . GLN A 1 35 ? -6.563  8.667   -1.096  1.00 0.00 ? 35 GLN A NE2  3  
ATOM 2698  H H    . GLN A 1 35 ? -5.699  5.399   -5.039  1.00 0.00 ? 35 GLN A H    3  
ATOM 2699  H HA   . GLN A 1 35 ? -6.533  5.586   -2.337  1.00 0.00 ? 35 GLN A HA   3  
ATOM 2700  H HB2  . GLN A 1 35 ? -6.182  7.542   -3.820  1.00 0.00 ? 35 GLN A HB2  3  
ATOM 2701  H HB3  . GLN A 1 35 ? -7.593  7.064   -4.754  1.00 0.00 ? 35 GLN A HB3  3  
ATOM 2702  H HG2  . GLN A 1 35 ? -8.857  8.261   -3.400  1.00 0.00 ? 35 GLN A HG2  3  
ATOM 2703  H HG3  . GLN A 1 35 ? -8.421  7.185   -2.073  1.00 0.00 ? 35 GLN A HG3  3  
ATOM 2704  H HE21 . GLN A 1 35 ? -6.536  7.728   -0.817  1.00 0.00 ? 35 GLN A HE21 3  
ATOM 2705  H HE22 . GLN A 1 35 ? -6.076  9.385   -0.637  1.00 0.00 ? 35 GLN A HE22 3  
ATOM 2706  N N    . ASN A 1 36 ? -8.512  4.049   -4.362  1.00 0.00 ? 36 ASN A N    3  
ATOM 2707  C CA   . ASN A 1 36 ? -9.765  3.310   -4.475  1.00 0.00 ? 36 ASN A CA   3  
ATOM 2708  C C    . ASN A 1 36 ? -9.535  1.804   -4.630  1.00 0.00 ? 36 ASN A C    3  
ATOM 2709  O O    . ASN A 1 36 ? -10.482 1.021   -4.581  1.00 0.00 ? 36 ASN A O    3  
ATOM 2710  C CB   . ASN A 1 36 ? -10.575 3.835   -5.662  1.00 0.00 ? 36 ASN A CB   3  
ATOM 2711  C CG   . ASN A 1 36 ? -11.549 4.923   -5.262  1.00 0.00 ? 36 ASN A CG   3  
ATOM 2712  O OD1  . ASN A 1 36 ? -12.623 4.649   -4.727  1.00 0.00 ? 36 ASN A OD1  3  
ATOM 2713  N ND2  . ASN A 1 36 ? -11.175 6.170   -5.523  1.00 0.00 ? 36 ASN A ND2  3  
ATOM 2714  H H    . ASN A 1 36 ? -7.841  3.963   -5.070  1.00 0.00 ? 36 ASN A H    3  
ATOM 2715  H HA   . ASN A 1 36 ? -10.327 3.479   -3.568  1.00 0.00 ? 36 ASN A HA   3  
ATOM 2716  H HB2  . ASN A 1 36 ? -9.900  4.241   -6.400  1.00 0.00 ? 36 ASN A HB2  3  
ATOM 2717  H HB3  . ASN A 1 36 ? -11.134 3.020   -6.099  1.00 0.00 ? 36 ASN A HB3  3  
ATOM 2718  H HD21 . ASN A 1 36 ? -10.307 6.313   -5.952  1.00 0.00 ? 36 ASN A HD21 3  
ATOM 2719  H HD22 . ASN A 1 36 ? -11.784 6.895   -5.277  1.00 0.00 ? 36 ASN A HD22 3  
ATOM 2720  N N    . LEU A 1 37 ? -8.279  1.398   -4.820  1.00 0.00 ? 37 LEU A N    3  
ATOM 2721  C CA   . LEU A 1 37 ? -7.953  -0.015  -4.985  1.00 0.00 ? 37 LEU A CA   3  
ATOM 2722  C C    . LEU A 1 37 ? -8.345  -0.815  -3.745  1.00 0.00 ? 37 LEU A C    3  
ATOM 2723  O O    . LEU A 1 37 ? -8.410  -0.275  -2.640  1.00 0.00 ? 37 LEU A O    3  
ATOM 2724  C CB   . LEU A 1 37 ? -6.459  -0.187  -5.269  1.00 0.00 ? 37 LEU A CB   3  
ATOM 2725  C CG   . LEU A 1 37 ? -6.128  -0.870  -6.598  1.00 0.00 ? 37 LEU A CG   3  
ATOM 2726  C CD1  . LEU A 1 37 ? -4.988  -0.149  -7.300  1.00 0.00 ? 37 LEU A CD1  3  
ATOM 2727  C CD2  . LEU A 1 37 ? -5.779  -2.334  -6.372  1.00 0.00 ? 37 LEU A CD2  3  
ATOM 2728  H H    . LEU A 1 37 ? -7.559  2.059   -4.855  1.00 0.00 ? 37 LEU A H    3  
ATOM 2729  H HA   . LEU A 1 37 ? -8.517  -0.386  -5.828  1.00 0.00 ? 37 LEU A HA   3  
ATOM 2730  H HB2  . LEU A 1 37 ? -6.000  0.790   -5.268  1.00 0.00 ? 37 LEU A HB2  3  
ATOM 2731  H HB3  . LEU A 1 37 ? -6.025  -0.770  -4.471  1.00 0.00 ? 37 LEU A HB3  3  
ATOM 2732  H HG   . LEU A 1 37 ? -6.994  -0.830  -7.241  1.00 0.00 ? 37 LEU A HG   3  
ATOM 2733  H HD11 . LEU A 1 37 ? -4.072  -0.301  -6.748  1.00 0.00 ? 37 LEU A HD11 3  
ATOM 2734  H HD12 . LEU A 1 37 ? -5.207  0.907   -7.351  1.00 0.00 ? 37 LEU A HD12 3  
ATOM 2735  H HD13 . LEU A 1 37 ? -4.874  -0.544  -8.299  1.00 0.00 ? 37 LEU A HD13 3  
ATOM 2736  H HD21 . LEU A 1 37 ? -6.572  -2.812  -5.817  1.00 0.00 ? 37 LEU A HD21 3  
ATOM 2737  H HD22 . LEU A 1 37 ? -4.857  -2.402  -5.815  1.00 0.00 ? 37 LEU A HD22 3  
ATOM 2738  H HD23 . LEU A 1 37 ? -5.661  -2.827  -7.326  1.00 0.00 ? 37 LEU A HD23 3  
ATOM 2739  N N    . THR A 1 38 ? -8.610  -2.105  -3.937  1.00 0.00 ? 38 THR A N    3  
ATOM 2740  C CA   . THR A 1 38 ? -9.003  -2.978  -2.836  1.00 0.00 ? 38 THR A CA   3  
ATOM 2741  C C    . THR A 1 38 ? -8.356  -4.348  -2.954  1.00 0.00 ? 38 THR A C    3  
ATOM 2742  O O    . THR A 1 38 ? -7.657  -4.639  -3.925  1.00 0.00 ? 38 THR A O    3  
ATOM 2743  C CB   . THR A 1 38 ? -10.524 -3.150  -2.813  1.00 0.00 ? 38 THR A CB   3  
ATOM 2744  O OG1  . THR A 1 38 ? -11.143 -2.282  -3.747  1.00 0.00 ? 38 THR A OG1  3  
ATOM 2745  C CG2  . THR A 1 38 ? -11.135 -2.882  -1.457  1.00 0.00 ? 38 THR A CG2  3  
ATOM 2746  H H    . THR A 1 38 ? -8.545  -2.477  -4.841  1.00 0.00 ? 38 THR A H    3  
ATOM 2747  H HA   . THR A 1 38 ? -8.684  -2.517  -1.913  1.00 0.00 ? 38 THR A HA   3  
ATOM 2748  H HB   . THR A 1 38 ? -10.765 -4.173  -3.087  1.00 0.00 ? 38 THR A HB   3  
ATOM 2749  H HG1  . THR A 1 38 ? -10.885 -1.376  -3.561  1.00 0.00 ? 38 THR A HG1  3  
ATOM 2750  H HG21 . THR A 1 38 ? -10.500 -2.205  -0.905  1.00 0.00 ? 38 THR A HG21 3  
ATOM 2751  H HG22 . THR A 1 38 ? -11.226 -3.811  -0.915  1.00 0.00 ? 38 THR A HG22 3  
ATOM 2752  H HG23 . THR A 1 38 ? -12.111 -2.439  -1.583  1.00 0.00 ? 38 THR A HG23 3  
ATOM 2753  N N    . ILE A 1 39 ? -8.630  -5.201  -1.973  1.00 0.00 ? 39 ILE A N    3  
ATOM 2754  C CA   . ILE A 1 39 ? -8.141  -6.568  -1.999  1.00 0.00 ? 39 ILE A CA   3  
ATOM 2755  C C    . ILE A 1 39 ? -8.684  -7.277  -3.224  1.00 0.00 ? 39 ILE A C    3  
ATOM 2756  O O    . ILE A 1 39 ? -8.013  -8.109  -3.833  1.00 0.00 ? 39 ILE A O    3  
ATOM 2757  C CB   . ILE A 1 39 ? -8.567  -7.342  -0.742  1.00 0.00 ? 39 ILE A CB   3  
ATOM 2758  C CG1  . ILE A 1 39 ? -7.980  -8.754  -0.760  1.00 0.00 ? 39 ILE A CG1  3  
ATOM 2759  C CG2  . ILE A 1 39 ? -10.083 -7.396  -0.641  1.00 0.00 ? 39 ILE A CG2  3  
ATOM 2760  C CD1  . ILE A 1 39 ? -6.471  -8.782  -0.849  1.00 0.00 ? 39 ILE A CD1  3  
ATOM 2761  H H    . ILE A 1 39 ? -9.223  -4.919  -1.245  1.00 0.00 ? 39 ILE A H    3  
ATOM 2762  H HA   . ILE A 1 39 ? -7.064  -6.546  -2.044  1.00 0.00 ? 39 ILE A HA   3  
ATOM 2763  H HB   . ILE A 1 39 ? -8.196  -6.811  0.118   1.00 0.00 ? 39 ILE A HB   3  
ATOM 2764  H HG12 . ILE A 1 39 ? -8.268  -9.268  0.145   1.00 0.00 ? 39 ILE A HG12 3  
ATOM 2765  H HG13 . ILE A 1 39 ? -8.372  -9.288  -1.612  1.00 0.00 ? 39 ILE A HG13 3  
ATOM 2766  H HG21 . ILE A 1 39 ? -10.485 -7.891  -1.511  1.00 0.00 ? 39 ILE A HG21 3  
ATOM 2767  H HG22 . ILE A 1 39 ? -10.475 -6.392  -0.584  1.00 0.00 ? 39 ILE A HG22 3  
ATOM 2768  H HG23 . ILE A 1 39 ? -10.364 -7.944  0.247   1.00 0.00 ? 39 ILE A HG23 3  
ATOM 2769  H HD11 . ILE A 1 39 ? -6.152  -8.239  -1.726  1.00 0.00 ? 39 ILE A HD11 3  
ATOM 2770  H HD12 . ILE A 1 39 ? -6.136  -9.806  -0.918  1.00 0.00 ? 39 ILE A HD12 3  
ATOM 2771  H HD13 . ILE A 1 39 ? -6.049  -8.322  0.033   1.00 0.00 ? 39 ILE A HD13 3  
ATOM 2772  N N    . GLU A 1 40 ? -9.905  -6.909  -3.593  1.00 0.00 ? 40 GLU A N    3  
ATOM 2773  C CA   . GLU A 1 40 ? -10.553 -7.485  -4.761  1.00 0.00 ? 40 GLU A CA   3  
ATOM 2774  C C    . GLU A 1 40 ? -9.706  -7.254  -6.007  1.00 0.00 ? 40 GLU A C    3  
ATOM 2775  O O    . GLU A 1 40 ? -9.587  -8.132  -6.861  1.00 0.00 ? 40 GLU A O    3  
ATOM 2776  C CB   . GLU A 1 40 ? -11.955 -6.896  -4.953  1.00 0.00 ? 40 GLU A CB   3  
ATOM 2777  C CG   . GLU A 1 40 ? -12.025 -5.389  -4.775  1.00 0.00 ? 40 GLU A CG   3  
ATOM 2778  C CD   . GLU A 1 40 ? -12.888 -4.720  -5.827  1.00 0.00 ? 40 GLU A CD   3  
ATOM 2779  O OE1  . GLU A 1 40 ? -13.577 -5.441  -6.577  1.00 0.00 ? 40 GLU A OE1  3  
ATOM 2780  O OE2  . GLU A 1 40 ? -12.874 -3.473  -5.900  1.00 0.00 ? 40 GLU A OE2  3  
ATOM 2781  H H    . GLU A 1 40 ? -10.379 -6.236  -3.062  1.00 0.00 ? 40 GLU A H    3  
ATOM 2782  H HA   . GLU A 1 40 ? -10.641 -8.543  -4.592  1.00 0.00 ? 40 GLU A HA   3  
ATOM 2783  H HB2  . GLU A 1 40 ? -12.298 -7.135  -5.949  1.00 0.00 ? 40 GLU A HB2  3  
ATOM 2784  H HB3  . GLU A 1 40 ? -12.623 -7.351  -4.235  1.00 0.00 ? 40 GLU A HB3  3  
ATOM 2785  H HG2  . GLU A 1 40 ? -12.438 -5.173  -3.801  1.00 0.00 ? 40 GLU A HG2  3  
ATOM 2786  H HG3  . GLU A 1 40 ? -11.028 -4.984  -4.840  1.00 0.00 ? 40 GLU A HG3  3  
ATOM 2787  N N    . ASP A 1 41 ? -9.119  -6.064  -6.104  1.00 0.00 ? 41 ASP A N    3  
ATOM 2788  C CA   . ASP A 1 41 ? -8.257  -5.722  -7.229  1.00 0.00 ? 41 ASP A CA   3  
ATOM 2789  C C    . ASP A 1 41 ? -6.827  -6.183  -6.970  1.00 0.00 ? 41 ASP A C    3  
ATOM 2790  O O    . ASP A 1 41 ? -6.115  -6.585  -7.890  1.00 0.00 ? 41 ASP A O    3  
ATOM 2791  C CB   . ASP A 1 41 ? -8.283  -4.213  -7.481  1.00 0.00 ? 41 ASP A CB   3  
ATOM 2792  C CG   . ASP A 1 41 ? -9.184  -3.834  -8.639  1.00 0.00 ? 41 ASP A CG   3  
ATOM 2793  O OD1  . ASP A 1 41 ? -9.364  -4.670  -9.550  1.00 0.00 ? 41 ASP A OD1  3  
ATOM 2794  O OD2  . ASP A 1 41 ? -9.709  -2.701  -8.637  1.00 0.00 ? 41 ASP A OD2  3  
ATOM 2795  H H    . ASP A 1 41 ? -9.238  -5.413  -5.381  1.00 0.00 ? 41 ASP A H    3  
ATOM 2796  H HA   . ASP A 1 41 ? -8.634  -6.233  -8.103  1.00 0.00 ? 41 ASP A HA   3  
ATOM 2797  H HB2  . ASP A 1 41 ? -8.640  -3.713  -6.593  1.00 0.00 ? 41 ASP A HB2  3  
ATOM 2798  H HB3  . ASP A 1 41 ? -7.282  -3.874  -7.702  1.00 0.00 ? 41 ASP A HB3  3  
ATOM 2799  N N    . LEU A 1 42 ? -6.414  -6.118  -5.707  1.00 0.00 ? 42 LEU A N    3  
ATOM 2800  C CA   . LEU A 1 42 ? -5.069  -6.526  -5.314  1.00 0.00 ? 42 LEU A CA   3  
ATOM 2801  C C    . LEU A 1 42 ? -4.721  -7.890  -5.902  1.00 0.00 ? 42 LEU A C    3  
ATOM 2802  O O    . LEU A 1 42 ? -3.755  -8.025  -6.652  1.00 0.00 ? 42 LEU A O    3  
ATOM 2803  C CB   . LEU A 1 42 ? -4.955  -6.571  -3.781  1.00 0.00 ? 42 LEU A CB   3  
ATOM 2804  C CG   . LEU A 1 42 ? -4.914  -5.217  -3.036  1.00 0.00 ? 42 LEU A CG   3  
ATOM 2805  C CD1  . LEU A 1 42 ? -3.691  -5.153  -2.140  1.00 0.00 ? 42 LEU A CD1  3  
ATOM 2806  C CD2  . LEU A 1 42 ? -4.933  -4.023  -3.987  1.00 0.00 ? 42 LEU A CD2  3  
ATOM 2807  H H    . LEU A 1 42 ? -7.030  -5.789  -5.021  1.00 0.00 ? 42 LEU A H    3  
ATOM 2808  H HA   . LEU A 1 42 ? -4.376  -5.792  -5.698  1.00 0.00 ? 42 LEU A HA   3  
ATOM 2809  H HB2  . LEU A 1 42 ? -5.797  -7.132  -3.404  1.00 0.00 ? 42 LEU A HB2  3  
ATOM 2810  H HB3  . LEU A 1 42 ? -4.053  -7.114  -3.534  1.00 0.00 ? 42 LEU A HB3  3  
ATOM 2811  H HG   . LEU A 1 42 ? -5.784  -5.142  -2.400  1.00 0.00 ? 42 LEU A HG   3  
ATOM 2812  H HD11 . LEU A 1 42 ? -3.860  -5.755  -1.260  1.00 0.00 ? 42 LEU A HD11 3  
ATOM 2813  H HD12 . LEU A 1 42 ? -3.512  -4.129  -1.847  1.00 0.00 ? 42 LEU A HD12 3  
ATOM 2814  H HD13 . LEU A 1 42 ? -2.830  -5.531  -2.674  1.00 0.00 ? 42 LEU A HD13 3  
ATOM 2815  H HD21 . LEU A 1 42 ? -3.964  -3.919  -4.454  1.00 0.00 ? 42 LEU A HD21 3  
ATOM 2816  H HD22 . LEU A 1 42 ? -5.164  -3.125  -3.433  1.00 0.00 ? 42 LEU A HD22 3  
ATOM 2817  H HD23 . LEU A 1 42 ? -5.684  -4.179  -4.747  1.00 0.00 ? 42 LEU A HD23 3  
ATOM 2818  N N    . GLY A 1 43 ? -5.521  -8.895  -5.563  1.00 0.00 ? 43 GLY A N    3  
ATOM 2819  C CA   . GLY A 1 43 ? -5.293  -10.230 -6.080  1.00 0.00 ? 43 GLY A CA   3  
ATOM 2820  C C    . GLY A 1 43 ? -5.298  -10.271 -7.596  1.00 0.00 ? 43 GLY A C    3  
ATOM 2821  O O    . GLY A 1 43 ? -4.791  -11.216 -8.200  1.00 0.00 ? 43 GLY A O    3  
ATOM 2822  H H    . GLY A 1 43 ? -6.282  -8.725  -4.968  1.00 0.00 ? 43 GLY A H    3  
ATOM 2823  H HA2  . GLY A 1 43 ? -4.336  -10.584 -5.724  1.00 0.00 ? 43 GLY A HA2  3  
ATOM 2824  H HA3  . GLY A 1 43 ? -6.067  -10.885 -5.709  1.00 0.00 ? 43 GLY A HA3  3  
ATOM 2825  N N    . ALA A 1 44 ? -5.878  -9.244  -8.214  1.00 0.00 ? 44 ALA A N    3  
ATOM 2826  C CA   . ALA A 1 44 ? -5.944  -9.166  -9.668  1.00 0.00 ? 44 ALA A CA   3  
ATOM 2827  C C    . ALA A 1 44 ? -4.554  -8.981  -10.265 1.00 0.00 ? 44 ALA A C    3  
ATOM 2828  O O    . ALA A 1 44 ? -4.278  -9.437  -11.373 1.00 0.00 ? 44 ALA A O    3  
ATOM 2829  C CB   . ALA A 1 44 ? -6.861  -8.030  -10.096 1.00 0.00 ? 44 ALA A CB   3  
ATOM 2830  H H    . ALA A 1 44 ? -6.263  -8.520  -7.679  1.00 0.00 ? 44 ALA A H    3  
ATOM 2831  H HA   . ALA A 1 44 ? -6.363  -10.091 -10.034 1.00 0.00 ? 44 ALA A HA   3  
ATOM 2832  H HB1  . ALA A 1 44 ? -7.734  -8.013  -9.460  1.00 0.00 ? 44 ALA A HB1  3  
ATOM 2833  H HB2  . ALA A 1 44 ? -7.165  -8.181  -11.121 1.00 0.00 ? 44 ALA A HB2  3  
ATOM 2834  H HB3  . ALA A 1 44 ? -6.335  -7.091  -10.011 1.00 0.00 ? 44 ALA A HB3  3  
ATOM 2835  N N    . LEU A 1 45 ? -3.684  -8.311  -9.518  1.00 0.00 ? 45 LEU A N    3  
ATOM 2836  C CA   . LEU A 1 45 ? -2.321  -8.064  -9.963  1.00 0.00 ? 45 LEU A CA   3  
ATOM 2837  C C    . LEU A 1 45 ? -1.547  -9.370  -10.149 1.00 0.00 ? 45 LEU A C    3  
ATOM 2838  O O    . LEU A 1 45 ? -0.515  -9.397  -10.820 1.00 0.00 ? 45 LEU A O    3  
ATOM 2839  C CB   . LEU A 1 45 ? -1.605  -7.171  -8.952  1.00 0.00 ? 45 LEU A CB   3  
ATOM 2840  C CG   . LEU A 1 45 ? -2.045  -5.707  -8.962  1.00 0.00 ? 45 LEU A CG   3  
ATOM 2841  C CD1  . LEU A 1 45 ? -3.551  -5.595  -8.782  1.00 0.00 ? 45 LEU A CD1  3  
ATOM 2842  C CD2  . LEU A 1 45 ? -1.319  -4.929  -7.878  1.00 0.00 ? 45 LEU A CD2  3  
ATOM 2843  H H    . LEU A 1 45 ? -3.966  -7.968  -8.645  1.00 0.00 ? 45 LEU A H    3  
ATOM 2844  H HA   . LEU A 1 45 ? -2.370  -7.551  -10.913 1.00 0.00 ? 45 LEU A HA   3  
ATOM 2845  H HB2  . LEU A 1 45 ? -1.779  -7.571  -7.964  1.00 0.00 ? 45 LEU A HB2  3  
ATOM 2846  H HB3  . LEU A 1 45 ? -0.543  -7.209  -9.153  1.00 0.00 ? 45 LEU A HB3  3  
ATOM 2847  H HG   . LEU A 1 45 ? -1.793  -5.273  -9.915  1.00 0.00 ? 45 LEU A HG   3  
ATOM 2848  H HD11 . LEU A 1 45 ? -3.821  -4.557  -8.650  1.00 0.00 ? 45 LEU A HD11 3  
ATOM 2849  H HD12 . LEU A 1 45 ? -3.853  -6.158  -7.912  1.00 0.00 ? 45 LEU A HD12 3  
ATOM 2850  H HD13 . LEU A 1 45 ? -4.048  -5.987  -9.656  1.00 0.00 ? 45 LEU A HD13 3  
ATOM 2851  H HD21 . LEU A 1 45 ? -1.578  -5.334  -6.912  1.00 0.00 ? 45 LEU A HD21 3  
ATOM 2852  H HD22 . LEU A 1 45 ? -1.610  -3.890  -7.923  1.00 0.00 ? 45 LEU A HD22 3  
ATOM 2853  H HD23 . LEU A 1 45 ? -0.253  -5.012  -8.028  1.00 0.00 ? 45 LEU A HD23 3  
ATOM 2854  N N    . LYS A 1 46 ? -2.054  -10.453 -9.561  1.00 0.00 ? 46 LYS A N    3  
ATOM 2855  C CA   . LYS A 1 46 ? -1.408  -11.763 -9.667  1.00 0.00 ? 46 LYS A CA   3  
ATOM 2856  C C    . LYS A 1 46 ? -0.155  -11.836 -8.802  1.00 0.00 ? 46 LYS A C    3  
ATOM 2857  O O    . LYS A 1 46 ? 0.686   -12.717 -8.980  1.00 0.00 ? 46 LYS A O    3  
ATOM 2858  C CB   . LYS A 1 46 ? -1.050  -12.075 -11.122 1.00 0.00 ? 46 LYS A CB   3  
ATOM 2859  C CG   . LYS A 1 46 ? -2.016  -11.468 -12.123 1.00 0.00 ? 46 LYS A CG   3  
ATOM 2860  C CD   . LYS A 1 46 ? -2.485  -12.494 -13.142 1.00 0.00 ? 46 LYS A CD   3  
ATOM 2861  C CE   . LYS A 1 46 ? -1.319  -13.088 -13.914 1.00 0.00 ? 46 LYS A CE   3  
ATOM 2862  N NZ   . LYS A 1 46 ? -1.730  -13.570 -15.260 1.00 0.00 ? 46 LYS A NZ   3  
ATOM 2863  H H    . LYS A 1 46 ? -2.877  -10.372 -9.038  1.00 0.00 ? 46 LYS A H    3  
ATOM 2864  H HA   . LYS A 1 46 ? -2.109  -12.501 -9.313  1.00 0.00 ? 46 LYS A HA   3  
ATOM 2865  H HB2  . LYS A 1 46 ? -0.062  -11.691 -11.329 1.00 0.00 ? 46 LYS A HB2  3  
ATOM 2866  H HB3  . LYS A 1 46 ? -1.046  -13.146 -11.260 1.00 0.00 ? 46 LYS A HB3  3  
ATOM 2867  H HG2  . LYS A 1 46 ? -2.872  -11.089 -11.586 1.00 0.00 ? 46 LYS A HG2  3  
ATOM 2868  H HG3  . LYS A 1 46 ? -1.523  -10.659 -12.637 1.00 0.00 ? 46 LYS A HG3  3  
ATOM 2869  H HD2  . LYS A 1 46 ? -3.005  -13.288 -12.627 1.00 0.00 ? 46 LYS A HD2  3  
ATOM 2870  H HD3  . LYS A 1 46 ? -3.157  -12.014 -13.838 1.00 0.00 ? 46 LYS A HD3  3  
ATOM 2871  H HE2  . LYS A 1 46 ? -0.557  -12.331 -14.029 1.00 0.00 ? 46 LYS A HE2  3  
ATOM 2872  H HE3  . LYS A 1 46 ? -0.917  -13.918 -13.351 1.00 0.00 ? 46 LYS A HE3  3  
ATOM 2873  H HZ1  . LYS A 1 46 ? -2.077  -12.775 -15.835 1.00 0.00 ? 46 LYS A HZ1  3  
ATOM 2874  H HZ2  . LYS A 1 46 ? -2.489  -14.275 -15.172 1.00 0.00 ? 46 LYS A HZ2  3  
ATOM 2875  H HZ3  . LYS A 1 46 ? -0.921  -14.007 -15.747 1.00 0.00 ? 46 LYS A HZ3  3  
ATOM 2876  N N    . ILE A 1 47 ? -0.046  -10.913 -7.858  1.00 0.00 ? 47 ILE A N    3  
ATOM 2877  C CA   . ILE A 1 47 ? 1.093   -10.878 -6.949  1.00 0.00 ? 47 ILE A CA   3  
ATOM 2878  C C    . ILE A 1 47 ? 0.909   -11.884 -5.815  1.00 0.00 ? 47 ILE A C    3  
ATOM 2879  O O    . ILE A 1 47 ? -0.188  -12.020 -5.271  1.00 0.00 ? 47 ILE A O    3  
ATOM 2880  C CB   . ILE A 1 47 ? 1.288   -9.471  -6.352  1.00 0.00 ? 47 ILE A CB   3  
ATOM 2881  C CG1  . ILE A 1 47 ? 1.086   -8.409  -7.431  1.00 0.00 ? 47 ILE A CG1  3  
ATOM 2882  C CG2  . ILE A 1 47 ? 2.667   -9.339  -5.730  1.00 0.00 ? 47 ILE A CG2  3  
ATOM 2883  C CD1  . ILE A 1 47 ? 1.304   -6.995  -6.936  1.00 0.00 ? 47 ILE A CD1  3  
ATOM 2884  H H    . ILE A 1 47 ? -0.755  -10.246 -7.763  1.00 0.00 ? 47 ILE A H    3  
ATOM 2885  H HA   . ILE A 1 47 ? 1.978   -11.136 -7.511  1.00 0.00 ? 47 ILE A HA   3  
ATOM 2886  H HB   . ILE A 1 47 ? 0.553   -9.331  -5.573  1.00 0.00 ? 47 ILE A HB   3  
ATOM 2887  H HG12 . ILE A 1 47 ? 1.781   -8.587  -8.238  1.00 0.00 ? 47 ILE A HG12 3  
ATOM 2888  H HG13 . ILE A 1 47 ? 0.078   -8.477  -7.807  1.00 0.00 ? 47 ILE A HG13 3  
ATOM 2889  H HG21 . ILE A 1 47 ? 3.421   -9.502  -6.486  1.00 0.00 ? 47 ILE A HG21 3  
ATOM 2890  H HG22 . ILE A 1 47 ? 2.781   -10.071 -4.945  1.00 0.00 ? 47 ILE A HG22 3  
ATOM 2891  H HG23 . ILE A 1 47 ? 2.781   -8.348  -5.316  1.00 0.00 ? 47 ILE A HG23 3  
ATOM 2892  H HD11 . ILE A 1 47 ? 2.275   -6.923  -6.469  1.00 0.00 ? 47 ILE A HD11 3  
ATOM 2893  H HD12 . ILE A 1 47 ? 0.539   -6.744  -6.215  1.00 0.00 ? 47 ILE A HD12 3  
ATOM 2894  H HD13 . ILE A 1 47 ? 1.253   -6.309  -7.769  1.00 0.00 ? 47 ILE A HD13 3  
ATOM 2895  N N    . PRO A 1 48 ? 1.979   -12.614 -5.448  1.00 0.00 ? 48 PRO A N    3  
ATOM 2896  C CA   . PRO A 1 48 ? 1.930   -13.611 -4.378  1.00 0.00 ? 48 PRO A CA   3  
ATOM 2897  C C    . PRO A 1 48 ? 1.049   -13.181 -3.210  1.00 0.00 ? 48 PRO A C    3  
ATOM 2898  O O    . PRO A 1 48 ? 1.361   -12.223 -2.502  1.00 0.00 ? 48 PRO A O    3  
ATOM 2899  C CB   . PRO A 1 48 ? 3.391   -13.704 -3.950  1.00 0.00 ? 48 PRO A CB   3  
ATOM 2900  C CG   . PRO A 1 48 ? 4.158   -13.465 -5.207  1.00 0.00 ? 48 PRO A CG   3  
ATOM 2901  C CD   . PRO A 1 48 ? 3.326   -12.521 -6.043  1.00 0.00 ? 48 PRO A CD   3  
ATOM 2902  H HA   . PRO A 1 48 ? 1.598   -14.571 -4.746  1.00 0.00 ? 48 PRO A HA   3  
ATOM 2903  H HB2  . PRO A 1 48 ? 3.600   -12.949 -3.207  1.00 0.00 ? 48 PRO A HB2  3  
ATOM 2904  H HB3  . PRO A 1 48 ? 3.590   -14.684 -3.544  1.00 0.00 ? 48 PRO A HB3  3  
ATOM 2905  H HG2  . PRO A 1 48 ? 5.111   -13.014 -4.973  1.00 0.00 ? 48 PRO A HG2  3  
ATOM 2906  H HG3  . PRO A 1 48 ? 4.303   -14.398 -5.729  1.00 0.00 ? 48 PRO A HG3  3  
ATOM 2907  H HD2  . PRO A 1 48 ? 3.712   -11.516 -5.970  1.00 0.00 ? 48 PRO A HD2  3  
ATOM 2908  H HD3  . PRO A 1 48 ? 3.314   -12.846 -7.073  1.00 0.00 ? 48 PRO A HD3  3  
ATOM 2909  N N    . GLU A 1 49 ? -0.063  -13.887 -3.025  1.00 0.00 ? 49 GLU A N    3  
ATOM 2910  C CA   . GLU A 1 49 ? -1.002  -13.573 -1.954  1.00 0.00 ? 49 GLU A CA   3  
ATOM 2911  C C    . GLU A 1 49 ? -0.394  -13.868 -0.586  1.00 0.00 ? 49 GLU A C    3  
ATOM 2912  O O    . GLU A 1 49 ? -0.889  -14.721 0.151   1.00 0.00 ? 49 GLU A O    3  
ATOM 2913  C CB   . GLU A 1 49 ? -2.296  -14.370 -2.134  1.00 0.00 ? 49 GLU A CB   3  
ATOM 2914  C CG   . GLU A 1 49 ? -3.388  -13.987 -1.148  1.00 0.00 ? 49 GLU A CG   3  
ATOM 2915  C CD   . GLU A 1 49 ? -4.774  -14.047 -1.761  1.00 0.00 ? 49 GLU A CD   3  
ATOM 2916  O OE1  . GLU A 1 49 ? -4.872  -14.080 -3.006  1.00 0.00 ? 49 GLU A OE1  3  
ATOM 2917  O OE2  . GLU A 1 49 ? -5.761  -14.058 -0.996  1.00 0.00 ? 49 GLU A OE2  3  
ATOM 2918  H H    . GLU A 1 49 ? -0.260  -14.635 -3.627  1.00 0.00 ? 49 GLU A H    3  
ATOM 2919  H HA   . GLU A 1 49 ? -1.227  -12.518 -2.013  1.00 0.00 ? 49 GLU A HA   3  
ATOM 2920  H HB2  . GLU A 1 49 ? -2.670  -14.207 -3.133  1.00 0.00 ? 49 GLU A HB2  3  
ATOM 2921  H HB3  . GLU A 1 49 ? -2.078  -15.420 -2.006  1.00 0.00 ? 49 GLU A HB3  3  
ATOM 2922  H HG2  . GLU A 1 49 ? -3.353  -14.667 -0.309  1.00 0.00 ? 49 GLU A HG2  3  
ATOM 2923  H HG3  . GLU A 1 49 ? -3.207  -12.980 -0.802  1.00 0.00 ? 49 GLU A HG3  3  
ATOM 2924  N N    . GLN A 1 50 ? 0.675   -13.155 -0.252  1.00 0.00 ? 50 GLN A N    3  
ATOM 2925  C CA   . GLN A 1 50 ? 1.338   -13.330 1.035   1.00 0.00 ? 50 GLN A CA   3  
ATOM 2926  C C    . GLN A 1 50 ? 0.659   -12.485 2.106   1.00 0.00 ? 50 GLN A C    3  
ATOM 2927  O O    . GLN A 1 50 ? 0.318   -12.980 3.181   1.00 0.00 ? 50 GLN A O    3  
ATOM 2928  C CB   . GLN A 1 50 ? 2.816   -12.950 0.930   1.00 0.00 ? 50 GLN A CB   3  
ATOM 2929  C CG   . GLN A 1 50 ? 3.499   -13.492 -0.314  1.00 0.00 ? 50 GLN A CG   3  
ATOM 2930  C CD   . GLN A 1 50 ? 4.757   -12.730 -0.670  1.00 0.00 ? 50 GLN A CD   3  
ATOM 2931  O OE1  . GLN A 1 50 ? 4.821   -11.509 -0.522  1.00 0.00 ? 50 GLN A OE1  3  
ATOM 2932  N NE2  . GLN A 1 50 ? 5.766   -13.451 -1.138  1.00 0.00 ? 50 GLN A NE2  3  
ATOM 2933  H H    . GLN A 1 50 ? 1.018   -12.483 -0.879  1.00 0.00 ? 50 GLN A H    3  
ATOM 2934  H HA   . GLN A 1 50 ? 1.259   -14.371 1.309   1.00 0.00 ? 50 GLN A HA   3  
ATOM 2935  H HB2  . GLN A 1 50 ? 2.899   -11.873 0.919   1.00 0.00 ? 50 GLN A HB2  3  
ATOM 2936  H HB3  . GLN A 1 50 ? 3.336   -13.333 1.795   1.00 0.00 ? 50 GLN A HB3  3  
ATOM 2937  H HG2  . GLN A 1 50 ? 3.764   -14.525 -0.145  1.00 0.00 ? 50 GLN A HG2  3  
ATOM 2938  H HG3  . GLN A 1 50 ? 2.812   -13.429 -1.145  1.00 0.00 ? 50 GLN A HG3  3  
ATOM 2939  H HE21 . GLN A 1 50 ? 5.642   -14.418 -1.228  1.00 0.00 ? 50 GLN A HE21 3  
ATOM 2940  H HE22 . GLN A 1 50 ? 6.592   -12.986 -1.375  1.00 0.00 ? 50 GLN A HE22 3  
ATOM 2941  N N    . TYR A 1 51 ? 0.465   -11.206 1.803   1.00 0.00 ? 51 TYR A N    3  
ATOM 2942  C CA   . TYR A 1 51 ? -0.181  -10.285 2.735   1.00 0.00 ? 51 TYR A CA   3  
ATOM 2943  C C    . TYR A 1 51 ? -1.122  -9.346  1.989   1.00 0.00 ? 51 TYR A C    3  
ATOM 2944  O O    . TYR A 1 51 ? -1.354  -8.215  2.415   1.00 0.00 ? 51 TYR A O    3  
ATOM 2945  C CB   . TYR A 1 51 ? 0.858   -9.461  3.513   1.00 0.00 ? 51 TYR A CB   3  
ATOM 2946  C CG   . TYR A 1 51 ? 2.264   -10.022 3.477   1.00 0.00 ? 51 TYR A CG   3  
ATOM 2947  C CD1  . TYR A 1 51 ? 2.560   -11.248 4.059   1.00 0.00 ? 51 TYR A CD1  3  
ATOM 2948  C CD2  . TYR A 1 51 ? 3.294   -9.324  2.858   1.00 0.00 ? 51 TYR A CD2  3  
ATOM 2949  C CE1  . TYR A 1 51 ? 3.842   -11.762 4.026   1.00 0.00 ? 51 TYR A CE1  3  
ATOM 2950  C CE2  . TYR A 1 51 ? 4.578   -9.832  2.821   1.00 0.00 ? 51 TYR A CE2  3  
ATOM 2951  C CZ   . TYR A 1 51 ? 4.847   -11.051 3.406   1.00 0.00 ? 51 TYR A CZ   3  
ATOM 2952  O OH   . TYR A 1 51 ? 6.125   -11.560 3.371   1.00 0.00 ? 51 TYR A OH   3  
ATOM 2953  H H    . TYR A 1 51 ? 0.756   -10.873 0.929   1.00 0.00 ? 51 TYR A H    3  
ATOM 2954  H HA   . TYR A 1 51 ? -0.758  -10.872 3.433   1.00 0.00 ? 51 TYR A HA   3  
ATOM 2955  H HB2  . TYR A 1 51 ? 0.892   -8.464  3.101   1.00 0.00 ? 51 TYR A HB2  3  
ATOM 2956  H HB3  . TYR A 1 51 ? 0.553   -9.405  4.548   1.00 0.00 ? 51 TYR A HB3  3  
ATOM 2957  H HD1  . TYR A 1 51 ? 1.771   -11.803 4.544   1.00 0.00 ? 51 TYR A HD1  3  
ATOM 2958  H HD2  . TYR A 1 51 ? 3.079   -8.369  2.400   1.00 0.00 ? 51 TYR A HD2  3  
ATOM 2959  H HE1  . TYR A 1 51 ? 4.053   -12.717 4.485   1.00 0.00 ? 51 TYR A HE1  3  
ATOM 2960  H HE2  . TYR A 1 51 ? 5.365   -9.274  2.335   1.00 0.00 ? 51 TYR A HE2  3  
ATOM 2961  H HH   . TYR A 1 51 ? 6.311   -11.898 2.493   1.00 0.00 ? 51 TYR A HH   3  
ATOM 2962  N N    . ARG A 1 52 ? -1.659  -9.823  0.868   1.00 0.00 ? 52 ARG A N    3  
ATOM 2963  C CA   . ARG A 1 52 ? -2.566  -9.030  0.051   1.00 0.00 ? 52 ARG A CA   3  
ATOM 2964  C C    . ARG A 1 52 ? -3.631  -8.349  0.907   1.00 0.00 ? 52 ARG A C    3  
ATOM 2965  O O    . ARG A 1 52 ? -4.106  -7.263  0.576   1.00 0.00 ? 52 ARG A O    3  
ATOM 2966  C CB   . ARG A 1 52 ? -3.227  -9.920  -1.000  1.00 0.00 ? 52 ARG A CB   3  
ATOM 2967  C CG   . ARG A 1 52 ? -3.258  -9.302  -2.388  1.00 0.00 ? 52 ARG A CG   3  
ATOM 2968  C CD   . ARG A 1 52 ? -2.266  -9.980  -3.320  1.00 0.00 ? 52 ARG A CD   3  
ATOM 2969  N NE   . ARG A 1 52 ? -1.089  -9.153  -3.564  1.00 0.00 ? 52 ARG A NE   3  
ATOM 2970  C CZ   . ARG A 1 52 ? -0.056  -9.077  -2.731  1.00 0.00 ? 52 ARG A CZ   3  
ATOM 2971  N NH1  . ARG A 1 52 ? -0.058  -9.775  -1.603  1.00 0.00 ? 52 ARG A NH1  3  
ATOM 2972  N NH2  . ARG A 1 52 ? 0.979   -8.302  -3.024  1.00 0.00 ? 52 ARG A NH2  3  
ATOM 2973  H H    . ARG A 1 52 ? -1.433  -10.730 0.579   1.00 0.00 ? 52 ARG A H    3  
ATOM 2974  H HA   . ARG A 1 52 ? -1.984  -8.270  -0.448  1.00 0.00 ? 52 ARG A HA   3  
ATOM 2975  H HB2  . ARG A 1 52 ? -2.686  -10.853 -1.057  1.00 0.00 ? 52 ARG A HB2  3  
ATOM 2976  H HB3  . ARG A 1 52 ? -4.242  -10.123 -0.696  1.00 0.00 ? 52 ARG A HB3  3  
ATOM 2977  H HG2  . ARG A 1 52 ? -4.251  -9.404  -2.797  1.00 0.00 ? 52 ARG A HG2  3  
ATOM 2978  H HG3  . ARG A 1 52 ? -3.003  -8.256  -2.309  1.00 0.00 ? 52 ARG A HG3  3  
ATOM 2979  H HD2  . ARG A 1 52 ? -1.954  -10.913 -2.874  1.00 0.00 ? 52 ARG A HD2  3  
ATOM 2980  H HD3  . ARG A 1 52 ? -2.757  -10.179 -4.262  1.00 0.00 ? 52 ARG A HD3  3  
ATOM 2981  H HE   . ARG A 1 52 ? -1.065  -8.629  -4.391  1.00 0.00 ? 52 ARG A HE   3  
ATOM 2982  H HH11 . ARG A 1 52 ? -0.836  -10.360 -1.378  1.00 0.00 ? 52 ARG A HH11 3  
ATOM 2983  H HH12 . ARG A 1 52 ? 0.720   -9.716  -0.978  1.00 0.00 ? 52 ARG A HH12 3  
ATOM 2984  H HH21 . ARG A 1 52 ? 0.983   -7.774  -3.873  1.00 0.00 ? 52 ARG A HH21 3  
ATOM 2985  H HH22 . ARG A 1 52 ? 1.755   -8.245  -2.395  1.00 0.00 ? 52 ARG A HH22 3  
ATOM 2986  N N    . MET A 1 53 ? -3.995  -8.990  2.013   1.00 0.00 ? 53 MET A N    3  
ATOM 2987  C CA   . MET A 1 53 ? -4.992  -8.436  2.921   1.00 0.00 ? 53 MET A CA   3  
ATOM 2988  C C    . MET A 1 53 ? -4.442  -7.209  3.639   1.00 0.00 ? 53 MET A C    3  
ATOM 2989  O O    . MET A 1 53 ? -5.080  -6.158  3.670   1.00 0.00 ? 53 MET A O    3  
ATOM 2990  C CB   . MET A 1 53 ? -5.424  -9.490  3.942   1.00 0.00 ? 53 MET A CB   3  
ATOM 2991  C CG   . MET A 1 53 ? -6.371  -10.533 3.375   1.00 0.00 ? 53 MET A CG   3  
ATOM 2992  S SD   . MET A 1 53 ? -6.043  -12.188 4.009   1.00 0.00 ? 53 MET A SD   3  
ATOM 2993  C CE   . MET A 1 53 ? -7.653  -12.624 4.662   1.00 0.00 ? 53 MET A CE   3  
ATOM 2994  H H    . MET A 1 53 ? -3.576  -9.850  2.228   1.00 0.00 ? 53 MET A H    3  
ATOM 2995  H HA   . MET A 1 53 ? -5.850  -8.141  2.331   1.00 0.00 ? 53 MET A HA   3  
ATOM 2996  H HB2  . MET A 1 53 ? -4.545  -9.996  4.313   1.00 0.00 ? 53 MET A HB2  3  
ATOM 2997  H HB3  . MET A 1 53 ? -5.917  -8.994  4.765   1.00 0.00 ? 53 MET A HB3  3  
ATOM 2998  H HG2  . MET A 1 53 ? -7.383  -10.258 3.634   1.00 0.00 ? 53 MET A HG2  3  
ATOM 2999  H HG3  . MET A 1 53 ? -6.268  -10.547 2.300   1.00 0.00 ? 53 MET A HG3  3  
ATOM 3000  H HE1  . MET A 1 53 ? -8.030  -13.492 4.141   1.00 0.00 ? 53 MET A HE1  3  
ATOM 3001  H HE2  . MET A 1 53 ? -8.334  -11.797 4.522   1.00 0.00 ? 53 MET A HE2  3  
ATOM 3002  H HE3  . MET A 1 53 ? -7.566  -12.846 5.715   1.00 0.00 ? 53 MET A HE3  3  
ATOM 3003  N N    . THR A 1 54 ? -3.251  -7.350  4.213   1.00 0.00 ? 54 THR A N    3  
ATOM 3004  C CA   . THR A 1 54 ? -2.609  -6.246  4.917   1.00 0.00 ? 54 THR A CA   3  
ATOM 3005  C C    . THR A 1 54 ? -2.505  -5.027  4.009   1.00 0.00 ? 54 THR A C    3  
ATOM 3006  O O    . THR A 1 54 ? -2.710  -3.895  4.445   1.00 0.00 ? 54 THR A O    3  
ATOM 3007  C CB   . THR A 1 54 ? -1.215  -6.661  5.401   1.00 0.00 ? 54 THR A CB   3  
ATOM 3008  O OG1  . THR A 1 54 ? -1.312  -7.651  6.410   1.00 0.00 ? 54 THR A OG1  3  
ATOM 3009  C CG2  . THR A 1 54 ? -0.401  -5.512  5.960   1.00 0.00 ? 54 THR A CG2  3  
ATOM 3010  H H    . THR A 1 54 ? -2.787  -8.211  4.149   1.00 0.00 ? 54 THR A H    3  
ATOM 3011  H HA   . THR A 1 54 ? -3.220  -5.995  5.771   1.00 0.00 ? 54 THR A HA   3  
ATOM 3012  H HB   . THR A 1 54 ? -0.667  -7.077  4.569   1.00 0.00 ? 54 THR A HB   3  
ATOM 3013  H HG1  . THR A 1 54 ? -1.155  -8.517  6.026   1.00 0.00 ? 54 THR A HG1  3  
ATOM 3014  H HG21 . THR A 1 54 ? -0.874  -5.137  6.856   1.00 0.00 ? 54 THR A HG21 3  
ATOM 3015  H HG22 . THR A 1 54 ? -0.339  -4.722  5.227   1.00 0.00 ? 54 THR A HG22 3  
ATOM 3016  H HG23 . THR A 1 54 ? 0.594   -5.860  6.199   1.00 0.00 ? 54 THR A HG23 3  
ATOM 3017  N N    . ILE A 1 55 ? -2.186  -5.270  2.743   1.00 0.00 ? 55 ILE A N    3  
ATOM 3018  C CA   . ILE A 1 55 ? -2.060  -4.193  1.772   1.00 0.00 ? 55 ILE A CA   3  
ATOM 3019  C C    . ILE A 1 55 ? -3.383  -3.455  1.604   1.00 0.00 ? 55 ILE A C    3  
ATOM 3020  O O    . ILE A 1 55 ? -3.454  -2.240  1.789   1.00 0.00 ? 55 ILE A O    3  
ATOM 3021  C CB   . ILE A 1 55 ? -1.591  -4.719  0.403   1.00 0.00 ? 55 ILE A CB   3  
ATOM 3022  C CG1  . ILE A 1 55 ? -0.466  -5.744  0.576   1.00 0.00 ? 55 ILE A CG1  3  
ATOM 3023  C CG2  . ILE A 1 55 ? -1.136  -3.568  -0.479  1.00 0.00 ? 55 ILE A CG2  3  
ATOM 3024  C CD1  . ILE A 1 55 ? 0.618   -5.307  1.539   1.00 0.00 ? 55 ILE A CD1  3  
ATOM 3025  H H    . ILE A 1 55 ? -2.037  -6.194  2.455   1.00 0.00 ? 55 ILE A H    3  
ATOM 3026  H HA   . ILE A 1 55 ? -1.318  -3.503  2.138   1.00 0.00 ? 55 ILE A HA   3  
ATOM 3027  H HB   . ILE A 1 55 ? -2.430  -5.196  -0.076  1.00 0.00 ? 55 ILE A HB   3  
ATOM 3028  H HG12 . ILE A 1 55 ? -0.884  -6.668  0.946   1.00 0.00 ? 55 ILE A HG12 3  
ATOM 3029  H HG13 . ILE A 1 55 ? -0.003  -5.922  -0.383  1.00 0.00 ? 55 ILE A HG13 3  
ATOM 3030  H HG21 . ILE A 1 55 ? -0.056  -3.540  -0.506  1.00 0.00 ? 55 ILE A HG21 3  
ATOM 3031  H HG22 . ILE A 1 55 ? -1.509  -2.637  -0.078  1.00 0.00 ? 55 ILE A HG22 3  
ATOM 3032  H HG23 . ILE A 1 55 ? -1.518  -3.707  -1.480  1.00 0.00 ? 55 ILE A HG23 3  
ATOM 3033  H HD11 . ILE A 1 55 ? 1.482   -5.942  1.420   1.00 0.00 ? 55 ILE A HD11 3  
ATOM 3034  H HD12 . ILE A 1 55 ? 0.251   -5.384  2.553   1.00 0.00 ? 55 ILE A HD12 3  
ATOM 3035  H HD13 . ILE A 1 55 ? 0.892   -4.283  1.333   1.00 0.00 ? 55 ILE A HD13 3  
ATOM 3036  N N    . TRP A 1 56 ? -4.436  -4.198  1.270   1.00 0.00 ? 56 TRP A N    3  
ATOM 3037  C CA   . TRP A 1 56 ? -5.760  -3.615  1.110   1.00 0.00 ? 56 TRP A CA   3  
ATOM 3038  C C    . TRP A 1 56 ? -6.130  -2.796  2.346   1.00 0.00 ? 56 TRP A C    3  
ATOM 3039  O O    . TRP A 1 56 ? -6.612  -1.668  2.237   1.00 0.00 ? 56 TRP A O    3  
ATOM 3040  C CB   . TRP A 1 56 ? -6.785  -4.731  0.861   1.00 0.00 ? 56 TRP A CB   3  
ATOM 3041  C CG   . TRP A 1 56 ? -8.211  -4.333  1.096   1.00 0.00 ? 56 TRP A CG   3  
ATOM 3042  C CD1  . TRP A 1 56 ? -8.805  -3.151  0.759   1.00 0.00 ? 56 TRP A CD1  3  
ATOM 3043  C CD2  . TRP A 1 56 ? -9.220  -5.125  1.726   1.00 0.00 ? 56 TRP A CD2  3  
ATOM 3044  N NE1  . TRP A 1 56 ? -10.126 -3.165  1.142   1.00 0.00 ? 56 TRP A NE1  3  
ATOM 3045  C CE2  . TRP A 1 56 ? -10.402 -4.364  1.736   1.00 0.00 ? 56 TRP A CE2  3  
ATOM 3046  C CE3  . TRP A 1 56 ? -9.236  -6.404  2.282   1.00 0.00 ? 56 TRP A CE3  3  
ATOM 3047  C CZ2  . TRP A 1 56 ? -11.587 -4.838  2.279   1.00 0.00 ? 56 TRP A CZ2  3  
ATOM 3048  C CZ3  . TRP A 1 56 ? -10.417 -6.879  2.823   1.00 0.00 ? 56 TRP A CZ3  3  
ATOM 3049  C CH2  . TRP A 1 56 ? -11.580 -6.096  2.818   1.00 0.00 ? 56 TRP A CH2  3  
ATOM 3050  H H    . TRP A 1 56 ? -4.325  -5.164  1.149   1.00 0.00 ? 56 TRP A H    3  
ATOM 3051  H HA   . TRP A 1 56 ? -5.735  -2.960  0.251   1.00 0.00 ? 56 TRP A HA   3  
ATOM 3052  H HB2  . TRP A 1 56 ? -6.700  -5.060  -0.164  1.00 0.00 ? 56 TRP A HB2  3  
ATOM 3053  H HB3  . TRP A 1 56 ? -6.562  -5.560  1.517   1.00 0.00 ? 56 TRP A HB3  3  
ATOM 3054  H HD1  . TRP A 1 56 ? -8.299  -2.336  0.266   1.00 0.00 ? 56 TRP A HD1  3  
ATOM 3055  H HE1  . TRP A 1 56 ? -10.768 -2.437  1.011   1.00 0.00 ? 56 TRP A HE1  3  
ATOM 3056  H HE3  . TRP A 1 56 ? -8.345  -7.018  2.293   1.00 0.00 ? 56 TRP A HE3  3  
ATOM 3057  H HZ2  . TRP A 1 56 ? -12.488 -4.243  2.279   1.00 0.00 ? 56 TRP A HZ2  3  
ATOM 3058  H HZ3  . TRP A 1 56 ? -10.452 -7.867  3.257   1.00 0.00 ? 56 TRP A HZ3  3  
ATOM 3059  H HH2  . TRP A 1 56 ? -12.482 -6.505  3.250   1.00 0.00 ? 56 TRP A HH2  3  
ATOM 3060  N N    . ARG A 1 57 ? -5.884  -3.367  3.521   1.00 0.00 ? 57 ARG A N    3  
ATOM 3061  C CA   . ARG A 1 57 ? -6.172  -2.688  4.778   1.00 0.00 ? 57 ARG A CA   3  
ATOM 3062  C C    . ARG A 1 57 ? -5.559  -1.294  4.787   1.00 0.00 ? 57 ARG A C    3  
ATOM 3063  O O    . ARG A 1 57 ? -6.247  -0.300  5.018   1.00 0.00 ? 57 ARG A O    3  
ATOM 3064  C CB   . ARG A 1 57 ? -5.635  -3.502  5.957   1.00 0.00 ? 57 ARG A CB   3  
ATOM 3065  C CG   . ARG A 1 57 ? -6.167  -4.925  6.004   1.00 0.00 ? 57 ARG A CG   3  
ATOM 3066  C CD   . ARG A 1 57 ? -7.100  -5.133  7.186   1.00 0.00 ? 57 ARG A CD   3  
ATOM 3067  N NE   . ARG A 1 57 ? -6.381  -5.563  8.382   1.00 0.00 ? 57 ARG A NE   3  
ATOM 3068  C CZ   . ARG A 1 57 ? -6.924  -5.606  9.594   1.00 0.00 ? 57 ARG A CZ   3  
ATOM 3069  N NH1  . ARG A 1 57 ? -8.188  -5.247  9.769   1.00 0.00 ? 57 ARG A NH1  3  
ATOM 3070  N NH2  . ARG A 1 57 ? -6.203  -6.008  10.632  1.00 0.00 ? 57 ARG A NH2  3  
ATOM 3071  H H    . ARG A 1 57 ? -5.493  -4.264  3.540   1.00 0.00 ? 57 ARG A H    3  
ATOM 3072  H HA   . ARG A 1 57 ? -7.242  -2.597  4.868   1.00 0.00 ? 57 ARG A HA   3  
ATOM 3073  H HB2  . ARG A 1 57 ? -4.558  -3.545  5.889   1.00 0.00 ? 57 ARG A HB2  3  
ATOM 3074  H HB3  . ARG A 1 57 ? -5.910  -3.007  6.877   1.00 0.00 ? 57 ARG A HB3  3  
ATOM 3075  H HG2  . ARG A 1 57 ? -6.708  -5.127  5.091   1.00 0.00 ? 57 ARG A HG2  3  
ATOM 3076  H HG3  . ARG A 1 57 ? -5.335  -5.608  6.091   1.00 0.00 ? 57 ARG A HG3  3  
ATOM 3077  H HD2  . ARG A 1 57 ? -7.606  -4.202  7.398   1.00 0.00 ? 57 ARG A HD2  3  
ATOM 3078  H HD3  . ARG A 1 57 ? -7.829  -5.887  6.927   1.00 0.00 ? 57 ARG A HD3  3  
ATOM 3079  H HE   . ARG A 1 57 ? -5.443  -5.832  8.276   1.00 0.00 ? 57 ARG A HE   3  
ATOM 3080  H HH11 . ARG A 1 57 ? -8.735  -4.944  8.989   1.00 0.00 ? 57 ARG A HH11 3  
ATOM 3081  H HH12 . ARG A 1 57 ? -8.596  -5.281  10.682  1.00 0.00 ? 57 ARG A HH12 3  
ATOM 3082  H HH21 . ARG A 1 57 ? -5.249  -6.279  10.503  1.00 0.00 ? 57 ARG A HH21 3  
ATOM 3083  H HH22 . ARG A 1 57 ? -6.614  -6.040  11.543  1.00 0.00 ? 57 ARG A HH22 3  
ATOM 3084  N N    . GLY A 1 58 ? -4.261  -1.231  4.521   1.00 0.00 ? 58 GLY A N    3  
ATOM 3085  C CA   . GLY A 1 58 ? -3.571  0.044   4.479   1.00 0.00 ? 58 GLY A CA   3  
ATOM 3086  C C    . GLY A 1 58 ? -4.263  1.035   3.566   1.00 0.00 ? 58 GLY A C    3  
ATOM 3087  O O    . GLY A 1 58 ? -4.399  2.211   3.903   1.00 0.00 ? 58 GLY A O    3  
ATOM 3088  H H    . GLY A 1 58 ? -3.771  -2.057  4.336   1.00 0.00 ? 58 GLY A H    3  
ATOM 3089  H HA2  . GLY A 1 58 ? -3.533  0.454   5.479   1.00 0.00 ? 58 GLY A HA2  3  
ATOM 3090  H HA3  . GLY A 1 58 ? -2.563  -0.115  4.126   1.00 0.00 ? 58 GLY A HA3  3  
ATOM 3091  N N    . LEU A 1 59 ? -4.714  0.554   2.412   1.00 0.00 ? 59 LEU A N    3  
ATOM 3092  C CA   . LEU A 1 59 ? -5.418  1.399   1.457   1.00 0.00 ? 59 LEU A CA   3  
ATOM 3093  C C    . LEU A 1 59 ? -6.743  1.871   2.043   1.00 0.00 ? 59 LEU A C    3  
ATOM 3094  O O    . LEU A 1 59 ? -7.241  2.943   1.697   1.00 0.00 ? 59 LEU A O    3  
ATOM 3095  C CB   . LEU A 1 59 ? -5.662  0.641   0.151   1.00 0.00 ? 59 LEU A CB   3  
ATOM 3096  C CG   . LEU A 1 59 ? -4.778  1.071   -1.022  1.00 0.00 ? 59 LEU A CG   3  
ATOM 3097  C CD1  . LEU A 1 59 ? -3.315  0.793   -0.714  1.00 0.00 ? 59 LEU A CD1  3  
ATOM 3098  C CD2  . LEU A 1 59 ? -5.202  0.361   -2.298  1.00 0.00 ? 59 LEU A CD2  3  
ATOM 3099  H H    . LEU A 1 59 ? -4.585  -0.396  2.206   1.00 0.00 ? 59 LEU A H    3  
ATOM 3100  H HA   . LEU A 1 59 ? -4.798  2.260   1.257   1.00 0.00 ? 59 LEU A HA   3  
ATOM 3101  H HB2  . LEU A 1 59 ? -5.496  -0.411  0.333   1.00 0.00 ? 59 LEU A HB2  3  
ATOM 3102  H HB3  . LEU A 1 59 ? -6.694  0.780   -0.134  1.00 0.00 ? 59 LEU A HB3  3  
ATOM 3103  H HG   . LEU A 1 59 ? -4.890  2.134   -1.177  1.00 0.00 ? 59 LEU A HG   3  
ATOM 3104  H HD11 . LEU A 1 59 ? -2.799  1.727   -0.546  1.00 0.00 ? 59 LEU A HD11 3  
ATOM 3105  H HD12 . LEU A 1 59 ? -2.863  0.278   -1.549  1.00 0.00 ? 59 LEU A HD12 3  
ATOM 3106  H HD13 . LEU A 1 59 ? -3.243  0.177   0.170   1.00 0.00 ? 59 LEU A HD13 3  
ATOM 3107  H HD21 . LEU A 1 59 ? -4.348  0.254   -2.951  1.00 0.00 ? 59 LEU A HD21 3  
ATOM 3108  H HD22 . LEU A 1 59 ? -5.967  0.940   -2.796  1.00 0.00 ? 59 LEU A HD22 3  
ATOM 3109  H HD23 . LEU A 1 59 ? -5.593  -0.616  -2.054  1.00 0.00 ? 59 LEU A HD23 3  
ATOM 3110  N N    . GLN A 1 60 ? -7.304  1.066   2.941   1.00 0.00 ? 60 GLN A N    3  
ATOM 3111  C CA   . GLN A 1 60 ? -8.561  1.408   3.594   1.00 0.00 ? 60 GLN A CA   3  
ATOM 3112  C C    . GLN A 1 60 ? -8.338  2.485   4.649   1.00 0.00 ? 60 GLN A C    3  
ATOM 3113  O O    . GLN A 1 60 ? -9.232  3.280   4.940   1.00 0.00 ? 60 GLN A O    3  
ATOM 3114  C CB   . GLN A 1 60 ? -9.183  0.166   4.238   1.00 0.00 ? 60 GLN A CB   3  
ATOM 3115  C CG   . GLN A 1 60 ? -9.748  -0.823  3.232   1.00 0.00 ? 60 GLN A CG   3  
ATOM 3116  C CD   . GLN A 1 60 ? -10.481 -1.974  3.892   1.00 0.00 ? 60 GLN A CD   3  
ATOM 3117  O OE1  . GLN A 1 60 ? -11.669 -1.875  4.198   1.00 0.00 ? 60 GLN A OE1  3  
ATOM 3118  N NE2  . GLN A 1 60 ? -9.773  -3.076  4.115   1.00 0.00 ? 60 GLN A NE2  3  
ATOM 3119  H H    . GLN A 1 60 ? -6.852  0.231   3.182   1.00 0.00 ? 60 GLN A H    3  
ATOM 3120  H HA   . GLN A 1 60 ? -9.234  1.790   2.840   1.00 0.00 ? 60 GLN A HA   3  
ATOM 3121  H HB2  . GLN A 1 60 ? -8.427  -0.338  4.822   1.00 0.00 ? 60 GLN A HB2  3  
ATOM 3122  H HB3  . GLN A 1 60 ? -9.982  0.477   4.893   1.00 0.00 ? 60 GLN A HB3  3  
ATOM 3123  H HG2  . GLN A 1 60 ? -10.437 -0.302  2.583   1.00 0.00 ? 60 GLN A HG2  3  
ATOM 3124  H HG3  . GLN A 1 60 ? -8.935  -1.223  2.644   1.00 0.00 ? 60 GLN A HG3  3  
ATOM 3125  H HE21 . GLN A 1 60 ? -8.830  -3.084  3.845   1.00 0.00 ? 60 GLN A HE21 3  
ATOM 3126  H HE22 . GLN A 1 60 ? -10.222 -3.837  4.540   1.00 0.00 ? 60 GLN A HE22 3  
ATOM 3127  N N    . ASP A 1 61 ? -7.136  2.508   5.213   1.00 0.00 ? 61 ASP A N    3  
ATOM 3128  C CA   . ASP A 1 61 ? -6.785  3.494   6.227   1.00 0.00 ? 61 ASP A CA   3  
ATOM 3129  C C    . ASP A 1 61 ? -6.739  4.893   5.621   1.00 0.00 ? 61 ASP A C    3  
ATOM 3130  O O    . ASP A 1 61 ? -7.003  5.885   6.300   1.00 0.00 ? 61 ASP A O    3  
ATOM 3131  C CB   . ASP A 1 61 ? -5.432  3.152   6.853   1.00 0.00 ? 61 ASP A CB   3  
ATOM 3132  C CG   . ASP A 1 61 ? -5.317  3.639   8.285   1.00 0.00 ? 61 ASP A CG   3  
ATOM 3133  O OD1  . ASP A 1 61 ? -5.028  4.837   8.483   1.00 0.00 ? 61 ASP A OD1  3  
ATOM 3134  O OD2  . ASP A 1 61 ? -5.516  2.821   9.208   1.00 0.00 ? 61 ASP A OD2  3  
ATOM 3135  H H    . ASP A 1 61 ? -6.464  1.852   4.933   1.00 0.00 ? 61 ASP A H    3  
ATOM 3136  H HA   . ASP A 1 61 ? -7.546  3.470   6.992   1.00 0.00 ? 61 ASP A HA   3  
ATOM 3137  H HB2  . ASP A 1 61 ? -5.299  2.079   6.845   1.00 0.00 ? 61 ASP A HB2  3  
ATOM 3138  H HB3  . ASP A 1 61 ? -4.646  3.611   6.273   1.00 0.00 ? 61 ASP A HB3  3  
ATOM 3139  N N    . LEU A 1 62 ? -6.407  4.961   4.335   1.00 0.00 ? 62 LEU A N    3  
ATOM 3140  C CA   . LEU A 1 62 ? -6.340  6.234   3.628   1.00 0.00 ? 62 LEU A CA   3  
ATOM 3141  C C    . LEU A 1 62 ? -7.729  6.839   3.476   1.00 0.00 ? 62 LEU A C    3  
ATOM 3142  O O    . LEU A 1 62 ? -7.947  8.012   3.777   1.00 0.00 ? 62 LEU A O    3  
ATOM 3143  C CB   . LEU A 1 62 ? -5.704  6.042   2.251   1.00 0.00 ? 62 LEU A CB   3  
ATOM 3144  C CG   . LEU A 1 62 ? -4.225  5.654   2.267   1.00 0.00 ? 62 LEU A CG   3  
ATOM 3145  C CD1  . LEU A 1 62 ? -3.861  4.882   1.008   1.00 0.00 ? 62 LEU A CD1  3  
ATOM 3146  C CD2  . LEU A 1 62 ? -3.354  6.892   2.407   1.00 0.00 ? 62 LEU A CD2  3  
ATOM 3147  H H    . LEU A 1 62 ? -6.215  4.133   3.847   1.00 0.00 ? 62 LEU A H    3  
ATOM 3148  H HA   . LEU A 1 62 ? -5.727  6.906   4.211   1.00 0.00 ? 62 LEU A HA   3  
ATOM 3149  H HB2  . LEU A 1 62 ? -6.251  5.271   1.729   1.00 0.00 ? 62 LEU A HB2  3  
ATOM 3150  H HB3  . LEU A 1 62 ? -5.805  6.966   1.699   1.00 0.00 ? 62 LEU A HB3  3  
ATOM 3151  H HG   . LEU A 1 62 ? -4.037  5.015   3.118   1.00 0.00 ? 62 LEU A HG   3  
ATOM 3152  H HD11 . LEU A 1 62 ? -4.717  4.311   0.676   1.00 0.00 ? 62 LEU A HD11 3  
ATOM 3153  H HD12 . LEU A 1 62 ? -3.042  4.211   1.221   1.00 0.00 ? 62 LEU A HD12 3  
ATOM 3154  H HD13 . LEU A 1 62 ? -3.568  5.574   0.233   1.00 0.00 ? 62 LEU A HD13 3  
ATOM 3155  H HD21 . LEU A 1 62 ? -2.459  6.772   1.814   1.00 0.00 ? 62 LEU A HD21 3  
ATOM 3156  H HD22 . LEU A 1 62 ? -3.085  7.027   3.444   1.00 0.00 ? 62 LEU A HD22 3  
ATOM 3157  H HD23 . LEU A 1 62 ? -3.901  7.757   2.062   1.00 0.00 ? 62 LEU A HD23 3  
ATOM 3158  N N    . LYS A 1 63 ? -8.668  6.025   3.004   1.00 0.00 ? 63 LYS A N    3  
ATOM 3159  C CA   . LYS A 1 63 ? -10.042 6.471   2.812   1.00 0.00 ? 63 LYS A CA   3  
ATOM 3160  C C    . LYS A 1 63 ? -10.645 6.956   4.126   1.00 0.00 ? 63 LYS A C    3  
ATOM 3161  O O    . LYS A 1 63 ? -10.923 8.144   4.291   1.00 0.00 ? 63 LYS A O    3  
ATOM 3162  C CB   . LYS A 1 63 ? -10.889 5.332   2.241   1.00 0.00 ? 63 LYS A CB   3  
ATOM 3163  C CG   . LYS A 1 63 ? -11.877 5.782   1.176   1.00 0.00 ? 63 LYS A CG   3  
ATOM 3164  C CD   . LYS A 1 63 ? -12.323 4.620   0.304   1.00 0.00 ? 63 LYS A CD   3  
ATOM 3165  C CE   . LYS A 1 63 ? -11.244 4.217   -0.687  1.00 0.00 ? 63 LYS A CE   3  
ATOM 3166  N NZ   . LYS A 1 63 ? -10.696 2.864   -0.393  1.00 0.00 ? 63 LYS A NZ   3  
ATOM 3167  H H    . LYS A 1 63 ? -8.430  5.102   2.784   1.00 0.00 ? 63 LYS A H    3  
ATOM 3168  H HA   . LYS A 1 63 ? -10.030 7.290   2.109   1.00 0.00 ? 63 LYS A HA   3  
ATOM 3169  H HB2  . LYS A 1 63 ? -10.233 4.594   1.803   1.00 0.00 ? 63 LYS A HB2  3  
ATOM 3170  H HB3  . LYS A 1 63 ? -11.445 4.873   3.045   1.00 0.00 ? 63 LYS A HB3  3  
ATOM 3171  H HG2  . LYS A 1 63 ? -12.742 6.208   1.660   1.00 0.00 ? 63 LYS A HG2  3  
ATOM 3172  H HG3  . LYS A 1 63 ? -11.405 6.527   0.553   1.00 0.00 ? 63 LYS A HG3  3  
ATOM 3173  H HD2  . LYS A 1 63 ? -12.550 3.775   0.936   1.00 0.00 ? 63 LYS A HD2  3  
ATOM 3174  H HD3  . LYS A 1 63 ? -13.208 4.912   -0.242  1.00 0.00 ? 63 LYS A HD3  3  
ATOM 3175  H HE2  . LYS A 1 63 ? -11.667 4.216   -1.681  1.00 0.00 ? 63 LYS A HE2  3  
ATOM 3176  H HE3  . LYS A 1 63 ? -10.442 4.939   -0.640  1.00 0.00 ? 63 LYS A HE3  3  
ATOM 3177  H HZ1  . LYS A 1 63 ? -11.467 2.166   -0.363  1.00 0.00 ? 63 LYS A HZ1  3  
ATOM 3178  H HZ2  . LYS A 1 63 ? -10.210 2.867   0.526   1.00 0.00 ? 63 LYS A HZ2  3  
ATOM 3179  H HZ3  . LYS A 1 63 ? -10.020 2.584   -1.131  1.00 0.00 ? 63 LYS A HZ3  3  
ATOM 3180  N N    . GLN A 1 64 ? -10.841 6.029   5.058   1.00 0.00 ? 64 GLN A N    3  
ATOM 3181  C CA   . GLN A 1 64 ? -11.409 6.359   6.360   1.00 0.00 ? 64 GLN A CA   3  
ATOM 3182  C C    . GLN A 1 64 ? -12.674 7.186   6.216   1.00 0.00 ? 64 GLN A C    3  
ATOM 3183  O O    . GLN A 1 64 ? -13.006 8.005   7.072   1.00 0.00 ? 64 GLN A O    3  
ATOM 3184  C CB   . GLN A 1 64 ? -10.395 7.116   7.195   1.00 0.00 ? 64 GLN A CB   3  
ATOM 3185  C CG   . GLN A 1 64 ? -9.705  6.232   8.208   1.00 0.00 ? 64 GLN A CG   3  
ATOM 3186  C CD   . GLN A 1 64 ? -8.352  6.764   8.633   1.00 0.00 ? 64 GLN A CD   3  
ATOM 3187  O OE1  . GLN A 1 64 ? -7.834  7.715   8.048   1.00 0.00 ? 64 GLN A OE1  3  
ATOM 3188  N NE2  . GLN A 1 64 ? -7.772  6.152   9.659   1.00 0.00 ? 64 GLN A NE2  3  
ATOM 3189  H H    . GLN A 1 64 ? -10.597 5.100   4.865   1.00 0.00 ? 64 GLN A H    3  
ATOM 3190  H HA   . GLN A 1 64 ? -11.655 5.433   6.858   1.00 0.00 ? 64 GLN A HA   3  
ATOM 3191  H HB2  . GLN A 1 64 ? -9.648  7.538   6.542   1.00 0.00 ? 64 GLN A HB2  3  
ATOM 3192  H HB3  . GLN A 1 64 ? -10.900 7.912   7.718   1.00 0.00 ? 64 GLN A HB3  3  
ATOM 3193  H HG2  . GLN A 1 64 ? -10.337 6.150   9.079   1.00 0.00 ? 64 GLN A HG2  3  
ATOM 3194  H HG3  . GLN A 1 64 ? -9.575  5.255   7.768   1.00 0.00 ? 64 GLN A HG3  3  
ATOM 3195  H HE21 . GLN A 1 64 ? -8.243  5.402   10.077  1.00 0.00 ? 64 GLN A HE21 3  
ATOM 3196  H HE22 . GLN A 1 64 ? -6.895  6.475   9.956   1.00 0.00 ? 64 GLN A HE22 3  
ATOM 3197  N N    . GLY A 1 65 ? -13.366 6.956   5.122   1.00 0.00 ? 65 GLY A N    3  
ATOM 3198  C CA   . GLY A 1 65 ? -14.598 7.670   4.848   1.00 0.00 ? 65 GLY A CA   3  
ATOM 3199  C C    . GLY A 1 65 ? -14.395 8.832   3.895   1.00 0.00 ? 65 GLY A C    3  
ATOM 3200  O O    . GLY A 1 65 ? -14.584 9.990   4.268   1.00 0.00 ? 65 GLY A O    3  
ATOM 3201  H H    . GLY A 1 65 ? -13.032 6.289   4.494   1.00 0.00 ? 65 GLY A H    3  
ATOM 3202  H HA2  . GLY A 1 65 ? -15.311 6.984   4.415   1.00 0.00 ? 65 GLY A HA2  3  
ATOM 3203  H HA3  . GLY A 1 65 ? -14.998 8.047   5.777   1.00 0.00 ? 65 GLY A HA3  3  
ATOM 3204  N N    . HIS A 1 66 ? -14.011 8.521   2.662   1.00 0.00 ? 66 HIS A N    3  
ATOM 3205  C CA   . HIS A 1 66 ? -13.782 9.548   1.652   1.00 0.00 ? 66 HIS A CA   3  
ATOM 3206  C C    . HIS A 1 66 ? -14.951 9.622   0.675   1.00 0.00 ? 66 HIS A C    3  
ATOM 3207  O O    . HIS A 1 66 ? -15.605 8.617   0.397   1.00 0.00 ? 66 HIS A O    3  
ATOM 3208  C CB   . HIS A 1 66 ? -12.486 9.265   0.888   1.00 0.00 ? 66 HIS A CB   3  
ATOM 3209  C CG   . HIS A 1 66 ? -12.121 10.338  -0.089  1.00 0.00 ? 66 HIS A CG   3  
ATOM 3210  N ND1  . HIS A 1 66 ? -12.593 10.369  -1.385  1.00 0.00 ? 66 HIS A ND1  3  
ATOM 3211  C CD2  . HIS A 1 66 ? -11.327 11.426  0.046   1.00 0.00 ? 66 HIS A CD2  3  
ATOM 3212  C CE1  . HIS A 1 66 ? -12.102 11.428  -2.005  1.00 0.00 ? 66 HIS A CE1  3  
ATOM 3213  N NE2  . HIS A 1 66 ? -11.332 12.085  -1.158  1.00 0.00 ? 66 HIS A NE2  3  
ATOM 3214  H H    . HIS A 1 66 ? -13.879 7.580   2.424   1.00 0.00 ? 66 HIS A H    3  
ATOM 3215  H HA   . HIS A 1 66 ? -13.692 10.496  2.159   1.00 0.00 ? 66 HIS A HA   3  
ATOM 3216  H HB2  . HIS A 1 66 ? -11.674 9.167   1.595   1.00 0.00 ? 66 HIS A HB2  3  
ATOM 3217  H HB3  . HIS A 1 66 ? -12.595 8.339   0.341   1.00 0.00 ? 66 HIS A HB3  3  
ATOM 3218  H HD1  . HIS A 1 66 ? -13.195 9.711   -1.791  1.00 0.00 ? 66 HIS A HD1  3  
ATOM 3219  H HD2  . HIS A 1 66 ? -10.788 11.721  0.936   1.00 0.00 ? 66 HIS A HD2  3  
ATOM 3220  H HE1  . HIS A 1 66 ? -12.299 11.708  -3.030  1.00 0.00 ? 66 HIS A HE1  3  
ATOM 3221  H HE2  . HIS A 1 66 ? -10.844 12.910  -1.360  1.00 0.00 ? 66 HIS A HE2  3  
ATOM 3222  N N    . ASP A 1 67 ? -15.201 10.817  0.152   1.00 0.00 ? 67 ASP A N    3  
ATOM 3223  C CA   . ASP A 1 67 ? -16.287 11.024  -0.798  1.00 0.00 ? 67 ASP A CA   3  
ATOM 3224  C C    . ASP A 1 67 ? -16.409 12.498  -1.168  1.00 0.00 ? 67 ASP A C    3  
ATOM 3225  O O    . ASP A 1 67 ? -16.400 13.369  -0.298  1.00 0.00 ? 67 ASP A O    3  
ATOM 3226  C CB   . ASP A 1 67 ? -17.608 10.519  -0.215  1.00 0.00 ? 67 ASP A CB   3  
ATOM 3227  C CG   . ASP A 1 67 ? -17.795 10.926  1.233   1.00 0.00 ? 67 ASP A CG   3  
ATOM 3228  O OD1  . ASP A 1 67 ? -17.554 12.109  1.552   1.00 0.00 ? 67 ASP A OD1  3  
ATOM 3229  O OD2  . ASP A 1 67 ? -18.183 10.062  2.047   1.00 0.00 ? 67 ASP A OD2  3  
ATOM 3230  H H    . ASP A 1 67 ? -14.643 11.579  0.411   1.00 0.00 ? 67 ASP A H    3  
ATOM 3231  H HA   . ASP A 1 67 ? -16.056 10.460  -1.690  1.00 0.00 ? 67 ASP A HA   3  
ATOM 3232  H HB2  . ASP A 1 67 ? -18.426 10.923  -0.792  1.00 0.00 ? 67 ASP A HB2  3  
ATOM 3233  H HB3  . ASP A 1 67 ? -17.630 9.441   -0.272  1.00 0.00 ? 67 ASP A HB3  3  
ATOM 3234  N N    . TYR A 1 68 ? -16.516 12.769  -2.463  1.00 0.00 ? 68 TYR A N    3  
ATOM 3235  C CA   . TYR A 1 68 ? -16.637 14.138  -2.952  1.00 0.00 ? 68 TYR A CA   3  
ATOM 3236  C C    . TYR A 1 68 ? -15.357 14.924  -2.692  1.00 0.00 ? 68 TYR A C    3  
ATOM 3237  O O    . TYR A 1 68 ? -15.021 15.796  -3.522  1.00 0.00 ? 68 TYR A O    3  
ATOM 3238  C CB   . TYR A 1 68 ? -17.820 14.838  -2.283  1.00 0.00 ? 68 TYR A CB   3  
ATOM 3239  C CG   . TYR A 1 68 ? -19.075 14.849  -3.125  1.00 0.00 ? 68 TYR A CG   3  
ATOM 3240  C CD1  . TYR A 1 68 ? -19.540 13.687  -3.729  1.00 0.00 ? 68 TYR A CD1  3  
ATOM 3241  C CD2  . TYR A 1 68 ? -19.795 16.021  -3.315  1.00 0.00 ? 68 TYR A CD2  3  
ATOM 3242  C CE1  . TYR A 1 68 ? -20.687 13.694  -4.498  1.00 0.00 ? 68 TYR A CE1  3  
ATOM 3243  C CE2  . TYR A 1 68 ? -20.943 16.035  -4.084  1.00 0.00 ? 68 TYR A CE2  3  
ATOM 3244  C CZ   . TYR A 1 68 ? -21.385 14.870  -4.673  1.00 0.00 ? 68 TYR A CZ   3  
ATOM 3245  O OH   . TYR A 1 68 ? -22.527 14.881  -5.439  1.00 0.00 ? 68 TYR A OH   3  
ATOM 3246  O OXT  . TYR A 1 68 ? -14.701 14.663  -1.662  1.00 0.00 ? 68 TYR A OXT  3  
ATOM 3247  H H    . TYR A 1 68 ? -16.514 12.030  -3.107  1.00 0.00 ? 68 TYR A H    3  
ATOM 3248  H HA   . TYR A 1 68 ? -16.811 14.097  -4.015  1.00 0.00 ? 68 TYR A HA   3  
ATOM 3249  H HB2  . TYR A 1 68 ? -18.048 14.336  -1.354  1.00 0.00 ? 68 TYR A HB2  3  
ATOM 3250  H HB3  . TYR A 1 68 ? -17.550 15.862  -2.077  1.00 0.00 ? 68 TYR A HB3  3  
ATOM 3251  H HD1  . TYR A 1 68 ? -18.991 12.767  -3.589  1.00 0.00 ? 68 TYR A HD1  3  
ATOM 3252  H HD2  . TYR A 1 68 ? -19.446 16.932  -2.853  1.00 0.00 ? 68 TYR A HD2  3  
ATOM 3253  H HE1  . TYR A 1 68 ? -21.033 12.780  -4.960  1.00 0.00 ? 68 TYR A HE1  3  
ATOM 3254  H HE2  . TYR A 1 68 ? -21.489 16.957  -4.220  1.00 0.00 ? 68 TYR A HE2  3  
ATOM 3255  H HH   . TYR A 1 68 ? -22.357 15.348  -6.260  1.00 0.00 ? 68 TYR A HH   3  
ATOM 3256  N N    . TYR A 1 1  ? 14.388  16.432  -5.267  1.00 0.00 ? 1  TYR A N    4  
ATOM 3257  C CA   . TYR A 1 1  ? 13.237  16.230  -4.350  1.00 0.00 ? 1  TYR A CA   4  
ATOM 3258  C C    . TYR A 1 1  ? 12.133  15.420  -5.021  1.00 0.00 ? 1  TYR A C    4  
ATOM 3259  O O    . TYR A 1 1  ? 11.196  15.980  -5.590  1.00 0.00 ? 1  TYR A O    4  
ATOM 3260  C CB   . TYR A 1 1  ? 12.703  17.600  -3.928  1.00 0.00 ? 1  TYR A CB   4  
ATOM 3261  C CG   . TYR A 1 1  ? 13.688  18.409  -3.114  1.00 0.00 ? 1  TYR A CG   4  
ATOM 3262  C CD1  . TYR A 1 1  ? 14.290  17.871  -1.982  1.00 0.00 ? 1  TYR A CD1  4  
ATOM 3263  C CD2  . TYR A 1 1  ? 14.018  19.708  -3.477  1.00 0.00 ? 1  TYR A CD2  4  
ATOM 3264  C CE1  . TYR A 1 1  ? 15.191  18.606  -1.237  1.00 0.00 ? 1  TYR A CE1  4  
ATOM 3265  C CE2  . TYR A 1 1  ? 14.919  20.449  -2.736  1.00 0.00 ? 1  TYR A CE2  4  
ATOM 3266  C CZ   . TYR A 1 1  ? 15.503  19.893  -1.617  1.00 0.00 ? 1  TYR A CZ   4  
ATOM 3267  O OH   . TYR A 1 1  ? 16.400  20.629  -0.876  1.00 0.00 ? 1  TYR A OH   4  
ATOM 3268  H H1   . TYR A 1 1  ? 14.149  17.215  -5.908  1.00 0.00 ? 1  TYR A H1   4  
ATOM 3269  H H2   . TYR A 1 1  ? 14.532  15.547  -5.795  1.00 0.00 ? 1  TYR A H2   4  
ATOM 3270  H H3   . TYR A 1 1  ? 15.219  16.662  -4.686  1.00 0.00 ? 1  TYR A H3   4  
ATOM 3271  H HA   . TYR A 1 1  ? 13.582  15.698  -3.476  1.00 0.00 ? 1  TYR A HA   4  
ATOM 3272  H HB2  . TYR A 1 1  ? 12.456  18.171  -4.811  1.00 0.00 ? 1  TYR A HB2  4  
ATOM 3273  H HB3  . TYR A 1 1  ? 11.814  17.465  -3.332  1.00 0.00 ? 1  TYR A HB3  4  
ATOM 3274  H HD1  . TYR A 1 1  ? 14.044  16.861  -1.687  1.00 0.00 ? 1  TYR A HD1  4  
ATOM 3275  H HD2  . TYR A 1 1  ? 13.560  20.140  -4.354  1.00 0.00 ? 1  TYR A HD2  4  
ATOM 3276  H HE1  . TYR A 1 1  ? 15.648  18.170  -0.360  1.00 0.00 ? 1  TYR A HE1  4  
ATOM 3277  H HE2  . TYR A 1 1  ? 15.162  21.458  -3.035  1.00 0.00 ? 1  TYR A HE2  4  
ATOM 3278  H HH   . TYR A 1 1  ? 15.950  21.019  -0.123  1.00 0.00 ? 1  TYR A HH   4  
ATOM 3279  N N    . HIS A 1 2  ? 12.252  14.098  -4.951  1.00 0.00 ? 2  HIS A N    4  
ATOM 3280  C CA   . HIS A 1 2  ? 11.264  13.210  -5.551  1.00 0.00 ? 2  HIS A CA   4  
ATOM 3281  C C    . HIS A 1 2  ? 9.858   13.560  -5.075  1.00 0.00 ? 2  HIS A C    4  
ATOM 3282  O O    . HIS A 1 2  ? 9.680   14.109  -3.987  1.00 0.00 ? 2  HIS A O    4  
ATOM 3283  C CB   . HIS A 1 2  ? 11.582  11.754  -5.205  1.00 0.00 ? 2  HIS A CB   4  
ATOM 3284  C CG   . HIS A 1 2  ? 11.610  11.482  -3.733  1.00 0.00 ? 2  HIS A CG   4  
ATOM 3285  N ND1  . HIS A 1 2  ? 10.476  11.474  -2.948  1.00 0.00 ? 2  HIS A ND1  4  
ATOM 3286  C CD2  . HIS A 1 2  ? 12.643  11.208  -2.901  1.00 0.00 ? 2  HIS A CD2  4  
ATOM 3287  C CE1  . HIS A 1 2  ? 10.810  11.207  -1.698  1.00 0.00 ? 2  HIS A CE1  4  
ATOM 3288  N NE2  . HIS A 1 2  ? 12.118  11.041  -1.644  1.00 0.00 ? 2  HIS A NE2  4  
ATOM 3289  H H    . HIS A 1 2  ? 13.021  13.711  -4.484  1.00 0.00 ? 2  HIS A H    4  
ATOM 3290  H HA   . HIS A 1 2  ? 11.311  13.337  -6.623  1.00 0.00 ? 2  HIS A HA   4  
ATOM 3291  H HB2  . HIS A 1 2  ? 10.834  11.114  -5.648  1.00 0.00 ? 2  HIS A HB2  4  
ATOM 3292  H HB3  . HIS A 1 2  ? 12.552  11.499  -5.608  1.00 0.00 ? 2  HIS A HB3  4  
ATOM 3293  H HD1  . HIS A 1 2  ? 9.562   11.640  -3.260  1.00 0.00 ? 2  HIS A HD1  4  
ATOM 3294  H HD2  . HIS A 1 2  ? 13.686  11.134  -3.176  1.00 0.00 ? 2  HIS A HD2  4  
ATOM 3295  H HE1  . HIS A 1 2  ? 10.129  11.137  -0.862  1.00 0.00 ? 2  HIS A HE1  4  
ATOM 3296  H HE2  . HIS A 1 2  ? 12.629  10.834  -0.834  1.00 0.00 ? 2  HIS A HE2  4  
ATOM 3297  N N    . ALA A 1 3  ? 8.863   13.239  -5.895  1.00 0.00 ? 3  ALA A N    4  
ATOM 3298  C CA   . ALA A 1 3  ? 7.473   13.519  -5.556  1.00 0.00 ? 3  ALA A CA   4  
ATOM 3299  C C    . ALA A 1 3  ? 6.763   12.257  -5.074  1.00 0.00 ? 3  ALA A C    4  
ATOM 3300  O O    . ALA A 1 3  ? 7.230   11.143  -5.309  1.00 0.00 ? 3  ALA A O    4  
ATOM 3301  C CB   . ALA A 1 3  ? 6.747   14.110  -6.754  1.00 0.00 ? 3  ALA A CB   4  
ATOM 3302  H H    . ALA A 1 3  ? 9.069   12.802  -6.747  1.00 0.00 ? 3  ALA A H    4  
ATOM 3303  H HA   . ALA A 1 3  ? 7.463   14.251  -4.763  1.00 0.00 ? 3  ALA A HA   4  
ATOM 3304  H HB1  . ALA A 1 3  ? 7.448   14.256  -7.564  1.00 0.00 ? 3  ALA A HB1  4  
ATOM 3305  H HB2  . ALA A 1 3  ? 6.312   15.059  -6.480  1.00 0.00 ? 3  ALA A HB2  4  
ATOM 3306  H HB3  . ALA A 1 3  ? 5.966   13.435  -7.072  1.00 0.00 ? 3  ALA A HB3  4  
ATOM 3307  N N    . ASP A 1 4  ? 5.634   12.441  -4.398  1.00 0.00 ? 4  ASP A N    4  
ATOM 3308  C CA   . ASP A 1 4  ? 4.860   11.317  -3.884  1.00 0.00 ? 4  ASP A CA   4  
ATOM 3309  C C    . ASP A 1 4  ? 5.646   10.554  -2.820  1.00 0.00 ? 4  ASP A C    4  
ATOM 3310  O O    . ASP A 1 4  ? 5.769   9.330   -2.883  1.00 0.00 ? 4  ASP A O    4  
ATOM 3311  C CB   . ASP A 1 4  ? 4.470   10.375  -5.028  1.00 0.00 ? 4  ASP A CB   4  
ATOM 3312  C CG   . ASP A 1 4  ? 2.983   10.080  -5.055  1.00 0.00 ? 4  ASP A CG   4  
ATOM 3313  O OD1  . ASP A 1 4  ? 2.495   9.406   -4.125  1.00 0.00 ? 4  ASP A OD1  4  
ATOM 3314  O OD2  . ASP A 1 4  ? 2.308   10.521  -6.009  1.00 0.00 ? 4  ASP A OD2  4  
ATOM 3315  H H    . ASP A 1 4  ? 5.313   13.353  -4.244  1.00 0.00 ? 4  ASP A H    4  
ATOM 3316  H HA   . ASP A 1 4  ? 3.962   11.714  -3.435  1.00 0.00 ? 4  ASP A HA   4  
ATOM 3317  H HB2  . ASP A 1 4  ? 4.745   10.830  -5.969  1.00 0.00 ? 4  ASP A HB2  4  
ATOM 3318  H HB3  . ASP A 1 4  ? 5.002   9.442   -4.916  1.00 0.00 ? 4  ASP A HB3  4  
ATOM 3319  N N    . PRO A 1 5  ? 6.191   11.271  -1.822  1.00 0.00 ? 5  PRO A N    4  
ATOM 3320  C CA   . PRO A 1 5  ? 6.968   10.655  -0.740  1.00 0.00 ? 5  PRO A CA   4  
ATOM 3321  C C    . PRO A 1 5  ? 6.107   9.777   0.161   1.00 0.00 ? 5  PRO A C    4  
ATOM 3322  O O    . PRO A 1 5  ? 6.581   8.785   0.716   1.00 0.00 ? 5  PRO A O    4  
ATOM 3323  C CB   . PRO A 1 5  ? 7.511   11.854  0.041   1.00 0.00 ? 5  PRO A CB   4  
ATOM 3324  C CG   . PRO A 1 5  ? 6.560   12.961  -0.257  1.00 0.00 ? 5  PRO A CG   4  
ATOM 3325  C CD   . PRO A 1 5  ? 6.094   12.734  -1.668  1.00 0.00 ? 5  PRO A CD   4  
ATOM 3326  H HA   . PRO A 1 5  ? 7.791   10.072  -1.127  1.00 0.00 ? 5  PRO A HA   4  
ATOM 3327  H HB2  . PRO A 1 5  ? 7.529   11.622  1.095   1.00 0.00 ? 5  PRO A HB2  4  
ATOM 3328  H HB3  . PRO A 1 5  ? 8.509   12.087  -0.300  1.00 0.00 ? 5  PRO A HB3  4  
ATOM 3329  H HG2  . PRO A 1 5  ? 5.725   12.922  0.426   1.00 0.00 ? 5  PRO A HG2  4  
ATOM 3330  H HG3  . PRO A 1 5  ? 7.067   13.912  -0.178  1.00 0.00 ? 5  PRO A HG3  4  
ATOM 3331  H HD2  . PRO A 1 5  ? 5.074   13.067  -1.787  1.00 0.00 ? 5  PRO A HD2  4  
ATOM 3332  H HD3  . PRO A 1 5  ? 6.743   13.241  -2.367  1.00 0.00 ? 5  PRO A HD3  4  
ATOM 3333  N N    . SER A 1 6  ? 4.840   10.150  0.304   1.00 0.00 ? 6  SER A N    4  
ATOM 3334  C CA   . SER A 1 6  ? 3.912   9.397   1.138   1.00 0.00 ? 6  SER A CA   4  
ATOM 3335  C C    . SER A 1 6  ? 3.295   8.238   0.361   1.00 0.00 ? 6  SER A C    4  
ATOM 3336  O O    . SER A 1 6  ? 2.073   8.109   0.284   1.00 0.00 ? 6  SER A O    4  
ATOM 3337  C CB   . SER A 1 6  ? 2.808   10.316  1.665   1.00 0.00 ? 6  SER A CB   4  
ATOM 3338  O OG   . SER A 1 6  ? 3.354   11.411  2.380   1.00 0.00 ? 6  SER A OG   4  
ATOM 3339  H H    . SER A 1 6  ? 4.521   10.949  -0.164  1.00 0.00 ? 6  SER A H    4  
ATOM 3340  H HA   . SER A 1 6  ? 4.467   8.997   1.974   1.00 0.00 ? 6  SER A HA   4  
ATOM 3341  H HB2  . SER A 1 6  ? 2.231   10.695  0.835   1.00 0.00 ? 6  SER A HB2  4  
ATOM 3342  H HB3  . SER A 1 6  ? 2.162   9.757   2.326   1.00 0.00 ? 6  SER A HB3  4  
ATOM 3343  H HG   . SER A 1 6  ? 4.087   11.783  1.885   1.00 0.00 ? 6  SER A HG   4  
ATOM 3344  N N    . LEU A 1 7  ? 4.149   7.396   -0.216  1.00 0.00 ? 7  LEU A N    4  
ATOM 3345  C CA   . LEU A 1 7  ? 3.687   6.249   -0.988  1.00 0.00 ? 7  LEU A CA   4  
ATOM 3346  C C    . LEU A 1 7  ? 4.665   5.083   -0.871  1.00 0.00 ? 7  LEU A C    4  
ATOM 3347  O O    . LEU A 1 7  ? 4.313   4.013   -0.379  1.00 0.00 ? 7  LEU A O    4  
ATOM 3348  C CB   . LEU A 1 7  ? 3.507   6.636   -2.459  1.00 0.00 ? 7  LEU A CB   4  
ATOM 3349  C CG   . LEU A 1 7  ? 3.193   5.476   -3.408  1.00 0.00 ? 7  LEU A CG   4  
ATOM 3350  C CD1  . LEU A 1 7  ? 4.465   4.719   -3.764  1.00 0.00 ? 7  LEU A CD1  4  
ATOM 3351  C CD2  . LEU A 1 7  ? 2.167   4.537   -2.792  1.00 0.00 ? 7  LEU A CD2  4  
ATOM 3352  H H    . LEU A 1 7  ? 5.112   7.552   -0.119  1.00 0.00 ? 7  LEU A H    4  
ATOM 3353  H HA   . LEU A 1 7  ? 2.732   5.941   -0.585  1.00 0.00 ? 7  LEU A HA   4  
ATOM 3354  H HB2  . LEU A 1 7  ? 2.699   7.352   -2.523  1.00 0.00 ? 7  LEU A HB2  4  
ATOM 3355  H HB3  . LEU A 1 7  ? 4.415   7.114   -2.796  1.00 0.00 ? 7  LEU A HB3  4  
ATOM 3356  H HG   . LEU A 1 7  ? 2.776   5.872   -4.322  1.00 0.00 ? 7  LEU A HG   4  
ATOM 3357  H HD11 . LEU A 1 7  ? 4.450   4.463   -4.812  1.00 0.00 ? 7  LEU A HD11 4  
ATOM 3358  H HD12 . LEU A 1 7  ? 4.523   3.817   -3.173  1.00 0.00 ? 7  LEU A HD12 4  
ATOM 3359  H HD13 . LEU A 1 7  ? 5.323   5.341   -3.557  1.00 0.00 ? 7  LEU A HD13 4  
ATOM 3360  H HD21 . LEU A 1 7  ? 1.203   5.025   -2.766  1.00 0.00 ? 7  LEU A HD21 4  
ATOM 3361  H HD22 . LEU A 1 7  ? 2.468   4.284   -1.786  1.00 0.00 ? 7  LEU A HD22 4  
ATOM 3362  H HD23 . LEU A 1 7  ? 2.099   3.638   -3.386  1.00 0.00 ? 7  LEU A HD23 4  
ATOM 3363  N N    . VAL A 1 8  ? 5.895   5.298   -1.329  1.00 0.00 ? 8  VAL A N    4  
ATOM 3364  C CA   . VAL A 1 8  ? 6.923   4.264   -1.273  1.00 0.00 ? 8  VAL A CA   4  
ATOM 3365  C C    . VAL A 1 8  ? 7.081   3.724   0.146   1.00 0.00 ? 8  VAL A C    4  
ATOM 3366  O O    . VAL A 1 8  ? 6.887   2.532   0.397   1.00 0.00 ? 8  VAL A O    4  
ATOM 3367  C CB   . VAL A 1 8  ? 8.284   4.800   -1.757  1.00 0.00 ? 8  VAL A CB   4  
ATOM 3368  C CG1  . VAL A 1 8  ? 9.317   3.685   -1.793  1.00 0.00 ? 8  VAL A CG1  4  
ATOM 3369  C CG2  . VAL A 1 8  ? 8.145   5.456   -3.122  1.00 0.00 ? 8  VAL A CG2  4  
ATOM 3370  H H    . VAL A 1 8  ? 6.116   6.172   -1.711  1.00 0.00 ? 8  VAL A H    4  
ATOM 3371  H HA   . VAL A 1 8  ? 6.624   3.457   -1.926  1.00 0.00 ? 8  VAL A HA   4  
ATOM 3372  H HB   . VAL A 1 8  ? 8.622   5.550   -1.056  1.00 0.00 ? 8  VAL A HB   4  
ATOM 3373  H HG11 . VAL A 1 8  ? 9.089   2.958   -1.028  1.00 0.00 ? 8  VAL A HG11 4  
ATOM 3374  H HG12 . VAL A 1 8  ? 10.300  4.098   -1.617  1.00 0.00 ? 8  VAL A HG12 4  
ATOM 3375  H HG13 . VAL A 1 8  ? 9.297   3.207   -2.761  1.00 0.00 ? 8  VAL A HG13 4  
ATOM 3376  H HG21 . VAL A 1 8  ? 8.066   6.526   -3.001  1.00 0.00 ? 8  VAL A HG21 4  
ATOM 3377  H HG22 . VAL A 1 8  ? 7.258   5.083   -3.612  1.00 0.00 ? 8  VAL A HG22 4  
ATOM 3378  H HG23 . VAL A 1 8  ? 9.013   5.225   -3.722  1.00 0.00 ? 8  VAL A HG23 4  
ATOM 3379  N N    . SER A 1 9  ? 7.421   4.611   1.072   1.00 0.00 ? 9  SER A N    4  
ATOM 3380  C CA   . SER A 1 9  ? 7.611   4.229   2.465   1.00 0.00 ? 9  SER A CA   4  
ATOM 3381  C C    . SER A 1 9  ? 6.290   3.840   3.132   1.00 0.00 ? 9  SER A C    4  
ATOM 3382  O O    . SER A 1 9  ? 6.284   3.371   4.271   1.00 0.00 ? 9  SER A O    4  
ATOM 3383  C CB   . SER A 1 9  ? 8.271   5.373   3.238   1.00 0.00 ? 9  SER A CB   4  
ATOM 3384  O OG   . SER A 1 9  ? 7.955   5.311   4.619   1.00 0.00 ? 9  SER A OG   4  
ATOM 3385  H H    . SER A 1 9  ? 7.563   5.545   0.809   1.00 0.00 ? 9  SER A H    4  
ATOM 3386  H HA   . SER A 1 9  ? 8.271   3.375   2.482   1.00 0.00 ? 9  SER A HA   4  
ATOM 3387  H HB2  . SER A 1 9  ? 9.342   5.307   3.124   1.00 0.00 ? 9  SER A HB2  4  
ATOM 3388  H HB3  . SER A 1 9  ? 7.925   6.317   2.845   1.00 0.00 ? 9  SER A HB3  4  
ATOM 3389  H HG   . SER A 1 9  ? 8.140   6.159   5.028   1.00 0.00 ? 9  SER A HG   4  
ATOM 3390  N N    . PHE A 1 10 ? 5.172   4.030   2.430   1.00 0.00 ? 10 PHE A N    4  
ATOM 3391  C CA   . PHE A 1 10 ? 3.869   3.689   2.981   1.00 0.00 ? 10 PHE A CA   4  
ATOM 3392  C C    . PHE A 1 10 ? 3.461   2.277   2.576   1.00 0.00 ? 10 PHE A C    4  
ATOM 3393  O O    . PHE A 1 10 ? 3.245   1.415   3.428   1.00 0.00 ? 10 PHE A O    4  
ATOM 3394  C CB   . PHE A 1 10 ? 2.813   4.692   2.510   1.00 0.00 ? 10 PHE A CB   4  
ATOM 3395  C CG   . PHE A 1 10 ? 2.181   5.472   3.628   1.00 0.00 ? 10 PHE A CG   4  
ATOM 3396  C CD1  . PHE A 1 10 ? 2.965   6.129   4.563   1.00 0.00 ? 10 PHE A CD1  4  
ATOM 3397  C CD2  . PHE A 1 10 ? 0.802   5.553   3.740   1.00 0.00 ? 10 PHE A CD2  4  
ATOM 3398  C CE1  . PHE A 1 10 ? 2.386   6.849   5.591   1.00 0.00 ? 10 PHE A CE1  4  
ATOM 3399  C CE2  . PHE A 1 10 ? 0.218   6.272   4.765   1.00 0.00 ? 10 PHE A CE2  4  
ATOM 3400  C CZ   . PHE A 1 10 ? 1.011   6.921   5.691   1.00 0.00 ? 10 PHE A CZ   4  
ATOM 3401  H H    . PHE A 1 10 ? 5.222   4.404   1.528   1.00 0.00 ? 10 PHE A H    4  
ATOM 3402  H HA   . PHE A 1 10 ? 3.944   3.731   4.058   1.00 0.00 ? 10 PHE A HA   4  
ATOM 3403  H HB2  . PHE A 1 10 ? 3.276   5.396   1.834   1.00 0.00 ? 10 PHE A HB2  4  
ATOM 3404  H HB3  . PHE A 1 10 ? 2.030   4.162   1.990   1.00 0.00 ? 10 PHE A HB3  4  
ATOM 3405  H HD1  . PHE A 1 10 ? 4.041   6.073   4.484   1.00 0.00 ? 10 PHE A HD1  4  
ATOM 3406  H HD2  . PHE A 1 10 ? 0.181   5.047   3.016   1.00 0.00 ? 10 PHE A HD2  4  
ATOM 3407  H HE1  . PHE A 1 10 ? 3.008   7.355   6.314   1.00 0.00 ? 10 PHE A HE1  4  
ATOM 3408  H HE2  . PHE A 1 10 ? -0.859  6.326   4.842   1.00 0.00 ? 10 PHE A HE2  4  
ATOM 3409  H HZ   . PHE A 1 10 ? 0.556   7.482   6.494   1.00 0.00 ? 10 PHE A HZ   4  
ATOM 3410  N N    . LEU A 1 11 ? 3.365   2.042   1.272   1.00 0.00 ? 11 LEU A N    4  
ATOM 3411  C CA   . LEU A 1 11 ? 2.984   0.730   0.766   1.00 0.00 ? 11 LEU A CA   4  
ATOM 3412  C C    . LEU A 1 11 ? 4.010   -0.322  1.181   1.00 0.00 ? 11 LEU A C    4  
ATOM 3413  O O    . LEU A 1 11 ? 3.678   -1.497  1.335   1.00 0.00 ? 11 LEU A O    4  
ATOM 3414  C CB   . LEU A 1 11 ? 2.794   0.776   -0.762  1.00 0.00 ? 11 LEU A CB   4  
ATOM 3415  C CG   . LEU A 1 11 ? 4.002   0.390   -1.628  1.00 0.00 ? 11 LEU A CG   4  
ATOM 3416  C CD1  . LEU A 1 11 ? 5.246   1.133   -1.173  1.00 0.00 ? 11 LEU A CD1  4  
ATOM 3417  C CD2  . LEU A 1 11 ? 4.230   -1.115  -1.603  1.00 0.00 ? 11 LEU A CD2  4  
ATOM 3418  H H    . LEU A 1 11 ? 3.548   2.764   0.638   1.00 0.00 ? 11 LEU A H    4  
ATOM 3419  H HA   . LEU A 1 11 ? 2.037   0.476   1.220   1.00 0.00 ? 11 LEU A HA   4  
ATOM 3420  H HB2  . LEU A 1 11 ? 1.978   0.116   -1.015  1.00 0.00 ? 11 LEU A HB2  4  
ATOM 3421  H HB3  . LEU A 1 11 ? 2.508   1.784   -1.025  1.00 0.00 ? 11 LEU A HB3  4  
ATOM 3422  H HG   . LEU A 1 11 ? 3.803   0.673   -2.650  1.00 0.00 ? 11 LEU A HG   4  
ATOM 3423  H HD11 . LEU A 1 11 ? 4.973   1.867   -0.429  1.00 0.00 ? 11 LEU A HD11 4  
ATOM 3424  H HD12 . LEU A 1 11 ? 5.698   1.628   -2.018  1.00 0.00 ? 11 LEU A HD12 4  
ATOM 3425  H HD13 . LEU A 1 11 ? 5.948   0.433   -0.749  1.00 0.00 ? 11 LEU A HD13 4  
ATOM 3426  H HD21 . LEU A 1 11 ? 3.423   -1.593  -1.068  1.00 0.00 ? 11 LEU A HD21 4  
ATOM 3427  H HD22 . LEU A 1 11 ? 5.166   -1.329  -1.108  1.00 0.00 ? 11 LEU A HD22 4  
ATOM 3428  H HD23 . LEU A 1 11 ? 4.264   -1.491  -2.615  1.00 0.00 ? 11 LEU A HD23 4  
ATOM 3429  N N    . THR A 1 12 ? 5.248   0.114   1.403   1.00 0.00 ? 12 THR A N    4  
ATOM 3430  C CA   . THR A 1 12 ? 6.304   -0.790  1.840   1.00 0.00 ? 12 THR A CA   4  
ATOM 3431  C C    . THR A 1 12 ? 6.210   -1.025  3.345   1.00 0.00 ? 12 THR A C    4  
ATOM 3432  O O    . THR A 1 12 ? 6.213   -2.169  3.808   1.00 0.00 ? 12 THR A O    4  
ATOM 3433  C CB   . THR A 1 12 ? 7.680   -0.216  1.480   1.00 0.00 ? 12 THR A CB   4  
ATOM 3434  O OG1  . THR A 1 12 ? 7.863   -0.195  0.076   1.00 0.00 ? 12 THR A OG1  4  
ATOM 3435  C CG2  . THR A 1 12 ? 8.834   -0.992  2.079   1.00 0.00 ? 12 THR A CG2  4  
ATOM 3436  H H    . THR A 1 12 ? 5.452   1.066   1.278   1.00 0.00 ? 12 THR A H    4  
ATOM 3437  H HA   . THR A 1 12 ? 6.168   -1.731  1.330   1.00 0.00 ? 12 THR A HA   4  
ATOM 3438  H HB   . THR A 1 12 ? 7.742   0.797   1.847   1.00 0.00 ? 12 THR A HB   4  
ATOM 3439  H HG1  . THR A 1 12 ? 8.326   0.607   -0.175  1.00 0.00 ? 12 THR A HG1  4  
ATOM 3440  H HG21 . THR A 1 12 ? 9.418   -0.339  2.711   1.00 0.00 ? 12 THR A HG21 4  
ATOM 3441  H HG22 . THR A 1 12 ? 9.457   -1.379  1.286   1.00 0.00 ? 12 THR A HG22 4  
ATOM 3442  H HG23 . THR A 1 12 ? 8.451   -1.813  2.668   1.00 0.00 ? 12 THR A HG23 4  
ATOM 3443  N N    . GLY A 1 13 ? 6.124   0.071   4.100   1.00 0.00 ? 13 GLY A N    4  
ATOM 3444  C CA   . GLY A 1 13 ? 5.998   -0.022  5.544   1.00 0.00 ? 13 GLY A CA   4  
ATOM 3445  C C    . GLY A 1 13 ? 4.764   -0.796  5.942   1.00 0.00 ? 13 GLY A C    4  
ATOM 3446  O O    . GLY A 1 13 ? 4.715   -1.415  7.005   1.00 0.00 ? 13 GLY A O    4  
ATOM 3447  H H    . GLY A 1 13 ? 6.085   0.946   3.665   1.00 0.00 ? 13 GLY A H    4  
ATOM 3448  H HA2  . GLY A 1 13 ? 6.870   -0.519  5.943   1.00 0.00 ? 13 GLY A HA2  4  
ATOM 3449  H HA3  . GLY A 1 13 ? 5.938   0.974   5.958   1.00 0.00 ? 13 GLY A HA3  4  
ATOM 3450  N N    . LEU A 1 14 ? 3.780   -0.788  5.053   1.00 0.00 ? 14 LEU A N    4  
ATOM 3451  C CA   . LEU A 1 14 ? 2.548   -1.526  5.247   1.00 0.00 ? 14 LEU A CA   4  
ATOM 3452  C C    . LEU A 1 14 ? 2.832   -2.970  5.639   1.00 0.00 ? 14 LEU A C    4  
ATOM 3453  O O    . LEU A 1 14 ? 1.999   -3.638  6.252   1.00 0.00 ? 14 LEU A O    4  
ATOM 3454  C CB   . LEU A 1 14 ? 1.756   -1.499  3.942   1.00 0.00 ? 14 LEU A CB   4  
ATOM 3455  C CG   . LEU A 1 14 ? 0.356   -2.121  3.991   1.00 0.00 ? 14 LEU A CG   4  
ATOM 3456  C CD1  . LEU A 1 14 ? -0.334  -1.818  5.314   1.00 0.00 ? 14 LEU A CD1  4  
ATOM 3457  C CD2  . LEU A 1 14 ? -0.484  -1.614  2.828   1.00 0.00 ? 14 LEU A CD2  4  
ATOM 3458  H H    . LEU A 1 14 ? 3.900   -0.293  4.217   1.00 0.00 ? 14 LEU A H    4  
ATOM 3459  H HA   . LEU A 1 14 ? 1.978   -1.047  6.029   1.00 0.00 ? 14 LEU A HA   4  
ATOM 3460  H HB2  . LEU A 1 14 ? 1.661   -0.475  3.632   1.00 0.00 ? 14 LEU A HB2  4  
ATOM 3461  H HB3  . LEU A 1 14 ? 2.337   -2.019  3.194   1.00 0.00 ? 14 LEU A HB3  4  
ATOM 3462  H HG   . LEU A 1 14 ? 0.443   -3.193  3.896   1.00 0.00 ? 14 LEU A HG   4  
ATOM 3463  H HD11 . LEU A 1 14 ? -0.251  -0.763  5.531   1.00 0.00 ? 14 LEU A HD11 4  
ATOM 3464  H HD12 . LEU A 1 14 ? 0.138   -2.385  6.104   1.00 0.00 ? 14 LEU A HD12 4  
ATOM 3465  H HD13 . LEU A 1 14 ? -1.376  -2.091  5.249   1.00 0.00 ? 14 LEU A HD13 4  
ATOM 3466  H HD21 . LEU A 1 14 ? -0.539  -0.537  2.867   1.00 0.00 ? 14 LEU A HD21 4  
ATOM 3467  H HD22 . LEU A 1 14 ? -1.479  -2.027  2.896   1.00 0.00 ? 14 LEU A HD22 4  
ATOM 3468  H HD23 . LEU A 1 14 ? -0.029  -1.918  1.897   1.00 0.00 ? 14 LEU A HD23 4  
ATOM 3469  N N    . GLY A 1 15 ? 4.009   -3.451  5.255   1.00 0.00 ? 15 GLY A N    4  
ATOM 3470  C CA   . GLY A 1 15 ? 4.384   -4.819  5.534   1.00 0.00 ? 15 GLY A CA   4  
ATOM 3471  C C    . GLY A 1 15 ? 4.771   -5.577  4.278   1.00 0.00 ? 15 GLY A C    4  
ATOM 3472  O O    . GLY A 1 15 ? 4.928   -6.798  4.312   1.00 0.00 ? 15 GLY A O    4  
ATOM 3473  H H    . GLY A 1 15 ? 4.622   -2.875  4.758   1.00 0.00 ? 15 GLY A H    4  
ATOM 3474  H HA2  . GLY A 1 15 ? 5.221   -4.819  6.216   1.00 0.00 ? 15 GLY A HA2  4  
ATOM 3475  H HA3  . GLY A 1 15 ? 3.551   -5.321  6.004   1.00 0.00 ? 15 GLY A HA3  4  
ATOM 3476  N N    . CYS A 1 16 ? 4.925   -4.860  3.161   1.00 0.00 ? 16 CYS A N    4  
ATOM 3477  C CA   . CYS A 1 16 ? 5.293   -5.498  1.901   1.00 0.00 ? 16 CYS A CA   4  
ATOM 3478  C C    . CYS A 1 16 ? 6.414   -4.731  1.204   1.00 0.00 ? 16 CYS A C    4  
ATOM 3479  O O    . CYS A 1 16 ? 6.187   -4.067  0.192   1.00 0.00 ? 16 CYS A O    4  
ATOM 3480  C CB   . CYS A 1 16 ? 4.078   -5.604  0.974   1.00 0.00 ? 16 CYS A CB   4  
ATOM 3481  S SG   . CYS A 1 16 ? 2.907   -4.232  1.113   1.00 0.00 ? 16 CYS A SG   4  
ATOM 3482  H H    . CYS A 1 16 ? 4.788   -3.884  3.183   1.00 0.00 ? 16 CYS A H    4  
ATOM 3483  H HA   . CYS A 1 16 ? 5.648   -6.493  2.129   1.00 0.00 ? 16 CYS A HA   4  
ATOM 3484  H HB2  . CYS A 1 16 ? 4.419   -5.639  -0.050  1.00 0.00 ? 16 CYS A HB2  4  
ATOM 3485  H HB3  . CYS A 1 16 ? 3.543   -6.515  1.200   1.00 0.00 ? 16 CYS A HB3  4  
ATOM 3486  H HG   . CYS A 1 16 ? 2.696   -4.116  2.043   1.00 0.00 ? 16 CYS A HG   4  
ATOM 3487  N N    . PRO A 1 17 ? 7.650   -4.832  1.724   1.00 0.00 ? 17 PRO A N    4  
ATOM 3488  C CA   . PRO A 1 17 ? 8.810   -4.142  1.157   1.00 0.00 ? 17 PRO A CA   4  
ATOM 3489  C C    . PRO A 1 17 ? 9.357   -4.828  -0.094  1.00 0.00 ? 17 PRO A C    4  
ATOM 3490  O O    . PRO A 1 17 ? 10.381  -4.411  -0.637  1.00 0.00 ? 17 PRO A O    4  
ATOM 3491  C CB   . PRO A 1 17 ? 9.855   -4.187  2.285   1.00 0.00 ? 17 PRO A CB   4  
ATOM 3492  C CG   . PRO A 1 17 ? 9.166   -4.792  3.467   1.00 0.00 ? 17 PRO A CG   4  
ATOM 3493  C CD   . PRO A 1 17 ? 8.015   -5.589  2.924   1.00 0.00 ? 17 PRO A CD   4  
ATOM 3494  H HA   . PRO A 1 17 ? 8.577   -3.114  0.923   1.00 0.00 ? 17 PRO A HA   4  
ATOM 3495  H HB2  . PRO A 1 17 ? 10.695  -4.790  1.971   1.00 0.00 ? 17 PRO A HB2  4  
ATOM 3496  H HB3  . PRO A 1 17 ? 10.193  -3.184  2.500   1.00 0.00 ? 17 PRO A HB3  4  
ATOM 3497  H HG2  . PRO A 1 17 ? 9.849   -5.438  3.998   1.00 0.00 ? 17 PRO A HG2  4  
ATOM 3498  H HG3  . PRO A 1 17 ? 8.805   -4.011  4.119   1.00 0.00 ? 17 PRO A HG3  4  
ATOM 3499  H HD2  . PRO A 1 17 ? 8.331   -6.590  2.672   1.00 0.00 ? 17 PRO A HD2  4  
ATOM 3500  H HD3  . PRO A 1 17 ? 7.200   -5.612  3.633   1.00 0.00 ? 17 PRO A HD3  4  
ATOM 3501  N N    . ASN A 1 18 ? 8.684   -5.883  -0.548  1.00 0.00 ? 18 ASN A N    4  
ATOM 3502  C CA   . ASN A 1 18 ? 9.124   -6.609  -1.732  1.00 0.00 ? 18 ASN A CA   4  
ATOM 3503  C C    . ASN A 1 18 ? 7.964   -6.853  -2.695  1.00 0.00 ? 18 ASN A C    4  
ATOM 3504  O O    . ASN A 1 18 ? 8.039   -7.727  -3.559  1.00 0.00 ? 18 ASN A O    4  
ATOM 3505  C CB   . ASN A 1 18 ? 9.756   -7.943  -1.328  1.00 0.00 ? 18 ASN A CB   4  
ATOM 3506  C CG   . ASN A 1 18 ? 8.744   -8.910  -0.745  1.00 0.00 ? 18 ASN A CG   4  
ATOM 3507  O OD1  . ASN A 1 18 ? 7.690   -8.503  -0.254  1.00 0.00 ? 18 ASN A OD1  4  
ATOM 3508  N ND2  . ASN A 1 18 ? 9.060   -10.198 -0.796  1.00 0.00 ? 18 ASN A ND2  4  
ATOM 3509  H H    . ASN A 1 18 ? 7.876   -6.178  -0.082  1.00 0.00 ? 18 ASN A H    4  
ATOM 3510  H HA   . ASN A 1 18 ? 9.867   -6.006  -2.231  1.00 0.00 ? 18 ASN A HA   4  
ATOM 3511  H HB2  . ASN A 1 18 ? 10.204  -8.400  -2.196  1.00 0.00 ? 18 ASN A HB2  4  
ATOM 3512  H HB3  . ASN A 1 18 ? 10.519  -7.761  -0.585  1.00 0.00 ? 18 ASN A HB3  4  
ATOM 3513  H HD21 . ASN A 1 18 ? 9.917   -10.449 -1.201  1.00 0.00 ? 18 ASN A HD21 4  
ATOM 3514  H HD22 . ASN A 1 18 ? 8.424   -10.846 -0.426  1.00 0.00 ? 18 ASN A HD22 4  
ATOM 3515  N N    . CYS A 1 19 ? 6.897   -6.071  -2.551  1.00 0.00 ? 19 CYS A N    4  
ATOM 3516  C CA   . CYS A 1 19 ? 5.731   -6.207  -3.416  1.00 0.00 ? 19 CYS A CA   4  
ATOM 3517  C C    . CYS A 1 19 ? 5.548   -4.968  -4.288  1.00 0.00 ? 19 CYS A C    4  
ATOM 3518  O O    . CYS A 1 19 ? 4.938   -5.035  -5.355  1.00 0.00 ? 19 CYS A O    4  
ATOM 3519  C CB   . CYS A 1 19 ? 4.472   -6.446  -2.579  1.00 0.00 ? 19 CYS A CB   4  
ATOM 3520  S SG   . CYS A 1 19 ? 4.597   -7.845  -1.441  1.00 0.00 ? 19 CYS A SG   4  
ATOM 3521  H H    . CYS A 1 19 ? 6.893   -5.391  -1.846  1.00 0.00 ? 19 CYS A H    4  
ATOM 3522  H HA   . CYS A 1 19 ? 5.896   -7.059  -4.055  1.00 0.00 ? 19 CYS A HA   4  
ATOM 3523  H HB2  . CYS A 1 19 ? 4.265   -5.563  -1.992  1.00 0.00 ? 19 CYS A HB2  4  
ATOM 3524  H HB3  . CYS A 1 19 ? 3.640   -6.635  -3.242  1.00 0.00 ? 19 CYS A HB3  4  
ATOM 3525  H HG   . CYS A 1 19 ? 3.801   -8.374  -1.534  1.00 0.00 ? 19 CYS A HG   4  
ATOM 3526  N N    . ILE A 1 20 ? 6.078   -3.841  -3.826  1.00 0.00 ? 20 ILE A N    4  
ATOM 3527  C CA   . ILE A 1 20 ? 5.974   -2.589  -4.563  1.00 0.00 ? 20 ILE A CA   4  
ATOM 3528  C C    . ILE A 1 20 ? 6.394   -2.767  -6.014  1.00 0.00 ? 20 ILE A C    4  
ATOM 3529  O O    . ILE A 1 20 ? 5.838   -2.142  -6.913  1.00 0.00 ? 20 ILE A O    4  
ATOM 3530  C CB   . ILE A 1 20 ? 6.849   -1.497  -3.929  1.00 0.00 ? 20 ILE A CB   4  
ATOM 3531  C CG1  . ILE A 1 20 ? 6.669   -0.170  -4.671  1.00 0.00 ? 20 ILE A CG1  4  
ATOM 3532  C CG2  . ILE A 1 20 ? 8.306   -1.926  -3.951  1.00 0.00 ? 20 ILE A CG2  4  
ATOM 3533  C CD1  . ILE A 1 20 ? 5.270   0.394   -4.565  1.00 0.00 ? 20 ILE A CD1  4  
ATOM 3534  H H    . ILE A 1 20 ? 6.552   -3.850  -2.970  1.00 0.00 ? 20 ILE A H    4  
ATOM 3535  H HA   . ILE A 1 20 ? 4.945   -2.266  -4.534  1.00 0.00 ? 20 ILE A HA   4  
ATOM 3536  H HB   . ILE A 1 20 ? 6.549   -1.375  -2.900  1.00 0.00 ? 20 ILE A HB   4  
ATOM 3537  H HG12 . ILE A 1 20 ? 7.352   0.559   -4.262  1.00 0.00 ? 20 ILE A HG12 4  
ATOM 3538  H HG13 . ILE A 1 20 ? 6.889   -0.317  -5.718  1.00 0.00 ? 20 ILE A HG13 4  
ATOM 3539  H HG21 . ILE A 1 20 ? 8.878   -1.297  -3.285  1.00 0.00 ? 20 ILE A HG21 4  
ATOM 3540  H HG22 . ILE A 1 20 ? 8.691   -1.832  -4.957  1.00 0.00 ? 20 ILE A HG22 4  
ATOM 3541  H HG23 . ILE A 1 20 ? 8.381   -2.955  -3.632  1.00 0.00 ? 20 ILE A HG23 4  
ATOM 3542  H HD11 . ILE A 1 20 ? 4.598   -0.374  -4.210  1.00 0.00 ? 20 ILE A HD11 4  
ATOM 3543  H HD12 . ILE A 1 20 ? 4.945   0.736   -5.537  1.00 0.00 ? 20 ILE A HD12 4  
ATOM 3544  H HD13 . ILE A 1 20 ? 5.268   1.223   -3.873  1.00 0.00 ? 20 ILE A HD13 4  
ATOM 3545  N N    . GLU A 1 21 ? 7.401   -3.601  -6.232  1.00 0.00 ? 21 GLU A N    4  
ATOM 3546  C CA   . GLU A 1 21 ? 7.896   -3.864  -7.575  1.00 0.00 ? 21 GLU A CA   4  
ATOM 3547  C C    . GLU A 1 21 ? 6.838   -4.577  -8.404  1.00 0.00 ? 21 GLU A C    4  
ATOM 3548  O O    . GLU A 1 21 ? 6.654   -4.287  -9.587  1.00 0.00 ? 21 GLU A O    4  
ATOM 3549  C CB   . GLU A 1 21 ? 9.153   -4.722  -7.505  1.00 0.00 ? 21 GLU A CB   4  
ATOM 3550  C CG   . GLU A 1 21 ? 10.306  -4.053  -6.773  1.00 0.00 ? 21 GLU A CG   4  
ATOM 3551  C CD   . GLU A 1 21 ? 11.454  -3.692  -7.695  1.00 0.00 ? 21 GLU A CD   4  
ATOM 3552  O OE1  . GLU A 1 21 ? 12.327  -4.555  -7.923  1.00 0.00 ? 21 GLU A OE1  4  
ATOM 3553  O OE2  . GLU A 1 21 ? 11.479  -2.543  -8.187  1.00 0.00 ? 21 GLU A OE2  4  
ATOM 3554  H H    . GLU A 1 21 ? 7.806   -4.070  -5.474  1.00 0.00 ? 21 GLU A H    4  
ATOM 3555  H HA   . GLU A 1 21 ? 8.131   -2.919  -8.040  1.00 0.00 ? 21 GLU A HA   4  
ATOM 3556  H HB2  . GLU A 1 21 ? 8.912   -5.639  -6.992  1.00 0.00 ? 21 GLU A HB2  4  
ATOM 3557  H HB3  . GLU A 1 21 ? 9.476   -4.955  -8.508  1.00 0.00 ? 21 GLU A HB3  4  
ATOM 3558  H HG2  . GLU A 1 21 ? 9.942   -3.150  -6.304  1.00 0.00 ? 21 GLU A HG2  4  
ATOM 3559  H HG3  . GLU A 1 21 ? 10.673  -4.729  -6.014  1.00 0.00 ? 21 GLU A HG3  4  
ATOM 3560  N N    . TYR A 1 22 ? 6.151   -5.518  -7.772  1.00 0.00 ? 22 TYR A N    4  
ATOM 3561  C CA   . TYR A 1 22 ? 5.100   -6.277  -8.437  1.00 0.00 ? 22 TYR A CA   4  
ATOM 3562  C C    . TYR A 1 22 ? 3.855   -5.421  -8.611  1.00 0.00 ? 22 TYR A C    4  
ATOM 3563  O O    . TYR A 1 22 ? 3.101   -5.586  -9.570  1.00 0.00 ? 22 TYR A O    4  
ATOM 3564  C CB   . TYR A 1 22 ? 4.771   -7.541  -7.637  1.00 0.00 ? 22 TYR A CB   4  
ATOM 3565  C CG   . TYR A 1 22 ? 5.988   -8.222  -7.046  1.00 0.00 ? 22 TYR A CG   4  
ATOM 3566  C CD1  . TYR A 1 22 ? 7.247   -8.061  -7.616  1.00 0.00 ? 22 TYR A CD1  4  
ATOM 3567  C CD2  . TYR A 1 22 ? 5.878   -9.028  -5.920  1.00 0.00 ? 22 TYR A CD2  4  
ATOM 3568  C CE1  . TYR A 1 22 ? 8.359   -8.680  -7.078  1.00 0.00 ? 22 TYR A CE1  4  
ATOM 3569  C CE2  . TYR A 1 22 ? 6.986   -9.651  -5.377  1.00 0.00 ? 22 TYR A CE2  4  
ATOM 3570  C CZ   . TYR A 1 22 ? 8.224   -9.474  -5.960  1.00 0.00 ? 22 TYR A CZ   4  
ATOM 3571  O OH   . TYR A 1 22 ? 9.329   -10.094 -5.423  1.00 0.00 ? 22 TYR A OH   4  
ATOM 3572  H H    . TYR A 1 22 ? 6.344   -5.695  -6.827  1.00 0.00 ? 22 TYR A H    4  
ATOM 3573  H HA   . TYR A 1 22 ? 5.466   -6.563  -9.413  1.00 0.00 ? 22 TYR A HA   4  
ATOM 3574  H HB2  . TYR A 1 22 ? 4.111   -7.279  -6.823  1.00 0.00 ? 22 TYR A HB2  4  
ATOM 3575  H HB3  . TYR A 1 22 ? 4.274   -8.248  -8.283  1.00 0.00 ? 22 TYR A HB3  4  
ATOM 3576  H HD1  . TYR A 1 22 ? 7.350   -7.437  -8.491  1.00 0.00 ? 22 TYR A HD1  4  
ATOM 3577  H HD2  . TYR A 1 22 ? 4.908   -9.166  -5.465  1.00 0.00 ? 22 TYR A HD2  4  
ATOM 3578  H HE1  . TYR A 1 22 ? 9.327   -8.539  -7.535  1.00 0.00 ? 22 TYR A HE1  4  
ATOM 3579  H HE2  . TYR A 1 22 ? 6.881   -10.274 -4.501  1.00 0.00 ? 22 TYR A HE2  4  
ATOM 3580  H HH   . TYR A 1 22 ? 9.267   -10.087 -4.465  1.00 0.00 ? 22 TYR A HH   4  
ATOM 3581  N N    . PHE A 1 23 ? 3.657   -4.492  -7.683  1.00 0.00 ? 23 PHE A N    4  
ATOM 3582  C CA   . PHE A 1 23 ? 2.523   -3.582  -7.745  1.00 0.00 ? 23 PHE A CA   4  
ATOM 3583  C C    . PHE A 1 23 ? 2.813   -2.437  -8.707  1.00 0.00 ? 23 PHE A C    4  
ATOM 3584  O O    . PHE A 1 23 ? 1.958   -2.047  -9.501  1.00 0.00 ? 23 PHE A O    4  
ATOM 3585  C CB   . PHE A 1 23 ? 2.210   -3.025  -6.355  1.00 0.00 ? 23 PHE A CB   4  
ATOM 3586  C CG   . PHE A 1 23 ? 1.182   -3.822  -5.604  1.00 0.00 ? 23 PHE A CG   4  
ATOM 3587  C CD1  . PHE A 1 23 ? 1.510   -5.044  -5.041  1.00 0.00 ? 23 PHE A CD1  4  
ATOM 3588  C CD2  . PHE A 1 23 ? -0.111  -3.346  -5.457  1.00 0.00 ? 23 PHE A CD2  4  
ATOM 3589  C CE1  . PHE A 1 23 ? 0.567   -5.779  -4.348  1.00 0.00 ? 23 PHE A CE1  4  
ATOM 3590  C CE2  . PHE A 1 23 ? -1.059  -4.077  -4.766  1.00 0.00 ? 23 PHE A CE2  4  
ATOM 3591  C CZ   . PHE A 1 23 ? -0.719  -5.294  -4.211  1.00 0.00 ? 23 PHE A CZ   4  
ATOM 3592  H H    . PHE A 1 23 ? 4.303   -4.400  -6.952  1.00 0.00 ? 23 PHE A H    4  
ATOM 3593  H HA   . PHE A 1 23 ? 1.669   -4.136  -8.106  1.00 0.00 ? 23 PHE A HA   4  
ATOM 3594  H HB2  . PHE A 1 23 ? 3.116   -3.015  -5.767  1.00 0.00 ? 23 PHE A HB2  4  
ATOM 3595  H HB3  . PHE A 1 23 ? 1.840   -2.016  -6.455  1.00 0.00 ? 23 PHE A HB3  4  
ATOM 3596  H HD1  . PHE A 1 23 ? 2.515   -5.423  -5.148  1.00 0.00 ? 23 PHE A HD1  4  
ATOM 3597  H HD2  . PHE A 1 23 ? -0.379  -2.394  -5.893  1.00 0.00 ? 23 PHE A HD2  4  
ATOM 3598  H HE1  . PHE A 1 23 ? 0.835   -6.731  -3.915  1.00 0.00 ? 23 PHE A HE1  4  
ATOM 3599  H HE2  . PHE A 1 23 ? -2.065  -3.696  -4.661  1.00 0.00 ? 23 PHE A HE2  4  
ATOM 3600  H HZ   . PHE A 1 23 ? -1.458  -5.867  -3.669  1.00 0.00 ? 23 PHE A HZ   4  
ATOM 3601  N N    . THR A 1 24 ? 4.032   -1.910  -8.636  1.00 0.00 ? 24 THR A N    4  
ATOM 3602  C CA   . THR A 1 24 ? 4.439   -0.814  -9.507  1.00 0.00 ? 24 THR A CA   4  
ATOM 3603  C C    . THR A 1 24 ? 4.183   -1.157  -10.970 1.00 0.00 ? 24 THR A C    4  
ATOM 3604  O O    . THR A 1 24 ? 3.930   -0.275  -11.791 1.00 0.00 ? 24 THR A O    4  
ATOM 3605  C CB   . THR A 1 24 ? 5.921   -0.494  -9.302  1.00 0.00 ? 24 THR A CB   4  
ATOM 3606  O OG1  . THR A 1 24 ? 6.689   -1.685  -9.261  1.00 0.00 ? 24 THR A OG1  4  
ATOM 3607  C CG2  . THR A 1 24 ? 6.195   0.276   -8.031  1.00 0.00 ? 24 THR A CG2  4  
ATOM 3608  H H    . THR A 1 24 ? 4.675   -2.267  -7.978  1.00 0.00 ? 24 THR A H    4  
ATOM 3609  H HA   . THR A 1 24 ? 3.852   0.053   -9.244  1.00 0.00 ? 24 THR A HA   4  
ATOM 3610  H HB   . THR A 1 24 ? 6.267   0.105   -10.131 1.00 0.00 ? 24 THR A HB   4  
ATOM 3611  H HG1  . THR A 1 24 ? 6.763   -2.048  -10.146 1.00 0.00 ? 24 THR A HG1  4  
ATOM 3612  H HG21 . THR A 1 24 ? 6.112   1.335   -8.227  1.00 0.00 ? 24 THR A HG21 4  
ATOM 3613  H HG22 . THR A 1 24 ? 7.192   0.051   -7.682  1.00 0.00 ? 24 THR A HG22 4  
ATOM 3614  H HG23 . THR A 1 24 ? 5.476   -0.008  -7.277  1.00 0.00 ? 24 THR A HG23 4  
ATOM 3615  N N    . SER A 1 25 ? 4.249   -2.445  -11.289 1.00 0.00 ? 25 SER A N    4  
ATOM 3616  C CA   . SER A 1 25 ? 4.032   -2.911  -12.654 1.00 0.00 ? 25 SER A CA   4  
ATOM 3617  C C    . SER A 1 25 ? 2.760   -2.313  -13.247 1.00 0.00 ? 25 SER A C    4  
ATOM 3618  O O    . SER A 1 25 ? 2.642   -2.163  -14.463 1.00 0.00 ? 25 SER A O    4  
ATOM 3619  C CB   . SER A 1 25 ? 3.949   -4.438  -12.685 1.00 0.00 ? 25 SER A CB   4  
ATOM 3620  O OG   . SER A 1 25 ? 4.510   -4.956  -13.879 1.00 0.00 ? 25 SER A OG   4  
ATOM 3621  H H    . SER A 1 25 ? 4.458   -3.098  -10.589 1.00 0.00 ? 25 SER A H    4  
ATOM 3622  H HA   . SER A 1 25 ? 4.876   -2.592  -13.249 1.00 0.00 ? 25 SER A HA   4  
ATOM 3623  H HB2  . SER A 1 25 ? 4.490   -4.843  -11.842 1.00 0.00 ? 25 SER A HB2  4  
ATOM 3624  H HB3  . SER A 1 25 ? 2.914   -4.741  -12.628 1.00 0.00 ? 25 SER A HB3  4  
ATOM 3625  H HG   . SER A 1 25 ? 3.807   -5.192  -14.487 1.00 0.00 ? 25 SER A HG   4  
ATOM 3626  N N    . GLN A 1 26 ? 1.808   -1.978  -12.382 1.00 0.00 ? 26 GLN A N    4  
ATOM 3627  C CA   . GLN A 1 26 ? 0.541   -1.404  -12.826 1.00 0.00 ? 26 GLN A CA   4  
ATOM 3628  C C    . GLN A 1 26 ? 0.539   0.111   -12.655 1.00 0.00 ? 26 GLN A C    4  
ATOM 3629  O O    . GLN A 1 26 ? 0.349   0.854   -13.618 1.00 0.00 ? 26 GLN A O    4  
ATOM 3630  C CB   . GLN A 1 26 ? -0.627  -2.015  -12.044 1.00 0.00 ? 26 GLN A CB   4  
ATOM 3631  C CG   . GLN A 1 26 ? -0.400  -3.460  -11.630 1.00 0.00 ? 26 GLN A CG   4  
ATOM 3632  C CD   . GLN A 1 26 ? -0.153  -4.376  -12.812 1.00 0.00 ? 26 GLN A CD   4  
ATOM 3633  O OE1  . GLN A 1 26 ? -0.280  -3.967  -13.967 1.00 0.00 ? 26 GLN A OE1  4  
ATOM 3634  N NE2  . GLN A 1 26 ? 0.203   -5.622  -12.528 1.00 0.00 ? 26 GLN A NE2  4  
ATOM 3635  H H    . GLN A 1 26 ? 1.958   -2.123  -11.425 1.00 0.00 ? 26 GLN A H    4  
ATOM 3636  H HA   . GLN A 1 26 ? 0.423   -1.637  -13.874 1.00 0.00 ? 26 GLN A HA   4  
ATOM 3637  H HB2  . GLN A 1 26 ? -0.793  -1.429  -11.152 1.00 0.00 ? 26 GLN A HB2  4  
ATOM 3638  H HB3  . GLN A 1 26 ? -1.514  -1.975  -12.660 1.00 0.00 ? 26 GLN A HB3  4  
ATOM 3639  H HG2  . GLN A 1 26 ? 0.459   -3.502  -10.976 1.00 0.00 ? 26 GLN A HG2  4  
ATOM 3640  H HG3  . GLN A 1 26 ? -1.273  -3.810  -11.100 1.00 0.00 ? 26 GLN A HG3  4  
ATOM 3641  H HE21 . GLN A 1 26 ? 0.285   -5.876  -11.585 1.00 0.00 ? 26 GLN A HE21 4  
ATOM 3642  H HE22 . GLN A 1 26 ? 0.369   -6.237  -13.271 1.00 0.00 ? 26 GLN A HE22 4  
ATOM 3643  N N    . GLY A 1 27 ? 0.747   0.562   -11.422 1.00 0.00 ? 27 GLY A N    4  
ATOM 3644  C CA   . GLY A 1 27 ? 0.762   1.985   -11.143 1.00 0.00 ? 27 GLY A CA   4  
ATOM 3645  C C    . GLY A 1 27 ? 0.709   2.284   -9.659  1.00 0.00 ? 27 GLY A C    4  
ATOM 3646  O O    . GLY A 1 27 ? -0.055  3.143   -9.219  1.00 0.00 ? 27 GLY A O    4  
ATOM 3647  H H    . GLY A 1 27 ? 0.892   -0.079  -10.694 1.00 0.00 ? 27 GLY A H    4  
ATOM 3648  H HA2  . GLY A 1 27 ? 1.665   2.413   -11.553 1.00 0.00 ? 27 GLY A HA2  4  
ATOM 3649  H HA3  . GLY A 1 27 ? -0.090  2.444   -11.623 1.00 0.00 ? 27 GLY A HA3  4  
ATOM 3650  N N    . LEU A 1 28 ? 1.536   1.586   -8.887  1.00 0.00 ? 28 LEU A N    4  
ATOM 3651  C CA   . LEU A 1 28 ? 1.574   1.773   -7.444  1.00 0.00 ? 28 LEU A CA   4  
ATOM 3652  C C    . LEU A 1 28 ? 2.735   2.673   -7.038  1.00 0.00 ? 28 LEU A C    4  
ATOM 3653  O O    . LEU A 1 28 ? 3.392   2.438   -6.025  1.00 0.00 ? 28 LEU A O    4  
ATOM 3654  C CB   . LEU A 1 28 ? 1.690   0.419   -6.743  1.00 0.00 ? 28 LEU A CB   4  
ATOM 3655  C CG   . LEU A 1 28 ? 0.601   0.127   -5.709  1.00 0.00 ? 28 LEU A CG   4  
ATOM 3656  C CD1  . LEU A 1 28 ? 0.729   1.065   -4.521  1.00 0.00 ? 28 LEU A CD1  4  
ATOM 3657  C CD2  . LEU A 1 28 ? -0.782  0.237   -6.338  1.00 0.00 ? 28 LEU A CD2  4  
ATOM 3658  H H    . LEU A 1 28 ? 2.113   0.909   -9.294  1.00 0.00 ? 28 LEU A H    4  
ATOM 3659  H HA   . LEU A 1 28 ? 0.651   2.248   -7.148  1.00 0.00 ? 28 LEU A HA   4  
ATOM 3660  H HB2  . LEU A 1 28 ? 1.660   -0.356  -7.494  1.00 0.00 ? 28 LEU A HB2  4  
ATOM 3661  H HB3  . LEU A 1 28 ? 2.648   0.376   -6.245  1.00 0.00 ? 28 LEU A HB3  4  
ATOM 3662  H HG   . LEU A 1 28 ? 0.722   -0.883  -5.350  1.00 0.00 ? 28 LEU A HG   4  
ATOM 3663  H HD11 . LEU A 1 28 ? -0.248  1.249   -4.098  1.00 0.00 ? 28 LEU A HD11 4  
ATOM 3664  H HD12 . LEU A 1 28 ? 1.163   1.999   -4.845  1.00 0.00 ? 28 LEU A HD12 4  
ATOM 3665  H HD13 . LEU A 1 28 ? 1.365   0.615   -3.773  1.00 0.00 ? 28 LEU A HD13 4  
ATOM 3666  H HD21 . LEU A 1 28 ? -0.870  -0.479  -7.141  1.00 0.00 ? 28 LEU A HD21 4  
ATOM 3667  H HD22 . LEU A 1 28 ? -0.926  1.234   -6.728  1.00 0.00 ? 28 LEU A HD22 4  
ATOM 3668  H HD23 . LEU A 1 28 ? -1.533  0.033   -5.590  1.00 0.00 ? 28 LEU A HD23 4  
ATOM 3669  N N    . GLN A 1 29 ? 2.971   3.714   -7.829  1.00 0.00 ? 29 GLN A N    4  
ATOM 3670  C CA   . GLN A 1 29 ? 4.030   4.672   -7.535  1.00 0.00 ? 29 GLN A CA   4  
ATOM 3671  C C    . GLN A 1 29 ? 3.444   5.915   -6.878  1.00 0.00 ? 29 GLN A C    4  
ATOM 3672  O O    . GLN A 1 29 ? 4.101   6.579   -6.075  1.00 0.00 ? 29 GLN A O    4  
ATOM 3673  C CB   . GLN A 1 29 ? 4.777   5.053   -8.816  1.00 0.00 ? 29 GLN A CB   4  
ATOM 3674  C CG   . GLN A 1 29 ? 3.889   5.695   -9.870  1.00 0.00 ? 29 GLN A CG   4  
ATOM 3675  C CD   . GLN A 1 29 ? 4.205   7.162   -10.081 1.00 0.00 ? 29 GLN A CD   4  
ATOM 3676  O OE1  . GLN A 1 29 ? 4.940   7.770   -9.302  1.00 0.00 ? 29 GLN A OE1  4  
ATOM 3677  N NE2  . GLN A 1 29 ? 3.649   7.740   -11.140 1.00 0.00 ? 29 GLN A NE2  4  
ATOM 3678  H H    . GLN A 1 29 ? 2.402   3.857   -8.614  1.00 0.00 ? 29 GLN A H    4  
ATOM 3679  H HA   . GLN A 1 29 ? 4.720   4.205   -6.849  1.00 0.00 ? 29 GLN A HA   4  
ATOM 3680  H HB2  . GLN A 1 29 ? 5.563   5.749   -8.566  1.00 0.00 ? 29 GLN A HB2  4  
ATOM 3681  H HB3  . GLN A 1 29 ? 5.217   4.163   -9.241  1.00 0.00 ? 29 GLN A HB3  4  
ATOM 3682  H HG2  . GLN A 1 29 ? 4.030   5.174   -10.806 1.00 0.00 ? 29 GLN A HG2  4  
ATOM 3683  H HG3  . GLN A 1 29 ? 2.860   5.604   -9.559  1.00 0.00 ? 29 GLN A HG3  4  
ATOM 3684  H HE21 . GLN A 1 29 ? 3.076   7.195   -11.716 1.00 0.00 ? 29 GLN A HE21 4  
ATOM 3685  H HE22 . GLN A 1 29 ? 3.837   8.689   -11.301 1.00 0.00 ? 29 GLN A HE22 4  
ATOM 3686  N N    . SER A 1 30 ? 2.190   6.208   -7.210  1.00 0.00 ? 30 SER A N    4  
ATOM 3687  C CA   . SER A 1 30 ? 1.483   7.343   -6.633  1.00 0.00 ? 30 SER A CA   4  
ATOM 3688  C C    . SER A 1 30 ? 0.292   6.860   -5.818  1.00 0.00 ? 30 SER A C    4  
ATOM 3689  O O    . SER A 1 30 ? -0.641  6.272   -6.363  1.00 0.00 ? 30 SER A O    4  
ATOM 3690  C CB   . SER A 1 30 ? 1.013   8.297   -7.732  1.00 0.00 ? 30 SER A CB   4  
ATOM 3691  O OG   . SER A 1 30 ? 0.458   7.583   -8.823  1.00 0.00 ? 30 SER A OG   4  
ATOM 3692  H H    . SER A 1 30 ? 1.719   5.627   -7.844  1.00 0.00 ? 30 SER A H    4  
ATOM 3693  H HA   . SER A 1 30 ? 2.162   7.864   -5.979  1.00 0.00 ? 30 SER A HA   4  
ATOM 3694  H HB2  . SER A 1 30 ? 0.261   8.961   -7.334  1.00 0.00 ? 30 SER A HB2  4  
ATOM 3695  H HB3  . SER A 1 30 ? 1.853   8.875   -8.089  1.00 0.00 ? 30 SER A HB3  4  
ATOM 3696  H HG   . SER A 1 30 ? -0.188  6.951   -8.496  1.00 0.00 ? 30 SER A HG   4  
ATOM 3697  N N    . ILE A 1 31 ? 0.329   7.100   -4.510  1.00 0.00 ? 31 ILE A N    4  
ATOM 3698  C CA   . ILE A 1 31 ? -0.747  6.659   -3.627  1.00 0.00 ? 31 ILE A CA   4  
ATOM 3699  C C    . ILE A 1 31 ? -2.115  7.033   -4.199  1.00 0.00 ? 31 ILE A C    4  
ATOM 3700  O O    . ILE A 1 31 ? -3.118  6.371   -3.929  1.00 0.00 ? 31 ILE A O    4  
ATOM 3701  C CB   . ILE A 1 31 ? -0.588  7.219   -2.197  1.00 0.00 ? 31 ILE A CB   4  
ATOM 3702  C CG1  . ILE A 1 31 ? -1.378  6.355   -1.211  1.00 0.00 ? 31 ILE A CG1  4  
ATOM 3703  C CG2  . ILE A 1 31 ? -1.031  8.674   -2.114  1.00 0.00 ? 31 ILE A CG2  4  
ATOM 3704  C CD1  . ILE A 1 31 ? -0.506  5.644   -0.199  1.00 0.00 ? 31 ILE A CD1  4  
ATOM 3705  H H    . ILE A 1 31 ? 1.104   7.562   -4.127  1.00 0.00 ? 31 ILE A H    4  
ATOM 3706  H HA   . ILE A 1 31 ? -0.687  5.586   -3.561  1.00 0.00 ? 31 ILE A HA   4  
ATOM 3707  H HB   . ILE A 1 31 ? 0.460   7.178   -1.937  1.00 0.00 ? 31 ILE A HB   4  
ATOM 3708  H HG12 . ILE A 1 31 ? -2.074  6.978   -0.671  1.00 0.00 ? 31 ILE A HG12 4  
ATOM 3709  H HG13 . ILE A 1 31 ? -1.925  5.602   -1.761  1.00 0.00 ? 31 ILE A HG13 4  
ATOM 3710  H HG21 . ILE A 1 31 ? -0.492  9.256   -2.846  1.00 0.00 ? 31 ILE A HG21 4  
ATOM 3711  H HG22 . ILE A 1 31 ? -0.828  9.057   -1.127  1.00 0.00 ? 31 ILE A HG22 4  
ATOM 3712  H HG23 . ILE A 1 31 ? -2.091  8.736   -2.315  1.00 0.00 ? 31 ILE A HG23 4  
ATOM 3713  H HD11 . ILE A 1 31 ? -0.974  4.713   0.087   1.00 0.00 ? 31 ILE A HD11 4  
ATOM 3714  H HD12 . ILE A 1 31 ? -0.384  6.269   0.672   1.00 0.00 ? 31 ILE A HD12 4  
ATOM 3715  H HD13 . ILE A 1 31 ? 0.460   5.441   -0.636  1.00 0.00 ? 31 ILE A HD13 4  
ATOM 3716  N N    . TYR A 1 32 ? -2.145  8.091   -5.003  1.00 0.00 ? 32 TYR A N    4  
ATOM 3717  C CA   . TYR A 1 32 ? -3.379  8.529   -5.638  1.00 0.00 ? 32 TYR A CA   4  
ATOM 3718  C C    . TYR A 1 32 ? -3.949  7.423   -6.526  1.00 0.00 ? 32 TYR A C    4  
ATOM 3719  O O    . TYR A 1 32 ? -5.131  7.438   -6.867  1.00 0.00 ? 32 TYR A O    4  
ATOM 3720  C CB   . TYR A 1 32 ? -3.131  9.791   -6.467  1.00 0.00 ? 32 TYR A CB   4  
ATOM 3721  C CG   . TYR A 1 32 ? -2.546  10.935  -5.671  1.00 0.00 ? 32 TYR A CG   4  
ATOM 3722  C CD1  . TYR A 1 32 ? -2.949  11.173  -4.362  1.00 0.00 ? 32 TYR A CD1  4  
ATOM 3723  C CD2  . TYR A 1 32 ? -1.591  11.778  -6.227  1.00 0.00 ? 32 TYR A CD2  4  
ATOM 3724  C CE1  . TYR A 1 32 ? -2.416  12.217  -3.630  1.00 0.00 ? 32 TYR A CE1  4  
ATOM 3725  C CE2  . TYR A 1 32 ? -1.054  12.825  -5.500  1.00 0.00 ? 32 TYR A CE2  4  
ATOM 3726  C CZ   . TYR A 1 32 ? -1.469  13.040  -4.205  1.00 0.00 ? 32 TYR A CZ   4  
ATOM 3727  O OH   . TYR A 1 32 ? -0.937  14.081  -3.479  1.00 0.00 ? 32 TYR A OH   4  
ATOM 3728  H H    . TYR A 1 32 ? -1.313  8.572   -5.192  1.00 0.00 ? 32 TYR A H    4  
ATOM 3729  H HA   . TYR A 1 32 ? -4.091  8.752   -4.859  1.00 0.00 ? 32 TYR A HA   4  
ATOM 3730  H HB2  . TYR A 1 32 ? -2.446  9.559   -7.268  1.00 0.00 ? 32 TYR A HB2  4  
ATOM 3731  H HB3  . TYR A 1 32 ? -4.068  10.125  -6.889  1.00 0.00 ? 32 TYR A HB3  4  
ATOM 3732  H HD1  . TYR A 1 32 ? -3.690  10.528  -3.916  1.00 0.00 ? 32 TYR A HD1  4  
ATOM 3733  H HD2  . TYR A 1 32 ? -1.268  11.606  -7.243  1.00 0.00 ? 32 TYR A HD2  4  
ATOM 3734  H HE1  . TYR A 1 32 ? -2.742  12.386  -2.615  1.00 0.00 ? 32 TYR A HE1  4  
ATOM 3735  H HE2  . TYR A 1 32 ? -0.312  13.469  -5.950  1.00 0.00 ? 32 TYR A HE2  4  
ATOM 3736  H HH   . TYR A 1 32 ? -1.011  13.889  -2.542  1.00 0.00 ? 32 TYR A HH   4  
ATOM 3737  N N    . HIS A 1 33 ? -3.100  6.465   -6.899  1.00 0.00 ? 33 HIS A N    4  
ATOM 3738  C CA   . HIS A 1 33 ? -3.527  5.351   -7.737  1.00 0.00 ? 33 HIS A CA   4  
ATOM 3739  C C    . HIS A 1 33 ? -4.124  4.238   -6.884  1.00 0.00 ? 33 HIS A C    4  
ATOM 3740  O O    . HIS A 1 33 ? -5.005  3.503   -7.331  1.00 0.00 ? 33 HIS A O    4  
ATOM 3741  C CB   . HIS A 1 33 ? -2.348  4.813   -8.548  1.00 0.00 ? 33 HIS A CB   4  
ATOM 3742  C CG   . HIS A 1 33 ? -2.261  5.384   -9.930  1.00 0.00 ? 33 HIS A CG   4  
ATOM 3743  N ND1  . HIS A 1 33 ? -1.098  5.392   -10.670 1.00 0.00 ? 33 HIS A ND1  4  
ATOM 3744  C CD2  . HIS A 1 33 ? -3.203  5.971   -10.706 1.00 0.00 ? 33 HIS A CD2  4  
ATOM 3745  C CE1  . HIS A 1 33 ? -1.327  5.958   -11.842 1.00 0.00 ? 33 HIS A CE1  4  
ATOM 3746  N NE2  . HIS A 1 33 ? -2.596  6.318   -11.888 1.00 0.00 ? 33 HIS A NE2  4  
ATOM 3747  H H    . HIS A 1 33 ? -2.170  6.498   -6.591  1.00 0.00 ? 33 HIS A H    4  
ATOM 3748  H HA   . HIS A 1 33 ? -4.285  5.716   -8.414  1.00 0.00 ? 33 HIS A HA   4  
ATOM 3749  H HB2  . HIS A 1 33 ? -1.428  5.048   -8.034  1.00 0.00 ? 33 HIS A HB2  4  
ATOM 3750  H HB3  . HIS A 1 33 ? -2.440  3.740   -8.638  1.00 0.00 ? 33 HIS A HB3  4  
ATOM 3751  H HD1  . HIS A 1 33 ? -0.232  5.034   -10.381 1.00 0.00 ? 33 HIS A HD1  4  
ATOM 3752  H HD2  . HIS A 1 33 ? -4.238  6.136   -10.444 1.00 0.00 ? 33 HIS A HD2  4  
ATOM 3753  H HE1  . HIS A 1 33 ? -0.601  6.101   -12.628 1.00 0.00 ? 33 HIS A HE1  4  
ATOM 3754  H HE2  . HIS A 1 33 ? -3.032  6.762   -12.645 1.00 0.00 ? 33 HIS A HE2  4  
ATOM 3755  N N    . LEU A 1 34 ? -3.639  4.120   -5.653  1.00 0.00 ? 34 LEU A N    4  
ATOM 3756  C CA   . LEU A 1 34 ? -4.143  3.114   -4.727  1.00 0.00 ? 34 LEU A CA   4  
ATOM 3757  C C    . LEU A 1 34 ? -5.157  3.724   -3.766  1.00 0.00 ? 34 LEU A C    4  
ATOM 3758  O O    . LEU A 1 34 ? -5.382  3.213   -2.671  1.00 0.00 ? 34 LEU A O    4  
ATOM 3759  C CB   . LEU A 1 34 ? -2.993  2.491   -3.944  1.00 0.00 ? 34 LEU A CB   4  
ATOM 3760  C CG   . LEU A 1 34 ? -1.846  3.446   -3.612  1.00 0.00 ? 34 LEU A CG   4  
ATOM 3761  C CD1  . LEU A 1 34 ? -1.152  3.017   -2.330  1.00 0.00 ? 34 LEU A CD1  4  
ATOM 3762  C CD2  . LEU A 1 34 ? -0.853  3.506   -4.763  1.00 0.00 ? 34 LEU A CD2  4  
ATOM 3763  H H    . LEU A 1 34 ? -2.950  4.746   -5.348  1.00 0.00 ? 34 LEU A H    4  
ATOM 3764  H HA   . LEU A 1 34 ? -4.629  2.349   -5.309  1.00 0.00 ? 34 LEU A HA   4  
ATOM 3765  H HB2  . LEU A 1 34 ? -3.385  2.095   -3.019  1.00 0.00 ? 34 LEU A HB2  4  
ATOM 3766  H HB3  . LEU A 1 34 ? -2.597  1.676   -4.526  1.00 0.00 ? 34 LEU A HB3  4  
ATOM 3767  H HG   . LEU A 1 34 ? -2.243  4.439   -3.459  1.00 0.00 ? 34 LEU A HG   4  
ATOM 3768  H HD11 . LEU A 1 34 ? -1.672  3.438   -1.481  1.00 0.00 ? 34 LEU A HD11 4  
ATOM 3769  H HD12 . LEU A 1 34 ? -0.132  3.370   -2.337  1.00 0.00 ? 34 LEU A HD12 4  
ATOM 3770  H HD13 . LEU A 1 34 ? -1.160  1.940   -2.259  1.00 0.00 ? 34 LEU A HD13 4  
ATOM 3771  H HD21 . LEU A 1 34 ? -0.944  2.615   -5.365  1.00 0.00 ? 34 LEU A HD21 4  
ATOM 3772  H HD22 . LEU A 1 34 ? 0.150   3.575   -4.369  1.00 0.00 ? 34 LEU A HD22 4  
ATOM 3773  H HD23 . LEU A 1 34 ? -1.058  4.373   -5.373  1.00 0.00 ? 34 LEU A HD23 4  
ATOM 3774  N N    . GLN A 1 35 ? -5.758  4.821   -4.193  1.00 0.00 ? 35 GLN A N    4  
ATOM 3775  C CA   . GLN A 1 35 ? -6.742  5.534   -3.392  1.00 0.00 ? 35 GLN A CA   4  
ATOM 3776  C C    . GLN A 1 35 ? -8.015  4.728   -3.224  1.00 0.00 ? 35 GLN A C    4  
ATOM 3777  O O    . GLN A 1 35 ? -8.671  4.776   -2.184  1.00 0.00 ? 35 GLN A O    4  
ATOM 3778  C CB   . GLN A 1 35 ? -7.083  6.853   -4.079  1.00 0.00 ? 35 GLN A CB   4  
ATOM 3779  C CG   . GLN A 1 35 ? -6.150  7.985   -3.715  1.00 0.00 ? 35 GLN A CG   4  
ATOM 3780  C CD   . GLN A 1 35 ? -6.682  8.845   -2.586  1.00 0.00 ? 35 GLN A CD   4  
ATOM 3781  O OE1  . GLN A 1 35 ? -7.074  9.992   -2.796  1.00 0.00 ? 35 GLN A OE1  4  
ATOM 3782  N NE2  . GLN A 1 35 ? -6.696  8.294   -1.378  1.00 0.00 ? 35 GLN A NE2  4  
ATOM 3783  H H    . GLN A 1 35 ? -5.526  5.173   -5.074  1.00 0.00 ? 35 GLN A H    4  
ATOM 3784  H HA   . GLN A 1 35 ? -6.314  5.727   -2.423  1.00 0.00 ? 35 GLN A HA   4  
ATOM 3785  H HB2  . GLN A 1 35 ? -7.028  6.707   -5.148  1.00 0.00 ? 35 GLN A HB2  4  
ATOM 3786  H HB3  . GLN A 1 35 ? -8.092  7.137   -3.813  1.00 0.00 ? 35 GLN A HB3  4  
ATOM 3787  H HG2  . GLN A 1 35 ? -5.204  7.563   -3.417  1.00 0.00 ? 35 GLN A HG2  4  
ATOM 3788  H HG3  . GLN A 1 35 ? -6.010  8.603   -4.587  1.00 0.00 ? 35 GLN A HG3  4  
ATOM 3789  H HE21 . GLN A 1 35 ? -6.367  7.375   -1.284  1.00 0.00 ? 35 GLN A HE21 4  
ATOM 3790  H HE22 . GLN A 1 35 ? -7.034  8.828   -0.629  1.00 0.00 ? 35 GLN A HE22 4  
ATOM 3791  N N    . ASN A 1 36 ? -8.384  4.043   -4.287  1.00 0.00 ? 36 ASN A N    4  
ATOM 3792  C CA   . ASN A 1 36 ? -9.617  3.271   -4.319  1.00 0.00 ? 36 ASN A CA   4  
ATOM 3793  C C    . ASN A 1 36 ? -9.342  1.776   -4.390  1.00 0.00 ? 36 ASN A C    4  
ATOM 3794  O O    . ASN A 1 36 ? -10.211 0.957   -4.089  1.00 0.00 ? 36 ASN A O    4  
ATOM 3795  C CB   . ASN A 1 36 ? -10.449 3.705   -5.520  1.00 0.00 ? 36 ASN A CB   4  
ATOM 3796  C CG   . ASN A 1 36 ? -9.606  3.923   -6.753  1.00 0.00 ? 36 ASN A CG   4  
ATOM 3797  O OD1  . ASN A 1 36 ? -9.539  3.074   -7.643  1.00 0.00 ? 36 ASN A OD1  4  
ATOM 3798  N ND2  . ASN A 1 36 ? -8.954  5.072   -6.799  1.00 0.00 ? 36 ASN A ND2  4  
ATOM 3799  H H    . ASN A 1 36 ? -7.820  4.079   -5.087  1.00 0.00 ? 36 ASN A H    4  
ATOM 3800  H HA   . ASN A 1 36 ? -10.165 3.483   -3.415  1.00 0.00 ? 36 ASN A HA   4  
ATOM 3801  H HB2  . ASN A 1 36 ? -11.193 2.958   -5.735  1.00 0.00 ? 36 ASN A HB2  4  
ATOM 3802  H HB3  . ASN A 1 36 ? -10.927 4.634   -5.283  1.00 0.00 ? 36 ASN A HB3  4  
ATOM 3803  H HD21 . ASN A 1 36 ? -9.063  5.690   -6.047  1.00 0.00 ? 36 ASN A HD21 4  
ATOM 3804  H HD22 . ASN A 1 36 ? -8.392  5.255   -7.572  1.00 0.00 ? 36 ASN A HD22 4  
ATOM 3805  N N    . LEU A 1 37 ? -8.126  1.428   -4.782  1.00 0.00 ? 37 LEU A N    4  
ATOM 3806  C CA   . LEU A 1 37 ? -7.723  0.028   -4.904  1.00 0.00 ? 37 LEU A CA   4  
ATOM 3807  C C    . LEU A 1 37 ? -8.181  -0.789  -3.696  1.00 0.00 ? 37 LEU A C    4  
ATOM 3808  O O    . LEU A 1 37 ? -8.274  -0.273  -2.583  1.00 0.00 ? 37 LEU A O    4  
ATOM 3809  C CB   . LEU A 1 37 ? -6.204  -0.063  -5.045  1.00 0.00 ? 37 LEU A CB   4  
ATOM 3810  C CG   . LEU A 1 37 ? -5.705  -0.551  -6.406  1.00 0.00 ? 37 LEU A CG   4  
ATOM 3811  C CD1  . LEU A 1 37 ? -4.285  -0.068  -6.656  1.00 0.00 ? 37 LEU A CD1  4  
ATOM 3812  C CD2  . LEU A 1 37 ? -5.778  -2.069  -6.489  1.00 0.00 ? 37 LEU A CD2  4  
ATOM 3813  H H    . LEU A 1 37 ? -7.484  2.132   -5.013  1.00 0.00 ? 37 LEU A H    4  
ATOM 3814  H HA   . LEU A 1 37 ? -8.186  -0.373  -5.793  1.00 0.00 ? 37 LEU A HA   4  
ATOM 3815  H HB2  . LEU A 1 37 ? -5.792  0.916   -4.866  1.00 0.00 ? 37 LEU A HB2  4  
ATOM 3816  H HB3  . LEU A 1 37 ? -5.831  -0.731  -4.287  1.00 0.00 ? 37 LEU A HB3  4  
ATOM 3817  H HG   . LEU A 1 37 ? -6.336  -0.144  -7.182  1.00 0.00 ? 37 LEU A HG   4  
ATOM 3818  H HD11 . LEU A 1 37 ? -3.938  -0.447  -7.606  1.00 0.00 ? 37 LEU A HD11 4  
ATOM 3819  H HD12 . LEU A 1 37 ? -3.639  -0.426  -5.867  1.00 0.00 ? 37 LEU A HD12 4  
ATOM 3820  H HD13 . LEU A 1 37 ? -4.270  1.011   -6.672  1.00 0.00 ? 37 LEU A HD13 4  
ATOM 3821  H HD21 . LEU A 1 37 ? -5.984  -2.364  -7.506  1.00 0.00 ? 37 LEU A HD21 4  
ATOM 3822  H HD22 . LEU A 1 37 ? -6.567  -2.426  -5.843  1.00 0.00 ? 37 LEU A HD22 4  
ATOM 3823  H HD23 . LEU A 1 37 ? -4.836  -2.492  -6.172  1.00 0.00 ? 37 LEU A HD23 4  
ATOM 3824  N N    . THR A 1 38 ? -8.468  -2.067  -3.929  1.00 0.00 ? 38 THR A N    4  
ATOM 3825  C CA   . THR A 1 38 ? -8.917  -2.957  -2.865  1.00 0.00 ? 38 THR A CA   4  
ATOM 3826  C C    . THR A 1 38 ? -8.294  -4.337  -3.006  1.00 0.00 ? 38 THR A C    4  
ATOM 3827  O O    . THR A 1 38 ? -7.648  -4.640  -4.008  1.00 0.00 ? 38 THR A O    4  
ATOM 3828  C CB   . THR A 1 38 ? -10.441 -3.096  -2.896  1.00 0.00 ? 38 THR A CB   4  
ATOM 3829  O OG1  . THR A 1 38 ? -11.004 -2.241  -3.876  1.00 0.00 ? 38 THR A OG1  4  
ATOM 3830  C CG2  . THR A 1 38 ? -11.097 -2.775  -1.572  1.00 0.00 ? 38 THR A CG2  4  
ATOM 3831  H H    . THR A 1 38 ? -8.374  -2.419  -4.840  1.00 0.00 ? 38 THR A H    4  
ATOM 3832  H HA   . THR A 1 38 ? -8.616  -2.529  -1.920  1.00 0.00 ? 38 THR A HA   4  
ATOM 3833  H HB   . THR A 1 38 ? -10.695 -4.119  -3.148  1.00 0.00 ? 38 THR A HB   4  
ATOM 3834  H HG1  . THR A 1 38 ? -11.274 -2.761  -4.637  1.00 0.00 ? 38 THR A HG1  4  
ATOM 3835  H HG21 . THR A 1 38 ? -11.988 -2.190  -1.744  1.00 0.00 ? 38 THR A HG21 4  
ATOM 3836  H HG22 . THR A 1 38 ? -10.410 -2.213  -0.958  1.00 0.00 ? 38 THR A HG22 4  
ATOM 3837  H HG23 . THR A 1 38 ? -11.361 -3.693  -1.070  1.00 0.00 ? 38 THR A HG23 4  
ATOM 3838  N N    . ILE A 1 39 ? -8.536  -5.186  -2.013  1.00 0.00 ? 39 ILE A N    4  
ATOM 3839  C CA   . ILE A 1 39 ? -8.062  -6.557  -2.065  1.00 0.00 ? 39 ILE A CA   4  
ATOM 3840  C C    . ILE A 1 39 ? -8.603  -7.230  -3.313  1.00 0.00 ? 39 ILE A C    4  
ATOM 3841  O O    . ILE A 1 39 ? -7.937  -8.059  -3.935  1.00 0.00 ? 39 ILE A O    4  
ATOM 3842  C CB   . ILE A 1 39 ? -8.504  -7.353  -0.824  1.00 0.00 ? 39 ILE A CB   4  
ATOM 3843  C CG1  . ILE A 1 39 ? -7.861  -8.742  -0.824  1.00 0.00 ? 39 ILE A CG1  4  
ATOM 3844  C CG2  . ILE A 1 39 ? -10.020 -7.468  -0.773  1.00 0.00 ? 39 ILE A CG2  4  
ATOM 3845  C CD1  . ILE A 1 39 ? -6.355  -8.713  -0.963  1.00 0.00 ? 39 ILE A CD1  4  
ATOM 3846  H H    . ILE A 1 39 ? -9.088  -4.898  -1.258  1.00 0.00 ? 39 ILE A H    4  
ATOM 3847  H HA   . ILE A 1 39 ? -6.985  -6.545  -2.103  1.00 0.00 ? 39 ILE A HA   4  
ATOM 3848  H HB   . ILE A 1 39 ? -8.182  -6.813  0.049   1.00 0.00 ? 39 ILE A HB   4  
ATOM 3849  H HG12 . ILE A 1 39 ? -8.098  -9.241  0.104   1.00 0.00 ? 39 ILE A HG12 4  
ATOM 3850  H HG13 . ILE A 1 39 ? -8.259  -9.315  -1.648  1.00 0.00 ? 39 ILE A HG13 4  
ATOM 3851  H HG21 . ILE A 1 39 ? -10.370 -7.999  -1.646  1.00 0.00 ? 39 ILE A HG21 4  
ATOM 3852  H HG22 . ILE A 1 39 ? -10.455 -6.478  -0.754  1.00 0.00 ? 39 ILE A HG22 4  
ATOM 3853  H HG23 . ILE A 1 39 ? -10.311 -8.006  0.116   1.00 0.00 ? 39 ILE A HG23 4  
ATOM 3854  H HD11 . ILE A 1 39 ? -5.934  -8.093  -0.186  1.00 0.00 ? 39 ILE A HD11 4  
ATOM 3855  H HD12 . ILE A 1 39 ? -6.091  -8.309  -1.929  1.00 0.00 ? 39 ILE A HD12 4  
ATOM 3856  H HD13 . ILE A 1 39 ? -5.966  -9.717  -0.874  1.00 0.00 ? 39 ILE A HD13 4  
ATOM 3857  N N    . GLU A 1 40 ? -9.813  -6.834  -3.685  1.00 0.00 ? 40 GLU A N    4  
ATOM 3858  C CA   . GLU A 1 40 ? -10.462 -7.357  -4.876  1.00 0.00 ? 40 GLU A CA   4  
ATOM 3859  C C    . GLU A 1 40 ? -9.577  -7.144  -6.098  1.00 0.00 ? 40 GLU A C    4  
ATOM 3860  O O    . GLU A 1 40 ? -9.392  -8.051  -6.910  1.00 0.00 ? 40 GLU A O    4  
ATOM 3861  C CB   . GLU A 1 40 ? -11.814 -6.672  -5.087  1.00 0.00 ? 40 GLU A CB   4  
ATOM 3862  C CG   . GLU A 1 40 ? -12.757 -6.811  -3.904  1.00 0.00 ? 40 GLU A CG   4  
ATOM 3863  C CD   . GLU A 1 40 ? -14.043 -7.531  -4.262  1.00 0.00 ? 40 GLU A CD   4  
ATOM 3864  O OE1  . GLU A 1 40 ? -14.835 -6.973  -5.049  1.00 0.00 ? 40 GLU A OE1  4  
ATOM 3865  O OE2  . GLU A 1 40 ? -14.257 -8.651  -3.755  1.00 0.00 ? 40 GLU A OE2  4  
ATOM 3866  H H    . GLU A 1 40 ? -10.277 -6.161  -3.144  1.00 0.00 ? 40 GLU A H    4  
ATOM 3867  H HA   . GLU A 1 40 ? -10.618 -8.412  -4.733  1.00 0.00 ? 40 GLU A HA   4  
ATOM 3868  H HB2  . GLU A 1 40 ? -11.647 -5.621  -5.266  1.00 0.00 ? 40 GLU A HB2  4  
ATOM 3869  H HB3  . GLU A 1 40 ? -12.291 -7.105  -5.954  1.00 0.00 ? 40 GLU A HB3  4  
ATOM 3870  H HG2  . GLU A 1 40 ? -12.256 -7.367  -3.125  1.00 0.00 ? 40 GLU A HG2  4  
ATOM 3871  H HG3  . GLU A 1 40 ? -13.005 -5.825  -3.540  1.00 0.00 ? 40 GLU A HG3  4  
ATOM 3872  N N    . ASP A 1 41 ? -9.024  -5.941  -6.213  1.00 0.00 ? 41 ASP A N    4  
ATOM 3873  C CA   . ASP A 1 41 ? -8.148  -5.604  -7.328  1.00 0.00 ? 41 ASP A CA   4  
ATOM 3874  C C    . ASP A 1 41 ? -6.717  -6.046  -7.045  1.00 0.00 ? 41 ASP A C    4  
ATOM 3875  O O    . ASP A 1 41 ? -5.975  -6.401  -7.960  1.00 0.00 ? 41 ASP A O    4  
ATOM 3876  C CB   . ASP A 1 41 ? -8.185  -4.099  -7.596  1.00 0.00 ? 41 ASP A CB   4  
ATOM 3877  C CG   . ASP A 1 41 ? -9.259  -3.716  -8.595  1.00 0.00 ? 41 ASP A CG   4  
ATOM 3878  O OD1  . ASP A 1 41 ? -10.452 -3.947  -8.302  1.00 0.00 ? 41 ASP A OD1  4  
ATOM 3879  O OD2  . ASP A 1 41 ? -8.909  -3.188  -9.672  1.00 0.00 ? 41 ASP A OD2  4  
ATOM 3880  H H    . ASP A 1 41 ? -9.211  -5.264  -5.528  1.00 0.00 ? 41 ASP A H    4  
ATOM 3881  H HA   . ASP A 1 41 ? -8.507  -6.127  -8.201  1.00 0.00 ? 41 ASP A HA   4  
ATOM 3882  H HB2  . ASP A 1 41 ? -8.378  -3.579  -6.671  1.00 0.00 ? 41 ASP A HB2  4  
ATOM 3883  H HB3  . ASP A 1 41 ? -7.228  -3.786  -7.988  1.00 0.00 ? 41 ASP A HB3  4  
ATOM 3884  N N    . LEU A 1 42 ? -6.335  -6.024  -5.771  1.00 0.00 ? 42 LEU A N    4  
ATOM 3885  C CA   . LEU A 1 42 ? -4.994  -6.434  -5.372  1.00 0.00 ? 42 LEU A CA   4  
ATOM 3886  C C    . LEU A 1 42 ? -4.691  -7.835  -5.888  1.00 0.00 ? 42 LEU A C    4  
ATOM 3887  O O    . LEU A 1 42 ? -3.619  -8.087  -6.438  1.00 0.00 ? 42 LEU A O    4  
ATOM 3888  C CB   . LEU A 1 42 ? -4.852  -6.396  -3.843  1.00 0.00 ? 42 LEU A CB   4  
ATOM 3889  C CG   . LEU A 1 42 ? -5.013  -5.022  -3.157  1.00 0.00 ? 42 LEU A CG   4  
ATOM 3890  C CD1  . LEU A 1 42 ? -3.938  -4.839  -2.099  1.00 0.00 ? 42 LEU A CD1  4  
ATOM 3891  C CD2  . LEU A 1 42 ? -4.969  -3.866  -4.154  1.00 0.00 ? 42 LEU A CD2  4  
ATOM 3892  H H    . LEU A 1 42 ? -6.972  -5.737  -5.087  1.00 0.00 ? 42 LEU A H    4  
ATOM 3893  H HA   . LEU A 1 42 ? -4.292  -5.741  -5.810  1.00 0.00 ? 42 LEU A HA   4  
ATOM 3894  H HB2  . LEU A 1 42 ? -5.589  -7.064  -3.424  1.00 0.00 ? 42 LEU A HB2  4  
ATOM 3895  H HB3  . LEU A 1 42 ? -3.873  -6.778  -3.592  1.00 0.00 ? 42 LEU A HB3  4  
ATOM 3896  H HG   . LEU A 1 42 ? -5.969  -4.990  -2.657  1.00 0.00 ? 42 LEU A HG   4  
ATOM 3897  H HD11 . LEU A 1 42 ? -2.965  -4.988  -2.544  1.00 0.00 ? 42 LEU A HD11 4  
ATOM 3898  H HD12 . LEU A 1 42 ? -4.087  -5.560  -1.309  1.00 0.00 ? 42 LEU A HD12 4  
ATOM 3899  H HD13 . LEU A 1 42 ? -4.000  -3.841  -1.692  1.00 0.00 ? 42 LEU A HD13 4  
ATOM 3900  H HD21 . LEU A 1 42 ? -4.009  -3.854  -4.649  1.00 0.00 ? 42 LEU A HD21 4  
ATOM 3901  H HD22 . LEU A 1 42 ? -5.116  -2.933  -3.631  1.00 0.00 ? 42 LEU A HD22 4  
ATOM 3902  H HD23 . LEU A 1 42 ? -5.751  -3.994  -4.888  1.00 0.00 ? 42 LEU A HD23 4  
ATOM 3903  N N    . GLY A 1 43 ? -5.649  -8.742  -5.717  1.00 0.00 ? 43 GLY A N    4  
ATOM 3904  C CA   . GLY A 1 43 ? -5.476  -10.102 -6.191  1.00 0.00 ? 43 GLY A CA   4  
ATOM 3905  C C    . GLY A 1 43 ? -5.440  -10.192 -7.707  1.00 0.00 ? 43 GLY A C    4  
ATOM 3906  O O    . GLY A 1 43 ? -5.120  -11.243 -8.262  1.00 0.00 ? 43 GLY A O    4  
ATOM 3907  H H    . GLY A 1 43 ? -6.487  -8.479  -5.282  1.00 0.00 ? 43 GLY A H    4  
ATOM 3908  H HA2  . GLY A 1 43 ? -4.549  -10.493 -5.798  1.00 0.00 ? 43 GLY A HA2  4  
ATOM 3909  H HA3  . GLY A 1 43 ? -6.293  -10.706 -5.824  1.00 0.00 ? 43 GLY A HA3  4  
ATOM 3910  N N    . ALA A 1 44 ? -5.776  -9.093  -8.379  1.00 0.00 ? 44 ALA A N    4  
ATOM 3911  C CA   . ALA A 1 44 ? -5.759  -9.054  -9.837  1.00 0.00 ? 44 ALA A CA   4  
ATOM 3912  C C    . ALA A 1 44 ? -4.334  -8.885  -10.347 1.00 0.00 ? 44 ALA A C    4  
ATOM 3913  O O    . ALA A 1 44 ? -3.988  -9.349  -11.433 1.00 0.00 ? 44 ALA A O    4  
ATOM 3914  C CB   . ALA A 1 44 ? -6.648  -7.929  -10.348 1.00 0.00 ? 44 ALA A CB   4  
ATOM 3915  H H    . ALA A 1 44 ? -6.010  -8.280  -7.885  1.00 0.00 ? 44 ALA A H    4  
ATOM 3916  H HA   . ALA A 1 44 ? -6.156  -9.990  -10.203 1.00 0.00 ? 44 ALA A HA   4  
ATOM 3917  H HB1  . ALA A 1 44 ? -6.054  -7.040  -10.496 1.00 0.00 ? 44 ALA A HB1  4  
ATOM 3918  H HB2  . ALA A 1 44 ? -7.425  -7.728  -9.624  1.00 0.00 ? 44 ALA A HB2  4  
ATOM 3919  H HB3  . ALA A 1 44 ? -7.096  -8.223  -11.285 1.00 0.00 ? 44 ALA A HB3  4  
ATOM 3920  N N    . LEU A 1 45 ? -3.502  -8.253  -9.526  1.00 0.00 ? 45 LEU A N    4  
ATOM 3921  C CA   . LEU A 1 45 ? -2.106  -8.023  -9.856  1.00 0.00 ? 45 LEU A CA   4  
ATOM 3922  C C    . LEU A 1 45 ? -1.332  -9.330  -10.030 1.00 0.00 ? 45 LEU A C    4  
ATOM 3923  O O    . LEU A 1 45 ? -0.209  -9.328  -10.534 1.00 0.00 ? 45 LEU A O    4  
ATOM 3924  C CB   . LEU A 1 45 ? -1.471  -7.191  -8.750  1.00 0.00 ? 45 LEU A CB   4  
ATOM 3925  C CG   . LEU A 1 45 ? -1.823  -5.709  -8.792  1.00 0.00 ? 45 LEU A CG   4  
ATOM 3926  C CD1  . LEU A 1 45 ? -3.332  -5.519  -8.770  1.00 0.00 ? 45 LEU A CD1  4  
ATOM 3927  C CD2  . LEU A 1 45 ? -1.174  -4.987  -7.627  1.00 0.00 ? 45 LEU A CD2  4  
ATOM 3928  H H    . LEU A 1 45 ? -3.843  -7.906  -8.675  1.00 0.00 ? 45 LEU A H    4  
ATOM 3929  H HA   . LEU A 1 45 ? -2.069  -7.470  -10.782 1.00 0.00 ? 45 LEU A HA   4  
ATOM 3930  H HB2  . LEU A 1 45 ? -1.800  -7.585  -7.801  1.00 0.00 ? 45 LEU A HB2  4  
ATOM 3931  H HB3  . LEU A 1 45 ? -0.398  -7.294  -8.812  1.00 0.00 ? 45 LEU A HB3  4  
ATOM 3932  H HG   . LEU A 1 45 ? -1.448  -5.284  -9.707  1.00 0.00 ? 45 LEU A HG   4  
ATOM 3933  H HD11 . LEU A 1 45 ? -3.752  -5.859  -9.704  1.00 0.00 ? 45 LEU A HD11 4  
ATOM 3934  H HD12 . LEU A 1 45 ? -3.561  -4.473  -8.631  1.00 0.00 ? 45 LEU A HD12 4  
ATOM 3935  H HD13 . LEU A 1 45 ? -3.755  -6.091  -7.956  1.00 0.00 ? 45 LEU A HD13 4  
ATOM 3936  H HD21 . LEU A 1 45 ? -0.114  -4.889  -7.809  1.00 0.00 ? 45 LEU A HD21 4  
ATOM 3937  H HD22 . LEU A 1 45 ? -1.334  -5.556  -6.723  1.00 0.00 ? 45 LEU A HD22 4  
ATOM 3938  H HD23 . LEU A 1 45 ? -1.616  -4.008  -7.519  1.00 0.00 ? 45 LEU A HD23 4  
ATOM 3939  N N    . LYS A 1 46 ? -1.941  -10.447 -9.631  1.00 0.00 ? 46 LYS A N    4  
ATOM 3940  C CA   . LYS A 1 46 ? -1.293  -11.758 -9.725  1.00 0.00 ? 46 LYS A CA   4  
ATOM 3941  C C    . LYS A 1 46 ? -0.271  -11.934 -8.611  1.00 0.00 ? 46 LYS A C    4  
ATOM 3942  O O    . LYS A 1 46 ? 0.629   -12.770 -8.702  1.00 0.00 ? 46 LYS A O    4  
ATOM 3943  C CB   . LYS A 1 46 ? -0.618  -11.936 -11.087 1.00 0.00 ? 46 LYS A CB   4  
ATOM 3944  C CG   . LYS A 1 46 ? -1.363  -11.249 -12.215 1.00 0.00 ? 46 LYS A CG   4  
ATOM 3945  C CD   . LYS A 1 46 ? -1.257  -12.030 -13.515 1.00 0.00 ? 46 LYS A CD   4  
ATOM 3946  C CE   . LYS A 1 46 ? 0.192   -12.203 -13.942 1.00 0.00 ? 46 LYS A CE   4  
ATOM 3947  N NZ   . LYS A 1 46 ? 0.304   -12.876 -15.266 1.00 0.00 ? 46 LYS A NZ   4  
ATOM 3948  H H    . LYS A 1 46 ? -2.823  -10.386 -9.215  1.00 0.00 ? 46 LYS A H    4  
ATOM 3949  H HA   . LYS A 1 46 ? -2.058  -12.510 -9.612  1.00 0.00 ? 46 LYS A HA   4  
ATOM 3950  H HB2  . LYS A 1 46 ? 0.380   -11.526 -11.040 1.00 0.00 ? 46 LYS A HB2  4  
ATOM 3951  H HB3  . LYS A 1 46 ? -0.557  -12.990 -11.313 1.00 0.00 ? 46 LYS A HB3  4  
ATOM 3952  H HG2  . LYS A 1 46 ? -2.403  -11.162 -11.936 1.00 0.00 ? 46 LYS A HG2  4  
ATOM 3953  H HG3  . LYS A 1 46 ? -0.944  -10.266 -12.359 1.00 0.00 ? 46 LYS A HG3  4  
ATOM 3954  H HD2  . LYS A 1 46 ? -1.700  -13.005 -13.375 1.00 0.00 ? 46 LYS A HD2  4  
ATOM 3955  H HD3  . LYS A 1 46 ? -1.789  -11.496 -14.288 1.00 0.00 ? 46 LYS A HD3  4  
ATOM 3956  H HE2  . LYS A 1 46 ? 0.654   -11.229 -14.004 1.00 0.00 ? 46 LYS A HE2  4  
ATOM 3957  H HE3  . LYS A 1 46 ? 0.704   -12.798 -13.202 1.00 0.00 ? 46 LYS A HE3  4  
ATOM 3958  H HZ1  . LYS A 1 46 ? -0.641  -13.028 -15.672 1.00 0.00 ? 46 LYS A HZ1  4  
ATOM 3959  H HZ2  . LYS A 1 46 ? 0.776   -13.797 -15.161 1.00 0.00 ? 46 LYS A HZ2  4  
ATOM 3960  H HZ3  . LYS A 1 46 ? 0.860   -12.288 -15.920 1.00 0.00 ? 46 LYS A HZ3  4  
ATOM 3961  N N    . ILE A 1 47 ? -0.420  -11.140 -7.560  1.00 0.00 ? 47 ILE A N    4  
ATOM 3962  C CA   . ILE A 1 47 ? 0.478   -11.206 -6.415  1.00 0.00 ? 47 ILE A CA   4  
ATOM 3963  C C    . ILE A 1 47 ? 0.063   -12.333 -5.468  1.00 0.00 ? 47 ILE A C    4  
ATOM 3964  O O    . ILE A 1 47 ? -1.112  -12.457 -5.122  1.00 0.00 ? 47 ILE A O    4  
ATOM 3965  C CB   . ILE A 1 47 ? 0.501   -9.877  -5.633  1.00 0.00 ? 47 ILE A CB   4  
ATOM 3966  C CG1  . ILE A 1 47 ? 0.449   -8.686  -6.592  1.00 0.00 ? 47 ILE A CG1  4  
ATOM 3967  C CG2  . ILE A 1 47 ? 1.740   -9.796  -4.759  1.00 0.00 ? 47 ILE A CG2  4  
ATOM 3968  C CD1  . ILE A 1 47 ? 1.658   -8.580  -7.494  1.00 0.00 ? 47 ILE A CD1  4  
ATOM 3969  H H    . ILE A 1 47 ? -1.162  -10.503 -7.551  1.00 0.00 ? 47 ILE A H    4  
ATOM 3970  H HA   . ILE A 1 47 ? 1.473   -11.399 -6.783  1.00 0.00 ? 47 ILE A HA   4  
ATOM 3971  H HB   . ILE A 1 47 ? -0.365  -9.850  -4.988  1.00 0.00 ? 47 ILE A HB   4  
ATOM 3972  H HG12 . ILE A 1 47 ? -0.422  -8.774  -7.218  1.00 0.00 ? 47 ILE A HG12 4  
ATOM 3973  H HG13 . ILE A 1 47 ? 0.385   -7.773  -6.018  1.00 0.00 ? 47 ILE A HG13 4  
ATOM 3974  H HG21 . ILE A 1 47 ? 1.601   -10.402 -3.877  1.00 0.00 ? 47 ILE A HG21 4  
ATOM 3975  H HG22 . ILE A 1 47 ? 1.906   -8.769  -4.468  1.00 0.00 ? 47 ILE A HG22 4  
ATOM 3976  H HG23 . ILE A 1 47 ? 2.595   -10.155 -5.313  1.00 0.00 ? 47 ILE A HG23 4  
ATOM 3977  H HD11 . ILE A 1 47 ? 1.387   -8.883  -8.494  1.00 0.00 ? 47 ILE A HD11 4  
ATOM 3978  H HD12 . ILE A 1 47 ? 2.443   -9.223  -7.122  1.00 0.00 ? 47 ILE A HD12 4  
ATOM 3979  H HD13 . ILE A 1 47 ? 2.008   -7.559  -7.509  1.00 0.00 ? 47 ILE A HD13 4  
ATOM 3980  N N    . PRO A 1 48 ? 1.019   -13.178 -5.042  1.00 0.00 ? 48 PRO A N    4  
ATOM 3981  C CA   . PRO A 1 48 ? 0.740   -14.297 -4.137  1.00 0.00 ? 48 PRO A CA   4  
ATOM 3982  C C    . PRO A 1 48 ? -0.065  -13.869 -2.915  1.00 0.00 ? 48 PRO A C    4  
ATOM 3983  O O    . PRO A 1 48 ? -0.346  -12.686 -2.728  1.00 0.00 ? 48 PRO A O    4  
ATOM 3984  C CB   . PRO A 1 48 ? 2.136   -14.789 -3.715  1.00 0.00 ? 48 PRO A CB   4  
ATOM 3985  C CG   . PRO A 1 48 ? 3.097   -13.761 -4.216  1.00 0.00 ? 48 PRO A CG   4  
ATOM 3986  C CD   . PRO A 1 48 ? 2.440   -13.113 -5.397  1.00 0.00 ? 48 PRO A CD   4  
ATOM 3987  H HA   . PRO A 1 48 ? 0.218   -15.093 -4.647  1.00 0.00 ? 48 PRO A HA   4  
ATOM 3988  H HB2  . PRO A 1 48 ? 2.176   -14.872 -2.640  1.00 0.00 ? 48 PRO A HB2  4  
ATOM 3989  H HB3  . PRO A 1 48 ? 2.326   -15.754 -4.160  1.00 0.00 ? 48 PRO A HB3  4  
ATOM 3990  H HG2  . PRO A 1 48 ? 3.285   -13.028 -3.445  1.00 0.00 ? 48 PRO A HG2  4  
ATOM 3991  H HG3  . PRO A 1 48 ? 4.020   -14.236 -4.514  1.00 0.00 ? 48 PRO A HG3  4  
ATOM 3992  H HD2  . PRO A 1 48 ? 2.768   -12.090 -5.501  1.00 0.00 ? 48 PRO A HD2  4  
ATOM 3993  H HD3  . PRO A 1 48 ? 2.641   -13.672 -6.298  1.00 0.00 ? 48 PRO A HD3  4  
ATOM 3994  N N    . GLU A 1 49 ? -0.426  -14.841 -2.081  1.00 0.00 ? 49 GLU A N    4  
ATOM 3995  C CA   . GLU A 1 49 ? -1.200  -14.566 -0.874  1.00 0.00 ? 49 GLU A CA   4  
ATOM 3996  C C    . GLU A 1 49 ? -0.281  -14.321 0.320   1.00 0.00 ? 49 GLU A C    4  
ATOM 3997  O O    . GLU A 1 49 ? -0.552  -14.784 1.427   1.00 0.00 ? 49 GLU A O    4  
ATOM 3998  C CB   . GLU A 1 49 ? -2.142  -15.733 -0.569  1.00 0.00 ? 49 GLU A CB   4  
ATOM 3999  C CG   . GLU A 1 49 ? -3.506  -15.606 -1.226  1.00 0.00 ? 49 GLU A CG   4  
ATOM 4000  C CD   . GLU A 1 49 ? -4.044  -16.937 -1.713  1.00 0.00 ? 49 GLU A CD   4  
ATOM 4001  O OE1  . GLU A 1 49 ? -3.439  -17.522 -2.635  1.00 0.00 ? 49 GLU A OE1  4  
ATOM 4002  O OE2  . GLU A 1 49 ? -5.072  -17.395 -1.169  1.00 0.00 ? 49 GLU A OE2  4  
ATOM 4003  H H    . GLU A 1 49 ? -0.172  -15.765 -2.284  1.00 0.00 ? 49 GLU A H    4  
ATOM 4004  H HA   . GLU A 1 49 ? -1.786  -13.677 -1.050  1.00 0.00 ? 49 GLU A HA   4  
ATOM 4005  H HB2  . GLU A 1 49 ? -1.684  -16.649 -0.914  1.00 0.00 ? 49 GLU A HB2  4  
ATOM 4006  H HB3  . GLU A 1 49 ? -2.286  -15.795 0.500   1.00 0.00 ? 49 GLU A HB3  4  
ATOM 4007  H HG2  . GLU A 1 49 ? -4.200  -15.195 -0.508  1.00 0.00 ? 49 GLU A HG2  4  
ATOM 4008  H HG3  . GLU A 1 49 ? -3.424  -14.937 -2.070  1.00 0.00 ? 49 GLU A HG3  4  
ATOM 4009  N N    . GLN A 1 50 ? 0.808   -13.595 0.088   1.00 0.00 ? 50 GLN A N    4  
ATOM 4010  C CA   . GLN A 1 50 ? 1.762   -13.293 1.146   1.00 0.00 ? 50 GLN A CA   4  
ATOM 4011  C C    . GLN A 1 50 ? 1.295   -12.100 1.972   1.00 0.00 ? 50 GLN A C    4  
ATOM 4012  O O    . GLN A 1 50 ? 1.226   -12.170 3.199   1.00 0.00 ? 50 GLN A O    4  
ATOM 4013  C CB   . GLN A 1 50 ? 3.143   -13.006 0.552   1.00 0.00 ? 50 GLN A CB   4  
ATOM 4014  C CG   . GLN A 1 50 ? 3.483   -13.881 -0.643  1.00 0.00 ? 50 GLN A CG   4  
ATOM 4015  C CD   . GLN A 1 50 ? 4.817   -14.580 -0.494  1.00 0.00 ? 50 GLN A CD   4  
ATOM 4016  O OE1  . GLN A 1 50 ? 5.758   -14.037 0.085   1.00 0.00 ? 50 GLN A OE1  4  
ATOM 4017  N NE2  . GLN A 1 50 ? 4.904   -15.796 -1.018  1.00 0.00 ? 50 GLN A NE2  4  
ATOM 4018  H H    . GLN A 1 50 ? 0.972   -13.252 -0.814  1.00 0.00 ? 50 GLN A H    4  
ATOM 4019  H HA   . GLN A 1 50 ? 1.828   -14.157 1.790   1.00 0.00 ? 50 GLN A HA   4  
ATOM 4020  H HB2  . GLN A 1 50 ? 3.178   -11.974 0.237   1.00 0.00 ? 50 GLN A HB2  4  
ATOM 4021  H HB3  . GLN A 1 50 ? 3.890   -13.166 1.314   1.00 0.00 ? 50 GLN A HB3  4  
ATOM 4022  H HG2  . GLN A 1 50 ? 2.716   -14.633 -0.754  1.00 0.00 ? 50 GLN A HG2  4  
ATOM 4023  H HG3  . GLN A 1 50 ? 3.514   -13.264 -1.528  1.00 0.00 ? 50 GLN A HG3  4  
ATOM 4024  H HE21 . GLN A 1 50 ? 4.113   -16.165 -1.464  1.00 0.00 ? 50 GLN A HE21 4  
ATOM 4025  H HE22 . GLN A 1 50 ? 5.752   -16.275 -0.937  1.00 0.00 ? 50 GLN A HE22 4  
ATOM 4026  N N    . TYR A 1 51 ? 0.973   -11.004 1.292   1.00 0.00 ? 51 TYR A N    4  
ATOM 4027  C CA   . TYR A 1 51 ? 0.517   -9.795  1.964   1.00 0.00 ? 51 TYR A CA   4  
ATOM 4028  C C    . TYR A 1 51 ? -0.616  -9.126  1.192   1.00 0.00 ? 51 TYR A C    4  
ATOM 4029  O O    . TYR A 1 51 ? -0.823  -7.918  1.299   1.00 0.00 ? 51 TYR A O    4  
ATOM 4030  C CB   . TYR A 1 51 ? 1.680   -8.816  2.137   1.00 0.00 ? 51 TYR A CB   4  
ATOM 4031  C CG   . TYR A 1 51 ? 2.963   -9.474  2.590   1.00 0.00 ? 51 TYR A CG   4  
ATOM 4032  C CD1  . TYR A 1 51 ? 3.113   -9.925  3.895   1.00 0.00 ? 51 TYR A CD1  4  
ATOM 4033  C CD2  . TYR A 1 51 ? 4.026   -9.646  1.711   1.00 0.00 ? 51 TYR A CD2  4  
ATOM 4034  C CE1  . TYR A 1 51 ? 4.283   -10.528 4.313   1.00 0.00 ? 51 TYR A CE1  4  
ATOM 4035  C CE2  . TYR A 1 51 ? 5.200   -10.249 2.121   1.00 0.00 ? 51 TYR A CE2  4  
ATOM 4036  C CZ   . TYR A 1 51 ? 5.323   -10.688 3.422   1.00 0.00 ? 51 TYR A CZ   4  
ATOM 4037  O OH   . TYR A 1 51 ? 6.492   -11.287 3.835   1.00 0.00 ? 51 TYR A OH   4  
ATOM 4038  H H    . TYR A 1 51 ? 1.050   -11.008 0.314   1.00 0.00 ? 51 TYR A H    4  
ATOM 4039  H HA   . TYR A 1 51 ? 0.150   -10.079 2.940   1.00 0.00 ? 51 TYR A HA   4  
ATOM 4040  H HB2  . TYR A 1 51 ? 1.873   -8.327  1.193   1.00 0.00 ? 51 TYR A HB2  4  
ATOM 4041  H HB3  . TYR A 1 51 ? 1.410   -8.073  2.873   1.00 0.00 ? 51 TYR A HB3  4  
ATOM 4042  H HD1  . TYR A 1 51 ? 2.295   -9.799  4.591   1.00 0.00 ? 51 TYR A HD1  4  
ATOM 4043  H HD2  . TYR A 1 51 ? 3.926   -9.303  0.693   1.00 0.00 ? 51 TYR A HD2  4  
ATOM 4044  H HE1  . TYR A 1 51 ? 4.380   -10.872 5.332   1.00 0.00 ? 51 TYR A HE1  4  
ATOM 4045  H HE2  . TYR A 1 51 ? 6.014   -10.374 1.423   1.00 0.00 ? 51 TYR A HE2  4  
ATOM 4046  H HH   . TYR A 1 51 ? 6.942   -10.714 4.460   1.00 0.00 ? 51 TYR A HH   4  
ATOM 4047  N N    . ARG A 1 52 ? -1.350  -9.917  0.414   1.00 0.00 ? 52 ARG A N    4  
ATOM 4048  C CA   . ARG A 1 52 ? -2.468  -9.397  -0.363  1.00 0.00 ? 52 ARG A CA   4  
ATOM 4049  C C    . ARG A 1 52 ? -3.417  -8.600  0.526   1.00 0.00 ? 52 ARG A C    4  
ATOM 4050  O O    . ARG A 1 52 ? -3.671  -7.420  0.281   1.00 0.00 ? 52 ARG A O    4  
ATOM 4051  C CB   . ARG A 1 52 ? -3.226  -10.548 -1.029  1.00 0.00 ? 52 ARG A CB   4  
ATOM 4052  C CG   . ARG A 1 52 ? -3.621  -10.273 -2.472  1.00 0.00 ? 52 ARG A CG   4  
ATOM 4053  C CD   . ARG A 1 52 ? -4.421  -11.427 -3.051  1.00 0.00 ? 52 ARG A CD   4  
ATOM 4054  N NE   . ARG A 1 52 ? -3.790  -11.989 -4.241  1.00 0.00 ? 52 ARG A NE   4  
ATOM 4055  C CZ   . ARG A 1 52 ? -4.119  -13.167 -4.762  1.00 0.00 ? 52 ARG A CZ   4  
ATOM 4056  N NH1  . ARG A 1 52 ? -5.070  -13.901 -4.197  1.00 0.00 ? 52 ARG A NH1  4  
ATOM 4057  N NH2  . ARG A 1 52 ? -3.500  -13.613 -5.845  1.00 0.00 ? 52 ARG A NH2  4  
ATOM 4058  H H    . ARG A 1 52 ? -1.142  -10.875 0.372   1.00 0.00 ? 52 ARG A H    4  
ATOM 4059  H HA   . ARG A 1 52 ? -2.071  -8.745  -1.126  1.00 0.00 ? 52 ARG A HA   4  
ATOM 4060  H HB2  . ARG A 1 52 ? -2.603  -11.431 -1.011  1.00 0.00 ? 52 ARG A HB2  4  
ATOM 4061  H HB3  . ARG A 1 52 ? -4.126  -10.743 -0.465  1.00 0.00 ? 52 ARG A HB3  4  
ATOM 4062  H HG2  . ARG A 1 52 ? -4.222  -9.376  -2.509  1.00 0.00 ? 52 ARG A HG2  4  
ATOM 4063  H HG3  . ARG A 1 52 ? -2.727  -10.136 -3.062  1.00 0.00 ? 52 ARG A HG3  4  
ATOM 4064  H HD2  . ARG A 1 52 ? -4.505  -12.200 -2.300  1.00 0.00 ? 52 ARG A HD2  4  
ATOM 4065  H HD3  . ARG A 1 52 ? -5.406  -11.070 -3.312  1.00 0.00 ? 52 ARG A HD3  4  
ATOM 4066  H HE   . ARG A 1 52 ? -3.085  -11.463 -4.673  1.00 0.00 ? 52 ARG A HE   4  
ATOM 4067  H HH11 . ARG A 1 52 ? -5.538  -13.568 -3.379  1.00 0.00 ? 52 ARG A HH11 4  
ATOM 4068  H HH12 . ARG A 1 52 ? -5.317  -14.787 -4.590  1.00 0.00 ? 52 ARG A HH12 4  
ATOM 4069  H HH21 . ARG A 1 52 ? -2.783  -13.063 -6.274  1.00 0.00 ? 52 ARG A HH21 4  
ATOM 4070  H HH22 . ARG A 1 52 ? -3.750  -14.499 -6.236  1.00 0.00 ? 52 ARG A HH22 4  
ATOM 4071  N N    . MET A 1 53 ? -3.932  -9.253  1.563   1.00 0.00 ? 53 MET A N    4  
ATOM 4072  C CA   . MET A 1 53 ? -4.850  -8.609  2.494   1.00 0.00 ? 53 MET A CA   4  
ATOM 4073  C C    . MET A 1 53 ? -4.191  -7.409  3.166   1.00 0.00 ? 53 MET A C    4  
ATOM 4074  O O    . MET A 1 53 ? -4.770  -6.324  3.224   1.00 0.00 ? 53 MET A O    4  
ATOM 4075  C CB   . MET A 1 53 ? -5.316  -9.609  3.553   1.00 0.00 ? 53 MET A CB   4  
ATOM 4076  C CG   . MET A 1 53 ? -5.964  -10.853 2.969   1.00 0.00 ? 53 MET A CG   4  
ATOM 4077  S SD   . MET A 1 53 ? -7.744  -10.671 2.747   1.00 0.00 ? 53 MET A SD   4  
ATOM 4078  C CE   . MET A 1 53 ? -8.300  -10.698 4.450   1.00 0.00 ? 53 MET A CE   4  
ATOM 4079  H H    . MET A 1 53 ? -3.688  -10.192 1.705   1.00 0.00 ? 53 MET A H    4  
ATOM 4080  H HA   . MET A 1 53 ? -5.706  -8.267  1.932   1.00 0.00 ? 53 MET A HA   4  
ATOM 4081  H HB2  . MET A 1 53 ? -4.464  -9.916  4.142   1.00 0.00 ? 53 MET A HB2  4  
ATOM 4082  H HB3  . MET A 1 53 ? -6.034  -9.124  4.199   1.00 0.00 ? 53 MET A HB3  4  
ATOM 4083  H HG2  . MET A 1 53 ? -5.516  -11.058 2.008   1.00 0.00 ? 53 MET A HG2  4  
ATOM 4084  H HG3  . MET A 1 53 ? -5.781  -11.684 3.634   1.00 0.00 ? 53 MET A HG3  4  
ATOM 4085  H HE1  . MET A 1 53 ? -8.526  -9.691  4.769   1.00 0.00 ? 53 MET A HE1  4  
ATOM 4086  H HE2  . MET A 1 53 ? -7.522  -11.108 5.077   1.00 0.00 ? 53 MET A HE2  4  
ATOM 4087  H HE3  . MET A 1 53 ? -9.187  -11.308 4.530   1.00 0.00 ? 53 MET A HE3  4  
ATOM 4088  N N    . THR A 1 54 ? -2.975  -7.608  3.669   1.00 0.00 ? 54 THR A N    4  
ATOM 4089  C CA   . THR A 1 54 ? -2.238  -6.533  4.325   1.00 0.00 ? 54 THR A CA   4  
ATOM 4090  C C    . THR A 1 54 ? -2.215  -5.285  3.450   1.00 0.00 ? 54 THR A C    4  
ATOM 4091  O O    . THR A 1 54 ? -2.500  -4.182  3.916   1.00 0.00 ? 54 THR A O    4  
ATOM 4092  C CB   . THR A 1 54 ? -0.807  -6.978  4.635   1.00 0.00 ? 54 THR A CB   4  
ATOM 4093  O OG1  . THR A 1 54 ? -0.803  -8.020  5.596   1.00 0.00 ? 54 THR A OG1  4  
ATOM 4094  C CG2  . THR A 1 54 ? 0.071   -5.861  5.163   1.00 0.00 ? 54 THR A CG2  4  
ATOM 4095  H H    . THR A 1 54 ? -2.562  -8.492  3.589   1.00 0.00 ? 54 THR A H    4  
ATOM 4096  H HA   . THR A 1 54 ? -2.744  -6.300  5.251   1.00 0.00 ? 54 THR A HA   4  
ATOM 4097  H HB   . THR A 1 54 ? -0.352  -7.350  3.729   1.00 0.00 ? 54 THR A HB   4  
ATOM 4098  H HG1  . THR A 1 54 ? -0.564  -8.846  5.171   1.00 0.00 ? 54 THR A HG1  4  
ATOM 4099  H HG21 . THR A 1 54 ? -0.278  -5.560  6.140   1.00 0.00 ? 54 THR A HG21 4  
ATOM 4100  H HG22 . THR A 1 54 ? 0.028   -5.018  4.489   1.00 0.00 ? 54 THR A HG22 4  
ATOM 4101  H HG23 . THR A 1 54 ? 1.091   -6.210  5.238   1.00 0.00 ? 54 THR A HG23 4  
ATOM 4102  N N    . ILE A 1 55 ? -1.880  -5.471  2.179   1.00 0.00 ? 55 ILE A N    4  
ATOM 4103  C CA   . ILE A 1 55 ? -1.828  -4.363  1.238   1.00 0.00 ? 55 ILE A CA   4  
ATOM 4104  C C    . ILE A 1 55 ? -3.161  -3.620  1.203   1.00 0.00 ? 55 ILE A C    4  
ATOM 4105  O O    . ILE A 1 55 ? -3.217  -2.417  1.461   1.00 0.00 ? 55 ILE A O    4  
ATOM 4106  C CB   . ILE A 1 55 ? -1.469  -4.842  -0.180  1.00 0.00 ? 55 ILE A CB   4  
ATOM 4107  C CG1  . ILE A 1 55 ? -0.132  -5.585  -0.166  1.00 0.00 ? 55 ILE A CG1  4  
ATOM 4108  C CG2  . ILE A 1 55 ? -1.414  -3.664  -1.140  1.00 0.00 ? 55 ILE A CG2  4  
ATOM 4109  C CD1  . ILE A 1 55 ? -0.082  -6.758  -1.120  1.00 0.00 ? 55 ILE A CD1  4  
ATOM 4110  H H    . ILE A 1 55 ? -1.668  -6.376  1.867   1.00 0.00 ? 55 ILE A H    4  
ATOM 4111  H HA   . ILE A 1 55 ? -1.058  -3.684  1.567   1.00 0.00 ? 55 ILE A HA   4  
ATOM 4112  H HB   . ILE A 1 55 ? -2.244  -5.515  -0.515  1.00 0.00 ? 55 ILE A HB   4  
ATOM 4113  H HG12 . ILE A 1 55 ? 0.656   -4.900  -0.442  1.00 0.00 ? 55 ILE A HG12 4  
ATOM 4114  H HG13 . ILE A 1 55 ? 0.054   -5.958  0.830   1.00 0.00 ? 55 ILE A HG13 4  
ATOM 4115  H HG21 . ILE A 1 55 ? -0.566  -3.041  -0.895  1.00 0.00 ? 55 ILE A HG21 4  
ATOM 4116  H HG22 . ILE A 1 55 ? -2.322  -3.086  -1.053  1.00 0.00 ? 55 ILE A HG22 4  
ATOM 4117  H HG23 . ILE A 1 55 ? -1.313  -4.028  -2.152  1.00 0.00 ? 55 ILE A HG23 4  
ATOM 4118  H HD11 . ILE A 1 55 ? -1.068  -6.938  -1.523  1.00 0.00 ? 55 ILE A HD11 4  
ATOM 4119  H HD12 . ILE A 1 55 ? 0.257   -7.637  -0.591  1.00 0.00 ? 55 ILE A HD12 4  
ATOM 4120  H HD13 . ILE A 1 55 ? 0.602   -6.538  -1.926  1.00 0.00 ? 55 ILE A HD13 4  
ATOM 4121  N N    . TRP A 1 56 ? -4.237  -4.345  0.904   1.00 0.00 ? 56 TRP A N    4  
ATOM 4122  C CA   . TRP A 1 56 ? -5.568  -3.754  0.863   1.00 0.00 ? 56 TRP A CA   4  
ATOM 4123  C C    . TRP A 1 56 ? -5.851  -2.984  2.154   1.00 0.00 ? 56 TRP A C    4  
ATOM 4124  O O    . TRP A 1 56 ? -6.219  -1.811  2.121   1.00 0.00 ? 56 TRP A O    4  
ATOM 4125  C CB   . TRP A 1 56 ? -6.615  -4.855  0.638   1.00 0.00 ? 56 TRP A CB   4  
ATOM 4126  C CG   . TRP A 1 56 ? -8.019  -4.461  0.987   1.00 0.00 ? 56 TRP A CG   4  
ATOM 4127  C CD1  . TRP A 1 56 ? -8.652  -3.296  0.663   1.00 0.00 ? 56 TRP A CD1  4  
ATOM 4128  C CD2  . TRP A 1 56 ? -8.958  -5.234  1.737   1.00 0.00 ? 56 TRP A CD2  4  
ATOM 4129  N NE1  . TRP A 1 56 ? -9.933  -3.303  1.165   1.00 0.00 ? 56 TRP A NE1  4  
ATOM 4130  C CE2  . TRP A 1 56 ? -10.141 -4.481  1.824   1.00 0.00 ? 56 TRP A CE2  4  
ATOM 4131  C CE3  . TRP A 1 56 ? -8.912  -6.492  2.341   1.00 0.00 ? 56 TRP A CE3  4  
ATOM 4132  C CZ2  . TRP A 1 56 ? -11.268 -4.939  2.493   1.00 0.00 ? 56 TRP A CZ2  4  
ATOM 4133  C CZ3  . TRP A 1 56 ? -10.036 -6.952  3.003   1.00 0.00 ? 56 TRP A CZ3  4  
ATOM 4134  C CH2  . TRP A 1 56 ? -11.200 -6.176  3.076   1.00 0.00 ? 56 TRP A CH2  4  
ATOM 4135  H H    . TRP A 1 56 ? -4.136  -5.304  0.716   1.00 0.00 ? 56 TRP A H    4  
ATOM 4136  H HA   . TRP A 1 56 ? -5.597  -3.064  0.033   1.00 0.00 ? 56 TRP A HA   4  
ATOM 4137  H HB2  . TRP A 1 56 ? -6.602  -5.141  -0.403  1.00 0.00 ? 56 TRP A HB2  4  
ATOM 4138  H HB3  . TRP A 1 56 ? -6.354  -5.713  1.241   1.00 0.00 ? 56 TRP A HB3  4  
ATOM 4139  H HD1  . TRP A 1 56 ? -8.202  -2.497  0.095   1.00 0.00 ? 56 TRP A HD1  4  
ATOM 4140  H HE1  . TRP A 1 56 ? -10.590 -2.585  1.067   1.00 0.00 ? 56 TRP A HE1  4  
ATOM 4141  H HE3  . TRP A 1 56 ? -8.020  -7.101  2.293   1.00 0.00 ? 56 TRP A HE3  4  
ATOM 4142  H HZ2  . TRP A 1 56 ? -12.169 -4.349  2.552   1.00 0.00 ? 56 TRP A HZ2  4  
ATOM 4143  H HZ3  . TRP A 1 56 ? -10.021 -7.923  3.477   1.00 0.00 ? 56 TRP A HZ3  4  
ATOM 4144  H HH2  . TRP A 1 56 ? -12.054 -6.573  3.604   1.00 0.00 ? 56 TRP A HH2  4  
ATOM 4145  N N    . ARG A 1 57 ? -5.660  -3.652  3.289   1.00 0.00 ? 57 ARG A N    4  
ATOM 4146  C CA   . ARG A 1 57 ? -5.888  -3.035  4.595   1.00 0.00 ? 57 ARG A CA   4  
ATOM 4147  C C    . ARG A 1 57 ? -5.241  -1.657  4.669   1.00 0.00 ? 57 ARG A C    4  
ATOM 4148  O O    . ARG A 1 57 ? -5.917  -0.650  4.882   1.00 0.00 ? 57 ARG A O    4  
ATOM 4149  C CB   . ARG A 1 57 ? -5.335  -3.927  5.707   1.00 0.00 ? 57 ARG A CB   4  
ATOM 4150  C CG   . ARG A 1 57 ? -5.955  -5.312  5.738   1.00 0.00 ? 57 ARG A CG   4  
ATOM 4151  C CD   . ARG A 1 57 ? -6.938  -5.456  6.889   1.00 0.00 ? 57 ARG A CD   4  
ATOM 4152  N NE   . ARG A 1 57 ? -7.681  -6.711  6.822   1.00 0.00 ? 57 ARG A NE   4  
ATOM 4153  C CZ   . ARG A 1 57 ? -8.575  -7.084  7.731   1.00 0.00 ? 57 ARG A CZ   4  
ATOM 4154  N NH1  . ARG A 1 57 ? -8.835  -6.303  8.769   1.00 0.00 ? 57 ARG A NH1  4  
ATOM 4155  N NH2  . ARG A 1 57 ? -9.212  -8.241  7.602   1.00 0.00 ? 57 ARG A NH2  4  
ATOM 4156  H H    . ARG A 1 57 ? -5.365  -4.585  3.249   1.00 0.00 ? 57 ARG A H    4  
ATOM 4157  H HA   . ARG A 1 57 ? -6.951  -2.924  4.728   1.00 0.00 ? 57 ARG A HA   4  
ATOM 4158  H HB2  . ARG A 1 57 ? -4.269  -4.035  5.571   1.00 0.00 ? 57 ARG A HB2  4  
ATOM 4159  H HB3  . ARG A 1 57 ? -5.521  -3.451  6.659   1.00 0.00 ? 57 ARG A HB3  4  
ATOM 4160  H HG2  . ARG A 1 57 ? -6.478  -5.483  4.808   1.00 0.00 ? 57 ARG A HG2  4  
ATOM 4161  H HG3  . ARG A 1 57 ? -5.172  -6.046  5.853   1.00 0.00 ? 57 ARG A HG3  4  
ATOM 4162  H HD2  . ARG A 1 57 ? -6.389  -5.423  7.819   1.00 0.00 ? 57 ARG A HD2  4  
ATOM 4163  H HD3  . ARG A 1 57 ? -7.637  -4.633  6.854   1.00 0.00 ? 57 ARG A HD3  4  
ATOM 4164  H HE   . ARG A 1 57 ? -7.505  -7.304  6.062   1.00 0.00 ? 57 ARG A HE   4  
ATOM 4165  H HH11 . ARG A 1 57 ? -8.357  -5.430  8.871   1.00 0.00 ? 57 ARG A HH11 4  
ATOM 4166  H HH12 . ARG A 1 57 ? -9.508  -6.586  9.453   1.00 0.00 ? 57 ARG A HH12 4  
ATOM 4167  H HH21 . ARG A 1 57 ? -9.019  -8.833  6.820   1.00 0.00 ? 57 ARG A HH21 4  
ATOM 4168  H HH22 . ARG A 1 57 ? -9.884  -8.521  8.287   1.00 0.00 ? 57 ARG A HH22 4  
ATOM 4169  N N    . GLY A 1 58 ? -3.929  -1.621  4.484   1.00 0.00 ? 58 GLY A N    4  
ATOM 4170  C CA   . GLY A 1 58 ? -3.210  -0.364  4.507   1.00 0.00 ? 58 GLY A CA   4  
ATOM 4171  C C    . GLY A 1 58 ? -3.835  0.655   3.580   1.00 0.00 ? 58 GLY A C    4  
ATOM 4172  O O    . GLY A 1 58 ? -3.849  1.850   3.873   1.00 0.00 ? 58 GLY A O    4  
ATOM 4173  H H    . GLY A 1 58 ? -3.452  -2.453  4.303   1.00 0.00 ? 58 GLY A H    4  
ATOM 4174  H HA2  . GLY A 1 58 ? -3.217  0.026   5.515   1.00 0.00 ? 58 GLY A HA2  4  
ATOM 4175  H HA3  . GLY A 1 58 ? -2.188  -0.537  4.204   1.00 0.00 ? 58 GLY A HA3  4  
ATOM 4176  N N    . LEU A 1 59 ? -4.375  0.169   2.468   1.00 0.00 ? 59 LEU A N    4  
ATOM 4177  C CA   . LEU A 1 59 ? -5.044  1.033   1.508   1.00 0.00 ? 59 LEU A CA   4  
ATOM 4178  C C    . LEU A 1 59 ? -6.350  1.551   2.092   1.00 0.00 ? 59 LEU A C    4  
ATOM 4179  O O    . LEU A 1 59 ? -6.782  2.665   1.791   1.00 0.00 ? 59 LEU A O    4  
ATOM 4180  C CB   . LEU A 1 59 ? -5.308  0.278   0.206   1.00 0.00 ? 59 LEU A CB   4  
ATOM 4181  C CG   . LEU A 1 59 ? -4.449  0.721   -0.978  1.00 0.00 ? 59 LEU A CG   4  
ATOM 4182  C CD1  . LEU A 1 59 ? -2.974  0.679   -0.612  1.00 0.00 ? 59 LEU A CD1  4  
ATOM 4183  C CD2  . LEU A 1 59 ? -4.728  -0.149  -2.193  1.00 0.00 ? 59 LEU A CD2  4  
ATOM 4184  H H    . LEU A 1 59 ? -4.346  -0.796  2.303   1.00 0.00 ? 59 LEU A H    4  
ATOM 4185  H HA   . LEU A 1 59 ? -4.394  1.871   1.306   1.00 0.00 ? 59 LEU A HA   4  
ATOM 4186  H HB2  . LEU A 1 59 ? -5.131  -0.773  0.381   1.00 0.00 ? 59 LEU A HB2  4  
ATOM 4187  H HB3  . LEU A 1 59 ? -6.347  0.410   -0.059  1.00 0.00 ? 59 LEU A HB3  4  
ATOM 4188  H HG   . LEU A 1 59 ? -4.700  1.739   -1.232  1.00 0.00 ? 59 LEU A HG   4  
ATOM 4189  H HD11 . LEU A 1 59 ? -2.488  -0.110  -1.167  1.00 0.00 ? 59 LEU A HD11 4  
ATOM 4190  H HD12 . LEU A 1 59 ? -2.870  0.491   0.447   1.00 0.00 ? 59 LEU A HD12 4  
ATOM 4191  H HD13 . LEU A 1 59 ? -2.515  1.626   -0.857  1.00 0.00 ? 59 LEU A HD13 4  
ATOM 4192  H HD21 . LEU A 1 59 ? -4.486  -1.177  -1.963  1.00 0.00 ? 59 LEU A HD21 4  
ATOM 4193  H HD22 . LEU A 1 59 ? -4.123  0.186   -3.023  1.00 0.00 ? 59 LEU A HD22 4  
ATOM 4194  H HD23 . LEU A 1 59 ? -5.773  -0.076  -2.456  1.00 0.00 ? 59 LEU A HD23 4  
ATOM 4195  N N    . GLN A 1 60 ? -6.969  0.739   2.944   1.00 0.00 ? 60 GLN A N    4  
ATOM 4196  C CA   . GLN A 1 60 ? -8.205  1.134   3.608   1.00 0.00 ? 60 GLN A CA   4  
ATOM 4197  C C    . GLN A 1 60 ? -7.926  2.254   4.601   1.00 0.00 ? 60 GLN A C    4  
ATOM 4198  O O    . GLN A 1 60 ? -8.784  3.097   4.866   1.00 0.00 ? 60 GLN A O    4  
ATOM 4199  C CB   . GLN A 1 60 ? -8.832  -0.061  4.331   1.00 0.00 ? 60 GLN A CB   4  
ATOM 4200  C CG   . GLN A 1 60 ? -9.328  -1.150  3.393   1.00 0.00 ? 60 GLN A CG   4  
ATOM 4201  C CD   . GLN A 1 60 ? -10.145 -2.208  4.109   1.00 0.00 ? 60 GLN A CD   4  
ATOM 4202  O OE1  . GLN A 1 60 ? -11.293 -1.970  4.487   1.00 0.00 ? 60 GLN A OE1  4  
ATOM 4203  N NE2  . GLN A 1 60 ? -9.557  -3.381  4.302   1.00 0.00 ? 60 GLN A NE2  4  
ATOM 4204  H H    . GLN A 1 60 ? -6.563  -0.127  3.162   1.00 0.00 ? 60 GLN A H    4  
ATOM 4205  H HA   . GLN A 1 60 ? -8.890  1.495   2.856   1.00 0.00 ? 60 GLN A HA   4  
ATOM 4206  H HB2  . GLN A 1 60 ? -8.097  -0.494  4.993   1.00 0.00 ? 60 GLN A HB2  4  
ATOM 4207  H HB3  . GLN A 1 60 ? -9.670  0.287   4.917   1.00 0.00 ? 60 GLN A HB3  4  
ATOM 4208  H HG2  . GLN A 1 60 ? -9.943  -0.697  2.629   1.00 0.00 ? 60 GLN A HG2  4  
ATOM 4209  H HG3  . GLN A 1 60 ? -8.475  -1.626  2.932   1.00 0.00 ? 60 GLN A HG3  4  
ATOM 4210  H HE21 . GLN A 1 60 ? -8.643  -3.501  3.973   1.00 0.00 ? 60 GLN A HE21 4  
ATOM 4211  H HE22 . GLN A 1 60 ? -10.064 -4.084  4.761   1.00 0.00 ? 60 GLN A HE22 4  
ATOM 4212  N N    . ASP A 1 61 ? -6.707  2.264   5.132   1.00 0.00 ? 61 ASP A N    4  
ATOM 4213  C CA   . ASP A 1 61 ? -6.288  3.290   6.075   1.00 0.00 ? 61 ASP A CA   4  
ATOM 4214  C C    . ASP A 1 61 ? -6.358  4.668   5.426   1.00 0.00 ? 61 ASP A C    4  
ATOM 4215  O O    . ASP A 1 61 ? -6.608  5.671   6.094   1.00 0.00 ? 61 ASP A O    4  
ATOM 4216  C CB   . ASP A 1 61 ? -4.865  3.006   6.562   1.00 0.00 ? 61 ASP A CB   4  
ATOM 4217  C CG   . ASP A 1 61 ? -4.719  3.187   8.060   1.00 0.00 ? 61 ASP A CG   4  
ATOM 4218  O OD1  . ASP A 1 61 ? -5.204  2.316   8.812   1.00 0.00 ? 61 ASP A OD1  4  
ATOM 4219  O OD2  . ASP A 1 61 ? -4.123  4.200   8.481   1.00 0.00 ? 61 ASP A OD2  4  
ATOM 4220  H H    . ASP A 1 61 ? -6.066  1.570   4.870   1.00 0.00 ? 61 ASP A H    4  
ATOM 4221  H HA   . ASP A 1 61 ? -6.963  3.265   6.917   1.00 0.00 ? 61 ASP A HA   4  
ATOM 4222  H HB2  . ASP A 1 61 ? -4.602  1.987   6.312   1.00 0.00 ? 61 ASP A HB2  4  
ATOM 4223  H HB3  . ASP A 1 61 ? -4.181  3.681   6.068   1.00 0.00 ? 61 ASP A HB3  4  
ATOM 4224  N N    . LEU A 1 62 ? -6.147  4.703   4.114   1.00 0.00 ? 62 LEU A N    4  
ATOM 4225  C CA   . LEU A 1 62 ? -6.203  5.949   3.360   1.00 0.00 ? 62 LEU A CA   4  
ATOM 4226  C C    . LEU A 1 62 ? -7.647  6.385   3.152   1.00 0.00 ? 62 LEU A C    4  
ATOM 4227  O O    . LEU A 1 62 ? -7.993  7.549   3.355   1.00 0.00 ? 62 LEU A O    4  
ATOM 4228  C CB   . LEU A 1 62 ? -5.512  5.778   2.006   1.00 0.00 ? 62 LEU A CB   4  
ATOM 4229  C CG   . LEU A 1 62 ? -4.102  5.189   2.068   1.00 0.00 ? 62 LEU A CG   4  
ATOM 4230  C CD1  . LEU A 1 62 ? -3.750  4.515   0.751   1.00 0.00 ? 62 LEU A CD1  4  
ATOM 4231  C CD2  . LEU A 1 62 ? -3.089  6.271   2.405   1.00 0.00 ? 62 LEU A CD2  4  
ATOM 4232  H H    . LEU A 1 62 ? -5.961  3.866   3.638   1.00 0.00 ? 62 LEU A H    4  
ATOM 4233  H HA   . LEU A 1 62 ? -5.685  6.708   3.930   1.00 0.00 ? 62 LEU A HA   4  
ATOM 4234  H HB2  . LEU A 1 62 ? -6.121  5.130   1.393   1.00 0.00 ? 62 LEU A HB2  4  
ATOM 4235  H HB3  . LEU A 1 62 ? -5.454  6.746   1.530   1.00 0.00 ? 62 LEU A HB3  4  
ATOM 4236  H HG   . LEU A 1 62 ? -4.065  4.441   2.846   1.00 0.00 ? 62 LEU A HG   4  
ATOM 4237  H HD11 . LEU A 1 62 ? -2.767  4.075   0.824   1.00 0.00 ? 62 LEU A HD11 4  
ATOM 4238  H HD12 . LEU A 1 62 ? -3.759  5.248   -0.042  1.00 0.00 ? 62 LEU A HD12 4  
ATOM 4239  H HD13 . LEU A 1 62 ? -4.475  3.744   0.537   1.00 0.00 ? 62 LEU A HD13 4  
ATOM 4240  H HD21 . LEU A 1 62 ? -2.851  6.832   1.514   1.00 0.00 ? 62 LEU A HD21 4  
ATOM 4241  H HD22 . LEU A 1 62 ? -2.191  5.815   2.795   1.00 0.00 ? 62 LEU A HD22 4  
ATOM 4242  H HD23 . LEU A 1 62 ? -3.507  6.935   3.147   1.00 0.00 ? 62 LEU A HD23 4  
ATOM 4243  N N    . LYS A 1 63 ? -8.487  5.439   2.750   1.00 0.00 ? 63 LYS A N    4  
ATOM 4244  C CA   . LYS A 1 63 ? -9.899  5.714   2.515   1.00 0.00 ? 63 LYS A CA   4  
ATOM 4245  C C    . LYS A 1 63 ? -10.520 6.422   3.715   1.00 0.00 ? 63 LYS A C    4  
ATOM 4246  O O    . LYS A 1 63 ? -11.242 7.407   3.562   1.00 0.00 ? 63 LYS A O    4  
ATOM 4247  C CB   . LYS A 1 63 ? -10.649 4.411   2.231   1.00 0.00 ? 63 LYS A CB   4  
ATOM 4248  C CG   . LYS A 1 63 ? -11.222 4.331   0.825   1.00 0.00 ? 63 LYS A CG   4  
ATOM 4249  C CD   . LYS A 1 63 ? -12.420 5.252   0.659   1.00 0.00 ? 63 LYS A CD   4  
ATOM 4250  C CE   . LYS A 1 63 ? -12.085 6.454   -0.209  1.00 0.00 ? 63 LYS A CE   4  
ATOM 4251  N NZ   . LYS A 1 63 ? -13.296 7.025   -0.861  1.00 0.00 ? 63 LYS A NZ   4  
ATOM 4252  H H    . LYS A 1 63 ? -8.148  4.529   2.608   1.00 0.00 ? 63 LYS A H    4  
ATOM 4253  H HA   . LYS A 1 63 ? -9.972  6.360   1.653   1.00 0.00 ? 63 LYS A HA   4  
ATOM 4254  H HB2  . LYS A 1 63 ? -9.970  3.582   2.367   1.00 0.00 ? 63 LYS A HB2  4  
ATOM 4255  H HB3  . LYS A 1 63 ? -11.463 4.316   2.935   1.00 0.00 ? 63 LYS A HB3  4  
ATOM 4256  H HG2  . LYS A 1 63 ? -10.456 4.619   0.119   1.00 0.00 ? 63 LYS A HG2  4  
ATOM 4257  H HG3  . LYS A 1 63 ? -11.531 3.316   0.631   1.00 0.00 ? 63 LYS A HG3  4  
ATOM 4258  H HD2  . LYS A 1 63 ? -13.224 4.699   0.194   1.00 0.00 ? 63 LYS A HD2  4  
ATOM 4259  H HD3  . LYS A 1 63 ? -12.733 5.598   1.632   1.00 0.00 ? 63 LYS A HD3  4  
ATOM 4260  H HE2  . LYS A 1 63 ? -11.630 7.212   0.411   1.00 0.00 ? 63 LYS A HE2  4  
ATOM 4261  H HE3  . LYS A 1 63 ? -11.386 6.147   -0.973  1.00 0.00 ? 63 LYS A HE3  4  
ATOM 4262  H HZ1  . LYS A 1 63 ? -13.641 6.380   -1.601  1.00 0.00 ? 63 LYS A HZ1  4  
ATOM 4263  H HZ2  . LYS A 1 63 ? -13.071 7.942   -1.294  1.00 0.00 ? 63 LYS A HZ2  4  
ATOM 4264  H HZ3  . LYS A 1 63 ? -14.049 7.161   -0.157  1.00 0.00 ? 63 LYS A HZ3  4  
ATOM 4265  N N    . GLN A 1 64 ? -10.232 5.913   4.909   1.00 0.00 ? 64 GLN A N    4  
ATOM 4266  C CA   . GLN A 1 64 ? -10.762 6.496   6.136   1.00 0.00 ? 64 GLN A CA   4  
ATOM 4267  C C    . GLN A 1 64 ? -10.375 7.966   6.252   1.00 0.00 ? 64 GLN A C    4  
ATOM 4268  O O    . GLN A 1 64 ? -11.185 8.855   5.988   1.00 0.00 ? 64 GLN A O    4  
ATOM 4269  C CB   . GLN A 1 64 ? -10.247 5.724   7.352   1.00 0.00 ? 64 GLN A CB   4  
ATOM 4270  C CG   . GLN A 1 64 ? -11.314 4.884   8.036   1.00 0.00 ? 64 GLN A CG   4  
ATOM 4271  C CD   . GLN A 1 64 ? -10.756 4.046   9.169   1.00 0.00 ? 64 GLN A CD   4  
ATOM 4272  O OE1  . GLN A 1 64 ? -9.543  3.972   9.363   1.00 0.00 ? 64 GLN A OE1  4  
ATOM 4273  N NE2  . GLN A 1 64 ? -11.641 3.408   9.925   1.00 0.00 ? 64 GLN A NE2  4  
ATOM 4274  H H    . GLN A 1 64 ? -9.651  5.126   4.965   1.00 0.00 ? 64 GLN A H    4  
ATOM 4275  H HA   . GLN A 1 64 ? -11.839 6.421   6.100   1.00 0.00 ? 64 GLN A HA   4  
ATOM 4276  H HB2  . GLN A 1 64 ? -9.451  5.068   7.037   1.00 0.00 ? 64 GLN A HB2  4  
ATOM 4277  H HB3  . GLN A 1 64 ? -9.858  6.429   8.072   1.00 0.00 ? 64 GLN A HB3  4  
ATOM 4278  H HG2  . GLN A 1 64 ? -12.073 5.542   8.434   1.00 0.00 ? 64 GLN A HG2  4  
ATOM 4279  H HG3  . GLN A 1 64 ? -11.759 4.224   7.305   1.00 0.00 ? 64 GLN A HG3  4  
ATOM 4280  H HE21 . GLN A 1 64 ? -12.593 3.511   9.713   1.00 0.00 ? 64 GLN A HE21 4  
ATOM 4281  H HE22 . GLN A 1 64 ? -11.308 2.857   10.665  1.00 0.00 ? 64 GLN A HE22 4  
ATOM 4282  N N    . GLY A 1 65 ? -9.132  8.216   6.653   1.00 0.00 ? 65 GLY A N    4  
ATOM 4283  C CA   . GLY A 1 65 ? -8.661  9.581   6.799   1.00 0.00 ? 65 GLY A CA   4  
ATOM 4284  C C    . GLY A 1 65 ? -7.167  9.706   6.568   1.00 0.00 ? 65 GLY A C    4  
ATOM 4285  O O    . GLY A 1 65 ? -6.524  8.769   6.096   1.00 0.00 ? 65 GLY A O    4  
ATOM 4286  H H    . GLY A 1 65 ? -8.531  7.468   6.851   1.00 0.00 ? 65 GLY A H    4  
ATOM 4287  H HA2  . GLY A 1 65 ? -9.177  10.206  6.088   1.00 0.00 ? 65 GLY A HA2  4  
ATOM 4288  H HA3  . GLY A 1 65 ? -8.888  9.923   7.798   1.00 0.00 ? 65 GLY A HA3  4  
ATOM 4289  N N    . HIS A 1 66 ? -6.614  10.868  6.901   1.00 0.00 ? 66 HIS A N    4  
ATOM 4290  C CA   . HIS A 1 66 ? -5.189  11.115  6.724   1.00 0.00 ? 66 HIS A CA   4  
ATOM 4291  C C    . HIS A 1 66 ? -4.491  11.268  8.071   1.00 0.00 ? 66 HIS A C    4  
ATOM 4292  O O    . HIS A 1 66 ? -4.925  12.043  8.923   1.00 0.00 ? 66 HIS A O    4  
ATOM 4293  C CB   . HIS A 1 66 ? -4.970  12.372  5.880   1.00 0.00 ? 66 HIS A CB   4  
ATOM 4294  C CG   . HIS A 1 66 ? -3.781  12.288  4.975   1.00 0.00 ? 66 HIS A CG   4  
ATOM 4295  N ND1  . HIS A 1 66 ? -3.733  12.892  3.736   1.00 0.00 ? 66 HIS A ND1  4  
ATOM 4296  C CD2  . HIS A 1 66 ? -2.588  11.665  5.135   1.00 0.00 ? 66 HIS A CD2  4  
ATOM 4297  C CE1  . HIS A 1 66 ? -2.563  12.644  3.173   1.00 0.00 ? 66 HIS A CE1  4  
ATOM 4298  N NE2  . HIS A 1 66 ? -1.852  11.903  4.001   1.00 0.00 ? 66 HIS A NE2  4  
ATOM 4299  H H    . HIS A 1 66 ? -7.181  11.577  7.272   1.00 0.00 ? 66 HIS A H    4  
ATOM 4300  H HA   . HIS A 1 66 ? -4.767  10.266  6.208   1.00 0.00 ? 66 HIS A HA   4  
ATOM 4301  H HB2  . HIS A 1 66 ? -5.843  12.542  5.267   1.00 0.00 ? 66 HIS A HB2  4  
ATOM 4302  H HB3  . HIS A 1 66 ? -4.829  13.219  6.536   1.00 0.00 ? 66 HIS A HB3  4  
ATOM 4303  H HD1  . HIS A 1 66 ? -4.450  13.422  3.330   1.00 0.00 ? 66 HIS A HD1  4  
ATOM 4304  H HD2  . HIS A 1 66 ? -2.275  11.089  5.994   1.00 0.00 ? 66 HIS A HD2  4  
ATOM 4305  H HE1  . HIS A 1 66 ? -2.244  12.990  2.200   1.00 0.00 ? 66 HIS A HE1  4  
ATOM 4306  H HE2  . HIS A 1 66 ? -0.944  11.576  3.831   1.00 0.00 ? 66 HIS A HE2  4  
ATOM 4307  N N    . ASP A 1 67 ? -3.405  10.524  8.257   1.00 0.00 ? 67 ASP A N    4  
ATOM 4308  C CA   . ASP A 1 67 ? -2.645  10.573  9.488   1.00 0.00 ? 67 ASP A CA   4  
ATOM 4309  C C    . ASP A 1 67 ? -1.152  10.533  9.185   1.00 0.00 ? 67 ASP A C    4  
ATOM 4310  O O    . ASP A 1 67 ? -0.725  10.813  8.065   1.00 0.00 ? 67 ASP A O    4  
ATOM 4311  C CB   . ASP A 1 67 ? -3.045  9.404   10.395  1.00 0.00 ? 67 ASP A CB   4  
ATOM 4312  C CG   . ASP A 1 67 ? -2.543  8.068   9.883   1.00 0.00 ? 67 ASP A CG   4  
ATOM 4313  O OD1  . ASP A 1 67 ? -2.866  7.717   8.729   1.00 0.00 ? 67 ASP A OD1  4  
ATOM 4314  O OD2  . ASP A 1 67 ? -1.830  7.373   10.636  1.00 0.00 ? 67 ASP A OD2  4  
ATOM 4315  H H    . ASP A 1 67 ? -3.104  9.926   7.547   1.00 0.00 ? 67 ASP A H    4  
ATOM 4316  H HA   . ASP A 1 67 ? -2.872  11.499  9.989   1.00 0.00 ? 67 ASP A HA   4  
ATOM 4317  H HB2  . ASP A 1 67 ? -2.638  9.567   11.384  1.00 0.00 ? 67 ASP A HB2  4  
ATOM 4318  H HB3  . ASP A 1 67 ? -4.121  9.362   10.459  1.00 0.00 ? 67 ASP A HB3  4  
ATOM 4319  N N    . TYR A 1 68 ? -0.374  10.188  10.191  1.00 0.00 ? 68 TYR A N    4  
ATOM 4320  C CA   . TYR A 1 68 ? 1.074   10.104  10.051  1.00 0.00 ? 68 TYR A CA   4  
ATOM 4321  C C    . TYR A 1 68 ? 1.532   8.651   9.981   1.00 0.00 ? 68 TYR A C    4  
ATOM 4322  O O    . TYR A 1 68 ? 2.192   8.286   8.985   1.00 0.00 ? 68 TYR A O    4  
ATOM 4323  C CB   . TYR A 1 68 ? 1.762   10.811  11.220  1.00 0.00 ? 68 TYR A CB   4  
ATOM 4324  C CG   . TYR A 1 68 ? 2.219   12.215  10.895  1.00 0.00 ? 68 TYR A CG   4  
ATOM 4325  C CD1  . TYR A 1 68 ? 1.371   13.301  11.072  1.00 0.00 ? 68 TYR A CD1  4  
ATOM 4326  C CD2  . TYR A 1 68 ? 3.500   12.455  10.414  1.00 0.00 ? 68 TYR A CD2  4  
ATOM 4327  C CE1  . TYR A 1 68 ? 1.785   14.586  10.777  1.00 0.00 ? 68 TYR A CE1  4  
ATOM 4328  C CE2  . TYR A 1 68 ? 3.922   13.736  10.117  1.00 0.00 ? 68 TYR A CE2  4  
ATOM 4329  C CZ   . TYR A 1 68 ? 3.061   14.798  10.300  1.00 0.00 ? 68 TYR A CZ   4  
ATOM 4330  O OH   . TYR A 1 68 ? 3.477   16.076  10.005  1.00 0.00 ? 68 TYR A OH   4  
ATOM 4331  O OXT  . TYR A 1 68 ? 1.228   7.890   10.923  1.00 0.00 ? 68 TYR A OXT  4  
ATOM 4332  H H    . TYR A 1 68 ? -0.786  9.979   11.047  1.00 0.00 ? 68 TYR A H    4  
ATOM 4333  H HA   . TYR A 1 68 ? 1.349   10.599  9.132   1.00 0.00 ? 68 TYR A HA   4  
ATOM 4334  H HB2  . TYR A 1 68 ? 1.074   10.869  12.051  1.00 0.00 ? 68 TYR A HB2  4  
ATOM 4335  H HB3  . TYR A 1 68 ? 2.629   10.240  11.514  1.00 0.00 ? 68 TYR A HB3  4  
ATOM 4336  H HD1  . TYR A 1 68 ? 0.371   13.131  11.445  1.00 0.00 ? 68 TYR A HD1  4  
ATOM 4337  H HD2  . TYR A 1 68 ? 4.172   11.622  10.271  1.00 0.00 ? 68 TYR A HD2  4  
ATOM 4338  H HE1  . TYR A 1 68 ? 1.110   15.417  10.920  1.00 0.00 ? 68 TYR A HE1  4  
ATOM 4339  H HE2  . TYR A 1 68 ? 4.922   13.903  9.743   1.00 0.00 ? 68 TYR A HE2  4  
ATOM 4340  H HH   . TYR A 1 68 ? 4.409   16.166  10.217  1.00 0.00 ? 68 TYR A HH   4  
ATOM 4341  N N    . TYR A 1 1  ? 10.287  7.722   -2.584  1.00 0.00 ? 1  TYR A N    5  
ATOM 4342  C CA   . TYR A 1 1  ? 11.267  7.708   -3.701  1.00 0.00 ? 1  TYR A CA   5  
ATOM 4343  C C    . TYR A 1 1  ? 10.635  8.212   -4.993  1.00 0.00 ? 1  TYR A C    5  
ATOM 4344  O O    . TYR A 1 1  ? 9.433   8.062   -5.207  1.00 0.00 ? 1  TYR A O    5  
ATOM 4345  C CB   . TYR A 1 1  ? 11.775  6.277   -3.887  1.00 0.00 ? 1  TYR A CB   5  
ATOM 4346  C CG   . TYR A 1 1  ? 12.934  6.165   -4.851  1.00 0.00 ? 1  TYR A CG   5  
ATOM 4347  C CD1  . TYR A 1 1  ? 13.959  7.104   -4.848  1.00 0.00 ? 1  TYR A CD1  5  
ATOM 4348  C CD2  . TYR A 1 1  ? 13.005  5.119   -5.763  1.00 0.00 ? 1  TYR A CD2  5  
ATOM 4349  C CE1  . TYR A 1 1  ? 15.020  7.005   -5.728  1.00 0.00 ? 1  TYR A CE1  5  
ATOM 4350  C CE2  . TYR A 1 1  ? 14.064  5.013   -6.645  1.00 0.00 ? 1  TYR A CE2  5  
ATOM 4351  C CZ   . TYR A 1 1  ? 15.068  5.957   -6.624  1.00 0.00 ? 1  TYR A CZ   5  
ATOM 4352  O OH   . TYR A 1 1  ? 16.123  5.855   -7.502  1.00 0.00 ? 1  TYR A OH   5  
ATOM 4353  H H1   . TYR A 1 1  ? 10.823  7.743   -1.693  1.00 0.00 ? 1  TYR A H1   5  
ATOM 4354  H H2   . TYR A 1 1  ? 9.713   6.857   -2.656  1.00 0.00 ? 1  TYR A H2   5  
ATOM 4355  H H3   . TYR A 1 1  ? 9.698   8.572   -2.689  1.00 0.00 ? 1  TYR A H3   5  
ATOM 4356  H HA   . TYR A 1 1  ? 12.095  8.351   -3.439  1.00 0.00 ? 1  TYR A HA   5  
ATOM 4357  H HB2  . TYR A 1 1  ? 12.100  5.891   -2.932  1.00 0.00 ? 1  TYR A HB2  5  
ATOM 4358  H HB3  . TYR A 1 1  ? 10.971  5.664   -4.263  1.00 0.00 ? 1  TYR A HB3  5  
ATOM 4359  H HD1  . TYR A 1 1  ? 13.918  7.923   -4.146  1.00 0.00 ? 1  TYR A HD1  5  
ATOM 4360  H HD2  . TYR A 1 1  ? 12.217  4.382   -5.777  1.00 0.00 ? 1  TYR A HD2  5  
ATOM 4361  H HE1  . TYR A 1 1  ? 15.806  7.745   -5.711  1.00 0.00 ? 1  TYR A HE1  5  
ATOM 4362  H HE2  . TYR A 1 1  ? 14.100  4.193   -7.347  1.00 0.00 ? 1  TYR A HE2  5  
ATOM 4363  H HH   . TYR A 1 1  ? 16.698  5.137   -7.229  1.00 0.00 ? 1  TYR A HH   5  
ATOM 4364  N N    . HIS A 1 2  ? 11.454  8.807   -5.854  1.00 0.00 ? 2  HIS A N    5  
ATOM 4365  C CA   . HIS A 1 2  ? 10.973  9.330   -7.126  1.00 0.00 ? 2  HIS A CA   5  
ATOM 4366  C C    . HIS A 1 2  ? 9.770   10.246  -6.917  1.00 0.00 ? 2  HIS A C    5  
ATOM 4367  O O    . HIS A 1 2  ? 8.752   10.116  -7.596  1.00 0.00 ? 2  HIS A O    5  
ATOM 4368  C CB   . HIS A 1 2  ? 10.602  8.178   -8.062  1.00 0.00 ? 2  HIS A CB   5  
ATOM 4369  C CG   . HIS A 1 2  ? 11.674  7.845   -9.052  1.00 0.00 ? 2  HIS A CG   5  
ATOM 4370  N ND1  . HIS A 1 2  ? 12.997  8.193   -8.876  1.00 0.00 ? 2  HIS A ND1  5  
ATOM 4371  C CD2  . HIS A 1 2  ? 11.614  7.190   -10.237 1.00 0.00 ? 2  HIS A CD2  5  
ATOM 4372  C CE1  . HIS A 1 2  ? 13.703  7.768   -9.908  1.00 0.00 ? 2  HIS A CE1  5  
ATOM 4373  N NE2  . HIS A 1 2  ? 12.889  7.157   -10.747 1.00 0.00 ? 2  HIS A NE2  5  
ATOM 4374  H H    . HIS A 1 2  ? 12.403  8.896   -5.627  1.00 0.00 ? 2  HIS A H    5  
ATOM 4375  H HA   . HIS A 1 2  ? 11.773  9.903   -7.572  1.00 0.00 ? 2  HIS A HA   5  
ATOM 4376  H HB2  . HIS A 1 2  ? 10.407  7.294   -7.474  1.00 0.00 ? 2  HIS A HB2  5  
ATOM 4377  H HB3  . HIS A 1 2  ? 9.712   8.442   -8.613  1.00 0.00 ? 2  HIS A HB3  5  
ATOM 4378  H HD1  . HIS A 1 2  ? 13.363  8.680   -8.109  1.00 0.00 ? 2  HIS A HD1  5  
ATOM 4379  H HD2  . HIS A 1 2  ? 10.728  6.772   -10.695 1.00 0.00 ? 2  HIS A HD2  5  
ATOM 4380  H HE1  . HIS A 1 2  ? 14.767  7.898   -10.042 1.00 0.00 ? 2  HIS A HE1  5  
ATOM 4381  H HE2  . HIS A 1 2  ? 13.153  6.746   -11.597 1.00 0.00 ? 2  HIS A HE2  5  
ATOM 4382  N N    . ALA A 1 3  ? 9.896   11.170  -5.969  1.00 0.00 ? 3  ALA A N    5  
ATOM 4383  C CA   . ALA A 1 3  ? 8.822   12.112  -5.671  1.00 0.00 ? 3  ALA A CA   5  
ATOM 4384  C C    . ALA A 1 3  ? 7.648   11.413  -4.994  1.00 0.00 ? 3  ALA A C    5  
ATOM 4385  O O    . ALA A 1 3  ? 7.457   10.207  -5.146  1.00 0.00 ? 3  ALA A O    5  
ATOM 4386  C CB   . ALA A 1 3  ? 8.364   12.808  -6.942  1.00 0.00 ? 3  ALA A CB   5  
ATOM 4387  H H    . ALA A 1 3  ? 10.732  11.224  -5.463  1.00 0.00 ? 3  ALA A H    5  
ATOM 4388  H HA   . ALA A 1 3  ? 9.216   12.862  -5.001  1.00 0.00 ? 3  ALA A HA   5  
ATOM 4389  H HB1  . ALA A 1 3  ? 7.900   13.751  -6.689  1.00 0.00 ? 3  ALA A HB1  5  
ATOM 4390  H HB2  . ALA A 1 3  ? 7.651   12.183  -7.458  1.00 0.00 ? 3  ALA A HB2  5  
ATOM 4391  H HB3  . ALA A 1 3  ? 9.216   12.987  -7.581  1.00 0.00 ? 3  ALA A HB3  5  
ATOM 4392  N N    . ASP A 1 4  ? 6.860   12.183  -4.249  1.00 0.00 ? 4  ASP A N    5  
ATOM 4393  C CA   . ASP A 1 4  ? 5.700   11.643  -3.549  1.00 0.00 ? 4  ASP A CA   5  
ATOM 4394  C C    . ASP A 1 4  ? 6.125   10.641  -2.478  1.00 0.00 ? 4  ASP A C    5  
ATOM 4395  O O    . ASP A 1 4  ? 6.006   9.431   -2.664  1.00 0.00 ? 4  ASP A O    5  
ATOM 4396  C CB   . ASP A 1 4  ? 4.746   10.974  -4.542  1.00 0.00 ? 4  ASP A CB   5  
ATOM 4397  C CG   . ASP A 1 4  ? 3.304   11.393  -4.330  1.00 0.00 ? 4  ASP A CG   5  
ATOM 4398  O OD1  . ASP A 1 4  ? 2.725   11.022  -3.287  1.00 0.00 ? 4  ASP A OD1  5  
ATOM 4399  O OD2  . ASP A 1 4  ? 2.755   12.093  -5.206  1.00 0.00 ? 4  ASP A OD2  5  
ATOM 4400  H H    . ASP A 1 4  ? 7.064   13.137  -4.168  1.00 0.00 ? 4  ASP A H    5  
ATOM 4401  H HA   . ASP A 1 4  ? 5.190   12.467  -3.072  1.00 0.00 ? 4  ASP A HA   5  
ATOM 4402  H HB2  . ASP A 1 4  ? 5.035   11.242  -5.547  1.00 0.00 ? 4  ASP A HB2  5  
ATOM 4403  H HB3  . ASP A 1 4  ? 4.809   9.902   -4.427  1.00 0.00 ? 4  ASP A HB3  5  
ATOM 4404  N N    . PRO A 1 5  ? 6.630   11.136  -1.334  1.00 0.00 ? 5  PRO A N    5  
ATOM 4405  C CA   . PRO A 1 5  ? 7.071   10.278  -0.231  1.00 0.00 ? 5  PRO A CA   5  
ATOM 4406  C C    . PRO A 1 5  ? 5.900   9.619   0.490   1.00 0.00 ? 5  PRO A C    5  
ATOM 4407  O O    . PRO A 1 5  ? 6.046   8.552   1.089   1.00 0.00 ? 5  PRO A O    5  
ATOM 4408  C CB   . PRO A 1 5  ? 7.799   11.246  0.702   1.00 0.00 ? 5  PRO A CB   5  
ATOM 4409  C CG   . PRO A 1 5  ? 7.174   12.572  0.432   1.00 0.00 ? 5  PRO A CG   5  
ATOM 4410  C CD   . PRO A 1 5  ? 6.806   12.569  -1.027  1.00 0.00 ? 5  PRO A CD   5  
ATOM 4411  H HA   . PRO A 1 5  ? 7.756   9.516   -0.572  1.00 0.00 ? 5  PRO A HA   5  
ATOM 4412  H HB2  . PRO A 1 5  ? 7.654   10.941  1.728   1.00 0.00 ? 5  PRO A HB2  5  
ATOM 4413  H HB3  . PRO A 1 5  ? 8.853   11.251  0.467   1.00 0.00 ? 5  PRO A HB3  5  
ATOM 4414  H HG2  . PRO A 1 5  ? 6.290   12.691  1.042   1.00 0.00 ? 5  PRO A HG2  5  
ATOM 4415  H HG3  . PRO A 1 5  ? 7.884   13.360  0.638   1.00 0.00 ? 5  PRO A HG3  5  
ATOM 4416  H HD2  . PRO A 1 5  ? 5.886   13.112  -1.185  1.00 0.00 ? 5  PRO A HD2  5  
ATOM 4417  H HD3  . PRO A 1 5  ? 7.604   12.994  -1.618  1.00 0.00 ? 5  PRO A HD3  5  
ATOM 4418  N N    . SER A 1 6  ? 4.736   10.258  0.425   1.00 0.00 ? 6  SER A N    5  
ATOM 4419  C CA   . SER A 1 6  ? 3.538   9.732   1.068   1.00 0.00 ? 6  SER A CA   5  
ATOM 4420  C C    . SER A 1 6  ? 2.923   8.611   0.239   1.00 0.00 ? 6  SER A C    5  
ATOM 4421  O O    . SER A 1 6  ? 1.772   8.702   -0.191  1.00 0.00 ? 6  SER A O    5  
ATOM 4422  C CB   . SER A 1 6  ? 2.514   10.850  1.275   1.00 0.00 ? 6  SER A CB   5  
ATOM 4423  O OG   . SER A 1 6  ? 1.711   10.603  2.417   1.00 0.00 ? 6  SER A OG   5  
ATOM 4424  H H    . SER A 1 6  ? 4.681   11.102  -0.069  1.00 0.00 ? 6  SER A H    5  
ATOM 4425  H HA   . SER A 1 6  ? 3.826   9.335   2.030   1.00 0.00 ? 6  SER A HA   5  
ATOM 4426  H HB2  . SER A 1 6  ? 3.031   11.789  1.411   1.00 0.00 ? 6  SER A HB2  5  
ATOM 4427  H HB3  . SER A 1 6  ? 1.873   10.914  0.408   1.00 0.00 ? 6  SER A HB3  5  
ATOM 4428  H HG   . SER A 1 6  ? 1.007   9.993   2.187   1.00 0.00 ? 6  SER A HG   5  
ATOM 4429  N N    . LEU A 1 7  ? 3.696   7.553   0.016   1.00 0.00 ? 7  LEU A N    5  
ATOM 4430  C CA   . LEU A 1 7  ? 3.228   6.414   -0.764  1.00 0.00 ? 7  LEU A CA   5  
ATOM 4431  C C    . LEU A 1 7  ? 4.166   5.223   -0.604  1.00 0.00 ? 7  LEU A C    5  
ATOM 4432  O O    . LEU A 1 7  ? 3.756   4.150   -0.163  1.00 0.00 ? 7  LEU A O    5  
ATOM 4433  C CB   . LEU A 1 7  ? 3.114   6.794   -2.242  1.00 0.00 ? 7  LEU A CB   5  
ATOM 4434  C CG   . LEU A 1 7  ? 2.816   5.632   -3.197  1.00 0.00 ? 7  LEU A CG   5  
ATOM 4435  C CD1  . LEU A 1 7  ? 4.086   4.851   -3.501  1.00 0.00 ? 7  LEU A CD1  5  
ATOM 4436  C CD2  . LEU A 1 7  ? 1.750   4.716   -2.614  1.00 0.00 ? 7  LEU A CD2  5  
ATOM 4437  H H    . LEU A 1 7  ? 4.604   7.539   0.385   1.00 0.00 ? 7  LEU A H    5  
ATOM 4438  H HA   . LEU A 1 7  ? 2.251   6.139   -0.395  1.00 0.00 ? 7  LEU A HA   5  
ATOM 4439  H HB2  . LEU A 1 7  ? 2.326   7.525   -2.344  1.00 0.00 ? 7  LEU A HB2  5  
ATOM 4440  H HB3  . LEU A 1 7  ? 4.045   7.251   -2.546  1.00 0.00 ? 7  LEU A HB3  5  
ATOM 4441  H HG   . LEU A 1 7  ? 2.440   6.029   -4.128  1.00 0.00 ? 7  LEU A HG   5  
ATOM 4442  H HD11 . LEU A 1 7  ? 4.120   3.965   -2.885  1.00 0.00 ? 7  LEU A HD11 5  
ATOM 4443  H HD12 . LEU A 1 7  ? 4.948   5.468   -3.292  1.00 0.00 ? 7  LEU A HD12 5  
ATOM 4444  H HD13 . LEU A 1 7  ? 4.092   4.566   -4.543  1.00 0.00 ? 7  LEU A HD13 5  
ATOM 4445  H HD21 . LEU A 1 7  ? 0.812   5.247   -2.554  1.00 0.00 ? 7  LEU A HD21 5  
ATOM 4446  H HD22 . LEU A 1 7  ? 2.048   4.401   -1.626  1.00 0.00 ? 7  LEU A HD22 5  
ATOM 4447  H HD23 . LEU A 1 7  ? 1.634   3.850   -3.248  1.00 0.00 ? 7  LEU A HD23 5  
ATOM 4448  N N    . VAL A 1 8  ? 5.428   5.420   -0.971  1.00 0.00 ? 8  VAL A N    5  
ATOM 4449  C CA   . VAL A 1 8  ? 6.427   4.363   -0.870  1.00 0.00 ? 8  VAL A CA   5  
ATOM 4450  C C    . VAL A 1 8  ? 6.726   4.030   0.587   1.00 0.00 ? 8  VAL A C    5  
ATOM 4451  O O    . VAL A 1 8  ? 6.845   2.861   0.956   1.00 0.00 ? 8  VAL A O    5  
ATOM 4452  C CB   . VAL A 1 8  ? 7.737   4.759   -1.577  1.00 0.00 ? 8  VAL A CB   5  
ATOM 4453  C CG1  . VAL A 1 8  ? 8.756   3.633   -1.485  1.00 0.00 ? 8  VAL A CG1  5  
ATOM 4454  C CG2  . VAL A 1 8  ? 7.470   5.131   -3.027  1.00 0.00 ? 8  VAL A CG2  5  
ATOM 4455  H H    . VAL A 1 8  ? 5.695   6.297   -1.317  1.00 0.00 ? 8  VAL A H    5  
ATOM 4456  H HA   . VAL A 1 8  ? 6.033   3.483   -1.357  1.00 0.00 ? 8  VAL A HA   5  
ATOM 4457  H HB   . VAL A 1 8  ? 8.145   5.625   -1.077  1.00 0.00 ? 8  VAL A HB   5  
ATOM 4458  H HG11 . VAL A 1 8  ? 8.479   2.842   -2.165  1.00 0.00 ? 8  VAL A HG11 5  
ATOM 4459  H HG12 . VAL A 1 8  ? 8.780   3.250   -0.476  1.00 0.00 ? 8  VAL A HG12 5  
ATOM 4460  H HG13 . VAL A 1 8  ? 9.733   4.010   -1.751  1.00 0.00 ? 8  VAL A HG13 5  
ATOM 4461  H HG21 . VAL A 1 8  ? 7.183   6.170   -3.085  1.00 0.00 ? 8  VAL A HG21 5  
ATOM 4462  H HG22 . VAL A 1 8  ? 6.673   4.515   -3.416  1.00 0.00 ? 8  VAL A HG22 5  
ATOM 4463  H HG23 . VAL A 1 8  ? 8.365   4.971   -3.610  1.00 0.00 ? 8  VAL A HG23 5  
ATOM 4464  N N    . SER A 1 9  ? 6.844   5.065   1.413   1.00 0.00 ? 9  SER A N    5  
ATOM 4465  C CA   . SER A 1 9  ? 7.128   4.883   2.832   1.00 0.00 ? 9  SER A CA   5  
ATOM 4466  C C    . SER A 1 9  ? 6.093   3.972   3.483   1.00 0.00 ? 9  SER A C    5  
ATOM 4467  O O    . SER A 1 9  ? 6.369   3.333   4.499   1.00 0.00 ? 9  SER A O    5  
ATOM 4468  C CB   . SER A 1 9  ? 7.153   6.236   3.545   1.00 0.00 ? 9  SER A CB   5  
ATOM 4469  O OG   . SER A 1 9  ? 7.506   7.279   2.652   1.00 0.00 ? 9  SER A OG   5  
ATOM 4470  H H    . SER A 1 9  ? 6.739   5.972   1.059   1.00 0.00 ? 9  SER A H    5  
ATOM 4471  H HA   . SER A 1 9  ? 8.100   4.423   2.918   1.00 0.00 ? 9  SER A HA   5  
ATOM 4472  H HB2  . SER A 1 9  ? 6.175   6.444   3.953   1.00 0.00 ? 9  SER A HB2  5  
ATOM 4473  H HB3  . SER A 1 9  ? 7.878   6.204   4.345   1.00 0.00 ? 9  SER A HB3  5  
ATOM 4474  H HG   . SER A 1 9  ? 8.462   7.345   2.599   1.00 0.00 ? 9  SER A HG   5  
ATOM 4475  N N    . PHE A 1 10 ? 4.903   3.917   2.894   1.00 0.00 ? 10 PHE A N    5  
ATOM 4476  C CA   . PHE A 1 10 ? 3.828   3.087   3.424   1.00 0.00 ? 10 PHE A CA   5  
ATOM 4477  C C    . PHE A 1 10 ? 3.738   1.763   2.677   1.00 0.00 ? 10 PHE A C    5  
ATOM 4478  O O    . PHE A 1 10 ? 3.600   0.703   3.288   1.00 0.00 ? 10 PHE A O    5  
ATOM 4479  C CB   . PHE A 1 10 ? 2.493   3.826   3.332   1.00 0.00 ? 10 PHE A CB   5  
ATOM 4480  C CG   . PHE A 1 10 ? 2.098   4.516   4.605   1.00 0.00 ? 10 PHE A CG   5  
ATOM 4481  C CD1  . PHE A 1 10 ? 1.421   3.829   5.600   1.00 0.00 ? 10 PHE A CD1  5  
ATOM 4482  C CD2  . PHE A 1 10 ? 2.399   5.854   4.806   1.00 0.00 ? 10 PHE A CD2  5  
ATOM 4483  C CE1  . PHE A 1 10 ? 1.054   4.461   6.772   1.00 0.00 ? 10 PHE A CE1  5  
ATOM 4484  C CE2  . PHE A 1 10 ? 2.035   6.491   5.976   1.00 0.00 ? 10 PHE A CE2  5  
ATOM 4485  C CZ   . PHE A 1 10 ? 1.362   5.795   6.961   1.00 0.00 ? 10 PHE A CZ   5  
ATOM 4486  H H    . PHE A 1 10 ? 4.742   4.451   2.089   1.00 0.00 ? 10 PHE A H    5  
ATOM 4487  H HA   . PHE A 1 10 ? 4.050   2.883   4.462   1.00 0.00 ? 10 PHE A HA   5  
ATOM 4488  H HB2  . PHE A 1 10 ? 2.557   4.574   2.554   1.00 0.00 ? 10 PHE A HB2  5  
ATOM 4489  H HB3  . PHE A 1 10 ? 1.715   3.120   3.081   1.00 0.00 ? 10 PHE A HB3  5  
ATOM 4490  H HD1  . PHE A 1 10 ? 1.181   2.786   5.453   1.00 0.00 ? 10 PHE A HD1  5  
ATOM 4491  H HD2  . PHE A 1 10 ? 2.925   6.399   4.037   1.00 0.00 ? 10 PHE A HD2  5  
ATOM 4492  H HE1  . PHE A 1 10 ? 0.529   3.913   7.540   1.00 0.00 ? 10 PHE A HE1  5  
ATOM 4493  H HE2  . PHE A 1 10 ? 2.276   7.534   6.121   1.00 0.00 ? 10 PHE A HE2  5  
ATOM 4494  H HZ   . PHE A 1 10 ? 1.076   6.291   7.876   1.00 0.00 ? 10 PHE A HZ   5  
ATOM 4495  N N    . LEU A 1 11 ? 3.818   1.826   1.350   1.00 0.00 ? 11 LEU A N    5  
ATOM 4496  C CA   . LEU A 1 11 ? 3.746   0.629   0.517   1.00 0.00 ? 11 LEU A CA   5  
ATOM 4497  C C    . LEU A 1 11 ? 4.635   -0.479  1.069   1.00 0.00 ? 11 LEU A C    5  
ATOM 4498  O O    . LEU A 1 11 ? 4.178   -1.596  1.312   1.00 0.00 ? 11 LEU A O    5  
ATOM 4499  C CB   . LEU A 1 11 ? 4.165   0.958   -0.917  1.00 0.00 ? 11 LEU A CB   5  
ATOM 4500  C CG   . LEU A 1 11 ? 3.507   0.099   -2.000  1.00 0.00 ? 11 LEU A CG   5  
ATOM 4501  C CD1  . LEU A 1 11 ? 3.127   0.956   -3.198  1.00 0.00 ? 11 LEU A CD1  5  
ATOM 4502  C CD2  . LEU A 1 11 ? 4.436   -1.030  -2.421  1.00 0.00 ? 11 LEU A CD2  5  
ATOM 4503  H H    . LEU A 1 11 ? 3.929   2.700   0.921   1.00 0.00 ? 11 LEU A H    5  
ATOM 4504  H HA   . LEU A 1 11 ? 2.724   0.286   0.518   1.00 0.00 ? 11 LEU A HA   5  
ATOM 4505  H HB2  . LEU A 1 11 ? 3.922   1.992   -1.111  1.00 0.00 ? 11 LEU A HB2  5  
ATOM 4506  H HB3  . LEU A 1 11 ? 5.236   0.838   -0.990  1.00 0.00 ? 11 LEU A HB3  5  
ATOM 4507  H HG   . LEU A 1 11 ? 2.604   -0.341  -1.605  1.00 0.00 ? 11 LEU A HG   5  
ATOM 4508  H HD11 . LEU A 1 11 ? 4.008   1.449   -3.582  1.00 0.00 ? 11 LEU A HD11 5  
ATOM 4509  H HD12 . LEU A 1 11 ? 2.404   1.697   -2.894  1.00 0.00 ? 11 LEU A HD12 5  
ATOM 4510  H HD13 . LEU A 1 11 ? 2.700   0.329   -3.967  1.00 0.00 ? 11 LEU A HD13 5  
ATOM 4511  H HD21 . LEU A 1 11 ? 4.632   -0.960  -3.480  1.00 0.00 ? 11 LEU A HD21 5  
ATOM 4512  H HD22 . LEU A 1 11 ? 3.968   -1.980  -2.204  1.00 0.00 ? 11 LEU A HD22 5  
ATOM 4513  H HD23 . LEU A 1 11 ? 5.365   -0.955  -1.876  1.00 0.00 ? 11 LEU A HD23 5  
ATOM 4514  N N    . THR A 1 12 ? 5.903   -0.153  1.269   1.00 0.00 ? 12 THR A N    5  
ATOM 4515  C CA   . THR A 1 12 ? 6.862   -1.110  1.804   1.00 0.00 ? 12 THR A CA   5  
ATOM 4516  C C    . THR A 1 12 ? 6.673   -1.275  3.307   1.00 0.00 ? 12 THR A C    5  
ATOM 4517  O O    . THR A 1 12 ? 6.575   -2.396  3.811   1.00 0.00 ? 12 THR A O    5  
ATOM 4518  C CB   . THR A 1 12 ? 8.290   -0.649  1.505   1.00 0.00 ? 12 THR A CB   5  
ATOM 4519  O OG1  . THR A 1 12 ? 8.436   -0.333  0.132   1.00 0.00 ? 12 THR A OG1  5  
ATOM 4520  C CG2  . THR A 1 12 ? 9.339   -1.681  1.855   1.00 0.00 ? 12 THR A CG2  5  
ATOM 4521  H H    . THR A 1 12 ? 6.200   0.756   1.059   1.00 0.00 ? 12 THR A H    5  
ATOM 4522  H HA   . THR A 1 12 ? 6.688   -2.060  1.323   1.00 0.00 ? 12 THR A HA   5  
ATOM 4523  H HB   . THR A 1 12 ? 8.499   0.240   2.083   1.00 0.00 ? 12 THR A HB   5  
ATOM 4524  H HG1  . THR A 1 12 ? 8.406   0.620   0.017   1.00 0.00 ? 12 THR A HG1  5  
ATOM 4525  H HG21 . THR A 1 12 ? 9.773   -1.442  2.815   1.00 0.00 ? 12 THR A HG21 5  
ATOM 4526  H HG22 . THR A 1 12 ? 10.111  -1.680  1.100   1.00 0.00 ? 12 THR A HG22 5  
ATOM 4527  H HG23 . THR A 1 12 ? 8.881   -2.658  1.901   1.00 0.00 ? 12 THR A HG23 5  
ATOM 4528  N N    . GLY A 1 13 ? 6.615   -0.150  4.016   1.00 0.00 ? 13 GLY A N    5  
ATOM 4529  C CA   . GLY A 1 13 ? 6.431   -0.186  5.454   1.00 0.00 ? 13 GLY A CA   5  
ATOM 4530  C C    . GLY A 1 13 ? 5.257   -1.053  5.859   1.00 0.00 ? 13 GLY A C    5  
ATOM 4531  O O    . GLY A 1 13 ? 5.208   -1.569  6.975   1.00 0.00 ? 13 GLY A O    5  
ATOM 4532  H H    . GLY A 1 13 ? 6.688   0.712   3.554   1.00 0.00 ? 13 GLY A H    5  
ATOM 4533  H HA2  . GLY A 1 13 ? 7.328   -0.576  5.913   1.00 0.00 ? 13 GLY A HA2  5  
ATOM 4534  H HA3  . GLY A 1 13 ? 6.263   0.820   5.812   1.00 0.00 ? 13 GLY A HA3  5  
ATOM 4535  N N    . LEU A 1 14 ? 4.309   -1.210  4.942   1.00 0.00 ? 14 LEU A N    5  
ATOM 4536  C CA   . LEU A 1 14 ? 3.136   -2.029  5.183   1.00 0.00 ? 14 LEU A CA   5  
ATOM 4537  C C    . LEU A 1 14 ? 3.528   -3.466  5.518   1.00 0.00 ? 14 LEU A C    5  
ATOM 4538  O O    . LEU A 1 14 ? 2.733   -4.222  6.079   1.00 0.00 ? 14 LEU A O    5  
ATOM 4539  C CB   . LEU A 1 14 ? 2.251   -2.012  3.936   1.00 0.00 ? 14 LEU A CB   5  
ATOM 4540  C CG   . LEU A 1 14 ? 0.763   -1.750  4.173   1.00 0.00 ? 14 LEU A CG   5  
ATOM 4541  C CD1  . LEU A 1 14 ? 0.560   -0.646  5.201   1.00 0.00 ? 14 LEU A CD1  5  
ATOM 4542  C CD2  . LEU A 1 14 ? 0.083   -1.385  2.864   1.00 0.00 ? 14 LEU A CD2  5  
ATOM 4543  H H    . LEU A 1 14 ? 4.411   -0.781  4.068   1.00 0.00 ? 14 LEU A H    5  
ATOM 4544  H HA   . LEU A 1 14 ? 2.598   -1.610  6.019   1.00 0.00 ? 14 LEU A HA   5  
ATOM 4545  H HB2  . LEU A 1 14 ? 2.623   -1.245  3.273   1.00 0.00 ? 14 LEU A HB2  5  
ATOM 4546  H HB3  . LEU A 1 14 ? 2.354   -2.963  3.440   1.00 0.00 ? 14 LEU A HB3  5  
ATOM 4547  H HG   . LEU A 1 14 ? 0.302   -2.650  4.550   1.00 0.00 ? 14 LEU A HG   5  
ATOM 4548  H HD11 . LEU A 1 14 ? 0.361   -1.086  6.167   1.00 0.00 ? 14 LEU A HD11 5  
ATOM 4549  H HD12 . LEU A 1 14 ? -0.277  -0.029  4.907   1.00 0.00 ? 14 LEU A HD12 5  
ATOM 4550  H HD13 . LEU A 1 14 ? 1.452   -0.040  5.257   1.00 0.00 ? 14 LEU A HD13 5  
ATOM 4551  H HD21 . LEU A 1 14 ? 0.455   -2.024  2.076   1.00 0.00 ? 14 LEU A HD21 5  
ATOM 4552  H HD22 . LEU A 1 14 ? 0.299   -0.355  2.623   1.00 0.00 ? 14 LEU A HD22 5  
ATOM 4553  H HD23 . LEU A 1 14 ? -0.983  -1.515  2.963   1.00 0.00 ? 14 LEU A HD23 5  
ATOM 4554  N N    . GLY A 1 15 ? 4.755   -3.838  5.169   1.00 0.00 ? 15 GLY A N    5  
ATOM 4555  C CA   . GLY A 1 15 ? 5.223   -5.185  5.417   1.00 0.00 ? 15 GLY A CA   5  
ATOM 4556  C C    . GLY A 1 15 ? 5.437   -5.959  4.132   1.00 0.00 ? 15 GLY A C    5  
ATOM 4557  O O    . GLY A 1 15 ? 5.477   -7.191  4.141   1.00 0.00 ? 15 GLY A O    5  
ATOM 4558  H H    . GLY A 1 15 ? 5.341   -3.200  4.712   1.00 0.00 ? 15 GLY A H    5  
ATOM 4559  H HA2  . GLY A 1 15 ? 6.156   -5.138  5.958   1.00 0.00 ? 15 GLY A HA2  5  
ATOM 4560  H HA3  . GLY A 1 15 ? 4.493   -5.704  6.021   1.00 0.00 ? 15 GLY A HA3  5  
ATOM 4561  N N    . CYS A 1 16 ? 5.569   -5.237  3.022   1.00 0.00 ? 16 CYS A N    5  
ATOM 4562  C CA   . CYS A 1 16 ? 5.770   -5.867  1.723   1.00 0.00 ? 16 CYS A CA   5  
ATOM 4563  C C    . CYS A 1 16 ? 6.887   -5.178  0.945   1.00 0.00 ? 16 CYS A C    5  
ATOM 4564  O O    . CYS A 1 16 ? 6.629   -4.406  0.022   1.00 0.00 ? 16 CYS A O    5  
ATOM 4565  C CB   . CYS A 1 16 ? 4.471   -5.833  0.916   1.00 0.00 ? 16 CYS A CB   5  
ATOM 4566  S SG   . CYS A 1 16 ? 2.984   -6.134  1.897   1.00 0.00 ? 16 CYS A SG   5  
ATOM 4567  H H    . CYS A 1 16 ? 5.524   -4.257  3.077   1.00 0.00 ? 16 CYS A H    5  
ATOM 4568  H HA   . CYS A 1 16 ? 6.050   -6.896  1.895   1.00 0.00 ? 16 CYS A HA   5  
ATOM 4569  H HB2  . CYS A 1 16 ? 4.370   -4.861  0.455   1.00 0.00 ? 16 CYS A HB2  5  
ATOM 4570  H HB3  . CYS A 1 16 ? 4.515   -6.588  0.146   1.00 0.00 ? 16 CYS A HB3  5  
ATOM 4571  H HG   . CYS A 1 16 ? 3.226   -6.698  2.636   1.00 0.00 ? 16 CYS A HG   5  
ATOM 4572  N N    . PRO A 1 17 ? 8.152   -5.465  1.297   1.00 0.00 ? 17 PRO A N    5  
ATOM 4573  C CA   . PRO A 1 17 ? 9.313   -4.868  0.641   1.00 0.00 ? 17 PRO A CA   5  
ATOM 4574  C C    . PRO A 1 17 ? 9.765   -5.650  -0.591  1.00 0.00 ? 17 PRO A C    5  
ATOM 4575  O O    . PRO A 1 17 ? 10.902  -5.510  -1.040  1.00 0.00 ? 17 PRO A O    5  
ATOM 4576  C CB   . PRO A 1 17 ? 10.376  -4.937  1.732   1.00 0.00 ? 17 PRO A CB   5  
ATOM 4577  C CG   . PRO A 1 17 ? 10.049  -6.182  2.490   1.00 0.00 ? 17 PRO A CG   5  
ATOM 4578  C CD   . PRO A 1 17 ? 8.553   -6.368  2.394   1.00 0.00 ? 17 PRO A CD   5  
ATOM 4579  H HA   . PRO A 1 17 ? 9.132   -3.838  0.371   1.00 0.00 ? 17 PRO A HA   5  
ATOM 4580  H HB2  . PRO A 1 17 ? 11.355  -4.994  1.282   1.00 0.00 ? 17 PRO A HB2  5  
ATOM 4581  H HB3  . PRO A 1 17 ? 10.310  -4.062  2.360   1.00 0.00 ? 17 PRO A HB3  5  
ATOM 4582  H HG2  . PRO A 1 17 ? 10.559  -7.024  2.046   1.00 0.00 ? 17 PRO A HG2  5  
ATOM 4583  H HG3  . PRO A 1 17 ? 10.345  -6.069  3.523   1.00 0.00 ? 17 PRO A HG3  5  
ATOM 4584  H HD2  . PRO A 1 17 ? 8.316   -7.394  2.152   1.00 0.00 ? 17 PRO A HD2  5  
ATOM 4585  H HD3  . PRO A 1 17 ? 8.078   -6.080  3.320   1.00 0.00 ? 17 PRO A HD3  5  
ATOM 4586  N N    . ASN A 1 18 ? 8.873   -6.476  -1.132  1.00 0.00 ? 18 ASN A N    5  
ATOM 4587  C CA   . ASN A 1 18 ? 9.196   -7.280  -2.306  1.00 0.00 ? 18 ASN A CA   5  
ATOM 4588  C C    . ASN A 1 18 ? 7.995   -7.411  -3.242  1.00 0.00 ? 18 ASN A C    5  
ATOM 4589  O O    . ASN A 1 18 ? 7.944   -8.318  -4.073  1.00 0.00 ? 18 ASN A O    5  
ATOM 4590  C CB   . ASN A 1 18 ? 9.674   -8.669  -1.878  1.00 0.00 ? 18 ASN A CB   5  
ATOM 4591  C CG   . ASN A 1 18 ? 11.093  -8.958  -2.328  1.00 0.00 ? 18 ASN A CG   5  
ATOM 4592  O OD1  . ASN A 1 18 ? 11.322  -9.807  -3.190  1.00 0.00 ? 18 ASN A OD1  5  
ATOM 4593  N ND2  . ASN A 1 18 ? 12.054  -8.252  -1.744  1.00 0.00 ? 18 ASN A ND2  5  
ATOM 4594  H H    . ASN A 1 18 ? 7.982   -6.552  -0.730  1.00 0.00 ? 18 ASN A H    5  
ATOM 4595  H HA   . ASN A 1 18 ? 9.995   -6.783  -2.836  1.00 0.00 ? 18 ASN A HA   5  
ATOM 4596  H HB2  . ASN A 1 18 ? 9.636   -8.740  -0.801  1.00 0.00 ? 18 ASN A HB2  5  
ATOM 4597  H HB3  . ASN A 1 18 ? 9.022   -9.416  -2.307  1.00 0.00 ? 18 ASN A HB3  5  
ATOM 4598  H HD21 . ASN A 1 18 ? 11.798  -7.594  -1.065  1.00 0.00 ? 18 ASN A HD21 5  
ATOM 4599  H HD22 . ASN A 1 18 ? 12.981  -8.420  -2.016  1.00 0.00 ? 18 ASN A HD22 5  
ATOM 4600  N N    . CYS A 1 19 ? 7.036   -6.498  -3.112  1.00 0.00 ? 19 CYS A N    5  
ATOM 4601  C CA   . CYS A 1 19 ? 5.841   -6.526  -3.949  1.00 0.00 ? 19 CYS A CA   5  
ATOM 4602  C C    . CYS A 1 19 ? 5.701   -5.241  -4.762  1.00 0.00 ? 19 CYS A C    5  
ATOM 4603  O O    . CYS A 1 19 ? 5.166   -5.254  -5.870  1.00 0.00 ? 19 CYS A O    5  
ATOM 4604  C CB   . CYS A 1 19 ? 4.593   -6.738  -3.087  1.00 0.00 ? 19 CYS A CB   5  
ATOM 4605  S SG   . CYS A 1 19 ? 4.108   -5.294  -2.113  1.00 0.00 ? 19 CYS A SG   5  
ATOM 4606  H H    . CYS A 1 19 ? 7.127   -5.802  -2.430  1.00 0.00 ? 19 CYS A H    5  
ATOM 4607  H HA   . CYS A 1 19 ? 5.939   -7.354  -4.633  1.00 0.00 ? 19 CYS A HA   5  
ATOM 4608  H HB2  . CYS A 1 19 ? 3.762   -6.995  -3.727  1.00 0.00 ? 19 CYS A HB2  5  
ATOM 4609  H HB3  . CYS A 1 19 ? 4.775   -7.550  -2.399  1.00 0.00 ? 19 CYS A HB3  5  
ATOM 4610  H HG   . CYS A 1 19 ? 3.340   -5.535  -1.589  1.00 0.00 ? 19 CYS A HG   5  
ATOM 4611  N N    . ILE A 1 20 ? 6.184   -4.134  -4.205  1.00 0.00 ? 20 ILE A N    5  
ATOM 4612  C CA   . ILE A 1 20 ? 6.105   -2.841  -4.876  1.00 0.00 ? 20 ILE A CA   5  
ATOM 4613  C C    . ILE A 1 20 ? 6.542   -2.938  -6.331  1.00 0.00 ? 20 ILE A C    5  
ATOM 4614  O O    . ILE A 1 20 ? 6.077   -2.182  -7.176  1.00 0.00 ? 20 ILE A O    5  
ATOM 4615  C CB   . ILE A 1 20 ? 6.981   -1.793  -4.172  1.00 0.00 ? 20 ILE A CB   5  
ATOM 4616  C CG1  . ILE A 1 20 ? 6.804   -0.424  -4.835  1.00 0.00 ? 20 ILE A CG1  5  
ATOM 4617  C CG2  . ILE A 1 20 ? 8.437   -2.226  -4.220  1.00 0.00 ? 20 ILE A CG2  5  
ATOM 4618  C CD1  . ILE A 1 20 ? 7.158   0.738   -3.933  1.00 0.00 ? 20 ILE A CD1  5  
ATOM 4619  H H    . ILE A 1 20 ? 6.594   -4.186  -3.318  1.00 0.00 ? 20 ILE A H    5  
ATOM 4620  H HA   . ILE A 1 20 ? 5.080   -2.508  -4.841  1.00 0.00 ? 20 ILE A HA   5  
ATOM 4621  H HB   . ILE A 1 20 ? 6.679   -1.734  -3.138  1.00 0.00 ? 20 ILE A HB   5  
ATOM 4622  H HG12 . ILE A 1 20 ? 7.435   -0.370  -5.708  1.00 0.00 ? 20 ILE A HG12 5  
ATOM 4623  H HG13 . ILE A 1 20 ? 5.772   -0.309  -5.134  1.00 0.00 ? 20 ILE A HG13 5  
ATOM 4624  H HG21 . ILE A 1 20 ? 8.491   -3.305  -4.184  1.00 0.00 ? 20 ILE A HG21 5  
ATOM 4625  H HG22 . ILE A 1 20 ? 8.966   -1.809  -3.376  1.00 0.00 ? 20 ILE A HG22 5  
ATOM 4626  H HG23 . ILE A 1 20 ? 8.884   -1.873  -5.138  1.00 0.00 ? 20 ILE A HG23 5  
ATOM 4627  H HD11 . ILE A 1 20 ? 6.499   0.746   -3.078  1.00 0.00 ? 20 ILE A HD11 5  
ATOM 4628  H HD12 . ILE A 1 20 ? 7.050   1.663   -4.481  1.00 0.00 ? 20 ILE A HD12 5  
ATOM 4629  H HD13 . ILE A 1 20 ? 8.180   0.635   -3.598  1.00 0.00 ? 20 ILE A HD13 5  
ATOM 4630  N N    . GLU A 1 21 ? 7.459   -3.853  -6.610  1.00 0.00 ? 21 GLU A N    5  
ATOM 4631  C CA   . GLU A 1 21 ? 7.945   -4.051  -7.967  1.00 0.00 ? 21 GLU A CA   5  
ATOM 4632  C C    . GLU A 1 21 ? 6.827   -4.567  -8.859  1.00 0.00 ? 21 GLU A C    5  
ATOM 4633  O O    . GLU A 1 21 ? 6.662   -4.123  -9.996  1.00 0.00 ? 21 GLU A O    5  
ATOM 4634  C CB   . GLU A 1 21 ? 9.096   -5.048  -7.972  1.00 0.00 ? 21 GLU A CB   5  
ATOM 4635  C CG   . GLU A 1 21 ? 10.276  -4.626  -7.111  1.00 0.00 ? 21 GLU A CG   5  
ATOM 4636  C CD   . GLU A 1 21 ? 11.466  -4.167  -7.932  1.00 0.00 ? 21 GLU A CD   5  
ATOM 4637  O OE1  . GLU A 1 21 ? 11.488  -4.437  -9.151  1.00 0.00 ? 21 GLU A OE1  5  
ATOM 4638  O OE2  . GLU A 1 21 ? 12.377  -3.538  -7.353  1.00 0.00 ? 21 GLU A OE2  5  
ATOM 4639  H H    . GLU A 1 21 ? 7.793   -4.432  -5.893  1.00 0.00 ? 21 GLU A H    5  
ATOM 4640  H HA   . GLU A 1 21 ? 8.291   -3.100  -8.345  1.00 0.00 ? 21 GLU A HA   5  
ATOM 4641  H HB2  . GLU A 1 21 ? 8.726   -5.990  -7.604  1.00 0.00 ? 21 GLU A HB2  5  
ATOM 4642  H HB3  . GLU A 1 21 ? 9.441   -5.177  -8.986  1.00 0.00 ? 21 GLU A HB3  5  
ATOM 4643  H HG2  . GLU A 1 21 ? 9.966   -3.814  -6.471  1.00 0.00 ? 21 GLU A HG2  5  
ATOM 4644  H HG3  . GLU A 1 21 ? 10.580  -5.466  -6.504  1.00 0.00 ? 21 GLU A HG3  5  
ATOM 4645  N N    . TYR A 1 22 ? 6.076   -5.530  -8.338  1.00 0.00 ? 22 TYR A N    5  
ATOM 4646  C CA   . TYR A 1 22 ? 4.953   -6.097  -9.065  1.00 0.00 ? 22 TYR A CA   5  
ATOM 4647  C C    . TYR A 1 22 ? 3.787   -5.123  -9.053  1.00 0.00 ? 22 TYR A C    5  
ATOM 4648  O O    . TYR A 1 22 ? 2.980   -5.086  -9.983  1.00 0.00 ? 22 TYR A O    5  
ATOM 4649  C CB   . TYR A 1 22 ? 4.533   -7.430  -8.443  1.00 0.00 ? 22 TYR A CB   5  
ATOM 4650  C CG   . TYR A 1 22 ? 5.666   -8.422  -8.317  1.00 0.00 ? 22 TYR A CG   5  
ATOM 4651  C CD1  . TYR A 1 22 ? 6.582   -8.333  -7.277  1.00 0.00 ? 22 TYR A CD1  5  
ATOM 4652  C CD2  . TYR A 1 22 ? 5.821   -9.446  -9.243  1.00 0.00 ? 22 TYR A CD2  5  
ATOM 4653  C CE1  . TYR A 1 22 ? 7.619   -9.238  -7.161  1.00 0.00 ? 22 TYR A CE1  5  
ATOM 4654  C CE2  . TYR A 1 22 ? 6.856   -10.355 -9.134  1.00 0.00 ? 22 TYR A CE2  5  
ATOM 4655  C CZ   . TYR A 1 22 ? 7.753   -10.246 -8.092  1.00 0.00 ? 22 TYR A CZ   5  
ATOM 4656  O OH   . TYR A 1 22 ? 8.784   -11.149 -7.980  1.00 0.00 ? 22 TYR A OH   5  
ATOM 4657  H H    . TYR A 1 22 ? 6.250   -5.822  -7.419  1.00 0.00 ? 22 TYR A H    5  
ATOM 4658  H HA   . TYR A 1 22 ? 5.263   -6.263  -10.086 1.00 0.00 ? 22 TYR A HA   5  
ATOM 4659  H HB2  . TYR A 1 22 ? 4.138   -7.249  -7.454  1.00 0.00 ? 22 TYR A HB2  5  
ATOM 4660  H HB3  . TYR A 1 22 ? 3.766   -7.878  -9.056  1.00 0.00 ? 22 TYR A HB3  5  
ATOM 4661  H HD1  . TYR A 1 22 ? 6.475   -7.542  -6.549  1.00 0.00 ? 22 TYR A HD1  5  
ATOM 4662  H HD2  . TYR A 1 22 ? 5.117   -9.527  -10.059 1.00 0.00 ? 22 TYR A HD2  5  
ATOM 4663  H HE1  . TYR A 1 22 ? 8.321   -9.152  -6.345  1.00 0.00 ? 22 TYR A HE1  5  
ATOM 4664  H HE2  . TYR A 1 22 ? 6.960   -11.144 -9.863  1.00 0.00 ? 22 TYR A HE2  5  
ATOM 4665  H HH   . TYR A 1 22 ? 8.440   -11.992 -7.676  1.00 0.00 ? 22 TYR A HH   5  
ATOM 4666  N N    . PHE A 1 23 ? 3.720   -4.319  -7.999  1.00 0.00 ? 23 PHE A N    5  
ATOM 4667  C CA   . PHE A 1 23 ? 2.684   -3.310  -7.873  1.00 0.00 ? 23 PHE A CA   5  
ATOM 4668  C C    . PHE A 1 23 ? 3.024   -2.105  -8.741  1.00 0.00 ? 23 PHE A C    5  
ATOM 4669  O O    . PHE A 1 23 ? 2.135   -1.424  -9.254  1.00 0.00 ? 23 PHE A O    5  
ATOM 4670  C CB   . PHE A 1 23 ? 2.535   -2.880  -6.413  1.00 0.00 ? 23 PHE A CB   5  
ATOM 4671  C CG   . PHE A 1 23 ? 1.642   -3.779  -5.607  1.00 0.00 ? 23 PHE A CG   5  
ATOM 4672  C CD1  . PHE A 1 23 ? 0.267   -3.611  -5.630  1.00 0.00 ? 23 PHE A CD1  5  
ATOM 4673  C CD2  . PHE A 1 23 ? 2.178   -4.788  -4.821  1.00 0.00 ? 23 PHE A CD2  5  
ATOM 4674  C CE1  . PHE A 1 23 ? -0.558  -4.435  -4.888  1.00 0.00 ? 23 PHE A CE1  5  
ATOM 4675  C CE2  . PHE A 1 23 ? 1.357   -5.614  -4.077  1.00 0.00 ? 23 PHE A CE2  5  
ATOM 4676  C CZ   . PHE A 1 23 ? -0.012  -5.437  -4.112  1.00 0.00 ? 23 PHE A CZ   5  
ATOM 4677  H H    . PHE A 1 23 ? 4.407   -4.386  -7.302  1.00 0.00 ? 23 PHE A H    5  
ATOM 4678  H HA   . PHE A 1 23 ? 1.754   -3.739  -8.216  1.00 0.00 ? 23 PHE A HA   5  
ATOM 4679  H HB2  . PHE A 1 23 ? 3.510   -2.876  -5.946  1.00 0.00 ? 23 PHE A HB2  5  
ATOM 4680  H HB3  . PHE A 1 23 ? 2.122   -1.884  -6.378  1.00 0.00 ? 23 PHE A HB3  5  
ATOM 4681  H HD1  . PHE A 1 23 ? -0.161  -2.827  -6.238  1.00 0.00 ? 23 PHE A HD1  5  
ATOM 4682  H HD2  . PHE A 1 23 ? 3.249   -4.927  -4.795  1.00 0.00 ? 23 PHE A HD2  5  
ATOM 4683  H HE1  . PHE A 1 23 ? -1.628  -4.295  -4.916  1.00 0.00 ? 23 PHE A HE1  5  
ATOM 4684  H HE2  . PHE A 1 23 ? 1.787   -6.398  -3.470  1.00 0.00 ? 23 PHE A HE2  5  
ATOM 4685  H HZ   . PHE A 1 23 ? -0.655  -6.083  -3.531  1.00 0.00 ? 23 PHE A HZ   5  
ATOM 4686  N N    . THR A 1 24 ? 4.320   -1.862  -8.919  1.00 0.00 ? 24 THR A N    5  
ATOM 4687  C CA   . THR A 1 24 ? 4.781   -0.742  -9.733  1.00 0.00 ? 24 THR A CA   5  
ATOM 4688  C C    . THR A 1 24 ? 4.476   -0.980  -11.206 1.00 0.00 ? 24 THR A C    5  
ATOM 4689  O O    . THR A 1 24 ? 4.207   -0.042  -11.955 1.00 0.00 ? 24 THR A O    5  
ATOM 4690  C CB   . THR A 1 24 ? 6.283   -0.525  -9.542  1.00 0.00 ? 24 THR A CB   5  
ATOM 4691  O OG1  . THR A 1 24 ? 6.971   -1.762  -9.538  1.00 0.00 ? 24 THR A OG1  5  
ATOM 4692  C CG2  . THR A 1 24 ? 6.626   0.197   -8.258  1.00 0.00 ? 24 THR A CG2  5  
ATOM 4693  H H    . THR A 1 24 ? 4.987   -2.447  -8.483  1.00 0.00 ? 24 THR A H    5  
ATOM 4694  H HA   . THR A 1 24 ? 4.252   0.143   -9.407  1.00 0.00 ? 24 THR A HA   5  
ATOM 4695  H HB   . THR A 1 24 ? 6.657   0.069   -10.363 1.00 0.00 ? 24 THR A HB   5  
ATOM 4696  H HG1  . THR A 1 24 ? 7.223   -1.993  -10.435 1.00 0.00 ? 24 THR A HG1  5  
ATOM 4697  H HG21 . THR A 1 24 ? 5.828   0.059   -7.544  1.00 0.00 ? 24 THR A HG21 5  
ATOM 4698  H HG22 . THR A 1 24 ? 6.750   1.250   -8.461  1.00 0.00 ? 24 THR A HG22 5  
ATOM 4699  H HG23 . THR A 1 24 ? 7.543   -0.204  -7.855  1.00 0.00 ? 24 THR A HG23 5  
ATOM 4700  N N    . SER A 1 25 ? 4.520   -2.243  -11.615 1.00 0.00 ? 25 SER A N    5  
ATOM 4701  C CA   . SER A 1 25 ? 4.251   -2.608  -13.000 1.00 0.00 ? 25 SER A CA   5  
ATOM 4702  C C    . SER A 1 25 ? 2.938   -1.997  -13.480 1.00 0.00 ? 25 SER A C    5  
ATOM 4703  O O    . SER A 1 25 ? 2.740   -1.791  -14.678 1.00 0.00 ? 25 SER A O    5  
ATOM 4704  C CB   . SER A 1 25 ? 4.202   -4.130  -13.147 1.00 0.00 ? 25 SER A CB   5  
ATOM 4705  O OG   . SER A 1 25 ? 4.747   -4.772  -12.007 1.00 0.00 ? 25 SER A OG   5  
ATOM 4706  H H    . SER A 1 25 ? 4.743   -2.946  -10.969 1.00 0.00 ? 25 SER A H    5  
ATOM 4707  H HA   . SER A 1 25 ? 5.056   -2.221  -13.607 1.00 0.00 ? 25 SER A HA   5  
ATOM 4708  H HB2  . SER A 1 25 ? 3.176   -4.446  -13.267 1.00 0.00 ? 25 SER A HB2  5  
ATOM 4709  H HB3  . SER A 1 25 ? 4.772   -4.424  -14.016 1.00 0.00 ? 25 SER A HB3  5  
ATOM 4710  H HG   . SER A 1 25 ? 4.194   -5.519  -11.766 1.00 0.00 ? 25 SER A HG   5  
ATOM 4711  N N    . GLN A 1 26 ? 2.044   -1.707  -12.539 1.00 0.00 ? 26 GLN A N    5  
ATOM 4712  C CA   . GLN A 1 26 ? 0.750   -1.118  -12.870 1.00 0.00 ? 26 GLN A CA   5  
ATOM 4713  C C    . GLN A 1 26 ? 0.762   0.387   -12.627 1.00 0.00 ? 26 GLN A C    5  
ATOM 4714  O O    . GLN A 1 26 ? 0.356   1.169   -13.486 1.00 0.00 ? 26 GLN A O    5  
ATOM 4715  C CB   . GLN A 1 26 ? -0.369  -1.768  -12.047 1.00 0.00 ? 26 GLN A CB   5  
ATOM 4716  C CG   . GLN A 1 26 ? -0.083  -3.204  -11.635 1.00 0.00 ? 26 GLN A CG   5  
ATOM 4717  C CD   . GLN A 1 26 ? 0.005   -4.145  -12.821 1.00 0.00 ? 26 GLN A CD   5  
ATOM 4718  O OE1  . GLN A 1 26 ? -0.427  -3.813  -13.924 1.00 0.00 ? 26 GLN A OE1  5  
ATOM 4719  N NE2  . GLN A 1 26 ? 0.567   -5.328  -12.598 1.00 0.00 ? 26 GLN A NE2  5  
ATOM 4720  H H    . GLN A 1 26 ? 2.257   -1.895  -11.601 1.00 0.00 ? 26 GLN A H    5  
ATOM 4721  H HA   . GLN A 1 26 ? 0.566   -1.298  -13.919 1.00 0.00 ? 26 GLN A HA   5  
ATOM 4722  H HB2  . GLN A 1 26 ? -0.524  -1.185  -11.152 1.00 0.00 ? 26 GLN A HB2  5  
ATOM 4723  H HB3  . GLN A 1 26 ? -1.278  -1.761  -12.632 1.00 0.00 ? 26 GLN A HB3  5  
ATOM 4724  H HG2  . GLN A 1 26 ? 0.857   -3.232  -11.103 1.00 0.00 ? 26 GLN A HG2  5  
ATOM 4725  H HG3  . GLN A 1 26 ? -0.875  -3.543  -10.984 1.00 0.00 ? 26 GLN A HG3  5  
ATOM 4726  H HE21 . GLN A 1 26 ? 0.889   -5.524  -11.693 1.00 0.00 ? 26 GLN A HE21 5  
ATOM 4727  H HE22 . GLN A 1 26 ? 0.637   -5.956  -13.347 1.00 0.00 ? 26 GLN A HE22 5  
ATOM 4728  N N    . GLY A 1 27 ? 1.229   0.785   -11.448 1.00 0.00 ? 27 GLY A N    5  
ATOM 4729  C CA   . GLY A 1 27 ? 1.284   2.196   -11.107 1.00 0.00 ? 27 GLY A CA   5  
ATOM 4730  C C    . GLY A 1 27 ? 1.061   2.440   -9.628  1.00 0.00 ? 27 GLY A C    5  
ATOM 4731  O O    . GLY A 1 27 ? 0.223   3.256   -9.246  1.00 0.00 ? 27 GLY A O    5  
ATOM 4732  H H    . GLY A 1 27 ? 1.537   0.116   -10.802 1.00 0.00 ? 27 GLY A H    5  
ATOM 4733  H HA2  . GLY A 1 27 ? 2.252   2.585   -11.383 1.00 0.00 ? 27 GLY A HA2  5  
ATOM 4734  H HA3  . GLY A 1 27 ? 0.523   2.721   -11.667 1.00 0.00 ? 27 GLY A HA3  5  
ATOM 4735  N N    . LEU A 1 28 ? 1.815   1.731   -8.795  1.00 0.00 ? 28 LEU A N    5  
ATOM 4736  C CA   . LEU A 1 28 ? 1.695   1.872   -7.349  1.00 0.00 ? 28 LEU A CA   5  
ATOM 4737  C C    . LEU A 1 28 ? 2.794   2.773   -6.796  1.00 0.00 ? 28 LEU A C    5  
ATOM 4738  O O    . LEU A 1 28 ? 3.337   2.522   -5.720  1.00 0.00 ? 28 LEU A O    5  
ATOM 4739  C CB   . LEU A 1 28 ? 1.748   0.499   -6.676  1.00 0.00 ? 28 LEU A CB   5  
ATOM 4740  C CG   . LEU A 1 28 ? 0.460   0.071   -5.968  1.00 0.00 ? 28 LEU A CG   5  
ATOM 4741  C CD1  . LEU A 1 28 ? 0.300   0.821   -4.654  1.00 0.00 ? 28 LEU A CD1  5  
ATOM 4742  C CD2  . LEU A 1 28 ? -0.748  0.299   -6.869  1.00 0.00 ? 28 LEU A CD2  5  
ATOM 4743  H H    . LEU A 1 28 ? 2.464   1.094   -9.161  1.00 0.00 ? 28 LEU A H    5  
ATOM 4744  H HA   . LEU A 1 28 ? 0.738   2.328   -7.141  1.00 0.00 ? 28 LEU A HA   5  
ATOM 4745  H HB2  . LEU A 1 28 ? 1.980   -0.238  -7.430  1.00 0.00 ? 28 LEU A HB2  5  
ATOM 4746  H HB3  . LEU A 1 28 ? 2.547   0.505   -5.949  1.00 0.00 ? 28 LEU A HB3  5  
ATOM 4747  H HG   . LEU A 1 28 ? 0.513   -0.984  -5.745  1.00 0.00 ? 28 LEU A HG   5  
ATOM 4748  H HD11 . LEU A 1 28 ? -0.740  1.071   -4.505  1.00 0.00 ? 28 LEU A HD11 5  
ATOM 4749  H HD12 . LEU A 1 28 ? 0.889   1.725   -4.682  1.00 0.00 ? 28 LEU A HD12 5  
ATOM 4750  H HD13 . LEU A 1 28 ? 0.639   0.196   -3.841  1.00 0.00 ? 28 LEU A HD13 5  
ATOM 4751  H HD21 . LEU A 1 28 ? -0.551  -0.119  -7.845  1.00 0.00 ? 28 LEU A HD21 5  
ATOM 4752  H HD22 . LEU A 1 28 ? -0.934  1.358   -6.961  1.00 0.00 ? 28 LEU A HD22 5  
ATOM 4753  H HD23 . LEU A 1 28 ? -1.613  -0.182  -6.439  1.00 0.00 ? 28 LEU A HD23 5  
ATOM 4754  N N    . GLN A 1 29 ? 3.106   3.834   -7.532  1.00 0.00 ? 29 GLN A N    5  
ATOM 4755  C CA   . GLN A 1 29 ? 4.120   4.788   -7.105  1.00 0.00 ? 29 GLN A CA   5  
ATOM 4756  C C    . GLN A 1 29 ? 3.459   6.011   -6.478  1.00 0.00 ? 29 GLN A C    5  
ATOM 4757  O O    . GLN A 1 29 ? 4.026   6.658   -5.598  1.00 0.00 ? 29 GLN A O    5  
ATOM 4758  C CB   . GLN A 1 29 ? 4.992   5.211   -8.289  1.00 0.00 ? 29 GLN A CB   5  
ATOM 4759  C CG   . GLN A 1 29 ? 4.217   5.894   -9.404  1.00 0.00 ? 29 GLN A CG   5  
ATOM 4760  C CD   . GLN A 1 29 ? 4.764   5.568   -10.780 1.00 0.00 ? 29 GLN A CD   5  
ATOM 4761  O OE1  . GLN A 1 29 ? 5.787   6.109   -11.199 1.00 0.00 ? 29 GLN A OE1  5  
ATOM 4762  N NE2  . GLN A 1 29 ? 4.083   4.677   -11.492 1.00 0.00 ? 29 GLN A NE2  5  
ATOM 4763  H H    . GLN A 1 29 ? 2.629   3.988   -8.374  1.00 0.00 ? 29 GLN A H    5  
ATOM 4764  H HA   . GLN A 1 29 ? 4.739   4.307   -6.363  1.00 0.00 ? 29 GLN A HA   5  
ATOM 4765  H HB2  . GLN A 1 29 ? 5.751   5.893   -7.937  1.00 0.00 ? 29 GLN A HB2  5  
ATOM 4766  H HB3  . GLN A 1 29 ? 5.471   4.333   -8.698  1.00 0.00 ? 29 GLN A HB3  5  
ATOM 4767  H HG2  . GLN A 1 29 ? 3.187   5.574   -9.358  1.00 0.00 ? 29 GLN A HG2  5  
ATOM 4768  H HG3  . GLN A 1 29 ? 4.267   6.963   -9.258  1.00 0.00 ? 29 GLN A HG3  5  
ATOM 4769  H HE21 . GLN A 1 29 ? 3.277   4.286   -11.095 1.00 0.00 ? 29 GLN A HE21 5  
ATOM 4770  H HE22 . GLN A 1 29 ? 4.414   4.447   -12.385 1.00 0.00 ? 29 GLN A HE22 5  
ATOM 4771  N N    . SER A 1 30 ? 2.241   6.300   -6.925  1.00 0.00 ? 30 SER A N    5  
ATOM 4772  C CA   . SER A 1 30 ? 1.469   7.414   -6.392  1.00 0.00 ? 30 SER A CA   5  
ATOM 4773  C C    . SER A 1 30 ? 0.226   6.895   -5.684  1.00 0.00 ? 30 SER A C    5  
ATOM 4774  O O    . SER A 1 30 ? -0.663  6.331   -6.317  1.00 0.00 ? 30 SER A O    5  
ATOM 4775  C CB   . SER A 1 30 ? 1.072   8.374   -7.515  1.00 0.00 ? 30 SER A CB   5  
ATOM 4776  O OG   . SER A 1 30 ? 2.053   8.396   -8.537  1.00 0.00 ? 30 SER A OG   5  
ATOM 4777  H H    . SER A 1 30 ? 1.841   5.732   -7.617  1.00 0.00 ? 30 SER A H    5  
ATOM 4778  H HA   . SER A 1 30 ? 2.081   7.936   -5.677  1.00 0.00 ? 30 SER A HA   5  
ATOM 4779  H HB2  . SER A 1 30 ? 0.132   8.058   -7.942  1.00 0.00 ? 30 SER A HB2  5  
ATOM 4780  H HB3  . SER A 1 30 ? 0.968   9.372   -7.113  1.00 0.00 ? 30 SER A HB3  5  
ATOM 4781  H HG   . SER A 1 30 ? 1.640   8.202   -9.382  1.00 0.00 ? 30 SER A HG   5  
ATOM 4782  N N    . ILE A 1 31 ? 0.178   7.066   -4.364  1.00 0.00 ? 31 ILE A N    5  
ATOM 4783  C CA   . ILE A 1 31 ? -0.952  6.579   -3.574  1.00 0.00 ? 31 ILE A CA   5  
ATOM 4784  C C    . ILE A 1 31 ? -2.283  6.929   -4.242  1.00 0.00 ? 31 ILE A C    5  
ATOM 4785  O O    . ILE A 1 31 ? -3.274  6.214   -4.093  1.00 0.00 ? 31 ILE A O    5  
ATOM 4786  C CB   . ILE A 1 31 ? -0.915  7.112   -2.121  1.00 0.00 ? 31 ILE A CB   5  
ATOM 4787  C CG1  . ILE A 1 31 ? -1.683  6.161   -1.203  1.00 0.00 ? 31 ILE A CG1  5  
ATOM 4788  C CG2  . ILE A 1 31 ? -1.479  8.526   -2.020  1.00 0.00 ? 31 ILE A CG2  5  
ATOM 4789  C CD1  . ILE A 1 31 ? -0.803  5.451   -0.199  1.00 0.00 ? 31 ILE A CD1  5  
ATOM 4790  H H    . ILE A 1 31 ? 0.924   7.509   -3.910  1.00 0.00 ? 31 ILE A H    5  
ATOM 4791  H HA   . ILE A 1 31 ? -0.869  5.506   -3.525  1.00 0.00 ? 31 ILE A HA   5  
ATOM 4792  H HB   . ILE A 1 31 ? 0.116   7.147   -1.805  1.00 0.00 ? 31 ILE A HB   5  
ATOM 4793  H HG12 . ILE A 1 31 ? -2.430  6.718   -0.658  1.00 0.00 ? 31 ILE A HG12 5  
ATOM 4794  H HG13 . ILE A 1 31 ? -2.171  5.407   -1.806  1.00 0.00 ? 31 ILE A HG13 5  
ATOM 4795  H HG21 . ILE A 1 31 ? -1.070  9.134   -2.812  1.00 0.00 ? 31 ILE A HG21 5  
ATOM 4796  H HG22 . ILE A 1 31 ? -1.213  8.952   -1.064  1.00 0.00 ? 31 ILE A HG22 5  
ATOM 4797  H HG23 . ILE A 1 31 ? -2.555  8.489   -2.111  1.00 0.00 ? 31 ILE A HG23 5  
ATOM 4798  H HD11 . ILE A 1 31 ? -0.041  4.892   -0.721  1.00 0.00 ? 31 ILE A HD11 5  
ATOM 4799  H HD12 . ILE A 1 31 ? -1.404  4.777   0.393   1.00 0.00 ? 31 ILE A HD12 5  
ATOM 4800  H HD13 . ILE A 1 31 ? -0.336  6.180   0.447   1.00 0.00 ? 31 ILE A HD13 5  
ATOM 4801  N N    . TYR A 1 32 ? -2.286  8.028   -4.990  1.00 0.00 ? 32 TYR A N    5  
ATOM 4802  C CA   . TYR A 1 32 ? -3.478  8.462   -5.703  1.00 0.00 ? 32 TYR A CA   5  
ATOM 4803  C C    . TYR A 1 32 ? -3.975  7.367   -6.642  1.00 0.00 ? 32 TYR A C    5  
ATOM 4804  O O    . TYR A 1 32 ? -5.141  7.358   -7.040  1.00 0.00 ? 32 TYR A O    5  
ATOM 4805  C CB   . TYR A 1 32 ? -3.186  9.736   -6.496  1.00 0.00 ? 32 TYR A CB   5  
ATOM 4806  C CG   . TYR A 1 32 ? -3.407  11.007  -5.706  1.00 0.00 ? 32 TYR A CG   5  
ATOM 4807  C CD1  . TYR A 1 32 ? -2.676  11.268  -4.554  1.00 0.00 ? 32 TYR A CD1  5  
ATOM 4808  C CD2  . TYR A 1 32 ? -4.348  11.944  -6.113  1.00 0.00 ? 32 TYR A CD2  5  
ATOM 4809  C CE1  . TYR A 1 32 ? -2.877  12.429  -3.830  1.00 0.00 ? 32 TYR A CE1  5  
ATOM 4810  C CE2  . TYR A 1 32 ? -4.556  13.106  -5.395  1.00 0.00 ? 32 TYR A CE2  5  
ATOM 4811  C CZ   . TYR A 1 32 ? -3.817  13.345  -4.254  1.00 0.00 ? 32 TYR A CZ   5  
ATOM 4812  O OH   . TYR A 1 32 ? -4.020  14.500  -3.536  1.00 0.00 ? 32 TYR A OH   5  
ATOM 4813  H H    . TYR A 1 32 ? -1.460  8.547   -5.079  1.00 0.00 ? 32 TYR A H    5  
ATOM 4814  H HA   . TYR A 1 32 ? -4.244  8.669   -4.972  1.00 0.00 ? 32 TYR A HA   5  
ATOM 4815  H HB2  . TYR A 1 32 ? -2.155  9.723   -6.819  1.00 0.00 ? 32 TYR A HB2  5  
ATOM 4816  H HB3  . TYR A 1 32 ? -3.829  9.769   -7.363  1.00 0.00 ? 32 TYR A HB3  5  
ATOM 4817  H HD1  . TYR A 1 32 ? -1.940  10.550  -4.225  1.00 0.00 ? 32 TYR A HD1  5  
ATOM 4818  H HD2  . TYR A 1 32 ? -4.925  11.754  -7.006  1.00 0.00 ? 32 TYR A HD2  5  
ATOM 4819  H HE1  . TYR A 1 32 ? -2.298  12.615  -2.937  1.00 0.00 ? 32 TYR A HE1  5  
ATOM 4820  H HE2  . TYR A 1 32 ? -5.292  13.822  -5.727  1.00 0.00 ? 32 TYR A HE2  5  
ATOM 4821  H HH   . TYR A 1 32 ? -3.174  14.867  -3.272  1.00 0.00 ? 32 TYR A HH   5  
ATOM 4822  N N    . HIS A 1 33 ? -3.084  6.441   -6.996  1.00 0.00 ? 33 HIS A N    5  
ATOM 4823  C CA   . HIS A 1 33 ? -3.438  5.338   -7.880  1.00 0.00 ? 33 HIS A CA   5  
ATOM 4824  C C    . HIS A 1 33 ? -4.074  4.200   -7.090  1.00 0.00 ? 33 HIS A C    5  
ATOM 4825  O O    . HIS A 1 33 ? -4.925  3.473   -7.601  1.00 0.00 ? 33 HIS A O    5  
ATOM 4826  C CB   . HIS A 1 33 ? -2.197  4.831   -8.617  1.00 0.00 ? 33 HIS A CB   5  
ATOM 4827  C CG   . HIS A 1 33 ? -2.138  5.253   -10.052 1.00 0.00 ? 33 HIS A CG   5  
ATOM 4828  N ND1  . HIS A 1 33 ? -0.990  5.174   -10.812 1.00 0.00 ? 33 HIS A ND1  5  
ATOM 4829  C CD2  . HIS A 1 33 ? -3.093  5.761   -10.866 1.00 0.00 ? 33 HIS A CD2  5  
ATOM 4830  C CE1  . HIS A 1 33 ? -1.241  5.616   -12.032 1.00 0.00 ? 33 HIS A CE1  5  
ATOM 4831  N NE2  . HIS A 1 33 ? -2.509  5.977   -12.090 1.00 0.00 ? 33 HIS A NE2  5  
ATOM 4832  H H    . HIS A 1 33 ? -2.169  6.495   -6.643  1.00 0.00 ? 33 HIS A H    5  
ATOM 4833  H HA   . HIS A 1 33 ? -4.153  5.706   -8.600  1.00 0.00 ? 33 HIS A HA   5  
ATOM 4834  H HB2  . HIS A 1 33 ? -1.314  5.209   -8.123  1.00 0.00 ? 33 HIS A HB2  5  
ATOM 4835  H HB3  . HIS A 1 33 ? -2.185  3.752   -8.587  1.00 0.00 ? 33 HIS A HB3  5  
ATOM 4836  H HD1  . HIS A 1 33 ? -0.120  4.844   -10.504 1.00 0.00 ? 33 HIS A HD1  5  
ATOM 4837  H HD2  . HIS A 1 33 ? -4.122  5.959   -10.603 1.00 0.00 ? 33 HIS A HD2  5  
ATOM 4838  H HE1  . HIS A 1 33 ? -0.530  5.671   -12.843 1.00 0.00 ? 33 HIS A HE1  5  
ATOM 4839  H HE2  . HIS A 1 33 ? -2.959  6.341   -12.881 1.00 0.00 ? 33 HIS A HE2  5  
ATOM 4840  N N    . LEU A 1 34 ? -3.653  4.055   -5.839  1.00 0.00 ? 34 LEU A N    5  
ATOM 4841  C CA   . LEU A 1 34 ? -4.185  3.016   -4.966  1.00 0.00 ? 34 LEU A CA   5  
ATOM 4842  C C    . LEU A 1 34 ? -5.199  3.595   -3.989  1.00 0.00 ? 34 LEU A C    5  
ATOM 4843  O O    . LEU A 1 34 ? -5.414  3.059   -2.903  1.00 0.00 ? 34 LEU A O    5  
ATOM 4844  C CB   . LEU A 1 34 ? -3.049  2.356   -4.198  1.00 0.00 ? 34 LEU A CB   5  
ATOM 4845  C CG   . LEU A 1 34 ? -1.946  3.314   -3.742  1.00 0.00 ? 34 LEU A CG   5  
ATOM 4846  C CD1  . LEU A 1 34 ? -1.305  2.819   -2.456  1.00 0.00 ? 34 LEU A CD1  5  
ATOM 4847  C CD2  . LEU A 1 34 ? -0.902  3.480   -4.835  1.00 0.00 ? 34 LEU A CD2  5  
ATOM 4848  H H    . LEU A 1 34 ? -2.976  4.672   -5.489  1.00 0.00 ? 34 LEU A H    5  
ATOM 4849  H HA   . LEU A 1 34 ? -4.671  2.281   -5.585  1.00 0.00 ? 34 LEU A HA   5  
ATOM 4850  H HB2  . LEU A 1 34 ? -3.463  1.869   -3.327  1.00 0.00 ? 34 LEU A HB2  5  
ATOM 4851  H HB3  . LEU A 1 34 ? -2.609  1.606   -4.834  1.00 0.00 ? 34 LEU A HB3  5  
ATOM 4852  H HG   . LEU A 1 34 ? -2.381  4.285   -3.546  1.00 0.00 ? 34 LEU A HG   5  
ATOM 4853  H HD11 . LEU A 1 34 ? -0.233  2.924   -2.526  1.00 0.00 ? 34 LEU A HD11 5  
ATOM 4854  H HD12 . LEU A 1 34 ? -1.557  1.779   -2.306  1.00 0.00 ? 34 LEU A HD12 5  
ATOM 4855  H HD13 . LEU A 1 34 ? -1.672  3.402   -1.625  1.00 0.00 ? 34 LEU A HD13 5  
ATOM 4856  H HD21 . LEU A 1 34 ? -1.052  4.426   -5.333  1.00 0.00 ? 34 LEU A HD21 5  
ATOM 4857  H HD22 . LEU A 1 34 ? -0.998  2.679   -5.551  1.00 0.00 ? 34 LEU A HD22 5  
ATOM 4858  H HD23 . LEU A 1 34 ? 0.084   3.458   -4.396  1.00 0.00 ? 34 LEU A HD23 5  
ATOM 4859  N N    . GLN A 1 35 ? -5.806  4.701   -4.386  1.00 0.00 ? 35 GLN A N    5  
ATOM 4860  C CA   . GLN A 1 35 ? -6.788  5.388   -3.558  1.00 0.00 ? 35 GLN A CA   5  
ATOM 4861  C C    . GLN A 1 35 ? -8.052  4.569   -3.396  1.00 0.00 ? 35 GLN A C    5  
ATOM 4862  O O    . GLN A 1 35 ? -8.655  4.522   -2.324  1.00 0.00 ? 35 GLN A O    5  
ATOM 4863  C CB   . GLN A 1 35 ? -7.153  6.720   -4.207  1.00 0.00 ? 35 GLN A CB   5  
ATOM 4864  C CG   . GLN A 1 35 ? -6.307  7.881   -3.735  1.00 0.00 ? 35 GLN A CG   5  
ATOM 4865  C CD   . GLN A 1 35 ? -6.966  8.680   -2.625  1.00 0.00 ? 35 GLN A CD   5  
ATOM 4866  O OE1  . GLN A 1 35 ? -8.105  9.125   -2.758  1.00 0.00 ? 35 GLN A OE1  5  
ATOM 4867  N NE2  . GLN A 1 35 ? -6.244  8.881   -1.524  1.00 0.00 ? 35 GLN A NE2  5  
ATOM 4868  H H    . GLN A 1 35 ? -5.578  5.076   -5.259  1.00 0.00 ? 35 GLN A H    5  
ATOM 4869  H HA   . GLN A 1 35 ? -6.351  5.560   -2.591  1.00 0.00 ? 35 GLN A HA   5  
ATOM 4870  H HB2  . GLN A 1 35 ? -7.026  6.628   -5.275  1.00 0.00 ? 35 GLN A HB2  5  
ATOM 4871  H HB3  . GLN A 1 35 ? -8.191  6.939   -3.994  1.00 0.00 ? 35 GLN A HB3  5  
ATOM 4872  H HG2  . GLN A 1 35 ? -5.367  7.495   -3.377  1.00 0.00 ? 35 GLN A HG2  5  
ATOM 4873  H HG3  . GLN A 1 35 ? -6.133  8.534   -4.576  1.00 0.00 ? 35 GLN A HG3  5  
ATOM 4874  H HE21 . GLN A 1 35 ? -5.346  8.487   -1.478  1.00 0.00 ? 35 GLN A HE21 5  
ATOM 4875  H HE22 . GLN A 1 35 ? -6.655  9.379   -0.788  1.00 0.00 ? 35 GLN A HE22 5  
ATOM 4876  N N    . ASN A 1 36 ? -8.479  3.994   -4.499  1.00 0.00 ? 36 ASN A N    5  
ATOM 4877  C CA   . ASN A 1 36 ? -9.713  3.223   -4.544  1.00 0.00 ? 36 ASN A CA   5  
ATOM 4878  C C    . ASN A 1 36 ? -9.436  1.729   -4.562  1.00 0.00 ? 36 ASN A C    5  
ATOM 4879  O O    . ASN A 1 36 ? -10.292 0.921   -4.199  1.00 0.00 ? 36 ASN A O    5  
ATOM 4880  C CB   . ASN A 1 36 ? -10.529 3.623   -5.771  1.00 0.00 ? 36 ASN A CB   5  
ATOM 4881  C CG   . ASN A 1 36 ? -9.668  3.912   -6.980  1.00 0.00 ? 36 ASN A CG   5  
ATOM 4882  O OD1  . ASN A 1 36 ? -9.505  3.075   -7.867  1.00 0.00 ? 36 ASN A OD1  5  
ATOM 4883  N ND2  . ASN A 1 36 ? -9.104  5.110   -7.000  1.00 0.00 ? 36 ASN A ND2  5  
ATOM 4884  H H    . ASN A 1 36 ? -7.948  4.101   -5.315  1.00 0.00 ? 36 ASN A H    5  
ATOM 4885  H HA   . ASN A 1 36 ? -10.279 3.460   -3.656  1.00 0.00 ? 36 ASN A HA   5  
ATOM 4886  H HB2  . ASN A 1 36 ? -11.220 2.836   -6.019  1.00 0.00 ? 36 ASN A HB2  5  
ATOM 4887  H HB3  . ASN A 1 36 ? -11.071 4.519   -5.539  1.00 0.00 ? 36 ASN A HB3  5  
ATOM 4888  H HD21 . ASN A 1 36 ? -9.283  5.712   -6.251  1.00 0.00 ? 36 ASN A HD21 5  
ATOM 4889  H HD22 . ASN A 1 36 ? -8.530  5.342   -7.754  1.00 0.00 ? 36 ASN A HD22 5  
ATOM 4890  N N    . LEU A 1 37 ? -8.229  1.367   -4.970  1.00 0.00 ? 37 LEU A N    5  
ATOM 4891  C CA   . LEU A 1 37 ? -7.827  -0.035  -5.031  1.00 0.00 ? 37 LEU A CA   5  
ATOM 4892  C C    . LEU A 1 37 ? -8.218  -0.776  -3.753  1.00 0.00 ? 37 LEU A C    5  
ATOM 4893  O O    . LEU A 1 37 ? -8.191  -0.209  -2.660  1.00 0.00 ? 37 LEU A O    5  
ATOM 4894  C CB   . LEU A 1 37 ? -6.319  -0.147  -5.259  1.00 0.00 ? 37 LEU A CB   5  
ATOM 4895  C CG   . LEU A 1 37 ? -5.914  -0.909  -6.522  1.00 0.00 ? 37 LEU A CG   5  
ATOM 4896  C CD1  . LEU A 1 37 ? -4.641  -0.321  -7.111  1.00 0.00 ? 37 LEU A CD1  5  
ATOM 4897  C CD2  . LEU A 1 37 ? -5.730  -2.389  -6.218  1.00 0.00 ? 37 LEU A CD2  5  
ATOM 4898  H H    . LEU A 1 37 ? -7.596  2.061   -5.246  1.00 0.00 ? 37 LEU A H    5  
ATOM 4899  H HA   . LEU A 1 37 ? -8.343  -0.489  -5.865  1.00 0.00 ? 37 LEU A HA   5  
ATOM 4900  H HB2  . LEU A 1 37 ? -5.910  0.849   -5.317  1.00 0.00 ? 37 LEU A HB2  5  
ATOM 4901  H HB3  . LEU A 1 37 ? -5.884  -0.644  -4.407  1.00 0.00 ? 37 LEU A HB3  5  
ATOM 4902  H HG   . LEU A 1 37 ? -6.697  -0.815  -7.259  1.00 0.00 ? 37 LEU A HG   5  
ATOM 4903  H HD11 . LEU A 1 37 ? -4.656  -0.435  -8.185  1.00 0.00 ? 37 LEU A HD11 5  
ATOM 4904  H HD12 . LEU A 1 37 ? -3.784  -0.836  -6.705  1.00 0.00 ? 37 LEU A HD12 5  
ATOM 4905  H HD13 . LEU A 1 37 ? -4.582  0.729   -6.862  1.00 0.00 ? 37 LEU A HD13 5  
ATOM 4906  H HD21 . LEU A 1 37 ? -4.805  -2.534  -5.682  1.00 0.00 ? 37 LEU A HD21 5  
ATOM 4907  H HD22 . LEU A 1 37 ? -5.703  -2.946  -7.143  1.00 0.00 ? 37 LEU A HD22 5  
ATOM 4908  H HD23 . LEU A 1 37 ? -6.554  -2.736  -5.613  1.00 0.00 ? 37 LEU A HD23 5  
ATOM 4909  N N    . THR A 1 38 ? -8.588  -2.042  -3.902  1.00 0.00 ? 38 THR A N    5  
ATOM 4910  C CA   . THR A 1 38 ? -8.998  -2.860  -2.767  1.00 0.00 ? 38 THR A CA   5  
ATOM 4911  C C    . THR A 1 38 ? -8.358  -4.235  -2.824  1.00 0.00 ? 38 THR A C    5  
ATOM 4912  O O    . THR A 1 38 ? -7.655  -4.567  -3.777  1.00 0.00 ? 38 THR A O    5  
ATOM 4913  C CB   . THR A 1 38 ? -10.516 -3.026  -2.759  1.00 0.00 ? 38 THR A CB   5  
ATOM 4914  O OG1  . THR A 1 38 ? -11.129 -2.094  -3.632  1.00 0.00 ? 38 THR A OG1  5  
ATOM 4915  C CG2  . THR A 1 38 ? -11.127 -2.849  -1.389  1.00 0.00 ? 38 THR A CG2  5  
ATOM 4916  H H    . THR A 1 38 ? -8.594  -2.434  -4.799  1.00 0.00 ? 38 THR A H    5  
ATOM 4917  H HA   . THR A 1 38 ? -8.688  -2.363  -1.859  1.00 0.00 ? 38 THR A HA   5  
ATOM 4918  H HB   . THR A 1 38 ? -10.758 -4.028  -3.099  1.00 0.00 ? 38 THR A HB   5  
ATOM 4919  H HG1  . THR A 1 38 ? -10.963 -2.351  -4.543  1.00 0.00 ? 38 THR A HG1  5  
ATOM 4920  H HG21 . THR A 1 38 ? -12.017 -2.243  -1.468  1.00 0.00 ? 38 THR A HG21 5  
ATOM 4921  H HG22 . THR A 1 38 ? -10.415 -2.361  -0.741  1.00 0.00 ? 38 THR A HG22 5  
ATOM 4922  H HG23 . THR A 1 38 ? -11.383 -3.815  -0.982  1.00 0.00 ? 38 THR A HG23 5  
ATOM 4923  N N    . ILE A 1 39 ? -8.647  -5.049  -1.818  1.00 0.00 ? 39 ILE A N    5  
ATOM 4924  C CA   . ILE A 1 39 ? -8.157  -6.413  -1.793  1.00 0.00 ? 39 ILE A CA   5  
ATOM 4925  C C    . ILE A 1 39 ? -8.663  -7.153  -3.021  1.00 0.00 ? 39 ILE A C    5  
ATOM 4926  O O    . ILE A 1 39 ? -7.979  -8.013  -3.578  1.00 0.00 ? 39 ILE A O    5  
ATOM 4927  C CB   . ILE A 1 39 ? -8.610  -7.154  -0.522  1.00 0.00 ? 39 ILE A CB   5  
ATOM 4928  C CG1  . ILE A 1 39 ? -7.894  -8.500  -0.411  1.00 0.00 ? 39 ILE A CG1  5  
ATOM 4929  C CG2  . ILE A 1 39 ? -10.121 -7.346  -0.517  1.00 0.00 ? 39 ILE A CG2  5  
ATOM 4930  C CD1  . ILE A 1 39 ? -6.386  -8.382  -0.396  1.00 0.00 ? 39 ILE A CD1  5  
ATOM 4931  H H    . ILE A 1 39 ? -9.242  -4.740  -1.103  1.00 0.00 ? 39 ILE A H    5  
ATOM 4932  H HA   . ILE A 1 39 ? -7.081  -6.384  -1.811  1.00 0.00 ? 39 ILE A HA   5  
ATOM 4933  H HB   . ILE A 1 39 ? -8.351  -6.545  0.327   1.00 0.00 ? 39 ILE A HB   5  
ATOM 4934  H HG12 . ILE A 1 39 ? -8.198  -8.989  0.503   1.00 0.00 ? 39 ILE A HG12 5  
ATOM 4935  H HG13 . ILE A 1 39 ? -8.170  -9.116  -1.254  1.00 0.00 ? 39 ILE A HG13 5  
ATOM 4936  H HG21 . ILE A 1 39 ? -10.393 -8.078  -1.262  1.00 0.00 ? 39 ILE A HG21 5  
ATOM 4937  H HG22 . ILE A 1 39 ? -10.603 -6.407  -0.742  1.00 0.00 ? 39 ILE A HG22 5  
ATOM 4938  H HG23 . ILE A 1 39 ? -10.436 -7.688  0.457   1.00 0.00 ? 39 ILE A HG23 5  
ATOM 4939  H HD11 . ILE A 1 39 ? -6.106  -7.341  -0.335  1.00 0.00 ? 39 ILE A HD11 5  
ATOM 4940  H HD12 . ILE A 1 39 ? -5.982  -8.810  -1.301  1.00 0.00 ? 39 ILE A HD12 5  
ATOM 4941  H HD13 . ILE A 1 39 ? -5.992  -8.911  0.459   1.00 0.00 ? 39 ILE A HD13 5  
ATOM 4942  N N    . GLU A 1 40 ? -9.863  -6.779  -3.449  1.00 0.00 ? 40 GLU A N    5  
ATOM 4943  C CA   . GLU A 1 40 ? -10.481 -7.370  -4.625  1.00 0.00 ? 40 GLU A CA   5  
ATOM 4944  C C    . GLU A 1 40 ? -9.573  -7.227  -5.840  1.00 0.00 ? 40 GLU A C    5  
ATOM 4945  O O    . GLU A 1 40 ? -9.338  -8.189  -6.571  1.00 0.00 ? 40 GLU A O    5  
ATOM 4946  C CB   . GLU A 1 40 ? -11.832 -6.706  -4.903  1.00 0.00 ? 40 GLU A CB   5  
ATOM 4947  C CG   . GLU A 1 40 ? -12.776 -6.728  -3.712  1.00 0.00 ? 40 GLU A CG   5  
ATOM 4948  C CD   . GLU A 1 40 ? -14.101 -7.392  -4.032  1.00 0.00 ? 40 GLU A CD   5  
ATOM 4949  O OE1  . GLU A 1 40 ? -14.086 -8.533  -4.539  1.00 0.00 ? 40 GLU A OE1  5  
ATOM 4950  O OE2  . GLU A 1 40 ? -15.153 -6.769  -3.777  1.00 0.00 ? 40 GLU A OE2  5  
ATOM 4951  H H    . GLU A 1 40 ? -10.343 -6.081  -2.956  1.00 0.00 ? 40 GLU A H    5  
ATOM 4952  H HA   . GLU A 1 40 ? -10.637 -8.416  -4.424  1.00 0.00 ? 40 GLU A HA   5  
ATOM 4953  H HB2  . GLU A 1 40 ? -11.664 -5.677  -5.183  1.00 0.00 ? 40 GLU A HB2  5  
ATOM 4954  H HB3  . GLU A 1 40 ? -12.311 -7.221  -5.723  1.00 0.00 ? 40 GLU A HB3  5  
ATOM 4955  H HG2  . GLU A 1 40 ? -12.305 -7.269  -2.904  1.00 0.00 ? 40 GLU A HG2  5  
ATOM 4956  H HG3  . GLU A 1 40 ? -12.966 -5.712  -3.401  1.00 0.00 ? 40 GLU A HG3  5  
ATOM 4957  N N    . ASP A 1 41 ? -9.063  -6.017  -6.047  1.00 0.00 ? 41 ASP A N    5  
ATOM 4958  C CA   . ASP A 1 41 ? -8.170  -5.744  -7.167  1.00 0.00 ? 41 ASP A CA   5  
ATOM 4959  C C    . ASP A 1 41 ? -6.750  -6.200  -6.850  1.00 0.00 ? 41 ASP A C    5  
ATOM 4960  O O    . ASP A 1 41 ? -5.969  -6.510  -7.749  1.00 0.00 ? 41 ASP A O    5  
ATOM 4961  C CB   . ASP A 1 41 ? -8.178  -4.251  -7.500  1.00 0.00 ? 41 ASP A CB   5  
ATOM 4962  C CG   . ASP A 1 41 ? -9.268  -3.885  -8.488  1.00 0.00 ? 41 ASP A CG   5  
ATOM 4963  O OD1  . ASP A 1 41 ? -9.479  -4.652  -9.451  1.00 0.00 ? 41 ASP A OD1  5  
ATOM 4964  O OD2  . ASP A 1 41 ? -9.912  -2.832  -8.299  1.00 0.00 ? 41 ASP A OD2  5  
ATOM 4965  H H    . ASP A 1 41 ? -9.286  -5.292  -5.425  1.00 0.00 ? 41 ASP A H    5  
ATOM 4966  H HA   . ASP A 1 41 ? -8.531  -6.299  -8.020  1.00 0.00 ? 41 ASP A HA   5  
ATOM 4967  H HB2  . ASP A 1 41 ? -8.336  -3.687  -6.593  1.00 0.00 ? 41 ASP A HB2  5  
ATOM 4968  H HB3  . ASP A 1 41 ? -7.224  -3.979  -7.927  1.00 0.00 ? 41 ASP A HB3  5  
ATOM 4969  N N    . LEU A 1 42 ? -6.424  -6.240  -5.563  1.00 0.00 ? 42 LEU A N    5  
ATOM 4970  C CA   . LEU A 1 42 ? -5.101  -6.662  -5.121  1.00 0.00 ? 42 LEU A CA   5  
ATOM 4971  C C    . LEU A 1 42 ? -4.776  -8.047  -5.667  1.00 0.00 ? 42 LEU A C    5  
ATOM 4972  O O    . LEU A 1 42 ? -3.707  -8.269  -6.236  1.00 0.00 ? 42 LEU A O    5  
ATOM 4973  C CB   . LEU A 1 42 ? -5.033  -6.678  -3.586  1.00 0.00 ? 42 LEU A CB   5  
ATOM 4974  C CG   . LEU A 1 42 ? -4.806  -5.324  -2.876  1.00 0.00 ? 42 LEU A CG   5  
ATOM 4975  C CD1  . LEU A 1 42 ? -3.449  -5.315  -2.193  1.00 0.00 ? 42 LEU A CD1  5  
ATOM 4976  C CD2  . LEU A 1 42 ? -4.928  -4.131  -3.822  1.00 0.00 ? 42 LEU A CD2  5  
ATOM 4977  H H    . LEU A 1 42 ? -7.089  -5.983  -4.894  1.00 0.00 ? 42 LEU A H    5  
ATOM 4978  H HA   . LEU A 1 42 ? -4.379  -5.955  -5.503  1.00 0.00 ? 42 LEU A HA   5  
ATOM 4979  H HB2  . LEU A 1 42 ? -5.959  -7.094  -3.219  1.00 0.00 ? 42 LEU A HB2  5  
ATOM 4980  H HB3  . LEU A 1 42 ? -4.230  -7.341  -3.299  1.00 0.00 ? 42 LEU A HB3  5  
ATOM 4981  H HG   . LEU A 1 42 ? -5.556  -5.207  -2.108  1.00 0.00 ? 42 LEU A HG   5  
ATOM 4982  H HD11 . LEU A 1 42 ? -3.423  -4.527  -1.456  1.00 0.00 ? 42 LEU A HD11 5  
ATOM 4983  H HD12 . LEU A 1 42 ? -2.676  -5.143  -2.930  1.00 0.00 ? 42 LEU A HD12 5  
ATOM 4984  H HD13 . LEU A 1 42 ? -3.282  -6.266  -1.711  1.00 0.00 ? 42 LEU A HD13 5  
ATOM 4985  H HD21 . LEU A 1 42 ? -5.648  -4.350  -4.592  1.00 0.00 ? 42 LEU A HD21 5  
ATOM 4986  H HD22 . LEU A 1 42 ? -3.968  -3.931  -4.273  1.00 0.00 ? 42 LEU A HD22 5  
ATOM 4987  H HD23 . LEU A 1 42 ? -5.251  -3.263  -3.265  1.00 0.00 ? 42 LEU A HD23 5  
ATOM 4988  N N    . GLY A 1 43 ? -5.713  -8.975  -5.495  1.00 0.00 ? 43 GLY A N    5  
ATOM 4989  C CA   . GLY A 1 43 ? -5.521  -10.324 -5.989  1.00 0.00 ? 43 GLY A CA   5  
ATOM 4990  C C    . GLY A 1 43 ? -5.533  -10.402 -7.506  1.00 0.00 ? 43 GLY A C    5  
ATOM 4991  O O    . GLY A 1 43 ? -5.223  -11.446 -8.080  1.00 0.00 ? 43 GLY A O    5  
ATOM 4992  H H    . GLY A 1 43 ? -6.548  -8.735  -5.042  1.00 0.00 ? 43 GLY A H    5  
ATOM 4993  H HA2  . GLY A 1 43 ? -4.573  -10.695 -5.629  1.00 0.00 ? 43 GLY A HA2  5  
ATOM 4994  H HA3  . GLY A 1 43 ? -6.310  -10.952 -5.602  1.00 0.00 ? 43 GLY A HA3  5  
ATOM 4995  N N    . ALA A 1 44 ? -5.898  -9.299  -8.160  1.00 0.00 ? 44 ALA A N    5  
ATOM 4996  C CA   . ALA A 1 44 ? -5.931  -9.255  -9.616  1.00 0.00 ? 44 ALA A CA   5  
ATOM 4997  C C    . ALA A 1 44 ? -4.521  -9.128  -10.176 1.00 0.00 ? 44 ALA A C    5  
ATOM 4998  O O    . ALA A 1 44 ? -4.148  -9.823  -11.122 1.00 0.00 ? 44 ALA A O    5  
ATOM 4999  C CB   . ALA A 1 44 ? -6.804  -8.106  -10.096 1.00 0.00 ? 44 ALA A CB   5  
ATOM 5000  H H    . ALA A 1 44 ? -6.125  -8.492  -7.653  1.00 0.00 ? 44 ALA A H    5  
ATOM 5001  H HA   . ALA A 1 44 ? -6.368  -10.179 -9.969  1.00 0.00 ? 44 ALA A HA   5  
ATOM 5002  H HB1  . ALA A 1 44 ? -6.223  -7.452  -10.729 1.00 0.00 ? 44 ALA A HB1  5  
ATOM 5003  H HB2  . ALA A 1 44 ? -7.169  -7.551  -9.244  1.00 0.00 ? 44 ALA A HB2  5  
ATOM 5004  H HB3  . ALA A 1 44 ? -7.640  -8.498  -10.655 1.00 0.00 ? 44 ALA A HB3  5  
ATOM 5005  N N    . LEU A 1 45 ? -3.730  -8.257  -9.558  1.00 0.00 ? 45 LEU A N    5  
ATOM 5006  C CA   . LEU A 1 45 ? -2.349  -8.043  -9.960  1.00 0.00 ? 45 LEU A CA   5  
ATOM 5007  C C    . LEU A 1 45 ? -1.617  -9.359  -10.180 1.00 0.00 ? 45 LEU A C    5  
ATOM 5008  O O    . LEU A 1 45 ? -0.671  -9.431  -10.961 1.00 0.00 ? 45 LEU A O    5  
ATOM 5009  C CB   . LEU A 1 45 ? -1.640  -7.240  -8.880  1.00 0.00 ? 45 LEU A CB   5  
ATOM 5010  C CG   . LEU A 1 45 ? -1.867  -5.732  -8.953  1.00 0.00 ? 45 LEU A CG   5  
ATOM 5011  C CD1  . LEU A 1 45 ? -3.354  -5.415  -8.918  1.00 0.00 ? 45 LEU A CD1  5  
ATOM 5012  C CD2  . LEU A 1 45 ? -1.145  -5.032  -7.815  1.00 0.00 ? 45 LEU A CD2  5  
ATOM 5013  H H    . LEU A 1 45 ? -4.085  -7.737  -8.804  1.00 0.00 ? 45 LEU A H    5  
ATOM 5014  H HA   . LEU A 1 45 ? -2.348  -7.482  -10.880 1.00 0.00 ? 45 LEU A HA   5  
ATOM 5015  H HB2  . LEU A 1 45 ? -1.988  -7.587  -7.918  1.00 0.00 ? 45 LEU A HB2  5  
ATOM 5016  H HB3  . LEU A 1 45 ? -0.584  -7.437  -8.952  1.00 0.00 ? 45 LEU A HB3  5  
ATOM 5017  H HG   . LEU A 1 45 ? -1.471  -5.362  -9.883  1.00 0.00 ? 45 LEU A HG   5  
ATOM 5018  H HD11 . LEU A 1 45 ? -3.805  -5.900  -8.065  1.00 0.00 ? 45 LEU A HD11 5  
ATOM 5019  H HD12 . LEU A 1 45 ? -3.820  -5.773  -9.824  1.00 0.00 ? 45 LEU A HD12 5  
ATOM 5020  H HD13 . LEU A 1 45 ? -3.492  -4.347  -8.841  1.00 0.00 ? 45 LEU A HD13 5  
ATOM 5021  H HD21 . LEU A 1 45 ? -1.042  -3.982  -8.046  1.00 0.00 ? 45 LEU A HD21 5  
ATOM 5022  H HD22 . LEU A 1 45 ? -0.168  -5.471  -7.685  1.00 0.00 ? 45 LEU A HD22 5  
ATOM 5023  H HD23 . LEU A 1 45 ? -1.717  -5.147  -6.906  1.00 0.00 ? 45 LEU A HD23 5  
ATOM 5024  N N    . LYS A 1 46 ? -2.071  -10.388 -9.474  1.00 0.00 ? 46 LYS A N    5  
ATOM 5025  C CA   . LYS A 1 46 ? -1.469  -11.722 -9.519  1.00 0.00 ? 46 LYS A CA   5  
ATOM 5026  C C    . LYS A 1 46 ? -0.315  -11.841 -8.529  1.00 0.00 ? 46 LYS A C    5  
ATOM 5027  O O    . LYS A 1 46 ? 0.527   -12.731 -8.643  1.00 0.00 ? 46 LYS A O    5  
ATOM 5028  C CB   . LYS A 1 46 ? -0.979  -12.090 -10.916 1.00 0.00 ? 46 LYS A CB   5  
ATOM 5029  C CG   . LYS A 1 46 ? -0.544  -13.534 -10.997 1.00 0.00 ? 46 LYS A CG   5  
ATOM 5030  C CD   . LYS A 1 46 ? -0.624  -14.070 -12.419 1.00 0.00 ? 46 LYS A CD   5  
ATOM 5031  C CE   . LYS A 1 46 ? -1.844  -14.953 -12.614 1.00 0.00 ? 46 LYS A CE   5  
ATOM 5032  N NZ   . LYS A 1 46 ? -1.605  -16.345 -12.141 1.00 0.00 ? 46 LYS A NZ   5  
ATOM 5033  H H    . LYS A 1 46 ? -2.810  -10.231 -8.853  1.00 0.00 ? 46 LYS A H    5  
ATOM 5034  H HA   . LYS A 1 46 ? -2.235  -12.426 -9.229  1.00 0.00 ? 46 LYS A HA   5  
ATOM 5035  H HB2  . LYS A 1 46 ? -1.775  -11.927 -11.628 1.00 0.00 ? 46 LYS A HB2  5  
ATOM 5036  H HB3  . LYS A 1 46 ? -0.136  -11.471 -11.174 1.00 0.00 ? 46 LYS A HB3  5  
ATOM 5037  H HG2  . LYS A 1 46 ? 0.474   -13.604 -10.648 1.00 0.00 ? 46 LYS A HG2  5  
ATOM 5038  H HG3  . LYS A 1 46 ? -1.185  -14.120 -10.358 1.00 0.00 ? 46 LYS A HG3  5  
ATOM 5039  H HD2  . LYS A 1 46 ? -0.681  -13.238 -13.104 1.00 0.00 ? 46 LYS A HD2  5  
ATOM 5040  H HD3  . LYS A 1 46 ? 0.262   -14.649 -12.625 1.00 0.00 ? 46 LYS A HD3  5  
ATOM 5041  H HE2  . LYS A 1 46 ? -2.670  -14.531 -12.063 1.00 0.00 ? 46 LYS A HE2  5  
ATOM 5042  H HE3  . LYS A 1 46 ? -2.087  -14.977 -13.665 1.00 0.00 ? 46 LYS A HE3  5  
ATOM 5043  H HZ1  . LYS A 1 46 ? -0.633  -16.438 -11.780 1.00 0.00 ? 46 LYS A HZ1  5  
ATOM 5044  H HZ2  . LYS A 1 46 ? -1.737  -17.016 -12.924 1.00 0.00 ? 46 LYS A HZ2  5  
ATOM 5045  H HZ3  . LYS A 1 46 ? -2.270  -16.582 -11.379 1.00 0.00 ? 46 LYS A HZ3  5  
ATOM 5046  N N    . ILE A 1 47 ? -0.297  -10.947 -7.556  1.00 0.00 ? 47 ILE A N    5  
ATOM 5047  C CA   . ILE A 1 47 ? 0.734   -10.947 -6.525  1.00 0.00 ? 47 ILE A CA   5  
ATOM 5048  C C    . ILE A 1 47 ? 0.452   -12.024 -5.480  1.00 0.00 ? 47 ILE A C    5  
ATOM 5049  O O    . ILE A 1 47 ? -0.694  -12.217 -5.075  1.00 0.00 ? 47 ILE A O    5  
ATOM 5050  C CB   . ILE A 1 47 ? 0.828   -9.577  -5.819  1.00 0.00 ? 47 ILE A CB   5  
ATOM 5051  C CG1  . ILE A 1 47 ? 0.610   -8.440  -6.818  1.00 0.00 ? 47 ILE A CG1  5  
ATOM 5052  C CG2  . ILE A 1 47 ? 2.175   -9.425  -5.129  1.00 0.00 ? 47 ILE A CG2  5  
ATOM 5053  C CD1  . ILE A 1 47 ? 1.508   -8.521  -8.032  1.00 0.00 ? 47 ILE A CD1  5  
ATOM 5054  H H    . ILE A 1 47 ? -1.001  -10.278 -7.524  1.00 0.00 ? 47 ILE A H    5  
ATOM 5055  H HA   . ILE A 1 47 ? 1.683   -11.152 -6.998  1.00 0.00 ? 47 ILE A HA   5  
ATOM 5056  H HB   . ILE A 1 47 ? 0.059   -9.535  -5.061  1.00 0.00 ? 47 ILE A HB   5  
ATOM 5057  H HG12 . ILE A 1 47 ? -0.414  -8.461  -7.161  1.00 0.00 ? 47 ILE A HG12 5  
ATOM 5058  H HG13 . ILE A 1 47 ? 0.801   -7.496  -6.328  1.00 0.00 ? 47 ILE A HG13 5  
ATOM 5059  H HG21 . ILE A 1 47 ? 2.193   -10.035 -4.238  1.00 0.00 ? 47 ILE A HG21 5  
ATOM 5060  H HG22 . ILE A 1 47 ? 2.328   -8.391  -4.862  1.00 0.00 ? 47 ILE A HG22 5  
ATOM 5061  H HG23 . ILE A 1 47 ? 2.960   -9.744  -5.800  1.00 0.00 ? 47 ILE A HG23 5  
ATOM 5062  H HD11 . ILE A 1 47 ? 1.498   -7.575  -8.553  1.00 0.00 ? 47 ILE A HD11 5  
ATOM 5063  H HD12 . ILE A 1 47 ? 1.152   -9.300  -8.691  1.00 0.00 ? 47 ILE A HD12 5  
ATOM 5064  H HD13 . ILE A 1 47 ? 2.516   -8.749  -7.716  1.00 0.00 ? 47 ILE A HD13 5  
ATOM 5065  N N    . PRO A 1 48 ? 1.493   -12.746 -5.031  1.00 0.00 ? 48 PRO A N    5  
ATOM 5066  C CA   . PRO A 1 48 ? 1.344   -13.802 -4.029  1.00 0.00 ? 48 PRO A CA   5  
ATOM 5067  C C    . PRO A 1 48 ? 0.378   -13.413 -2.914  1.00 0.00 ? 48 PRO A C    5  
ATOM 5068  O O    . PRO A 1 48 ? 0.244   -12.236 -2.578  1.00 0.00 ? 48 PRO A O    5  
ATOM 5069  C CB   . PRO A 1 48 ? 2.762   -13.954 -3.487  1.00 0.00 ? 48 PRO A CB   5  
ATOM 5070  C CG   . PRO A 1 48 ? 3.636   -13.625 -4.649  1.00 0.00 ? 48 PRO A CG   5  
ATOM 5071  C CD   . PRO A 1 48 ? 2.898   -12.585 -5.454  1.00 0.00 ? 48 PRO A CD   5  
ATOM 5072  H HA   . PRO A 1 48 ? 1.023   -14.730 -4.475  1.00 0.00 ? 48 PRO A HA   5  
ATOM 5073  H HB2  . PRO A 1 48 ? 2.916   -13.268 -2.668  1.00 0.00 ? 48 PRO A HB2  5  
ATOM 5074  H HB3  . PRO A 1 48 ? 2.916   -14.970 -3.149  1.00 0.00 ? 48 PRO A HB3  5  
ATOM 5075  H HG2  . PRO A 1 48 ? 4.578   -13.228 -4.298  1.00 0.00 ? 48 PRO A HG2  5  
ATOM 5076  H HG3  . PRO A 1 48 ? 3.802   -14.510 -5.245  1.00 0.00 ? 48 PRO A HG3  5  
ATOM 5077  H HD2  . PRO A 1 48 ? 3.261   -11.597 -5.212  1.00 0.00 ? 48 PRO A HD2  5  
ATOM 5078  H HD3  . PRO A 1 48 ? 3.007   -12.778 -6.510  1.00 0.00 ? 48 PRO A HD3  5  
ATOM 5079  N N    . GLU A 1 49 ? -0.300  -14.407 -2.350  1.00 0.00 ? 49 GLU A N    5  
ATOM 5080  C CA   . GLU A 1 49 ? -1.260  -14.166 -1.278  1.00 0.00 ? 49 GLU A CA   5  
ATOM 5081  C C    . GLU A 1 49 ? -0.581  -14.211 0.086   1.00 0.00 ? 49 GLU A C    5  
ATOM 5082  O O    . GLU A 1 49 ? -1.071  -14.855 1.014   1.00 0.00 ? 49 GLU A O    5  
ATOM 5083  C CB   . GLU A 1 49 ? -2.386  -15.202 -1.333  1.00 0.00 ? 49 GLU A CB   5  
ATOM 5084  C CG   . GLU A 1 49 ? -3.531  -14.905 -0.377  1.00 0.00 ? 49 GLU A CG   5  
ATOM 5085  C CD   . GLU A 1 49 ? -4.787  -15.686 -0.709  1.00 0.00 ? 49 GLU A CD   5  
ATOM 5086  O OE1  . GLU A 1 49 ? -5.613  -15.176 -1.494  1.00 0.00 ? 49 GLU A OE1  5  
ATOM 5087  O OE2  . GLU A 1 49 ? -4.944  -16.808 -0.184  1.00 0.00 ? 49 GLU A OE2  5  
ATOM 5088  H H    . GLU A 1 49 ? -0.154  -15.324 -2.662  1.00 0.00 ? 49 GLU A H    5  
ATOM 5089  H HA   . GLU A 1 49 ? -1.680  -13.181 -1.426  1.00 0.00 ? 49 GLU A HA   5  
ATOM 5090  H HB2  . GLU A 1 49 ? -2.782  -15.232 -2.337  1.00 0.00 ? 49 GLU A HB2  5  
ATOM 5091  H HB3  . GLU A 1 49 ? -1.980  -16.171 -1.085  1.00 0.00 ? 49 GLU A HB3  5  
ATOM 5092  H HG2  . GLU A 1 49 ? -3.221  -15.160 0.625   1.00 0.00 ? 49 GLU A HG2  5  
ATOM 5093  H HG3  . GLU A 1 49 ? -3.759  -13.850 -0.426  1.00 0.00 ? 49 GLU A HG3  5  
ATOM 5094  N N    . GLN A 1 50 ? 0.550   -13.522 0.203   1.00 0.00 ? 50 GLN A N    5  
ATOM 5095  C CA   . GLN A 1 50 ? 1.293   -13.482 1.457   1.00 0.00 ? 50 GLN A CA   5  
ATOM 5096  C C    . GLN A 1 50 ? 0.748   -12.393 2.375   1.00 0.00 ? 50 GLN A C    5  
ATOM 5097  O O    . GLN A 1 50 ? 0.401   -12.656 3.527   1.00 0.00 ? 50 GLN A O    5  
ATOM 5098  C CB   . GLN A 1 50 ? 2.782   -13.240 1.189   1.00 0.00 ? 50 GLN A CB   5  
ATOM 5099  C CG   . GLN A 1 50 ? 3.281   -13.862 -0.106  1.00 0.00 ? 50 GLN A CG   5  
ATOM 5100  C CD   . GLN A 1 50 ? 4.545   -14.672 0.082   1.00 0.00 ? 50 GLN A CD   5  
ATOM 5101  O OE1  . GLN A 1 50 ? 5.407   -14.324 0.888   1.00 0.00 ? 50 GLN A OE1  5  
ATOM 5102  N NE2  . GLN A 1 50 ? 4.659   -15.762 -0.664  1.00 0.00 ? 50 GLN A NE2  5  
ATOM 5103  H H    . GLN A 1 50 ? 0.889   -13.025 -0.570  1.00 0.00 ? 50 GLN A H    5  
ATOM 5104  H HA   . GLN A 1 50 ? 1.173   -14.439 1.942   1.00 0.00 ? 50 GLN A HA   5  
ATOM 5105  H HB2  . GLN A 1 50 ? 2.958   -12.176 1.143   1.00 0.00 ? 50 GLN A HB2  5  
ATOM 5106  H HB3  . GLN A 1 50 ? 3.354   -13.656 2.006   1.00 0.00 ? 50 GLN A HB3  5  
ATOM 5107  H HG2  . GLN A 1 50 ? 2.514   -14.514 -0.498  1.00 0.00 ? 50 GLN A HG2  5  
ATOM 5108  H HG3  . GLN A 1 50 ? 3.479   -13.074 -0.817  1.00 0.00 ? 50 GLN A HG3  5  
ATOM 5109  H HE21 . GLN A 1 50 ? 3.931   -15.978 -1.284  1.00 0.00 ? 50 GLN A HE21 5  
ATOM 5110  H HE22 . GLN A 1 50 ? 5.464   -16.308 -0.565  1.00 0.00 ? 50 GLN A HE22 5  
ATOM 5111  N N    . TYR A 1 51 ? 0.672   -11.171 1.856   1.00 0.00 ? 51 TYR A N    5  
ATOM 5112  C CA   . TYR A 1 51 ? 0.177   -10.041 2.632   1.00 0.00 ? 51 TYR A CA   5  
ATOM 5113  C C    . TYR A 1 51 ? -0.769  -9.178  1.802   1.00 0.00 ? 51 TYR A C    5  
ATOM 5114  O O    . TYR A 1 51 ? -0.839  -7.963  1.988   1.00 0.00 ? 51 TYR A O    5  
ATOM 5115  C CB   . TYR A 1 51 ? 1.344   -9.187  3.143   1.00 0.00 ? 51 TYR A CB   5  
ATOM 5116  C CG   . TYR A 1 51 ? 2.586   -9.246  2.277   1.00 0.00 ? 51 TYR A CG   5  
ATOM 5117  C CD1  . TYR A 1 51 ? 2.512   -9.034  0.906   1.00 0.00 ? 51 TYR A CD1  5  
ATOM 5118  C CD2  . TYR A 1 51 ? 3.831   -9.515  2.834   1.00 0.00 ? 51 TYR A CD2  5  
ATOM 5119  C CE1  . TYR A 1 51 ? 3.643   -9.088  0.114   1.00 0.00 ? 51 TYR A CE1  5  
ATOM 5120  C CE2  . TYR A 1 51 ? 4.966   -9.570  2.048   1.00 0.00 ? 51 TYR A CE2  5  
ATOM 5121  C CZ   . TYR A 1 51 ? 4.867   -9.357  0.690   1.00 0.00 ? 51 TYR A CZ   5  
ATOM 5122  O OH   . TYR A 1 51 ? 5.996   -9.410  -0.096  1.00 0.00 ? 51 TYR A OH   5  
ATOM 5123  H H    . TYR A 1 51 ? 0.970   -11.024 0.936   1.00 0.00 ? 51 TYR A H    5  
ATOM 5124  H HA   . TYR A 1 51 ? -0.366  -10.435 3.478   1.00 0.00 ? 51 TYR A HA   5  
ATOM 5125  H HB2  . TYR A 1 51 ? 1.027   -8.157  3.189   1.00 0.00 ? 51 TYR A HB2  5  
ATOM 5126  H HB3  . TYR A 1 51 ? 1.616   -9.520  4.133   1.00 0.00 ? 51 TYR A HB3  5  
ATOM 5127  H HD1  . TYR A 1 51 ? 1.552   -8.825  0.458   1.00 0.00 ? 51 TYR A HD1  5  
ATOM 5128  H HD2  . TYR A 1 51 ? 3.904   -9.682  3.898   1.00 0.00 ? 51 TYR A HD2  5  
ATOM 5129  H HE1  . TYR A 1 51 ? 3.565   -8.921  -0.950  1.00 0.00 ? 51 TYR A HE1  5  
ATOM 5130  H HE2  . TYR A 1 51 ? 5.924   -9.780  2.499   1.00 0.00 ? 51 TYR A HE2  5  
ATOM 5131  H HH   . TYR A 1 51 ? 5.761   -9.720  -0.974  1.00 0.00 ? 51 TYR A HH   5  
ATOM 5132  N N    . ARG A 1 52 ? -1.496  -9.812  0.886   1.00 0.00 ? 52 ARG A N    5  
ATOM 5133  C CA   . ARG A 1 52 ? -2.443  -9.097  0.037   1.00 0.00 ? 52 ARG A CA   5  
ATOM 5134  C C    . ARG A 1 52 ? -3.435  -8.304  0.882   1.00 0.00 ? 52 ARG A C    5  
ATOM 5135  O O    . ARG A 1 52 ? -3.670  -7.121  0.635   1.00 0.00 ? 52 ARG A O    5  
ATOM 5136  C CB   . ARG A 1 52 ? -3.193  -10.081 -0.866  1.00 0.00 ? 52 ARG A CB   5  
ATOM 5137  C CG   . ARG A 1 52 ? -3.309  -9.621  -2.311  1.00 0.00 ? 52 ARG A CG   5  
ATOM 5138  C CD   . ARG A 1 52 ? -3.259  -10.794 -3.276  1.00 0.00 ? 52 ARG A CD   5  
ATOM 5139  N NE   . ARG A 1 52 ? -4.457  -11.623 -3.190  1.00 0.00 ? 52 ARG A NE   5  
ATOM 5140  C CZ   . ARG A 1 52 ? -4.656  -12.708 -3.931  1.00 0.00 ? 52 ARG A CZ   5  
ATOM 5141  N NH1  . ARG A 1 52 ? -3.739  -13.089 -4.809  1.00 0.00 ? 52 ARG A NH1  5  
ATOM 5142  N NH2  . ARG A 1 52 ? -5.772  -13.410 -3.796  1.00 0.00 ? 52 ARG A NH2  5  
ATOM 5143  H H    . ARG A 1 52 ? -1.401  -10.782 0.785   1.00 0.00 ? 52 ARG A H    5  
ATOM 5144  H HA   . ARG A 1 52 ? -1.882  -8.410  -0.580  1.00 0.00 ? 52 ARG A HA   5  
ATOM 5145  H HB2  . ARG A 1 52 ? -2.675  -11.028 -0.854  1.00 0.00 ? 52 ARG A HB2  5  
ATOM 5146  H HB3  . ARG A 1 52 ? -4.189  -10.221 -0.474  1.00 0.00 ? 52 ARG A HB3  5  
ATOM 5147  H HG2  . ARG A 1 52 ? -4.248  -9.101  -2.441  1.00 0.00 ? 52 ARG A HG2  5  
ATOM 5148  H HG3  . ARG A 1 52 ? -2.492  -8.949  -2.533  1.00 0.00 ? 52 ARG A HG3  5  
ATOM 5149  H HD2  . ARG A 1 52 ? -3.168  -10.413 -4.282  1.00 0.00 ? 52 ARG A HD2  5  
ATOM 5150  H HD3  . ARG A 1 52 ? -2.395  -11.400 -3.041  1.00 0.00 ? 52 ARG A HD3  5  
ATOM 5151  H HE   . ARG A 1 52 ? -5.147  -11.358 -2.547  1.00 0.00 ? 52 ARG A HE   5  
ATOM 5152  H HH11 . ARG A 1 52 ? -2.895  -12.561 -4.913  1.00 0.00 ? 52 ARG A HH11 5  
ATOM 5153  H HH12 . ARG A 1 52 ? -3.889  -13.906 -5.366  1.00 0.00 ? 52 ARG A HH12 5  
ATOM 5154  H HH21 . ARG A 1 52 ? -6.465  -13.124 -3.135  1.00 0.00 ? 52 ARG A HH21 5  
ATOM 5155  H HH22 . ARG A 1 52 ? -5.920  -14.226 -4.355  1.00 0.00 ? 52 ARG A HH22 5  
ATOM 5156  N N    . MET A 1 53 ? -4.007  -8.962  1.885   1.00 0.00 ? 53 MET A N    5  
ATOM 5157  C CA   . MET A 1 53 ? -4.967  -8.317  2.772   1.00 0.00 ? 53 MET A CA   5  
ATOM 5158  C C    . MET A 1 53 ? -4.328  -7.137  3.496   1.00 0.00 ? 53 MET A C    5  
ATOM 5159  O O    . MET A 1 53 ? -4.914  -6.058  3.583   1.00 0.00 ? 53 MET A O    5  
ATOM 5160  C CB   . MET A 1 53 ? -5.512  -9.321  3.790   1.00 0.00 ? 53 MET A CB   5  
ATOM 5161  C CG   . MET A 1 53 ? -6.221  -10.507 3.156   1.00 0.00 ? 53 MET A CG   5  
ATOM 5162  S SD   . MET A 1 53 ? -7.865  -10.782 3.844   1.00 0.00 ? 53 MET A SD   5  
ATOM 5163  C CE   . MET A 1 53 ? -8.700  -11.519 2.441   1.00 0.00 ? 53 MET A CE   5  
ATOM 5164  H H    . MET A 1 53 ? -3.775  -9.902  2.034   1.00 0.00 ? 53 MET A H    5  
ATOM 5165  H HA   . MET A 1 53 ? -5.783  -7.951  2.165   1.00 0.00 ? 53 MET A HA   5  
ATOM 5166  H HB2  . MET A 1 53 ? -4.690  -9.696  4.383   1.00 0.00 ? 53 MET A HB2  5  
ATOM 5167  H HB3  . MET A 1 53 ? -6.212  -8.816  4.439   1.00 0.00 ? 53 MET A HB3  5  
ATOM 5168  H HG2  . MET A 1 53 ? -6.317  -10.327 2.095   1.00 0.00 ? 53 MET A HG2  5  
ATOM 5169  H HG3  . MET A 1 53 ? -5.627  -11.393 3.317   1.00 0.00 ? 53 MET A HG3  5  
ATOM 5170  H HE1  . MET A 1 53 ? -8.640  -12.595 2.512   1.00 0.00 ? 53 MET A HE1  5  
ATOM 5171  H HE2  . MET A 1 53 ? -8.227  -11.191 1.527   1.00 0.00 ? 53 MET A HE2  5  
ATOM 5172  H HE3  . MET A 1 53 ? -9.737  -11.217 2.439   1.00 0.00 ? 53 MET A HE3  5  
ATOM 5173  N N    . THR A 1 54 ? -3.119  -7.348  4.009   1.00 0.00 ? 54 THR A N    5  
ATOM 5174  C CA   . THR A 1 54 ? -2.398  -6.294  4.714   1.00 0.00 ? 54 THR A CA   5  
ATOM 5175  C C    . THR A 1 54 ? -2.337  -5.029  3.867   1.00 0.00 ? 54 THR A C    5  
ATOM 5176  O O    . THR A 1 54 ? -2.594  -3.928  4.355   1.00 0.00 ? 54 THR A O    5  
ATOM 5177  C CB   . THR A 1 54 ? -0.982  -6.754  5.061   1.00 0.00 ? 54 THR A CB   5  
ATOM 5178  O OG1  . THR A 1 54 ? -1.017  -7.867  5.937   1.00 0.00 ? 54 THR A OG1  5  
ATOM 5179  C CG2  . THR A 1 54 ? -0.146  -5.677  5.718   1.00 0.00 ? 54 THR A CG2  5  
ATOM 5180  H H    . THR A 1 54 ? -2.699  -8.226  3.903   1.00 0.00 ? 54 THR A H    5  
ATOM 5181  H HA   . THR A 1 54 ? -2.935  -6.077  5.626   1.00 0.00 ? 54 THR A HA   5  
ATOM 5182  H HB   . THR A 1 54 ? -0.478  -7.053  4.154   1.00 0.00 ? 54 THR A HB   5  
ATOM 5183  H HG1  . THR A 1 54 ? -1.362  -8.631  5.471   1.00 0.00 ? 54 THR A HG1  5  
ATOM 5184  H HG21 . THR A 1 54 ? 0.857   -6.046  5.875   1.00 0.00 ? 54 THR A HG21 5  
ATOM 5185  H HG22 . THR A 1 54 ? -0.584  -5.411  6.668   1.00 0.00 ? 54 THR A HG22 5  
ATOM 5186  H HG23 . THR A 1 54 ? -0.114  -4.806  5.079   1.00 0.00 ? 54 THR A HG23 5  
ATOM 5187  N N    . ILE A 1 55 ? -2.004  -5.197  2.592   1.00 0.00 ? 55 ILE A N    5  
ATOM 5188  C CA   . ILE A 1 55 ? -1.918  -4.070  1.675   1.00 0.00 ? 55 ILE A CA   5  
ATOM 5189  C C    . ILE A 1 55 ? -3.268  -3.372  1.548   1.00 0.00 ? 55 ILE A C    5  
ATOM 5190  O O    . ILE A 1 55 ? -3.343  -2.143  1.551   1.00 0.00 ? 55 ILE A O    5  
ATOM 5191  C CB   . ILE A 1 55 ? -1.439  -4.506  0.277   1.00 0.00 ? 55 ILE A CB   5  
ATOM 5192  C CG1  . ILE A 1 55 ? -0.086  -5.212  0.372   1.00 0.00 ? 55 ILE A CG1  5  
ATOM 5193  C CG2  . ILE A 1 55 ? -1.346  -3.301  -0.647  1.00 0.00 ? 55 ILE A CG2  5  
ATOM 5194  C CD1  . ILE A 1 55 ? 0.136   -6.240  -0.716  1.00 0.00 ? 55 ILE A CD1  5  
ATOM 5195  H H    . ILE A 1 55 ? -1.815  -6.099  2.260   1.00 0.00 ? 55 ILE A H    5  
ATOM 5196  H HA   . ILE A 1 55 ? -1.200  -3.373  2.073   1.00 0.00 ? 55 ILE A HA   5  
ATOM 5197  H HB   . ILE A 1 55 ? -2.168  -5.189  -0.132  1.00 0.00 ? 55 ILE A HB   5  
ATOM 5198  H HG12 . ILE A 1 55 ? 0.702   -4.477  0.299   1.00 0.00 ? 55 ILE A HG12 5  
ATOM 5199  H HG13 . ILE A 1 55 ? -0.016  -5.717  1.324   1.00 0.00 ? 55 ILE A HG13 5  
ATOM 5200  H HG21 . ILE A 1 55 ? -2.340  -2.960  -0.896  1.00 0.00 ? 55 ILE A HG21 5  
ATOM 5201  H HG22 . ILE A 1 55 ? -0.825  -3.579  -1.551  1.00 0.00 ? 55 ILE A HG22 5  
ATOM 5202  H HG23 . ILE A 1 55 ? -0.808  -2.508  -0.149  1.00 0.00 ? 55 ILE A HG23 5  
ATOM 5203  H HD11 . ILE A 1 55 ? 0.950   -6.891  -0.435  1.00 0.00 ? 55 ILE A HD11 5  
ATOM 5204  H HD12 . ILE A 1 55 ? 0.378   -5.738  -1.642  1.00 0.00 ? 55 ILE A HD12 5  
ATOM 5205  H HD13 . ILE A 1 55 ? -0.763  -6.825  -0.849  1.00 0.00 ? 55 ILE A HD13 5  
ATOM 5206  N N    . TRP A 1 56 ? -4.332  -4.161  1.440   1.00 0.00 ? 56 TRP A N    5  
ATOM 5207  C CA   . TRP A 1 56 ? -5.677  -3.614  1.334   1.00 0.00 ? 56 TRP A CA   5  
ATOM 5208  C C    . TRP A 1 56 ? -6.003  -2.771  2.564   1.00 0.00 ? 56 TRP A C    5  
ATOM 5209  O O    . TRP A 1 56 ? -6.426  -1.621  2.449   1.00 0.00 ? 56 TRP A O    5  
ATOM 5210  C CB   . TRP A 1 56 ? -6.686  -4.756  1.169   1.00 0.00 ? 56 TRP A CB   5  
ATOM 5211  C CG   . TRP A 1 56 ? -8.109  -4.355  1.393   1.00 0.00 ? 56 TRP A CG   5  
ATOM 5212  C CD1  . TRP A 1 56 ? -8.723  -3.220  0.954   1.00 0.00 ? 56 TRP A CD1  5  
ATOM 5213  C CD2  . TRP A 1 56 ? -9.095  -5.089  2.121   1.00 0.00 ? 56 TRP A CD2  5  
ATOM 5214  N NE1  . TRP A 1 56 ? -10.035 -3.208  1.362   1.00 0.00 ? 56 TRP A NE1  5  
ATOM 5215  C CE2  . TRP A 1 56 ? -10.286 -4.345  2.076   1.00 0.00 ? 56 TRP A CE2  5  
ATOM 5216  C CE3  . TRP A 1 56 ? -9.085  -6.309  2.797   1.00 0.00 ? 56 TRP A CE3  5  
ATOM 5217  C CZ2  . TRP A 1 56 ? -11.456 -4.775  2.686   1.00 0.00 ? 56 TRP A CZ2  5  
ATOM 5218  C CZ3  . TRP A 1 56 ? -10.250 -6.741  3.406   1.00 0.00 ? 56 TRP A CZ3  5  
ATOM 5219  C CH2  . TRP A 1 56 ? -11.422 -5.973  3.347   1.00 0.00 ? 56 TRP A CH2  5  
ATOM 5220  H H    . TRP A 1 56 ? -4.213  -5.135  1.453   1.00 0.00 ? 56 TRP A H    5  
ATOM 5221  H HA   . TRP A 1 56 ? -5.713  -2.982  0.461   1.00 0.00 ? 56 TRP A HA   5  
ATOM 5222  H HB2  . TRP A 1 56 ? -6.609  -5.147  0.165   1.00 0.00 ? 56 TRP A HB2  5  
ATOM 5223  H HB3  . TRP A 1 56 ? -6.447  -5.540  1.873   1.00 0.00 ? 56 TRP A HB3  5  
ATOM 5224  H HD1  . TRP A 1 56 ? -8.235  -2.452  0.373   1.00 0.00 ? 56 TRP A HD1  5  
ATOM 5225  H HE1  . TRP A 1 56 ? -10.687 -2.501  1.171   1.00 0.00 ? 56 TRP A HE1  5  
ATOM 5226  H HE3  . TRP A 1 56 ? -8.187  -6.909  2.851   1.00 0.00 ? 56 TRP A HE3  5  
ATOM 5227  H HZ2  . TRP A 1 56 ? -12.363 -4.192  2.647   1.00 0.00 ? 56 TRP A HZ2  5  
ATOM 5228  H HZ3  . TRP A 1 56 ? -10.263 -7.681  3.937   1.00 0.00 ? 56 TRP A HZ3  5  
ATOM 5229  H HH2  . TRP A 1 56 ? -12.309 -6.347  3.836   1.00 0.00 ? 56 TRP A HH2  5  
ATOM 5230  N N    . ARG A 1 57 ? -5.772  -3.344  3.741   1.00 0.00 ? 57 ARG A N    5  
ATOM 5231  C CA   . ARG A 1 57 ? -6.016  -2.645  5.000   1.00 0.00 ? 57 ARG A CA   5  
ATOM 5232  C C    . ARG A 1 57 ? -5.427  -1.240  4.960   1.00 0.00 ? 57 ARG A C    5  
ATOM 5233  O O    . ARG A 1 57 ? -6.137  -0.250  5.141   1.00 0.00 ? 57 ARG A O    5  
ATOM 5234  C CB   . ARG A 1 57 ? -5.416  -3.430  6.168   1.00 0.00 ? 57 ARG A CB   5  
ATOM 5235  C CG   . ARG A 1 57 ? -5.762  -4.911  6.147   1.00 0.00 ? 57 ARG A CG   5  
ATOM 5236  C CD   . ARG A 1 57 ? -6.415  -5.349  7.448   1.00 0.00 ? 57 ARG A CD   5  
ATOM 5237  N NE   . ARG A 1 57 ? -5.441  -5.511  8.523   1.00 0.00 ? 57 ARG A NE   5  
ATOM 5238  C CZ   . ARG A 1 57 ? -5.717  -6.095  9.683   1.00 0.00 ? 57 ARG A CZ   5  
ATOM 5239  N NH1  . ARG A 1 57 ? -6.933  -6.570  9.917   1.00 0.00 ? 57 ARG A NH1  5  
ATOM 5240  N NH2  . ARG A 1 57 ? -4.778  -6.206  10.612  1.00 0.00 ? 57 ARG A NH2  5  
ATOM 5241  H H    . ARG A 1 57 ? -5.427  -4.259  3.763   1.00 0.00 ? 57 ARG A H    5  
ATOM 5242  H HA   . ARG A 1 57 ? -7.082  -2.570  5.136   1.00 0.00 ? 57 ARG A HA   5  
ATOM 5243  H HB2  . ARG A 1 57 ? -4.341  -3.334  6.137   1.00 0.00 ? 57 ARG A HB2  5  
ATOM 5244  H HB3  . ARG A 1 57 ? -5.780  -3.011  7.094   1.00 0.00 ? 57 ARG A HB3  5  
ATOM 5245  H HG2  . ARG A 1 57 ? -6.444  -5.099  5.331   1.00 0.00 ? 57 ARG A HG2  5  
ATOM 5246  H HG3  . ARG A 1 57 ? -4.856  -5.480  6.001   1.00 0.00 ? 57 ARG A HG3  5  
ATOM 5247  H HD2  . ARG A 1 57 ? -7.139  -4.604  7.740   1.00 0.00 ? 57 ARG A HD2  5  
ATOM 5248  H HD3  . ARG A 1 57 ? -6.916  -6.292  7.284   1.00 0.00 ? 57 ARG A HD3  5  
ATOM 5249  H HE   . ARG A 1 57 ? -4.536  -5.167  8.371   1.00 0.00 ? 57 ARG A HE   5  
ATOM 5250  H HH11 . ARG A 1 57 ? -7.644  -6.489  9.219   1.00 0.00 ? 57 ARG A HH11 5  
ATOM 5251  H HH12 . ARG A 1 57 ? -7.139  -7.009  10.792  1.00 0.00 ? 57 ARG A HH12 5  
ATOM 5252  H HH21 . ARG A 1 57 ? -3.860  -5.849  10.440  1.00 0.00 ? 57 ARG A HH21 5  
ATOM 5253  H HH22 . ARG A 1 57 ? -4.987  -6.646  11.485  1.00 0.00 ? 57 ARG A HH22 5  
ATOM 5254  N N    . GLY A 1 58 ? -4.130  -1.161  4.696   1.00 0.00 ? 58 GLY A N    5  
ATOM 5255  C CA   . GLY A 1 58 ? -3.474  0.127   4.596   1.00 0.00 ? 58 GLY A CA   5  
ATOM 5256  C C    . GLY A 1 58 ? -4.175  1.036   3.609   1.00 0.00 ? 58 GLY A C    5  
ATOM 5257  O O    . GLY A 1 58 ? -4.372  2.221   3.875   1.00 0.00 ? 58 GLY A O    5  
ATOM 5258  H H    . GLY A 1 58 ? -3.621  -1.982  4.545   1.00 0.00 ? 58 GLY A H    5  
ATOM 5259  H HA2  . GLY A 1 58 ? -3.472  0.598   5.569   1.00 0.00 ? 58 GLY A HA2  5  
ATOM 5260  H HA3  . GLY A 1 58 ? -2.454  -0.021  4.275   1.00 0.00 ? 58 GLY A HA3  5  
ATOM 5261  N N    . LEU A 1 59 ? -4.574  0.471   2.473   1.00 0.00 ? 59 LEU A N    5  
ATOM 5262  C CA   . LEU A 1 59 ? -5.290  1.227   1.455   1.00 0.00 ? 59 LEU A CA   5  
ATOM 5263  C C    . LEU A 1 59 ? -6.643  1.676   1.987   1.00 0.00 ? 59 LEU A C    5  
ATOM 5264  O O    . LEU A 1 59 ? -7.157  2.721   1.602   1.00 0.00 ? 59 LEU A O    5  
ATOM 5265  C CB   . LEU A 1 59 ? -5.472  0.385   0.192   1.00 0.00 ? 59 LEU A CB   5  
ATOM 5266  C CG   . LEU A 1 59 ? -4.564  0.774   -0.976  1.00 0.00 ? 59 LEU A CG   5  
ATOM 5267  C CD1  . LEU A 1 59 ? -3.102  0.653   -0.575  1.00 0.00 ? 59 LEU A CD1  5  
ATOM 5268  C CD2  . LEU A 1 59 ? -4.860  -0.089  -2.192  1.00 0.00 ? 59 LEU A CD2  5  
ATOM 5269  H H    . LEU A 1 59 ? -4.401  -0.483  2.327   1.00 0.00 ? 59 LEU A H    5  
ATOM 5270  H HA   . LEU A 1 59 ? -4.703  2.102   1.215   1.00 0.00 ? 59 LEU A HA   5  
ATOM 5271  H HB2  . LEU A 1 59 ? -5.283  -0.648  0.441   1.00 0.00 ? 59 LEU A HB2  5  
ATOM 5272  H HB3  . LEU A 1 59 ? -6.499  0.477   -0.132  1.00 0.00 ? 59 LEU A HB3  5  
ATOM 5273  H HG   . LEU A 1 59 ? -4.752  1.802   -1.241  1.00 0.00 ? 59 LEU A HG   5  
ATOM 5274  H HD11 . LEU A 1 59 ? -3.024  0.083   0.339   1.00 0.00 ? 59 LEU A HD11 5  
ATOM 5275  H HD12 . LEU A 1 59 ? -2.688  1.638   -0.422  1.00 0.00 ? 59 LEU A HD12 5  
ATOM 5276  H HD13 . LEU A 1 59 ? -2.554  0.150   -1.359  1.00 0.00 ? 59 LEU A HD13 5  
ATOM 5277  H HD21 . LEU A 1 59 ? -5.281  0.524   -2.974  1.00 0.00 ? 59 LEU A HD21 5  
ATOM 5278  H HD22 . LEU A 1 59 ? -5.563  -0.864  -1.924  1.00 0.00 ? 59 LEU A HD22 5  
ATOM 5279  H HD23 . LEU A 1 59 ? -3.944  -0.542  -2.544  1.00 0.00 ? 59 LEU A HD23 5  
ATOM 5280  N N    . GLN A 1 60 ? -7.209  0.885   2.889   1.00 0.00 ? 60 GLN A N    5  
ATOM 5281  C CA   . GLN A 1 60 ? -8.479  1.230   3.509   1.00 0.00 ? 60 GLN A CA   5  
ATOM 5282  C C    . GLN A 1 60 ? -8.303  2.395   4.484   1.00 0.00 ? 60 GLN A C    5  
ATOM 5283  O O    . GLN A 1 60 ? -9.272  3.054   4.858   1.00 0.00 ? 60 GLN A O    5  
ATOM 5284  C CB   . GLN A 1 60 ? -9.056  0.014   4.235   1.00 0.00 ? 60 GLN A CB   5  
ATOM 5285  C CG   . GLN A 1 60 ? -9.488  -1.098  3.296   1.00 0.00 ? 60 GLN A CG   5  
ATOM 5286  C CD   . GLN A 1 60 ? -10.375 -2.114  3.982   1.00 0.00 ? 60 GLN A CD   5  
ATOM 5287  O OE1  . GLN A 1 60 ? -11.595 -1.956  4.039   1.00 0.00 ? 60 GLN A OE1  5  
ATOM 5288  N NE2  . GLN A 1 60 ? -9.761  -3.155  4.526   1.00 0.00 ? 60 GLN A NE2  5  
ATOM 5289  H H    . GLN A 1 60 ? -6.744  0.072   3.173   1.00 0.00 ? 60 GLN A H    5  
ATOM 5290  H HA   . GLN A 1 60 ? -9.160  1.531   2.726   1.00 0.00 ? 60 GLN A HA   5  
ATOM 5291  H HB2  . GLN A 1 60 ? -8.306  -0.382  4.904   1.00 0.00 ? 60 GLN A HB2  5  
ATOM 5292  H HB3  . GLN A 1 60 ? -9.915  0.319   4.812   1.00 0.00 ? 60 GLN A HB3  5  
ATOM 5293  H HG2  . GLN A 1 60 ? -10.030 -0.665  2.470   1.00 0.00 ? 60 GLN A HG2  5  
ATOM 5294  H HG3  . GLN A 1 60 ? -8.608  -1.602  2.925   1.00 0.00 ? 60 GLN A HG3  5  
ATOM 5295  H HE21 . GLN A 1 60 ? -8.786  -3.214  4.442   1.00 0.00 ? 60 GLN A HE21 5  
ATOM 5296  H HE22 . GLN A 1 60 ? -10.308 -3.825  4.982   1.00 0.00 ? 60 GLN A HE22 5  
ATOM 5297  N N    . ASP A 1 61 ? -7.055  2.655   4.878   1.00 0.00 ? 61 ASP A N    5  
ATOM 5298  C CA   . ASP A 1 61 ? -6.750  3.744   5.796   1.00 0.00 ? 61 ASP A CA   5  
ATOM 5299  C C    . ASP A 1 61 ? -6.625  5.068   5.046   1.00 0.00 ? 61 ASP A C    5  
ATOM 5300  O O    . ASP A 1 61 ? -6.871  6.136   5.606   1.00 0.00 ? 61 ASP A O    5  
ATOM 5301  C CB   . ASP A 1 61 ? -5.451  3.446   6.549   1.00 0.00 ? 61 ASP A CB   5  
ATOM 5302  C CG   . ASP A 1 61 ? -5.595  3.628   8.047   1.00 0.00 ? 61 ASP A CG   5  
ATOM 5303  O OD1  . ASP A 1 61 ? -6.654  4.125   8.486   1.00 0.00 ? 61 ASP A OD1  5  
ATOM 5304  O OD2  . ASP A 1 61 ? -4.647  3.278   8.782   1.00 0.00 ? 61 ASP A OD2  5  
ATOM 5305  H H    . ASP A 1 61 ? -6.322  2.099   4.546   1.00 0.00 ? 61 ASP A H    5  
ATOM 5306  H HA   . ASP A 1 61 ? -7.561  3.819   6.505   1.00 0.00 ? 61 ASP A HA   5  
ATOM 5307  H HB2  . ASP A 1 61 ? -5.157  2.423   6.356   1.00 0.00 ? 61 ASP A HB2  5  
ATOM 5308  H HB3  . ASP A 1 61 ? -4.677  4.111   6.197   1.00 0.00 ? 61 ASP A HB3  5  
ATOM 5309  N N    . LEU A 1 62 ? -6.237  4.989   3.778   1.00 0.00 ? 62 LEU A N    5  
ATOM 5310  C CA   . LEU A 1 62 ? -6.104  6.172   2.937   1.00 0.00 ? 62 LEU A CA   5  
ATOM 5311  C C    . LEU A 1 62 ? -7.473  6.731   2.615   1.00 0.00 ? 62 LEU A C    5  
ATOM 5312  O O    . LEU A 1 62 ? -7.698  7.940   2.620   1.00 0.00 ? 62 LEU A O    5  
ATOM 5313  C CB   . LEU A 1 62 ? -5.352  5.801   1.653   1.00 0.00 ? 62 LEU A CB   5  
ATOM 5314  C CG   . LEU A 1 62 ? -6.191  5.277   0.484   1.00 0.00 ? 62 LEU A CG   5  
ATOM 5315  C CD1  . LEU A 1 62 ? -6.719  6.422   -0.352  1.00 0.00 ? 62 LEU A CD1  5  
ATOM 5316  C CD2  . LEU A 1 62 ? -5.365  4.330   -0.374  1.00 0.00 ? 62 LEU A CD2  5  
ATOM 5317  H H    . LEU A 1 62 ? -6.072  4.106   3.382   1.00 0.00 ? 62 LEU A H    5  
ATOM 5318  H HA   . LEU A 1 62 ? -5.538  6.912   3.483   1.00 0.00 ? 62 LEU A HA   5  
ATOM 5319  H HB2  . LEU A 1 62 ? -4.798  6.665   1.318   1.00 0.00 ? 62 LEU A HB2  5  
ATOM 5320  H HB3  . LEU A 1 62 ? -4.665  5.030   1.908   1.00 0.00 ? 62 LEU A HB3  5  
ATOM 5321  H HG   . LEU A 1 62 ? -7.029  4.728   0.866   1.00 0.00 ? 62 LEU A HG   5  
ATOM 5322  H HD11 . LEU A 1 62 ? -7.625  6.117   -0.851  1.00 0.00 ? 62 LEU A HD11 5  
ATOM 5323  H HD12 . LEU A 1 62 ? -5.977  6.693   -1.086  1.00 0.00 ? 62 LEU A HD12 5  
ATOM 5324  H HD13 . LEU A 1 62 ? -6.924  7.270   0.285   1.00 0.00 ? 62 LEU A HD13 5  
ATOM 5325  H HD21 . LEU A 1 62 ? -4.993  4.859   -1.238  1.00 0.00 ? 62 LEU A HD21 5  
ATOM 5326  H HD22 . LEU A 1 62 ? -5.983  3.504   -0.695  1.00 0.00 ? 62 LEU A HD22 5  
ATOM 5327  H HD23 . LEU A 1 62 ? -4.533  3.954   0.204   1.00 0.00 ? 62 LEU A HD23 5  
ATOM 5328  N N    . LYS A 1 63 ? -8.380  5.815   2.349   1.00 0.00 ? 63 LYS A N    5  
ATOM 5329  C CA   . LYS A 1 63 ? -9.758  6.163   2.025   1.00 0.00 ? 63 LYS A CA   5  
ATOM 5330  C C    . LYS A 1 63 ? -10.641 6.096   3.267   1.00 0.00 ? 63 LYS A C    5  
ATOM 5331  O O    . LYS A 1 63 ? -11.798 5.683   3.197   1.00 0.00 ? 63 LYS A O    5  
ATOM 5332  C CB   . LYS A 1 63 ? -10.301 5.228   0.943   1.00 0.00 ? 63 LYS A CB   5  
ATOM 5333  C CG   . LYS A 1 63 ? -10.961 5.961   -0.213  1.00 0.00 ? 63 LYS A CG   5  
ATOM 5334  C CD   . LYS A 1 63 ? -10.018 6.974   -0.843  1.00 0.00 ? 63 LYS A CD   5  
ATOM 5335  C CE   . LYS A 1 63 ? -10.697 8.319   -1.038  1.00 0.00 ? 63 LYS A CE   5  
ATOM 5336  N NZ   . LYS A 1 63 ? -11.119 8.532   -2.450  1.00 0.00 ? 63 LYS A NZ   5  
ATOM 5337  H H    . LYS A 1 63 ? -8.108  4.871   2.370   1.00 0.00 ? 63 LYS A H    5  
ATOM 5338  H HA   . LYS A 1 63 ? -9.764  7.175   1.650   1.00 0.00 ? 63 LYS A HA   5  
ATOM 5339  H HB2  . LYS A 1 63 ? -9.486  4.638   0.550   1.00 0.00 ? 63 LYS A HB2  5  
ATOM 5340  H HB3  . LYS A 1 63 ? -11.031 4.567   1.387   1.00 0.00 ? 63 LYS A HB3  5  
ATOM 5341  H HG2  . LYS A 1 63 ? -11.255 5.242   -0.963  1.00 0.00 ? 63 LYS A HG2  5  
ATOM 5342  H HG3  . LYS A 1 63 ? -11.834 6.480   0.154   1.00 0.00 ? 63 LYS A HG3  5  
ATOM 5343  H HD2  . LYS A 1 63 ? -9.163  7.104   -0.198  1.00 0.00 ? 63 LYS A HD2  5  
ATOM 5344  H HD3  . LYS A 1 63 ? -9.695  6.602   -1.805  1.00 0.00 ? 63 LYS A HD3  5  
ATOM 5345  H HE2  . LYS A 1 63 ? -11.568 8.365   -0.401  1.00 0.00 ? 63 LYS A HE2  5  
ATOM 5346  H HE3  . LYS A 1 63 ? -10.006 9.101   -0.757  1.00 0.00 ? 63 LYS A HE3  5  
ATOM 5347  H HZ1  . LYS A 1 63 ? -10.987 9.529   -2.717  1.00 0.00 ? 63 LYS A HZ1  5  
ATOM 5348  H HZ2  . LYS A 1 63 ? -12.122 8.283   -2.565  1.00 0.00 ? 63 LYS A HZ2  5  
ATOM 5349  H HZ3  . LYS A 1 63 ? -10.551 7.936   -3.086  1.00 0.00 ? 63 LYS A HZ3  5  
ATOM 5350  N N    . GLN A 1 64 ? -10.086 6.511   4.400   1.00 0.00 ? 64 GLN A N    5  
ATOM 5351  C CA   . GLN A 1 64 ? -10.820 6.504   5.659   1.00 0.00 ? 64 GLN A CA   5  
ATOM 5352  C C    . GLN A 1 64 ? -11.906 7.575   5.660   1.00 0.00 ? 64 GLN A C    5  
ATOM 5353  O O    . GLN A 1 64 ? -12.944 7.421   6.304   1.00 0.00 ? 64 GLN A O    5  
ATOM 5354  C CB   . GLN A 1 64 ? -9.862  6.734   6.830   1.00 0.00 ? 64 GLN A CB   5  
ATOM 5355  C CG   . GLN A 1 64 ? -9.289  8.142   6.877   1.00 0.00 ? 64 GLN A CG   5  
ATOM 5356  C CD   . GLN A 1 64 ? -7.966  8.210   7.615   1.00 0.00 ? 64 GLN A CD   5  
ATOM 5357  O OE1  . GLN A 1 64 ? -7.890  7.916   8.808   1.00 0.00 ? 64 GLN A OE1  5  
ATOM 5358  N NE2  . GLN A 1 64 ? -6.913  8.598   6.906   1.00 0.00 ? 64 GLN A NE2  5  
ATOM 5359  H H    . GLN A 1 64 ? -9.159  6.830   4.390   1.00 0.00 ? 64 GLN A H    5  
ATOM 5360  H HA   . GLN A 1 64 ? -11.285 5.535   5.769   1.00 0.00 ? 64 GLN A HA   5  
ATOM 5361  H HB2  . GLN A 1 64 ? -10.390 6.552   7.755   1.00 0.00 ? 64 GLN A HB2  5  
ATOM 5362  H HB3  . GLN A 1 64 ? -9.041  6.036   6.751   1.00 0.00 ? 64 GLN A HB3  5  
ATOM 5363  H HG2  . GLN A 1 64 ? -9.138  8.489   5.866   1.00 0.00 ? 64 GLN A HG2  5  
ATOM 5364  H HG3  . GLN A 1 64 ? -9.995  8.788   7.377   1.00 0.00 ? 64 GLN A HG3  5  
ATOM 5365  H HE21 . GLN A 1 64 ? -7.047  8.817   5.959   1.00 0.00 ? 64 GLN A HE21 5  
ATOM 5366  H HE22 . GLN A 1 64 ? -6.044  8.652   7.357   1.00 0.00 ? 64 GLN A HE22 5  
ATOM 5367  N N    . GLY A 1 65 ? -11.656 8.662   4.937   1.00 0.00 ? 65 GLY A N    5  
ATOM 5368  C CA   . GLY A 1 65 ? -12.620 9.746   4.870   1.00 0.00 ? 65 GLY A CA   5  
ATOM 5369  C C    . GLY A 1 65 ? -12.117 11.008  5.543   1.00 0.00 ? 65 GLY A C    5  
ATOM 5370  O O    . GLY A 1 65 ? -11.060 11.530  5.186   1.00 0.00 ? 65 GLY A O    5  
ATOM 5371  H H    . GLY A 1 65 ? -10.811 8.730   4.447   1.00 0.00 ? 65 GLY A H    5  
ATOM 5372  H HA2  . GLY A 1 65 ? -12.829 9.962   3.833   1.00 0.00 ? 65 GLY A HA2  5  
ATOM 5373  H HA3  . GLY A 1 65 ? -13.533 9.432   5.353   1.00 0.00 ? 65 GLY A HA3  5  
ATOM 5374  N N    . HIS A 1 66 ? -12.873 11.499  6.519   1.00 0.00 ? 66 HIS A N    5  
ATOM 5375  C CA   . HIS A 1 66 ? -12.495 12.706  7.245   1.00 0.00 ? 66 HIS A CA   5  
ATOM 5376  C C    . HIS A 1 66 ? -12.341 12.418  8.733   1.00 0.00 ? 66 HIS A C    5  
ATOM 5377  O O    . HIS A 1 66 ? -13.327 12.316  9.463   1.00 0.00 ? 66 HIS A O    5  
ATOM 5378  C CB   . HIS A 1 66 ? -13.537 13.803  7.033   1.00 0.00 ? 66 HIS A CB   5  
ATOM 5379  C CG   . HIS A 1 66 ? -13.051 15.172  7.399   1.00 0.00 ? 66 HIS A CG   5  
ATOM 5380  N ND1  . HIS A 1 66 ? -12.033 15.814  6.724   1.00 0.00 ? 66 HIS A ND1  5  
ATOM 5381  C CD2  . HIS A 1 66 ? -13.450 16.023  8.373   1.00 0.00 ? 66 HIS A CD2  5  
ATOM 5382  C CE1  . HIS A 1 66 ? -11.828 17.001  7.268   1.00 0.00 ? 66 HIS A CE1  5  
ATOM 5383  N NE2  . HIS A 1 66 ? -12.674 17.151  8.269   1.00 0.00 ? 66 HIS A NE2  5  
ATOM 5384  H H    . HIS A 1 66 ? -13.703 11.037  6.759   1.00 0.00 ? 66 HIS A H    5  
ATOM 5385  H HA   . HIS A 1 66 ? -11.545 13.041  6.856   1.00 0.00 ? 66 HIS A HA   5  
ATOM 5386  H HB2  . HIS A 1 66 ? -13.822 13.819  5.993   1.00 0.00 ? 66 HIS A HB2  5  
ATOM 5387  H HB3  . HIS A 1 66 ? -14.403 13.586  7.638   1.00 0.00 ? 66 HIS A HB3  5  
ATOM 5388  H HD1  . HIS A 1 66 ? -11.536 15.455  5.960   1.00 0.00 ? 66 HIS A HD1  5  
ATOM 5389  H HD2  . HIS A 1 66 ? -14.234 15.848  9.098   1.00 0.00 ? 66 HIS A HD2  5  
ATOM 5390  H HE1  . HIS A 1 66 ? -11.092 17.725  6.948   1.00 0.00 ? 66 HIS A HE1  5  
ATOM 5391  H HE2  . HIS A 1 66 ? -12.737 17.941  8.845   1.00 0.00 ? 66 HIS A HE2  5  
ATOM 5392  N N    . ASP A 1 67 ? -11.096 12.290  9.174   1.00 0.00 ? 67 ASP A N    5  
ATOM 5393  C CA   . ASP A 1 67 ? -10.803 12.008  10.574  1.00 0.00 ? 67 ASP A CA   5  
ATOM 5394  C C    . ASP A 1 67 ? -9.452  12.546  10.989  1.00 0.00 ? 67 ASP A C    5  
ATOM 5395  O O    . ASP A 1 67 ? -8.842  12.077  11.951  1.00 0.00 ? 67 ASP A O    5  
ATOM 5396  C CB   . ASP A 1 67 ? -10.856 10.526  10.813  1.00 0.00 ? 67 ASP A CB   5  
ATOM 5397  C CG   . ASP A 1 67 ? -11.626 10.156  12.065  1.00 0.00 ? 67 ASP A CG   5  
ATOM 5398  O OD1  . ASP A 1 67 ? -11.420 10.816  13.105  1.00 0.00 ? 67 ASP A OD1  5  
ATOM 5399  O OD2  . ASP A 1 67 ? -12.436 9.208   12.005  1.00 0.00 ? 67 ASP A OD2  5  
ATOM 5400  H H    . ASP A 1 67 ? -10.356 12.380  8.538   1.00 0.00 ? 67 ASP A H    5  
ATOM 5401  H HA   . ASP A 1 67 ? -11.545 12.475  11.162  1.00 0.00 ? 67 ASP A HA   5  
ATOM 5402  H HB2  . ASP A 1 67 ? -11.330 10.074  9.968   1.00 0.00 ? 67 ASP A HB2  5  
ATOM 5403  H HB3  . ASP A 1 67 ? -9.852  10.161  10.902  1.00 0.00 ? 67 ASP A HB3  5  
ATOM 5404  N N    . TYR A 1 68 ? -9.010  13.544  10.267  1.00 0.00 ? 68 TYR A N    5  
ATOM 5405  C CA   . TYR A 1 68 ? -7.722  14.168  10.523  1.00 0.00 ? 68 TYR A CA   5  
ATOM 5406  C C    . TYR A 1 68 ? -7.472  15.334  9.568   1.00 0.00 ? 68 TYR A C    5  
ATOM 5407  O O    . TYR A 1 68 ? -6.304  15.532  9.170   1.00 0.00 ? 68 TYR A O    5  
ATOM 5408  C CB   . TYR A 1 68 ? -6.617  13.116  10.400  1.00 0.00 ? 68 TYR A CB   5  
ATOM 5409  C CG   . TYR A 1 68 ? -6.213  12.800  8.974   1.00 0.00 ? 68 TYR A CG   5  
ATOM 5410  C CD1  . TYR A 1 68 ? -7.170  12.527  8.005   1.00 0.00 ? 68 TYR A CD1  5  
ATOM 5411  C CD2  . TYR A 1 68 ? -4.875  12.775  8.600   1.00 0.00 ? 68 TYR A CD2  5  
ATOM 5412  C CE1  . TYR A 1 68 ? -6.806  12.238  6.703   1.00 0.00 ? 68 TYR A CE1  5  
ATOM 5413  C CE2  . TYR A 1 68 ? -4.503  12.487  7.300   1.00 0.00 ? 68 TYR A CE2  5  
ATOM 5414  C CZ   . TYR A 1 68 ? -5.471  12.220  6.356   1.00 0.00 ? 68 TYR A CZ   5  
ATOM 5415  O OH   . TYR A 1 68 ? -5.104  11.933  5.062   1.00 0.00 ? 68 TYR A OH   5  
ATOM 5416  O OXT  . TYR A 1 68 ? -8.445  16.041  9.231   1.00 0.00 ? 68 TYR A OXT  5  
ATOM 5417  H H    . TYR A 1 68 ? -9.554  13.845  9.524   1.00 0.00 ? 68 TYR A H    5  
ATOM 5418  H HA   . TYR A 1 68 ? -7.735  14.545  11.535  1.00 0.00 ? 68 TYR A HA   5  
ATOM 5419  H HB2  . TYR A 1 68 ? -5.739  13.461  10.925  1.00 0.00 ? 68 TYR A HB2  5  
ATOM 5420  H HB3  . TYR A 1 68 ? -6.967  12.199  10.851  1.00 0.00 ? 68 TYR A HB3  5  
ATOM 5421  H HD1  . TYR A 1 68 ? -8.214  12.542  8.280   1.00 0.00 ? 68 TYR A HD1  5  
ATOM 5422  H HD2  . TYR A 1 68 ? -4.119  12.985  9.342   1.00 0.00 ? 68 TYR A HD2  5  
ATOM 5423  H HE1  . TYR A 1 68 ? -7.564  12.028  5.964   1.00 0.00 ? 68 TYR A HE1  5  
ATOM 5424  H HE2  . TYR A 1 68 ? -3.457  12.473  7.030   1.00 0.00 ? 68 TYR A HE2  5  
ATOM 5425  H HH   . TYR A 1 68 ? -4.318  11.382  5.067   1.00 0.00 ? 68 TYR A HH   5  
ATOM 5426  N N    . TYR A 1 1  ? 2.508   22.014  0.279   1.00 0.00 ? 1  TYR A N    6  
ATOM 5427  C CA   . TYR A 1 1  ? 2.600   20.710  -0.427  1.00 0.00 ? 1  TYR A CA   6  
ATOM 5428  C C    . TYR A 1 1  ? 3.096   19.610  0.505   1.00 0.00 ? 1  TYR A C    6  
ATOM 5429  O O    . TYR A 1 1  ? 3.760   19.882  1.505   1.00 0.00 ? 1  TYR A O    6  
ATOM 5430  C CB   . TYR A 1 1  ? 3.556   20.864  -1.612  1.00 0.00 ? 1  TYR A CB   6  
ATOM 5431  C CG   . TYR A 1 1  ? 2.858   20.909  -2.953  1.00 0.00 ? 1  TYR A CG   6  
ATOM 5432  C CD1  . TYR A 1 1  ? 1.736   21.704  -3.147  1.00 0.00 ? 1  TYR A CD1  6  
ATOM 5433  C CD2  . TYR A 1 1  ? 3.323   20.158  -4.024  1.00 0.00 ? 1  TYR A CD2  6  
ATOM 5434  C CE1  . TYR A 1 1  ? 1.096   21.749  -4.371  1.00 0.00 ? 1  TYR A CE1  6  
ATOM 5435  C CE2  . TYR A 1 1  ? 2.689   20.196  -5.251  1.00 0.00 ? 1  TYR A CE2  6  
ATOM 5436  C CZ   . TYR A 1 1  ? 1.576   20.993  -5.420  1.00 0.00 ? 1  TYR A CZ   6  
ATOM 5437  O OH   . TYR A 1 1  ? 0.942   21.034  -6.640  1.00 0.00 ? 1  TYR A OH   6  
ATOM 5438  H H1   . TYR A 1 1  ? 2.087   22.701  -0.379  1.00 0.00 ? 1  TYR A H1   6  
ATOM 5439  H H2   . TYR A 1 1  ? 3.471   22.296  0.550   1.00 0.00 ? 1  TYR A H2   6  
ATOM 5440  H H3   . TYR A 1 1  ? 1.906   21.879  1.115   1.00 0.00 ? 1  TYR A H3   6  
ATOM 5441  H HA   . TYR A 1 1  ? 1.619   20.447  -0.793  1.00 0.00 ? 1  TYR A HA   6  
ATOM 5442  H HB2  . TYR A 1 1  ? 4.114   21.782  -1.499  1.00 0.00 ? 1  TYR A HB2  6  
ATOM 5443  H HB3  . TYR A 1 1  ? 4.241   20.029  -1.624  1.00 0.00 ? 1  TYR A HB3  6  
ATOM 5444  H HD1  . TYR A 1 1  ? 1.362   22.294  -2.323  1.00 0.00 ? 1  TYR A HD1  6  
ATOM 5445  H HD2  . TYR A 1 1  ? 4.195   19.534  -3.889  1.00 0.00 ? 1  TYR A HD2  6  
ATOM 5446  H HE1  . TYR A 1 1  ? 0.225   22.372  -4.502  1.00 0.00 ? 1  TYR A HE1  6  
ATOM 5447  H HE2  . TYR A 1 1  ? 3.066   19.604  -6.073  1.00 0.00 ? 1  TYR A HE2  6  
ATOM 5448  H HH   . TYR A 1 1  ? 1.567   21.306  -7.316  1.00 0.00 ? 1  TYR A HH   6  
ATOM 5449  N N    . HIS A 1 2  ? 2.769   18.367  0.169   1.00 0.00 ? 2  HIS A N    6  
ATOM 5450  C CA   . HIS A 1 2  ? 3.180   17.223  0.974   1.00 0.00 ? 2  HIS A CA   6  
ATOM 5451  C C    . HIS A 1 2  ? 4.373   16.514  0.342   1.00 0.00 ? 2  HIS A C    6  
ATOM 5452  O O    . HIS A 1 2  ? 4.795   16.853  -0.763  1.00 0.00 ? 2  HIS A O    6  
ATOM 5453  C CB   . HIS A 1 2  ? 2.016   16.243  1.133   1.00 0.00 ? 2  HIS A CB   6  
ATOM 5454  C CG   . HIS A 1 2  ? 0.800   16.855  1.757   1.00 0.00 ? 2  HIS A CG   6  
ATOM 5455  N ND1  . HIS A 1 2  ? -0.074  16.147  2.556   1.00 0.00 ? 2  HIS A ND1  6  
ATOM 5456  C CD2  . HIS A 1 2  ? 0.313   18.118  1.697   1.00 0.00 ? 2  HIS A CD2  6  
ATOM 5457  C CE1  . HIS A 1 2  ? -1.046  16.947  2.959   1.00 0.00 ? 2  HIS A CE1  6  
ATOM 5458  N NE2  . HIS A 1 2  ? -0.834  18.147  2.453   1.00 0.00 ? 2  HIS A NE2  6  
ATOM 5459  H H    . HIS A 1 2  ? 2.238   18.215  -0.641  1.00 0.00 ? 2  HIS A H    6  
ATOM 5460  H HA   . HIS A 1 2  ? 3.468   17.590  1.948   1.00 0.00 ? 2  HIS A HA   6  
ATOM 5461  H HB2  . HIS A 1 2  ? 1.736   15.867  0.161   1.00 0.00 ? 2  HIS A HB2  6  
ATOM 5462  H HB3  . HIS A 1 2  ? 2.330   15.419  1.757   1.00 0.00 ? 2  HIS A HB3  6  
ATOM 5463  H HD1  . HIS A 1 2  ? 0.006   15.199  2.791   1.00 0.00 ? 2  HIS A HD1  6  
ATOM 5464  H HD2  . HIS A 1 2  ? 0.745   18.946  1.156   1.00 0.00 ? 2  HIS A HD2  6  
ATOM 5465  H HE1  . HIS A 1 2  ? -1.872  16.667  3.595   1.00 0.00 ? 2  HIS A HE1  6  
ATOM 5466  H HE2  . HIS A 1 2  ? -1.405  18.931  2.594   1.00 0.00 ? 2  HIS A HE2  6  
ATOM 5467  N N    . ALA A 1 3  ? 4.915   15.530  1.053   1.00 0.00 ? 3  ALA A N    6  
ATOM 5468  C CA   . ALA A 1 3  ? 6.062   14.775  0.563   1.00 0.00 ? 3  ALA A CA   6  
ATOM 5469  C C    . ALA A 1 3  ? 5.702   13.983  -0.690  1.00 0.00 ? 3  ALA A C    6  
ATOM 5470  O O    . ALA A 1 3  ? 4.537   13.654  -0.914  1.00 0.00 ? 3  ALA A O    6  
ATOM 5471  C CB   . ALA A 1 3  ? 6.584   13.845  1.647   1.00 0.00 ? 3  ALA A CB   6  
ATOM 5472  H H    . ALA A 1 3  ? 4.535   15.308  1.928   1.00 0.00 ? 3  ALA A H    6  
ATOM 5473  H HA   . ALA A 1 3  ? 6.845   15.478  0.319   1.00 0.00 ? 3  ALA A HA   6  
ATOM 5474  H HB1  . ALA A 1 3  ? 7.656   13.950  1.726   1.00 0.00 ? 3  ALA A HB1  6  
ATOM 5475  H HB2  . ALA A 1 3  ? 6.341   12.824  1.393   1.00 0.00 ? 3  ALA A HB2  6  
ATOM 5476  H HB3  . ALA A 1 3  ? 6.127   14.101  2.591   1.00 0.00 ? 3  ALA A HB3  6  
ATOM 5477  N N    . ASP A 1 4  ? 6.709   13.682  -1.504  1.00 0.00 ? 4  ASP A N    6  
ATOM 5478  C CA   . ASP A 1 4  ? 6.495   12.929  -2.734  1.00 0.00 ? 4  ASP A CA   6  
ATOM 5479  C C    . ASP A 1 4  ? 6.408   11.431  -2.448  1.00 0.00 ? 4  ASP A C    6  
ATOM 5480  O O    . ASP A 1 4  ? 5.468   10.763  -2.880  1.00 0.00 ? 4  ASP A O    6  
ATOM 5481  C CB   . ASP A 1 4  ? 7.621   13.206  -3.732  1.00 0.00 ? 4  ASP A CB   6  
ATOM 5482  C CG   . ASP A 1 4  ? 7.172   14.085  -4.883  1.00 0.00 ? 4  ASP A CG   6  
ATOM 5483  O OD1  . ASP A 1 4  ? 6.232   14.883  -4.689  1.00 0.00 ? 4  ASP A OD1  6  
ATOM 5484  O OD2  . ASP A 1 4  ? 7.762   13.976  -5.979  1.00 0.00 ? 4  ASP A OD2  6  
ATOM 5485  H H    . ASP A 1 4  ? 7.615   13.972  -1.272  1.00 0.00 ? 4  ASP A H    6  
ATOM 5486  H HA   . ASP A 1 4  ? 5.559   13.255  -3.162  1.00 0.00 ? 4  ASP A HA   6  
ATOM 5487  H HB2  . ASP A 1 4  ? 8.433   13.702  -3.220  1.00 0.00 ? 4  ASP A HB2  6  
ATOM 5488  H HB3  . ASP A 1 4  ? 7.976   12.269  -4.135  1.00 0.00 ? 4  ASP A HB3  6  
ATOM 5489  N N    . PRO A 1 5  ? 7.383   10.884  -1.701  1.00 0.00 ? 5  PRO A N    6  
ATOM 5490  C CA   . PRO A 1 5  ? 7.421   9.460   -1.359  1.00 0.00 ? 5  PRO A CA   6  
ATOM 5491  C C    . PRO A 1 5  ? 6.406   9.098   -0.279  1.00 0.00 ? 5  PRO A C    6  
ATOM 5492  O O    . PRO A 1 5  ? 6.765   8.547   0.763   1.00 0.00 ? 5  PRO A O    6  
ATOM 5493  C CB   . PRO A 1 5  ? 8.853   9.242   -0.841  1.00 0.00 ? 5  PRO A CB   6  
ATOM 5494  C CG   . PRO A 1 5  ? 9.584   10.519  -1.106  1.00 0.00 ? 5  PRO A CG   6  
ATOM 5495  C CD   . PRO A 1 5  ? 8.541   11.596  -1.150  1.00 0.00 ? 5  PRO A CD   6  
ATOM 5496  H HA   . PRO A 1 5  ? 7.253   8.842   -2.230  1.00 0.00 ? 5  PRO A HA   6  
ATOM 5497  H HB2  . PRO A 1 5  ? 8.823   9.019   0.215   1.00 0.00 ? 5  PRO A HB2  6  
ATOM 5498  H HB3  . PRO A 1 5  ? 9.304   8.415   -1.371  1.00 0.00 ? 5  PRO A HB3  6  
ATOM 5499  H HG2  . PRO A 1 5  ? 10.287  10.710  -0.308  1.00 0.00 ? 5  PRO A HG2  6  
ATOM 5500  H HG3  . PRO A 1 5  ? 10.099  10.457  -2.053  1.00 0.00 ? 5  PRO A HG3  6  
ATOM 5501  H HD2  . PRO A 1 5  ? 8.334   11.966  -0.157  1.00 0.00 ? 5  PRO A HD2  6  
ATOM 5502  H HD3  . PRO A 1 5  ? 8.852   12.399  -1.800  1.00 0.00 ? 5  PRO A HD3  6  
ATOM 5503  N N    . SER A 1 6  ? 5.139   9.414   -0.527  1.00 0.00 ? 6  SER A N    6  
ATOM 5504  C CA   . SER A 1 6  ? 4.078   9.120   0.430   1.00 0.00 ? 6  SER A CA   6  
ATOM 5505  C C    . SER A 1 6  ? 3.560   7.697   0.254   1.00 0.00 ? 6  SER A C    6  
ATOM 5506  O O    . SER A 1 6  ? 3.157   7.050   1.219   1.00 0.00 ? 6  SER A O    6  
ATOM 5507  C CB   . SER A 1 6  ? 2.929   10.117  0.271   1.00 0.00 ? 6  SER A CB   6  
ATOM 5508  O OG   . SER A 1 6  ? 1.834   9.771   1.100   1.00 0.00 ? 6  SER A OG   6  
ATOM 5509  H H    . SER A 1 6  ? 4.912   9.851   -1.373  1.00 0.00 ? 6  SER A H    6  
ATOM 5510  H HA   . SER A 1 6  ? 4.493   9.216   1.422   1.00 0.00 ? 6  SER A HA   6  
ATOM 5511  H HB2  . SER A 1 6  ? 3.273   11.105  0.543   1.00 0.00 ? 6  SER A HB2  6  
ATOM 5512  H HB3  . SER A 1 6  ? 2.599   10.122  -0.758  1.00 0.00 ? 6  SER A HB3  6  
ATOM 5513  H HG   . SER A 1 6  ? 1.396   10.570  1.403   1.00 0.00 ? 6  SER A HG   6  
ATOM 5514  N N    . LEU A 1 7  ? 3.571   7.216   -0.986  1.00 0.00 ? 7  LEU A N    6  
ATOM 5515  C CA   . LEU A 1 7  ? 3.094   5.871   -1.284  1.00 0.00 ? 7  LEU A CA   6  
ATOM 5516  C C    . LEU A 1 7  ? 4.087   4.816   -0.805  1.00 0.00 ? 7  LEU A C    6  
ATOM 5517  O O    . LEU A 1 7  ? 3.783   4.022   0.085   1.00 0.00 ? 7  LEU A O    6  
ATOM 5518  C CB   . LEU A 1 7  ? 2.856   5.708   -2.790  1.00 0.00 ? 7  LEU A CB   6  
ATOM 5519  C CG   . LEU A 1 7  ? 1.778   4.686   -3.178  1.00 0.00 ? 7  LEU A CG   6  
ATOM 5520  C CD1  . LEU A 1 7  ? 1.911   4.299   -4.638  1.00 0.00 ? 7  LEU A CD1  6  
ATOM 5521  C CD2  . LEU A 1 7  ? 1.863   3.448   -2.293  1.00 0.00 ? 7  LEU A CD2  6  
ATOM 5522  H H    . LEU A 1 7  ? 3.902   7.780   -1.715  1.00 0.00 ? 7  LEU A H    6  
ATOM 5523  H HA   . LEU A 1 7  ? 2.159   5.729   -0.763  1.00 0.00 ? 7  LEU A HA   6  
ATOM 5524  H HB2  . LEU A 1 7  ? 2.569   6.669   -3.192  1.00 0.00 ? 7  LEU A HB2  6  
ATOM 5525  H HB3  . LEU A 1 7  ? 3.786   5.409   -3.249  1.00 0.00 ? 7  LEU A HB3  6  
ATOM 5526  H HG   . LEU A 1 7  ? 0.805   5.129   -3.044  1.00 0.00 ? 7  LEU A HG   6  
ATOM 5527  H HD11 . LEU A 1 7  ? 1.345   4.986   -5.246  1.00 0.00 ? 7  LEU A HD11 6  
ATOM 5528  H HD12 . LEU A 1 7  ? 1.529   3.297   -4.779  1.00 0.00 ? 7  LEU A HD12 6  
ATOM 5529  H HD13 . LEU A 1 7  ? 2.950   4.335   -4.928  1.00 0.00 ? 7  LEU A HD13 6  
ATOM 5530  H HD21 . LEU A 1 7  ? 1.403   3.654   -1.338  1.00 0.00 ? 7  LEU A HD21 6  
ATOM 5531  H HD22 . LEU A 1 7  ? 2.899   3.185   -2.143  1.00 0.00 ? 7  LEU A HD22 6  
ATOM 5532  H HD23 . LEU A 1 7  ? 1.353   2.626   -2.769  1.00 0.00 ? 7  LEU A HD23 6  
ATOM 5533  N N    . VAL A 1 8  ? 5.269   4.805   -1.412  1.00 0.00 ? 8  VAL A N    6  
ATOM 5534  C CA   . VAL A 1 8  ? 6.306   3.835   -1.071  1.00 0.00 ? 8  VAL A CA   6  
ATOM 5535  C C    . VAL A 1 8  ? 6.444   3.663   0.441   1.00 0.00 ? 8  VAL A C    6  
ATOM 5536  O O    . VAL A 1 8  ? 6.679   2.558   0.930   1.00 0.00 ? 8  VAL A O    6  
ATOM 5537  C CB   . VAL A 1 8  ? 7.669   4.245   -1.656  1.00 0.00 ? 8  VAL A CB   6  
ATOM 5538  C CG1  . VAL A 1 8  ? 7.699   4.003   -3.158  1.00 0.00 ? 8  VAL A CG1  6  
ATOM 5539  C CG2  . VAL A 1 8  ? 7.971   5.703   -1.338  1.00 0.00 ? 8  VAL A CG2  6  
ATOM 5540  H H    . VAL A 1 8  ? 5.445   5.458   -2.122  1.00 0.00 ? 8  VAL A H    6  
ATOM 5541  H HA   . VAL A 1 8  ? 6.027   2.885   -1.504  1.00 0.00 ? 8  VAL A HA   6  
ATOM 5542  H HB   . VAL A 1 8  ? 8.435   3.635   -1.201  1.00 0.00 ? 8  VAL A HB   6  
ATOM 5543  H HG11 . VAL A 1 8  ? 7.028   3.195   -3.406  1.00 0.00 ? 8  VAL A HG11 6  
ATOM 5544  H HG12 . VAL A 1 8  ? 8.703   3.743   -3.461  1.00 0.00 ? 8  VAL A HG12 6  
ATOM 5545  H HG13 . VAL A 1 8  ? 7.389   4.901   -3.674  1.00 0.00 ? 8  VAL A HG13 6  
ATOM 5546  H HG21 . VAL A 1 8  ? 8.949   5.959   -1.718  1.00 0.00 ? 8  VAL A HG21 6  
ATOM 5547  H HG22 . VAL A 1 8  ? 7.951   5.848   -0.269  1.00 0.00 ? 8  VAL A HG22 6  
ATOM 5548  H HG23 . VAL A 1 8  ? 7.227   6.333   -1.801  1.00 0.00 ? 8  VAL A HG23 6  
ATOM 5549  N N    . SER A 1 9  ? 6.292   4.761   1.175   1.00 0.00 ? 9  SER A N    6  
ATOM 5550  C CA   . SER A 1 9  ? 6.404   4.727   2.629   1.00 0.00 ? 9  SER A CA   6  
ATOM 5551  C C    . SER A 1 9  ? 5.345   3.815   3.239   1.00 0.00 ? 9  SER A C    6  
ATOM 5552  O O    . SER A 1 9  ? 5.564   3.211   4.290   1.00 0.00 ? 9  SER A O    6  
ATOM 5553  C CB   . SER A 1 9  ? 6.269   6.138   3.204   1.00 0.00 ? 9  SER A CB   6  
ATOM 5554  O OG   . SER A 1 9  ? 5.487   6.963   2.357   1.00 0.00 ? 9  SER A OG   6  
ATOM 5555  H H    . SER A 1 9  ? 6.107   5.613   0.729   1.00 0.00 ? 9  SER A H    6  
ATOM 5556  H HA   . SER A 1 9  ? 7.381   4.339   2.875   1.00 0.00 ? 9  SER A HA   6  
ATOM 5557  H HB2  . SER A 1 9  ? 5.794   6.085   4.173   1.00 0.00 ? 9  SER A HB2  6  
ATOM 5558  H HB3  . SER A 1 9  ? 7.250   6.578   3.307   1.00 0.00 ? 9  SER A HB3  6  
ATOM 5559  H HG   . SER A 1 9  ? 5.831   7.859   2.376   1.00 0.00 ? 9  SER A HG   6  
ATOM 5560  N N    . PHE A 1 10 ? 4.197   3.719   2.578   1.00 0.00 ? 10 PHE A N    6  
ATOM 5561  C CA   . PHE A 1 10 ? 3.103   2.887   3.066   1.00 0.00 ? 10 PHE A CA   6  
ATOM 5562  C C    . PHE A 1 10 ? 3.115   1.512   2.408   1.00 0.00 ? 10 PHE A C    6  
ATOM 5563  O O    . PHE A 1 10 ? 2.997   0.491   3.085   1.00 0.00 ? 10 PHE A O    6  
ATOM 5564  C CB   . PHE A 1 10 ? 1.759   3.574   2.813   1.00 0.00 ? 10 PHE A CB   6  
ATOM 5565  C CG   . PHE A 1 10 ? 1.208   4.281   4.017   1.00 0.00 ? 10 PHE A CG   6  
ATOM 5566  C CD1  . PHE A 1 10 ? 0.657   3.563   5.066   1.00 0.00 ? 10 PHE A CD1  6  
ATOM 5567  C CD2  . PHE A 1 10 ? 1.241   5.664   4.099   1.00 0.00 ? 10 PHE A CD2  6  
ATOM 5568  C CE1  . PHE A 1 10 ? 0.148   4.213   6.176   1.00 0.00 ? 10 PHE A CE1  6  
ATOM 5569  C CE2  . PHE A 1 10 ? 0.733   6.318   5.206   1.00 0.00 ? 10 PHE A CE2  6  
ATOM 5570  C CZ   . PHE A 1 10 ? 0.187   5.592   6.245   1.00 0.00 ? 10 PHE A CZ   6  
ATOM 5571  H H    . PHE A 1 10 ? 4.077   4.229   1.749   1.00 0.00 ? 10 PHE A H    6  
ATOM 5572  H HA   . PHE A 1 10 ? 3.238   2.761   4.131   1.00 0.00 ? 10 PHE A HA   6  
ATOM 5573  H HB2  . PHE A 1 10 ? 1.878   4.304   2.026   1.00 0.00 ? 10 PHE A HB2  6  
ATOM 5574  H HB3  . PHE A 1 10 ? 1.037   2.832   2.505   1.00 0.00 ? 10 PHE A HB3  6  
ATOM 5575  H HD1  . PHE A 1 10 ? 0.626   2.485   5.013   1.00 0.00 ? 10 PHE A HD1  6  
ATOM 5576  H HD2  . PHE A 1 10 ? 1.668   6.232   3.287   1.00 0.00 ? 10 PHE A HD2  6  
ATOM 5577  H HE1  . PHE A 1 10 ? -0.278  3.641   6.987   1.00 0.00 ? 10 PHE A HE1  6  
ATOM 5578  H HE2  . PHE A 1 10 ? 0.765   7.396   5.257   1.00 0.00 ? 10 PHE A HE2  6  
ATOM 5579  H HZ   . PHE A 1 10 ? -0.210  6.100   7.111   1.00 0.00 ? 10 PHE A HZ   6  
ATOM 5580  N N    . LEU A 1 11 ? 3.258   1.490   1.086   1.00 0.00 ? 11 LEU A N    6  
ATOM 5581  C CA   . LEU A 1 11 ? 3.279   0.234   0.343   1.00 0.00 ? 11 LEU A CA   6  
ATOM 5582  C C    . LEU A 1 11 ? 4.237   -0.762  0.982   1.00 0.00 ? 11 LEU A C    6  
ATOM 5583  O O    . LEU A 1 11 ? 3.854   -1.884  1.314   1.00 0.00 ? 11 LEU A O    6  
ATOM 5584  C CB   . LEU A 1 11 ? 3.678   0.484   -1.113  1.00 0.00 ? 11 LEU A CB   6  
ATOM 5585  C CG   . LEU A 1 11 ? 3.268   -0.614  -2.097  1.00 0.00 ? 11 LEU A CG   6  
ATOM 5586  C CD1  . LEU A 1 11 ? 4.170   -1.830  -1.946  1.00 0.00 ? 11 LEU A CD1  6  
ATOM 5587  C CD2  . LEU A 1 11 ? 1.811   -0.999  -1.891  1.00 0.00 ? 11 LEU A CD2  6  
ATOM 5588  H H    . LEU A 1 11 ? 3.345   2.335   0.599   1.00 0.00 ? 11 LEU A H    6  
ATOM 5589  H HA   . LEU A 1 11 ? 2.286   -0.181  0.372   1.00 0.00 ? 11 LEU A HA   6  
ATOM 5590  H HB2  . LEU A 1 11 ? 3.226   1.410   -1.433  1.00 0.00 ? 11 LEU A HB2  6  
ATOM 5591  H HB3  . LEU A 1 11 ? 4.752   0.594   -1.155  1.00 0.00 ? 11 LEU A HB3  6  
ATOM 5592  H HG   . LEU A 1 11 ? 3.376   -0.243  -3.105  1.00 0.00 ? 11 LEU A HG   6  
ATOM 5593  H HD11 . LEU A 1 11 ? 4.172   -2.393  -2.867  1.00 0.00 ? 11 LEU A HD11 6  
ATOM 5594  H HD12 . LEU A 1 11 ? 3.804   -2.453  -1.143  1.00 0.00 ? 11 LEU A HD12 6  
ATOM 5595  H HD13 . LEU A 1 11 ? 5.175   -1.507  -1.720  1.00 0.00 ? 11 LEU A HD13 6  
ATOM 5596  H HD21 . LEU A 1 11 ? 1.447   -1.510  -2.769  1.00 0.00 ? 11 LEU A HD21 6  
ATOM 5597  H HD22 . LEU A 1 11 ? 1.224   -0.107  -1.723  1.00 0.00 ? 11 LEU A HD22 6  
ATOM 5598  H HD23 . LEU A 1 11 ? 1.728   -1.650  -1.033  1.00 0.00 ? 11 LEU A HD23 6  
ATOM 5599  N N    . THR A 1 12 ? 5.479   -0.340  1.163   1.00 0.00 ? 12 THR A N    6  
ATOM 5600  C CA   . THR A 1 12 ? 6.485   -1.184  1.789   1.00 0.00 ? 12 THR A CA   6  
ATOM 5601  C C    . THR A 1 12 ? 6.312   -1.177  3.302   1.00 0.00 ? 12 THR A C    6  
ATOM 5602  O O    . THR A 1 12 ? 6.357   -2.226  3.948   1.00 0.00 ? 12 THR A O    6  
ATOM 5603  C CB   . THR A 1 12 ? 7.889   -0.704  1.423   1.00 0.00 ? 12 THR A CB   6  
ATOM 5604  O OG1  . THR A 1 12 ? 8.063   -0.688  0.017   1.00 0.00 ? 12 THR A OG1  6  
ATOM 5605  C CG2  . THR A 1 12 ? 8.987   -1.560  2.014   1.00 0.00 ? 12 THR A CG2  6  
ATOM 5606  H H    . THR A 1 12 ? 5.719   0.571   0.889   1.00 0.00 ? 12 THR A H    6  
ATOM 5607  H HA   . THR A 1 12 ? 6.348   -2.192  1.425   1.00 0.00 ? 12 THR A HA   6  
ATOM 5608  H HB   . THR A 1 12 ? 8.022   0.302   1.793   1.00 0.00 ? 12 THR A HB   6  
ATOM 5609  H HG1  . THR A 1 12 ? 8.602   0.065   -0.232  1.00 0.00 ? 12 THR A HG1  6  
ATOM 5610  H HG21 . THR A 1 12 ? 8.586   -2.526  2.281   1.00 0.00 ? 12 THR A HG21 6  
ATOM 5611  H HG22 . THR A 1 12 ? 9.383   -1.078  2.896   1.00 0.00 ? 12 THR A HG22 6  
ATOM 5612  H HG23 . THR A 1 12 ? 9.776   -1.686  1.288   1.00 0.00 ? 12 THR A HG23 6  
ATOM 5613  N N    . GLY A 1 13 ? 6.093   0.013   3.856   1.00 0.00 ? 13 GLY A N    6  
ATOM 5614  C CA   . GLY A 1 13 ? 5.901   0.144   5.287   1.00 0.00 ? 13 GLY A CA   6  
ATOM 5615  C C    . GLY A 1 13 ? 4.868   -0.827  5.818   1.00 0.00 ? 13 GLY A C    6  
ATOM 5616  O O    . GLY A 1 13 ? 4.931   -1.240  6.976   1.00 0.00 ? 13 GLY A O    6  
ATOM 5617  H H    . GLY A 1 13 ? 6.056   0.810   3.286   1.00 0.00 ? 13 GLY A H    6  
ATOM 5618  H HA2  . GLY A 1 13 ? 6.842   -0.039  5.785   1.00 0.00 ? 13 GLY A HA2  6  
ATOM 5619  H HA3  . GLY A 1 13 ? 5.578   1.152   5.507   1.00 0.00 ? 13 GLY A HA3  6  
ATOM 5620  N N    . LEU A 1 14 ? 3.916   -1.197  4.968   1.00 0.00 ? 14 LEU A N    6  
ATOM 5621  C CA   . LEU A 1 14 ? 2.884   -2.143  5.348   1.00 0.00 ? 14 LEU A CA   6  
ATOM 5622  C C    . LEU A 1 14 ? 3.500   -3.440  5.865   1.00 0.00 ? 14 LEU A C    6  
ATOM 5623  O O    . LEU A 1 14 ? 2.860   -4.201  6.591   1.00 0.00 ? 14 LEU A O    6  
ATOM 5624  C CB   . LEU A 1 14 ? 1.992   -2.440  4.140   1.00 0.00 ? 14 LEU A CB   6  
ATOM 5625  C CG   . LEU A 1 14 ? 0.474   -2.428  4.390   1.00 0.00 ? 14 LEU A CG   6  
ATOM 5626  C CD1  . LEU A 1 14 ? 0.133   -2.779  5.833   1.00 0.00 ? 14 LEU A CD1  6  
ATOM 5627  C CD2  . LEU A 1 14 ? -0.109  -1.075  4.015   1.00 0.00 ? 14 LEU A CD2  6  
ATOM 5628  H H    . LEU A 1 14 ? 3.923   -0.848  4.051   1.00 0.00 ? 14 LEU A H    6  
ATOM 5629  H HA   . LEU A 1 14 ? 2.290   -1.696  6.131   1.00 0.00 ? 14 LEU A HA   6  
ATOM 5630  H HB2  . LEU A 1 14 ? 2.208   -1.707  3.378   1.00 0.00 ? 14 LEU A HB2  6  
ATOM 5631  H HB3  . LEU A 1 14 ? 2.262   -3.412  3.758   1.00 0.00 ? 14 LEU A HB3  6  
ATOM 5632  H HG   . LEU A 1 14 ? 0.015   -3.168  3.757   1.00 0.00 ? 14 LEU A HG   6  
ATOM 5633  H HD11 . LEU A 1 14 ? -0.875  -3.163  5.882   1.00 0.00 ? 14 LEU A HD11 6  
ATOM 5634  H HD12 . LEU A 1 14 ? 0.212   -1.894  6.447   1.00 0.00 ? 14 LEU A HD12 6  
ATOM 5635  H HD13 . LEU A 1 14 ? 0.823   -3.528  6.193   1.00 0.00 ? 14 LEU A HD13 6  
ATOM 5636  H HD21 . LEU A 1 14 ? 0.652   -0.474  3.540   1.00 0.00 ? 14 LEU A HD21 6  
ATOM 5637  H HD22 . LEU A 1 14 ? -0.460  -0.575  4.905   1.00 0.00 ? 14 LEU A HD22 6  
ATOM 5638  H HD23 . LEU A 1 14 ? -0.935  -1.217  3.332   1.00 0.00 ? 14 LEU A HD23 6  
ATOM 5639  N N    . GLY A 1 15 ? 4.749   -3.688  5.479   1.00 0.00 ? 15 GLY A N    6  
ATOM 5640  C CA   . GLY A 1 15 ? 5.428   -4.901  5.890   1.00 0.00 ? 15 GLY A CA   6  
ATOM 5641  C C    . GLY A 1 15 ? 5.722   -5.815  4.717   1.00 0.00 ? 15 GLY A C    6  
ATOM 5642  O O    . GLY A 1 15 ? 5.924   -7.017  4.892   1.00 0.00 ? 15 GLY A O    6  
ATOM 5643  H H    . GLY A 1 15 ? 5.207   -3.052  4.893   1.00 0.00 ? 15 GLY A H    6  
ATOM 5644  H HA2  . GLY A 1 15 ? 6.359   -4.636  6.370   1.00 0.00 ? 15 GLY A HA2  6  
ATOM 5645  H HA3  . GLY A 1 15 ? 4.806   -5.428  6.599   1.00 0.00 ? 15 GLY A HA3  6  
ATOM 5646  N N    . CYS A 1 16 ? 5.737   -5.242  3.515   1.00 0.00 ? 16 CYS A N    6  
ATOM 5647  C CA   . CYS A 1 16 ? 6.003   -6.011  2.305   1.00 0.00 ? 16 CYS A CA   6  
ATOM 5648  C C    . CYS A 1 16 ? 6.990   -5.277  1.400   1.00 0.00 ? 16 CYS A C    6  
ATOM 5649  O O    . CYS A 1 16 ? 6.590   -4.591  0.460   1.00 0.00 ? 16 CYS A O    6  
ATOM 5650  C CB   . CYS A 1 16 ? 4.700   -6.273  1.547   1.00 0.00 ? 16 CYS A CB   6  
ATOM 5651  S SG   . CYS A 1 16 ? 3.559   -4.870  1.534   1.00 0.00 ? 16 CYS A SG   6  
ATOM 5652  H H    . CYS A 1 16 ? 5.567   -4.278  3.441   1.00 0.00 ? 16 CYS A H    6  
ATOM 5653  H HA   . CYS A 1 16 ? 6.436   -6.956  2.600   1.00 0.00 ? 16 CYS A HA   6  
ATOM 5654  H HB2  . CYS A 1 16 ? 4.931   -6.518  0.521   1.00 0.00 ? 16 CYS A HB2  6  
ATOM 5655  H HB3  . CYS A 1 16 ? 4.188   -7.107  2.004   1.00 0.00 ? 16 CYS A HB3  6  
ATOM 5656  H HG   . CYS A 1 16 ? 2.720   -5.174  1.177   1.00 0.00 ? 16 CYS A HG   6  
ATOM 5657  N N    . PRO A 1 17 ? 8.300   -5.425  1.667   1.00 0.00 ? 17 PRO A N    6  
ATOM 5658  C CA   . PRO A 1 17 ? 9.345   -4.764  0.890   1.00 0.00 ? 17 PRO A CA   6  
ATOM 5659  C C    . PRO A 1 17 ? 9.778   -5.568  -0.334  1.00 0.00 ? 17 PRO A C    6  
ATOM 5660  O O    . PRO A 1 17 ? 10.875  -5.369  -0.858  1.00 0.00 ? 17 PRO A O    6  
ATOM 5661  C CB   . PRO A 1 17 ? 10.486  -4.666  1.896   1.00 0.00 ? 17 PRO A CB   6  
ATOM 5662  C CG   . PRO A 1 17 ? 10.337  -5.880  2.753   1.00 0.00 ? 17 PRO A CG   6  
ATOM 5663  C CD   . PRO A 1 17 ? 8.864   -6.217  2.777   1.00 0.00 ? 17 PRO A CD   6  
ATOM 5664  H HA   . PRO A 1 17 ? 9.044   -3.772  0.582   1.00 0.00 ? 17 PRO A HA   6  
ATOM 5665  H HB2  . PRO A 1 17 ? 11.432  -4.665  1.372   1.00 0.00 ? 17 PRO A HB2  6  
ATOM 5666  H HB3  . PRO A 1 17 ? 10.386  -3.759  2.472   1.00 0.00 ? 17 PRO A HB3  6  
ATOM 5667  H HG2  . PRO A 1 17 ? 10.898  -6.697  2.328   1.00 0.00 ? 17 PRO A HG2  6  
ATOM 5668  H HG3  . PRO A 1 17 ? 10.686  -5.665  3.752   1.00 0.00 ? 17 PRO A HG3  6  
ATOM 5669  H HD2  . PRO A 1 17 ? 8.717   -7.273  2.607   1.00 0.00 ? 17 PRO A HD2  6  
ATOM 5670  H HD3  . PRO A 1 17 ? 8.426   -5.922  3.719   1.00 0.00 ? 17 PRO A HD3  6  
ATOM 5671  N N    . ASN A 1 18 ? 8.917   -6.473  -0.788  1.00 0.00 ? 18 ASN A N    6  
ATOM 5672  C CA   . ASN A 1 18 ? 9.222   -7.297  -1.952  1.00 0.00 ? 18 ASN A CA   6  
ATOM 5673  C C    . ASN A 1 18 ? 8.008   -7.437  -2.869  1.00 0.00 ? 18 ASN A C    6  
ATOM 5674  O O    . ASN A 1 18 ? 7.962   -8.328  -3.717  1.00 0.00 ? 18 ASN A O    6  
ATOM 5675  C CB   . ASN A 1 18 ? 9.698   -8.681  -1.510  1.00 0.00 ? 18 ASN A CB   6  
ATOM 5676  C CG   . ASN A 1 18 ? 11.117  -8.661  -0.978  1.00 0.00 ? 18 ASN A CG   6  
ATOM 5677  O OD1  . ASN A 1 18 ? 11.992  -7.996  -1.534  1.00 0.00 ? 18 ASN A OD1  6  
ATOM 5678  N ND2  . ASN A 1 18 ? 11.352  -9.390  0.106   1.00 0.00 ? 18 ASN A ND2  6  
ATOM 5679  H H    . ASN A 1 18 ? 8.058   -6.589  -0.333  1.00 0.00 ? 18 ASN A H    6  
ATOM 5680  H HA   . ASN A 1 18 ? 10.015  -6.811  -2.501  1.00 0.00 ? 18 ASN A HA   6  
ATOM 5681  H HB2  . ASN A 1 18 ? 9.046   -9.049  -0.733  1.00 0.00 ? 18 ASN A HB2  6  
ATOM 5682  H HB3  . ASN A 1 18 ? 9.661   -9.355  -2.354  1.00 0.00 ? 18 ASN A HB3  6  
ATOM 5683  H HD21 . ASN A 1 18 ? 10.607  -9.893  0.497   1.00 0.00 ? 18 ASN A HD21 6  
ATOM 5684  H HD22 . ASN A 1 18 ? 12.262  -9.394  0.473   1.00 0.00 ? 18 ASN A HD22 6  
ATOM 5685  N N    . CYS A 1 19 ? 7.029   -6.551  -2.703  1.00 0.00 ? 19 CYS A N    6  
ATOM 5686  C CA   . CYS A 1 19 ? 5.824   -6.586  -3.524  1.00 0.00 ? 19 CYS A CA   6  
ATOM 5687  C C    . CYS A 1 19 ? 5.706   -5.331  -4.385  1.00 0.00 ? 19 CYS A C    6  
ATOM 5688  O O    . CYS A 1 19 ? 5.094   -5.356  -5.451  1.00 0.00 ? 19 CYS A O    6  
ATOM 5689  C CB   . CYS A 1 19 ? 4.583   -6.731  -2.638  1.00 0.00 ? 19 CYS A CB   6  
ATOM 5690  S SG   . CYS A 1 19 ? 4.201   -5.262  -1.656  1.00 0.00 ? 19 CYS A SG   6  
ATOM 5691  H H    . CYS A 1 19 ? 7.115   -5.863  -2.012  1.00 0.00 ? 19 CYS A H    6  
ATOM 5692  H HA   . CYS A 1 19 ? 5.894   -7.445  -4.173  1.00 0.00 ? 19 CYS A HA   6  
ATOM 5693  H HB2  . CYS A 1 19 ? 3.728   -6.940  -3.263  1.00 0.00 ? 19 CYS A HB2  6  
ATOM 5694  H HB3  . CYS A 1 19 ? 4.733   -7.553  -1.954  1.00 0.00 ? 19 CYS A HB3  6  
ATOM 5695  H HG   . CYS A 1 19 ? 3.667   -4.674  -2.197  1.00 0.00 ? 19 CYS A HG   6  
ATOM 5696  N N    . ILE A 1 20 ? 6.298   -4.238  -3.915  1.00 0.00 ? 20 ILE A N    6  
ATOM 5697  C CA   . ILE A 1 20 ? 6.263   -2.975  -4.643  1.00 0.00 ? 20 ILE A CA   6  
ATOM 5698  C C    . ILE A 1 20 ? 6.648   -3.170  -6.106  1.00 0.00 ? 20 ILE A C    6  
ATOM 5699  O O    . ILE A 1 20 ? 6.027   -2.599  -7.002  1.00 0.00 ? 20 ILE A O    6  
ATOM 5700  C CB   . ILE A 1 20 ? 7.210   -1.941  -4.011  1.00 0.00 ? 20 ILE A CB   6  
ATOM 5701  C CG1  . ILE A 1 20 ? 7.110   -0.603  -4.747  1.00 0.00 ? 20 ILE A CG1  6  
ATOM 5702  C CG2  . ILE A 1 20 ? 8.639   -2.459  -4.032  1.00 0.00 ? 20 ILE A CG2  6  
ATOM 5703  C CD1  . ILE A 1 20 ? 6.831   0.571   -3.833  1.00 0.00 ? 20 ILE A CD1  6  
ATOM 5704  H H    . ILE A 1 20 ? 6.773   -4.280  -3.060  1.00 0.00 ? 20 ILE A H    6  
ATOM 5705  H HA   . ILE A 1 20 ? 5.255   -2.589  -4.594  1.00 0.00 ? 20 ILE A HA   6  
ATOM 5706  H HB   . ILE A 1 20 ? 6.920   -1.801  -2.980  1.00 0.00 ? 20 ILE A HB   6  
ATOM 5707  H HG12 . ILE A 1 20 ? 8.042   -0.410  -5.258  1.00 0.00 ? 20 ILE A HG12 6  
ATOM 5708  H HG13 . ILE A 1 20 ? 6.311   -0.657  -5.471  1.00 0.00 ? 20 ILE A HG13 6  
ATOM 5709  H HG21 . ILE A 1 20 ? 9.101   -2.201  -4.974  1.00 0.00 ? 20 ILE A HG21 6  
ATOM 5710  H HG22 . ILE A 1 20 ? 8.633   -3.534  -3.916  1.00 0.00 ? 20 ILE A HG22 6  
ATOM 5711  H HG23 . ILE A 1 20 ? 9.197   -2.012  -3.223  1.00 0.00 ? 20 ILE A HG23 6  
ATOM 5712  H HD11 . ILE A 1 20 ? 6.131   0.273   -3.068  1.00 0.00 ? 20 ILE A HD11 6  
ATOM 5713  H HD12 . ILE A 1 20 ? 6.412   1.383   -4.409  1.00 0.00 ? 20 ILE A HD12 6  
ATOM 5714  H HD13 . ILE A 1 20 ? 7.752   0.896   -3.372  1.00 0.00 ? 20 ILE A HD13 6  
ATOM 5715  N N    . GLU A 1 21 ? 7.674   -3.979  -6.340  1.00 0.00 ? 21 GLU A N    6  
ATOM 5716  C CA   . GLU A 1 21 ? 8.140   -4.252  -7.694  1.00 0.00 ? 21 GLU A CA   6  
ATOM 5717  C C    . GLU A 1 21 ? 7.007   -4.789  -8.560  1.00 0.00 ? 21 GLU A C    6  
ATOM 5718  O O    . GLU A 1 21 ? 6.859   -4.400  -9.718  1.00 0.00 ? 21 GLU A O    6  
ATOM 5719  C CB   . GLU A 1 21 ? 9.294   -5.254  -7.664  1.00 0.00 ? 21 GLU A CB   6  
ATOM 5720  C CG   . GLU A 1 21 ? 9.008   -6.485  -6.819  1.00 0.00 ? 21 GLU A CG   6  
ATOM 5721  C CD   . GLU A 1 21 ? 10.172  -6.862  -5.924  1.00 0.00 ? 21 GLU A CD   6  
ATOM 5722  O OE1  . GLU A 1 21 ? 10.233  -6.356  -4.784  1.00 0.00 ? 21 GLU A OE1  6  
ATOM 5723  O OE2  . GLU A 1 21 ? 11.024  -7.662  -6.365  1.00 0.00 ? 21 GLU A OE2  6  
ATOM 5724  H H    . GLU A 1 21 ? 8.128   -4.406  -5.583  1.00 0.00 ? 21 GLU A H    6  
ATOM 5725  H HA   . GLU A 1 21 ? 8.491   -3.321  -8.117  1.00 0.00 ? 21 GLU A HA   6  
ATOM 5726  H HB2  . GLU A 1 21 ? 9.500   -5.577  -8.675  1.00 0.00 ? 21 GLU A HB2  6  
ATOM 5727  H HB3  . GLU A 1 21 ? 10.170  -4.766  -7.266  1.00 0.00 ? 21 GLU A HB3  6  
ATOM 5728  H HG2  . GLU A 1 21 ? 8.146   -6.288  -6.200  1.00 0.00 ? 21 GLU A HG2  6  
ATOM 5729  H HG3  . GLU A 1 21 ? 8.795   -7.316  -7.476  1.00 0.00 ? 21 GLU A HG3  6  
ATOM 5730  N N    . TYR A 1 22 ? 6.210   -5.686  -7.990  1.00 0.00 ? 22 TYR A N    6  
ATOM 5731  C CA   . TYR A 1 22 ? 5.084   -6.272  -8.708  1.00 0.00 ? 22 TYR A CA   6  
ATOM 5732  C C    . TYR A 1 22 ? 3.946   -5.267  -8.835  1.00 0.00 ? 22 TYR A C    6  
ATOM 5733  O O    . TYR A 1 22 ? 3.189   -5.287  -9.806  1.00 0.00 ? 22 TYR A O    6  
ATOM 5734  C CB   . TYR A 1 22 ? 4.592   -7.530  -7.990  1.00 0.00 ? 22 TYR A CB   6  
ATOM 5735  C CG   . TYR A 1 22 ? 5.668   -8.572  -7.788  1.00 0.00 ? 22 TYR A CG   6  
ATOM 5736  C CD1  . TYR A 1 22 ? 6.573   -8.469  -6.738  1.00 0.00 ? 22 TYR A CD1  6  
ATOM 5737  C CD2  . TYR A 1 22 ? 5.780   -9.659  -8.646  1.00 0.00 ? 22 TYR A CD2  6  
ATOM 5738  C CE1  . TYR A 1 22 ? 7.558   -9.419  -6.550  1.00 0.00 ? 22 TYR A CE1  6  
ATOM 5739  C CE2  . TYR A 1 22 ? 6.763   -10.614 -8.464  1.00 0.00 ? 22 TYR A CE2  6  
ATOM 5740  C CZ   . TYR A 1 22 ? 7.650   -10.489 -7.415  1.00 0.00 ? 22 TYR A CZ   6  
ATOM 5741  O OH   . TYR A 1 22 ? 8.630   -11.437 -7.231  1.00 0.00 ? 22 TYR A OH   6  
ATOM 5742  H H    . TYR A 1 22 ? 6.375   -5.952  -7.061  1.00 0.00 ? 22 TYR A H    6  
ATOM 5743  H HA   . TYR A 1 22 ? 5.425   -6.540  -9.697  1.00 0.00 ? 22 TYR A HA   6  
ATOM 5744  H HB2  . TYR A 1 22 ? 4.209   -7.255  -7.018  1.00 0.00 ? 22 TYR A HB2  6  
ATOM 5745  H HB3  . TYR A 1 22 ? 3.799   -7.980  -8.569  1.00 0.00 ? 22 TYR A HB3  6  
ATOM 5746  H HD1  . TYR A 1 22 ? 6.499   -7.630  -6.063  1.00 0.00 ? 22 TYR A HD1  6  
ATOM 5747  H HD2  . TYR A 1 22 ? 5.085   -9.754  -9.467  1.00 0.00 ? 22 TYR A HD2  6  
ATOM 5748  H HE1  . TYR A 1 22 ? 8.251   -9.320  -5.728  1.00 0.00 ? 22 TYR A HE1  6  
ATOM 5749  H HE2  . TYR A 1 22 ? 6.835   -11.452 -9.141  1.00 0.00 ? 22 TYR A HE2  6  
ATOM 5750  H HH   . TYR A 1 22 ? 8.673   -11.677 -6.302  1.00 0.00 ? 22 TYR A HH   6  
ATOM 5751  N N    . PHE A 1 23 ? 3.838   -4.382  -7.850  1.00 0.00 ? 23 PHE A N    6  
ATOM 5752  C CA   . PHE A 1 23 ? 2.800   -3.360  -7.850  1.00 0.00 ? 23 PHE A CA   6  
ATOM 5753  C C    . PHE A 1 23 ? 3.152   -2.232  -8.815  1.00 0.00 ? 23 PHE A C    6  
ATOM 5754  O O    . PHE A 1 23 ? 2.351   -1.861  -9.671  1.00 0.00 ? 23 PHE A O    6  
ATOM 5755  C CB   . PHE A 1 23 ? 2.610   -2.800  -6.438  1.00 0.00 ? 23 PHE A CB   6  
ATOM 5756  C CG   . PHE A 1 23 ? 1.741   -3.655  -5.563  1.00 0.00 ? 23 PHE A CG   6  
ATOM 5757  C CD1  . PHE A 1 23 ? 0.364   -3.661  -5.725  1.00 0.00 ? 23 PHE A CD1  6  
ATOM 5758  C CD2  . PHE A 1 23 ? 2.299   -4.453  -4.576  1.00 0.00 ? 23 PHE A CD2  6  
ATOM 5759  C CE1  . PHE A 1 23 ? -0.439  -4.446  -4.919  1.00 0.00 ? 23 PHE A CE1  6  
ATOM 5760  C CE2  . PHE A 1 23 ? 1.501   -5.240  -3.768  1.00 0.00 ? 23 PHE A CE2  6  
ATOM 5761  C CZ   . PHE A 1 23 ? 0.131   -5.236  -3.940  1.00 0.00 ? 23 PHE A CZ   6  
ATOM 5762  H H    . PHE A 1 23 ? 4.475   -4.416  -7.107  1.00 0.00 ? 23 PHE A H    6  
ATOM 5763  H HA   . PHE A 1 23 ? 1.878   -3.821  -8.174  1.00 0.00 ? 23 PHE A HA   6  
ATOM 5764  H HB2  . PHE A 1 23 ? 3.576   -2.711  -5.962  1.00 0.00 ? 23 PHE A HB2  6  
ATOM 5765  H HB3  . PHE A 1 23 ? 2.156   -1.824  -6.504  1.00 0.00 ? 23 PHE A HB3  6  
ATOM 5766  H HD1  . PHE A 1 23 ? -0.081  -3.042  -6.490  1.00 0.00 ? 23 PHE A HD1  6  
ATOM 5767  H HD2  . PHE A 1 23 ? 3.371   -4.455  -4.442  1.00 0.00 ? 23 PHE A HD2  6  
ATOM 5768  H HE1  . PHE A 1 23 ? -1.510  -4.440  -5.055  1.00 0.00 ? 23 PHE A HE1  6  
ATOM 5769  H HE2  . PHE A 1 23 ? 1.949   -5.857  -3.003  1.00 0.00 ? 23 PHE A HE2  6  
ATOM 5770  H HZ   . PHE A 1 23 ? -0.495  -5.851  -3.309  1.00 0.00 ? 23 PHE A HZ   6  
ATOM 5771  N N    . THR A 1 24 ? 4.361   -1.698  -8.673  1.00 0.00 ? 24 THR A N    6  
ATOM 5772  C CA   . THR A 1 24 ? 4.824   -0.614  -9.532  1.00 0.00 ? 24 THR A CA   6  
ATOM 5773  C C    . THR A 1 24 ? 4.615   -0.951  -11.004 1.00 0.00 ? 24 THR A C    6  
ATOM 5774  O O    . THR A 1 24 ? 4.455   -0.060  -11.839 1.00 0.00 ? 24 THR A O    6  
ATOM 5775  C CB   . THR A 1 24 ? 6.304   -0.327  -9.271  1.00 0.00 ? 24 THR A CB   6  
ATOM 5776  O OG1  . THR A 1 24 ? 7.078   -1.502  -9.446  1.00 0.00 ? 24 THR A OG1  6  
ATOM 5777  C CG2  . THR A 1 24 ? 6.578   0.200   -7.880  1.00 0.00 ? 24 THR A CG2  6  
ATOM 5778  H H    . THR A 1 24 ? 4.955   -2.037  -7.970  1.00 0.00 ? 24 THR A H    6  
ATOM 5779  H HA   . THR A 1 24 ? 4.249   0.268   -9.291  1.00 0.00 ? 24 THR A HA   6  
ATOM 5780  H HB   . THR A 1 24 ? 6.647   0.414   -9.977  1.00 0.00 ? 24 THR A HB   6  
ATOM 5781  H HG1  . THR A 1 24 ? 7.794   -1.324  -10.060 1.00 0.00 ? 24 THR A HG1  6  
ATOM 5782  H HG21 . THR A 1 24 ? 6.996   1.194   -7.947  1.00 0.00 ? 24 THR A HG21 6  
ATOM 5783  H HG22 . THR A 1 24 ? 7.278   -0.452  -7.379  1.00 0.00 ? 24 THR A HG22 6  
ATOM 5784  H HG23 . THR A 1 24 ? 5.654   0.235   -7.321  1.00 0.00 ? 24 THR A HG23 6  
ATOM 5785  N N    . SER A 1 25 ? 4.621   -2.242  -11.318 1.00 0.00 ? 25 SER A N    6  
ATOM 5786  C CA   . SER A 1 25 ? 4.445   -2.699  -12.691 1.00 0.00 ? 25 SER A CA   6  
ATOM 5787  C C    . SER A 1 25 ? 3.182   -2.109  -13.315 1.00 0.00 ? 25 SER A C    6  
ATOM 5788  O O    . SER A 1 25 ? 3.077   -2.002  -14.537 1.00 0.00 ? 25 SER A O    6  
ATOM 5789  C CB   . SER A 1 25 ? 4.380   -4.227  -12.735 1.00 0.00 ? 25 SER A CB   6  
ATOM 5790  O OG   . SER A 1 25 ? 4.688   -4.715  -14.029 1.00 0.00 ? 25 SER A OG   6  
ATOM 5791  H H    . SER A 1 25 ? 4.760   -2.904  -10.608 1.00 0.00 ? 25 SER A H    6  
ATOM 5792  H HA   . SER A 1 25 ? 5.300   -2.368  -13.262 1.00 0.00 ? 25 SER A HA   6  
ATOM 5793  H HB2  . SER A 1 25 ? 5.089   -4.636  -12.031 1.00 0.00 ? 25 SER A HB2  6  
ATOM 5794  H HB3  . SER A 1 25 ? 3.383   -4.550  -12.470 1.00 0.00 ? 25 SER A HB3  6  
ATOM 5795  H HG   . SER A 1 25 ? 4.367   -5.615  -14.118 1.00 0.00 ? 25 SER A HG   6  
ATOM 5796  N N    . GLN A 1 26 ? 2.226   -1.732  -12.473 1.00 0.00 ? 26 GLN A N    6  
ATOM 5797  C CA   . GLN A 1 26 ? 0.967   -1.168  -12.951 1.00 0.00 ? 26 GLN A CA   6  
ATOM 5798  C C    . GLN A 1 26 ? 0.934   0.343   -12.754 1.00 0.00 ? 26 GLN A C    6  
ATOM 5799  O O    . GLN A 1 26 ? 0.418   1.080   -13.595 1.00 0.00 ? 26 GLN A O    6  
ATOM 5800  C CB   . GLN A 1 26 ? -0.224  -1.806  -12.226 1.00 0.00 ? 26 GLN A CB   6  
ATOM 5801  C CG   . GLN A 1 26 ? 0.035   -3.221  -11.725 1.00 0.00 ? 26 GLN A CG   6  
ATOM 5802  C CD   . GLN A 1 26 ? -0.005  -4.251  -12.837 1.00 0.00 ? 26 GLN A CD   6  
ATOM 5803  O OE1  . GLN A 1 26 ? -0.630  -4.037  -13.875 1.00 0.00 ? 26 GLN A OE1  6  
ATOM 5804  N NE2  . GLN A 1 26 ? 0.661   -5.378  -12.620 1.00 0.00 ? 26 GLN A NE2  6  
ATOM 5805  H H    . GLN A 1 26 ? 2.363   -1.848  -11.509 1.00 0.00 ? 26 GLN A H    6  
ATOM 5806  H HA   . GLN A 1 26 ? 0.891   -1.381  -14.008 1.00 0.00 ? 26 GLN A HA   6  
ATOM 5807  H HB2  . GLN A 1 26 ? -0.482  -1.191  -11.376 1.00 0.00 ? 26 GLN A HB2  6  
ATOM 5808  H HB3  . GLN A 1 26 ? -1.065  -1.838  -12.902 1.00 0.00 ? 26 GLN A HB3  6  
ATOM 5809  H HG2  . GLN A 1 26 ? 1.010   -3.251  -11.262 1.00 0.00 ? 26 GLN A HG2  6  
ATOM 5810  H HG3  . GLN A 1 26 ? -0.717  -3.473  -10.994 1.00 0.00 ? 26 GLN A HG3  6  
ATOM 5811  H HE21 . GLN A 1 26 ? 1.136   -5.480  -11.769 1.00 0.00 ? 26 GLN A HE21 6  
ATOM 5812  H HE22 . GLN A 1 26 ? 0.651   -6.063  -13.321 1.00 0.00 ? 26 GLN A HE22 6  
ATOM 5813  N N    . GLY A 1 27 ? 1.474   0.797   -11.629 1.00 0.00 ? 27 GLY A N    6  
ATOM 5814  C CA   . GLY A 1 27 ? 1.479   2.216   -11.322 1.00 0.00 ? 27 GLY A CA   6  
ATOM 5815  C C    . GLY A 1 27 ? 1.186   2.478   -9.863  1.00 0.00 ? 27 GLY A C    6  
ATOM 5816  O O    . GLY A 1 27 ? 0.371   3.338   -9.529  1.00 0.00 ? 27 GLY A O    6  
ATOM 5817  H H    . GLY A 1 27 ? 1.859   0.160   -10.992 1.00 0.00 ? 27 GLY A H    6  
ATOM 5818  H HA2  . GLY A 1 27 ? 2.448   2.626   -11.562 1.00 0.00 ? 27 GLY A HA2  6  
ATOM 5819  H HA3  . GLY A 1 27 ? 0.730   2.709   -11.923 1.00 0.00 ? 27 GLY A HA3  6  
ATOM 5820  N N    . LEU A 1 28 ? 1.860   1.739   -8.992  1.00 0.00 ? 28 LEU A N    6  
ATOM 5821  C CA   . LEU A 1 28 ? 1.670   1.890   -7.559  1.00 0.00 ? 28 LEU A CA   6  
ATOM 5822  C C    . LEU A 1 28 ? 2.773   2.751   -6.959  1.00 0.00 ? 28 LEU A C    6  
ATOM 5823  O O    . LEU A 1 28 ? 3.335   2.432   -5.912  1.00 0.00 ? 28 LEU A O    6  
ATOM 5824  C CB   . LEU A 1 28 ? 1.624   0.521   -6.879  1.00 0.00 ? 28 LEU A CB   6  
ATOM 5825  C CG   . LEU A 1 28 ? 0.238   0.095   -6.390  1.00 0.00 ? 28 LEU A CG   6  
ATOM 5826  C CD1  . LEU A 1 28 ? -0.164  0.901   -5.164  1.00 0.00 ? 28 LEU A CD1  6  
ATOM 5827  C CD2  . LEU A 1 28 ? -0.791  0.264   -7.497  1.00 0.00 ? 28 LEU A CD2  6  
ATOM 5828  H H    . LEU A 1 28 ? 2.493   1.069   -9.323  1.00 0.00 ? 28 LEU A H    6  
ATOM 5829  H HA   . LEU A 1 28 ? 0.723   2.387   -7.406  1.00 0.00 ? 28 LEU A HA   6  
ATOM 5830  H HB2  . LEU A 1 28 ? 1.976   -0.218  -7.583  1.00 0.00 ? 28 LEU A HB2  6  
ATOM 5831  H HB3  . LEU A 1 28 ? 2.293   0.534   -6.033  1.00 0.00 ? 28 LEU A HB3  6  
ATOM 5832  H HG   . LEU A 1 28 ? 0.264   -0.948  -6.112  1.00 0.00 ? 28 LEU A HG   6  
ATOM 5833  H HD11 . LEU A 1 28 ? 0.209   1.911   -5.258  1.00 0.00 ? 28 LEU A HD11 6  
ATOM 5834  H HD12 . LEU A 1 28 ? 0.254   0.444   -4.279  1.00 0.00 ? 28 LEU A HD12 6  
ATOM 5835  H HD13 . LEU A 1 28 ? -1.241  0.922   -5.084  1.00 0.00 ? 28 LEU A HD13 6  
ATOM 5836  H HD21 . LEU A 1 28 ? -1.668  -0.322  -7.266  1.00 0.00 ? 28 LEU A HD21 6  
ATOM 5837  H HD22 . LEU A 1 28 ? -0.371  -0.072  -8.433  1.00 0.00 ? 28 LEU A HD22 6  
ATOM 5838  H HD23 . LEU A 1 28 ? -1.066  1.306   -7.579  1.00 0.00 ? 28 LEU A HD23 6  
ATOM 5839  N N    . GLN A 1 29 ? 3.072   3.849   -7.642  1.00 0.00 ? 29 GLN A N    6  
ATOM 5840  C CA   . GLN A 1 29 ? 4.058   4.810   -7.170  1.00 0.00 ? 29 GLN A CA   6  
ATOM 5841  C C    . GLN A 1 29 ? 3.366   6.084   -6.680  1.00 0.00 ? 29 GLN A C    6  
ATOM 5842  O O    . GLN A 1 29 ? 3.978   6.916   -6.010  1.00 0.00 ? 29 GLN A O    6  
ATOM 5843  C CB   . GLN A 1 29 ? 5.052   5.146   -8.284  1.00 0.00 ? 29 GLN A CB   6  
ATOM 5844  C CG   . GLN A 1 29 ? 4.425   5.873   -9.462  1.00 0.00 ? 29 GLN A CG   6  
ATOM 5845  C CD   . GLN A 1 29 ? 5.081   5.520   -10.783 1.00 0.00 ? 29 GLN A CD   6  
ATOM 5846  O OE1  . GLN A 1 29 ? 4.843   4.448   -11.339 1.00 0.00 ? 29 GLN A OE1  6  
ATOM 5847  N NE2  . GLN A 1 29 ? 5.911   6.422   -11.291 1.00 0.00 ? 29 GLN A NE2  6  
ATOM 5848  H H    . GLN A 1 29 ? 2.567   4.052   -8.458  1.00 0.00 ? 29 GLN A H    6  
ATOM 5849  H HA   . GLN A 1 29 ? 4.590   4.362   -6.344  1.00 0.00 ? 29 GLN A HA   6  
ATOM 5850  H HB2  . GLN A 1 29 ? 5.833   5.772   -7.875  1.00 0.00 ? 29 GLN A HB2  6  
ATOM 5851  H HB3  . GLN A 1 29 ? 5.491   4.229   -8.646  1.00 0.00 ? 29 GLN A HB3  6  
ATOM 5852  H HG2  . GLN A 1 29 ? 3.380   5.611   -9.515  1.00 0.00 ? 29 GLN A HG2  6  
ATOM 5853  H HG3  . GLN A 1 29 ? 4.521   6.937   -9.304  1.00 0.00 ? 29 GLN A HG3  6  
ATOM 5854  H HE21 . GLN A 1 29 ? 6.052   7.255   -10.792 1.00 0.00 ? 29 GLN A HE21 6  
ATOM 5855  H HE22 . GLN A 1 29 ? 6.349   6.220   -12.144 1.00 0.00 ? 29 GLN A HE22 6  
ATOM 5856  N N    . SER A 1 30 ? 2.083   6.228   -7.021  1.00 0.00 ? 30 SER A N    6  
ATOM 5857  C CA   . SER A 1 30 ? 1.292   7.374   -6.596  1.00 0.00 ? 30 SER A CA   6  
ATOM 5858  C C    . SER A 1 30 ? 0.015   6.897   -5.926  1.00 0.00 ? 30 SER A C    6  
ATOM 5859  O O    . SER A 1 30 ? -0.909  6.437   -6.594  1.00 0.00 ? 30 SER A O    6  
ATOM 5860  C CB   . SER A 1 30 ? 0.959   8.269   -7.791  1.00 0.00 ? 30 SER A CB   6  
ATOM 5861  O OG   . SER A 1 30 ? 1.883   8.075   -8.847  1.00 0.00 ? 30 SER A OG   6  
ATOM 5862  H H    . SER A 1 30 ? 1.643   5.525   -7.540  1.00 0.00 ? 30 SER A H    6  
ATOM 5863  H HA   . SER A 1 30 ? 1.868   7.936   -5.881  1.00 0.00 ? 30 SER A HA   6  
ATOM 5864  H HB2  . SER A 1 30 ? -0.032  8.031   -8.150  1.00 0.00 ? 30 SER A HB2  6  
ATOM 5865  H HB3  . SER A 1 30 ? 0.992   9.304   -7.485  1.00 0.00 ? 30 SER A HB3  6  
ATOM 5866  H HG   . SER A 1 30 ? 2.762   8.327   -8.554  1.00 0.00 ? 30 SER A HG   6  
ATOM 5867  N N    . ILE A 1 31 ? -0.019  6.972   -4.599  1.00 0.00 ? 31 ILE A N    6  
ATOM 5868  C CA   . ILE A 1 31 ? -1.165  6.490   -3.833  1.00 0.00 ? 31 ILE A CA   6  
ATOM 5869  C C    . ILE A 1 31 ? -2.492  6.900   -4.478  1.00 0.00 ? 31 ILE A C    6  
ATOM 5870  O O    . ILE A 1 31 ? -3.500  6.208   -4.344  1.00 0.00 ? 31 ILE A O    6  
ATOM 5871  C CB   . ILE A 1 31 ? -1.115  6.972   -2.366  1.00 0.00 ? 31 ILE A CB   6  
ATOM 5872  C CG1  . ILE A 1 31 ? -2.001  6.080   -1.494  1.00 0.00 ? 31 ILE A CG1  6  
ATOM 5873  C CG2  . ILE A 1 31 ? -1.537  8.430   -2.245  1.00 0.00 ? 31 ILE A CG2  6  
ATOM 5874  C CD1  . ILE A 1 31 ? -1.227  5.273   -0.476  1.00 0.00 ? 31 ILE A CD1  6  
ATOM 5875  H H    . ILE A 1 31 ? 0.761   7.322   -4.121  1.00 0.00 ? 31 ILE A H    6  
ATOM 5876  H HA   . ILE A 1 31 ? -1.110  5.414   -3.822  1.00 0.00 ? 31 ILE A HA   6  
ATOM 5877  H HB   . ILE A 1 31 ? -0.093  6.894   -2.022  1.00 0.00 ? 31 ILE A HB   6  
ATOM 5878  H HG12 . ILE A 1 31 ? -2.709  6.697   -0.961  1.00 0.00 ? 31 ILE A HG12 6  
ATOM 5879  H HG13 . ILE A 1 31 ? -2.536  5.388   -2.127  1.00 0.00 ? 31 ILE A HG13 6  
ATOM 5880  H HG21 . ILE A 1 31 ? -1.579  8.874   -3.228  1.00 0.00 ? 31 ILE A HG21 6  
ATOM 5881  H HG22 . ILE A 1 31 ? -0.824  8.964   -1.637  1.00 0.00 ? 31 ILE A HG22 6  
ATOM 5882  H HG23 . ILE A 1 31 ? -2.514  8.483   -1.785  1.00 0.00 ? 31 ILE A HG23 6  
ATOM 5883  H HD11 . ILE A 1 31 ? -1.303  5.746   0.492   1.00 0.00 ? 31 ILE A HD11 6  
ATOM 5884  H HD12 . ILE A 1 31 ? -0.189  5.222   -0.770  1.00 0.00 ? 31 ILE A HD12 6  
ATOM 5885  H HD13 . ILE A 1 31 ? -1.635  4.275   -0.422  1.00 0.00 ? 31 ILE A HD13 6  
ATOM 5886  N N    . TYR A 1 32 ? -2.483  8.028   -5.179  1.00 0.00 ? 32 TYR A N    6  
ATOM 5887  C CA   . TYR A 1 32 ? -3.682  8.506   -5.856  1.00 0.00 ? 32 TYR A CA   6  
ATOM 5888  C C    . TYR A 1 32 ? -4.212  7.450   -6.822  1.00 0.00 ? 32 TYR A C    6  
ATOM 5889  O O    . TYR A 1 32 ? -5.392  7.455   -7.173  1.00 0.00 ? 32 TYR A O    6  
ATOM 5890  C CB   . TYR A 1 32 ? -3.388  9.805   -6.608  1.00 0.00 ? 32 TYR A CB   6  
ATOM 5891  C CG   . TYR A 1 32 ? -4.535  10.791  -6.582  1.00 0.00 ? 32 TYR A CG   6  
ATOM 5892  C CD1  . TYR A 1 32 ? -4.762  11.593  -5.471  1.00 0.00 ? 32 TYR A CD1  6  
ATOM 5893  C CD2  . TYR A 1 32 ? -5.395  10.915  -7.667  1.00 0.00 ? 32 TYR A CD2  6  
ATOM 5894  C CE1  . TYR A 1 32 ? -5.811  12.493  -5.443  1.00 0.00 ? 32 TYR A CE1  6  
ATOM 5895  C CE2  . TYR A 1 32 ? -6.445  11.812  -7.646  1.00 0.00 ? 32 TYR A CE2  6  
ATOM 5896  C CZ   . TYR A 1 32 ? -6.649  12.599  -6.532  1.00 0.00 ? 32 TYR A CZ   6  
ATOM 5897  O OH   . TYR A 1 32 ? -7.695  13.493  -6.507  1.00 0.00 ? 32 TYR A OH   6  
ATOM 5898  H H    . TYR A 1 32 ? -1.651  8.539   -5.259  1.00 0.00 ? 32 TYR A H    6  
ATOM 5899  H HA   . TYR A 1 32 ? -4.432  8.698   -5.104  1.00 0.00 ? 32 TYR A HA   6  
ATOM 5900  H HB2  . TYR A 1 32 ? -2.528  10.285  -6.164  1.00 0.00 ? 32 TYR A HB2  6  
ATOM 5901  H HB3  . TYR A 1 32 ? -3.172  9.575   -7.641  1.00 0.00 ? 32 TYR A HB3  6  
ATOM 5902  H HD1  . TYR A 1 32 ? -4.103  11.508  -4.619  1.00 0.00 ? 32 TYR A HD1  6  
ATOM 5903  H HD2  . TYR A 1 32 ? -5.233  10.298  -8.538  1.00 0.00 ? 32 TYR A HD2  6  
ATOM 5904  H HE1  . TYR A 1 32 ? -5.969  13.109  -4.569  1.00 0.00 ? 32 TYR A HE1  6  
ATOM 5905  H HE2  . TYR A 1 32 ? -7.102  11.895  -8.499  1.00 0.00 ? 32 TYR A HE2  6  
ATOM 5906  H HH   . TYR A 1 32 ? -8.480  13.058  -6.167  1.00 0.00 ? 32 TYR A HH   6  
ATOM 5907  N N    . HIS A 1 33 ? -3.334  6.544   -7.247  1.00 0.00 ? 33 HIS A N    6  
ATOM 5908  C CA   . HIS A 1 33 ? -3.720  5.475   -8.163  1.00 0.00 ? 33 HIS A CA   6  
ATOM 5909  C C    . HIS A 1 33 ? -4.301  4.276   -7.412  1.00 0.00 ? 33 HIS A C    6  
ATOM 5910  O O    . HIS A 1 33 ? -4.857  3.364   -8.025  1.00 0.00 ? 33 HIS A O    6  
ATOM 5911  C CB   . HIS A 1 33 ? -2.514  5.030   -8.993  1.00 0.00 ? 33 HIS A CB   6  
ATOM 5912  C CG   . HIS A 1 33 ? -2.868  4.103   -10.115 1.00 0.00 ? 33 HIS A CG   6  
ATOM 5913  N ND1  . HIS A 1 33 ? -2.430  2.797   -10.179 1.00 0.00 ? 33 HIS A ND1  6  
ATOM 5914  C CD2  . HIS A 1 33 ? -3.622  4.300   -11.223 1.00 0.00 ? 33 HIS A CD2  6  
ATOM 5915  C CE1  . HIS A 1 33 ? -2.899  2.231   -11.277 1.00 0.00 ? 33 HIS A CE1  6  
ATOM 5916  N NE2  . HIS A 1 33 ? -3.624  3.121   -11.927 1.00 0.00 ? 33 HIS A NE2  6  
ATOM 5917  H H    . HIS A 1 33 ? -2.404  6.586   -6.927  1.00 0.00 ? 33 HIS A H    6  
ATOM 5918  H HA   . HIS A 1 33 ? -4.477  5.868   -8.826  1.00 0.00 ? 33 HIS A HA   6  
ATOM 5919  H HB2  . HIS A 1 33 ? -2.038  5.901   -9.419  1.00 0.00 ? 33 HIS A HB2  6  
ATOM 5920  H HB3  . HIS A 1 33 ? -1.813  4.520   -8.350  1.00 0.00 ? 33 HIS A HB3  6  
ATOM 5921  H HD1  . HIS A 1 33 ? -1.859  2.351   -9.519  1.00 0.00 ? 33 HIS A HD1  6  
ATOM 5922  H HD2  . HIS A 1 33 ? -4.127  5.214   -11.501 1.00 0.00 ? 33 HIS A HD2  6  
ATOM 5923  H HE1  . HIS A 1 33 ? -2.719  1.212   -11.590 1.00 0.00 ? 33 HIS A HE1  6  
ATOM 5924  H HE2  . HIS A 1 33 ? -4.089  2.964   -12.775 1.00 0.00 ? 33 HIS A HE2  6  
ATOM 5925  N N    . LEU A 1 34 ? -4.156  4.269   -6.088  1.00 0.00 ? 34 LEU A N    6  
ATOM 5926  C CA   . LEU A 1 34 ? -4.663  3.175   -5.268  1.00 0.00 ? 34 LEU A CA   6  
ATOM 5927  C C    . LEU A 1 34 ? -5.643  3.678   -4.213  1.00 0.00 ? 34 LEU A C    6  
ATOM 5928  O O    . LEU A 1 34 ? -5.964  2.967   -3.261  1.00 0.00 ? 34 LEU A O    6  
ATOM 5929  C CB   . LEU A 1 34 ? -3.501  2.456   -4.588  1.00 0.00 ? 34 LEU A CB   6  
ATOM 5930  C CG   . LEU A 1 34 ? -2.302  3.343   -4.248  1.00 0.00 ? 34 LEU A CG   6  
ATOM 5931  C CD1  . LEU A 1 34 ? -1.415  2.676   -3.212  1.00 0.00 ? 34 LEU A CD1  6  
ATOM 5932  C CD2  . LEU A 1 34 ? -1.502  3.660   -5.504  1.00 0.00 ? 34 LEU A CD2  6  
ATOM 5933  H H    . LEU A 1 34 ? -3.705  5.019   -5.648  1.00 0.00 ? 34 LEU A H    6  
ATOM 5934  H HA   . LEU A 1 34 ? -5.175  2.482   -5.919  1.00 0.00 ? 34 LEU A HA   6  
ATOM 5935  H HB2  . LEU A 1 34 ? -3.864  2.010   -3.674  1.00 0.00 ? 34 LEU A HB2  6  
ATOM 5936  H HB3  . LEU A 1 34 ? -3.166  1.671   -5.244  1.00 0.00 ? 34 LEU A HB3  6  
ATOM 5937  H HG   . LEU A 1 34 ? -2.657  4.275   -3.832  1.00 0.00 ? 34 LEU A HG   6  
ATOM 5938  H HD11 . LEU A 1 34 ? -1.499  3.201   -2.274  1.00 0.00 ? 34 LEU A HD11 6  
ATOM 5939  H HD12 . LEU A 1 34 ? -0.390  2.705   -3.551  1.00 0.00 ? 34 LEU A HD12 6  
ATOM 5940  H HD13 . LEU A 1 34 ? -1.723  1.650   -3.081  1.00 0.00 ? 34 LEU A HD13 6  
ATOM 5941  H HD21 . LEU A 1 34 ? -1.630  2.864   -6.223  1.00 0.00 ? 34 LEU A HD21 6  
ATOM 5942  H HD22 . LEU A 1 34 ? -0.456  3.750   -5.250  1.00 0.00 ? 34 LEU A HD22 6  
ATOM 5943  H HD23 . LEU A 1 34 ? -1.849  4.588   -5.929  1.00 0.00 ? 34 LEU A HD23 6  
ATOM 5944  N N    . GLN A 1 35 ? -6.111  4.908   -4.384  1.00 0.00 ? 35 GLN A N    6  
ATOM 5945  C CA   . GLN A 1 35 ? -7.051  5.508   -3.446  1.00 0.00 ? 35 GLN A CA   6  
ATOM 5946  C C    . GLN A 1 35 ? -8.327  4.681   -3.339  1.00 0.00 ? 35 GLN A C    6  
ATOM 5947  O O    . GLN A 1 35 ? -9.035  4.743   -2.334  1.00 0.00 ? 35 GLN A O    6  
ATOM 5948  C CB   . GLN A 1 35 ? -7.393  6.932   -3.887  1.00 0.00 ? 35 GLN A CB   6  
ATOM 5949  C CG   . GLN A 1 35 ? -8.104  7.745   -2.818  1.00 0.00 ? 35 GLN A CG   6  
ATOM 5950  C CD   . GLN A 1 35 ? -7.198  8.772   -2.168  1.00 0.00 ? 35 GLN A CD   6  
ATOM 5951  O OE1  . GLN A 1 35 ? -7.431  9.976   -2.273  1.00 0.00 ? 35 GLN A OE1  6  
ATOM 5952  N NE2  . GLN A 1 35 ? -6.160  8.300   -1.487  1.00 0.00 ? 35 GLN A NE2  6  
ATOM 5953  H H    . GLN A 1 35 ? -5.818  5.426   -5.160  1.00 0.00 ? 35 GLN A H    6  
ATOM 5954  H HA   . GLN A 1 35 ? -6.575  5.543   -2.477  1.00 0.00 ? 35 GLN A HA   6  
ATOM 5955  H HB2  . GLN A 1 35 ? -6.481  7.444   -4.153  1.00 0.00 ? 35 GLN A HB2  6  
ATOM 5956  H HB3  . GLN A 1 35 ? -8.034  6.882   -4.756  1.00 0.00 ? 35 GLN A HB3  6  
ATOM 5957  H HG2  . GLN A 1 35 ? -8.938  8.258   -3.271  1.00 0.00 ? 35 GLN A HG2  6  
ATOM 5958  H HG3  . GLN A 1 35 ? -8.466  7.072   -2.055  1.00 0.00 ? 35 GLN A HG3  6  
ATOM 5959  H HE21 . GLN A 1 35 ? -6.036  7.329   -1.446  1.00 0.00 ? 35 GLN A HE21 6  
ATOM 5960  H HE22 . GLN A 1 35 ? -5.559  8.942   -1.056  1.00 0.00 ? 35 GLN A HE22 6  
ATOM 5961  N N    . ASN A 1 36 ? -8.618  3.914   -4.383  1.00 0.00 ? 36 ASN A N    6  
ATOM 5962  C CA   . ASN A 1 36 ? -9.820  3.092   -4.413  1.00 0.00 ? 36 ASN A CA   6  
ATOM 5963  C C    . ASN A 1 36 ? -9.479  1.603   -4.447  1.00 0.00 ? 36 ASN A C    6  
ATOM 5964  O O    . ASN A 1 36 ? -10.322 0.760   -4.138  1.00 0.00 ? 36 ASN A O    6  
ATOM 5965  C CB   . ASN A 1 36 ? -10.674 3.458   -5.629  1.00 0.00 ? 36 ASN A CB   6  
ATOM 5966  C CG   . ASN A 1 36 ? -11.693 4.533   -5.317  1.00 0.00 ? 36 ASN A CG   6  
ATOM 5967  O OD1  . ASN A 1 36 ? -12.732 4.266   -4.713  1.00 0.00 ? 36 ASN A OD1  6  
ATOM 5968  N ND2  . ASN A 1 36 ? -11.400 5.758   -5.732  1.00 0.00 ? 36 ASN A ND2  6  
ATOM 5969  H H    . ASN A 1 36 ? -8.019  3.914   -5.159  1.00 0.00 ? 36 ASN A H    6  
ATOM 5970  H HA   . ASN A 1 36 ? -10.383 3.297   -3.515  1.00 0.00 ? 36 ASN A HA   6  
ATOM 5971  H HB2  . ASN A 1 36 ? -10.031 3.822   -6.415  1.00 0.00 ? 36 ASN A HB2  6  
ATOM 5972  H HB3  . ASN A 1 36 ? -11.198 2.578   -5.972  1.00 0.00 ? 36 ASN A HB3  6  
ATOM 5973  H HD21 . ASN A 1 36 ? -10.553 5.896   -6.207  1.00 0.00 ? 36 ASN A HD21 6  
ATOM 5974  H HD22 . ASN A 1 36 ? -12.039 6.475   -5.546  1.00 0.00 ? 36 ASN A HD22 6  
ATOM 5975  N N    . LEU A 1 37 ? -8.242  1.282   -4.820  1.00 0.00 ? 37 LEU A N    6  
ATOM 5976  C CA   . LEU A 1 37 ? -7.803  -0.110  -4.896  1.00 0.00 ? 37 LEU A CA   6  
ATOM 5977  C C    . LEU A 1 37 ? -8.189  -0.877  -3.632  1.00 0.00 ? 37 LEU A C    6  
ATOM 5978  O O    . LEU A 1 37 ? -8.159  -0.332  -2.529  1.00 0.00 ? 37 LEU A O    6  
ATOM 5979  C CB   . LEU A 1 37 ? -6.289  -0.180  -5.108  1.00 0.00 ? 37 LEU A CB   6  
ATOM 5980  C CG   . LEU A 1 37 ? -5.848  -0.897  -6.388  1.00 0.00 ? 37 LEU A CG   6  
ATOM 5981  C CD1  . LEU A 1 37 ? -4.715  -0.138  -7.061  1.00 0.00 ? 37 LEU A CD1  6  
ATOM 5982  C CD2  . LEU A 1 37 ? -5.428  -2.326  -6.080  1.00 0.00 ? 37 LEU A CD2  6  
ATOM 5983  H H    . LEU A 1 37 ? -7.612  1.993   -5.058  1.00 0.00 ? 37 LEU A H    6  
ATOM 5984  H HA   . LEU A 1 37 ? -8.297  -0.565  -5.741  1.00 0.00 ? 37 LEU A HA   6  
ATOM 5985  H HB2  . LEU A 1 37 ? -5.903  0.829   -5.136  1.00 0.00 ? 37 LEU A HB2  6  
ATOM 5986  H HB3  . LEU A 1 37 ? -5.849  -0.692  -4.264  1.00 0.00 ? 37 LEU A HB3  6  
ATOM 5987  H HG   . LEU A 1 37 ? -6.680  -0.935  -7.076  1.00 0.00 ? 37 LEU A HG   6  
ATOM 5988  H HD11 . LEU A 1 37 ? -3.935  -0.830  -7.339  1.00 0.00 ? 37 LEU A HD11 6  
ATOM 5989  H HD12 . LEU A 1 37 ? -4.319  0.598   -6.378  1.00 0.00 ? 37 LEU A HD12 6  
ATOM 5990  H HD13 . LEU A 1 37 ? -5.089  0.356   -7.945  1.00 0.00 ? 37 LEU A HD13 6  
ATOM 5991  H HD21 . LEU A 1 37 ? -6.140  -2.774  -5.404  1.00 0.00 ? 37 LEU A HD21 6  
ATOM 5992  H HD22 . LEU A 1 37 ? -4.450  -2.322  -5.622  1.00 0.00 ? 37 LEU A HD22 6  
ATOM 5993  H HD23 . LEU A 1 37 ? -5.394  -2.896  -6.996  1.00 0.00 ? 37 LEU A HD23 6  
ATOM 5994  N N    . THR A 1 38 ? -8.559  -2.142  -3.805  1.00 0.00 ? 38 THR A N    6  
ATOM 5995  C CA   . THR A 1 38 ? -8.963  -2.981  -2.683  1.00 0.00 ? 38 THR A CA   6  
ATOM 5996  C C    . THR A 1 38 ? -8.368  -4.374  -2.795  1.00 0.00 ? 38 THR A C    6  
ATOM 5997  O O    . THR A 1 38 ? -7.749  -4.719  -3.800  1.00 0.00 ? 38 THR A O    6  
ATOM 5998  C CB   . THR A 1 38 ? -10.485 -3.102  -2.633  1.00 0.00 ? 38 THR A CB   6  
ATOM 5999  O OG1  . THR A 1 38 ? -11.093 -2.176  -3.516  1.00 0.00 ? 38 THR A OG1  6  
ATOM 6000  C CG2  . THR A 1 38 ? -11.053 -2.870  -1.253  1.00 0.00 ? 38 THR A CG2  6  
ATOM 6001  H H    . THR A 1 38 ? -8.567  -2.517  -4.711  1.00 0.00 ? 38 THR A H    6  
ATOM 6002  H HA   . THR A 1 38 ? -8.612  -2.518  -1.772  1.00 0.00 ? 38 THR A HA   6  
ATOM 6003  H HB   . THR A 1 38 ? -10.765 -4.105  -2.940  1.00 0.00 ? 38 THR A HB   6  
ATOM 6004  H HG1  . THR A 1 38 ? -10.794 -2.345  -4.412  1.00 0.00 ? 38 THR A HG1  6  
ATOM 6005  H HG21 . THR A 1 38 ? -11.976 -2.317  -1.332  1.00 0.00 ? 38 THR A HG21 6  
ATOM 6006  H HG22 . THR A 1 38 ? -10.344 -2.306  -0.665  1.00 0.00 ? 38 THR A HG22 6  
ATOM 6007  H HG23 . THR A 1 38 ? -11.240 -3.821  -0.778  1.00 0.00 ? 38 THR A HG23 6  
ATOM 6008  N N    . ILE A 1 39 ? -8.615  -5.192  -1.780  1.00 0.00 ? 39 ILE A N    6  
ATOM 6009  C CA   . ILE A 1 39 ? -8.169  -6.573  -1.800  1.00 0.00 ? 39 ILE A CA   6  
ATOM 6010  C C    . ILE A 1 39 ? -8.709  -7.261  -3.041  1.00 0.00 ? 39 ILE A C    6  
ATOM 6011  O O    . ILE A 1 39 ? -8.051  -8.110  -3.642  1.00 0.00 ? 39 ILE A O    6  
ATOM 6012  C CB   . ILE A 1 39 ? -8.642  -7.338  -0.553  1.00 0.00 ? 39 ILE A CB   6  
ATOM 6013  C CG1  . ILE A 1 39 ? -8.094  -8.768  -0.558  1.00 0.00 ? 39 ILE A CG1  6  
ATOM 6014  C CG2  . ILE A 1 39 ? -10.162 -7.352  -0.485  1.00 0.00 ? 39 ILE A CG2  6  
ATOM 6015  C CD1  . ILE A 1 39 ? -6.612  -8.851  -0.855  1.00 0.00 ? 39 ILE A CD1  6  
ATOM 6016  H H    . ILE A 1 39 ? -9.148  -4.872  -1.022  1.00 0.00 ? 39 ILE A H    6  
ATOM 6017  H HA   . ILE A 1 39 ? -7.093  -6.580  -1.824  1.00 0.00 ? 39 ILE A HA   6  
ATOM 6018  H HB   . ILE A 1 39 ? -8.276  -6.819  0.315   1.00 0.00 ? 39 ILE A HB   6  
ATOM 6019  H HG12 . ILE A 1 39 ? -8.263  -9.214  0.410   1.00 0.00 ? 39 ILE A HG12 6  
ATOM 6020  H HG13 . ILE A 1 39 ? -8.615  -9.342  -1.310  1.00 0.00 ? 39 ILE A HG13 6  
ATOM 6021  H HG21 . ILE A 1 39 ? -10.475 -7.521  0.534   1.00 0.00 ? 39 ILE A HG21 6  
ATOM 6022  H HG22 . ILE A 1 39 ? -10.543 -8.143  -1.115  1.00 0.00 ? 39 ILE A HG22 6  
ATOM 6023  H HG23 . ILE A 1 39 ? -10.546 -6.403  -0.828  1.00 0.00 ? 39 ILE A HG23 6  
ATOM 6024  H HD11 . ILE A 1 39 ? -6.186  -9.692  -0.328  1.00 0.00 ? 39 ILE A HD11 6  
ATOM 6025  H HD12 . ILE A 1 39 ? -6.127  -7.942  -0.532  1.00 0.00 ? 39 ILE A HD12 6  
ATOM 6026  H HD13 . ILE A 1 39 ? -6.464  -8.981  -1.918  1.00 0.00 ? 39 ILE A HD13 6  
ATOM 6027  N N    . GLU A 1 40 ? -9.905  -6.846  -3.433  1.00 0.00 ? 40 GLU A N    6  
ATOM 6028  C CA   . GLU A 1 40 ? -10.557 -7.381  -4.618  1.00 0.00 ? 40 GLU A CA   6  
ATOM 6029  C C    . GLU A 1 40 ? -9.676  -7.194  -5.848  1.00 0.00 ? 40 GLU A C    6  
ATOM 6030  O O    . GLU A 1 40 ? -9.538  -8.098  -6.672  1.00 0.00 ? 40 GLU A O    6  
ATOM 6031  C CB   . GLU A 1 40 ? -11.907 -6.697  -4.835  1.00 0.00 ? 40 GLU A CB   6  
ATOM 6032  C CG   . GLU A 1 40 ? -12.879 -6.890  -3.683  1.00 0.00 ? 40 GLU A CG   6  
ATOM 6033  C CD   . GLU A 1 40 ? -14.034 -7.805  -4.040  1.00 0.00 ? 40 GLU A CD   6  
ATOM 6034  O OE1  . GLU A 1 40 ? -13.780 -8.984  -4.361  1.00 0.00 ? 40 GLU A OE1  6  
ATOM 6035  O OE2  . GLU A 1 40 ? -15.193 -7.341  -3.996  1.00 0.00 ? 40 GLU A OE2  6  
ATOM 6036  H H    . GLU A 1 40 ? -10.363 -6.159  -2.905  1.00 0.00 ? 40 GLU A H    6  
ATOM 6037  H HA   . GLU A 1 40 ? -10.717 -8.434  -4.459  1.00 0.00 ? 40 GLU A HA   6  
ATOM 6038  H HB2  . GLU A 1 40 ? -11.743 -5.638  -4.967  1.00 0.00 ? 40 GLU A HB2  6  
ATOM 6039  H HB3  . GLU A 1 40 ? -12.359 -7.095  -5.731  1.00 0.00 ? 40 GLU A HB3  6  
ATOM 6040  H HG2  . GLU A 1 40 ? -12.345 -7.317  -2.848  1.00 0.00 ? 40 GLU A HG2  6  
ATOM 6041  H HG3  . GLU A 1 40 ? -13.276 -5.926  -3.400  1.00 0.00 ? 40 GLU A HG3  6  
ATOM 6042  N N    . ASP A 1 41 ? -9.082  -6.010  -5.965  1.00 0.00 ? 41 ASP A N    6  
ATOM 6043  C CA   . ASP A 1 41 ? -8.209  -5.701  -7.092  1.00 0.00 ? 41 ASP A CA   6  
ATOM 6044  C C    . ASP A 1 41 ? -6.790  -6.192  -6.827  1.00 0.00 ? 41 ASP A C    6  
ATOM 6045  O O    . ASP A 1 41 ? -6.050  -6.521  -7.754  1.00 0.00 ? 41 ASP A O    6  
ATOM 6046  C CB   . ASP A 1 41 ? -8.198  -4.194  -7.359  1.00 0.00 ? 41 ASP A CB   6  
ATOM 6047  C CG   . ASP A 1 41 ? -9.484  -3.709  -7.998  1.00 0.00 ? 41 ASP A CG   6  
ATOM 6048  O OD1  . ASP A 1 41 ? -10.529 -3.720  -7.313  1.00 0.00 ? 41 ASP A OD1  6  
ATOM 6049  O OD2  . ASP A 1 41 ? -9.447  -3.316  -9.184  1.00 0.00 ? 41 ASP A OD2  6  
ATOM 6050  H H    . ASP A 1 41 ? -9.229  -5.331  -5.272  1.00 0.00 ? 41 ASP A H    6  
ATOM 6051  H HA   . ASP A 1 41 ? -8.598  -6.210  -7.962  1.00 0.00 ? 41 ASP A HA   6  
ATOM 6052  H HB2  . ASP A 1 41 ? -8.063  -3.670  -6.425  1.00 0.00 ? 41 ASP A HB2  6  
ATOM 6053  H HB3  . ASP A 1 41 ? -7.378  -3.957  -8.022  1.00 0.00 ? 41 ASP A HB3  6  
ATOM 6054  N N    . LEU A 1 42 ? -6.421  -6.241  -5.552  1.00 0.00 ? 42 LEU A N    6  
ATOM 6055  C CA   . LEU A 1 42 ? -5.097  -6.698  -5.153  1.00 0.00 ? 42 LEU A CA   6  
ATOM 6056  C C    . LEU A 1 42 ? -4.795  -8.058  -5.771  1.00 0.00 ? 42 LEU A C    6  
ATOM 6057  O O    . LEU A 1 42 ? -3.718  -8.276  -6.325  1.00 0.00 ? 42 LEU A O    6  
ATOM 6058  C CB   . LEU A 1 42 ? -5.010  -6.791  -3.623  1.00 0.00 ? 42 LEU A CB   6  
ATOM 6059  C CG   . LEU A 1 42 ? -4.710  -5.483  -2.858  1.00 0.00 ? 42 LEU A CG   6  
ATOM 6060  C CD1  . LEU A 1 42 ? -3.300  -5.521  -2.290  1.00 0.00 ? 42 LEU A CD1  6  
ATOM 6061  C CD2  . LEU A 1 42 ? -4.900  -4.239  -3.723  1.00 0.00 ? 42 LEU A CD2  6  
ATOM 6062  H H    . LEU A 1 42 ? -7.058  -5.970  -4.862  1.00 0.00 ? 42 LEU A H    6  
ATOM 6063  H HA   . LEU A 1 42 ? -4.372  -5.981  -5.509  1.00 0.00 ? 42 LEU A HA   6  
ATOM 6064  H HB2  . LEU A 1 42 ? -5.950  -7.180  -3.262  1.00 0.00 ? 42 LEU A HB2  6  
ATOM 6065  H HB3  . LEU A 1 42 ? -4.235  -7.503  -3.378  1.00 0.00 ? 42 LEU A HB3  6  
ATOM 6066  H HG   . LEU A 1 42 ? -5.395  -5.406  -2.025  1.00 0.00 ? 42 LEU A HG   6  
ATOM 6067  H HD11 . LEU A 1 42 ? -2.636  -5.987  -3.004  1.00 0.00 ? 42 LEU A HD11 6  
ATOM 6068  H HD12 . LEU A 1 42 ? -3.296  -6.089  -1.372  1.00 0.00 ? 42 LEU A HD12 6  
ATOM 6069  H HD13 . LEU A 1 42 ? -2.965  -4.514  -2.091  1.00 0.00 ? 42 LEU A HD13 6  
ATOM 6070  H HD21 . LEU A 1 42 ? -5.156  -3.400  -3.093  1.00 0.00 ? 42 LEU A HD21 6  
ATOM 6071  H HD22 . LEU A 1 42 ? -5.691  -4.409  -4.434  1.00 0.00 ? 42 LEU A HD22 6  
ATOM 6072  H HD23 . LEU A 1 42 ? -3.981  -4.025  -4.250  1.00 0.00 ? 42 LEU A HD23 6  
ATOM 6073  N N    . GLY A 1 43 ? -5.763  -8.965  -5.681  1.00 0.00 ? 43 GLY A N    6  
ATOM 6074  C CA   . GLY A 1 43 ? -5.599  -10.287 -6.253  1.00 0.00 ? 43 GLY A CA   6  
ATOM 6075  C C    . GLY A 1 43 ? -5.655  -10.282 -7.772  1.00 0.00 ? 43 GLY A C    6  
ATOM 6076  O O    . GLY A 1 43 ? -5.446  -11.315 -8.407  1.00 0.00 ? 43 GLY A O    6  
ATOM 6077  H H    . GLY A 1 43 ? -6.603  -8.728  -5.236  1.00 0.00 ? 43 GLY A H    6  
ATOM 6078  H HA2  . GLY A 1 43 ? -4.645  -10.686 -5.941  1.00 0.00 ? 43 GLY A HA2  6  
ATOM 6079  H HA3  . GLY A 1 43 ? -6.384  -10.928 -5.878  1.00 0.00 ? 43 GLY A HA3  6  
ATOM 6080  N N    . ALA A 1 44 ? -5.950  -9.122  -8.357  1.00 0.00 ? 44 ALA A N    6  
ATOM 6081  C CA   . ALA A 1 44 ? -6.009  -8.996  -9.807  1.00 0.00 ? 44 ALA A CA   6  
ATOM 6082  C C    . ALA A 1 44 ? -4.609  -8.840  -10.379 1.00 0.00 ? 44 ALA A C    6  
ATOM 6083  O O    . ALA A 1 44 ? -4.245  -9.492  -11.358 1.00 0.00 ? 44 ALA A O    6  
ATOM 6084  C CB   . ALA A 1 44 ? -6.882  -7.816  -10.206 1.00 0.00 ? 44 ALA A CB   6  
ATOM 6085  H H    . ALA A 1 44 ? -6.093  -8.327  -7.804  1.00 0.00 ? 44 ALA A H    6  
ATOM 6086  H HA   . ALA A 1 44 ? -6.455  -9.895  -10.205 1.00 0.00 ? 44 ALA A HA   6  
ATOM 6087  H HB1  . ALA A 1 44 ? -6.256  -6.994  -10.519 1.00 0.00 ? 44 ALA A HB1  6  
ATOM 6088  H HB2  . ALA A 1 44 ? -7.481  -7.509  -9.360  1.00 0.00 ? 44 ALA A HB2  6  
ATOM 6089  H HB3  . ALA A 1 44 ? -7.531  -8.106  -11.019 1.00 0.00 ? 44 ALA A HB3  6  
ATOM 6090  N N    . LEU A 1 45 ? -3.816  -7.987  -9.739  1.00 0.00 ? 45 LEU A N    6  
ATOM 6091  C CA   . LEU A 1 45 ? -2.444  -7.754  -10.151 1.00 0.00 ? 45 LEU A CA   6  
ATOM 6092  C C    . LEU A 1 45 ? -1.699  -9.066  -10.356 1.00 0.00 ? 45 LEU A C    6  
ATOM 6093  O O    . LEU A 1 45 ? -0.769  -9.144  -11.155 1.00 0.00 ? 45 LEU A O    6  
ATOM 6094  C CB   . LEU A 1 45 ? -1.737  -6.927  -9.088  1.00 0.00 ? 45 LEU A CB   6  
ATOM 6095  C CG   . LEU A 1 45 ? -2.023  -5.428  -9.149  1.00 0.00 ? 45 LEU A CG   6  
ATOM 6096  C CD1  . LEU A 1 45 ? -3.519  -5.166  -9.071  1.00 0.00 ? 45 LEU A CD1  6  
ATOM 6097  C CD2  . LEU A 1 45 ? -1.294  -4.702  -8.032  1.00 0.00 ? 45 LEU A CD2  6  
ATOM 6098  H H    . LEU A 1 45 ? -4.164  -7.504  -8.958  1.00 0.00 ? 45 LEU A H    6  
ATOM 6099  H HA   . LEU A 1 45 ? -2.455  -7.210  -11.078 1.00 0.00 ? 45 LEU A HA   6  
ATOM 6100  H HB2  . LEU A 1 45 ? -2.042  -7.290  -8.117  1.00 0.00 ? 45 LEU A HB2  6  
ATOM 6101  H HB3  . LEU A 1 45 ? -0.678  -7.082  -9.192  1.00 0.00 ? 45 LEU A HB3  6  
ATOM 6102  H HG   . LEU A 1 45 ? -1.668  -5.043  -10.090 1.00 0.00 ? 45 LEU A HG   6  
ATOM 6103  H HD11 . LEU A 1 45 ? -3.896  -5.512  -8.119  1.00 0.00 ? 45 LEU A HD11 6  
ATOM 6104  H HD12 . LEU A 1 45 ? -4.019  -5.693  -9.869  1.00 0.00 ? 45 LEU A HD12 6  
ATOM 6105  H HD13 . LEU A 1 45 ? -3.705  -4.107  -9.167  1.00 0.00 ? 45 LEU A HD13 6  
ATOM 6106  H HD21 . LEU A 1 45 ? -0.227  -4.821  -8.160  1.00 0.00 ? 45 LEU A HD21 6  
ATOM 6107  H HD22 . LEU A 1 45 ? -1.591  -5.120  -7.081  1.00 0.00 ? 45 LEU A HD22 6  
ATOM 6108  H HD23 . LEU A 1 45 ? -1.545  -3.653  -8.059  1.00 0.00 ? 45 LEU A HD23 6  
ATOM 6109  N N    . LYS A 1 46 ? -2.132  -10.084 -9.623  1.00 0.00 ? 46 LYS A N    6  
ATOM 6110  C CA   . LYS A 1 46 ? -1.523  -11.414 -9.660  1.00 0.00 ? 46 LYS A CA   6  
ATOM 6111  C C    . LYS A 1 46 ? -0.305  -11.491 -8.748  1.00 0.00 ? 46 LYS A C    6  
ATOM 6112  O O    . LYS A 1 46 ? 0.558   -12.353 -8.914  1.00 0.00 ? 46 LYS A O    6  
ATOM 6113  C CB   . LYS A 1 46 ? -1.129  -11.829 -11.075 1.00 0.00 ? 46 LYS A CB   6  
ATOM 6114  C CG   . LYS A 1 46 ? -0.663  -13.265 -11.131 1.00 0.00 ? 46 LYS A CG   6  
ATOM 6115  C CD   . LYS A 1 46 ? -1.531  -14.104 -12.055 1.00 0.00 ? 46 LYS A CD   6  
ATOM 6116  C CE   . LYS A 1 46 ? -1.529  -15.568 -11.646 1.00 0.00 ? 46 LYS A CE   6  
ATOM 6117  N NZ   . LYS A 1 46 ? -2.236  -16.423 -12.640 1.00 0.00 ? 46 LYS A NZ   6  
ATOM 6118  H H    . LYS A 1 46 ? -2.862  -9.924  -8.995  1.00 0.00 ? 46 LYS A H    6  
ATOM 6119  H HA   . LYS A 1 46 ? -2.260  -12.113 -9.294  1.00 0.00 ? 46 LYS A HA   6  
ATOM 6120  H HB2  . LYS A 1 46 ? -1.979  -11.714 -11.730 1.00 0.00 ? 46 LYS A HB2  6  
ATOM 6121  H HB3  . LYS A 1 46 ? -0.323  -11.202 -11.420 1.00 0.00 ? 46 LYS A HB3  6  
ATOM 6122  H HG2  . LYS A 1 46 ? 0.356   -13.288 -11.486 1.00 0.00 ? 46 LYS A HG2  6  
ATOM 6123  H HG3  . LYS A 1 46 ? -0.709  -13.673 -10.131 1.00 0.00 ? 46 LYS A HG3  6  
ATOM 6124  H HD2  . LYS A 1 46 ? -2.545  -13.731 -12.018 1.00 0.00 ? 46 LYS A HD2  6  
ATOM 6125  H HD3  . LYS A 1 46 ? -1.152  -14.022 -13.063 1.00 0.00 ? 46 LYS A HD3  6  
ATOM 6126  H HE2  . LYS A 1 46 ? -0.506  -15.903 -11.560 1.00 0.00 ? 46 LYS A HE2  6  
ATOM 6127  H HE3  . LYS A 1 46 ? -2.021  -15.662 -10.689 1.00 0.00 ? 46 LYS A HE3  6  
ATOM 6128  H HZ1  . LYS A 1 46 ? -1.554  -17.026 -13.143 1.00 0.00 ? 46 LYS A HZ1  6  
ATOM 6129  H HZ2  . LYS A 1 46 ? -2.734  -15.829 -13.333 1.00 0.00 ? 46 LYS A HZ2  6  
ATOM 6130  H HZ3  . LYS A 1 46 ? -2.931  -17.031 -12.159 1.00 0.00 ? 46 LYS A HZ3  6  
ATOM 6131  N N    . ILE A 1 47 ? -0.254  -10.594 -7.778  1.00 0.00 ? 47 ILE A N    6  
ATOM 6132  C CA   . ILE A 1 47 ? 0.837   -10.566 -6.811  1.00 0.00 ? 47 ILE A CA   6  
ATOM 6133  C C    . ILE A 1 47 ? 0.573   -11.556 -5.679  1.00 0.00 ? 47 ILE A C    6  
ATOM 6134  O O    . ILE A 1 47 ? -0.554  -11.666 -5.198  1.00 0.00 ? 47 ILE A O    6  
ATOM 6135  C CB   . ILE A 1 47 ? 1.028   -9.157  -6.211  1.00 0.00 ? 47 ILE A CB   6  
ATOM 6136  C CG1  . ILE A 1 47 ? 0.830   -8.088  -7.287  1.00 0.00 ? 47 ILE A CG1  6  
ATOM 6137  C CG2  . ILE A 1 47 ? 2.405   -9.027  -5.580  1.00 0.00 ? 47 ILE A CG2  6  
ATOM 6138  C CD1  . ILE A 1 47 ? 0.929   -6.672  -6.762  1.00 0.00 ? 47 ILE A CD1  6  
ATOM 6139  H H    . ILE A 1 47 ? -0.981  -9.949  -7.697  1.00 0.00 ? 47 ILE A H    6  
ATOM 6140  H HA   . ILE A 1 47 ? 1.748   -10.844 -7.321  1.00 0.00 ? 47 ILE A HA   6  
ATOM 6141  H HB   . ILE A 1 47 ? 0.290   -9.019  -5.434  1.00 0.00 ? 47 ILE A HB   6  
ATOM 6142  H HG12 . ILE A 1 47 ? 1.583   -8.212  -8.051  1.00 0.00 ? 47 ILE A HG12 6  
ATOM 6143  H HG13 . ILE A 1 47 ? -0.147  -8.209  -7.726  1.00 0.00 ? 47 ILE A HG13 6  
ATOM 6144  H HG21 . ILE A 1 47 ? 3.162   -9.213  -6.328  1.00 0.00 ? 47 ILE A HG21 6  
ATOM 6145  H HG22 . ILE A 1 47 ? 2.505   -9.748  -4.782  1.00 0.00 ? 47 ILE A HG22 6  
ATOM 6146  H HG23 . ILE A 1 47 ? 2.527   -8.031  -5.183  1.00 0.00 ? 47 ILE A HG23 6  
ATOM 6147  H HD11 . ILE A 1 47 ? 1.395   -6.044  -7.507  1.00 0.00 ? 47 ILE A HD11 6  
ATOM 6148  H HD12 . ILE A 1 47 ? 1.524   -6.663  -5.860  1.00 0.00 ? 47 ILE A HD12 6  
ATOM 6149  H HD13 . ILE A 1 47 ? -0.060  -6.299  -6.544  1.00 0.00 ? 47 ILE A HD13 6  
ATOM 6150  N N    . PRO A 1 48 ? 1.606   -12.300 -5.244  1.00 0.00 ? 48 PRO A N    6  
ATOM 6151  C CA   . PRO A 1 48 ? 1.476   -13.285 -4.170  1.00 0.00 ? 48 PRO A CA   6  
ATOM 6152  C C    . PRO A 1 48 ? 0.542   -12.819 -3.057  1.00 0.00 ? 48 PRO A C    6  
ATOM 6153  O O    . PRO A 1 48 ? 0.366   -11.620 -2.842  1.00 0.00 ? 48 PRO A O    6  
ATOM 6154  C CB   . PRO A 1 48 ? 2.909   -13.410 -3.660  1.00 0.00 ? 48 PRO A CB   6  
ATOM 6155  C CG   . PRO A 1 48 ? 3.753   -13.186 -4.870  1.00 0.00 ? 48 PRO A CG   6  
ATOM 6156  C CD   . PRO A 1 48 ? 2.988   -12.239 -5.763  1.00 0.00 ? 48 PRO A CD   6  
ATOM 6157  H HA   . PRO A 1 48 ? 1.140   -14.240 -4.547  1.00 0.00 ? 48 PRO A HA   6  
ATOM 6158  H HB2  . PRO A 1 48 ? 3.093   -12.661 -2.904  1.00 0.00 ? 48 PRO A HB2  6  
ATOM 6159  H HB3  . PRO A 1 48 ? 3.063   -14.396 -3.247  1.00 0.00 ? 48 PRO A HB3  6  
ATOM 6160  H HG2  . PRO A 1 48 ? 4.696   -12.745 -4.580  1.00 0.00 ? 48 PRO A HG2  6  
ATOM 6161  H HG3  . PRO A 1 48 ? 3.920   -14.124 -5.377  1.00 0.00 ? 48 PRO A HG3  6  
ATOM 6162  H HD2  . PRO A 1 48 ? 3.387   -11.240 -5.678  1.00 0.00 ? 48 PRO A HD2  6  
ATOM 6163  H HD3  . PRO A 1 48 ? 3.027   -12.575 -6.788  1.00 0.00 ? 48 PRO A HD3  6  
ATOM 6164  N N    . GLU A 1 49 ? -0.066  -13.776 -2.363  1.00 0.00 ? 49 GLU A N    6  
ATOM 6165  C CA   . GLU A 1 49 ? -1.001  -13.461 -1.287  1.00 0.00 ? 49 GLU A CA   6  
ATOM 6166  C C    . GLU A 1 49 ? -0.293  -13.390 0.063   1.00 0.00 ? 49 GLU A C    6  
ATOM 6167  O O    . GLU A 1 49 ? -0.925  -13.524 1.110   1.00 0.00 ? 49 GLU A O    6  
ATOM 6168  C CB   . GLU A 1 49 ? -2.123  -14.505 -1.238  1.00 0.00 ? 49 GLU A CB   6  
ATOM 6169  C CG   . GLU A 1 49 ? -1.705  -15.842 -0.641  1.00 0.00 ? 49 GLU A CG   6  
ATOM 6170  C CD   . GLU A 1 49 ? -0.905  -16.691 -1.610  1.00 0.00 ? 49 GLU A CD   6  
ATOM 6171  O OE1  . GLU A 1 49 ? -0.909  -16.377 -2.818  1.00 0.00 ? 49 GLU A OE1  6  
ATOM 6172  O OE2  . GLU A 1 49 ? -0.274  -17.670 -1.159  1.00 0.00 ? 49 GLU A OE2  6  
ATOM 6173  H H    . GLU A 1 49 ? 0.107   -14.712 -2.589  1.00 0.00 ? 49 GLU A H    6  
ATOM 6174  H HA   . GLU A 1 49 ? -1.432  -12.495 -1.502  1.00 0.00 ? 49 GLU A HA   6  
ATOM 6175  H HB2  . GLU A 1 49 ? -2.936  -14.111 -0.646  1.00 0.00 ? 49 GLU A HB2  6  
ATOM 6176  H HB3  . GLU A 1 49 ? -2.476  -14.681 -2.243  1.00 0.00 ? 49 GLU A HB3  6  
ATOM 6177  H HG2  . GLU A 1 49 ? -1.102  -15.659 0.235   1.00 0.00 ? 49 GLU A HG2  6  
ATOM 6178  H HG3  . GLU A 1 49 ? -2.593  -16.387 -0.359  1.00 0.00 ? 49 GLU A HG3  6  
ATOM 6179  N N    . GLN A 1 50 ? 1.019   -13.180 0.035   1.00 0.00 ? 50 GLN A N    6  
ATOM 6180  C CA   . GLN A 1 50 ? 1.798   -13.093 1.263   1.00 0.00 ? 50 GLN A CA   6  
ATOM 6181  C C    . GLN A 1 50 ? 1.280   -11.971 2.155   1.00 0.00 ? 50 GLN A C    6  
ATOM 6182  O O    . GLN A 1 50 ? 1.143   -12.141 3.367   1.00 0.00 ? 50 GLN A O    6  
ATOM 6183  C CB   . GLN A 1 50 ? 3.275   -12.867 0.938   1.00 0.00 ? 50 GLN A CB   6  
ATOM 6184  C CG   . GLN A 1 50 ? 3.884   -13.970 0.088   1.00 0.00 ? 50 GLN A CG   6  
ATOM 6185  C CD   . GLN A 1 50 ? 5.070   -13.496 -0.722  1.00 0.00 ? 50 GLN A CD   6  
ATOM 6186  O OE1  . GLN A 1 50 ? 5.085   -12.374 -1.230  1.00 0.00 ? 50 GLN A OE1  6  
ATOM 6187  N NE2  . GLN A 1 50 ? 6.075   -14.352 -0.847  1.00 0.00 ? 50 GLN A NE2  6  
ATOM 6188  H H    . GLN A 1 50 ? 1.472   -13.081 -0.827  1.00 0.00 ? 50 GLN A H    6  
ATOM 6189  H HA   . GLN A 1 50 ? 1.693   -14.032 1.788   1.00 0.00 ? 50 GLN A HA   6  
ATOM 6190  H HB2  . GLN A 1 50 ? 3.375   -11.933 0.405   1.00 0.00 ? 50 GLN A HB2  6  
ATOM 6191  H HB3  . GLN A 1 50 ? 3.830   -12.805 1.862   1.00 0.00 ? 50 GLN A HB3  6  
ATOM 6192  H HG2  . GLN A 1 50 ? 4.213   -14.767 0.736   1.00 0.00 ? 50 GLN A HG2  6  
ATOM 6193  H HG3  . GLN A 1 50 ? 3.131   -14.343 -0.590  1.00 0.00 ? 50 GLN A HG3  6  
ATOM 6194  H HE21 . GLN A 1 50 ? 5.993   -15.228 -0.415  1.00 0.00 ? 50 GLN A HE21 6  
ATOM 6195  H HE22 . GLN A 1 50 ? 6.856   -14.074 -1.364  1.00 0.00 ? 50 GLN A HE22 6  
ATOM 6196  N N    . TYR A 1 51 ? 1.003   -10.820 1.550   1.00 0.00 ? 51 TYR A N    6  
ATOM 6197  C CA   . TYR A 1 51 ? 0.503   -9.669  2.295   1.00 0.00 ? 51 TYR A CA   6  
ATOM 6198  C C    . TYR A 1 51 ? -0.571  -8.922  1.509   1.00 0.00 ? 51 TYR A C    6  
ATOM 6199  O O    . TYR A 1 51 ? -0.701  -7.703  1.627   1.00 0.00 ? 51 TYR A O    6  
ATOM 6200  C CB   . TYR A 1 51 ? 1.652   -8.719  2.637   1.00 0.00 ? 51 TYR A CB   6  
ATOM 6201  C CG   . TYR A 1 51 ? 2.908   -9.426  3.094   1.00 0.00 ? 51 TYR A CG   6  
ATOM 6202  C CD1  . TYR A 1 51 ? 2.985   -9.999  4.358   1.00 0.00 ? 51 TYR A CD1  6  
ATOM 6203  C CD2  . TYR A 1 51 ? 4.018   -9.518  2.264   1.00 0.00 ? 51 TYR A CD2  6  
ATOM 6204  C CE1  . TYR A 1 51 ? 4.132   -10.644 4.780   1.00 0.00 ? 51 TYR A CE1  6  
ATOM 6205  C CE2  . TYR A 1 51 ? 5.169   -10.160 2.679   1.00 0.00 ? 51 TYR A CE2  6  
ATOM 6206  C CZ   . TYR A 1 51 ? 5.221   -10.721 3.937   1.00 0.00 ? 51 TYR A CZ   6  
ATOM 6207  O OH   . TYR A 1 51 ? 6.365   -11.362 4.353   1.00 0.00 ? 51 TYR A OH   6  
ATOM 6208  H H    . TYR A 1 51 ? 1.131   -10.745 0.582   1.00 0.00 ? 51 TYR A H    6  
ATOM 6209  H HA   . TYR A 1 51 ? 0.067   -10.036 3.214   1.00 0.00 ? 51 TYR A HA   6  
ATOM 6210  H HB2  . TYR A 1 51 ? 1.899   -8.136  1.761   1.00 0.00 ? 51 TYR A HB2  6  
ATOM 6211  H HB3  . TYR A 1 51 ? 1.337   -8.055  3.428   1.00 0.00 ? 51 TYR A HB3  6  
ATOM 6212  H HD1  . TYR A 1 51 ? 2.131   -9.936  5.016   1.00 0.00 ? 51 TYR A HD1  6  
ATOM 6213  H HD2  . TYR A 1 51 ? 3.974   -9.076  1.279   1.00 0.00 ? 51 TYR A HD2  6  
ATOM 6214  H HE1  . TYR A 1 51 ? 4.173   -11.083 5.765   1.00 0.00 ? 51 TYR A HE1  6  
ATOM 6215  H HE2  . TYR A 1 51 ? 6.020   -10.221 2.018   1.00 0.00 ? 51 TYR A HE2  6  
ATOM 6216  H HH   . TYR A 1 51 ? 7.134   -10.889 4.026   1.00 0.00 ? 51 TYR A HH   6  
ATOM 6217  N N    . ARG A 1 52 ? -1.340  -9.653  0.708   1.00 0.00 ? 52 ARG A N    6  
ATOM 6218  C CA   . ARG A 1 52 ? -2.402  -9.046  -0.088  1.00 0.00 ? 52 ARG A CA   6  
ATOM 6219  C C    . ARG A 1 52 ? -3.360  -8.259  0.799   1.00 0.00 ? 52 ARG A C    6  
ATOM 6220  O O    . ARG A 1 52 ? -3.512  -7.047  0.646   1.00 0.00 ? 52 ARG A O    6  
ATOM 6221  C CB   . ARG A 1 52 ? -3.171  -10.120 -0.861  1.00 0.00 ? 52 ARG A CB   6  
ATOM 6222  C CG   . ARG A 1 52 ? -3.592  -9.688  -2.259  1.00 0.00 ? 52 ARG A CG   6  
ATOM 6223  C CD   . ARG A 1 52 ? -3.842  -10.887 -3.161  1.00 0.00 ? 52 ARG A CD   6  
ATOM 6224  N NE   . ARG A 1 52 ? -5.252  -11.271 -3.184  1.00 0.00 ? 52 ARG A NE   6  
ATOM 6225  C CZ   . ARG A 1 52 ? -5.823  -12.054 -2.272  1.00 0.00 ? 52 ARG A CZ   6  
ATOM 6226  N NH1  . ARG A 1 52 ? -5.110  -12.539 -1.263  1.00 0.00 ? 52 ARG A NH1  6  
ATOM 6227  N NH2  . ARG A 1 52 ? -7.111  -12.353 -2.368  1.00 0.00 ? 52 ARG A NH2  6  
ATOM 6228  H H    . ARG A 1 52 ? -1.194  -10.621 0.655   1.00 0.00 ? 52 ARG A H    6  
ATOM 6229  H HA   . ARG A 1 52 ? -1.942  -8.366  -0.791  1.00 0.00 ? 52 ARG A HA   6  
ATOM 6230  H HB2  . ARG A 1 52 ? -2.547  -10.997 -0.952  1.00 0.00 ? 52 ARG A HB2  6  
ATOM 6231  H HB3  . ARG A 1 52 ? -4.060  -10.378 -0.305  1.00 0.00 ? 52 ARG A HB3  6  
ATOM 6232  H HG2  . ARG A 1 52 ? -4.501  -9.108  -2.190  1.00 0.00 ? 52 ARG A HG2  6  
ATOM 6233  H HG3  . ARG A 1 52 ? -2.809  -9.083  -2.691  1.00 0.00 ? 52 ARG A HG3  6  
ATOM 6234  H HD2  . ARG A 1 52 ? -3.532  -10.636 -4.164  1.00 0.00 ? 52 ARG A HD2  6  
ATOM 6235  H HD3  . ARG A 1 52 ? -3.257  -11.720 -2.802  1.00 0.00 ? 52 ARG A HD3  6  
ATOM 6236  H HE   . ARG A 1 52 ? -5.802  -10.927 -3.916  1.00 0.00 ? 52 ARG A HE   6  
ATOM 6237  H HH11 . ARG A 1 52 ? -4.139  -12.318 -1.185  1.00 0.00 ? 52 ARG A HH11 6  
ATOM 6238  H HH12 . ARG A 1 52 ? -5.545  -13.127 -0.582  1.00 0.00 ? 52 ARG A HH12 6  
ATOM 6239  H HH21 . ARG A 1 52 ? -7.653  -11.990 -3.127  1.00 0.00 ? 52 ARG A HH21 6  
ATOM 6240  H HH22 . ARG A 1 52 ? -7.540  -12.941 -1.684  1.00 0.00 ? 52 ARG A HH22 6  
ATOM 6241  N N    . MET A 1 53 ? -4.003  -8.956  1.731   1.00 0.00 ? 53 MET A N    6  
ATOM 6242  C CA   . MET A 1 53 ? -4.945  -8.323  2.647   1.00 0.00 ? 53 MET A CA   6  
ATOM 6243  C C    . MET A 1 53 ? -4.276  -7.186  3.410   1.00 0.00 ? 53 MET A C    6  
ATOM 6244  O O    . MET A 1 53 ? -4.857  -6.114  3.585   1.00 0.00 ? 53 MET A O    6  
ATOM 6245  C CB   . MET A 1 53 ? -5.502  -9.353  3.631   1.00 0.00 ? 53 MET A CB   6  
ATOM 6246  C CG   . MET A 1 53 ? -6.698  -10.123 3.095   1.00 0.00 ? 53 MET A CG   6  
ATOM 6247  S SD   . MET A 1 53 ? -6.526  -11.905 3.303   1.00 0.00 ? 53 MET A SD   6  
ATOM 6248  C CE   . MET A 1 53 ? -5.854  -12.368 1.709   1.00 0.00 ? 53 MET A CE   6  
ATOM 6249  H H    . MET A 1 53 ? -3.840  -9.920  1.805   1.00 0.00 ? 53 MET A H    6  
ATOM 6250  H HA   . MET A 1 53 ? -5.756  -7.919  2.060   1.00 0.00 ? 53 MET A HA   6  
ATOM 6251  H HB2  . MET A 1 53 ? -4.723  -10.062 3.871   1.00 0.00 ? 53 MET A HB2  6  
ATOM 6252  H HB3  . MET A 1 53 ? -5.804  -8.844  4.534   1.00 0.00 ? 53 MET A HB3  6  
ATOM 6253  H HG2  . MET A 1 53 ? -7.583  -9.797  3.620   1.00 0.00 ? 53 MET A HG2  6  
ATOM 6254  H HG3  . MET A 1 53 ? -6.806  -9.907  2.042   1.00 0.00 ? 53 MET A HG3  6  
ATOM 6255  H HE1  . MET A 1 53 ? -5.841  -11.505 1.059   1.00 0.00 ? 53 MET A HE1  6  
ATOM 6256  H HE2  . MET A 1 53 ? -6.469  -13.140 1.269   1.00 0.00 ? 53 MET A HE2  6  
ATOM 6257  H HE3  . MET A 1 53 ? -4.847  -12.739 1.836   1.00 0.00 ? 53 MET A HE3  6  
ATOM 6258  N N    . THR A 1 54 ? -3.052  -7.429  3.867   1.00 0.00 ? 54 THR A N    6  
ATOM 6259  C CA   . THR A 1 54 ? -2.300  -6.427  4.614   1.00 0.00 ? 54 THR A CA   6  
ATOM 6260  C C    . THR A 1 54 ? -2.275  -5.097  3.868   1.00 0.00 ? 54 THR A C    6  
ATOM 6261  O O    . THR A 1 54 ? -2.584  -4.048  4.436   1.00 0.00 ? 54 THR A O    6  
ATOM 6262  C CB   . THR A 1 54 ? -0.872  -6.917  4.859   1.00 0.00 ? 54 THR A CB   6  
ATOM 6263  O OG1  . THR A 1 54 ? -0.875  -8.092  5.650   1.00 0.00 ? 54 THR A OG1  6  
ATOM 6264  C CG2  . THR A 1 54 ? 0.003   -5.897  5.554   1.00 0.00 ? 54 THR A CG2  6  
ATOM 6265  H H    . THR A 1 54 ? -2.643  -8.303  3.696   1.00 0.00 ? 54 THR A H    6  
ATOM 6266  H HA   . THR A 1 54 ? -2.793  -6.284  5.565   1.00 0.00 ? 54 THR A HA   6  
ATOM 6267  H HB   . THR A 1 54 ? -0.414  -7.149  3.909   1.00 0.00 ? 54 THR A HB   6  
ATOM 6268  H HG1  . THR A 1 54 ? -1.192  -7.884  6.532   1.00 0.00 ? 54 THR A HG1  6  
ATOM 6269  H HG21 . THR A 1 54 ? 0.207   -5.079  4.878   1.00 0.00 ? 54 THR A HG21 6  
ATOM 6270  H HG22 . THR A 1 54 ? 0.932   -6.362  5.848   1.00 0.00 ? 54 THR A HG22 6  
ATOM 6271  H HG23 . THR A 1 54 ? -0.506  -5.523  6.430   1.00 0.00 ? 54 THR A HG23 6  
ATOM 6272  N N    . ILE A 1 55 ? -1.909  -5.146  2.591   1.00 0.00 ? 55 ILE A N    6  
ATOM 6273  C CA   . ILE A 1 55 ? -1.850  -3.945  1.767   1.00 0.00 ? 55 ILE A CA   6  
ATOM 6274  C C    . ILE A 1 55 ? -3.227  -3.309  1.629   1.00 0.00 ? 55 ILE A C    6  
ATOM 6275  O O    . ILE A 1 55 ? -3.359  -2.084  1.624   1.00 0.00 ? 55 ILE A O    6  
ATOM 6276  C CB   . ILE A 1 55 ? -1.293  -4.251  0.365   1.00 0.00 ? 55 ILE A CB   6  
ATOM 6277  C CG1  . ILE A 1 55 ? 0.074   -4.927  0.473   1.00 0.00 ? 55 ILE A CG1  6  
ATOM 6278  C CG2  . ILE A 1 55 ? -1.196  -2.975  -0.457  1.00 0.00 ? 55 ILE A CG2  6  
ATOM 6279  C CD1  . ILE A 1 55 ? 0.292   -6.020  -0.551  1.00 0.00 ? 55 ILE A CD1  6  
ATOM 6280  H H    . ILE A 1 55 ? -1.678  -6.011  2.193   1.00 0.00 ? 55 ILE A H    6  
ATOM 6281  H HA   . ILE A 1 55 ? -1.186  -3.242  2.247   1.00 0.00 ? 55 ILE A HA   6  
ATOM 6282  H HB   . ILE A 1 55 ? -1.981  -4.917  -0.132  1.00 0.00 ? 55 ILE A HB   6  
ATOM 6283  H HG12 . ILE A 1 55 ? 0.848   -4.185  0.334   1.00 0.00 ? 55 ILE A HG12 6  
ATOM 6284  H HG13 . ILE A 1 55 ? 0.175   -5.366  1.454   1.00 0.00 ? 55 ILE A HG13 6  
ATOM 6285  H HG21 . ILE A 1 55 ? -0.780  -2.186  0.151   1.00 0.00 ? 55 ILE A HG21 6  
ATOM 6286  H HG22 . ILE A 1 55 ? -2.181  -2.689  -0.795  1.00 0.00 ? 55 ILE A HG22 6  
ATOM 6287  H HG23 . ILE A 1 55 ? -0.557  -3.146  -1.312  1.00 0.00 ? 55 ILE A HG23 6  
ATOM 6288  H HD11 . ILE A 1 55 ? -0.632  -6.558  -0.704  1.00 0.00 ? 55 ILE A HD11 6  
ATOM 6289  H HD12 . ILE A 1 55 ? 1.051   -6.701  -0.194  1.00 0.00 ? 55 ILE A HD12 6  
ATOM 6290  H HD13 . ILE A 1 55 ? 0.612   -5.581  -1.484  1.00 0.00 ? 55 ILE A HD13 6  
ATOM 6291  N N    . TRP A 1 56 ? -4.252  -4.148  1.520   1.00 0.00 ? 56 TRP A N    6  
ATOM 6292  C CA   . TRP A 1 56 ? -5.621  -3.670  1.396   1.00 0.00 ? 56 TRP A CA   6  
ATOM 6293  C C    . TRP A 1 56 ? -6.020  -2.869  2.635   1.00 0.00 ? 56 TRP A C    6  
ATOM 6294  O O    . TRP A 1 56 ? -6.452  -1.721  2.533   1.00 0.00 ? 56 TRP A O    6  
ATOM 6295  C CB   . TRP A 1 56 ? -6.565  -4.861  1.189   1.00 0.00 ? 56 TRP A CB   6  
ATOM 6296  C CG   . TRP A 1 56 ? -8.015  -4.544  1.401   1.00 0.00 ? 56 TRP A CG   6  
ATOM 6297  C CD1  . TRP A 1 56 ? -8.691  -3.442  0.961   1.00 0.00 ? 56 TRP A CD1  6  
ATOM 6298  C CD2  . TRP A 1 56 ? -8.963  -5.339  2.116   1.00 0.00 ? 56 TRP A CD2  6  
ATOM 6299  N NE1  . TRP A 1 56 ? -10.005 -3.511  1.358   1.00 0.00 ? 56 TRP A NE1  6  
ATOM 6300  C CE2  . TRP A 1 56 ? -10.194 -4.664  2.066   1.00 0.00 ? 56 TRP A CE2  6  
ATOM 6301  C CE3  . TRP A 1 56 ? -8.890  -6.561  2.788   1.00 0.00 ? 56 TRP A CE3  6  
ATOM 6302  C CZ2  . TRP A 1 56 ? -11.343 -5.164  2.663   1.00 0.00 ? 56 TRP A CZ2  6  
ATOM 6303  C CZ3  . TRP A 1 56 ? -10.034 -7.061  3.384   1.00 0.00 ? 56 TRP A CZ3  6  
ATOM 6304  C CH2  . TRP A 1 56 ? -11.247 -6.362  3.318   1.00 0.00 ? 56 TRP A CH2  6  
ATOM 6305  H H    . TRP A 1 56 ? -4.085  -5.115  1.538   1.00 0.00 ? 56 TRP A H    6  
ATOM 6306  H HA   . TRP A 1 56 ? -5.670  -3.024  0.531   1.00 0.00 ? 56 TRP A HA   6  
ATOM 6307  H HB2  . TRP A 1 56 ? -6.451  -5.226  0.179   1.00 0.00 ? 56 TRP A HB2  6  
ATOM 6308  H HB3  . TRP A 1 56 ? -6.295  -5.645  1.880   1.00 0.00 ? 56 TRP A HB3  6  
ATOM 6309  H HD1  . TRP A 1 56 ? -8.246  -2.644  0.388   1.00 0.00 ? 56 TRP A HD1  6  
ATOM 6310  H HE1  . TRP A 1 56 ? -10.696 -2.844  1.167   1.00 0.00 ? 56 TRP A HE1  6  
ATOM 6311  H HE3  . TRP A 1 56 ? -7.961  -7.109  2.847   1.00 0.00 ? 56 TRP A HE3  6  
ATOM 6312  H HZ2  . TRP A 1 56 ? -12.282 -4.634  2.618   1.00 0.00 ? 56 TRP A HZ2  6  
ATOM 6313  H HZ3  . TRP A 1 56 ? -9.998  -8.003  3.910   1.00 0.00 ? 56 TRP A HZ3  6  
ATOM 6314  H HH2  . TRP A 1 56 ? -12.116 -6.789  3.797   1.00 0.00 ? 56 TRP A HH2  6  
ATOM 6315  N N    . ARG A 1 57 ? -5.868  -3.485  3.802   1.00 0.00 ? 57 ARG A N    6  
ATOM 6316  C CA   . ARG A 1 57 ? -6.209  -2.831  5.060   1.00 0.00 ? 57 ARG A CA   6  
ATOM 6317  C C    . ARG A 1 57 ? -5.482  -1.498  5.193   1.00 0.00 ? 57 ARG A C    6  
ATOM 6318  O O    . ARG A 1 57 ? -6.030  -0.529  5.717   1.00 0.00 ? 57 ARG A O    6  
ATOM 6319  C CB   . ARG A 1 57 ? -5.859  -3.736  6.245   1.00 0.00 ? 57 ARG A CB   6  
ATOM 6320  C CG   . ARG A 1 57 ? -6.181  -5.203  6.008   1.00 0.00 ? 57 ARG A CG   6  
ATOM 6321  C CD   . ARG A 1 57 ? -6.901  -5.816  7.198   1.00 0.00 ? 57 ARG A CD   6  
ATOM 6322  N NE   . ARG A 1 57 ? -6.036  -5.912  8.370   1.00 0.00 ? 57 ARG A NE   6  
ATOM 6323  C CZ   . ARG A 1 57 ? -6.405  -6.481  9.513   1.00 0.00 ? 57 ARG A CZ   6  
ATOM 6324  N NH1  . ARG A 1 57 ? -7.618  -7.002  9.637   1.00 0.00 ? 57 ARG A NH1  6  
ATOM 6325  N NH2  . ARG A 1 57 ? -5.561  -6.529  10.535  1.00 0.00 ? 57 ARG A NH2  6  
ATOM 6326  H H    . ARG A 1 57 ? -5.517  -4.399  3.817   1.00 0.00 ? 57 ARG A H    6  
ATOM 6327  H HA   . ARG A 1 57 ? -7.272  -2.646  5.058   1.00 0.00 ? 57 ARG A HA   6  
ATOM 6328  H HB2  . ARG A 1 57 ? -4.803  -3.650  6.450   1.00 0.00 ? 57 ARG A HB2  6  
ATOM 6329  H HB3  . ARG A 1 57 ? -6.414  -3.404  7.111   1.00 0.00 ? 57 ARG A HB3  6  
ATOM 6330  H HG2  . ARG A 1 57 ? -6.811  -5.286  5.135   1.00 0.00 ? 57 ARG A HG2  6  
ATOM 6331  H HG3  . ARG A 1 57 ? -5.258  -5.740  5.842   1.00 0.00 ? 57 ARG A HG3  6  
ATOM 6332  H HD2  . ARG A 1 57 ? -7.755  -5.200  7.441   1.00 0.00 ? 57 ARG A HD2  6  
ATOM 6333  H HD3  . ARG A 1 57 ? -7.237  -6.806  6.927   1.00 0.00 ? 57 ARG A HD3  6  
ATOM 6334  H HE   . ARG A 1 57 ? -5.135  -5.534  8.302   1.00 0.00 ? 57 ARG A HE   6  
ATOM 6335  H HH11 . ARG A 1 57 ? -8.258  -6.967  8.869   1.00 0.00 ? 57 ARG A HH11 6  
ATOM 6336  H HH12 . ARG A 1 57 ? -7.894  -7.430  10.498  1.00 0.00 ? 57 ARG A HH12 6  
ATOM 6337  H HH21 . ARG A 1 57 ? -4.644  -6.138  10.446  1.00 0.00 ? 57 ARG A HH21 6  
ATOM 6338  H HH22 . ARG A 1 57 ? -5.840  -6.958  11.394  1.00 0.00 ? 57 ARG A HH22 6  
ATOM 6339  N N    . GLY A 1 58 ? -4.244  -1.457  4.713   1.00 0.00 ? 58 GLY A N    6  
ATOM 6340  C CA   . GLY A 1 58 ? -3.467  -0.235  4.773   1.00 0.00 ? 58 GLY A CA   6  
ATOM 6341  C C    . GLY A 1 58 ? -3.932  0.787   3.756   1.00 0.00 ? 58 GLY A C    6  
ATOM 6342  O O    . GLY A 1 58 ? -3.854  1.992   3.992   1.00 0.00 ? 58 GLY A O    6  
ATOM 6343  H H    . GLY A 1 58 ? -3.863  -2.258  4.298   1.00 0.00 ? 58 GLY A H    6  
ATOM 6344  H HA2  . GLY A 1 58 ? -3.557  0.190   5.763   1.00 0.00 ? 58 GLY A HA2  6  
ATOM 6345  H HA3  . GLY A 1 58 ? -2.429  -0.469  4.585   1.00 0.00 ? 58 GLY A HA3  6  
ATOM 6346  N N    . LEU A 1 59 ? -4.426  0.299   2.622   1.00 0.00 ? 59 LEU A N    6  
ATOM 6347  C CA   . LEU A 1 59 ? -4.917  1.169   1.565   1.00 0.00 ? 59 LEU A CA   6  
ATOM 6348  C C    . LEU A 1 59 ? -6.259  1.780   1.947   1.00 0.00 ? 59 LEU A C    6  
ATOM 6349  O O    . LEU A 1 59 ? -6.538  2.936   1.627   1.00 0.00 ? 59 LEU A O    6  
ATOM 6350  C CB   . LEU A 1 59 ? -5.052  0.386   0.258   1.00 0.00 ? 59 LEU A CB   6  
ATOM 6351  C CG   . LEU A 1 59 ? -4.512  1.100   -0.981  1.00 0.00 ? 59 LEU A CG   6  
ATOM 6352  C CD1  . LEU A 1 59 ? -3.019  1.354   -0.844  1.00 0.00 ? 59 LEU A CD1  6  
ATOM 6353  C CD2  . LEU A 1 59 ? -4.806  0.288   -2.233  1.00 0.00 ? 59 LEU A CD2  6  
ATOM 6354  H H    . LEU A 1 59 ? -4.464  -0.672  2.496   1.00 0.00 ? 59 LEU A H    6  
ATOM 6355  H HA   . LEU A 1 59 ? -4.200  1.965   1.431   1.00 0.00 ? 59 LEU A HA   6  
ATOM 6356  H HB2  . LEU A 1 59 ? -4.522  -0.549  0.368   1.00 0.00 ? 59 LEU A HB2  6  
ATOM 6357  H HB3  . LEU A 1 59 ? -6.097  0.171   0.098   1.00 0.00 ? 59 LEU A HB3  6  
ATOM 6358  H HG   . LEU A 1 59 ? -5.005  2.055   -1.080  1.00 0.00 ? 59 LEU A HG   6  
ATOM 6359  H HD11 . LEU A 1 59 ? -2.710  1.147   0.169   1.00 0.00 ? 59 LEU A HD11 6  
ATOM 6360  H HD12 . LEU A 1 59 ? -2.806  2.385   -1.082  1.00 0.00 ? 59 LEU A HD12 6  
ATOM 6361  H HD13 . LEU A 1 59 ? -2.479  0.710   -1.523  1.00 0.00 ? 59 LEU A HD13 6  
ATOM 6362  H HD21 . LEU A 1 59 ? -5.445  0.857   -2.890  1.00 0.00 ? 59 LEU A HD21 6  
ATOM 6363  H HD22 . LEU A 1 59 ? -5.301  -0.632  -1.958  1.00 0.00 ? 59 LEU A HD22 6  
ATOM 6364  H HD23 . LEU A 1 59 ? -3.879  0.059   -2.740  1.00 0.00 ? 59 LEU A HD23 6  
ATOM 6365  N N    . GLN A 1 60 ? -7.088  1.002   2.637   1.00 0.00 ? 60 GLN A N    6  
ATOM 6366  C CA   . GLN A 1 60 ? -8.387  1.491   3.077   1.00 0.00 ? 60 GLN A CA   6  
ATOM 6367  C C    . GLN A 1 60 ? -8.213  2.548   4.161   1.00 0.00 ? 60 GLN A C    6  
ATOM 6368  O O    . GLN A 1 60 ? -9.053  3.434   4.319   1.00 0.00 ? 60 GLN A O    6  
ATOM 6369  C CB   . GLN A 1 60 ? -9.249  0.340   3.598   1.00 0.00 ? 60 GLN A CB   6  
ATOM 6370  C CG   . GLN A 1 60 ? -8.587  -0.465  4.705   1.00 0.00 ? 60 GLN A CG   6  
ATOM 6371  C CD   . GLN A 1 60 ? -9.474  -1.582  5.222   1.00 0.00 ? 60 GLN A CD   6  
ATOM 6372  O OE1  . GLN A 1 60 ? -9.853  -1.596  6.393   1.00 0.00 ? 60 GLN A OE1  6  
ATOM 6373  N NE2  . GLN A 1 60 ? -9.808  -2.524  4.349   1.00 0.00 ? 60 GLN A NE2  6  
ATOM 6374  H H    . GLN A 1 60 ? -6.807  0.092   2.878   1.00 0.00 ? 60 GLN A H    6  
ATOM 6375  H HA   . GLN A 1 60 ? -8.878  1.941   2.227   1.00 0.00 ? 60 GLN A HA   6  
ATOM 6376  H HB2  . GLN A 1 60 ? -10.175 0.743   3.981   1.00 0.00 ? 60 GLN A HB2  6  
ATOM 6377  H HB3  . GLN A 1 60 ? -9.469  -0.329  2.779   1.00 0.00 ? 60 GLN A HB3  6  
ATOM 6378  H HG2  . GLN A 1 60 ? -7.675  -0.896  4.322   1.00 0.00 ? 60 GLN A HG2  6  
ATOM 6379  H HG3  . GLN A 1 60 ? -8.355  0.199   5.525   1.00 0.00 ? 60 GLN A HG3  6  
ATOM 6380  H HE21 . GLN A 1 60 ? -9.470  -2.447  3.432   1.00 0.00 ? 60 GLN A HE21 6  
ATOM 6381  H HE22 . GLN A 1 60 ? -10.381 -3.257  4.656   1.00 0.00 ? 60 GLN A HE22 6  
ATOM 6382  N N    . ASP A 1 61 ? -7.105  2.458   4.891   1.00 0.00 ? 61 ASP A N    6  
ATOM 6383  C CA   . ASP A 1 61 ? -6.801  3.423   5.937   1.00 0.00 ? 61 ASP A CA   6  
ATOM 6384  C C    . ASP A 1 61 ? -6.667  4.820   5.344   1.00 0.00 ? 61 ASP A C    6  
ATOM 6385  O O    . ASP A 1 61 ? -6.939  5.820   6.009   1.00 0.00 ? 61 ASP A O    6  
ATOM 6386  C CB   . ASP A 1 61 ? -5.510  3.034   6.660   1.00 0.00 ? 61 ASP A CB   6  
ATOM 6387  C CG   . ASP A 1 61 ? -5.730  2.775   8.137   1.00 0.00 ? 61 ASP A CG   6  
ATOM 6388  O OD1  . ASP A 1 61 ? -6.569  3.473   8.745   1.00 0.00 ? 61 ASP A OD1  6  
ATOM 6389  O OD2  . ASP A 1 61 ? -5.064  1.873   8.688   1.00 0.00 ? 61 ASP A OD2  6  
ATOM 6390  H H    . ASP A 1 61 ? -6.468  1.737   4.706   1.00 0.00 ? 61 ASP A H    6  
ATOM 6391  H HA   . ASP A 1 61 ? -7.619  3.419   6.643   1.00 0.00 ? 61 ASP A HA   6  
ATOM 6392  H HB2  . ASP A 1 61 ? -5.111  2.135   6.212   1.00 0.00 ? 61 ASP A HB2  6  
ATOM 6393  H HB3  . ASP A 1 61 ? -4.791  3.833   6.557   1.00 0.00 ? 61 ASP A HB3  6  
ATOM 6394  N N    . LEU A 1 62 ? -6.253  4.879   4.081   1.00 0.00 ? 62 LEU A N    6  
ATOM 6395  C CA   . LEU A 1 62 ? -6.104  6.149   3.383   1.00 0.00 ? 62 LEU A CA   6  
ATOM 6396  C C    . LEU A 1 62 ? -7.463  6.804   3.176   1.00 0.00 ? 62 LEU A C    6  
ATOM 6397  O O    . LEU A 1 62 ? -7.596  8.025   3.243   1.00 0.00 ? 62 LEU A O    6  
ATOM 6398  C CB   . LEU A 1 62 ? -5.424  5.932   2.030   1.00 0.00 ? 62 LEU A CB   6  
ATOM 6399  C CG   . LEU A 1 62 ? -4.181  5.042   2.064   1.00 0.00 ? 62 LEU A CG   6  
ATOM 6400  C CD1  . LEU A 1 62 ? -3.955  4.393   0.708   1.00 0.00 ? 62 LEU A CD1  6  
ATOM 6401  C CD2  . LEU A 1 62 ? -2.965  5.850   2.485   1.00 0.00 ? 62 LEU A CD2  6  
ATOM 6402  H H    . LEU A 1 62 ? -6.064  4.043   3.601   1.00 0.00 ? 62 LEU A H    6  
ATOM 6403  H HA   . LEU A 1 62 ? -5.491  6.796   3.992   1.00 0.00 ? 62 LEU A HA   6  
ATOM 6404  H HB2  . LEU A 1 62 ? -6.141  5.487   1.357   1.00 0.00 ? 62 LEU A HB2  6  
ATOM 6405  H HB3  . LEU A 1 62 ? -5.138  6.898   1.637   1.00 0.00 ? 62 LEU A HB3  6  
ATOM 6406  H HG   . LEU A 1 62 ? -4.327  4.257   2.790   1.00 0.00 ? 62 LEU A HG   6  
ATOM 6407  H HD11 . LEU A 1 62 ? -3.143  3.683   0.779   1.00 0.00 ? 62 LEU A HD11 6  
ATOM 6408  H HD12 . LEU A 1 62 ? -3.709  5.151   -0.018  1.00 0.00 ? 62 LEU A HD12 6  
ATOM 6409  H HD13 . LEU A 1 62 ? -4.855  3.879   0.402   1.00 0.00 ? 62 LEU A HD13 6  
ATOM 6410  H HD21 . LEU A 1 62 ? -2.664  6.496   1.674   1.00 0.00 ? 62 LEU A HD21 6  
ATOM 6411  H HD22 . LEU A 1 62 ? -2.155  5.180   2.733   1.00 0.00 ? 62 LEU A HD22 6  
ATOM 6412  H HD23 . LEU A 1 62 ? -3.214  6.447   3.350   1.00 0.00 ? 62 LEU A HD23 6  
ATOM 6413  N N    . LYS A 1 63 ? -8.472  5.973   2.938   1.00 0.00 ? 63 LYS A N    6  
ATOM 6414  C CA   . LYS A 1 63 ? -9.831  6.455   2.720   1.00 0.00 ? 63 LYS A CA   6  
ATOM 6415  C C    . LYS A 1 63 ? -10.624 6.480   4.024   1.00 0.00 ? 63 LYS A C    6  
ATOM 6416  O O    . LYS A 1 63 ? -11.836 6.264   4.027   1.00 0.00 ? 63 LYS A O    6  
ATOM 6417  C CB   . LYS A 1 63 ? -10.548 5.568   1.699   1.00 0.00 ? 63 LYS A CB   6  
ATOM 6418  C CG   . LYS A 1 63 ? -11.819 6.185   1.134   1.00 0.00 ? 63 LYS A CG   6  
ATOM 6419  C CD   . LYS A 1 63 ? -11.609 7.636   0.729   1.00 0.00 ? 63 LYS A CD   6  
ATOM 6420  C CE   . LYS A 1 63 ? -10.432 7.788   -0.221  1.00 0.00 ? 63 LYS A CE   6  
ATOM 6421  N NZ   . LYS A 1 63 ? -10.839 8.399   -1.516  1.00 0.00 ? 63 LYS A NZ   6  
ATOM 6422  H H    . LYS A 1 63 ? -8.293  5.010   2.897   1.00 0.00 ? 63 LYS A H    6  
ATOM 6423  H HA   . LYS A 1 63 ? -9.769  7.461   2.331   1.00 0.00 ? 63 LYS A HA   6  
ATOM 6424  H HB2  . LYS A 1 63 ? -9.875  5.366   0.879   1.00 0.00 ? 63 LYS A HB2  6  
ATOM 6425  H HB3  . LYS A 1 63 ? -10.810 4.634   2.175   1.00 0.00 ? 63 LYS A HB3  6  
ATOM 6426  H HG2  . LYS A 1 63 ? -12.125 5.621   0.265   1.00 0.00 ? 63 LYS A HG2  6  
ATOM 6427  H HG3  . LYS A 1 63 ? -12.593 6.140   1.885   1.00 0.00 ? 63 LYS A HG3  6  
ATOM 6428  H HD2  . LYS A 1 63 ? -12.503 7.995   0.241   1.00 0.00 ? 63 LYS A HD2  6  
ATOM 6429  H HD3  . LYS A 1 63 ? -11.420 8.223   1.617   1.00 0.00 ? 63 LYS A HD3  6  
ATOM 6430  H HE2  . LYS A 1 63 ? -9.688  8.416   0.246   1.00 0.00 ? 63 LYS A HE2  6  
ATOM 6431  H HE3  . LYS A 1 63 ? -10.011 6.812   -0.411  1.00 0.00 ? 63 LYS A HE3  6  
ATOM 6432  H HZ1  . LYS A 1 63 ? -10.157 9.134   -1.795  1.00 0.00 ? 63 LYS A HZ1  6  
ATOM 6433  H HZ2  . LYS A 1 63 ? -11.780 8.834   -1.427  1.00 0.00 ? 63 LYS A HZ2  6  
ATOM 6434  H HZ3  . LYS A 1 63 ? -10.873 7.673   -2.260  1.00 0.00 ? 63 LYS A HZ3  6  
ATOM 6435  N N    . GLN A 1 64 ? -9.935  6.743   5.130   1.00 0.00 ? 64 GLN A N    6  
ATOM 6436  C CA   . GLN A 1 64 ? -10.581 6.792   6.436   1.00 0.00 ? 64 GLN A CA   6  
ATOM 6437  C C    . GLN A 1 64 ? -11.767 7.751   6.420   1.00 0.00 ? 64 GLN A C    6  
ATOM 6438  O O    . GLN A 1 64 ? -12.915 7.332   6.275   1.00 0.00 ? 64 GLN A O    6  
ATOM 6439  C CB   . GLN A 1 64 ? -9.576  7.220   7.507   1.00 0.00 ? 64 GLN A CB   6  
ATOM 6440  C CG   . GLN A 1 64 ? -8.823  6.057   8.132   1.00 0.00 ? 64 GLN A CG   6  
ATOM 6441  C CD   . GLN A 1 64 ? -9.431  5.609   9.446   1.00 0.00 ? 64 GLN A CD   6  
ATOM 6442  O OE1  . GLN A 1 64 ? -9.840  6.430   10.267  1.00 0.00 ? 64 GLN A OE1  6  
ATOM 6443  N NE2  . GLN A 1 64 ? -9.492  4.299   9.653   1.00 0.00 ? 64 GLN A NE2  6  
ATOM 6444  H H    . GLN A 1 64 ? -8.972  6.907   5.068   1.00 0.00 ? 64 GLN A H    6  
ATOM 6445  H HA   . GLN A 1 64 ? -10.939 5.800   6.666   1.00 0.00 ? 64 GLN A HA   6  
ATOM 6446  H HB2  . GLN A 1 64 ? -8.855  7.890   7.061   1.00 0.00 ? 64 GLN A HB2  6  
ATOM 6447  H HB3  . GLN A 1 64 ? -10.103 7.743   8.291   1.00 0.00 ? 64 GLN A HB3  6  
ATOM 6448  H HG2  . GLN A 1 64 ? -8.836  5.225   7.444   1.00 0.00 ? 64 GLN A HG2  6  
ATOM 6449  H HG3  . GLN A 1 64 ? -7.802  6.360   8.311   1.00 0.00 ? 64 GLN A HG3  6  
ATOM 6450  H HE21 . GLN A 1 64 ? -9.147  3.703   8.954   1.00 0.00 ? 64 GLN A HE21 6  
ATOM 6451  H HE22 . GLN A 1 64 ? -9.880  3.980   10.494  1.00 0.00 ? 64 GLN A HE22 6  
ATOM 6452  N N    . GLY A 1 65 ? -11.482 9.042   6.565   1.00 0.00 ? 65 GLY A N    6  
ATOM 6453  C CA   . GLY A 1 65 ? -12.536 10.038  6.560   1.00 0.00 ? 65 GLY A CA   6  
ATOM 6454  C C    . GLY A 1 65 ? -12.361 11.061  5.455   1.00 0.00 ? 65 GLY A C    6  
ATOM 6455  O O    . GLY A 1 65 ? -11.751 12.110  5.661   1.00 0.00 ? 65 GLY A O    6  
ATOM 6456  H H    . GLY A 1 65 ? -10.548 9.319   6.674   1.00 0.00 ? 65 GLY A H    6  
ATOM 6457  H HA2  . GLY A 1 65 ? -13.486 9.542   6.428   1.00 0.00 ? 65 GLY A HA2  6  
ATOM 6458  H HA3  . GLY A 1 65 ? -12.538 10.548  7.511   1.00 0.00 ? 65 GLY A HA3  6  
ATOM 6459  N N    . HIS A 1 66 ? -12.898 10.756  4.277   1.00 0.00 ? 66 HIS A N    6  
ATOM 6460  C CA   . HIS A 1 66 ? -12.796 11.657  3.135   1.00 0.00 ? 66 HIS A CA   6  
ATOM 6461  C C    . HIS A 1 66 ? -14.159 11.874  2.486   1.00 0.00 ? 66 HIS A C    6  
ATOM 6462  O O    . HIS A 1 66 ? -14.907 10.923  2.260   1.00 0.00 ? 66 HIS A O    6  
ATOM 6463  C CB   . HIS A 1 66 ? -11.811 11.100  2.104   1.00 0.00 ? 66 HIS A CB   6  
ATOM 6464  C CG   . HIS A 1 66 ? -11.448 12.080  1.033   1.00 0.00 ? 66 HIS A CG   6  
ATOM 6465  N ND1  . HIS A 1 66 ? -10.155 12.504  0.806   1.00 0.00 ? 66 HIS A ND1  6  
ATOM 6466  C CD2  . HIS A 1 66 ? -12.217 12.721  0.121   1.00 0.00 ? 66 HIS A CD2  6  
ATOM 6467  C CE1  . HIS A 1 66 ? -10.145 13.363  -0.197  1.00 0.00 ? 66 HIS A CE1  6  
ATOM 6468  N NE2  . HIS A 1 66 ? -11.382 13.511  -0.630  1.00 0.00 ? 66 HIS A NE2  6  
ATOM 6469  H H    . HIS A 1 66 ? -13.371 9.905   4.174   1.00 0.00 ? 66 HIS A H    6  
ATOM 6470  H HA   . HIS A 1 66 ? -12.427 12.607  3.495   1.00 0.00 ? 66 HIS A HA   6  
ATOM 6471  H HB2  . HIS A 1 66 ? -10.902 10.805  2.607   1.00 0.00 ? 66 HIS A HB2  6  
ATOM 6472  H HB3  . HIS A 1 66 ? -12.251 10.235  1.628   1.00 0.00 ? 66 HIS A HB3  6  
ATOM 6473  H HD1  . HIS A 1 66 ? -9.363  12.218  1.307   1.00 0.00 ? 66 HIS A HD1  6  
ATOM 6474  H HD2  . HIS A 1 66 ? -13.288 12.628  0.006   1.00 0.00 ? 66 HIS A HD2  6  
ATOM 6475  H HE1  . HIS A 1 66 ? -9.272  13.859  -0.596  1.00 0.00 ? 66 HIS A HE1  6  
ATOM 6476  H HE2  . HIS A 1 66 ? -11.659 14.093  -1.368  1.00 0.00 ? 66 HIS A HE2  6  
ATOM 6477  N N    . ASP A 1 67 ? -14.472 13.131  2.188   1.00 0.00 ? 67 ASP A N    6  
ATOM 6478  C CA   . ASP A 1 67 ? -15.734 13.484  1.558   1.00 0.00 ? 67 ASP A CA   6  
ATOM 6479  C C    . ASP A 1 67 ? -15.825 14.983  1.340   1.00 0.00 ? 67 ASP A C    6  
ATOM 6480  O O    . ASP A 1 67 ? -15.382 15.776  2.169   1.00 0.00 ? 67 ASP A O    6  
ATOM 6481  C CB   . ASP A 1 67 ? -16.911 13.013  2.392   1.00 0.00 ? 67 ASP A CB   6  
ATOM 6482  C CG   . ASP A 1 67 ? -18.231 13.153  1.661   1.00 0.00 ? 67 ASP A CG   6  
ATOM 6483  O OD1  . ASP A 1 67 ? -18.328 12.673  0.512   1.00 0.00 ? 67 ASP A OD1  6  
ATOM 6484  O OD2  . ASP A 1 67 ? -19.168 13.745  2.237   1.00 0.00 ? 67 ASP A OD2  6  
ATOM 6485  H H    . ASP A 1 67 ? -13.829 13.842  2.383   1.00 0.00 ? 67 ASP A H    6  
ATOM 6486  H HA   . ASP A 1 67 ? -15.778 12.995  0.610   1.00 0.00 ? 67 ASP A HA   6  
ATOM 6487  H HB2  . ASP A 1 67 ? -16.771 11.977  2.651   1.00 0.00 ? 67 ASP A HB2  6  
ATOM 6488  H HB3  . ASP A 1 67 ? -16.950 13.601  3.281   1.00 0.00 ? 67 ASP A HB3  6  
ATOM 6489  N N    . TYR A 1 68 ? -16.398 15.358  0.211   1.00 0.00 ? 68 TYR A N    6  
ATOM 6490  C CA   . TYR A 1 68 ? -16.565 16.762  -0.133  1.00 0.00 ? 68 TYR A CA   6  
ATOM 6491  C C    . TYR A 1 68 ? -15.221 17.488  -0.098  1.00 0.00 ? 68 TYR A C    6  
ATOM 6492  O O    . TYR A 1 68 ? -14.469 17.387  -1.090  1.00 0.00 ? 68 TYR A O    6  
ATOM 6493  C CB   . TYR A 1 68 ? -17.558 17.412  0.836   1.00 0.00 ? 68 TYR A CB   6  
ATOM 6494  C CG   . TYR A 1 68 ? -17.544 18.927  0.828   1.00 0.00 ? 68 TYR A CG   6  
ATOM 6495  C CD1  . TYR A 1 68 ? -17.321 19.632  -0.348  1.00 0.00 ? 68 TYR A CD1  6  
ATOM 6496  C CD2  . TYR A 1 68 ? -17.750 19.649  1.997   1.00 0.00 ? 68 TYR A CD2  6  
ATOM 6497  C CE1  . TYR A 1 68 ? -17.306 21.014  -0.359  1.00 0.00 ? 68 TYR A CE1  6  
ATOM 6498  C CE2  . TYR A 1 68 ? -17.737 21.030  1.994   1.00 0.00 ? 68 TYR A CE2  6  
ATOM 6499  C CZ   . TYR A 1 68 ? -17.515 21.708  0.814   1.00 0.00 ? 68 TYR A CZ   6  
ATOM 6500  O OH   . TYR A 1 68 ? -17.500 23.084  0.806   1.00 0.00 ? 68 TYR A OH   6  
ATOM 6501  O OXT  . TYR A 1 68 ? -14.933 18.151  0.922   1.00 0.00 ? 68 TYR A OXT  6  
ATOM 6502  H H    . TYR A 1 68 ? -16.732 14.671  -0.395  1.00 0.00 ? 68 TYR A H    6  
ATOM 6503  H HA   . TYR A 1 68 ? -16.963 16.813  -1.136  1.00 0.00 ? 68 TYR A HA   6  
ATOM 6504  H HB2  . TYR A 1 68 ? -18.557 17.092  0.579   1.00 0.00 ? 68 TYR A HB2  6  
ATOM 6505  H HB3  . TYR A 1 68 ? -17.329 17.082  1.838   1.00 0.00 ? 68 TYR A HB3  6  
ATOM 6506  H HD1  . TYR A 1 68 ? -17.158 19.086  -1.265  1.00 0.00 ? 68 TYR A HD1  6  
ATOM 6507  H HD2  . TYR A 1 68 ? -17.924 19.115  2.919   1.00 0.00 ? 68 TYR A HD2  6  
ATOM 6508  H HE1  . TYR A 1 68 ? -17.132 21.544  -1.284  1.00 0.00 ? 68 TYR A HE1  6  
ATOM 6509  H HE2  . TYR A 1 68 ? -17.899 21.574  2.913   1.00 0.00 ? 68 TYR A HE2  6  
ATOM 6510  H HH   . TYR A 1 68 ? -18.140 23.408  0.168   1.00 0.00 ? 68 TYR A HH   6  
ATOM 6511  N N    . TYR A 1 1  ? 10.262  16.585  -3.099  1.00 0.00 ? 1  TYR A N    7  
ATOM 6512  C CA   . TYR A 1 1  ? 9.204   17.611  -2.910  1.00 0.00 ? 1  TYR A CA   7  
ATOM 6513  C C    . TYR A 1 1  ? 7.884   17.165  -3.531  1.00 0.00 ? 1  TYR A C    7  
ATOM 6514  O O    . TYR A 1 1  ? 7.861   16.333  -4.437  1.00 0.00 ? 1  TYR A O    7  
ATOM 6515  C CB   . TYR A 1 1  ? 9.674   18.918  -3.552  1.00 0.00 ? 1  TYR A CB   7  
ATOM 6516  C CG   . TYR A 1 1  ? 9.999   20.004  -2.550  1.00 0.00 ? 1  TYR A CG   7  
ATOM 6517  C CD1  . TYR A 1 1  ? 9.153   20.265  -1.480  1.00 0.00 ? 1  TYR A CD1  7  
ATOM 6518  C CD2  . TYR A 1 1  ? 11.153  20.767  -2.675  1.00 0.00 ? 1  TYR A CD2  7  
ATOM 6519  C CE1  . TYR A 1 1  ? 9.447   21.255  -0.563  1.00 0.00 ? 1  TYR A CE1  7  
ATOM 6520  C CE2  . TYR A 1 1  ? 11.454  21.760  -1.763  1.00 0.00 ? 1  TYR A CE2  7  
ATOM 6521  C CZ   . TYR A 1 1  ? 10.598  22.001  -0.708  1.00 0.00 ? 1  TYR A CZ   7  
ATOM 6522  O OH   . TYR A 1 1  ? 10.894  22.988  0.203   1.00 0.00 ? 1  TYR A OH   7  
ATOM 6523  H H1   . TYR A 1 1  ? 11.175  17.028  -2.870  1.00 0.00 ? 1  TYR A H1   7  
ATOM 6524  H H2   . TYR A 1 1  ? 10.232  16.279  -4.093  1.00 0.00 ? 1  TYR A H2   7  
ATOM 6525  H H3   . TYR A 1 1  ? 10.055  15.795  -2.456  1.00 0.00 ? 1  TYR A H3   7  
ATOM 6526  H HA   . TYR A 1 1  ? 9.061   17.766  -1.852  1.00 0.00 ? 1  TYR A HA   7  
ATOM 6527  H HB2  . TYR A 1 1  ? 10.563  18.727  -4.133  1.00 0.00 ? 1  TYR A HB2  7  
ATOM 6528  H HB3  . TYR A 1 1  ? 8.897   19.291  -4.203  1.00 0.00 ? 1  TYR A HB3  7  
ATOM 6529  H HD1  . TYR A 1 1  ? 8.252   19.680  -1.369  1.00 0.00 ? 1  TYR A HD1  7  
ATOM 6530  H HD2  . TYR A 1 1  ? 11.821  20.577  -3.502  1.00 0.00 ? 1  TYR A HD2  7  
ATOM 6531  H HE1  . TYR A 1 1  ? 8.776   21.443  0.263   1.00 0.00 ? 1  TYR A HE1  7  
ATOM 6532  H HE2  . TYR A 1 1  ? 12.356  22.343  -1.876  1.00 0.00 ? 1  TYR A HE2  7  
ATOM 6533  H HH   . TYR A 1 1  ? 10.648  22.696  1.084   1.00 0.00 ? 1  TYR A HH   7  
ATOM 6534  N N    . HIS A 1 2  ? 6.784   17.722  -3.033  1.00 0.00 ? 2  HIS A N    7  
ATOM 6535  C CA   . HIS A 1 2  ? 5.458   17.382  -3.536  1.00 0.00 ? 2  HIS A CA   7  
ATOM 6536  C C    . HIS A 1 2  ? 5.136   15.915  -3.279  1.00 0.00 ? 2  HIS A C    7  
ATOM 6537  O O    . HIS A 1 2  ? 6.013   15.129  -2.918  1.00 0.00 ? 2  HIS A O    7  
ATOM 6538  C CB   . HIS A 1 2  ? 5.365   17.679  -5.033  1.00 0.00 ? 2  HIS A CB   7  
ATOM 6539  C CG   . HIS A 1 2  ? 4.859   19.054  -5.341  1.00 0.00 ? 2  HIS A CG   7  
ATOM 6540  N ND1  . HIS A 1 2  ? 5.454   19.886  -6.268  1.00 0.00 ? 2  HIS A ND1  7  
ATOM 6541  C CD2  . HIS A 1 2  ? 3.808   19.746  -4.838  1.00 0.00 ? 2  HIS A CD2  7  
ATOM 6542  C CE1  . HIS A 1 2  ? 4.791   21.028  -6.322  1.00 0.00 ? 2  HIS A CE1  7  
ATOM 6543  N NE2  . HIS A 1 2  ? 3.790   20.967  -5.464  1.00 0.00 ? 2  HIS A NE2  7  
ATOM 6544  H H    . HIS A 1 2  ? 6.867   18.379  -2.310  1.00 0.00 ? 2  HIS A H    7  
ATOM 6545  H HA   . HIS A 1 2  ? 4.738   17.993  -3.011  1.00 0.00 ? 2  HIS A HA   7  
ATOM 6546  H HB2  . HIS A 1 2  ? 6.346   17.580  -5.474  1.00 0.00 ? 2  HIS A HB2  7  
ATOM 6547  H HB3  . HIS A 1 2  ? 4.695   16.968  -5.493  1.00 0.00 ? 2  HIS A HB3  7  
ATOM 6548  H HD1  . HIS A 1 2  ? 6.244   19.670  -6.805  1.00 0.00 ? 2  HIS A HD1  7  
ATOM 6549  H HD2  . HIS A 1 2  ? 3.115   19.400  -4.084  1.00 0.00 ? 2  HIS A HD2  7  
ATOM 6550  H HE1  . HIS A 1 2  ? 5.029   21.866  -6.959  1.00 0.00 ? 2  HIS A HE1  7  
ATOM 6551  H HE2  . HIS A 1 2  ? 3.138   21.682  -5.303  1.00 0.00 ? 2  HIS A HE2  7  
ATOM 6552  N N    . ALA A 1 3  ? 3.871   15.551  -3.466  1.00 0.00 ? 3  ALA A N    7  
ATOM 6553  C CA   . ALA A 1 3  ? 3.433   14.177  -3.256  1.00 0.00 ? 3  ALA A CA   7  
ATOM 6554  C C    . ALA A 1 3  ? 4.334   13.195  -3.997  1.00 0.00 ? 3  ALA A C    7  
ATOM 6555  O O    . ALA A 1 3  ? 4.481   13.274  -5.217  1.00 0.00 ? 3  ALA A O    7  
ATOM 6556  C CB   . ALA A 1 3  ? 1.988   14.011  -3.700  1.00 0.00 ? 3  ALA A CB   7  
ATOM 6557  H H    . ALA A 1 3  ? 3.218   16.223  -3.754  1.00 0.00 ? 3  ALA A H    7  
ATOM 6558  H HA   . ALA A 1 3  ? 3.484   13.968  -2.197  1.00 0.00 ? 3  ALA A HA   7  
ATOM 6559  H HB1  . ALA A 1 3  ? 1.442   14.920  -3.498  1.00 0.00 ? 3  ALA A HB1  7  
ATOM 6560  H HB2  . ALA A 1 3  ? 1.537   13.192  -3.159  1.00 0.00 ? 3  ALA A HB2  7  
ATOM 6561  H HB3  . ALA A 1 3  ? 1.959   13.801  -4.759  1.00 0.00 ? 3  ALA A HB3  7  
ATOM 6562  N N    . ASP A 1 4  ? 4.938   12.277  -3.252  1.00 0.00 ? 4  ASP A N    7  
ATOM 6563  C CA   . ASP A 1 4  ? 5.828   11.280  -3.838  1.00 0.00 ? 4  ASP A CA   7  
ATOM 6564  C C    . ASP A 1 4  ? 6.267   10.260  -2.791  1.00 0.00 ? 4  ASP A C    7  
ATOM 6565  O O    . ASP A 1 4  ? 5.945   9.077   -2.892  1.00 0.00 ? 4  ASP A O    7  
ATOM 6566  C CB   . ASP A 1 4  ? 7.053   11.960  -4.454  1.00 0.00 ? 4  ASP A CB   7  
ATOM 6567  C CG   . ASP A 1 4  ? 6.989   12.009  -5.968  1.00 0.00 ? 4  ASP A CG   7  
ATOM 6568  O OD1  . ASP A 1 4  ? 7.411   11.024  -6.612  1.00 0.00 ? 4  ASP A OD1  7  
ATOM 6569  O OD2  . ASP A 1 4  ? 6.520   13.031  -6.510  1.00 0.00 ? 4  ASP A OD2  7  
ATOM 6570  H H    . ASP A 1 4  ? 4.781   12.266  -2.285  1.00 0.00 ? 4  ASP A H    7  
ATOM 6571  H HA   . ASP A 1 4  ? 5.282   10.767  -4.616  1.00 0.00 ? 4  ASP A HA   7  
ATOM 6572  H HB2  . ASP A 1 4  ? 7.120   12.971  -4.083  1.00 0.00 ? 4  ASP A HB2  7  
ATOM 6573  H HB3  . ASP A 1 4  ? 7.941   11.415  -4.166  1.00 0.00 ? 4  ASP A HB3  7  
ATOM 6574  N N    . PRO A 1 5  ? 7.009   10.707  -1.762  1.00 0.00 ? 5  PRO A N    7  
ATOM 6575  C CA   . PRO A 1 5  ? 7.487   9.825   -0.693  1.00 0.00 ? 5  PRO A CA   7  
ATOM 6576  C C    . PRO A 1 5  ? 6.351   9.326   0.195   1.00 0.00 ? 5  PRO A C    7  
ATOM 6577  O O    . PRO A 1 5  ? 6.488   8.315   0.886   1.00 0.00 ? 5  PRO A O    7  
ATOM 6578  C CB   . PRO A 1 5  ? 8.442   10.714  0.106   1.00 0.00 ? 5  PRO A CB   7  
ATOM 6579  C CG   . PRO A 1 5  ? 7.979   12.105  -0.159  1.00 0.00 ? 5  PRO A CG   7  
ATOM 6580  C CD   . PRO A 1 5  ? 7.438   12.103  -1.561  1.00 0.00 ? 5  PRO A CD   7  
ATOM 6581  H HA   . PRO A 1 5  ? 8.028   8.979   -1.091  1.00 0.00 ? 5  PRO A HA   7  
ATOM 6582  H HB2  . PRO A 1 5  ? 8.374   10.467  1.156   1.00 0.00 ? 5  PRO A HB2  7  
ATOM 6583  H HB3  . PRO A 1 5  ? 9.453   10.561  -0.239  1.00 0.00 ? 5  PRO A HB3  7  
ATOM 6584  H HG2  . PRO A 1 5  ? 7.202   12.373  0.542   1.00 0.00 ? 5  PRO A HG2  7  
ATOM 6585  H HG3  . PRO A 1 5  ? 8.809   12.790  -0.078  1.00 0.00 ? 5  PRO A HG3  7  
ATOM 6586  H HD2  . PRO A 1 5  ? 6.599   12.779  -1.643  1.00 0.00 ? 5  PRO A HD2  7  
ATOM 6587  H HD3  . PRO A 1 5  ? 8.211   12.374  -2.264  1.00 0.00 ? 5  PRO A HD3  7  
ATOM 6588  N N    . SER A 1 6  ? 5.228   10.037  0.171   1.00 0.00 ? 6  SER A N    7  
ATOM 6589  C CA   . SER A 1 6  ? 4.067   9.661   0.969   1.00 0.00 ? 6  SER A CA   7  
ATOM 6590  C C    . SER A 1 6  ? 3.272   8.554   0.285   1.00 0.00 ? 6  SER A C    7  
ATOM 6591  O O    . SER A 1 6  ? 2.082   8.706   0.011   1.00 0.00 ? 6  SER A O    7  
ATOM 6592  C CB   . SER A 1 6  ? 3.168   10.877  1.204   1.00 0.00 ? 6  SER A CB   7  
ATOM 6593  O OG   . SER A 1 6  ? 2.546   10.815  2.476   1.00 0.00 ? 6  SER A OG   7  
ATOM 6594  H H    . SER A 1 6  ? 5.177   10.831  -0.401  1.00 0.00 ? 6  SER A H    7  
ATOM 6595  H HA   . SER A 1 6  ? 4.423   9.297   1.921   1.00 0.00 ? 6  SER A HA   7  
ATOM 6596  H HB2  . SER A 1 6  ? 3.764   11.778  1.154   1.00 0.00 ? 6  SER A HB2  7  
ATOM 6597  H HB3  . SER A 1 6  ? 2.403   10.910  0.443   1.00 0.00 ? 6  SER A HB3  7  
ATOM 6598  H HG   . SER A 1 6  ? 3.152   11.139  3.146   1.00 0.00 ? 6  SER A HG   7  
ATOM 6599  N N    . LEU A 1 7  ? 3.942   7.439   0.011   1.00 0.00 ? 7  LEU A N    7  
ATOM 6600  C CA   . LEU A 1 7  ? 3.307   6.303   -0.646  1.00 0.00 ? 7  LEU A CA   7  
ATOM 6601  C C    . LEU A 1 7  ? 4.202   5.070   -0.572  1.00 0.00 ? 7  LEU A C    7  
ATOM 6602  O O    . LEU A 1 7  ? 3.771   4.000   -0.143  1.00 0.00 ? 7  LEU A O    7  
ATOM 6603  C CB   . LEU A 1 7  ? 3.001   6.643   -2.109  1.00 0.00 ? 7  LEU A CB   7  
ATOM 6604  C CG   . LEU A 1 7  ? 2.572   5.462   -2.986  1.00 0.00 ? 7  LEU A CG   7  
ATOM 6605  C CD1  . LEU A 1 7  ? 3.783   4.654   -3.428  1.00 0.00 ? 7  LEU A CD1  7  
ATOM 6606  C CD2  . LEU A 1 7  ? 1.577   4.577   -2.252  1.00 0.00 ? 7  LEU A CD2  7  
ATOM 6607  H H    . LEU A 1 7  ? 4.889   7.380   0.254   1.00 0.00 ? 7  LEU A H    7  
ATOM 6608  H HA   . LEU A 1 7  ? 2.382   6.094   -0.131  1.00 0.00 ? 7  LEU A HA   7  
ATOM 6609  H HB2  . LEU A 1 7  ? 2.210   7.379   -2.125  1.00 0.00 ? 7  LEU A HB2  7  
ATOM 6610  H HB3  . LEU A 1 7  ? 3.885   7.083   -2.545  1.00 0.00 ? 7  LEU A HB3  7  
ATOM 6611  H HG   . LEU A 1 7  ? 2.087   5.841   -3.873  1.00 0.00 ? 7  LEU A HG   7  
ATOM 6612  H HD11 . LEU A 1 7  ? 3.917   3.814   -2.763  1.00 0.00 ? 7  LEU A HD11 7  
ATOM 6613  H HD12 . LEU A 1 7  ? 4.663   5.280   -3.400  1.00 0.00 ? 7  LEU A HD12 7  
ATOM 6614  H HD13 . LEU A 1 7  ? 3.629   4.295   -4.434  1.00 0.00 ? 7  LEU A HD13 7  
ATOM 6615  H HD21 . LEU A 1 7  ? 0.618   5.070   -2.211  1.00 0.00 ? 7  LEU A HD21 7  
ATOM 6616  H HD22 . LEU A 1 7  ? 1.929   4.392   -1.248  1.00 0.00 ? 7  LEU A HD22 7  
ATOM 6617  H HD23 . LEU A 1 7  ? 1.475   3.637   -2.776  1.00 0.00 ? 7  LEU A HD23 7  
ATOM 6618  N N    . VAL A 1 8  ? 5.453   5.233   -0.989  1.00 0.00 ? 8  VAL A N    7  
ATOM 6619  C CA   . VAL A 1 8  ? 6.412   4.137   -0.974  1.00 0.00 ? 8  VAL A CA   7  
ATOM 6620  C C    . VAL A 1 8  ? 6.780   3.748   0.454   1.00 0.00 ? 8  VAL A C    7  
ATOM 6621  O O    . VAL A 1 8  ? 6.932   2.566   0.766   1.00 0.00 ? 8  VAL A O    7  
ATOM 6622  C CB   . VAL A 1 8  ? 7.694   4.504   -1.741  1.00 0.00 ? 8  VAL A CB   7  
ATOM 6623  C CG1  . VAL A 1 8  ? 8.627   3.307   -1.825  1.00 0.00 ? 8  VAL A CG1  7  
ATOM 6624  C CG2  . VAL A 1 8  ? 7.354   5.025   -3.130  1.00 0.00 ? 8  VAL A CG2  7  
ATOM 6625  H H    . VAL A 1 8  ? 5.736   6.110   -1.320  1.00 0.00 ? 8  VAL A H    7  
ATOM 6626  H HA   . VAL A 1 8  ? 5.957   3.289   -1.462  1.00 0.00 ? 8  VAL A HA   7  
ATOM 6627  H HB   . VAL A 1 8  ? 8.201   5.290   -1.200  1.00 0.00 ? 8  VAL A HB   7  
ATOM 6628  H HG11 . VAL A 1 8  ? 9.120   3.167   -0.874  1.00 0.00 ? 8  VAL A HG11 7  
ATOM 6629  H HG12 . VAL A 1 8  ? 9.368   3.479   -2.592  1.00 0.00 ? 8  VAL A HG12 7  
ATOM 6630  H HG13 . VAL A 1 8  ? 8.056   2.423   -2.067  1.00 0.00 ? 8  VAL A HG13 7  
ATOM 6631  H HG21 . VAL A 1 8  ? 6.729   4.308   -3.641  1.00 0.00 ? 8  VAL A HG21 7  
ATOM 6632  H HG22 . VAL A 1 8  ? 8.264   5.175   -3.691  1.00 0.00 ? 8  VAL A HG22 7  
ATOM 6633  H HG23 . VAL A 1 8  ? 6.825   5.963   -3.043  1.00 0.00 ? 8  VAL A HG23 7  
ATOM 6634  N N    . SER A 1 9  ? 6.921   4.748   1.318   1.00 0.00 ? 9  SER A N    7  
ATOM 6635  C CA   . SER A 1 9  ? 7.271   4.508   2.713   1.00 0.00 ? 9  SER A CA   7  
ATOM 6636  C C    . SER A 1 9  ? 6.229   3.627   3.391   1.00 0.00 ? 9  SER A C    7  
ATOM 6637  O O    . SER A 1 9  ? 6.557   2.814   4.256   1.00 0.00 ? 9  SER A O    7  
ATOM 6638  C CB   . SER A 1 9  ? 7.397   5.836   3.463   1.00 0.00 ? 9  SER A CB   7  
ATOM 6639  O OG   . SER A 1 9  ? 6.215   6.608   3.340   1.00 0.00 ? 9  SER A OG   7  
ATOM 6640  H H    . SER A 1 9  ? 6.788   5.669   1.010   1.00 0.00 ? 9  SER A H    7  
ATOM 6641  H HA   . SER A 1 9  ? 8.223   4.000   2.733   1.00 0.00 ? 9  SER A HA   7  
ATOM 6642  H HB2  . SER A 1 9  ? 7.578   5.639   4.509   1.00 0.00 ? 9  SER A HB2  7  
ATOM 6643  H HB3  . SER A 1 9  ? 8.224   6.399   3.055   1.00 0.00 ? 9  SER A HB3  7  
ATOM 6644  H HG   . SER A 1 9  ? 6.348   7.465   3.751   1.00 0.00 ? 9  SER A HG   7  
ATOM 6645  N N    . PHE A 1 10 ? 4.971   3.792   2.992   1.00 0.00 ? 10 PHE A N    7  
ATOM 6646  C CA   . PHE A 1 10 ? 3.882   3.007   3.560   1.00 0.00 ? 10 PHE A CA   7  
ATOM 6647  C C    . PHE A 1 10 ? 3.716   1.690   2.814   1.00 0.00 ? 10 PHE A C    7  
ATOM 6648  O O    . PHE A 1 10 ? 3.548   0.635   3.426   1.00 0.00 ? 10 PHE A O    7  
ATOM 6649  C CB   . PHE A 1 10 ? 2.575   3.801   3.514   1.00 0.00 ? 10 PHE A CB   7  
ATOM 6650  C CG   . PHE A 1 10 ? 2.038   4.155   4.872   1.00 0.00 ? 10 PHE A CG   7  
ATOM 6651  C CD1  . PHE A 1 10 ? 1.183   3.294   5.540   1.00 0.00 ? 10 PHE A CD1  7  
ATOM 6652  C CD2  . PHE A 1 10 ? 2.387   5.351   5.478   1.00 0.00 ? 10 PHE A CD2  7  
ATOM 6653  C CE1  . PHE A 1 10 ? 0.686   3.618   6.789   1.00 0.00 ? 10 PHE A CE1  7  
ATOM 6654  C CE2  . PHE A 1 10 ? 1.894   5.681   6.726   1.00 0.00 ? 10 PHE A CE2  7  
ATOM 6655  C CZ   . PHE A 1 10 ? 1.042   4.814   7.382   1.00 0.00 ? 10 PHE A CZ   7  
ATOM 6656  H H    . PHE A 1 10 ? 4.774   4.454   2.298   1.00 0.00 ? 10 PHE A H    7  
ATOM 6657  H HA   . PHE A 1 10 ? 4.131   2.793   4.589   1.00 0.00 ? 10 PHE A HA   7  
ATOM 6658  H HB2  . PHE A 1 10 ? 2.739   4.721   2.973   1.00 0.00 ? 10 PHE A HB2  7  
ATOM 6659  H HB3  . PHE A 1 10 ? 1.825   3.217   3.003   1.00 0.00 ? 10 PHE A HB3  7  
ATOM 6660  H HD1  . PHE A 1 10 ? 0.903   2.358   5.077   1.00 0.00 ? 10 PHE A HD1  7  
ATOM 6661  H HD2  . PHE A 1 10 ? 3.052   6.030   4.966   1.00 0.00 ? 10 PHE A HD2  7  
ATOM 6662  H HE1  . PHE A 1 10 ? 0.020   2.937   7.299   1.00 0.00 ? 10 PHE A HE1  7  
ATOM 6663  H HE2  . PHE A 1 10 ? 2.173   6.617   7.188   1.00 0.00 ? 10 PHE A HE2  7  
ATOM 6664  H HZ   . PHE A 1 10 ? 0.655   5.069   8.357   1.00 0.00 ? 10 PHE A HZ   7  
ATOM 6665  N N    . LEU A 1 11 ? 3.775   1.754   1.485   1.00 0.00 ? 11 LEU A N    7  
ATOM 6666  C CA   . LEU A 1 11 ? 3.639   0.563   0.653   1.00 0.00 ? 11 LEU A CA   7  
ATOM 6667  C C    . LEU A 1 11 ? 4.535   -0.559  1.161   1.00 0.00 ? 11 LEU A C    7  
ATOM 6668  O O    . LEU A 1 11 ? 4.076   -1.676  1.403   1.00 0.00 ? 11 LEU A O    7  
ATOM 6669  C CB   . LEU A 1 11 ? 3.998   0.892   -0.796  1.00 0.00 ? 11 LEU A CB   7  
ATOM 6670  C CG   . LEU A 1 11 ? 3.445   -0.083  -1.839  1.00 0.00 ? 11 LEU A CG   7  
ATOM 6671  C CD1  . LEU A 1 11 ? 4.187   -1.409  -1.775  1.00 0.00 ? 11 LEU A CD1  7  
ATOM 6672  C CD2  . LEU A 1 11 ? 1.953   -0.292  -1.634  1.00 0.00 ? 11 LEU A CD2  7  
ATOM 6673  H H    . LEU A 1 11 ? 3.915   2.623   1.055   1.00 0.00 ? 11 LEU A H    7  
ATOM 6674  H HA   . LEU A 1 11 ? 2.613   0.239   0.699   1.00 0.00 ? 11 LEU A HA   7  
ATOM 6675  H HB2  . LEU A 1 11 ? 3.623   1.879   -1.023  1.00 0.00 ? 11 LEU A HB2  7  
ATOM 6676  H HB3  . LEU A 1 11 ? 5.074   0.907   -0.882  1.00 0.00 ? 11 LEU A HB3  7  
ATOM 6677  H HG   . LEU A 1 11 ? 3.592   0.333   -2.825  1.00 0.00 ? 11 LEU A HG   7  
ATOM 6678  H HD11 . LEU A 1 11 ? 4.311   -1.801  -2.774  1.00 0.00 ? 11 LEU A HD11 7  
ATOM 6679  H HD12 . LEU A 1 11 ? 3.620   -2.110  -1.181  1.00 0.00 ? 11 LEU A HD12 7  
ATOM 6680  H HD13 . LEU A 1 11 ? 5.157   -1.258  -1.325  1.00 0.00 ? 11 LEU A HD13 7  
ATOM 6681  H HD21 . LEU A 1 11 ? 1.796   -1.072  -0.903  1.00 0.00 ? 11 LEU A HD21 7  
ATOM 6682  H HD22 . LEU A 1 11 ? 1.498   -0.582  -2.570  1.00 0.00 ? 11 LEU A HD22 7  
ATOM 6683  H HD23 . LEU A 1 11 ? 1.504   0.625   -1.285  1.00 0.00 ? 11 LEU A HD23 7  
ATOM 6684  N N    . THR A 1 12 ? 5.811   -0.247  1.327   1.00 0.00 ? 12 THR A N    7  
ATOM 6685  C CA   . THR A 1 12 ? 6.781   -1.216  1.819   1.00 0.00 ? 12 THR A CA   7  
ATOM 6686  C C    . THR A 1 12 ? 6.619   -1.423  3.321   1.00 0.00 ? 12 THR A C    7  
ATOM 6687  O O    . THR A 1 12 ? 6.518   -2.556  3.796   1.00 0.00 ? 12 THR A O    7  
ATOM 6688  C CB   . THR A 1 12 ? 8.202   -0.743  1.506   1.00 0.00 ? 12 THR A CB   7  
ATOM 6689  O OG1  . THR A 1 12 ? 8.414   -0.687  0.106   1.00 0.00 ? 12 THR A OG1  7  
ATOM 6690  C CG2  . THR A 1 12 ? 9.274   -1.630  2.098   1.00 0.00 ? 12 THR A CG2  7  
ATOM 6691  H H    . THR A 1 12 ? 6.108   0.663   1.121   1.00 0.00 ? 12 THR A H    7  
ATOM 6692  H HA   . THR A 1 12 ? 6.600   -2.154  1.315   1.00 0.00 ? 12 THR A HA   7  
ATOM 6693  H HB   . THR A 1 12 ? 8.338   0.250   1.910   1.00 0.00 ? 12 THR A HB   7  
ATOM 6694  H HG1  . THR A 1 12 ? 8.784   0.168   -0.129  1.00 0.00 ? 12 THR A HG1  7  
ATOM 6695  H HG21 . THR A 1 12 ? 10.032  -1.824  1.353   1.00 0.00 ? 12 THR A HG21 7  
ATOM 6696  H HG22 . THR A 1 12 ? 8.833   -2.564  2.415   1.00 0.00 ? 12 THR A HG22 7  
ATOM 6697  H HG23 . THR A 1 12 ? 9.721   -1.136  2.948   1.00 0.00 ? 12 THR A HG23 7  
ATOM 6698  N N    . GLY A 1 13 ? 6.585   -0.317  4.062   1.00 0.00 ? 13 GLY A N    7  
ATOM 6699  C CA   . GLY A 1 13 ? 6.426   -0.392  5.504   1.00 0.00 ? 13 GLY A CA   7  
ATOM 6700  C C    . GLY A 1 13 ? 5.234   -1.232  5.908   1.00 0.00 ? 13 GLY A C    7  
ATOM 6701  O O    . GLY A 1 13 ? 5.184   -1.764  7.017   1.00 0.00 ? 13 GLY A O    7  
ATOM 6702  H H    . GLY A 1 13 ? 6.659   0.556   3.623   1.00 0.00 ? 13 GLY A H    7  
ATOM 6703  H HA2  . GLY A 1 13 ? 7.319   -0.822  5.933   1.00 0.00 ? 13 GLY A HA2  7  
ATOM 6704  H HA3  . GLY A 1 13 ? 6.298   0.607   5.893   1.00 0.00 ? 13 GLY A HA3  7  
ATOM 6705  N N    . LEU A 1 14 ? 4.273   -1.355  5.000   1.00 0.00 ? 14 LEU A N    7  
ATOM 6706  C CA   . LEU A 1 14 ? 3.080   -2.148  5.246   1.00 0.00 ? 14 LEU A CA   7  
ATOM 6707  C C    . LEU A 1 14 ? 3.437   -3.599  5.559   1.00 0.00 ? 14 LEU A C    7  
ATOM 6708  O O    . LEU A 1 14 ? 2.627   -4.340  6.116   1.00 0.00 ? 14 LEU A O    7  
ATOM 6709  C CB   . LEU A 1 14 ? 2.174   -2.089  4.014   1.00 0.00 ? 14 LEU A CB   7  
ATOM 6710  C CG   . LEU A 1 14 ? 0.688   -1.863  4.293   1.00 0.00 ? 14 LEU A CG   7  
ATOM 6711  C CD1  . LEU A 1 14 ? 0.492   -0.768  5.331   1.00 0.00 ? 14 LEU A CD1  7  
ATOM 6712  C CD2  . LEU A 1 14 ? -0.035  -1.510  3.004   1.00 0.00 ? 14 LEU A CD2  7  
ATOM 6713  H H    . LEU A 1 14 ? 4.375   -0.915  4.132   1.00 0.00 ? 14 LEU A H    7  
ATOM 6714  H HA   . LEU A 1 14 ? 2.566   -1.724  6.093   1.00 0.00 ? 14 LEU A HA   7  
ATOM 6715  H HB2  . LEU A 1 14 ? 2.522   -1.289  3.380   1.00 0.00 ? 14 LEU A HB2  7  
ATOM 6716  H HB3  . LEU A 1 14 ? 2.281   -3.018  3.477   1.00 0.00 ? 14 LEU A HB3  7  
ATOM 6717  H HG   . LEU A 1 14 ? 0.259   -2.773  4.681   1.00 0.00 ? 14 LEU A HG   7  
ATOM 6718  H HD11 . LEU A 1 14 ? -0.448  -0.268  5.154   1.00 0.00 ? 14 LEU A HD11 7  
ATOM 6719  H HD12 . LEU A 1 14 ? 1.299   -0.054  5.257   1.00 0.00 ? 14 LEU A HD12 7  
ATOM 6720  H HD13 . LEU A 1 14 ? 0.489   -1.205  6.318   1.00 0.00 ? 14 LEU A HD13 7  
ATOM 6721  H HD21 . LEU A 1 14 ? 0.348   -2.122  2.198   1.00 0.00 ? 14 LEU A HD21 7  
ATOM 6722  H HD22 . LEU A 1 14 ? 0.130   -0.468  2.773   1.00 0.00 ? 14 LEU A HD22 7  
ATOM 6723  H HD23 . LEU A 1 14 ? -1.093  -1.690  3.123   1.00 0.00 ? 14 LEU A HD23 7  
ATOM 6724  N N    . GLY A 1 15 ? 4.654   -3.999  5.196   1.00 0.00 ? 15 GLY A N    7  
ATOM 6725  C CA   . GLY A 1 15 ? 5.089   -5.359  5.435   1.00 0.00 ? 15 GLY A CA   7  
ATOM 6726  C C    . GLY A 1 15 ? 5.443   -6.092  4.153   1.00 0.00 ? 15 GLY A C    7  
ATOM 6727  O O    . GLY A 1 15 ? 5.614   -7.310  4.158   1.00 0.00 ? 15 GLY A O    7  
ATOM 6728  H H    . GLY A 1 15 ? 5.255   -3.369  4.749   1.00 0.00 ? 15 GLY A H    7  
ATOM 6729  H HA2  . GLY A 1 15 ? 5.960   -5.339  6.075   1.00 0.00 ? 15 GLY A HA2  7  
ATOM 6730  H HA3  . GLY A 1 15 ? 4.299   -5.896  5.937   1.00 0.00 ? 15 GLY A HA3  7  
ATOM 6731  N N    . CYS A 1 16 ? 5.553   -5.350  3.051   1.00 0.00 ? 16 CYS A N    7  
ATOM 6732  C CA   . CYS A 1 16 ? 5.884   -5.950  1.764   1.00 0.00 ? 16 CYS A CA   7  
ATOM 6733  C C    . CYS A 1 16 ? 6.996   -5.173  1.065   1.00 0.00 ? 16 CYS A C    7  
ATOM 6734  O O    . CYS A 1 16 ? 6.738   -4.403  0.139   1.00 0.00 ? 16 CYS A O    7  
ATOM 6735  C CB   . CYS A 1 16 ? 4.645   -6.003  0.869   1.00 0.00 ? 16 CYS A CB   7  
ATOM 6736  S SG   . CYS A 1 16 ? 3.112   -6.388  1.749   1.00 0.00 ? 16 CYS A SG   7  
ATOM 6737  H H    . CYS A 1 16 ? 5.405   -4.382  3.103   1.00 0.00 ? 16 CYS A H    7  
ATOM 6738  H HA   . CYS A 1 16 ? 6.229   -6.958  1.948   1.00 0.00 ? 16 CYS A HA   7  
ATOM 6739  H HB2  . CYS A 1 16 ? 4.516   -5.045  0.389   1.00 0.00 ? 16 CYS A HB2  7  
ATOM 6740  H HB3  . CYS A 1 16 ? 4.789   -6.763  0.115   1.00 0.00 ? 16 CYS A HB3  7  
ATOM 6741  H HG   . CYS A 1 16 ? 2.808   -5.585  2.178   1.00 0.00 ? 16 CYS A HG   7  
ATOM 6742  N N    . PRO A 1 17 ? 8.254   -5.371  1.493   1.00 0.00 ? 17 PRO A N    7  
ATOM 6743  C CA   . PRO A 1 17 ? 9.406   -4.688  0.904   1.00 0.00 ? 17 PRO A CA   7  
ATOM 6744  C C    . PRO A 1 17 ? 9.873   -5.327  -0.402  1.00 0.00 ? 17 PRO A C    7  
ATOM 6745  O O    . PRO A 1 17 ? 10.885  -4.919  -0.972  1.00 0.00 ? 17 PRO A O    7  
ATOM 6746  C CB   . PRO A 1 17 ? 10.476  -4.837  1.983   1.00 0.00 ? 17 PRO A CB   7  
ATOM 6747  C CG   . PRO A 1 17 ? 10.153  -6.133  2.644   1.00 0.00 ? 17 PRO A CG   7  
ATOM 6748  C CD   . PRO A 1 17 ? 8.652   -6.273  2.594   1.00 0.00 ? 17 PRO A CD   7  
ATOM 6749  H HA   . PRO A 1 17 ? 9.202   -3.640  0.738   1.00 0.00 ? 17 PRO A HA   7  
ATOM 6750  H HB2  . PRO A 1 17 ? 11.454  -4.857  1.525   1.00 0.00 ? 17 PRO A HB2  7  
ATOM 6751  H HB3  . PRO A 1 17 ? 10.411  -4.011  2.676   1.00 0.00 ? 17 PRO A HB3  7  
ATOM 6752  H HG2  . PRO A 1 17 ? 10.623  -6.944  2.107   1.00 0.00 ? 17 PRO A HG2  7  
ATOM 6753  H HG3  . PRO A 1 17 ? 10.493  -6.115  3.670   1.00 0.00 ? 17 PRO A HG3  7  
ATOM 6754  H HD2  . PRO A 1 17 ? 8.377   -7.293  2.374   1.00 0.00 ? 17 PRO A HD2  7  
ATOM 6755  H HD3  . PRO A 1 17 ? 8.214   -5.955  3.528   1.00 0.00 ? 17 PRO A HD3  7  
ATOM 6756  N N    . ASN A 1 18 ? 9.138   -6.330  -0.877  1.00 0.00 ? 18 ASN A N    7  
ATOM 6757  C CA   . ASN A 1 18 ? 9.490   -7.011  -2.116  1.00 0.00 ? 18 ASN A CA   7  
ATOM 6758  C C    . ASN A 1 18 ? 8.268   -7.197  -3.010  1.00 0.00 ? 18 ASN A C    7  
ATOM 6759  O O    . ASN A 1 18 ? 8.263   -8.050  -3.898  1.00 0.00 ? 18 ASN A O    7  
ATOM 6760  C CB   . ASN A 1 18 ? 10.124  -8.370  -1.812  1.00 0.00 ? 18 ASN A CB   7  
ATOM 6761  C CG   . ASN A 1 18 ? 11.448  -8.562  -2.526  1.00 0.00 ? 18 ASN A CG   7  
ATOM 6762  O OD1  . ASN A 1 18 ? 11.485  -8.863  -3.719  1.00 0.00 ? 18 ASN A OD1  7  
ATOM 6763  N ND2  . ASN A 1 18 ? 12.544  -8.389  -1.796  1.00 0.00 ? 18 ASN A ND2  7  
ATOM 6764  H H    . ASN A 1 18 ? 8.339   -6.616  -0.386  1.00 0.00 ? 18 ASN A H    7  
ATOM 6765  H HA   . ASN A 1 18 ? 10.210  -6.397  -2.638  1.00 0.00 ? 18 ASN A HA   7  
ATOM 6766  H HB2  . ASN A 1 18 ? 10.295  -8.451  -0.749  1.00 0.00 ? 18 ASN A HB2  7  
ATOM 6767  H HB3  . ASN A 1 18 ? 9.450   -9.153  -2.126  1.00 0.00 ? 18 ASN A HB3  7  
ATOM 6768  H HD21 . ASN A 1 18 ? 12.437  -8.151  -0.851  1.00 0.00 ? 18 ASN A HD21 7  
ATOM 6769  H HD22 . ASN A 1 18 ? 13.413  -8.507  -2.232  1.00 0.00 ? 18 ASN A HD22 7  
ATOM 6770  N N    . CYS A 1 19 ? 7.234   -6.395  -2.774  1.00 0.00 ? 19 CYS A N    7  
ATOM 6771  C CA   . CYS A 1 19 ? 6.010   -6.478  -3.562  1.00 0.00 ? 19 CYS A CA   7  
ATOM 6772  C C    . CYS A 1 19 ? 5.801   -5.209  -4.381  1.00 0.00 ? 19 CYS A C    7  
ATOM 6773  O O    . CYS A 1 19 ? 5.188   -5.243  -5.448  1.00 0.00 ? 19 CYS A O    7  
ATOM 6774  C CB   . CYS A 1 19 ? 4.803   -6.714  -2.652  1.00 0.00 ? 19 CYS A CB   7  
ATOM 6775  S SG   . CYS A 1 19 ? 4.527   -8.450  -2.231  1.00 0.00 ? 19 CYS A SG   7  
ATOM 6776  H H    . CYS A 1 19 ? 7.293   -5.733  -2.054  1.00 0.00 ? 19 CYS A H    7  
ATOM 6777  H HA   . CYS A 1 19 ? 6.111   -7.312  -4.238  1.00 0.00 ? 19 CYS A HA   7  
ATOM 6778  H HB2  . CYS A 1 19 ? 4.945   -6.171  -1.730  1.00 0.00 ? 19 CYS A HB2  7  
ATOM 6779  H HB3  . CYS A 1 19 ? 3.914   -6.352  -3.146  1.00 0.00 ? 19 CYS A HB3  7  
ATOM 6780  H HG   . CYS A 1 19 ? 5.304   -8.947  -2.497  1.00 0.00 ? 19 CYS A HG   7  
ATOM 6781  N N    . ILE A 1 20 ? 6.318   -4.090  -3.881  1.00 0.00 ? 20 ILE A N    7  
ATOM 6782  C CA   . ILE A 1 20 ? 6.187   -2.811  -4.571  1.00 0.00 ? 20 ILE A CA   7  
ATOM 6783  C C    . ILE A 1 20 ? 6.547   -2.945  -6.048  1.00 0.00 ? 20 ILE A C    7  
ATOM 6784  O O    . ILE A 1 20 ? 5.851   -2.420  -6.915  1.00 0.00 ? 20 ILE A O    7  
ATOM 6785  C CB   . ILE A 1 20 ? 7.080   -1.732  -3.934  1.00 0.00 ? 20 ILE A CB   7  
ATOM 6786  C CG1  . ILE A 1 20 ? 6.918   -0.402  -4.675  1.00 0.00 ? 20 ILE A CG1  7  
ATOM 6787  C CG2  . ILE A 1 20 ? 8.532   -2.178  -3.949  1.00 0.00 ? 20 ILE A CG2  7  
ATOM 6788  C CD1  . ILE A 1 20 ? 6.845   0.801   -3.761  1.00 0.00 ? 20 ILE A CD1  7  
ATOM 6789  H H    . ILE A 1 20 ? 6.796   -4.124  -3.027  1.00 0.00 ? 20 ILE A H    7  
ATOM 6790  H HA   . ILE A 1 20 ? 5.159   -2.491  -4.488  1.00 0.00 ? 20 ILE A HA   7  
ATOM 6791  H HB   . ILE A 1 20 ? 6.778   -1.605  -2.904  1.00 0.00 ? 20 ILE A HB   7  
ATOM 6792  H HG12 . ILE A 1 20 ? 7.759   -0.262  -5.337  1.00 0.00 ? 20 ILE A HG12 7  
ATOM 6793  H HG13 . ILE A 1 20 ? 6.008   -0.431  -5.256  1.00 0.00 ? 20 ILE A HG13 7  
ATOM 6794  H HG21 . ILE A 1 20 ? 8.581   -3.246  -3.790  1.00 0.00 ? 20 ILE A HG21 7  
ATOM 6795  H HG22 . ILE A 1 20 ? 9.075   -1.672  -3.165  1.00 0.00 ? 20 ILE A HG22 7  
ATOM 6796  H HG23 . ILE A 1 20 ? 8.971   -1.936  -4.906  1.00 0.00 ? 20 ILE A HG23 7  
ATOM 6797  H HD11 . ILE A 1 20 ? 6.457   1.648   -4.311  1.00 0.00 ? 20 ILE A HD11 7  
ATOM 6798  H HD12 . ILE A 1 20 ? 7.832   1.033   -3.393  1.00 0.00 ? 20 ILE A HD12 7  
ATOM 6799  H HD13 . ILE A 1 20 ? 6.193   0.583   -2.928  1.00 0.00 ? 20 ILE A HD13 7  
ATOM 6800  N N    . GLU A 1 21 ? 7.637   -3.652  -6.327  1.00 0.00 ? 21 GLU A N    7  
ATOM 6801  C CA   . GLU A 1 21 ? 8.083   -3.857  -7.701  1.00 0.00 ? 21 GLU A CA   7  
ATOM 6802  C C    . GLU A 1 21 ? 6.934   -4.347  -8.576  1.00 0.00 ? 21 GLU A C    7  
ATOM 6803  O O    . GLU A 1 21 ? 6.738   -3.862  -9.691  1.00 0.00 ? 21 GLU A O    7  
ATOM 6804  C CB   . GLU A 1 21 ? 9.234   -4.863  -7.739  1.00 0.00 ? 21 GLU A CB   7  
ATOM 6805  C CG   . GLU A 1 21 ? 10.471  -4.399  -6.988  1.00 0.00 ? 21 GLU A CG   7  
ATOM 6806  C CD   . GLU A 1 21 ? 11.634  -4.093  -7.910  1.00 0.00 ? 21 GLU A CD   7  
ATOM 6807  O OE1  . GLU A 1 21 ? 12.414  -5.023  -8.210  1.00 0.00 ? 21 GLU A OE1  7  
ATOM 6808  O OE2  . GLU A 1 21 ? 11.768  -2.926  -8.333  1.00 0.00 ? 21 GLU A OE2  7  
ATOM 6809  H H    . GLU A 1 21 ? 8.150   -4.049  -5.593  1.00 0.00 ? 21 GLU A H    7  
ATOM 6810  H HA   . GLU A 1 21 ? 8.431   -2.908  -8.081  1.00 0.00 ? 21 GLU A HA   7  
ATOM 6811  H HB2  . GLU A 1 21 ? 8.899   -5.792  -7.302  1.00 0.00 ? 21 GLU A HB2  7  
ATOM 6812  H HB3  . GLU A 1 21 ? 9.509   -5.039  -8.769  1.00 0.00 ? 21 GLU A HB3  7  
ATOM 6813  H HG2  . GLU A 1 21 ? 10.226  -3.504  -6.435  1.00 0.00 ? 21 GLU A HG2  7  
ATOM 6814  H HG3  . GLU A 1 21 ? 10.771  -5.175  -6.300  1.00 0.00 ? 21 GLU A HG3  7  
ATOM 6815  N N    . TYR A 1 22 ? 6.171   -5.305  -8.058  1.00 0.00 ? 22 TYR A N    7  
ATOM 6816  C CA   . TYR A 1 22 ? 5.028   -5.847  -8.783  1.00 0.00 ? 22 TYR A CA   7  
ATOM 6817  C C    . TYR A 1 22 ? 3.868   -4.858  -8.770  1.00 0.00 ? 22 TYR A C    7  
ATOM 6818  O O    . TYR A 1 22 ? 3.099   -4.773  -9.727  1.00 0.00 ? 22 TYR A O    7  
ATOM 6819  C CB   . TYR A 1 22 ? 4.589   -7.176  -8.167  1.00 0.00 ? 22 TYR A CB   7  
ATOM 6820  C CG   . TYR A 1 22 ? 5.689   -8.211  -8.117  1.00 0.00 ? 22 TYR A CG   7  
ATOM 6821  C CD1  . TYR A 1 22 ? 6.655   -8.178  -7.120  1.00 0.00 ? 22 TYR A CD1  7  
ATOM 6822  C CD2  . TYR A 1 22 ? 5.767   -9.216  -9.073  1.00 0.00 ? 22 TYR A CD2  7  
ATOM 6823  C CE1  . TYR A 1 22 ? 7.665   -9.119  -7.073  1.00 0.00 ? 22 TYR A CE1  7  
ATOM 6824  C CE2  . TYR A 1 22 ? 6.773   -10.161 -9.033  1.00 0.00 ? 22 TYR A CE2  7  
ATOM 6825  C CZ   . TYR A 1 22 ? 7.719   -10.109 -8.032  1.00 0.00 ? 22 TYR A CZ   7  
ATOM 6826  O OH   . TYR A 1 22 ? 8.724   -11.049 -7.988  1.00 0.00 ? 22 TYR A OH   7  
ATOM 6827  H H    . TYR A 1 22 ? 6.373   -5.643  -7.161  1.00 0.00 ? 22 TYR A H    7  
ATOM 6828  H HA   . TYR A 1 22 ? 5.331   -6.014  -9.805  1.00 0.00 ? 22 TYR A HA   7  
ATOM 6829  H HB2  . TYR A 1 22 ? 4.250   -7.003  -7.156  1.00 0.00 ? 22 TYR A HB2  7  
ATOM 6830  H HB3  . TYR A 1 22 ? 3.776   -7.584  -8.749  1.00 0.00 ? 22 TYR A HB3  7  
ATOM 6831  H HD1  . TYR A 1 22 ? 6.610   -7.402  -6.370  1.00 0.00 ? 22 TYR A HD1  7  
ATOM 6832  H HD2  . TYR A 1 22 ? 5.024   -9.254  -9.856  1.00 0.00 ? 22 TYR A HD2  7  
ATOM 6833  H HE1  . TYR A 1 22 ? 8.405   -9.078  -6.289  1.00 0.00 ? 22 TYR A HE1  7  
ATOM 6834  H HE2  . TYR A 1 22 ? 6.815   -10.936 -9.784  1.00 0.00 ? 22 TYR A HE2  7  
ATOM 6835  H HH   . TYR A 1 22 ? 9.552   -10.622 -7.756  1.00 0.00 ? 22 TYR A HH   7  
ATOM 6836  N N    . PHE A 1 23 ? 3.758   -4.103  -7.682  1.00 0.00 ? 23 PHE A N    7  
ATOM 6837  C CA   . PHE A 1 23 ? 2.709   -3.103  -7.547  1.00 0.00 ? 23 PHE A CA   7  
ATOM 6838  C C    . PHE A 1 23 ? 2.947   -1.944  -8.507  1.00 0.00 ? 23 PHE A C    7  
ATOM 6839  O O    . PHE A 1 23 ? 2.056   -1.560  -9.266  1.00 0.00 ? 23 PHE A O    7  
ATOM 6840  C CB   . PHE A 1 23 ? 2.658   -2.585  -6.109  1.00 0.00 ? 23 PHE A CB   7  
ATOM 6841  C CG   . PHE A 1 23 ? 1.885   -3.473  -5.177  1.00 0.00 ? 23 PHE A CG   7  
ATOM 6842  C CD1  . PHE A 1 23 ? 2.098   -4.841  -5.169  1.00 0.00 ? 23 PHE A CD1  7  
ATOM 6843  C CD2  . PHE A 1 23 ? 0.943   -2.939  -4.315  1.00 0.00 ? 23 PHE A CD2  7  
ATOM 6844  C CE1  . PHE A 1 23 ? 1.385   -5.662  -4.317  1.00 0.00 ? 23 PHE A CE1  7  
ATOM 6845  C CE2  . PHE A 1 23 ? 0.228   -3.754  -3.458  1.00 0.00 ? 23 PHE A CE2  7  
ATOM 6846  C CZ   . PHE A 1 23 ? 0.449   -5.117  -3.459  1.00 0.00 ? 23 PHE A CZ   7  
ATOM 6847  H H    . PHE A 1 23 ? 4.407   -4.215  -6.956  1.00 0.00 ? 23 PHE A H    7  
ATOM 6848  H HA   . PHE A 1 23 ? 1.767   -3.573  -7.789  1.00 0.00 ? 23 PHE A HA   7  
ATOM 6849  H HB2  . PHE A 1 23 ? 3.665   -2.499  -5.728  1.00 0.00 ? 23 PHE A HB2  7  
ATOM 6850  H HB3  . PHE A 1 23 ? 2.192   -1.612  -6.101  1.00 0.00 ? 23 PHE A HB3  7  
ATOM 6851  H HD1  . PHE A 1 23 ? 2.829   -5.268  -5.840  1.00 0.00 ? 23 PHE A HD1  7  
ATOM 6852  H HD2  . PHE A 1 23 ? 0.771   -1.873  -4.311  1.00 0.00 ? 23 PHE A HD2  7  
ATOM 6853  H HE1  . PHE A 1 23 ? 1.560   -6.727  -4.319  1.00 0.00 ? 23 PHE A HE1  7  
ATOM 6854  H HE2  . PHE A 1 23 ? -0.504  -3.324  -2.791  1.00 0.00 ? 23 PHE A HE2  7  
ATOM 6855  H HZ   . PHE A 1 23 ? -0.110  -5.756  -2.791  1.00 0.00 ? 23 PHE A HZ   7  
ATOM 6856  N N    . THR A 1 24 ? 4.159   -1.398  -8.478  1.00 0.00 ? 24 THR A N    7  
ATOM 6857  C CA   . THR A 1 24 ? 4.519   -0.283  -9.347  1.00 0.00 ? 24 THR A CA   7  
ATOM 6858  C C    . THR A 1 24 ? 4.336   -0.650  -10.817 1.00 0.00 ? 24 THR A C    7  
ATOM 6859  O O    . THR A 1 24 ? 4.086   0.217   -11.654 1.00 0.00 ? 24 THR A O    7  
ATOM 6860  C CB   . THR A 1 24 ? 5.966   0.141   -9.097  1.00 0.00 ? 24 THR A CB   7  
ATOM 6861  O OG1  . THR A 1 24 ? 6.856   -0.921  -9.388  1.00 0.00 ? 24 THR A OG1  7  
ATOM 6862  C CG2  . THR A 1 24 ? 6.222   0.581   -7.674  1.00 0.00 ? 24 THR A CG2  7  
ATOM 6863  H H    . THR A 1 24 ? 4.827   -1.748  -7.847  1.00 0.00 ? 24 THR A H    7  
ATOM 6864  H HA   . THR A 1 24 ? 3.867   0.544   -9.112  1.00 0.00 ? 24 THR A HA   7  
ATOM 6865  H HB   . THR A 1 24 ? 6.204   0.972   -9.745  1.00 0.00 ? 24 THR A HB   7  
ATOM 6866  H HG1  . THR A 1 24 ? 6.757   -1.612  -8.729  1.00 0.00 ? 24 THR A HG1  7  
ATOM 6867  H HG21 . THR A 1 24 ? 5.293   0.577   -7.123  1.00 0.00 ? 24 THR A HG21 7  
ATOM 6868  H HG22 . THR A 1 24 ? 6.636   1.579   -7.674  1.00 0.00 ? 24 THR A HG22 7  
ATOM 6869  H HG23 . THR A 1 24 ? 6.920   -0.098  -7.208  1.00 0.00 ? 24 THR A HG23 7  
ATOM 6870  N N    . SER A 1 25 ? 4.466   -1.937  -11.124 1.00 0.00 ? 25 SER A N    7  
ATOM 6871  C CA   . SER A 1 25 ? 4.327   -2.417  -12.496 1.00 0.00 ? 25 SER A CA   7  
ATOM 6872  C C    . SER A 1 25 ? 3.081   -1.836  -13.162 1.00 0.00 ? 25 SER A C    7  
ATOM 6873  O O    . SER A 1 25 ? 3.034   -1.678  -14.382 1.00 0.00 ? 25 SER A O    7  
ATOM 6874  C CB   . SER A 1 25 ? 4.265   -3.945  -12.518 1.00 0.00 ? 25 SER A CB   7  
ATOM 6875  O OG   . SER A 1 25 ? 3.924   -4.426  -13.808 1.00 0.00 ? 25 SER A OG   7  
ATOM 6876  H H    . SER A 1 25 ? 4.671   -2.579  -10.412 1.00 0.00 ? 25 SER A H    7  
ATOM 6877  H HA   . SER A 1 25 ? 5.196   -2.093  -13.048 1.00 0.00 ? 25 SER A HA   7  
ATOM 6878  H HB2  . SER A 1 25 ? 5.228   -4.347  -12.241 1.00 0.00 ? 25 SER A HB2  7  
ATOM 6879  H HB3  . SER A 1 25 ? 3.518   -4.283  -11.815 1.00 0.00 ? 25 SER A HB3  7  
ATOM 6880  H HG   . SER A 1 25 ? 4.276   -3.832  -14.475 1.00 0.00 ? 25 SER A HG   7  
ATOM 6881  N N    . GLN A 1 26 ? 2.077   -1.516  -12.352 1.00 0.00 ? 26 GLN A N    7  
ATOM 6882  C CA   . GLN A 1 26 ? 0.834   -0.949  -12.865 1.00 0.00 ? 26 GLN A CA   7  
ATOM 6883  C C    . GLN A 1 26 ? 0.796   0.560   -12.643 1.00 0.00 ? 26 GLN A C    7  
ATOM 6884  O O    . GLN A 1 26 ? 0.626   1.334   -13.585 1.00 0.00 ? 26 GLN A O    7  
ATOM 6885  C CB   . GLN A 1 26 ? -0.378  -1.596  -12.186 1.00 0.00 ? 26 GLN A CB   7  
ATOM 6886  C CG   . GLN A 1 26 ? -0.145  -3.031  -11.738 1.00 0.00 ? 26 GLN A CG   7  
ATOM 6887  C CD   . GLN A 1 26 ? -0.186  -4.016  -12.888 1.00 0.00 ? 26 GLN A CD   7  
ATOM 6888  O OE1  . GLN A 1 26 ? -0.637  -3.690  -13.986 1.00 0.00 ? 26 GLN A OE1  7  
ATOM 6889  N NE2  . GLN A 1 26 ? 0.285   -5.232  -12.640 1.00 0.00 ? 26 GLN A NE2  7  
ATOM 6890  H H    . GLN A 1 26 ? 2.174   -1.662  -11.387 1.00 0.00 ? 26 GLN A H    7  
ATOM 6891  H HA   . GLN A 1 26 ? 0.792   -1.146  -13.925 1.00 0.00 ? 26 GLN A HA   7  
ATOM 6892  H HB2  . GLN A 1 26 ? -0.644  -1.012  -11.318 1.00 0.00 ? 26 GLN A HB2  7  
ATOM 6893  H HB3  . GLN A 1 26 ? -1.207  -1.590  -12.878 1.00 0.00 ? 26 GLN A HB3  7  
ATOM 6894  H HG2  . GLN A 1 26 ? 0.824   -3.093  -11.264 1.00 0.00 ? 26 GLN A HG2  7  
ATOM 6895  H HG3  . GLN A 1 26 ? -0.911  -3.301  -11.026 1.00 0.00 ? 26 GLN A HG3  7  
ATOM 6896  H HE21 . GLN A 1 26 ? 0.629   -5.421  -11.742 1.00 0.00 ? 26 GLN A HE21 7  
ATOM 6897  H HE22 . GLN A 1 26 ? 0.270   -5.891  -13.365 1.00 0.00 ? 26 GLN A HE22 7  
ATOM 6898  N N    . GLY A 1 27 ? 0.950   0.967   -11.387 1.00 0.00 ? 27 GLY A N    7  
ATOM 6899  C CA   . GLY A 1 27 ? 0.923   2.378   -11.052 1.00 0.00 ? 27 GLY A CA   7  
ATOM 6900  C C    . GLY A 1 27 ? 0.706   2.608   -9.569  1.00 0.00 ? 27 GLY A C    7  
ATOM 6901  O O    . GLY A 1 27 ? -0.113  3.438   -9.176  1.00 0.00 ? 27 GLY A O    7  
ATOM 6902  H H    . GLY A 1 27 ? 1.079   0.302   -10.680 1.00 0.00 ? 27 GLY A H    7  
ATOM 6903  H HA2  . GLY A 1 27 ? 1.863   2.825   -11.341 1.00 0.00 ? 27 GLY A HA2  7  
ATOM 6904  H HA3  . GLY A 1 27 ? 0.125   2.855   -11.601 1.00 0.00 ? 27 GLY A HA3  7  
ATOM 6905  N N    . LEU A 1 28 ? 1.448   1.875   -8.748  1.00 0.00 ? 28 LEU A N    7  
ATOM 6906  C CA   . LEU A 1 28 ? 1.326   1.984   -7.301  1.00 0.00 ? 28 LEU A CA   7  
ATOM 6907  C C    . LEU A 1 28 ? 2.427   2.866   -6.721  1.00 0.00 ? 28 LEU A C    7  
ATOM 6908  O O    . LEU A 1 28 ? 2.947   2.601   -5.637  1.00 0.00 ? 28 LEU A O    7  
ATOM 6909  C CB   . LEU A 1 28 ? 1.373   0.597   -6.660  1.00 0.00 ? 28 LEU A CB   7  
ATOM 6910  C CG   . LEU A 1 28 ? 0.057   0.128   -6.034  1.00 0.00 ? 28 LEU A CG   7  
ATOM 6911  C CD1  . LEU A 1 28 ? -0.166  0.805   -4.690  1.00 0.00 ? 28 LEU A CD1  7  
ATOM 6912  C CD2  . LEU A 1 28 ? -1.108  0.401   -6.974  1.00 0.00 ? 28 LEU A CD2  7  
ATOM 6913  H H    . LEU A 1 28 ? 2.074   1.225   -9.126  1.00 0.00 ? 28 LEU A H    7  
ATOM 6914  H HA   . LEU A 1 28 ? 0.371   2.438   -7.085  1.00 0.00 ? 28 LEU A HA   7  
ATOM 6915  H HB2  . LEU A 1 28 ? 1.660   -0.117  -7.418  1.00 0.00 ? 28 LEU A HB2  7  
ATOM 6916  H HB3  . LEU A 1 28 ? 2.130   0.600   -5.890  1.00 0.00 ? 28 LEU A HB3  7  
ATOM 6917  H HG   . LEU A 1 28 ? 0.106   -0.938  -5.867  1.00 0.00 ? 28 LEU A HG   7  
ATOM 6918  H HD11 . LEU A 1 28 ? 0.216   0.175   -3.901  1.00 0.00 ? 28 LEU A HD11 7  
ATOM 6919  H HD12 . LEU A 1 28 ? -1.224  0.968   -4.540  1.00 0.00 ? 28 LEU A HD12 7  
ATOM 6920  H HD13 . LEU A 1 28 ? 0.349   1.754   -4.674  1.00 0.00 ? 28 LEU A HD13 7  
ATOM 6921  H HD21 . LEU A 1 28 ? -1.923  -0.267  -6.740  1.00 0.00 ? 28 LEU A HD21 7  
ATOM 6922  H HD22 . LEU A 1 28 ? -0.792  0.241   -7.994  1.00 0.00 ? 28 LEU A HD22 7  
ATOM 6923  H HD23 . LEU A 1 28 ? -1.434  1.424   -6.854  1.00 0.00 ? 28 LEU A HD23 7  
ATOM 6924  N N    . GLN A 1 29 ? 2.757   3.935   -7.437  1.00 0.00 ? 29 GLN A N    7  
ATOM 6925  C CA   . GLN A 1 29 ? 3.764   4.881   -6.974  1.00 0.00 ? 29 GLN A CA   7  
ATOM 6926  C C    . GLN A 1 29 ? 3.084   6.090   -6.341  1.00 0.00 ? 29 GLN A C    7  
ATOM 6927  O O    . GLN A 1 29 ? 3.632   6.724   -5.439  1.00 0.00 ? 29 GLN A O    7  
ATOM 6928  C CB   . GLN A 1 29 ? 4.662   5.322   -8.131  1.00 0.00 ? 29 GLN A CB   7  
ATOM 6929  C CG   . GLN A 1 29 ? 3.913   6.028   -9.249  1.00 0.00 ? 29 GLN A CG   7  
ATOM 6930  C CD   . GLN A 1 29 ? 4.722   7.142   -9.883  1.00 0.00 ? 29 GLN A CD   7  
ATOM 6931  O OE1  . GLN A 1 29 ? 5.835   6.924   -10.362 1.00 0.00 ? 29 GLN A OE1  7  
ATOM 6932  N NE2  . GLN A 1 29 ? 4.162   8.347   -9.894  1.00 0.00 ? 29 GLN A NE2  7  
ATOM 6933  H H    . GLN A 1 29 ? 2.294   4.105   -8.284  1.00 0.00 ? 29 GLN A H    7  
ATOM 6934  H HA   . GLN A 1 29 ? 4.367   4.386   -6.227  1.00 0.00 ? 29 GLN A HA   7  
ATOM 6935  H HB2  . GLN A 1 29 ? 5.416   5.993   -7.749  1.00 0.00 ? 29 GLN A HB2  7  
ATOM 6936  H HB3  . GLN A 1 29 ? 5.147   4.450   -8.545  1.00 0.00 ? 29 GLN A HB3  7  
ATOM 6937  H HG2  . GLN A 1 29 ? 3.666   5.305   -10.012 1.00 0.00 ? 29 GLN A HG2  7  
ATOM 6938  H HG3  . GLN A 1 29 ? 3.005   6.449   -8.846  1.00 0.00 ? 29 GLN A HG3  7  
ATOM 6939  H HE21 . GLN A 1 29 ? 3.273   8.447   -9.497  1.00 0.00 ? 29 GLN A HE21 7  
ATOM 6940  H HE22 . GLN A 1 29 ? 4.662   9.086   -10.300 1.00 0.00 ? 29 GLN A HE22 7  
ATOM 6941  N N    . SER A 1 30 ? 1.869   6.375   -6.797  1.00 0.00 ? 30 SER A N    7  
ATOM 6942  C CA   . SER A 1 30 ? 1.073   7.464   -6.249  1.00 0.00 ? 30 SER A CA   7  
ATOM 6943  C C    . SER A 1 30 ? -0.115  6.901   -5.483  1.00 0.00 ? 30 SER A C    7  
ATOM 6944  O O    . SER A 1 30 ? -1.042  6.358   -6.079  1.00 0.00 ? 30 SER A O    7  
ATOM 6945  C CB   . SER A 1 30 ? 0.588   8.390   -7.367  1.00 0.00 ? 30 SER A CB   7  
ATOM 6946  O OG   . SER A 1 30 ? 0.413   7.679   -8.581  1.00 0.00 ? 30 SER A OG   7  
ATOM 6947  H H    . SER A 1 30 ? 1.480   5.814   -7.500  1.00 0.00 ? 30 SER A H    7  
ATOM 6948  H HA   . SER A 1 30 ? 1.693   8.024   -5.568  1.00 0.00 ? 30 SER A HA   7  
ATOM 6949  H HB2  . SER A 1 30 ? -0.359  8.828   -7.083  1.00 0.00 ? 30 SER A HB2  7  
ATOM 6950  H HB3  . SER A 1 30 ? 1.314   9.174   -7.525  1.00 0.00 ? 30 SER A HB3  7  
ATOM 6951  H HG   . SER A 1 30 ? 0.004   8.252   -9.233  1.00 0.00 ? 30 SER A HG   7  
ATOM 6952  N N    . ILE A 1 31 ? -0.069  7.001   -4.155  1.00 0.00 ? 31 ILE A N    7  
ATOM 6953  C CA   . ILE A 1 31 ? -1.132  6.460   -3.307  1.00 0.00 ? 31 ILE A CA   7  
ATOM 6954  C C    . ILE A 1 31 ? -2.521  6.777   -3.874  1.00 0.00 ? 31 ILE A C    7  
ATOM 6955  O O    . ILE A 1 31 ? -3.456  5.990   -3.736  1.00 0.00 ? 31 ILE A O    7  
ATOM 6956  C CB   . ILE A 1 31 ? -1.013  6.973   -1.850  1.00 0.00 ? 31 ILE A CB   7  
ATOM 6957  C CG1  . ILE A 1 31 ? -1.656  5.972   -0.894  1.00 0.00 ? 31 ILE A CG1  7  
ATOM 6958  C CG2  . ILE A 1 31 ? -1.642  8.350   -1.682  1.00 0.00 ? 31 ILE A CG2  7  
ATOM 6959  C CD1  . ILE A 1 31 ? -0.652  5.140   -0.128  1.00 0.00 ? 31 ILE A CD1  7  
ATOM 6960  H H    . ILE A 1 31 ? 0.707   7.425   -3.734  1.00 0.00 ? 31 ILE A H    7  
ATOM 6961  H HA   . ILE A 1 31 ? -1.011  5.389   -3.284  1.00 0.00 ? 31 ILE A HA   7  
ATOM 6962  H HB   . ILE A 1 31 ? 0.037   7.059   -1.612  1.00 0.00 ? 31 ILE A HB   7  
ATOM 6963  H HG12 . ILE A 1 31 ? -2.263  6.504   -0.176  1.00 0.00 ? 31 ILE A HG12 7  
ATOM 6964  H HG13 . ILE A 1 31 ? -2.281  5.297   -1.460  1.00 0.00 ? 31 ILE A HG13 7  
ATOM 6965  H HG21 . ILE A 1 31 ? -1.170  9.048   -2.358  1.00 0.00 ? 31 ILE A HG21 7  
ATOM 6966  H HG22 . ILE A 1 31 ? -1.509  8.687   -0.665  1.00 0.00 ? 31 ILE A HG22 7  
ATOM 6967  H HG23 . ILE A 1 31 ? -2.697  8.289   -1.905  1.00 0.00 ? 31 ILE A HG23 7  
ATOM 6968  H HD11 . ILE A 1 31 ? -0.905  5.144   0.920   1.00 0.00 ? 31 ILE A HD11 7  
ATOM 6969  H HD12 . ILE A 1 31 ? 0.335   5.557   -0.263  1.00 0.00 ? 31 ILE A HD12 7  
ATOM 6970  H HD13 . ILE A 1 31 ? -0.667  4.127   -0.500  1.00 0.00 ? 31 ILE A HD13 7  
ATOM 6971  N N    . TYR A 1 32 ? -2.639  7.938   -4.507  1.00 0.00 ? 32 TYR A N    7  
ATOM 6972  C CA   . TYR A 1 32 ? -3.900  8.355   -5.104  1.00 0.00 ? 32 TYR A CA   7  
ATOM 6973  C C    . TYR A 1 32 ? -4.407  7.311   -6.096  1.00 0.00 ? 32 TYR A C    7  
ATOM 6974  O O    . TYR A 1 32 ? -5.596  7.271   -6.415  1.00 0.00 ? 32 TYR A O    7  
ATOM 6975  C CB   . TYR A 1 32 ? -3.728  9.703   -5.808  1.00 0.00 ? 32 TYR A CB   7  
ATOM 6976  C CG   . TYR A 1 32 ? -5.030  10.425  -6.069  1.00 0.00 ? 32 TYR A CG   7  
ATOM 6977  C CD1  . TYR A 1 32 ? -5.782  10.151  -7.203  1.00 0.00 ? 32 TYR A CD1  7  
ATOM 6978  C CD2  . TYR A 1 32 ? -5.504  11.386  -5.183  1.00 0.00 ? 32 TYR A CD2  7  
ATOM 6979  C CE1  . TYR A 1 32 ? -6.973  10.811  -7.448  1.00 0.00 ? 32 TYR A CE1  7  
ATOM 6980  C CE2  . TYR A 1 32 ? -6.693  12.050  -5.420  1.00 0.00 ? 32 TYR A CE2  7  
ATOM 6981  C CZ   . TYR A 1 32 ? -7.423  11.759  -6.554  1.00 0.00 ? 32 TYR A CZ   7  
ATOM 6982  O OH   . TYR A 1 32 ? -8.607  12.417  -6.794  1.00 0.00 ? 32 TYR A OH   7  
ATOM 6983  H H    . TYR A 1 32 ? -1.855  8.520   -4.588  1.00 0.00 ? 32 TYR A H    7  
ATOM 6984  H HA   . TYR A 1 32 ? -4.624  8.461   -4.309  1.00 0.00 ? 32 TYR A HA   7  
ATOM 6985  H HB2  . TYR A 1 32 ? -3.110  10.343  -5.195  1.00 0.00 ? 32 TYR A HB2  7  
ATOM 6986  H HB3  . TYR A 1 32 ? -3.241  9.544   -6.759  1.00 0.00 ? 32 TYR A HB3  7  
ATOM 6987  H HD1  . TYR A 1 32 ? -5.428  9.409   -7.902  1.00 0.00 ? 32 TYR A HD1  7  
ATOM 6988  H HD2  . TYR A 1 32 ? -4.930  11.612  -4.296  1.00 0.00 ? 32 TYR A HD2  7  
ATOM 6989  H HE1  . TYR A 1 32 ? -7.544  10.582  -8.336  1.00 0.00 ? 32 TYR A HE1  7  
ATOM 6990  H HE2  . TYR A 1 32 ? -7.046  12.792  -4.720  1.00 0.00 ? 32 TYR A HE2  7  
ATOM 6991  H HH   . TYR A 1 32 ? -8.422  13.305  -7.111  1.00 0.00 ? 32 TYR A HH   7  
ATOM 6992  N N    . HIS A 1 33 ? -3.501  6.463   -6.578  1.00 0.00 ? 33 HIS A N    7  
ATOM 6993  C CA   . HIS A 1 33 ? -3.860  5.430   -7.543  1.00 0.00 ? 33 HIS A CA   7  
ATOM 6994  C C    . HIS A 1 33 ? -4.418  4.184   -6.855  1.00 0.00 ? 33 HIS A C    7  
ATOM 6995  O O    . HIS A 1 33 ? -5.024  3.333   -7.505  1.00 0.00 ? 33 HIS A O    7  
ATOM 6996  C CB   . HIS A 1 33 ? -2.643  5.052   -8.390  1.00 0.00 ? 33 HIS A CB   7  
ATOM 6997  C CG   . HIS A 1 33 ? -2.981  4.750   -9.817  1.00 0.00 ? 33 HIS A CG   7  
ATOM 6998  N ND1  . HIS A 1 33 ? -3.602  5.657   -10.650 1.00 0.00 ? 33 HIS A ND1  7  
ATOM 6999  C CD2  . HIS A 1 33 ? -2.786  3.633   -10.558 1.00 0.00 ? 33 HIS A CD2  7  
ATOM 7000  C CE1  . HIS A 1 33 ? -3.772  5.113   -11.843 1.00 0.00 ? 33 HIS A CE1  7  
ATOM 7001  N NE2  . HIS A 1 33 ? -3.286  3.886   -11.811 1.00 0.00 ? 33 HIS A NE2  7  
ATOM 7002  H H    . HIS A 1 33 ? -2.563  6.548   -6.296  1.00 0.00 ? 33 HIS A H    7  
ATOM 7003  H HA   . HIS A 1 33 ? -4.623  5.837   -8.189  1.00 0.00 ? 33 HIS A HA   7  
ATOM 7004  H HB2  . HIS A 1 33 ? -1.939  5.871   -8.382  1.00 0.00 ? 33 HIS A HB2  7  
ATOM 7005  H HB3  . HIS A 1 33 ? -2.175  4.176   -7.967  1.00 0.00 ? 33 HIS A HB3  7  
ATOM 7006  H HD1  . HIS A 1 33 ? -3.875  6.566   -10.405 1.00 0.00 ? 33 HIS A HD1  7  
ATOM 7007  H HD2  . HIS A 1 33 ? -2.324  2.715   -10.225 1.00 0.00 ? 33 HIS A HD2  7  
ATOM 7008  H HE1  . HIS A 1 33 ? -4.230  5.590   -12.696 1.00 0.00 ? 33 HIS A HE1  7  
ATOM 7009  H HE2  . HIS A 1 33 ? -3.284  3.259   -12.565 1.00 0.00 ? 33 HIS A HE2  7  
ATOM 7010  N N    . LEU A 1 34 ? -4.204  4.070   -5.547  1.00 0.00 ? 34 LEU A N    7  
ATOM 7011  C CA   . LEU A 1 34 ? -4.701  2.920   -4.797  1.00 0.00 ? 34 LEU A CA   7  
ATOM 7012  C C    . LEU A 1 34 ? -5.785  3.321   -3.799  1.00 0.00 ? 34 LEU A C    7  
ATOM 7013  O O    . LEU A 1 34 ? -6.200  2.513   -2.968  1.00 0.00 ? 34 LEU A O    7  
ATOM 7014  C CB   . LEU A 1 34 ? -3.556  2.221   -4.066  1.00 0.00 ? 34 LEU A CB   7  
ATOM 7015  C CG   . LEU A 1 34 ? -2.410  3.128   -3.602  1.00 0.00 ? 34 LEU A CG   7  
ATOM 7016  C CD1  . LEU A 1 34 ? -1.536  2.401   -2.592  1.00 0.00 ? 34 LEU A CD1  7  
ATOM 7017  C CD2  . LEU A 1 34 ? -1.575  3.579   -4.792  1.00 0.00 ? 34 LEU A CD2  7  
ATOM 7018  H H    . LEU A 1 34 ? -3.721  4.776   -5.072  1.00 0.00 ? 34 LEU A H    7  
ATOM 7019  H HA   . LEU A 1 34 ? -5.131  2.230   -5.509  1.00 0.00 ? 34 LEU A HA   7  
ATOM 7020  H HB2  . LEU A 1 34 ? -3.964  1.719   -3.202  1.00 0.00 ? 34 LEU A HB2  7  
ATOM 7021  H HB3  . LEU A 1 34 ? -3.146  1.478   -4.729  1.00 0.00 ? 34 LEU A HB3  7  
ATOM 7022  H HG   . LEU A 1 34 ? -2.818  4.009   -3.121  1.00 0.00 ? 34 LEU A HG   7  
ATOM 7023  H HD11 . LEU A 1 34 ? -1.848  1.370   -2.524  1.00 0.00 ? 34 LEU A HD11 7  
ATOM 7024  H HD12 . LEU A 1 34 ? -1.635  2.871   -1.626  1.00 0.00 ? 34 LEU A HD12 7  
ATOM 7025  H HD13 . LEU A 1 34 ? -0.506  2.445   -2.911  1.00 0.00 ? 34 LEU A HD13 7  
ATOM 7026  H HD21 . LEU A 1 34 ? -1.802  4.608   -5.023  1.00 0.00 ? 34 LEU A HD21 7  
ATOM 7027  H HD22 . LEU A 1 34 ? -1.802  2.959   -5.647  1.00 0.00 ? 34 LEU A HD22 7  
ATOM 7028  H HD23 . LEU A 1 34 ? -0.527  3.490   -4.549  1.00 0.00 ? 34 LEU A HD23 7  
ATOM 7029  N N    . GLN A 1 35 ? -6.251  4.559   -3.894  1.00 0.00 ? 35 GLN A N    7  
ATOM 7030  C CA   . GLN A 1 35 ? -7.289  5.052   -2.998  1.00 0.00 ? 35 GLN A CA   7  
ATOM 7031  C C    . GLN A 1 35 ? -8.514  4.146   -3.030  1.00 0.00 ? 35 GLN A C    7  
ATOM 7032  O O    . GLN A 1 35 ? -9.169  3.932   -2.009  1.00 0.00 ? 35 GLN A O    7  
ATOM 7033  C CB   . GLN A 1 35 ? -7.688  6.476   -3.380  1.00 0.00 ? 35 GLN A CB   7  
ATOM 7034  C CG   . GLN A 1 35 ? -8.312  7.258   -2.236  1.00 0.00 ? 35 GLN A CG   7  
ATOM 7035  C CD   . GLN A 1 35 ? -7.671  8.618   -2.041  1.00 0.00 ? 35 GLN A CD   7  
ATOM 7036  O OE1  . GLN A 1 35 ? -7.803  9.505   -2.883  1.00 0.00 ? 35 GLN A OE1  7  
ATOM 7037  N NE2  . GLN A 1 35 ? -6.970  8.787   -0.926  1.00 0.00 ? 35 GLN A NE2  7  
ATOM 7038  H H    . GLN A 1 35 ? -5.888  5.157   -4.576  1.00 0.00 ? 35 GLN A H    7  
ATOM 7039  H HA   . GLN A 1 35 ? -6.886  5.055   -1.997  1.00 0.00 ? 35 GLN A HA   7  
ATOM 7040  H HB2  . GLN A 1 35 ? -6.809  7.008   -3.715  1.00 0.00 ? 35 GLN A HB2  7  
ATOM 7041  H HB3  . GLN A 1 35 ? -8.402  6.432   -4.190  1.00 0.00 ? 35 GLN A HB3  7  
ATOM 7042  H HG2  . GLN A 1 35 ? -9.362  7.398   -2.444  1.00 0.00 ? 35 GLN A HG2  7  
ATOM 7043  H HG3  . GLN A 1 35 ? -8.198  6.689   -1.326  1.00 0.00 ? 35 GLN A HG3  7  
ATOM 7044  H HE21 . GLN A 1 35 ? -6.908  8.036   -0.300  1.00 0.00 ? 35 GLN A HE21 7  
ATOM 7045  H HE22 . GLN A 1 35 ? -6.544  9.655   -0.775  1.00 0.00 ? 35 GLN A HE22 7  
ATOM 7046  N N    . ASN A 1 36 ? -8.821  3.616   -4.209  1.00 0.00 ? 36 ASN A N    7  
ATOM 7047  C CA   . ASN A 1 36 ? -9.972  2.738   -4.377  1.00 0.00 ? 36 ASN A CA   7  
ATOM 7048  C C    . ASN A 1 36 ? -9.550  1.273   -4.388  1.00 0.00 ? 36 ASN A C    7  
ATOM 7049  O O    . ASN A 1 36 ? -10.355 0.384   -4.109  1.00 0.00 ? 36 ASN A O    7  
ATOM 7050  C CB   . ASN A 1 36 ? -10.712 3.078   -5.671  1.00 0.00 ? 36 ASN A CB   7  
ATOM 7051  C CG   . ASN A 1 36 ? -11.816 4.090   -5.456  1.00 0.00 ? 36 ASN A CG   7  
ATOM 7052  O OD1  . ASN A 1 36 ? -12.900 3.755   -4.979  1.00 0.00 ? 36 ASN A OD1  7  
ATOM 7053  N ND2  . ASN A 1 36 ? -11.544 5.340   -5.811  1.00 0.00 ? 36 ASN A ND2  7  
ATOM 7054  H H    . ASN A 1 36 ? -8.262  3.825   -4.986  1.00 0.00 ? 36 ASN A H    7  
ATOM 7055  H HA   . ASN A 1 36 ? -10.635 2.901   -3.539  1.00 0.00 ? 36 ASN A HA   7  
ATOM 7056  H HB2  . ASN A 1 36 ? -10.010 3.489   -6.381  1.00 0.00 ? 36 ASN A HB2  7  
ATOM 7057  H HB3  . ASN A 1 36 ? -11.146 2.178   -6.078  1.00 0.00 ? 36 ASN A HB3  7  
ATOM 7058  H HD21 . ASN A 1 36 ? -10.659 5.533   -6.184  1.00 0.00 ? 36 ASN A HD21 7  
ATOM 7059  H HD22 . ASN A 1 36 ? -12.239 6.017   -5.685  1.00 0.00 ? 36 ASN A HD22 7  
ATOM 7060  N N    . LEU A 1 37 ? -8.282  1.024   -4.708  1.00 0.00 ? 37 LEU A N    7  
ATOM 7061  C CA   . LEU A 1 37 ? -7.752  -0.332  -4.753  1.00 0.00 ? 37 LEU A CA   7  
ATOM 7062  C C    . LEU A 1 37 ? -8.137  -1.114  -3.503  1.00 0.00 ? 37 LEU A C    7  
ATOM 7063  O O    . LEU A 1 37 ? -8.034  -0.606  -2.385  1.00 0.00 ? 37 LEU A O    7  
ATOM 7064  C CB   . LEU A 1 37 ? -6.229  -0.292  -4.884  1.00 0.00 ? 37 LEU A CB   7  
ATOM 7065  C CG   . LEU A 1 37 ? -5.550  -1.627  -5.213  1.00 0.00 ? 37 LEU A CG   7  
ATOM 7066  C CD1  . LEU A 1 37 ? -6.384  -2.446  -6.188  1.00 0.00 ? 37 LEU A CD1  7  
ATOM 7067  C CD2  . LEU A 1 37 ? -4.161  -1.385  -5.779  1.00 0.00 ? 37 LEU A CD2  7  
ATOM 7068  H H    . LEU A 1 37 ? -7.686  1.772   -4.920  1.00 0.00 ? 37 LEU A H    7  
ATOM 7069  H HA   . LEU A 1 37 ? -8.173  -0.824  -5.617  1.00 0.00 ? 37 LEU A HA   7  
ATOM 7070  H HB2  . LEU A 1 37 ? -5.974  0.418   -5.658  1.00 0.00 ? 37 LEU A HB2  7  
ATOM 7071  H HB3  . LEU A 1 37 ? -5.828  0.066   -3.950  1.00 0.00 ? 37 LEU A HB3  7  
ATOM 7072  H HG   . LEU A 1 37 ? -5.444  -2.198  -4.304  1.00 0.00 ? 37 LEU A HG   7  
ATOM 7073  H HD11 . LEU A 1 37 ? -6.978  -1.784  -6.799  1.00 0.00 ? 37 LEU A HD11 7  
ATOM 7074  H HD12 . LEU A 1 37 ? -7.033  -3.110  -5.636  1.00 0.00 ? 37 LEU A HD12 7  
ATOM 7075  H HD13 . LEU A 1 37 ? -5.729  -3.029  -6.819  1.00 0.00 ? 37 LEU A HD13 7  
ATOM 7076  H HD21 . LEU A 1 37 ? -3.718  -0.527  -5.293  1.00 0.00 ? 37 LEU A HD21 7  
ATOM 7077  H HD22 . LEU A 1 37 ? -4.231  -1.198  -6.840  1.00 0.00 ? 37 LEU A HD22 7  
ATOM 7078  H HD23 . LEU A 1 37 ? -3.545  -2.254  -5.606  1.00 0.00 ? 37 LEU A HD23 7  
ATOM 7079  N N    . THR A 1 38 ? -8.574  -2.351  -3.695  1.00 0.00 ? 38 THR A N    7  
ATOM 7080  C CA   . THR A 1 38 ? -8.973  -3.197  -2.580  1.00 0.00 ? 38 THR A CA   7  
ATOM 7081  C C    . THR A 1 38 ? -8.360  -4.581  -2.691  1.00 0.00 ? 38 THR A C    7  
ATOM 7082  O O    . THR A 1 38 ? -7.690  -4.901  -3.673  1.00 0.00 ? 38 THR A O    7  
ATOM 7083  C CB   . THR A 1 38 ? -10.494 -3.340  -2.538  1.00 0.00 ? 38 THR A CB   7  
ATOM 7084  O OG1  . THR A 1 38 ? -11.114 -2.358  -3.350  1.00 0.00 ? 38 THR A OG1  7  
ATOM 7085  C CG2  . THR A 1 38 ? -11.066 -3.220  -1.145  1.00 0.00 ? 38 THR A CG2  7  
ATOM 7086  H H    . THR A 1 38 ? -8.636  -2.702  -4.609  1.00 0.00 ? 38 THR A H    7  
ATOM 7087  H HA   . THR A 1 38 ? -8.630  -2.729  -1.669  1.00 0.00 ? 38 THR A HA   7  
ATOM 7088  H HB   . THR A 1 38 ? -10.761 -4.320  -2.919  1.00 0.00 ? 38 THR A HB   7  
ATOM 7089  H HG1  . THR A 1 38 ? -12.067 -2.484  -3.336  1.00 0.00 ? 38 THR A HG1  7  
ATOM 7090  H HG21 . THR A 1 38 ? -10.923 -4.151  -0.618  1.00 0.00 ? 38 THR A HG21 7  
ATOM 7091  H HG22 . THR A 1 38 ? -12.122 -2.999  -1.208  1.00 0.00 ? 38 THR A HG22 7  
ATOM 7092  H HG23 . THR A 1 38 ? -10.562 -2.425  -0.616  1.00 0.00 ? 38 THR A HG23 7  
ATOM 7093  N N    . ILE A 1 39 ? -8.642  -5.418  -1.702  1.00 0.00 ? 39 ILE A N    7  
ATOM 7094  C CA   . ILE A 1 39 ? -8.180  -6.795  -1.725  1.00 0.00 ? 39 ILE A CA   7  
ATOM 7095  C C    . ILE A 1 39 ? -8.721  -7.492  -2.961  1.00 0.00 ? 39 ILE A C    7  
ATOM 7096  O O    . ILE A 1 39 ? -8.070  -8.360  -3.543  1.00 0.00 ? 39 ILE A O    7  
ATOM 7097  C CB   . ILE A 1 39 ? -8.630  -7.561  -0.469  1.00 0.00 ? 39 ILE A CB   7  
ATOM 7098  C CG1  . ILE A 1 39 ? -7.980  -8.946  -0.427  1.00 0.00 ? 39 ILE A CG1  7  
ATOM 7099  C CG2  . ILE A 1 39 ? -10.146 -7.680  -0.426  1.00 0.00 ? 39 ILE A CG2  7  
ATOM 7100  C CD1  . ILE A 1 39 ? -6.548  -8.928  0.057   1.00 0.00 ? 39 ILE A CD1  7  
ATOM 7101  H H    . ILE A 1 39 ? -9.213  -5.116  -0.965  1.00 0.00 ? 39 ILE A H    7  
ATOM 7102  H HA   . ILE A 1 39 ? -7.105  -6.787  -1.758  1.00 0.00 ? 39 ILE A HA   7  
ATOM 7103  H HB   . ILE A 1 39 ? -8.318  -6.998  0.394   1.00 0.00 ? 39 ILE A HB   7  
ATOM 7104  H HG12 . ILE A 1 39 ? -8.546  -9.582  0.237   1.00 0.00 ? 39 ILE A HG12 7  
ATOM 7105  H HG13 . ILE A 1 39 ? -7.989  -9.370  -1.420  1.00 0.00 ? 39 ILE A HG13 7  
ATOM 7106  H HG21 . ILE A 1 39 ? -10.586 -6.699  -0.532  1.00 0.00 ? 39 ILE A HG21 7  
ATOM 7107  H HG22 . ILE A 1 39 ? -10.447 -8.110  0.518   1.00 0.00 ? 39 ILE A HG22 7  
ATOM 7108  H HG23 . ILE A 1 39 ? -10.480 -8.314  -1.234  1.00 0.00 ? 39 ILE A HG23 7  
ATOM 7109  H HD11 . ILE A 1 39 ? -6.437  -9.616  0.882   1.00 0.00 ? 39 ILE A HD11 7  
ATOM 7110  H HD12 . ILE A 1 39 ? -6.290  -7.931  0.383   1.00 0.00 ? 39 ILE A HD12 7  
ATOM 7111  H HD13 . ILE A 1 39 ? -5.892  -9.224  -0.748  1.00 0.00 ? 39 ILE A HD13 7  
ATOM 7112  N N    . GLU A 1 40 ? -9.915  -7.077  -3.365  1.00 0.00 ? 40 GLU A N    7  
ATOM 7113  C CA   . GLU A 1 40 ? -10.565 -7.632  -4.541  1.00 0.00 ? 40 GLU A CA   7  
ATOM 7114  C C    . GLU A 1 40 ? -9.682  -7.474  -5.774  1.00 0.00 ? 40 GLU A C    7  
ATOM 7115  O O    . GLU A 1 40 ? -9.520  -8.408  -6.559  1.00 0.00 ? 40 GLU A O    7  
ATOM 7116  C CB   . GLU A 1 40 ? -11.914 -6.948  -4.776  1.00 0.00 ? 40 GLU A CB   7  
ATOM 7117  C CG   . GLU A 1 40 ? -12.877 -7.087  -3.608  1.00 0.00 ? 40 GLU A CG   7  
ATOM 7118  C CD   . GLU A 1 40 ? -13.756 -8.318  -3.719  1.00 0.00 ? 40 GLU A CD   7  
ATOM 7119  O OE1  . GLU A 1 40 ? -14.549 -8.397  -4.680  1.00 0.00 ? 40 GLU A OE1  7  
ATOM 7120  O OE2  . GLU A 1 40 ? -13.652 -9.203  -2.843  1.00 0.00 ? 40 GLU A OE2  7  
ATOM 7121  H H    . GLU A 1 40 ? -10.371 -6.378  -2.849  1.00 0.00 ? 40 GLU A H    7  
ATOM 7122  H HA   . GLU A 1 40 ? -10.731 -8.680  -4.362  1.00 0.00 ? 40 GLU A HA   7  
ATOM 7123  H HB2  . GLU A 1 40 ? -11.746 -5.896  -4.952  1.00 0.00 ? 40 GLU A HB2  7  
ATOM 7124  H HB3  . GLU A 1 40 ? -12.377 -7.381  -5.650  1.00 0.00 ? 40 GLU A HB3  7  
ATOM 7125  H HG2  . GLU A 1 40 ? -12.307 -7.151  -2.693  1.00 0.00 ? 40 GLU A HG2  7  
ATOM 7126  H HG3  . GLU A 1 40 ? -13.511 -6.213  -3.575  1.00 0.00 ? 40 GLU A HG3  7  
ATOM 7127  N N    . ASP A 1 41 ? -9.114  -6.283  -5.938  1.00 0.00 ? 41 ASP A N    7  
ATOM 7128  C CA   . ASP A 1 41 ? -8.243  -6.000  -7.075  1.00 0.00 ? 41 ASP A CA   7  
ATOM 7129  C C    . ASP A 1 41 ? -6.813  -6.442  -6.787  1.00 0.00 ? 41 ASP A C    7  
ATOM 7130  O O    . ASP A 1 41 ? -6.053  -6.762  -7.702  1.00 0.00 ? 41 ASP A O    7  
ATOM 7131  C CB   . ASP A 1 41 ? -8.275  -4.508  -7.410  1.00 0.00 ? 41 ASP A CB   7  
ATOM 7132  C CG   . ASP A 1 41 ? -9.180  -4.200  -8.586  1.00 0.00 ? 41 ASP A CG   7  
ATOM 7133  O OD1  . ASP A 1 41 ? -10.078 -5.018  -8.874  1.00 0.00 ? 41 ASP A OD1  7  
ATOM 7134  O OD2  . ASP A 1 41 ? -8.992  -3.141  -9.218  1.00 0.00 ? 41 ASP A OD2  7  
ATOM 7135  H H    . ASP A 1 41 ? -9.281  -5.578  -5.276  1.00 0.00 ? 41 ASP A H    7  
ATOM 7136  H HA   . ASP A 1 41 ? -8.615  -6.558  -7.922  1.00 0.00 ? 41 ASP A HA   7  
ATOM 7137  H HB2  . ASP A 1 41 ? -8.631  -3.959  -6.550  1.00 0.00 ? 41 ASP A HB2  7  
ATOM 7138  H HB3  . ASP A 1 41 ? -7.274  -4.179  -7.653  1.00 0.00 ? 41 ASP A HB3  7  
ATOM 7139  N N    . LEU A 1 42 ? -6.454  -6.458  -5.507  1.00 0.00 ? 42 LEU A N    7  
ATOM 7140  C CA   . LEU A 1 42 ? -5.120  -6.870  -5.085  1.00 0.00 ? 42 LEU A CA   7  
ATOM 7141  C C    . LEU A 1 42 ? -4.731  -8.194  -5.732  1.00 0.00 ? 42 LEU A C    7  
ATOM 7142  O O    . LEU A 1 42 ? -3.683  -8.305  -6.368  1.00 0.00 ? 42 LEU A O    7  
ATOM 7143  C CB   . LEU A 1 42 ? -5.074  -7.004  -3.558  1.00 0.00 ? 42 LEU A CB   7  
ATOM 7144  C CG   . LEU A 1 42 ? -4.806  -5.718  -2.747  1.00 0.00 ? 42 LEU A CG   7  
ATOM 7145  C CD1  . LEU A 1 42 ? -3.434  -5.787  -2.097  1.00 0.00 ? 42 LEU A CD1  7  
ATOM 7146  C CD2  . LEU A 1 42 ? -4.923  -4.457  -3.597  1.00 0.00 ? 42 LEU A CD2  7  
ATOM 7147  H H    . LEU A 1 42 ? -7.107  -6.197  -4.827  1.00 0.00 ? 42 LEU A H    7  
ATOM 7148  H HA   . LEU A 1 42 ? -4.419  -6.108  -5.397  1.00 0.00 ? 42 LEU A HA   7  
ATOM 7149  H HB2  . LEU A 1 42 ? -6.020  -7.407  -3.235  1.00 0.00 ? 42 LEU A HB2  7  
ATOM 7150  H HB3  . LEU A 1 42 ? -4.302  -7.717  -3.311  1.00 0.00 ? 42 LEU A HB3  7  
ATOM 7151  H HG   . LEU A 1 42 ? -5.538  -5.648  -1.956  1.00 0.00 ? 42 LEU A HG   7  
ATOM 7152  H HD11 . LEU A 1 42 ? -3.380  -6.657  -1.460  1.00 0.00 ? 42 LEU A HD11 7  
ATOM 7153  H HD12 . LEU A 1 42 ? -3.274  -4.898  -1.505  1.00 0.00 ? 42 LEU A HD12 7  
ATOM 7154  H HD13 . LEU A 1 42 ? -2.675  -5.851  -2.862  1.00 0.00 ? 42 LEU A HD13 7  
ATOM 7155  H HD21 . LEU A 1 42 ? -3.965  -4.231  -4.041  1.00 0.00 ? 42 LEU A HD21 7  
ATOM 7156  H HD22 . LEU A 1 42 ? -5.234  -3.632  -2.974  1.00 0.00 ? 42 LEU A HD22 7  
ATOM 7157  H HD23 . LEU A 1 42 ? -5.653  -4.612  -4.377  1.00 0.00 ? 42 LEU A HD23 7  
ATOM 7158  N N    . GLY A 1 43 ? -5.593  -9.195  -5.575  1.00 0.00 ? 43 GLY A N    7  
ATOM 7159  C CA   . GLY A 1 43 ? -5.339  -10.495 -6.168  1.00 0.00 ? 43 GLY A CA   7  
ATOM 7160  C C    . GLY A 1 43 ? -5.414  -10.473 -7.684  1.00 0.00 ? 43 GLY A C    7  
ATOM 7161  O O    . GLY A 1 43 ? -5.068  -11.456 -8.340  1.00 0.00 ? 43 GLY A O    7  
ATOM 7162  H H    . GLY A 1 43 ? -6.417  -9.044  -5.067  1.00 0.00 ? 43 GLY A H    7  
ATOM 7163  H HA2  . GLY A 1 43 ? -4.354  -10.825 -5.873  1.00 0.00 ? 43 GLY A HA2  7  
ATOM 7164  H HA3  . GLY A 1 43 ? -6.068  -11.197 -5.793  1.00 0.00 ? 43 GLY A HA3  7  
ATOM 7165  N N    . ALA A 1 44 ? -5.869  -9.355  -8.244  1.00 0.00 ? 44 ALA A N    7  
ATOM 7166  C CA   . ALA A 1 44 ? -5.968  -9.211  -9.691  1.00 0.00 ? 44 ALA A CA   7  
ATOM 7167  C C    . ALA A 1 44 ? -4.589  -8.994  -10.299 1.00 0.00 ? 44 ALA A C    7  
ATOM 7168  O O    . ALA A 1 44 ? -4.248  -9.582  -11.326 1.00 0.00 ? 44 ALA A O    7  
ATOM 7169  C CB   . ALA A 1 44 ? -6.897  -8.059  -10.046 1.00 0.00 ? 44 ALA A CB   7  
ATOM 7170  H H    . ALA A 1 44 ? -6.120  -8.601  -7.674  1.00 0.00 ? 44 ALA A H    7  
ATOM 7171  H HA   . ALA A 1 44 ? -6.392  -10.121 -10.091 1.00 0.00 ? 44 ALA A HA   7  
ATOM 7172  H HB1  . ALA A 1 44 ? -6.310  -7.207  -10.356 1.00 0.00 ? 44 ALA A HB1  7  
ATOM 7173  H HB2  . ALA A 1 44 ? -7.488  -7.794  -9.183  1.00 0.00 ? 44 ALA A HB2  7  
ATOM 7174  H HB3  . ALA A 1 44 ? -7.551  -8.359  -10.852 1.00 0.00 ? 44 ALA A HB3  7  
ATOM 7175  N N    . LEU A 1 45 ? -3.792  -8.161  -9.639  1.00 0.00 ? 45 LEU A N    7  
ATOM 7176  C CA   . LEU A 1 45 ? -2.440  -7.869  -10.086 1.00 0.00 ? 45 LEU A CA   7  
ATOM 7177  C C    . LEU A 1 45 ? -1.678  -9.143  -10.424 1.00 0.00 ? 45 LEU A C    7  
ATOM 7178  O O    . LEU A 1 45 ? -0.776  -9.134  -11.259 1.00 0.00 ? 45 LEU A O    7  
ATOM 7179  C CB   . LEU A 1 45 ? -1.705  -7.110  -8.989  1.00 0.00 ? 45 LEU A CB   7  
ATOM 7180  C CG   . LEU A 1 45 ? -2.017  -5.616  -8.922  1.00 0.00 ? 45 LEU A CG   7  
ATOM 7181  C CD1  . LEU A 1 45 ? -3.512  -5.384  -8.762  1.00 0.00 ? 45 LEU A CD1  7  
ATOM 7182  C CD2  . LEU A 1 45 ? -1.251  -4.968  -7.781  1.00 0.00 ? 45 LEU A CD2  7  
ATOM 7183  H H    . LEU A 1 45 ? -4.120  -7.730  -8.822  1.00 0.00 ? 45 LEU A H    7  
ATOM 7184  H HA   . LEU A 1 45 ? -2.502  -7.253  -10.967 1.00 0.00 ? 45 LEU A HA   7  
ATOM 7185  H HB2  . LEU A 1 45 ? -1.966  -7.553  -8.040  1.00 0.00 ? 45 LEU A HB2  7  
ATOM 7186  H HB3  . LEU A 1 45 ? -0.649  -7.236  -9.146  1.00 0.00 ? 45 LEU A HB3  7  
ATOM 7187  H HG   . LEU A 1 45 ? -1.705  -5.152  -9.843  1.00 0.00 ? 45 LEU A HG   7  
ATOM 7188  H HD11 . LEU A 1 45 ? -3.693  -4.344  -8.536  1.00 0.00 ? 45 LEU A HD11 7  
ATOM 7189  H HD12 . LEU A 1 45 ? -3.887  -5.999  -7.958  1.00 0.00 ? 45 LEU A HD12 7  
ATOM 7190  H HD13 . LEU A 1 45 ? -4.016  -5.645  -9.681  1.00 0.00 ? 45 LEU A HD13 7  
ATOM 7191  H HD21 . LEU A 1 45 ? -0.207  -4.891  -8.045  1.00 0.00 ? 45 LEU A HD21 7  
ATOM 7192  H HD22 . LEU A 1 45 ? -1.356  -5.572  -6.892  1.00 0.00 ? 45 LEU A HD22 7  
ATOM 7193  H HD23 . LEU A 1 45 ? -1.650  -3.982  -7.596  1.00 0.00 ? 45 LEU A HD23 7  
ATOM 7194  N N    . LYS A 1 46 ? -2.061  -10.229 -9.760  1.00 0.00 ? 46 LYS A N    7  
ATOM 7195  C CA   . LYS A 1 46 ? -1.429  -11.543 -9.925  1.00 0.00 ? 46 LYS A CA   7  
ATOM 7196  C C    . LYS A 1 46 ? -0.228  -11.708 -9.000  1.00 0.00 ? 46 LYS A C    7  
ATOM 7197  O O    . LYS A 1 46 ? 0.612   -12.584 -9.203  1.00 0.00 ? 46 LYS A O    7  
ATOM 7198  C CB   . LYS A 1 46 ? -0.992  -11.799 -11.364 1.00 0.00 ? 46 LYS A CB   7  
ATOM 7199  C CG   . LYS A 1 46 ? -0.518  -13.218 -11.566 1.00 0.00 ? 46 LYS A CG   7  
ATOM 7200  C CD   . LYS A 1 46 ? -1.191  -13.872 -12.760 1.00 0.00 ? 46 LYS A CD   7  
ATOM 7201  C CE   . LYS A 1 46 ? -1.330  -15.374 -12.571 1.00 0.00 ? 46 LYS A CE   7  
ATOM 7202  N NZ   . LYS A 1 46 ? -0.013  -16.066 -12.621 1.00 0.00 ? 46 LYS A NZ   7  
ATOM 7203  H H    . LYS A 1 46 ? -2.772  -10.136 -9.097  1.00 0.00 ? 46 LYS A H    7  
ATOM 7204  H HA   . LYS A 1 46 ? -2.164  -12.285 -9.654  1.00 0.00 ? 46 LYS A HA   7  
ATOM 7205  H HB2  . LYS A 1 46 ? -1.824  -11.614 -12.029 1.00 0.00 ? 46 LYS A HB2  7  
ATOM 7206  H HB3  . LYS A 1 46 ? -0.179  -11.136 -11.615 1.00 0.00 ? 46 LYS A HB3  7  
ATOM 7207  H HG2  . LYS A 1 46 ? 0.550   -13.208 -11.721 1.00 0.00 ? 46 LYS A HG2  7  
ATOM 7208  H HG3  . LYS A 1 46 ? -0.748  -13.780 -10.672 1.00 0.00 ? 46 LYS A HG3  7  
ATOM 7209  H HD2  . LYS A 1 46 ? -2.173  -13.442 -12.888 1.00 0.00 ? 46 LYS A HD2  7  
ATOM 7210  H HD3  . LYS A 1 46 ? -0.597  -13.684 -13.643 1.00 0.00 ? 46 LYS A HD3  7  
ATOM 7211  H HE2  . LYS A 1 46 ? -1.789  -15.561 -11.610 1.00 0.00 ? 46 LYS A HE2  7  
ATOM 7212  H HE3  . LYS A 1 46 ? -1.963  -15.765 -13.354 1.00 0.00 ? 46 LYS A HE3  7  
ATOM 7213  H HZ1  . LYS A 1 46 ? 0.486   -15.821 -13.501 1.00 0.00 ? 46 LYS A HZ1  7  
ATOM 7214  H HZ2  . LYS A 1 46 ? -0.149  -17.096 -12.587 1.00 0.00 ? 46 LYS A HZ2  7  
ATOM 7215  H HZ3  . LYS A 1 46 ? 0.573   -15.778 -11.813 1.00 0.00 ? 46 LYS A HZ3  7  
ATOM 7216  N N    . ILE A 1 47 ? -0.156  -10.858 -7.991  1.00 0.00 ? 47 ILE A N    7  
ATOM 7217  C CA   . ILE A 1 47 ? 0.926   -10.904 -7.012  1.00 0.00 ? 47 ILE A CA   7  
ATOM 7218  C C    . ILE A 1 47 ? 0.598   -11.892 -5.895  1.00 0.00 ? 47 ILE A C    7  
ATOM 7219  O O    . ILE A 1 47 ? -0.537  -11.948 -5.421  1.00 0.00 ? 47 ILE A O    7  
ATOM 7220  C CB   . ILE A 1 47 ? 1.186   -9.513  -6.395  1.00 0.00 ? 47 ILE A CB   7  
ATOM 7221  C CG1  . ILE A 1 47 ? 1.012   -8.417  -7.448  1.00 0.00 ? 47 ILE A CG1  7  
ATOM 7222  C CG2  . ILE A 1 47 ? 2.577   -9.445  -5.790  1.00 0.00 ? 47 ILE A CG2  7  
ATOM 7223  C CD1  . ILE A 1 47 ? 1.221   -7.021  -6.909  1.00 0.00 ? 47 ILE A CD1  7  
ATOM 7224  H H    . ILE A 1 47 ? -0.862  -10.197 -7.888  1.00 0.00 ? 47 ILE A H    7  
ATOM 7225  H HA   . ILE A 1 47 ? 1.824   -11.227 -7.517  1.00 0.00 ? 47 ILE A HA   7  
ATOM 7226  H HB   . ILE A 1 47 ? 0.470   -9.358  -5.601  1.00 0.00 ? 47 ILE A HB   7  
ATOM 7227  H HG12 . ILE A 1 47 ? 1.723   -8.574  -8.244  1.00 0.00 ? 47 ILE A HG12 7  
ATOM 7228  H HG13 . ILE A 1 47 ? 0.012   -8.470  -7.847  1.00 0.00 ? 47 ILE A HG13 7  
ATOM 7229  H HG21 . ILE A 1 47 ? 2.712   -10.266 -5.103  1.00 0.00 ? 47 ILE A HG21 7  
ATOM 7230  H HG22 . ILE A 1 47 ? 2.694   -8.510  -5.262  1.00 0.00 ? 47 ILE A HG22 7  
ATOM 7231  H HG23 . ILE A 1 47 ? 3.315   -9.507  -6.577  1.00 0.00 ? 47 ILE A HG23 7  
ATOM 7232  H HD11 . ILE A 1 47 ? 1.382   -6.339  -7.729  1.00 0.00 ? 47 ILE A HD11 7  
ATOM 7233  H HD12 . ILE A 1 47 ? 2.085   -7.014  -6.260  1.00 0.00 ? 47 ILE A HD12 7  
ATOM 7234  H HD13 . ILE A 1 47 ? 0.349   -6.715  -6.350  1.00 0.00 ? 47 ILE A HD13 7  
ATOM 7235  N N    . PRO A 1 48 ? 1.587   -12.688 -5.454  1.00 0.00 ? 48 PRO A N    7  
ATOM 7236  C CA   . PRO A 1 48 ? 1.403   -13.667 -4.383  1.00 0.00 ? 48 PRO A CA   7  
ATOM 7237  C C    . PRO A 1 48 ? 0.534   -13.125 -3.253  1.00 0.00 ? 48 PRO A C    7  
ATOM 7238  O O    . PRO A 1 48 ? 0.567   -11.933 -2.948  1.00 0.00 ? 48 PRO A O    7  
ATOM 7239  C CB   . PRO A 1 48 ? 2.832   -13.940 -3.885  1.00 0.00 ? 48 PRO A CB   7  
ATOM 7240  C CG   . PRO A 1 48 ? 3.739   -13.080 -4.715  1.00 0.00 ? 48 PRO A CG   7  
ATOM 7241  C CD   . PRO A 1 48 ? 2.966   -12.695 -5.943  1.00 0.00 ? 48 PRO A CD   7  
ATOM 7242  H HA   . PRO A 1 48 ? 0.970   -14.583 -4.758  1.00 0.00 ? 48 PRO A HA   7  
ATOM 7243  H HB2  . PRO A 1 48 ? 2.901   -13.682 -2.839  1.00 0.00 ? 48 PRO A HB2  7  
ATOM 7244  H HB3  . PRO A 1 48 ? 3.062   -14.986 -4.014  1.00 0.00 ? 48 PRO A HB3  7  
ATOM 7245  H HG2  . PRO A 1 48 ? 4.015   -12.197 -4.157  1.00 0.00 ? 48 PRO A HG2  7  
ATOM 7246  H HG3  . PRO A 1 48 ? 4.621   -13.639 -4.989  1.00 0.00 ? 48 PRO A HG3  7  
ATOM 7247  H HD2  . PRO A 1 48 ? 3.262   -11.717 -6.289  1.00 0.00 ? 48 PRO A HD2  7  
ATOM 7248  H HD3  . PRO A 1 48 ? 3.098   -13.432 -6.721  1.00 0.00 ? 48 PRO A HD3  7  
ATOM 7249  N N    . GLU A 1 49 ? -0.246  -14.008 -2.635  1.00 0.00 ? 49 GLU A N    7  
ATOM 7250  C CA   . GLU A 1 49 ? -1.138  -13.614 -1.549  1.00 0.00 ? 49 GLU A CA   7  
ATOM 7251  C C    . GLU A 1 49 ? -0.446  -13.723 -0.193  1.00 0.00 ? 49 GLU A C    7  
ATOM 7252  O O    . GLU A 1 49 ? -1.042  -14.178 0.783   1.00 0.00 ? 49 GLU A O    7  
ATOM 7253  C CB   . GLU A 1 49 ? -2.398  -14.485 -1.560  1.00 0.00 ? 49 GLU A CB   7  
ATOM 7254  C CG   . GLU A 1 49 ? -2.157  -15.913 -1.097  1.00 0.00 ? 49 GLU A CG   7  
ATOM 7255  C CD   . GLU A 1 49 ? -3.270  -16.856 -1.508  1.00 0.00 ? 49 GLU A CD   7  
ATOM 7256  O OE1  . GLU A 1 49 ? -4.167  -16.423 -2.261  1.00 0.00 ? 49 GLU A OE1  7  
ATOM 7257  O OE2  . GLU A 1 49 ? -3.246  -18.027 -1.074  1.00 0.00 ? 49 GLU A OE2  7  
ATOM 7258  H H    . GLU A 1 49 ? -0.234  -14.944 -2.929  1.00 0.00 ? 49 GLU A H    7  
ATOM 7259  H HA   . GLU A 1 49 ? -1.422  -12.585 -1.712  1.00 0.00 ? 49 GLU A HA   7  
ATOM 7260  H HB2  . GLU A 1 49 ? -3.136  -14.038 -0.911  1.00 0.00 ? 49 GLU A HB2  7  
ATOM 7261  H HB3  . GLU A 1 49 ? -2.790  -14.518 -2.567  1.00 0.00 ? 49 GLU A HB3  7  
ATOM 7262  H HG2  . GLU A 1 49 ? -1.230  -16.265 -1.526  1.00 0.00 ? 49 GLU A HG2  7  
ATOM 7263  H HG3  . GLU A 1 49 ? -2.080  -15.921 -0.020  1.00 0.00 ? 49 GLU A HG3  7  
ATOM 7264  N N    . GLN A 1 50 ? 0.809   -13.290 -0.133  1.00 0.00 ? 50 GLN A N    7  
ATOM 7265  C CA   . GLN A 1 50 ? 1.569   -13.335 1.109   1.00 0.00 ? 50 GLN A CA   7  
ATOM 7266  C C    . GLN A 1 50 ? 1.024   -12.323 2.114   1.00 0.00 ? 50 GLN A C    7  
ATOM 7267  O O    . GLN A 1 50 ? 0.870   -12.629 3.296   1.00 0.00 ? 50 GLN A O    7  
ATOM 7268  C CB   . GLN A 1 50 ? 3.049   -13.058 0.835   1.00 0.00 ? 50 GLN A CB   7  
ATOM 7269  C CG   . GLN A 1 50 ? 3.759   -14.200 0.125   1.00 0.00 ? 50 GLN A CG   7  
ATOM 7270  C CD   . GLN A 1 50 ? 5.003   -13.747 -0.608  1.00 0.00 ? 50 GLN A CD   7  
ATOM 7271  O OE1  . GLN A 1 50 ? 5.034   -12.668 -1.197  1.00 0.00 ? 50 GLN A OE1  7  
ATOM 7272  N NE2  . GLN A 1 50 ? 6.036   -14.577 -0.575  1.00 0.00 ? 50 GLN A NE2  7  
ATOM 7273  H H    . GLN A 1 50 ? 1.232   -12.931 -0.939  1.00 0.00 ? 50 GLN A H    7  
ATOM 7274  H HA   . GLN A 1 50 ? 1.467   -14.327 1.525   1.00 0.00 ? 50 GLN A HA   7  
ATOM 7275  H HB2  . GLN A 1 50 ? 3.130   -12.175 0.220   1.00 0.00 ? 50 GLN A HB2  7  
ATOM 7276  H HB3  . GLN A 1 50 ? 3.551   -12.879 1.775   1.00 0.00 ? 50 GLN A HB3  7  
ATOM 7277  H HG2  . GLN A 1 50 ? 4.044   -14.941 0.857   1.00 0.00 ? 50 GLN A HG2  7  
ATOM 7278  H HG3  . GLN A 1 50 ? 3.080   -14.642 -0.588  1.00 0.00 ? 50 GLN A HG3  7  
ATOM 7279  H HE21 . GLN A 1 50 ? 5.938   -15.420 -0.086  1.00 0.00 ? 50 GLN A HE21 7  
ATOM 7280  H HE22 . GLN A 1 50 ? 6.854   -14.313 -1.040  1.00 0.00 ? 50 GLN A HE22 7  
ATOM 7281  N N    . TYR A 1 51 ? 0.733   -11.119 1.631   1.00 0.00 ? 51 TYR A N    7  
ATOM 7282  C CA   . TYR A 1 51 ? 0.196   -10.061 2.482   1.00 0.00 ? 51 TYR A CA   7  
ATOM 7283  C C    . TYR A 1 51 ? -0.883  -9.274  1.746   1.00 0.00 ? 51 TYR A C    7  
ATOM 7284  O O    . TYR A 1 51 ? -1.069  -8.082  1.986   1.00 0.00 ? 51 TYR A O    7  
ATOM 7285  C CB   . TYR A 1 51 ? 1.313   -9.116  2.936   1.00 0.00 ? 51 TYR A CB   7  
ATOM 7286  C CG   . TYR A 1 51 ? 2.657   -9.790  3.102   1.00 0.00 ? 51 TYR A CG   7  
ATOM 7287  C CD1  . TYR A 1 51 ? 2.991   -10.438 4.286   1.00 0.00 ? 51 TYR A CD1  7  
ATOM 7288  C CD2  . TYR A 1 51 ? 3.592   -9.779  2.075   1.00 0.00 ? 51 TYR A CD2  7  
ATOM 7289  C CE1  . TYR A 1 51 ? 4.219   -11.054 4.441   1.00 0.00 ? 51 TYR A CE1  7  
ATOM 7290  C CE2  . TYR A 1 51 ? 4.821   -10.394 2.221   1.00 0.00 ? 51 TYR A CE2  7  
ATOM 7291  C CZ   . TYR A 1 51 ? 5.130   -11.031 3.405   1.00 0.00 ? 51 TYR A CZ   7  
ATOM 7292  O OH   . TYR A 1 51 ? 6.352   -11.643 3.556   1.00 0.00 ? 51 TYR A OH   7  
ATOM 7293  H H    . TYR A 1 51 ? 0.875   -10.939 0.679   1.00 0.00 ? 51 TYR A H    7  
ATOM 7294  H HA   . TYR A 1 51 ? -0.245  -10.529 3.351   1.00 0.00 ? 51 TYR A HA   7  
ATOM 7295  H HB2  . TYR A 1 51 ? 1.426   -8.329  2.205   1.00 0.00 ? 51 TYR A HB2  7  
ATOM 7296  H HB3  . TYR A 1 51 ? 1.041   -8.681  3.886   1.00 0.00 ? 51 TYR A HB3  7  
ATOM 7297  H HD1  . TYR A 1 51 ? 2.275   -10.456 5.094   1.00 0.00 ? 51 TYR A HD1  7  
ATOM 7298  H HD2  . TYR A 1 51 ? 3.348   -9.281  1.149   1.00 0.00 ? 51 TYR A HD2  7  
ATOM 7299  H HE1  . TYR A 1 51 ? 4.459   -11.553 5.368   1.00 0.00 ? 51 TYR A HE1  7  
ATOM 7300  H HE2  . TYR A 1 51 ? 5.535   -10.375 1.411   1.00 0.00 ? 51 TYR A HE2  7  
ATOM 7301  H HH   . TYR A 1 51 ? 6.221   -12.569 3.777   1.00 0.00 ? 51 TYR A HH   7  
ATOM 7302  N N    . ARG A 1 52 ? -1.586  -9.951  0.844   1.00 0.00 ? 52 ARG A N    7  
ATOM 7303  C CA   . ARG A 1 52 ? -2.647  -9.322  0.063   1.00 0.00 ? 52 ARG A CA   7  
ATOM 7304  C C    . ARG A 1 52 ? -3.592  -8.528  0.961   1.00 0.00 ? 52 ARG A C    7  
ATOM 7305  O O    . ARG A 1 52 ? -3.878  -7.359  0.699   1.00 0.00 ? 52 ARG A O    7  
ATOM 7306  C CB   . ARG A 1 52 ? -3.430  -10.390 -0.702  1.00 0.00 ? 52 ARG A CB   7  
ATOM 7307  C CG   . ARG A 1 52 ? -3.762  -10.007 -2.136  1.00 0.00 ? 52 ARG A CG   7  
ATOM 7308  C CD   . ARG A 1 52 ? -4.273  -11.204 -2.920  1.00 0.00 ? 52 ARG A CD   7  
ATOM 7309  N NE   . ARG A 1 52 ? -5.515  -11.730 -2.360  1.00 0.00 ? 52 ARG A NE   7  
ATOM 7310  C CZ   . ARG A 1 52 ? -6.181  -12.756 -2.880  1.00 0.00 ? 52 ARG A CZ   7  
ATOM 7311  N NH1  . ARG A 1 52 ? -5.726  -13.363 -3.967  1.00 0.00 ? 52 ARG A NH1  7  
ATOM 7312  N NH2  . ARG A 1 52 ? -7.303  -13.175 -2.311  1.00 0.00 ? 52 ARG A NH2  7  
ATOM 7313  H H    . ARG A 1 52 ? -1.388  -10.899 0.698   1.00 0.00 ? 52 ARG A H    7  
ATOM 7314  H HA   . ARG A 1 52 ? -2.185  -8.647  -0.642  1.00 0.00 ? 52 ARG A HA   7  
ATOM 7315  H HB2  . ARG A 1 52 ? -2.847  -11.299 -0.723  1.00 0.00 ? 52 ARG A HB2  7  
ATOM 7316  H HB3  . ARG A 1 52 ? -4.356  -10.582 -0.182  1.00 0.00 ? 52 ARG A HB3  7  
ATOM 7317  H HG2  . ARG A 1 52 ? -4.524  -9.242  -2.131  1.00 0.00 ? 52 ARG A HG2  7  
ATOM 7318  H HG3  . ARG A 1 52 ? -2.872  -9.629  -2.616  1.00 0.00 ? 52 ARG A HG3  7  
ATOM 7319  H HD2  . ARG A 1 52 ? -4.447  -10.903 -3.940  1.00 0.00 ? 52 ARG A HD2  7  
ATOM 7320  H HD3  . ARG A 1 52 ? -3.523  -11.981 -2.896  1.00 0.00 ? 52 ARG A HD3  7  
ATOM 7321  H HE   . ARG A 1 52 ? -5.869  -11.296 -1.556  1.00 0.00 ? 52 ARG A HE   7  
ATOM 7322  H HH11 . ARG A 1 52 ? -4.879  -13.049 -4.398  1.00 0.00 ? 52 ARG A HH11 7  
ATOM 7323  H HH12 . ARG A 1 52 ? -6.227  -14.135 -4.357  1.00 0.00 ? 52 ARG A HH12 7  
ATOM 7324  H HH21 . ARG A 1 52 ? -7.648  -12.719 -1.491  1.00 0.00 ? 52 ARG A HH21 7  
ATOM 7325  H HH22 . ARG A 1 52 ? -7.804  -13.947 -2.703  1.00 0.00 ? 52 ARG A HH22 7  
ATOM 7326  N N    . MET A 1 53 ? -4.075  -9.170  2.021   1.00 0.00 ? 53 MET A N    7  
ATOM 7327  C CA   . MET A 1 53 ? -4.998  -8.528  2.950   1.00 0.00 ? 53 MET A CA   7  
ATOM 7328  C C    . MET A 1 53 ? -4.360  -7.311  3.611   1.00 0.00 ? 53 MET A C    7  
ATOM 7329  O O    . MET A 1 53 ? -4.913  -6.211  3.571   1.00 0.00 ? 53 MET A O    7  
ATOM 7330  C CB   . MET A 1 53 ? -5.450  -9.524  4.020   1.00 0.00 ? 53 MET A CB   7  
ATOM 7331  C CG   . MET A 1 53 ? -6.185  -10.729 3.456   1.00 0.00 ? 53 MET A CG   7  
ATOM 7332  S SD   . MET A 1 53 ? -7.238  -11.538 4.674   1.00 0.00 ? 53 MET A SD   7  
ATOM 7333  C CE   . MET A 1 53 ? -8.760  -11.707 3.747   1.00 0.00 ? 53 MET A CE   7  
ATOM 7334  H H    . MET A 1 53 ? -3.815  -10.103 2.173   1.00 0.00 ? 53 MET A H    7  
ATOM 7335  H HA   . MET A 1 53 ? -5.859  -8.204  2.387   1.00 0.00 ? 53 MET A HA   7  
ATOM 7336  H HB2  . MET A 1 53 ? -4.582  -9.878  4.557   1.00 0.00 ? 53 MET A HB2  7  
ATOM 7337  H HB3  . MET A 1 53 ? -6.108  -9.020  4.712   1.00 0.00 ? 53 MET A HB3  7  
ATOM 7338  H HG2  . MET A 1 53 ? -6.801  -10.402 2.631   1.00 0.00 ? 53 MET A HG2  7  
ATOM 7339  H HG3  . MET A 1 53 ? -5.458  -11.443 3.100   1.00 0.00 ? 53 MET A HG3  7  
ATOM 7340  H HE1  . MET A 1 53 ? -9.325  -12.543 4.132   1.00 0.00 ? 53 MET A HE1  7  
ATOM 7341  H HE2  . MET A 1 53 ? -8.529  -11.877 2.706   1.00 0.00 ? 53 MET A HE2  7  
ATOM 7342  H HE3  . MET A 1 53 ? -9.343  -10.804 3.843   1.00 0.00 ? 53 MET A HE3  7  
ATOM 7343  N N    . THR A 1 54 ? -3.195  -7.511  4.222   1.00 0.00 ? 54 THR A N    7  
ATOM 7344  C CA   . THR A 1 54 ? -2.486  -6.424  4.895   1.00 0.00 ? 54 THR A CA   7  
ATOM 7345  C C    . THR A 1 54 ? -2.418  -5.183  4.009   1.00 0.00 ? 54 THR A C    7  
ATOM 7346  O O    . THR A 1 54 ? -2.735  -4.076  4.447   1.00 0.00 ? 54 THR A O    7  
ATOM 7347  C CB   . THR A 1 54 ? -1.073  -6.868  5.278   1.00 0.00 ? 54 THR A CB   7  
ATOM 7348  O OG1  . THR A 1 54 ? -1.119  -7.914  6.232   1.00 0.00 ? 54 THR A OG1  7  
ATOM 7349  C CG2  . THR A 1 54 ? -0.228  -5.752  5.857   1.00 0.00 ? 54 THR A CG2  7  
ATOM 7350  H H    . THR A 1 54 ? -2.803  -8.409  4.222   1.00 0.00 ? 54 THR A H    7  
ATOM 7351  H HA   . THR A 1 54 ? -3.034  -6.180  5.793   1.00 0.00 ? 54 THR A HA   7  
ATOM 7352  H HB   . THR A 1 54 ? -0.570  -7.235  4.396   1.00 0.00 ? 54 THR A HB   7  
ATOM 7353  H HG1  . THR A 1 54 ? -0.227  -8.143  6.500   1.00 0.00 ? 54 THR A HG1  7  
ATOM 7354  H HG21 . THR A 1 54 ? 0.773   -6.113  6.035   1.00 0.00 ? 54 THR A HG21 7  
ATOM 7355  H HG22 . THR A 1 54 ? -0.662  -5.419  6.789   1.00 0.00 ? 54 THR A HG22 7  
ATOM 7356  H HG23 . THR A 1 54 ? -0.195  -4.926  5.161   1.00 0.00 ? 54 THR A HG23 7  
ATOM 7357  N N    . ILE A 1 55 ? -2.009  -5.379  2.760   1.00 0.00 ? 55 ILE A N    7  
ATOM 7358  C CA   . ILE A 1 55 ? -1.909  -4.277  1.815   1.00 0.00 ? 55 ILE A CA   7  
ATOM 7359  C C    . ILE A 1 55 ? -3.262  -3.597  1.633   1.00 0.00 ? 55 ILE A C    7  
ATOM 7360  O O    . ILE A 1 55 ? -3.350  -2.371  1.586   1.00 0.00 ? 55 ILE A O    7  
ATOM 7361  C CB   . ILE A 1 55 ? -1.386  -4.744  0.446   1.00 0.00 ? 55 ILE A CB   7  
ATOM 7362  C CG1  . ILE A 1 55 ? -0.093  -5.544  0.613   1.00 0.00 ? 55 ILE A CG1  7  
ATOM 7363  C CG2  . ILE A 1 55 ? -1.162  -3.549  -0.467  1.00 0.00 ? 55 ILE A CG2  7  
ATOM 7364  C CD1  . ILE A 1 55 ? 0.044   -6.688  -0.368  1.00 0.00 ? 55 ILE A CD1  7  
ATOM 7365  H H    . ILE A 1 55 ? -1.777  -6.285  2.468   1.00 0.00 ? 55 ILE A H    7  
ATOM 7366  H HA   . ILE A 1 55 ? -1.209  -3.560  2.215   1.00 0.00 ? 55 ILE A HA   7  
ATOM 7367  H HB   . ILE A 1 55 ? -2.138  -5.375  -0.005  1.00 0.00 ? 55 ILE A HB   7  
ATOM 7368  H HG12 . ILE A 1 55 ? 0.751   -4.885  0.473   1.00 0.00 ? 55 ILE A HG12 7  
ATOM 7369  H HG13 . ILE A 1 55 ? -0.059  -5.957  1.610   1.00 0.00 ? 55 ILE A HG13 7  
ATOM 7370  H HG21 . ILE A 1 55 ? -0.143  -3.554  -0.822  1.00 0.00 ? 55 ILE A HG21 7  
ATOM 7371  H HG22 . ILE A 1 55 ? -1.347  -2.638  0.082   1.00 0.00 ? 55 ILE A HG22 7  
ATOM 7372  H HG23 . ILE A 1 55 ? -1.835  -3.605  -1.308  1.00 0.00 ? 55 ILE A HG23 7  
ATOM 7373  H HD11 . ILE A 1 55 ? -0.922  -6.916  -0.792  1.00 0.00 ? 55 ILE A HD11 7  
ATOM 7374  H HD12 . ILE A 1 55 ? 0.427   -7.558  0.145   1.00 0.00 ? 55 ILE A HD12 7  
ATOM 7375  H HD13 . ILE A 1 55 ? 0.726   -6.405  -1.157  1.00 0.00 ? 55 ILE A HD13 7  
ATOM 7376  N N    . TRP A 1 56 ? -4.317  -4.403  1.549   1.00 0.00 ? 56 TRP A N    7  
ATOM 7377  C CA   . TRP A 1 56 ? -5.667  -3.878  1.401   1.00 0.00 ? 56 TRP A CA   7  
ATOM 7378  C C    . TRP A 1 56 ? -6.044  -3.035  2.620   1.00 0.00 ? 56 TRP A C    7  
ATOM 7379  O O    . TRP A 1 56 ? -6.561  -1.926  2.484   1.00 0.00 ? 56 TRP A O    7  
ATOM 7380  C CB   . TRP A 1 56 ? -6.655  -5.037  1.211   1.00 0.00 ? 56 TRP A CB   7  
ATOM 7381  C CG   . TRP A 1 56 ? -8.091  -4.670  1.439   1.00 0.00 ? 56 TRP A CG   7  
ATOM 7382  C CD1  . TRP A 1 56 ? -8.717  -3.518  1.059   1.00 0.00 ? 56 TRP A CD1  7  
ATOM 7383  C CD2  . TRP A 1 56 ? -9.073  -5.457  2.115   1.00 0.00 ? 56 TRP A CD2  7  
ATOM 7384  N NE1  . TRP A 1 56 ? -10.033 -3.548  1.454   1.00 0.00 ? 56 TRP A NE1  7  
ATOM 7385  C CE2  . TRP A 1 56 ? -10.274 -4.727  2.101   1.00 0.00 ? 56 TRP A CE2  7  
ATOM 7386  C CE3  . TRP A 1 56 ? -9.055  -6.714  2.724   1.00 0.00 ? 56 TRP A CE3  7  
ATOM 7387  C CZ2  . TRP A 1 56 ? -11.444 -5.205  2.674   1.00 0.00 ? 56 TRP A CZ2  7  
ATOM 7388  C CZ3  . TRP A 1 56 ? -10.221 -7.193  3.295   1.00 0.00 ? 56 TRP A CZ3  7  
ATOM 7389  C CH2  . TRP A 1 56 ? -11.402 -6.439  3.266   1.00 0.00 ? 56 TRP A CH2  7  
ATOM 7390  H H    . TRP A 1 56 ? -4.187  -5.374  1.604   1.00 0.00 ? 56 TRP A H    7  
ATOM 7391  H HA   . TRP A 1 56 ? -5.685  -3.249  0.523   1.00 0.00 ? 56 TRP A HA   7  
ATOM 7392  H HB2  . TRP A 1 56 ? -6.565  -5.411  0.202   1.00 0.00 ? 56 TRP A HB2  7  
ATOM 7393  H HB3  . TRP A 1 56 ? -6.403  -5.828  1.902   1.00 0.00 ? 56 TRP A HB3  7  
ATOM 7394  H HD1  . TRP A 1 56 ? -8.235  -2.712  0.526   1.00 0.00 ? 56 TRP A HD1  7  
ATOM 7395  H HE1  . TRP A 1 56 ? -10.693 -2.842  1.297   1.00 0.00 ? 56 TRP A HE1  7  
ATOM 7396  H HE3  . TRP A 1 56 ? -8.150  -7.306  2.754   1.00 0.00 ? 56 TRP A HE3  7  
ATOM 7397  H HZ2  . TRP A 1 56 ? -12.358 -4.633  2.656   1.00 0.00 ? 56 TRP A HZ2  7  
ATOM 7398  H HZ3  . TRP A 1 56 ? -10.227 -8.161  3.773   1.00 0.00 ? 56 TRP A HZ3  7  
ATOM 7399  H HH2  . TRP A 1 56 ? -12.289 -6.850  3.724   1.00 0.00 ? 56 TRP A HH2  7  
ATOM 7400  N N    . ARG A 1 57 ? -5.771  -3.568  3.808   1.00 0.00 ? 57 ARG A N    7  
ATOM 7401  C CA   . ARG A 1 57 ? -6.073  -2.864  5.052   1.00 0.00 ? 57 ARG A CA   7  
ATOM 7402  C C    . ARG A 1 57 ? -5.554  -1.433  5.004   1.00 0.00 ? 57 ARG A C    7  
ATOM 7403  O O    . ARG A 1 57 ? -6.320  -0.477  5.112   1.00 0.00 ? 57 ARG A O    7  
ATOM 7404  C CB   . ARG A 1 57 ? -5.459  -3.604  6.244   1.00 0.00 ? 57 ARG A CB   7  
ATOM 7405  C CG   . ARG A 1 57 ? -5.796  -5.085  6.281   1.00 0.00 ? 57 ARG A CG   7  
ATOM 7406  C CD   . ARG A 1 57 ? -6.790  -5.404  7.386   1.00 0.00 ? 57 ARG A CD   7  
ATOM 7407  N NE   . ARG A 1 57 ? -6.136  -5.936  8.579   1.00 0.00 ? 57 ARG A NE   7  
ATOM 7408  C CZ   . ARG A 1 57 ? -5.720  -7.192  8.693   1.00 0.00 ? 57 ARG A CZ   7  
ATOM 7409  N NH1  . ARG A 1 57 ? -5.885  -8.040  7.688   1.00 0.00 ? 57 ARG A NH1  7  
ATOM 7410  N NH2  . ARG A 1 57 ? -5.136  -7.601  9.811   1.00 0.00 ? 57 ARG A NH2  7  
ATOM 7411  H H    . ARG A 1 57 ? -5.356  -4.453  3.848   1.00 0.00 ? 57 ARG A H    7  
ATOM 7412  H HA   . ARG A 1 57 ? -7.144  -2.841  5.166   1.00 0.00 ? 57 ARG A HA   7  
ATOM 7413  H HB2  . ARG A 1 57 ? -4.384  -3.500  6.202   1.00 0.00 ? 57 ARG A HB2  7  
ATOM 7414  H HB3  . ARG A 1 57 ? -5.820  -3.152  7.157   1.00 0.00 ? 57 ARG A HB3  7  
ATOM 7415  H HG2  . ARG A 1 57 ? -6.224  -5.371  5.332   1.00 0.00 ? 57 ARG A HG2  7  
ATOM 7416  H HG3  . ARG A 1 57 ? -4.889  -5.646  6.453   1.00 0.00 ? 57 ARG A HG3  7  
ATOM 7417  H HD2  . ARG A 1 57 ? -7.318  -4.500  7.650   1.00 0.00 ? 57 ARG A HD2  7  
ATOM 7418  H HD3  . ARG A 1 57 ? -7.494  -6.137  7.019   1.00 0.00 ? 57 ARG A HD3  7  
ATOM 7419  H HE   . ARG A 1 57 ? -6.006  -5.325  9.336   1.00 0.00 ? 57 ARG A HE   7  
ATOM 7420  H HH11 . ARG A 1 57 ? -6.325  -7.736  6.843   1.00 0.00 ? 57 ARG A HH11 7  
ATOM 7421  H HH12 . ARG A 1 57 ? -5.570  -8.985  7.774   1.00 0.00 ? 57 ARG A HH12 7  
ATOM 7422  H HH21 . ARG A 1 57 ? -5.010  -6.963  10.571  1.00 0.00 ? 57 ARG A HH21 7  
ATOM 7423  H HH22 . ARG A 1 57 ? -4.822  -8.546  9.895   1.00 0.00 ? 57 ARG A HH22 7  
ATOM 7424  N N    . GLY A 1 58 ? -4.246  -1.295  4.832   1.00 0.00 ? 58 GLY A N    7  
ATOM 7425  C CA   . GLY A 1 58 ? -3.648  0.019   4.739   1.00 0.00 ? 58 GLY A CA   7  
ATOM 7426  C C    . GLY A 1 58 ? -4.252  0.829   3.614   1.00 0.00 ? 58 GLY A C    7  
ATOM 7427  O O    . GLY A 1 58 ? -4.342  2.054   3.699   1.00 0.00 ? 58 GLY A O    7  
ATOM 7428  H H    . GLY A 1 58 ? -3.690  -2.090  4.736   1.00 0.00 ? 58 GLY A H    7  
ATOM 7429  H HA2  . GLY A 1 58 ? -3.800  0.542   5.672   1.00 0.00 ? 58 GLY A HA2  7  
ATOM 7430  H HA3  . GLY A 1 58 ? -2.587  -0.089  4.565   1.00 0.00 ? 58 GLY A HA3  7  
ATOM 7431  N N    . LEU A 1 59 ? -4.686  0.138   2.564   1.00 0.00 ? 59 LEU A N    7  
ATOM 7432  C CA   . LEU A 1 59 ? -5.314  0.800   1.429   1.00 0.00 ? 59 LEU A CA   7  
ATOM 7433  C C    . LEU A 1 59 ? -6.694  1.316   1.815   1.00 0.00 ? 59 LEU A C    7  
ATOM 7434  O O    . LEU A 1 59 ? -7.193  2.283   1.242   1.00 0.00 ? 59 LEU A O    7  
ATOM 7435  C CB   . LEU A 1 59 ? -5.404  -0.144  0.236   1.00 0.00 ? 59 LEU A CB   7  
ATOM 7436  C CG   . LEU A 1 59 ? -4.626  0.318   -0.994  1.00 0.00 ? 59 LEU A CG   7  
ATOM 7437  C CD1  . LEU A 1 59 ? -3.211  0.717   -0.604  1.00 0.00 ? 59 LEU A CD1  7  
ATOM 7438  C CD2  . LEU A 1 59 ? -4.599  -0.775  -2.049  1.00 0.00 ? 59 LEU A CD2  7  
ATOM 7439  H H    . LEU A 1 59 ? -4.599  -0.838  2.562   1.00 0.00 ? 59 LEU A H    7  
ATOM 7440  H HA   . LEU A 1 59 ? -4.694  1.641   1.161   1.00 0.00 ? 59 LEU A HA   7  
ATOM 7441  H HB2  . LEU A 1 59 ? -5.021  -1.106  0.538   1.00 0.00 ? 59 LEU A HB2  7  
ATOM 7442  H HB3  . LEU A 1 59 ? -6.443  -0.255  -0.036  1.00 0.00 ? 59 LEU A HB3  7  
ATOM 7443  H HG   . LEU A 1 59 ? -5.114  1.188   -1.415  1.00 0.00 ? 59 LEU A HG   7  
ATOM 7444  H HD11 . LEU A 1 59 ? -3.060  0.529   0.448   1.00 0.00 ? 59 LEU A HD11 7  
ATOM 7445  H HD12 . LEU A 1 59 ? -3.066  1.768   -0.806  1.00 0.00 ? 59 LEU A HD12 7  
ATOM 7446  H HD13 . LEU A 1 59 ? -2.503  0.140   -1.179  1.00 0.00 ? 59 LEU A HD13 7  
ATOM 7447  H HD21 . LEU A 1 59 ? -4.180  -0.382  -2.963  1.00 0.00 ? 59 LEU A HD21 7  
ATOM 7448  H HD22 . LEU A 1 59 ? -5.605  -1.122  -2.234  1.00 0.00 ? 59 LEU A HD22 7  
ATOM 7449  H HD23 . LEU A 1 59 ? -3.992  -1.598  -1.700  1.00 0.00 ? 59 LEU A HD23 7  
ATOM 7450  N N    . GLN A 1 60 ? -7.306  0.679   2.806   1.00 0.00 ? 60 GLN A N    7  
ATOM 7451  C CA   . GLN A 1 60 ? -8.566  1.172   3.336   1.00 0.00 ? 60 GLN A CA   7  
ATOM 7452  C C    . GLN A 1 60 ? -8.320  2.485   4.086   1.00 0.00 ? 60 GLN A C    7  
ATOM 7453  O O    . GLN A 1 60 ? -9.257  3.218   4.401   1.00 0.00 ? 60 GLN A O    7  
ATOM 7454  C CB   . GLN A 1 60 ? -9.205  0.140   4.269   1.00 0.00 ? 60 GLN A CB   7  
ATOM 7455  C CG   . GLN A 1 60 ? -9.710  -1.101  3.550   1.00 0.00 ? 60 GLN A CG   7  
ATOM 7456  C CD   . GLN A 1 60 ? -10.248 -2.149  4.505   1.00 0.00 ? 60 GLN A CD   7  
ATOM 7457  O OE1  . GLN A 1 60 ? -11.276 -1.947  5.152   1.00 0.00 ? 60 GLN A OE1  7  
ATOM 7458  N NE2  . GLN A 1 60 ? -9.554  -3.277  4.598   1.00 0.00 ? 60 GLN A NE2  7  
ATOM 7459  H H    . GLN A 1 60 ? -6.844  -0.053  3.267   1.00 0.00 ? 60 GLN A H    7  
ATOM 7460  H HA   . GLN A 1 60 ? -9.229  1.363   2.505   1.00 0.00 ? 60 GLN A HA   7  
ATOM 7461  H HB2  . GLN A 1 60 ? -8.476  -0.167  5.002   1.00 0.00 ? 60 GLN A HB2  7  
ATOM 7462  H HB3  . GLN A 1 60 ? -10.040 0.599   4.777   1.00 0.00 ? 60 GLN A HB3  7  
ATOM 7463  H HG2  . GLN A 1 60 ? -10.500 -0.814  2.874   1.00 0.00 ? 60 GLN A HG2  7  
ATOM 7464  H HG3  . GLN A 1 60 ? -8.895  -1.532  2.989   1.00 0.00 ? 60 GLN A HG3  7  
ATOM 7465  H HE21 . GLN A 1 60 ? -8.744  -3.369  4.054   1.00 0.00 ? 60 GLN A HE21 7  
ATOM 7466  H HE22 . GLN A 1 60 ? -9.879  -3.972  5.209   1.00 0.00 ? 60 GLN A HE22 7  
ATOM 7467  N N    . ASP A 1 61 ? -7.040  2.782   4.342   1.00 0.00 ? 61 ASP A N    7  
ATOM 7468  C CA   . ASP A 1 61 ? -6.647  3.994   5.038   1.00 0.00 ? 61 ASP A CA   7  
ATOM 7469  C C    . ASP A 1 61 ? -6.595  5.183   4.079   1.00 0.00 ? 61 ASP A C    7  
ATOM 7470  O O    . ASP A 1 61 ? -6.957  6.301   4.446   1.00 0.00 ? 61 ASP A O    7  
ATOM 7471  C CB   . ASP A 1 61 ? -5.280  3.788   5.695   1.00 0.00 ? 61 ASP A CB   7  
ATOM 7472  C CG   . ASP A 1 61 ? -5.239  4.300   7.122   1.00 0.00 ? 61 ASP A CG   7  
ATOM 7473  O OD1  . ASP A 1 61 ? -5.677  5.447   7.353   1.00 0.00 ? 61 ASP A OD1  7  
ATOM 7474  O OD2  . ASP A 1 61 ? -4.769  3.556   8.008   1.00 0.00 ? 61 ASP A OD2  7  
ATOM 7475  H H    . ASP A 1 61 ? -6.338  2.160   4.070   1.00 0.00 ? 61 ASP A H    7  
ATOM 7476  H HA   . ASP A 1 61 ? -7.384  4.194   5.803   1.00 0.00 ? 61 ASP A HA   7  
ATOM 7477  H HB2  . ASP A 1 61 ? -5.047  2.729   5.703   1.00 0.00 ? 61 ASP A HB2  7  
ATOM 7478  H HB3  . ASP A 1 61 ? -4.529  4.311   5.123   1.00 0.00 ? 61 ASP A HB3  7  
ATOM 7479  N N    . LEU A 1 62 ? -6.142  4.942   2.848   1.00 0.00 ? 62 LEU A N    7  
ATOM 7480  C CA   . LEU A 1 62 ? -6.063  6.011   1.851   1.00 0.00 ? 62 LEU A CA   7  
ATOM 7481  C C    . LEU A 1 62 ? -7.409  6.714   1.727   1.00 0.00 ? 62 LEU A C    7  
ATOM 7482  O O    . LEU A 1 62 ? -7.475  7.925   1.519   1.00 0.00 ? 62 LEU A O    7  
ATOM 7483  C CB   . LEU A 1 62 ? -5.639  5.483   0.471   1.00 0.00 ? 62 LEU A CB   7  
ATOM 7484  C CG   . LEU A 1 62 ? -4.809  4.197   0.450   1.00 0.00 ? 62 LEU A CG   7  
ATOM 7485  C CD1  . LEU A 1 62 ? -4.285  3.935   -0.953  1.00 0.00 ? 62 LEU A CD1  7  
ATOM 7486  C CD2  . LEU A 1 62 ? -3.662  4.262   1.440   1.00 0.00 ? 62 LEU A CD2  7  
ATOM 7487  H H    . LEU A 1 62 ? -5.872  4.033   2.605   1.00 0.00 ? 62 LEU A H    7  
ATOM 7488  H HA   . LEU A 1 62 ? -5.328  6.726   2.193   1.00 0.00 ? 62 LEU A HA   7  
ATOM 7489  H HB2  . LEU A 1 62 ? -6.533  5.305   -0.106  1.00 0.00 ? 62 LEU A HB2  7  
ATOM 7490  H HB3  . LEU A 1 62 ? -5.068  6.256   -0.020  1.00 0.00 ? 62 LEU A HB3  7  
ATOM 7491  H HG   . LEU A 1 62 ? -5.436  3.371   0.727   1.00 0.00 ? 62 LEU A HG   7  
ATOM 7492  H HD11 . LEU A 1 62 ? -4.821  3.105   -1.386  1.00 0.00 ? 62 LEU A HD11 7  
ATOM 7493  H HD12 . LEU A 1 62 ? -3.234  3.700   -0.907  1.00 0.00 ? 62 LEU A HD12 7  
ATOM 7494  H HD13 . LEU A 1 62 ? -4.432  4.816   -1.562  1.00 0.00 ? 62 LEU A HD13 7  
ATOM 7495  H HD21 . LEU A 1 62 ? -3.861  5.025   2.177   1.00 0.00 ? 62 LEU A HD21 7  
ATOM 7496  H HD22 . LEU A 1 62 ? -2.748  4.497   0.914   1.00 0.00 ? 62 LEU A HD22 7  
ATOM 7497  H HD23 . LEU A 1 62 ? -3.559  3.303   1.928   1.00 0.00 ? 62 LEU A HD23 7  
ATOM 7498  N N    . LYS A 1 63 ? -8.480  5.937   1.851   1.00 0.00 ? 63 LYS A N    7  
ATOM 7499  C CA   . LYS A 1 63 ? -9.835  6.466   1.746   1.00 0.00 ? 63 LYS A CA   7  
ATOM 7500  C C    . LYS A 1 63 ? -10.070 7.588   2.753   1.00 0.00 ? 63 LYS A C    7  
ATOM 7501  O O    . LYS A 1 63 ? -10.320 8.733   2.376   1.00 0.00 ? 63 LYS A O    7  
ATOM 7502  C CB   . LYS A 1 63 ? -10.853 5.345   1.971   1.00 0.00 ? 63 LYS A CB   7  
ATOM 7503  C CG   . LYS A 1 63 ? -12.294 5.826   1.977   1.00 0.00 ? 63 LYS A CG   7  
ATOM 7504  C CD   . LYS A 1 63 ? -12.659 6.507   0.669   1.00 0.00 ? 63 LYS A CD   7  
ATOM 7505  C CE   . LYS A 1 63 ? -12.737 8.017   0.828   1.00 0.00 ? 63 LYS A CE   7  
ATOM 7506  N NZ   . LYS A 1 63 ? -13.847 8.602   0.028   1.00 0.00 ? 63 LYS A NZ   7  
ATOM 7507  H H    . LYS A 1 63 ? -8.356  4.978   2.012   1.00 0.00 ? 63 LYS A H    7  
ATOM 7508  H HA   . LYS A 1 63 ? -9.959  6.862   0.749   1.00 0.00 ? 63 LYS A HA   7  
ATOM 7509  H HB2  . LYS A 1 63 ? -10.743 4.612   1.184   1.00 0.00 ? 63 LYS A HB2  7  
ATOM 7510  H HB3  . LYS A 1 63 ? -10.648 4.873   2.919   1.00 0.00 ? 63 LYS A HB3  7  
ATOM 7511  H HG2  . LYS A 1 63 ? -12.946 4.977   2.124   1.00 0.00 ? 63 LYS A HG2  7  
ATOM 7512  H HG3  . LYS A 1 63 ? -12.426 6.529   2.787   1.00 0.00 ? 63 LYS A HG3  7  
ATOM 7513  H HD2  . LYS A 1 63 ? -11.907 6.271   -0.068  1.00 0.00 ? 63 LYS A HD2  7  
ATOM 7514  H HD3  . LYS A 1 63 ? -13.620 6.140   0.340   1.00 0.00 ? 63 LYS A HD3  7  
ATOM 7515  H HE2  . LYS A 1 63 ? -12.893 8.249   1.871   1.00 0.00 ? 63 LYS A HE2  7  
ATOM 7516  H HE3  . LYS A 1 63 ? -11.803 8.448   0.500   1.00 0.00 ? 63 LYS A HE3  7  
ATOM 7517  H HZ1  . LYS A 1 63 ? -14.711 8.034   0.147   1.00 0.00 ? 63 LYS A HZ1  7  
ATOM 7518  H HZ2  . LYS A 1 63 ? -13.592 8.620   -0.980  1.00 0.00 ? 63 LYS A HZ2  7  
ATOM 7519  H HZ3  . LYS A 1 63 ? -14.040 9.575   0.342   1.00 0.00 ? 63 LYS A HZ3  7  
ATOM 7520  N N    . GLN A 1 64 ? -9.984  7.252   4.037   1.00 0.00 ? 64 GLN A N    7  
ATOM 7521  C CA   . GLN A 1 64 ? -10.199 8.225   5.110   1.00 0.00 ? 64 GLN A CA   7  
ATOM 7522  C C    . GLN A 1 64 ? -9.532  9.563   4.798   1.00 0.00 ? 64 GLN A C    7  
ATOM 7523  O O    . GLN A 1 64 ? -10.188 10.605  4.781   1.00 0.00 ? 64 GLN A O    7  
ATOM 7524  C CB   . GLN A 1 64 ? -9.663  7.675   6.434   1.00 0.00 ? 64 GLN A CB   7  
ATOM 7525  C CG   . GLN A 1 64 ? -10.442 6.476   6.952   1.00 0.00 ? 64 GLN A CG   7  
ATOM 7526  C CD   . GLN A 1 64 ? -9.867  5.916   8.238   1.00 0.00 ? 64 GLN A CD   7  
ATOM 7527  O OE1  . GLN A 1 64 ? -9.664  6.643   9.210   1.00 0.00 ? 64 GLN A OE1  7  
ATOM 7528  N NE2  . GLN A 1 64 ? -9.605  4.615   8.250   1.00 0.00 ? 64 GLN A NE2  7  
ATOM 7529  H H    . GLN A 1 64 ? -9.790  6.321   4.272   1.00 0.00 ? 64 GLN A H    7  
ATOM 7530  H HA   . GLN A 1 64 ? -11.263 8.382   5.203   1.00 0.00 ? 64 GLN A HA   7  
ATOM 7531  H HB2  . GLN A 1 64 ? -8.634  7.377   6.298   1.00 0.00 ? 64 GLN A HB2  7  
ATOM 7532  H HB3  . GLN A 1 64 ? -9.706  8.455   7.179   1.00 0.00 ? 64 GLN A HB3  7  
ATOM 7533  H HG2  . GLN A 1 64 ? -11.462 6.778   7.133   1.00 0.00 ? 64 GLN A HG2  7  
ATOM 7534  H HG3  . GLN A 1 64 ? -10.425 5.701   6.200   1.00 0.00 ? 64 GLN A HG3  7  
ATOM 7535  H HE21 . GLN A 1 64 ? -9.793  4.097   7.439   1.00 0.00 ? 64 GLN A HE21 7  
ATOM 7536  H HE22 . GLN A 1 64 ? -9.233  4.224   9.069   1.00 0.00 ? 64 GLN A HE22 7  
ATOM 7537  N N    . GLY A 1 65 ? -8.228  9.527   4.546   1.00 0.00 ? 65 GLY A N    7  
ATOM 7538  C CA   . GLY A 1 65 ? -7.503  10.744  4.233   1.00 0.00 ? 65 GLY A CA   7  
ATOM 7539  C C    . GLY A 1 65 ? -6.003  10.577  4.365   1.00 0.00 ? 65 GLY A C    7  
ATOM 7540  O O    . GLY A 1 65 ? -5.456  10.656  5.464   1.00 0.00 ? 65 GLY A O    7  
ATOM 7541  H H    . GLY A 1 65 ? -7.756  8.668   4.571   1.00 0.00 ? 65 GLY A H    7  
ATOM 7542  H HA2  . GLY A 1 65 ? -7.734  11.037  3.219   1.00 0.00 ? 65 GLY A HA2  7  
ATOM 7543  H HA3  . GLY A 1 65 ? -7.826  11.526  4.905   1.00 0.00 ? 65 GLY A HA3  7  
ATOM 7544  N N    . HIS A 1 66 ? -5.335  10.348  3.239   1.00 0.00 ? 66 HIS A N    7  
ATOM 7545  C CA   . HIS A 1 66 ? -3.888  10.174  3.234   1.00 0.00 ? 66 HIS A CA   7  
ATOM 7546  C C    . HIS A 1 66 ? -3.221  11.212  2.342   1.00 0.00 ? 66 HIS A C    7  
ATOM 7547  O O    . HIS A 1 66 ? -3.075  11.012  1.136   1.00 0.00 ? 66 HIS A O    7  
ATOM 7548  C CB   . HIS A 1 66 ? -3.522  8.771   2.761   1.00 0.00 ? 66 HIS A CB   7  
ATOM 7549  C CG   . HIS A 1 66 ? -2.119  8.374   3.098   1.00 0.00 ? 66 HIS A CG   7  
ATOM 7550  N ND1  . HIS A 1 66 ? -1.223  7.903   2.161   1.00 0.00 ? 66 HIS A ND1  7  
ATOM 7551  C CD2  . HIS A 1 66 ? -1.456  8.380   4.279   1.00 0.00 ? 66 HIS A CD2  7  
ATOM 7552  C CE1  . HIS A 1 66 ? -0.071  7.637   2.751   1.00 0.00 ? 66 HIS A CE1  7  
ATOM 7553  N NE2  . HIS A 1 66 ? -0.186  7.918   4.034   1.00 0.00 ? 66 HIS A NE2  7  
ATOM 7554  H H    . HIS A 1 66 ? -5.826  10.297  2.393   1.00 0.00 ? 66 HIS A H    7  
ATOM 7555  H HA   . HIS A 1 66 ? -3.537  10.308  4.246   1.00 0.00 ? 66 HIS A HA   7  
ATOM 7556  H HB2  . HIS A 1 66 ? -4.189  8.062   3.223   1.00 0.00 ? 66 HIS A HB2  7  
ATOM 7557  H HB3  . HIS A 1 66 ? -3.633  8.722   1.689   1.00 0.00 ? 66 HIS A HB3  7  
ATOM 7558  H HD1  . HIS A 1 66 ? -1.404  7.781   1.206   1.00 0.00 ? 66 HIS A HD1  7  
ATOM 7559  H HD2  . HIS A 1 66 ? -1.853  8.691   5.236   1.00 0.00 ? 66 HIS A HD2  7  
ATOM 7560  H HE1  . HIS A 1 66 ? 0.815   7.255   2.265   1.00 0.00 ? 66 HIS A HE1  7  
ATOM 7561  H HE2  . HIS A 1 66 ? 0.521   7.813   4.704   1.00 0.00 ? 66 HIS A HE2  7  
ATOM 7562  N N    . ASP A 1 67 ? -2.827  12.322  2.950   1.00 0.00 ? 67 ASP A N    7  
ATOM 7563  C CA   . ASP A 1 67 ? -2.165  13.405  2.237   1.00 0.00 ? 67 ASP A CA   7  
ATOM 7564  C C    . ASP A 1 67 ? -2.050  14.637  3.121   1.00 0.00 ? 67 ASP A C    7  
ATOM 7565  O O    . ASP A 1 67 ? -2.956  14.951  3.894   1.00 0.00 ? 67 ASP A O    7  
ATOM 7566  C CB   . ASP A 1 67 ? -2.920  13.767  0.957   1.00 0.00 ? 67 ASP A CB   7  
ATOM 7567  C CG   . ASP A 1 67 ? -4.402  13.980  1.196   1.00 0.00 ? 67 ASP A CG   7  
ATOM 7568  O OD1  . ASP A 1 67 ? -5.038  13.098  1.811   1.00 0.00 ? 67 ASP A OD1  7  
ATOM 7569  O OD2  . ASP A 1 67 ? -4.928  15.030  0.769   1.00 0.00 ? 67 ASP A OD2  7  
ATOM 7570  H H    . ASP A 1 67 ? -2.969  12.405  3.912   1.00 0.00 ? 67 ASP A H    7  
ATOM 7571  H HA   . ASP A 1 67 ? -1.171  13.073  1.977   1.00 0.00 ? 67 ASP A HA   7  
ATOM 7572  H HB2  . ASP A 1 67 ? -2.504  14.681  0.553   1.00 0.00 ? 67 ASP A HB2  7  
ATOM 7573  H HB3  . ASP A 1 67 ? -2.799  12.973  0.235   1.00 0.00 ? 67 ASP A HB3  7  
ATOM 7574  N N    . TYR A 1 68 ? -0.935  15.341  2.976   1.00 0.00 ? 68 TYR A N    7  
ATOM 7575  C CA   . TYR A 1 68 ? -0.665  16.563  3.732   1.00 0.00 ? 68 TYR A CA   7  
ATOM 7576  C C    . TYR A 1 68 ? -1.929  17.409  3.912   1.00 0.00 ? 68 TYR A C    7  
ATOM 7577  O O    . TYR A 1 68 ? -2.303  17.673  5.075   1.00 0.00 ? 68 TYR A O    7  
ATOM 7578  C CB   . TYR A 1 68 ? 0.413   17.373  3.003   1.00 0.00 ? 68 TYR A CB   7  
ATOM 7579  C CG   . TYR A 1 68 ? 0.572   18.797  3.498   1.00 0.00 ? 68 TYR A CG   7  
ATOM 7580  C CD1  . TYR A 1 68 ? 0.422   19.105  4.846   1.00 0.00 ? 68 TYR A CD1  7  
ATOM 7581  C CD2  . TYR A 1 68 ? 0.868   19.831  2.618   1.00 0.00 ? 68 TYR A CD2  7  
ATOM 7582  C CE1  . TYR A 1 68 ? 0.565   20.403  5.301   1.00 0.00 ? 68 TYR A CE1  7  
ATOM 7583  C CE2  . TYR A 1 68 ? 1.013   21.130  3.066   1.00 0.00 ? 68 TYR A CE2  7  
ATOM 7584  C CZ   . TYR A 1 68 ? 0.860   21.410  4.408   1.00 0.00 ? 68 TYR A CZ   7  
ATOM 7585  O OH   . TYR A 1 68 ? 1.001   22.704  4.856   1.00 0.00 ? 68 TYR A OH   7  
ATOM 7586  O OXT  . TYR A 1 68 ? -2.532  17.798  2.890   1.00 0.00 ? 68 TYR A OXT  7  
ATOM 7587  H H    . TYR A 1 68 ? -0.265  15.025  2.337   1.00 0.00 ? 68 TYR A H    7  
ATOM 7588  H HA   . TYR A 1 68 ? -0.295  16.277  4.706   1.00 0.00 ? 68 TYR A HA   7  
ATOM 7589  H HB2  . TYR A 1 68 ? 1.364   16.876  3.123   1.00 0.00 ? 68 TYR A HB2  7  
ATOM 7590  H HB3  . TYR A 1 68 ? 0.165   17.409  1.951   1.00 0.00 ? 68 TYR A HB3  7  
ATOM 7591  H HD1  . TYR A 1 68 ? 0.191   18.313  5.543   1.00 0.00 ? 68 TYR A HD1  7  
ATOM 7592  H HD2  . TYR A 1 68 ? 0.987   19.608  1.569   1.00 0.00 ? 68 TYR A HD2  7  
ATOM 7593  H HE1  . TYR A 1 68 ? 0.446   20.622  6.351   1.00 0.00 ? 68 TYR A HE1  7  
ATOM 7594  H HE2  . TYR A 1 68 ? 1.244   21.920  2.366   1.00 0.00 ? 68 TYR A HE2  7  
ATOM 7595  H HH   . TYR A 1 68 ? 1.468   22.703  5.696   1.00 0.00 ? 68 TYR A HH   7  
ATOM 7596  N N    . TYR A 1 1  ? 3.736   19.347  -8.239  1.00 0.00 ? 1  TYR A N    8  
ATOM 7597  C CA   . TYR A 1 1  ? 3.352   17.949  -7.910  1.00 0.00 ? 1  TYR A CA   8  
ATOM 7598  C C    . TYR A 1 1  ? 4.536   17.172  -7.347  1.00 0.00 ? 1  TYR A C    8  
ATOM 7599  O O    . TYR A 1 1  ? 5.006   16.208  -7.954  1.00 0.00 ? 1  TYR A O    8  
ATOM 7600  C CB   . TYR A 1 1  ? 2.834   17.273  -9.181  1.00 0.00 ? 1  TYR A CB   8  
ATOM 7601  C CG   . TYR A 1 1  ? 1.597   16.432  -8.960  1.00 0.00 ? 1  TYR A CG   8  
ATOM 7602  C CD1  . TYR A 1 1  ? 0.346   17.022  -8.844  1.00 0.00 ? 1  TYR A CD1  8  
ATOM 7603  C CD2  . TYR A 1 1  ? 1.682   15.048  -8.868  1.00 0.00 ? 1  TYR A CD2  8  
ATOM 7604  C CE1  . TYR A 1 1  ? -0.787  16.257  -8.641  1.00 0.00 ? 1  TYR A CE1  8  
ATOM 7605  C CE2  . TYR A 1 1  ? 0.554   14.276  -8.665  1.00 0.00 ? 1  TYR A CE2  8  
ATOM 7606  C CZ   . TYR A 1 1  ? -0.677  14.885  -8.553  1.00 0.00 ? 1  TYR A CZ   8  
ATOM 7607  O OH   . TYR A 1 1  ? -1.804  14.120  -8.351  1.00 0.00 ? 1  TYR A OH   8  
ATOM 7608  H H1   . TYR A 1 1  ? 2.901   19.817  -8.641  1.00 0.00 ? 1  TYR A H1   8  
ATOM 7609  H H2   . TYR A 1 1  ? 4.515   19.307  -8.928  1.00 0.00 ? 1  TYR A H2   8  
ATOM 7610  H H3   . TYR A 1 1  ? 4.038   19.807  -7.357  1.00 0.00 ? 1  TYR A H3   8  
ATOM 7611  H HA   . TYR A 1 1  ? 2.564   17.973  -7.172  1.00 0.00 ? 1  TYR A HA   8  
ATOM 7612  H HB2  . TYR A 1 1  ? 2.594   18.032  -9.911  1.00 0.00 ? 1  TYR A HB2  8  
ATOM 7613  H HB3  . TYR A 1 1  ? 3.606   16.630  -9.579  1.00 0.00 ? 1  TYR A HB3  8  
ATOM 7614  H HD1  . TYR A 1 1  ? 0.263   18.096  -8.913  1.00 0.00 ? 1  TYR A HD1  8  
ATOM 7615  H HD2  . TYR A 1 1  ? 2.649   14.574  -8.956  1.00 0.00 ? 1  TYR A HD2  8  
ATOM 7616  H HE1  . TYR A 1 1  ? -1.752  16.734  -8.553  1.00 0.00 ? 1  TYR A HE1  8  
ATOM 7617  H HE2  . TYR A 1 1  ? 0.640   13.202  -8.596  1.00 0.00 ? 1  TYR A HE2  8  
ATOM 7618  H HH   . TYR A 1 1  ? -1.800  13.378  -8.960  1.00 0.00 ? 1  TYR A HH   8  
ATOM 7619  N N    . HIS A 1 2  ? 5.016   17.597  -6.185  1.00 0.00 ? 2  HIS A N    8  
ATOM 7620  C CA   . HIS A 1 2  ? 6.150   16.944  -5.542  1.00 0.00 ? 2  HIS A CA   8  
ATOM 7621  C C    . HIS A 1 2  ? 5.680   15.890  -4.545  1.00 0.00 ? 2  HIS A C    8  
ATOM 7622  O O    . HIS A 1 2  ? 5.589   16.151  -3.346  1.00 0.00 ? 2  HIS A O    8  
ATOM 7623  C CB   . HIS A 1 2  ? 7.025   17.982  -4.839  1.00 0.00 ? 2  HIS A CB   8  
ATOM 7624  C CG   . HIS A 1 2  ? 7.209   19.238  -5.632  1.00 0.00 ? 2  HIS A CG   8  
ATOM 7625  N ND1  . HIS A 1 2  ? 7.556   19.241  -6.968  1.00 0.00 ? 2  HIS A ND1  8  
ATOM 7626  C CD2  . HIS A 1 2  ? 7.083   20.540  -5.276  1.00 0.00 ? 2  HIS A CD2  8  
ATOM 7627  C CE1  . HIS A 1 2  ? 7.641   20.489  -7.396  1.00 0.00 ? 2  HIS A CE1  8  
ATOM 7628  N NE2  . HIS A 1 2  ? 7.358   21.294  -6.390  1.00 0.00 ? 2  HIS A NE2  8  
ATOM 7629  H H    . HIS A 1 2  ? 4.601   18.371  -5.750  1.00 0.00 ? 2  HIS A H    8  
ATOM 7630  H HA   . HIS A 1 2  ? 6.730   16.458  -6.313  1.00 0.00 ? 2  HIS A HA   8  
ATOM 7631  H HB2  . HIS A 1 2  ? 6.572   18.248  -3.896  1.00 0.00 ? 2  HIS A HB2  8  
ATOM 7632  H HB3  . HIS A 1 2  ? 8.002   17.556  -4.658  1.00 0.00 ? 2  HIS A HB3  8  
ATOM 7633  H HD1  . HIS A 1 2  ? 7.719   18.448  -7.519  1.00 0.00 ? 2  HIS A HD1  8  
ATOM 7634  H HD2  . HIS A 1 2  ? 6.817   20.913  -4.297  1.00 0.00 ? 2  HIS A HD2  8  
ATOM 7635  H HE1  . HIS A 1 2  ? 7.897   20.796  -8.399  1.00 0.00 ? 2  HIS A HE1  8  
ATOM 7636  H HE2  . HIS A 1 2  ? 7.347   22.273  -6.433  1.00 0.00 ? 2  HIS A HE2  8  
ATOM 7637  N N    . ALA A 1 3  ? 5.381   14.699  -5.052  1.00 0.00 ? 3  ALA A N    8  
ATOM 7638  C CA   . ALA A 1 3  ? 4.925   13.600  -4.211  1.00 0.00 ? 3  ALA A CA   8  
ATOM 7639  C C    . ALA A 1 3  ? 5.615   12.296  -4.601  1.00 0.00 ? 3  ALA A C    8  
ATOM 7640  O O    . ALA A 1 3  ? 5.925   12.074  -5.770  1.00 0.00 ? 3  ALA A O    8  
ATOM 7641  C CB   . ALA A 1 3  ? 3.414   13.451  -4.306  1.00 0.00 ? 3  ALA A CB   8  
ATOM 7642  H H    . ALA A 1 3  ? 5.478   14.553  -6.017  1.00 0.00 ? 3  ALA A H    8  
ATOM 7643  H HA   . ALA A 1 3  ? 5.176   13.837  -3.187  1.00 0.00 ? 3  ALA A HA   8  
ATOM 7644  H HB1  . ALA A 1 3  ? 3.007   14.268  -4.883  1.00 0.00 ? 3  ALA A HB1  8  
ATOM 7645  H HB2  . ALA A 1 3  ? 2.988   13.465  -3.313  1.00 0.00 ? 3  ALA A HB2  8  
ATOM 7646  H HB3  . ALA A 1 3  ? 3.173   12.515  -4.787  1.00 0.00 ? 3  ALA A HB3  8  
ATOM 7647  N N    . ASP A 1 4  ? 5.860   11.443  -3.612  1.00 0.00 ? 4  ASP A N    8  
ATOM 7648  C CA   . ASP A 1 4  ? 6.523   10.166  -3.854  1.00 0.00 ? 4  ASP A CA   8  
ATOM 7649  C C    . ASP A 1 4  ? 6.824   9.448   -2.542  1.00 0.00 ? 4  ASP A C    8  
ATOM 7650  O O    . ASP A 1 4  ? 6.299   8.364   -2.283  1.00 0.00 ? 4  ASP A O    8  
ATOM 7651  C CB   . ASP A 1 4  ? 7.820   10.382  -4.636  1.00 0.00 ? 4  ASP A CB   8  
ATOM 7652  C CG   . ASP A 1 4  ? 7.856   9.592   -5.928  1.00 0.00 ? 4  ASP A CG   8  
ATOM 7653  O OD1  . ASP A 1 4  ? 7.476   8.402   -5.908  1.00 0.00 ? 4  ASP A OD1  8  
ATOM 7654  O OD2  . ASP A 1 4  ? 8.262   10.163  -6.961  1.00 0.00 ? 4  ASP A OD2  8  
ATOM 7655  H H    . ASP A 1 4  ? 5.593   11.677  -2.699  1.00 0.00 ? 4  ASP A H    8  
ATOM 7656  H HA   . ASP A 1 4  ? 5.855   9.552   -4.441  1.00 0.00 ? 4  ASP A HA   8  
ATOM 7657  H HB2  . ASP A 1 4  ? 7.920   11.431  -4.873  1.00 0.00 ? 4  ASP A HB2  8  
ATOM 7658  H HB3  . ASP A 1 4  ? 8.656   10.074  -4.024  1.00 0.00 ? 4  ASP A HB3  8  
ATOM 7659  N N    . PRO A 1 5  ? 7.685   10.040  -1.695  1.00 0.00 ? 5  PRO A N    8  
ATOM 7660  C CA   . PRO A 1 5  ? 8.058   9.451   -0.406  1.00 0.00 ? 5  PRO A CA   8  
ATOM 7661  C C    . PRO A 1 5  ? 6.843   9.142   0.464   1.00 0.00 ? 5  PRO A C    8  
ATOM 7662  O O    . PRO A 1 5  ? 6.912   8.313   1.372   1.00 0.00 ? 5  PRO A O    8  
ATOM 7663  C CB   . PRO A 1 5  ? 8.932   10.526  0.256   1.00 0.00 ? 5  PRO A CB   8  
ATOM 7664  C CG   . PRO A 1 5  ? 8.688   11.773  -0.526  1.00 0.00 ? 5  PRO A CG   8  
ATOM 7665  C CD   . PRO A 1 5  ? 8.357   11.328  -1.920  1.00 0.00 ? 5  PRO A CD   8  
ATOM 7666  H HA   . PRO A 1 5  ? 8.636   8.549   -0.539  1.00 0.00 ? 5  PRO A HA   8  
ATOM 7667  H HB2  . PRO A 1 5  ? 8.637   10.646  1.287   1.00 0.00 ? 5  PRO A HB2  8  
ATOM 7668  H HB3  . PRO A 1 5  ? 9.968   10.228  0.208   1.00 0.00 ? 5  PRO A HB3  8  
ATOM 7669  H HG2  . PRO A 1 5  ? 7.860   12.319  -0.099  1.00 0.00 ? 5  PRO A HG2  8  
ATOM 7670  H HG3  . PRO A 1 5  ? 9.579   12.384  -0.529  1.00 0.00 ? 5  PRO A HG3  8  
ATOM 7671  H HD2  . PRO A 1 5  ? 7.695   12.035  -2.395  1.00 0.00 ? 5  PRO A HD2  8  
ATOM 7672  H HD3  . PRO A 1 5  ? 9.257   11.198  -2.501  1.00 0.00 ? 5  PRO A HD3  8  
ATOM 7673  N N    . SER A 1 6  ? 5.730   9.809   0.178   1.00 0.00 ? 6  SER A N    8  
ATOM 7674  C CA   . SER A 1 6  ? 4.501   9.602   0.936   1.00 0.00 ? 6  SER A CA   8  
ATOM 7675  C C    . SER A 1 6  ? 3.710   8.401   0.413   1.00 0.00 ? 6  SER A C    8  
ATOM 7676  O O    . SER A 1 6  ? 2.581   8.162   0.842   1.00 0.00 ? 6  SER A O    8  
ATOM 7677  C CB   . SER A 1 6  ? 3.631   10.860  0.882   1.00 0.00 ? 6  SER A CB   8  
ATOM 7678  O OG   . SER A 1 6  ? 2.297   10.576  1.268   1.00 0.00 ? 6  SER A OG   8  
ATOM 7679  H H    . SER A 1 6  ? 5.734   10.456  -0.558  1.00 0.00 ? 6  SER A H    8  
ATOM 7680  H HA   . SER A 1 6  ? 4.777   9.412   1.963   1.00 0.00 ? 6  SER A HA   8  
ATOM 7681  H HB2  . SER A 1 6  ? 4.035   11.603  1.553   1.00 0.00 ? 6  SER A HB2  8  
ATOM 7682  H HB3  . SER A 1 6  ? 3.626   11.248  -0.125  1.00 0.00 ? 6  SER A HB3  8  
ATOM 7683  H HG   . SER A 1 6  ? 1.868   11.385  1.557   1.00 0.00 ? 6  SER A HG   8  
ATOM 7684  N N    . LEU A 1 7  ? 4.302   7.644   -0.510  1.00 0.00 ? 7  LEU A N    8  
ATOM 7685  C CA   . LEU A 1 7  ? 3.640   6.473   -1.071  1.00 0.00 ? 7  LEU A CA   8  
ATOM 7686  C C    . LEU A 1 7  ? 4.467   5.217   -0.824  1.00 0.00 ? 7  LEU A C    8  
ATOM 7687  O O    . LEU A 1 7  ? 4.014   4.285   -0.162  1.00 0.00 ? 7  LEU A O    8  
ATOM 7688  C CB   . LEU A 1 7  ? 3.408   6.661   -2.573  1.00 0.00 ? 7  LEU A CB   8  
ATOM 7689  C CG   . LEU A 1 7  ? 2.954   5.408   -3.329  1.00 0.00 ? 7  LEU A CG   8  
ATOM 7690  C CD1  . LEU A 1 7  ? 4.143   4.512   -3.641  1.00 0.00 ? 7  LEU A CD1  8  
ATOM 7691  C CD2  . LEU A 1 7  ? 1.903   4.647   -2.532  1.00 0.00 ? 7  LEU A CD2  8  
ATOM 7692  H H    . LEU A 1 7  ? 5.203   7.873   -0.817  1.00 0.00 ? 7  LEU A H    8  
ATOM 7693  H HA   . LEU A 1 7  ? 2.686   6.363   -0.579  1.00 0.00 ? 7  LEU A HA   8  
ATOM 7694  H HB2  . LEU A 1 7  ? 2.657   7.425   -2.705  1.00 0.00 ? 7  LEU A HB2  8  
ATOM 7695  H HB3  . LEU A 1 7  ? 4.329   7.008   -3.017  1.00 0.00 ? 7  LEU A HB3  8  
ATOM 7696  H HG   . LEU A 1 7  ? 2.507   5.705   -4.267  1.00 0.00 ? 7  LEU A HG   8  
ATOM 7697  H HD11 . LEU A 1 7  ? 4.041   4.111   -4.639  1.00 0.00 ? 7  LEU A HD11 8  
ATOM 7698  H HD12 . LEU A 1 7  ? 4.180   3.701   -2.930  1.00 0.00 ? 7  LEU A HD12 8  
ATOM 7699  H HD13 . LEU A 1 7  ? 5.054   5.089   -3.577  1.00 0.00 ? 7  LEU A HD13 8  
ATOM 7700  H HD21 . LEU A 1 7  ? 1.668   3.721   -3.038  1.00 0.00 ? 7  LEU A HD21 8  
ATOM 7701  H HD22 . LEU A 1 7  ? 1.010   5.247   -2.449  1.00 0.00 ? 7  LEU A HD22 8  
ATOM 7702  H HD23 . LEU A 1 7  ? 2.284   4.431   -1.546  1.00 0.00 ? 7  LEU A HD23 8  
ATOM 7703  N N    . VAL A 1 8  ? 5.683   5.202   -1.355  1.00 0.00 ? 8  VAL A N    8  
ATOM 7704  C CA   . VAL A 1 8  ? 6.574   4.060   -1.190  1.00 0.00 ? 8  VAL A CA   8  
ATOM 7705  C C    . VAL A 1 8  ? 6.813   3.757   0.285   1.00 0.00 ? 8  VAL A C    8  
ATOM 7706  O O    . VAL A 1 8  ? 6.932   2.597   0.679   1.00 0.00 ? 8  VAL A O    8  
ATOM 7707  C CB   . VAL A 1 8  ? 7.929   4.305   -1.878  1.00 0.00 ? 8  VAL A CB   8  
ATOM 7708  C CG1  . VAL A 1 8  ? 7.742   4.475   -3.377  1.00 0.00 ? 8  VAL A CG1  8  
ATOM 7709  C CG2  . VAL A 1 8  ? 8.621   5.520   -1.278  1.00 0.00 ? 8  VAL A CG2  8  
ATOM 7710  H H    . VAL A 1 8  ? 5.988   5.976   -1.873  1.00 0.00 ? 8  VAL A H    8  
ATOM 7711  H HA   . VAL A 1 8  ? 6.109   3.204   -1.655  1.00 0.00 ? 8  VAL A HA   8  
ATOM 7712  H HB   . VAL A 1 8  ? 8.557   3.442   -1.712  1.00 0.00 ? 8  VAL A HB   8  
ATOM 7713  H HG11 . VAL A 1 8  ? 7.478   5.500   -3.593  1.00 0.00 ? 8  VAL A HG11 8  
ATOM 7714  H HG12 . VAL A 1 8  ? 6.953   3.820   -3.719  1.00 0.00 ? 8  VAL A HG12 8  
ATOM 7715  H HG13 . VAL A 1 8  ? 8.662   4.226   -3.886  1.00 0.00 ? 8  VAL A HG13 8  
ATOM 7716  H HG21 . VAL A 1 8  ? 9.619   5.602   -1.683  1.00 0.00 ? 8  VAL A HG21 8  
ATOM 7717  H HG22 . VAL A 1 8  ? 8.674   5.411   -0.205  1.00 0.00 ? 8  VAL A HG22 8  
ATOM 7718  H HG23 . VAL A 1 8  ? 8.059   6.410   -1.522  1.00 0.00 ? 8  VAL A HG23 8  
ATOM 7719  N N    . SER A 1 9  ? 6.880   4.807   1.098   1.00 0.00 ? 9  SER A N    8  
ATOM 7720  C CA   . SER A 1 9  ? 7.108   4.652   2.529   1.00 0.00 ? 9  SER A CA   8  
ATOM 7721  C C    . SER A 1 9  ? 5.950   3.913   3.192   1.00 0.00 ? 9  SER A C    8  
ATOM 7722  O O    . SER A 1 9  ? 6.116   3.298   4.246   1.00 0.00 ? 9  SER A O    8  
ATOM 7723  C CB   . SER A 1 9  ? 7.296   6.022   3.186   1.00 0.00 ? 9  SER A CB   8  
ATOM 7724  O OG   . SER A 1 9  ? 6.086   6.760   3.182   1.00 0.00 ? 9  SER A OG   8  
ATOM 7725  H H    . SER A 1 9  ? 6.778   5.707   0.724   1.00 0.00 ? 9  SER A H    8  
ATOM 7726  H HA   . SER A 1 9  ? 8.010   4.073   2.660   1.00 0.00 ? 9  SER A HA   8  
ATOM 7727  H HB2  . SER A 1 9  ? 7.617   5.888   4.208   1.00 0.00 ? 9  SER A HB2  8  
ATOM 7728  H HB3  . SER A 1 9  ? 8.044   6.579   2.643   1.00 0.00 ? 9  SER A HB3  8  
ATOM 7729  H HG   . SER A 1 9  ? 6.186   7.536   2.625   1.00 0.00 ? 9  SER A HG   8  
ATOM 7730  N N    . PHE A 1 10 ? 4.777   3.976   2.569   1.00 0.00 ? 10 PHE A N    8  
ATOM 7731  C CA   . PHE A 1 10 ? 3.592   3.313   3.102   1.00 0.00 ? 10 PHE A CA   8  
ATOM 7732  C C    . PHE A 1 10 ? 3.398   1.943   2.459   1.00 0.00 ? 10 PHE A C    8  
ATOM 7733  O O    . PHE A 1 10 ? 3.196   0.946   3.151   1.00 0.00 ? 10 PHE A O    8  
ATOM 7734  C CB   . PHE A 1 10 ? 2.353   4.181   2.875   1.00 0.00 ? 10 PHE A CB   8  
ATOM 7735  C CG   . PHE A 1 10 ? 2.151   5.228   3.934   1.00 0.00 ? 10 PHE A CG   8  
ATOM 7736  C CD1  . PHE A 1 10 ? 3.229   5.932   4.447   1.00 0.00 ? 10 PHE A CD1  8  
ATOM 7737  C CD2  . PHE A 1 10 ? 0.883   5.507   4.417   1.00 0.00 ? 10 PHE A CD2  8  
ATOM 7738  C CE1  . PHE A 1 10 ? 3.046   6.895   5.421   1.00 0.00 ? 10 PHE A CE1  8  
ATOM 7739  C CE2  . PHE A 1 10 ? 0.693   6.469   5.391   1.00 0.00 ? 10 PHE A CE2  8  
ATOM 7740  C CZ   . PHE A 1 10 ? 1.776   7.164   5.894   1.00 0.00 ? 10 PHE A CZ   8  
ATOM 7741  H H    . PHE A 1 10 ? 4.706   4.483   1.733   1.00 0.00 ? 10 PHE A H    8  
ATOM 7742  H HA   . PHE A 1 10 ? 3.739   3.179   4.163   1.00 0.00 ? 10 PHE A HA   8  
ATOM 7743  H HB2  . PHE A 1 10 ? 2.443   4.684   1.924   1.00 0.00 ? 10 PHE A HB2  8  
ATOM 7744  H HB3  . PHE A 1 10 ? 1.477   3.549   2.861   1.00 0.00 ? 10 PHE A HB3  8  
ATOM 7745  H HD1  . PHE A 1 10 ? 4.222   5.723   4.078   1.00 0.00 ? 10 PHE A HD1  8  
ATOM 7746  H HD2  . PHE A 1 10 ? 0.036   4.964   4.025   1.00 0.00 ? 10 PHE A HD2  8  
ATOM 7747  H HE1  . PHE A 1 10 ? 3.894   7.437   5.812   1.00 0.00 ? 10 PHE A HE1  8  
ATOM 7748  H HE2  . PHE A 1 10 ? -0.300  6.676   5.760   1.00 0.00 ? 10 PHE A HE2  8  
ATOM 7749  H HZ   . PHE A 1 10 ? 1.630   7.916   6.655   1.00 0.00 ? 10 PHE A HZ   8  
ATOM 7750  N N    . LEU A 1 11 ? 3.470   1.899   1.132   1.00 0.00 ? 11 LEU A N    8  
ATOM 7751  C CA   . LEU A 1 11 ? 3.316   0.650   0.394   1.00 0.00 ? 11 LEU A CA   8  
ATOM 7752  C C    . LEU A 1 11 ? 4.183   -0.447  0.997   1.00 0.00 ? 11 LEU A C    8  
ATOM 7753  O O    . LEU A 1 11 ? 3.701   -1.531  1.325   1.00 0.00 ? 11 LEU A O    8  
ATOM 7754  C CB   . LEU A 1 11 ? 3.692   0.859   -1.075  1.00 0.00 ? 11 LEU A CB   8  
ATOM 7755  C CG   . LEU A 1 11 ? 3.228   -0.239  -2.040  1.00 0.00 ? 11 LEU A CG   8  
ATOM 7756  C CD1  . LEU A 1 11 ? 4.189   -1.418  -2.009  1.00 0.00 ? 11 LEU A CD1  8  
ATOM 7757  C CD2  . LEU A 1 11 ? 1.813   -0.690  -1.706  1.00 0.00 ? 11 LEU A CD2  8  
ATOM 7758  H H    . LEU A 1 11 ? 3.639   2.727   0.636   1.00 0.00 ? 11 LEU A H    8  
ATOM 7759  H HA   . LEU A 1 11 ? 2.282   0.351   0.456   1.00 0.00 ? 11 LEU A HA   8  
ATOM 7760  H HB2  . LEU A 1 11 ? 3.268   1.797   -1.402  1.00 0.00 ? 11 LEU A HB2  8  
ATOM 7761  H HB3  . LEU A 1 11 ? 4.768   0.930   -1.138  1.00 0.00 ? 11 LEU A HB3  8  
ATOM 7762  H HG   . LEU A 1 11 ? 3.222   0.156   -3.045  1.00 0.00 ? 11 LEU A HG   8  
ATOM 7763  H HD11 . LEU A 1 11 ? 3.629   -2.336  -1.908  1.00 0.00 ? 11 LEU A HD11 8  
ATOM 7764  H HD12 . LEU A 1 11 ? 4.862   -1.313  -1.173  1.00 0.00 ? 11 LEU A HD12 8  
ATOM 7765  H HD13 . LEU A 1 11 ? 4.757   -1.443  -2.927  1.00 0.00 ? 11 LEU A HD13 8  
ATOM 7766  H HD21 . LEU A 1 11 ? 1.403   -1.240  -2.539  1.00 0.00 ? 11 LEU A HD21 8  
ATOM 7767  H HD22 . LEU A 1 11 ? 1.197   0.175   -1.507  1.00 0.00 ? 11 LEU A HD22 8  
ATOM 7768  H HD23 . LEU A 1 11 ? 1.834   -1.324  -0.831  1.00 0.00 ? 11 LEU A HD23 8  
ATOM 7769  N N    . THR A 1 12 ? 5.468   -0.150  1.143   1.00 0.00 ? 12 THR A N    8  
ATOM 7770  C CA   . THR A 1 12 ? 6.414   -1.097  1.716   1.00 0.00 ? 12 THR A CA   8  
ATOM 7771  C C    . THR A 1 12 ? 6.164   -1.272  3.209   1.00 0.00 ? 12 THR A C    8  
ATOM 7772  O O    . THR A 1 12 ? 6.064   -2.395  3.705   1.00 0.00 ? 12 THR A O    8  
ATOM 7773  C CB   . THR A 1 12 ? 7.846   -0.617  1.478   1.00 0.00 ? 12 THR A CB   8  
ATOM 7774  O OG1  . THR A 1 12 ? 8.108   -0.493  0.091   1.00 0.00 ? 12 THR A OG1  8  
ATOM 7775  C CG2  . THR A 1 12 ? 8.895   -1.538  2.064   1.00 0.00 ? 12 THR A CG2  8  
ATOM 7776  H H    . THR A 1 12 ? 5.784   0.734   0.866   1.00 0.00 ? 12 THR A H    8  
ATOM 7777  H HA   . THR A 1 12 ? 6.271   -2.048  1.224   1.00 0.00 ? 12 THR A HA   8  
ATOM 7778  H HB   . THR A 1 12 ? 7.971   0.353   1.935   1.00 0.00 ? 12 THR A HB   8  
ATOM 7779  H HG1  . THR A 1 12 ? 8.507   0.362   -0.084  1.00 0.00 ? 12 THR A HG1  8  
ATOM 7780  H HG21 . THR A 1 12 ? 9.675   -1.703  1.337   1.00 0.00 ? 12 THR A HG21 8  
ATOM 7781  H HG22 . THR A 1 12 ? 8.439   -2.481  2.326   1.00 0.00 ? 12 THR A HG22 8  
ATOM 7782  H HG23 . THR A 1 12 ? 9.318   -1.084  2.950   1.00 0.00 ? 12 THR A HG23 8  
ATOM 7783  N N    . GLY A 1 13 ? 6.058   -0.151  3.918   1.00 0.00 ? 13 GLY A N    8  
ATOM 7784  C CA   . GLY A 1 13 ? 5.817   -0.195  5.349   1.00 0.00 ? 13 GLY A CA   8  
ATOM 7785  C C    . GLY A 1 13 ? 4.652   -1.093  5.707   1.00 0.00 ? 13 GLY A C    8  
ATOM 7786  O O    . GLY A 1 13 ? 4.646   -1.729  6.761   1.00 0.00 ? 13 GLY A O    8  
ATOM 7787  H H    . GLY A 1 13 ? 6.138   0.713   3.463   1.00 0.00 ? 13 GLY A H    8  
ATOM 7788  H HA2  . GLY A 1 13 ? 6.705   -0.560  5.844   1.00 0.00 ? 13 GLY A HA2  8  
ATOM 7789  H HA3  . GLY A 1 13 ? 5.608   0.806   5.701   1.00 0.00 ? 13 GLY A HA3  8  
ATOM 7790  N N    . LEU A 1 14 ? 3.666   -1.148  4.820   1.00 0.00 ? 14 LEU A N    8  
ATOM 7791  C CA   . LEU A 1 14 ? 2.497   -1.987  5.020   1.00 0.00 ? 14 LEU A CA   8  
ATOM 7792  C C    . LEU A 1 14 ? 2.886   -3.459  5.139   1.00 0.00 ? 14 LEU A C    8  
ATOM 7793  O O    . LEU A 1 14 ? 2.101   -4.282  5.609   1.00 0.00 ? 14 LEU A O    8  
ATOM 7794  C CB   . LEU A 1 14 ? 1.534   -1.798  3.848   1.00 0.00 ? 14 LEU A CB   8  
ATOM 7795  C CG   . LEU A 1 14 ? 0.062   -1.636  4.223   1.00 0.00 ? 14 LEU A CG   8  
ATOM 7796  C CD1  . LEU A 1 14 ? -0.094  -0.638  5.360   1.00 0.00 ? 14 LEU A CD1  8  
ATOM 7797  C CD2  . LEU A 1 14 ? -0.740  -1.194  3.010   1.00 0.00 ? 14 LEU A CD2  8  
ATOM 7798  H H    . LEU A 1 14 ? 3.736   -0.627  3.995   1.00 0.00 ? 14 LEU A H    8  
ATOM 7799  H HA   . LEU A 1 14 ? 2.015   -1.676  5.935   1.00 0.00 ? 14 LEU A HA   8  
ATOM 7800  H HB2  . LEU A 1 14 ? 1.841   -0.919  3.300   1.00 0.00 ? 14 LEU A HB2  8  
ATOM 7801  H HB3  . LEU A 1 14 ? 1.626   -2.653  3.196   1.00 0.00 ? 14 LEU A HB3  8  
ATOM 7802  H HG   . LEU A 1 14 ? -0.326  -2.587  4.555   1.00 0.00 ? 14 LEU A HG   8  
ATOM 7803  H HD11 . LEU A 1 14 ? -0.987  -0.051  5.204   1.00 0.00 ? 14 LEU A HD11 8  
ATOM 7804  H HD12 . LEU A 1 14 ? 0.767   0.014   5.386   1.00 0.00 ? 14 LEU A HD12 8  
ATOM 7805  H HD13 . LEU A 1 14 ? -0.172  -1.170  6.297   1.00 0.00 ? 14 LEU A HD13 8  
ATOM 7806  H HD21 . LEU A 1 14 ? -0.688  -0.120  2.918   1.00 0.00 ? 14 LEU A HD21 8  
ATOM 7807  H HD22 . LEU A 1 14 ? -1.770  -1.497  3.129   1.00 0.00 ? 14 LEU A HD22 8  
ATOM 7808  H HD23 . LEU A 1 14 ? -0.327  -1.651  2.122   1.00 0.00 ? 14 LEU A HD23 8  
ATOM 7809  N N    . GLY A 1 15 ? 4.101   -3.786  4.703   1.00 0.00 ? 15 GLY A N    8  
ATOM 7810  C CA   . GLY A 1 15 ? 4.564   -5.159  4.757   1.00 0.00 ? 15 GLY A CA   8  
ATOM 7811  C C    . GLY A 1 15 ? 4.929   -5.706  3.389   1.00 0.00 ? 15 GLY A C    8  
ATOM 7812  O O    . GLY A 1 15 ? 5.145   -6.907  3.235   1.00 0.00 ? 15 GLY A O    8  
ATOM 7813  H H    . GLY A 1 15 ? 4.683   -3.095  4.331   1.00 0.00 ? 15 GLY A H    8  
ATOM 7814  H HA2  . GLY A 1 15 ? 5.434   -5.208  5.396   1.00 0.00 ? 15 GLY A HA2  8  
ATOM 7815  H HA3  . GLY A 1 15 ? 3.785   -5.773  5.182   1.00 0.00 ? 15 GLY A HA3  8  
ATOM 7816  N N    . CYS A 1 16 ? 5.004   -4.825  2.391   1.00 0.00 ? 16 CYS A N    8  
ATOM 7817  C CA   . CYS A 1 16 ? 5.343   -5.240  1.035   1.00 0.00 ? 16 CYS A CA   8  
ATOM 7818  C C    . CYS A 1 16 ? 6.678   -4.644  0.594   1.00 0.00 ? 16 CYS A C    8  
ATOM 7819  O O    . CYS A 1 16 ? 6.719   -3.746  -0.247  1.00 0.00 ? 16 CYS A O    8  
ATOM 7820  C CB   . CYS A 1 16 ? 4.240   -4.819  0.062   1.00 0.00 ? 16 CYS A CB   8  
ATOM 7821  S SG   . CYS A 1 16 ? 3.016   -6.108  -0.267  1.00 0.00 ? 16 CYS A SG   8  
ATOM 7822  H H    . CYS A 1 16 ? 4.820   -3.877  2.568   1.00 0.00 ? 16 CYS A H    8  
ATOM 7823  H HA   . CYS A 1 16 ? 5.425   -6.317  1.029   1.00 0.00 ? 16 CYS A HA   8  
ATOM 7824  H HB2  . CYS A 1 16 ? 3.717   -3.967  0.471   1.00 0.00 ? 16 CYS A HB2  8  
ATOM 7825  H HB3  . CYS A 1 16 ? 4.689   -4.542  -0.880  1.00 0.00 ? 16 CYS A HB3  8  
ATOM 7826  H HG   . CYS A 1 16 ? 3.452   -6.959  -0.175  1.00 0.00 ? 16 CYS A HG   8  
ATOM 7827  N N    . PRO A 1 17 ? 7.793   -5.148  1.149   1.00 0.00 ? 17 PRO A N    8  
ATOM 7828  C CA   . PRO A 1 17 ? 9.133   -4.658  0.817   1.00 0.00 ? 17 PRO A CA   8  
ATOM 7829  C C    . PRO A 1 17 ? 9.674   -5.241  -0.487  1.00 0.00 ? 17 PRO A C    8  
ATOM 7830  O O    . PRO A 1 17 ? 10.677  -4.763  -1.018  1.00 0.00 ? 17 PRO A O    8  
ATOM 7831  C CB   . PRO A 1 17 ? 9.968   -5.140  1.999   1.00 0.00 ? 17 PRO A CB   8  
ATOM 7832  C CG   . PRO A 1 17 ? 9.309   -6.408  2.421   1.00 0.00 ? 17 PRO A CG   8  
ATOM 7833  C CD   . PRO A 1 17 ? 7.836   -6.218  2.167   1.00 0.00 ? 17 PRO A CD   8  
ATOM 7834  H HA   . PRO A 1 17 ? 9.160   -3.579  0.768   1.00 0.00 ? 17 PRO A HA   8  
ATOM 7835  H HB2  . PRO A 1 17 ? 10.987  -5.309  1.681   1.00 0.00 ? 17 PRO A HB2  8  
ATOM 7836  H HB3  . PRO A 1 17 ? 9.947   -4.401  2.786   1.00 0.00 ? 17 PRO A HB3  8  
ATOM 7837  H HG2  . PRO A 1 17 ? 9.688   -7.231  1.833   1.00 0.00 ? 17 PRO A HG2  8  
ATOM 7838  H HG3  . PRO A 1 17 ? 9.489   -6.584  3.471   1.00 0.00 ? 17 PRO A HG3  8  
ATOM 7839  H HD2  . PRO A 1 17 ? 7.398   -7.128  1.786   1.00 0.00 ? 17 PRO A HD2  8  
ATOM 7840  H HD3  . PRO A 1 17 ? 7.335   -5.907  3.072   1.00 0.00 ? 17 PRO A HD3  8  
ATOM 7841  N N    . ASN A 1 18 ? 9.017   -6.282  -0.993  1.00 0.00 ? 18 ASN A N    8  
ATOM 7842  C CA   . ASN A 1 18 ? 9.447   -6.924  -2.230  1.00 0.00 ? 18 ASN A CA   8  
ATOM 7843  C C    . ASN A 1 18 ? 8.273   -7.122  -3.183  1.00 0.00 ? 18 ASN A C    8  
ATOM 7844  O O    . ASN A 1 18 ? 8.322   -7.972  -4.073  1.00 0.00 ? 18 ASN A O    8  
ATOM 7845  C CB   . ASN A 1 18 ? 10.102  -8.273  -1.924  1.00 0.00 ? 18 ASN A CB   8  
ATOM 7846  C CG   . ASN A 1 18 ? 10.926  -8.792  -3.085  1.00 0.00 ? 18 ASN A CG   8  
ATOM 7847  O OD1  . ASN A 1 18 ? 10.641  -9.854  -3.638  1.00 0.00 ? 18 ASN A OD1  8  
ATOM 7848  N ND2  . ASN A 1 18 ? 11.957  -8.044  -3.461  1.00 0.00 ? 18 ASN A ND2  8  
ATOM 7849  H H    . ASN A 1 18 ? 8.226   -6.623  -0.529  1.00 0.00 ? 18 ASN A H    8  
ATOM 7850  H HA   . ASN A 1 18 ? 10.173  -6.279  -2.702  1.00 0.00 ? 18 ASN A HA   8  
ATOM 7851  H HB2  . ASN A 1 18 ? 10.750  -8.164  -1.066  1.00 0.00 ? 18 ASN A HB2  8  
ATOM 7852  H HB3  . ASN A 1 18 ? 9.333   -8.996  -1.699  1.00 0.00 ? 18 ASN A HB3  8  
ATOM 7853  H HD21 . ASN A 1 18 ? 12.124  -7.210  -2.975  1.00 0.00 ? 18 ASN A HD21 8  
ATOM 7854  H HD22 . ASN A 1 18 ? 12.507  -8.356  -4.209  1.00 0.00 ? 18 ASN A HD22 8  
ATOM 7855  N N    . CYS A 1 19 ? 7.220   -6.332  -2.997  1.00 0.00 ? 19 CYS A N    8  
ATOM 7856  C CA   . CYS A 1 19 ? 6.040   -6.425  -3.845  1.00 0.00 ? 19 CYS A CA   8  
ATOM 7857  C C    . CYS A 1 19 ? 5.848   -5.150  -4.659  1.00 0.00 ? 19 CYS A C    8  
ATOM 7858  O O    . CYS A 1 19 ? 5.291   -5.180  -5.756  1.00 0.00 ? 19 CYS A O    8  
ATOM 7859  C CB   . CYS A 1 19 ? 4.795   -6.695  -2.997  1.00 0.00 ? 19 CYS A CB   8  
ATOM 7860  S SG   . CYS A 1 19 ? 4.814   -8.292  -2.149  1.00 0.00 ? 19 CYS A SG   8  
ATOM 7861  H H    . CYS A 1 19 ? 7.238   -5.674  -2.272  1.00 0.00 ? 19 CYS A H    8  
ATOM 7862  H HA   . CYS A 1 19 ? 6.188   -7.250  -4.525  1.00 0.00 ? 19 CYS A HA   8  
ATOM 7863  H HB2  . CYS A 1 19 ? 4.708   -5.925  -2.246  1.00 0.00 ? 19 CYS A HB2  8  
ATOM 7864  H HB3  . CYS A 1 19 ? 3.923   -6.673  -3.633  1.00 0.00 ? 19 CYS A HB3  8  
ATOM 7865  H HG   . CYS A 1 19 ? 5.730   -8.546  -2.013  1.00 0.00 ? 19 CYS A HG   8  
ATOM 7866  N N    . ILE A 1 20 ? 6.321   -4.030  -4.119  1.00 0.00 ? 20 ILE A N    8  
ATOM 7867  C CA   . ILE A 1 20 ? 6.212   -2.745  -4.801  1.00 0.00 ? 20 ILE A CA   8  
ATOM 7868  C C    . ILE A 1 20 ? 6.674   -2.852  -6.248  1.00 0.00 ? 20 ILE A C    8  
ATOM 7869  O O    . ILE A 1 20 ? 6.157   -2.168  -7.130  1.00 0.00 ? 20 ILE A O    8  
ATOM 7870  C CB   . ILE A 1 20 ? 7.043   -1.662  -4.090  1.00 0.00 ? 20 ILE A CB   8  
ATOM 7871  C CG1  . ILE A 1 20 ? 6.861   -0.311  -4.783  1.00 0.00 ? 20 ILE A CG1  8  
ATOM 7872  C CG2  . ILE A 1 20 ? 8.510   -2.061  -4.074  1.00 0.00 ? 20 ILE A CG2  8  
ATOM 7873  C CD1  . ILE A 1 20 ? 6.787   0.860   -3.826  1.00 0.00 ? 20 ILE A CD1  8  
ATOM 7874  H H    . ILE A 1 20 ? 6.758   -4.069  -3.244  1.00 0.00 ? 20 ILE A H    8  
ATOM 7875  H HA   . ILE A 1 20 ? 5.175   -2.445  -4.785  1.00 0.00 ? 20 ILE A HA   8  
ATOM 7876  H HB   . ILE A 1 20 ? 6.703   -1.588  -3.068  1.00 0.00 ? 20 ILE A HB   8  
ATOM 7877  H HG12 . ILE A 1 20 ? 7.695   -0.140  -5.447  1.00 0.00 ? 20 ILE A HG12 8  
ATOM 7878  H HG13 . ILE A 1 20 ? 5.947   -0.328  -5.356  1.00 0.00 ? 20 ILE A HG13 8  
ATOM 7879  H HG21 . ILE A 1 20 ? 8.591   -3.135  -4.174  1.00 0.00 ? 20 ILE A HG21 8  
ATOM 7880  H HG22 . ILE A 1 20 ? 8.958   -1.751  -3.142  1.00 0.00 ? 20 ILE A HG22 8  
ATOM 7881  H HG23 . ILE A 1 20 ? 9.021   -1.584  -4.897  1.00 0.00 ? 20 ILE A HG23 8  
ATOM 7882  H HD11 . ILE A 1 20 ? 7.748   1.002   -3.355  1.00 0.00 ? 20 ILE A HD11 8  
ATOM 7883  H HD12 . ILE A 1 20 ? 6.041   0.660   -3.071  1.00 0.00 ? 20 ILE A HD12 8  
ATOM 7884  H HD13 . ILE A 1 20 ? 6.517   1.753   -4.371  1.00 0.00 ? 20 ILE A HD13 8  
ATOM 7885  N N    . GLU A 1 21 ? 7.651   -3.719  -6.484  1.00 0.00 ? 21 GLU A N    8  
ATOM 7886  C CA   . GLU A 1 21 ? 8.171   -3.936  -7.827  1.00 0.00 ? 21 GLU A CA   8  
ATOM 7887  C C    . GLU A 1 21 ? 7.072   -4.448  -8.746  1.00 0.00 ? 21 GLU A C    8  
ATOM 7888  O O    . GLU A 1 21 ? 6.924   -3.988  -9.878  1.00 0.00 ? 21 GLU A O    8  
ATOM 7889  C CB   . GLU A 1 21 ? 9.321   -4.942  -7.788  1.00 0.00 ? 21 GLU A CB   8  
ATOM 7890  C CG   . GLU A 1 21 ? 10.433  -4.560  -6.826  1.00 0.00 ? 21 GLU A CG   8  
ATOM 7891  C CD   . GLU A 1 21 ? 11.808  -4.651  -7.456  1.00 0.00 ? 21 GLU A CD   8  
ATOM 7892  O OE1  . GLU A 1 21 ? 11.987  -4.117  -8.571  1.00 0.00 ? 21 GLU A OE1  8  
ATOM 7893  O OE2  . GLU A 1 21 ? 12.707  -5.256  -6.835  1.00 0.00 ? 21 GLU A OE2  8  
ATOM 7894  H H    . GLU A 1 21 ? 8.016   -4.242  -5.741  1.00 0.00 ? 21 GLU A H    8  
ATOM 7895  H HA   . GLU A 1 21 ? 8.533   -2.992  -8.204  1.00 0.00 ? 21 GLU A HA   8  
ATOM 7896  H HB2  . GLU A 1 21 ? 8.928   -5.902  -7.489  1.00 0.00 ? 21 GLU A HB2  8  
ATOM 7897  H HB3  . GLU A 1 21 ? 9.740   -5.029  -8.778  1.00 0.00 ? 21 GLU A HB3  8  
ATOM 7898  H HG2  . GLU A 1 21 ? 10.272  -3.546  -6.494  1.00 0.00 ? 21 GLU A HG2  8  
ATOM 7899  H HG3  . GLU A 1 21 ? 10.399  -5.226  -5.975  1.00 0.00 ? 21 GLU A HG3  8  
ATOM 7900  N N    . TYR A 1 22 ? 6.304   -5.406  -8.244  1.00 0.00 ? 22 TYR A N    8  
ATOM 7901  C CA   . TYR A 1 22 ? 5.205   -5.988  -9.007  1.00 0.00 ? 22 TYR A CA   8  
ATOM 7902  C C    . TYR A 1 22 ? 4.002   -5.053  -9.006  1.00 0.00 ? 22 TYR A C    8  
ATOM 7903  O O    . TYR A 1 22 ? 3.201   -5.053  -9.941  1.00 0.00 ? 22 TYR A O    8  
ATOM 7904  C CB   . TYR A 1 22 ? 4.811   -7.350  -8.426  1.00 0.00 ? 22 TYR A CB   8  
ATOM 7905  C CG   . TYR A 1 22 ? 5.966   -8.107  -7.809  1.00 0.00 ? 22 TYR A CG   8  
ATOM 7906  C CD1  . TYR A 1 22 ? 7.186   -8.206  -8.466  1.00 0.00 ? 22 TYR A CD1  8  
ATOM 7907  C CD2  . TYR A 1 22 ? 5.840   -8.709  -6.563  1.00 0.00 ? 22 TYR A CD2  8  
ATOM 7908  C CE1  . TYR A 1 22 ? 8.245   -8.892  -7.903  1.00 0.00 ? 22 TYR A CE1  8  
ATOM 7909  C CE2  . TYR A 1 22 ? 6.894   -9.396  -5.994  1.00 0.00 ? 22 TYR A CE2  8  
ATOM 7910  C CZ   . TYR A 1 22 ? 8.094   -9.483  -6.668  1.00 0.00 ? 22 TYR A CZ   8  
ATOM 7911  O OH   . TYR A 1 22 ? 9.147   -10.168 -6.104  1.00 0.00 ? 22 TYR A OH   8  
ATOM 7912  H H    . TYR A 1 22 ? 6.475   -5.725  -7.333  1.00 0.00 ? 22 TYR A H    8  
ATOM 7913  H HA   . TYR A 1 22 ? 5.542   -6.122  -10.023 1.00 0.00 ? 22 TYR A HA   8  
ATOM 7914  H HB2  . TYR A 1 22 ? 4.064   -7.203  -7.659  1.00 0.00 ? 22 TYR A HB2  8  
ATOM 7915  H HB3  . TYR A 1 22 ? 4.396   -7.962  -9.214  1.00 0.00 ? 22 TYR A HB3  8  
ATOM 7916  H HD1  . TYR A 1 22 ? 7.301   -7.741  -9.433  1.00 0.00 ? 22 TYR A HD1  8  
ATOM 7917  H HD2  . TYR A 1 22 ? 4.899   -8.638  -6.038  1.00 0.00 ? 22 TYR A HD2  8  
ATOM 7918  H HE1  . TYR A 1 22 ? 9.184   -8.960  -8.430  1.00 0.00 ? 22 TYR A HE1  8  
ATOM 7919  H HE2  . TYR A 1 22 ? 6.776   -9.860  -5.027  1.00 0.00 ? 22 TYR A HE2  8  
ATOM 7920  H HH   . TYR A 1 22 ? 9.048   -11.107 -6.279  1.00 0.00 ? 22 TYR A HH   8  
ATOM 7921  N N    . PHE A 1 23 ? 3.887   -4.251  -7.952  1.00 0.00 ? 23 PHE A N    8  
ATOM 7922  C CA   . PHE A 1 23 ? 2.793   -3.296  -7.835  1.00 0.00 ? 23 PHE A CA   8  
ATOM 7923  C C    . PHE A 1 23 ? 3.043   -2.089  -8.732  1.00 0.00 ? 23 PHE A C    8  
ATOM 7924  O O    . PHE A 1 23 ? 2.157   -1.655  -9.468  1.00 0.00 ? 23 PHE A O    8  
ATOM 7925  C CB   . PHE A 1 23 ? 2.635   -2.848  -6.381  1.00 0.00 ? 23 PHE A CB   8  
ATOM 7926  C CG   . PHE A 1 23 ? 1.771   -3.761  -5.559  1.00 0.00 ? 23 PHE A CG   8  
ATOM 7927  C CD1  . PHE A 1 23 ? 0.390   -3.663  -5.612  1.00 0.00 ? 23 PHE A CD1  8  
ATOM 7928  C CD2  . PHE A 1 23 ? 2.341   -4.714  -4.731  1.00 0.00 ? 23 PHE A CD2  8  
ATOM 7929  C CE1  . PHE A 1 23 ? -0.407  -4.501  -4.856  1.00 0.00 ? 23 PHE A CE1  8  
ATOM 7930  C CE2  . PHE A 1 23 ? 1.548   -5.555  -3.971  1.00 0.00 ? 23 PHE A CE2  8  
ATOM 7931  C CZ   . PHE A 1 23 ? 0.173   -5.448  -4.034  1.00 0.00 ? 23 PHE A CZ   8  
ATOM 7932  H H    . PHE A 1 23 ? 4.563   -4.291  -7.245  1.00 0.00 ? 23 PHE A H    8  
ATOM 7933  H HA   . PHE A 1 23 ? 1.887   -3.787  -8.155  1.00 0.00 ? 23 PHE A HA   8  
ATOM 7934  H HB2  . PHE A 1 23 ? 3.609   -2.805  -5.917  1.00 0.00 ? 23 PHE A HB2  8  
ATOM 7935  H HB3  . PHE A 1 23 ? 2.191   -1.865  -6.362  1.00 0.00 ? 23 PHE A HB3  8  
ATOM 7936  H HD1  . PHE A 1 23 ? -0.064  -2.924  -6.254  1.00 0.00 ? 23 PHE A HD1  8  
ATOM 7937  H HD2  . PHE A 1 23 ? 3.416   -4.798  -4.680  1.00 0.00 ? 23 PHE A HD2  8  
ATOM 7938  H HE1  . PHE A 1 23 ? -1.483  -4.416  -4.908  1.00 0.00 ? 23 PHE A HE1  8  
ATOM 7939  H HE2  . PHE A 1 23 ? 2.004   -6.294  -3.330  1.00 0.00 ? 23 PHE A HE2  8  
ATOM 7940  H HZ   . PHE A 1 23 ? -0.449  -6.104  -3.443  1.00 0.00 ? 23 PHE A HZ   8  
ATOM 7941  N N    . THR A 1 24 ? 4.264   -1.564  -8.680  1.00 0.00 ? 24 THR A N    8  
ATOM 7942  C CA   . THR A 1 24 ? 4.638   -0.415  -9.496  1.00 0.00 ? 24 THR A CA   8  
ATOM 7943  C C    . THR A 1 24 ? 4.402   -0.697  -10.977 1.00 0.00 ? 24 THR A C    8  
ATOM 7944  O O    . THR A 1 24 ? 4.107   0.213   -11.753 1.00 0.00 ? 24 THR A O    8  
ATOM 7945  C CB   . THR A 1 24 ? 6.106   -0.055  -9.265  1.00 0.00 ? 24 THR A CB   8  
ATOM 7946  O OG1  . THR A 1 24 ? 6.937   -1.187  -9.455  1.00 0.00 ? 24 THR A OG1  8  
ATOM 7947  C CG2  . THR A 1 24 ? 6.377   0.488   -7.880  1.00 0.00 ? 24 THR A CG2  8  
ATOM 7948  H H    . THR A 1 24 ? 4.929   -1.958  -8.071  1.00 0.00 ? 24 THR A H    8  
ATOM 7949  H HA   . THR A 1 24 ? 4.021   0.418   -9.198  1.00 0.00 ? 24 THR A HA   8  
ATOM 7950  H HB   . THR A 1 24 ? 6.397   0.704   -9.977  1.00 0.00 ? 24 THR A HB   8  
ATOM 7951  H HG1  . THR A 1 24 ? 7.799   -0.903  -9.766  1.00 0.00 ? 24 THR A HG1  8  
ATOM 7952  H HG21 . THR A 1 24 ? 6.724   1.509   -7.955  1.00 0.00 ? 24 THR A HG21 8  
ATOM 7953  H HG22 . THR A 1 24 ? 7.132   -0.114  -7.400  1.00 0.00 ? 24 THR A HG22 8  
ATOM 7954  H HG23 . THR A 1 24 ? 5.468   0.458   -7.298  1.00 0.00 ? 24 THR A HG23 8  
ATOM 7955  N N    . SER A 1 25 ? 4.536   -1.962  -11.362 1.00 0.00 ? 25 SER A N    8  
ATOM 7956  C CA   . SER A 1 25 ? 4.347   -2.363  -12.753 1.00 0.00 ? 25 SER A CA   8  
ATOM 7957  C C    . SER A 1 25 ? 2.974   -1.941  -13.269 1.00 0.00 ? 25 SER A C    8  
ATOM 7958  O O    . SER A 1 25 ? 2.777   -1.787  -14.475 1.00 0.00 ? 25 SER A O    8  
ATOM 7959  C CB   . SER A 1 25 ? 4.511   -3.878  -12.894 1.00 0.00 ? 25 SER A CB   8  
ATOM 7960  O OG   . SER A 1 25 ? 3.307   -4.554  -12.575 1.00 0.00 ? 25 SER A OG   8  
ATOM 7961  H H    . SER A 1 25 ? 4.779   -2.641  -10.698 1.00 0.00 ? 25 SER A H    8  
ATOM 7962  H HA   . SER A 1 25 ? 5.106   -1.872  -13.343 1.00 0.00 ? 25 SER A HA   8  
ATOM 7963  H HB2  . SER A 1 25 ? 4.782   -4.115  -13.913 1.00 0.00 ? 25 SER A HB2  8  
ATOM 7964  H HB3  . SER A 1 25 ? 5.288   -4.218  -12.227 1.00 0.00 ? 25 SER A HB3  8  
ATOM 7965  H HG   . SER A 1 25 ? 3.484   -5.493  -12.472 1.00 0.00 ? 25 SER A HG   8  
ATOM 7966  N N    . GLN A 1 26 ? 2.028   -1.755  -12.353 1.00 0.00 ? 26 GLN A N    8  
ATOM 7967  C CA   . GLN A 1 26 ? 0.674   -1.355  -12.726 1.00 0.00 ? 26 GLN A CA   8  
ATOM 7968  C C    . GLN A 1 26 ? 0.474   0.143   -12.523 1.00 0.00 ? 26 GLN A C    8  
ATOM 7969  O O    . GLN A 1 26 ? -0.242  0.794   -13.285 1.00 0.00 ? 26 GLN A O    8  
ATOM 7970  C CB   . GLN A 1 26 ? -0.364  -2.130  -11.905 1.00 0.00 ? 26 GLN A CB   8  
ATOM 7971  C CG   . GLN A 1 26 ? 0.090   -3.518  -11.483 1.00 0.00 ? 26 GLN A CG   8  
ATOM 7972  C CD   . GLN A 1 26 ? 0.094   -4.507  -12.632 1.00 0.00 ? 26 GLN A CD   8  
ATOM 7973  O OE1  . GLN A 1 26 ? -0.509  -4.265  -13.677 1.00 0.00 ? 26 GLN A OE1  8  
ATOM 7974  N NE2  . GLN A 1 26 ? 0.774   -5.631  -12.440 1.00 0.00 ? 26 GLN A NE2  8  
ATOM 7975  H H    . GLN A 1 26 ? 2.243   -1.895  -11.407 1.00 0.00 ? 26 GLN A H    8  
ATOM 7976  H HA   . GLN A 1 26 ? 0.538   -1.585  -13.773 1.00 0.00 ? 26 GLN A HA   8  
ATOM 7977  H HB2  . GLN A 1 26 ? -0.593  -1.564  -11.014 1.00 0.00 ? 26 GLN A HB2  8  
ATOM 7978  H HB3  . GLN A 1 26 ? -1.264  -2.234  -12.494 1.00 0.00 ? 26 GLN A HB3  8  
ATOM 7979  H HG2  . GLN A 1 26 ? 1.091   -3.449  -11.084 1.00 0.00 ? 26 GLN A HG2  8  
ATOM 7980  H HG3  . GLN A 1 26 ? -0.578  -3.883  -10.717 1.00 0.00 ? 26 GLN A HG3  8  
ATOM 7981  H HE21 . GLN A 1 26 ? 1.229   -5.757  -11.581 1.00 0.00 ? 26 GLN A HE21 8  
ATOM 7982  H HE22 . GLN A 1 26 ? 0.792   -6.290  -13.165 1.00 0.00 ? 26 GLN A HE22 8  
ATOM 7983  N N    . GLY A 1 27 ? 1.108   0.682   -11.488 1.00 0.00 ? 27 GLY A N    8  
ATOM 7984  C CA   . GLY A 1 27 ? 0.986   2.098   -11.194 1.00 0.00 ? 27 GLY A CA   8  
ATOM 7985  C C    . GLY A 1 27 ? 0.798   2.364   -9.714  1.00 0.00 ? 27 GLY A C    8  
ATOM 7986  O O    . GLY A 1 27 ? -0.012  3.204   -9.324  1.00 0.00 ? 27 GLY A O    8  
ATOM 7987  H H    . GLY A 1 27 ? 1.661   0.112   -10.915 1.00 0.00 ? 27 GLY A H    8  
ATOM 7988  H HA2  . GLY A 1 27 ? 1.879   2.604   -11.530 1.00 0.00 ? 27 GLY A HA2  8  
ATOM 7989  H HA3  . GLY A 1 27 ? 0.136   2.494   -11.730 1.00 0.00 ? 27 GLY A HA3  8  
ATOM 7990  N N    . LEU A 1 28 ? 1.552   1.645   -8.888  1.00 0.00 ? 28 LEU A N    8  
ATOM 7991  C CA   . LEU A 1 28 ? 1.464   1.798   -7.443  1.00 0.00 ? 28 LEU A CA   8  
ATOM 7992  C C    . LEU A 1 28 ? 2.594   2.676   -6.916  1.00 0.00 ? 28 LEU A C    8  
ATOM 7993  O O    . LEU A 1 28 ? 3.150   2.417   -5.848  1.00 0.00 ? 28 LEU A O    8  
ATOM 7994  C CB   . LEU A 1 28 ? 1.500   0.427   -6.763  1.00 0.00 ? 28 LEU A CB   8  
ATOM 7995  C CG   . LEU A 1 28 ? 0.235   0.055   -5.986  1.00 0.00 ? 28 LEU A CG   8  
ATOM 7996  C CD1  . LEU A 1 28 ? 0.129   0.876   -4.710  1.00 0.00 ? 28 LEU A CD1  8  
ATOM 7997  C CD2  . LEU A 1 28 ? -1.001  0.248   -6.852  1.00 0.00 ? 28 LEU A CD2  8  
ATOM 7998  H H    . LEU A 1 28 ? 2.175   0.988   -9.261  1.00 0.00 ? 28 LEU A H    8  
ATOM 7999  H HA   . LEU A 1 28 ? 0.522   2.277   -7.219  1.00 0.00 ? 28 LEU A HA   8  
ATOM 8000  H HB2  . LEU A 1 28 ? 1.663   -0.322  -7.523  1.00 0.00 ? 28 LEU A HB2  8  
ATOM 8001  H HB3  . LEU A 1 28 ? 2.336   0.408   -6.079  1.00 0.00 ? 28 LEU A HB3  8  
ATOM 8002  H HG   . LEU A 1 28 ? 0.287   -0.987  -5.707  1.00 0.00 ? 28 LEU A HG   8  
ATOM 8003  H HD11 . LEU A 1 28 ? -0.907  1.111   -4.517  1.00 0.00 ? 28 LEU A HD11 8  
ATOM 8004  H HD12 . LEU A 1 28 ? 0.691   1.792   -4.824  1.00 0.00 ? 28 LEU A HD12 8  
ATOM 8005  H HD13 . LEU A 1 28 ? 0.530   0.309   -3.882  1.00 0.00 ? 28 LEU A HD13 8  
ATOM 8006  H HD21 . LEU A 1 28 ? -1.146  1.300   -7.046  1.00 0.00 ? 28 LEU A HD21 8  
ATOM 8007  H HD22 . LEU A 1 28 ? -1.866  -0.145  -6.336  1.00 0.00 ? 28 LEU A HD22 8  
ATOM 8008  H HD23 . LEU A 1 28 ? -0.872  -0.276  -7.786  1.00 0.00 ? 28 LEU A HD23 8  
ATOM 8009  N N    . GLN A 1 29 ? 2.915   3.728   -7.660  1.00 0.00 ? 29 GLN A N    8  
ATOM 8010  C CA   . GLN A 1 29 ? 3.957   4.663   -7.252  1.00 0.00 ? 29 GLN A CA   8  
ATOM 8011  C C    . GLN A 1 29 ? 3.328   5.895   -6.615  1.00 0.00 ? 29 GLN A C    8  
ATOM 8012  O O    . GLN A 1 29 ? 3.912   6.520   -5.730  1.00 0.00 ? 29 GLN A O    8  
ATOM 8013  C CB   . GLN A 1 29 ? 4.816   5.066   -8.452  1.00 0.00 ? 29 GLN A CB   8  
ATOM 8014  C CG   . GLN A 1 29 ? 4.038   5.782   -9.543  1.00 0.00 ? 29 GLN A CG   8  
ATOM 8015  C CD   . GLN A 1 29 ? 4.937   6.558   -10.487 1.00 0.00 ? 29 GLN A CD   8  
ATOM 8016  O OE1  . GLN A 1 29 ? 6.000   6.081   -10.883 1.00 0.00 ? 29 GLN A OE1  8  
ATOM 8017  N NE2  . GLN A 1 29 ? 4.512   7.762   -10.853 1.00 0.00 ? 29 GLN A NE2  8  
ATOM 8018  H H    . GLN A 1 29 ? 2.426   3.892   -8.494  1.00 0.00 ? 29 GLN A H    8  
ATOM 8019  H HA   . GLN A 1 29 ? 4.579   4.168   -6.520  1.00 0.00 ? 29 GLN A HA   8  
ATOM 8020  H HB2  . GLN A 1 29 ? 5.604   5.721   -8.112  1.00 0.00 ? 29 GLN A HB2  8  
ATOM 8021  H HB3  . GLN A 1 29 ? 5.257   4.177   -8.878  1.00 0.00 ? 29 GLN A HB3  8  
ATOM 8022  H HG2  . GLN A 1 29 ? 3.487   5.051   -10.116 1.00 0.00 ? 29 GLN A HG2  8  
ATOM 8023  H HG3  . GLN A 1 29 ? 3.347   6.472   -9.082  1.00 0.00 ? 29 GLN A HG3  8  
ATOM 8024  H HE21 . GLN A 1 29 ? 3.655   8.078   -10.499 1.00 0.00 ? 29 GLN A HE21 8  
ATOM 8025  H HE22 . GLN A 1 29 ? 5.074   8.285   -11.463 1.00 0.00 ? 29 GLN A HE22 8  
ATOM 8026  N N    . SER A 1 30 ? 2.117   6.217   -7.056  1.00 0.00 ? 30 SER A N    8  
ATOM 8027  C CA   . SER A 1 30 ? 1.371   7.342   -6.508  1.00 0.00 ? 30 SER A CA   8  
ATOM 8028  C C    . SER A 1 30 ? 0.164   6.833   -5.734  1.00 0.00 ? 30 SER A C    8  
ATOM 8029  O O    . SER A 1 30 ? -0.785  6.322   -6.323  1.00 0.00 ? 30 SER A O    8  
ATOM 8030  C CB   . SER A 1 30 ? 0.919   8.283   -7.625  1.00 0.00 ? 30 SER A CB   8  
ATOM 8031  O OG   . SER A 1 30 ? 0.823   7.598   -8.862  1.00 0.00 ? 30 SER A OG   8  
ATOM 8032  H H    . SER A 1 30 ? 1.701   5.663   -7.750  1.00 0.00 ? 30 SER A H    8  
ATOM 8033  H HA   . SER A 1 30 ? 2.017   7.877   -5.832  1.00 0.00 ? 30 SER A HA   8  
ATOM 8034  H HB2  . SER A 1 30 ? -0.049  8.692   -7.379  1.00 0.00 ? 30 SER A HB2  8  
ATOM 8035  H HB3  . SER A 1 30 ? 1.633   9.086   -7.727  1.00 0.00 ? 30 SER A HB3  8  
ATOM 8036  H HG   . SER A 1 30 ? -0.085  7.624   -9.173  1.00 0.00 ? 30 SER A HG   8  
ATOM 8037  N N    . ILE A 1 31 ? 0.210   6.961   -4.409  1.00 0.00 ? 31 ILE A N    8  
ATOM 8038  C CA   . ILE A 1 31 ? -0.876  6.482   -3.555  1.00 0.00 ? 31 ILE A CA   8  
ATOM 8039  C C    . ILE A 1 31 ? -2.247  6.867   -4.120  1.00 0.00 ? 31 ILE A C    8  
ATOM 8040  O O    . ILE A 1 31 ? -3.241  6.178   -3.896  1.00 0.00 ? 31 ILE A O    8  
ATOM 8041  C CB   . ILE A 1 31 ? -0.728  7.001   -2.104  1.00 0.00 ? 31 ILE A CB   8  
ATOM 8042  C CG1  . ILE A 1 31 ? -1.498  6.097   -1.139  1.00 0.00 ? 31 ILE A CG1  8  
ATOM 8043  C CG2  . ILE A 1 31 ? -1.201  8.443   -1.977  1.00 0.00 ? 31 ILE A CG2  8  
ATOM 8044  C CD1  . ILE A 1 31 ? -0.602  5.259   -0.254  1.00 0.00 ? 31 ILE A CD1  8  
ATOM 8045  H H    . ILE A 1 31 ? 1.000   7.365   -3.996  1.00 0.00 ? 31 ILE A H    8  
ATOM 8046  H HA   . ILE A 1 31 ? -0.811  5.406   -3.522  1.00 0.00 ? 31 ILE A HA   8  
ATOM 8047  H HB   . ILE A 1 31 ? 0.320   6.975   -1.847  1.00 0.00 ? 31 ILE A HB   8  
ATOM 8048  H HG12 . ILE A 1 31 ? -2.119  6.707   -0.502  1.00 0.00 ? 31 ILE A HG12 8  
ATOM 8049  H HG13 . ILE A 1 31 ? -2.124  5.424   -1.708  1.00 0.00 ? 31 ILE A HG13 8  
ATOM 8050  H HG21 . ILE A 1 31 ? -0.621  8.947   -1.219  1.00 0.00 ? 31 ILE A HG21 8  
ATOM 8051  H HG22 . ILE A 1 31 ? -2.245  8.452   -1.699  1.00 0.00 ? 31 ILE A HG22 8  
ATOM 8052  H HG23 . ILE A 1 31 ? -1.077  8.946   -2.924  1.00 0.00 ? 31 ILE A HG23 8  
ATOM 8053  H HD11 . ILE A 1 31 ? 0.309   5.801   -0.048  1.00 0.00 ? 31 ILE A HD11 8  
ATOM 8054  H HD12 . ILE A 1 31 ? -0.365  4.333   -0.755  1.00 0.00 ? 31 ILE A HD12 8  
ATOM 8055  H HD13 . ILE A 1 31 ? -1.111  5.047   0.674   1.00 0.00 ? 31 ILE A HD13 8  
ATOM 8056  N N    . TYR A 1 32 ? -2.288  7.973   -4.856  1.00 0.00 ? 32 TYR A N    8  
ATOM 8057  C CA   . TYR A 1 32 ? -3.528  8.432   -5.468  1.00 0.00 ? 32 TYR A CA   8  
ATOM 8058  C C    . TYR A 1 32 ? -4.096  7.365   -6.401  1.00 0.00 ? 32 TYR A C    8  
ATOM 8059  O O    . TYR A 1 32 ? -5.293  7.354   -6.690  1.00 0.00 ? 32 TYR A O    8  
ATOM 8060  C CB   . TYR A 1 32 ? -3.288  9.728   -6.245  1.00 0.00 ? 32 TYR A CB   8  
ATOM 8061  C CG   . TYR A 1 32 ? -3.579  10.979  -5.444  1.00 0.00 ? 32 TYR A CG   8  
ATOM 8062  C CD1  . TYR A 1 32 ? -3.118  11.113  -4.142  1.00 0.00 ? 32 TYR A CD1  8  
ATOM 8063  C CD2  . TYR A 1 32 ? -4.311  12.023  -5.993  1.00 0.00 ? 32 TYR A CD2  8  
ATOM 8064  C CE1  . TYR A 1 32 ? -3.379  12.255  -3.407  1.00 0.00 ? 32 TYR A CE1  8  
ATOM 8065  C CE2  . TYR A 1 32 ? -4.578  13.167  -5.266  1.00 0.00 ? 32 TYR A CE2  8  
ATOM 8066  C CZ   . TYR A 1 32 ? -4.110  13.278  -3.973  1.00 0.00 ? 32 TYR A CZ   8  
ATOM 8067  O OH   . TYR A 1 32 ? -4.373  14.416  -3.245  1.00 0.00 ? 32 TYR A OH   8  
ATOM 8068  H H    . TYR A 1 32 ? -1.464  8.481   -5.006  1.00 0.00 ? 32 TYR A H    8  
ATOM 8069  H HA   . TYR A 1 32 ? -4.239  8.618   -4.677  1.00 0.00 ? 32 TYR A HA   8  
ATOM 8070  H HB2  . TYR A 1 32 ? -2.256  9.768   -6.557  1.00 0.00 ? 32 TYR A HB2  8  
ATOM 8071  H HB3  . TYR A 1 32 ? -3.925  9.739   -7.117  1.00 0.00 ? 32 TYR A HB3  8  
ATOM 8072  H HD1  . TYR A 1 32 ? -2.546  10.310  -3.701  1.00 0.00 ? 32 TYR A HD1  8  
ATOM 8073  H HD2  . TYR A 1 32 ? -4.677  11.933  -7.006  1.00 0.00 ? 32 TYR A HD2  8  
ATOM 8074  H HE1  . TYR A 1 32 ? -3.012  12.341  -2.395  1.00 0.00 ? 32 TYR A HE1  8  
ATOM 8075  H HE2  . TYR A 1 32 ? -5.150  13.969  -5.710  1.00 0.00 ? 32 TYR A HE2  8  
ATOM 8076  H HH   . TYR A 1 32 ? -5.266  14.715  -3.429  1.00 0.00 ? 32 TYR A HH   8  
ATOM 8077  N N    . HIS A 1 33 ? -3.230  6.467   -6.868  1.00 0.00 ? 33 HIS A N    8  
ATOM 8078  C CA   . HIS A 1 33 ? -3.648  5.398   -7.769  1.00 0.00 ? 33 HIS A CA   8  
ATOM 8079  C C    . HIS A 1 33 ? -4.206  4.207   -6.992  1.00 0.00 ? 33 HIS A C    8  
ATOM 8080  O O    . HIS A 1 33 ? -4.924  3.376   -7.551  1.00 0.00 ? 33 HIS A O    8  
ATOM 8081  C CB   . HIS A 1 33 ? -2.472  4.947   -8.635  1.00 0.00 ? 33 HIS A CB   8  
ATOM 8082  C CG   . HIS A 1 33 ? -2.294  5.761   -9.878  1.00 0.00 ? 33 HIS A CG   8  
ATOM 8083  N ND1  . HIS A 1 33 ? -1.955  5.211   -11.096 1.00 0.00 ? 33 HIS A ND1  8  
ATOM 8084  C CD2  . HIS A 1 33 ? -2.410  7.094   -10.087 1.00 0.00 ? 33 HIS A CD2  8  
ATOM 8085  C CE1  . HIS A 1 33 ? -1.871  6.171   -12.002 1.00 0.00 ? 33 HIS A CE1  8  
ATOM 8086  N NE2  . HIS A 1 33 ? -2.143  7.321   -11.415 1.00 0.00 ? 33 HIS A NE2  8  
ATOM 8087  H H    . HIS A 1 33 ? -2.284  6.526   -6.604  1.00 0.00 ? 33 HIS A H    8  
ATOM 8088  H HA   . HIS A 1 33 ? -4.425  5.791   -8.407  1.00 0.00 ? 33 HIS A HA   8  
ATOM 8089  H HB2  . HIS A 1 33 ? -1.561  5.017   -8.057  1.00 0.00 ? 33 HIS A HB2  8  
ATOM 8090  H HB3  . HIS A 1 33 ? -2.625  3.920   -8.930  1.00 0.00 ? 33 HIS A HB3  8  
ATOM 8091  H HD1  . HIS A 1 33 ? -1.800  4.260   -11.272 1.00 0.00 ? 33 HIS A HD1  8  
ATOM 8092  H HD2  . HIS A 1 33 ? -2.667  7.840   -9.348  1.00 0.00 ? 33 HIS A HD2  8  
ATOM 8093  H HE1  . HIS A 1 33 ? -1.623  6.035   -13.044 1.00 0.00 ? 33 HIS A HE1  8  
ATOM 8094  H HE2  . HIS A 1 33 ? -2.151  8.195   -11.858 1.00 0.00 ? 33 HIS A HE2  8  
ATOM 8095  N N    . LEU A 1 34 ? -3.868  4.121   -5.708  1.00 0.00 ? 34 LEU A N    8  
ATOM 8096  C CA   . LEU A 1 34 ? -4.342  3.028   -4.867  1.00 0.00 ? 34 LEU A CA   8  
ATOM 8097  C C    . LEU A 1 34 ? -5.346  3.513   -3.825  1.00 0.00 ? 34 LEU A C    8  
ATOM 8098  O O    . LEU A 1 34 ? -5.672  2.791   -2.883  1.00 0.00 ? 34 LEU A O    8  
ATOM 8099  C CB   . LEU A 1 34 ? -3.164  2.348   -4.171  1.00 0.00 ? 34 LEU A CB   8  
ATOM 8100  C CG   . LEU A 1 34 ? -2.002  3.272   -3.797  1.00 0.00 ? 34 LEU A CG   8  
ATOM 8101  C CD1  . LEU A 1 34 ? -1.203  2.680   -2.647  1.00 0.00 ? 34 LEU A CD1  8  
ATOM 8102  C CD2  . LEU A 1 34 ? -1.105  3.509   -5.002  1.00 0.00 ? 34 LEU A CD2  8  
ATOM 8103  H H    . LEU A 1 34 ? -3.296  4.811   -5.315  1.00 0.00 ? 34 LEU A H    8  
ATOM 8104  H HA   . LEU A 1 34 ? -4.831  2.309   -5.509  1.00 0.00 ? 34 LEU A HA   8  
ATOM 8105  H HB2  . LEU A 1 34 ? -3.527  1.879   -3.270  1.00 0.00 ? 34 LEU A HB2  8  
ATOM 8106  H HB3  . LEU A 1 34 ? -2.788  1.583   -4.828  1.00 0.00 ? 34 LEU A HB3  8  
ATOM 8107  H HG   . LEU A 1 34 ? -2.391  4.228   -3.475  1.00 0.00 ? 34 LEU A HG   8  
ATOM 8108  H HD11 . LEU A 1 34 ? -0.154  2.898   -2.788  1.00 0.00 ? 34 LEU A HD11 8  
ATOM 8109  H HD12 . LEU A 1 34 ? -1.348  1.610   -2.620  1.00 0.00 ? 34 LEU A HD12 8  
ATOM 8110  H HD13 . LEU A 1 34 ? -1.538  3.112   -1.716  1.00 0.00 ? 34 LEU A HD13 8  
ATOM 8111  H HD21 . LEU A 1 34 ? -1.410  4.412   -5.505  1.00 0.00 ? 34 LEU A HD21 8  
ATOM 8112  H HD22 . LEU A 1 34 ? -1.188  2.675   -5.681  1.00 0.00 ? 34 LEU A HD22 8  
ATOM 8113  H HD23 . LEU A 1 34 ? -0.081  3.607   -4.675  1.00 0.00 ? 34 LEU A HD23 8  
ATOM 8114  N N    . GLN A 1 35 ? -5.839  4.733   -4.001  1.00 0.00 ? 35 GLN A N    8  
ATOM 8115  C CA   . GLN A 1 35 ? -6.804  5.308   -3.072  1.00 0.00 ? 35 GLN A CA   8  
ATOM 8116  C C    . GLN A 1 35 ? -8.150  4.589   -3.150  1.00 0.00 ? 35 GLN A C    8  
ATOM 8117  O O    . GLN A 1 35 ? -8.978  4.712   -2.247  1.00 0.00 ? 35 GLN A O    8  
ATOM 8118  C CB   . GLN A 1 35 ? -6.997  6.796   -3.367  1.00 0.00 ? 35 GLN A CB   8  
ATOM 8119  C CG   . GLN A 1 35 ? -7.865  7.511   -2.345  1.00 0.00 ? 35 GLN A CG   8  
ATOM 8120  C CD   . GLN A 1 35 ? -7.086  8.514   -1.516  1.00 0.00 ? 35 GLN A CD   8  
ATOM 8121  O OE1  . GLN A 1 35 ? -7.347  9.715   -1.569  1.00 0.00 ? 35 GLN A OE1  8  
ATOM 8122  N NE2  . GLN A 1 35 ? -6.125  8.023   -0.742  1.00 0.00 ? 35 GLN A NE2  8  
ATOM 8123  H H    . GLN A 1 35 ? -5.543  5.261   -4.768  1.00 0.00 ? 35 GLN A H    8  
ATOM 8124  H HA   . GLN A 1 35 ? -6.409  5.196   -2.073  1.00 0.00 ? 35 GLN A HA   8  
ATOM 8125  H HB2  . GLN A 1 35 ? -6.030  7.276   -3.386  1.00 0.00 ? 35 GLN A HB2  8  
ATOM 8126  H HB3  . GLN A 1 35 ? -7.460  6.901   -4.337  1.00 0.00 ? 35 GLN A HB3  8  
ATOM 8127  H HG2  . GLN A 1 35 ? -8.654  8.032   -2.865  1.00 0.00 ? 35 GLN A HG2  8  
ATOM 8128  H HG3  . GLN A 1 35 ? -8.295  6.776   -1.681  1.00 0.00 ? 35 GLN A HG3  8  
ATOM 8129  H HE21 . GLN A 1 35 ? -5.973  7.055   -0.750  1.00 0.00 ? 35 GLN A HE21 8  
ATOM 8130  H HE22 . GLN A 1 35 ? -5.606  8.649   -0.196  1.00 0.00 ? 35 GLN A HE22 8  
ATOM 8131  N N    . ASN A 1 36 ? -8.369  3.846   -4.232  1.00 0.00 ? 36 ASN A N    8  
ATOM 8132  C CA   . ASN A 1 36 ? -9.626  3.131   -4.419  1.00 0.00 ? 36 ASN A CA   8  
ATOM 8133  C C    . ASN A 1 36 ? -9.394  1.656   -4.739  1.00 0.00 ? 36 ASN A C    8  
ATOM 8134  O O    . ASN A 1 36 ? -10.291 0.975   -5.239  1.00 0.00 ? 36 ASN A O    8  
ATOM 8135  C CB   . ASN A 1 36 ? -10.437 3.784   -5.539  1.00 0.00 ? 36 ASN A CB   8  
ATOM 8136  C CG   . ASN A 1 36 ? -11.376 4.855   -5.025  1.00 0.00 ? 36 ASN A CG   8  
ATOM 8137  O OD1  . ASN A 1 36 ? -12.431 4.558   -4.464  1.00 0.00 ? 36 ASN A OD1  8  
ATOM 8138  N ND2  . ASN A 1 36 ? -10.994 6.112   -5.214  1.00 0.00 ? 36 ASN A ND2  8  
ATOM 8139  H H    . ASN A 1 36 ? -7.681  3.791   -4.926  1.00 0.00 ? 36 ASN A H    8  
ATOM 8140  H HA   . ASN A 1 36 ? -10.184 3.202   -3.496  1.00 0.00 ? 36 ASN A HA   8  
ATOM 8141  H HB2  . ASN A 1 36 ? -9.760  4.239   -6.247  1.00 0.00 ? 36 ASN A HB2  8  
ATOM 8142  H HB3  . ASN A 1 36 ? -11.023 3.028   -6.041  1.00 0.00 ? 36 ASN A HB3  8  
ATOM 8143  H HD21 . ASN A 1 36 ? -10.140 6.274   -5.668  1.00 0.00 ? 36 ASN A HD21 8  
ATOM 8144  H HD22 . ASN A 1 36 ? -11.580 6.826   -4.893  1.00 0.00 ? 36 ASN A HD22 8  
ATOM 8145  N N    . LEU A 1 37 ? -8.194  1.161   -4.447  1.00 0.00 ? 37 LEU A N    8  
ATOM 8146  C CA   . LEU A 1 37 ? -7.866  -0.238  -4.698  1.00 0.00 ? 37 LEU A CA   8  
ATOM 8147  C C    . LEU A 1 37 ? -8.319  -1.113  -3.536  1.00 0.00 ? 37 LEU A C    8  
ATOM 8148  O O    . LEU A 1 37 ? -8.314  -0.680  -2.384  1.00 0.00 ? 37 LEU A O    8  
ATOM 8149  C CB   . LEU A 1 37 ? -6.361  -0.402  -4.921  1.00 0.00 ? 37 LEU A CB   8  
ATOM 8150  C CG   . LEU A 1 37 ? -5.968  -1.020  -6.264  1.00 0.00 ? 37 LEU A CG   8  
ATOM 8151  C CD1  . LEU A 1 37 ? -4.747  -0.316  -6.836  1.00 0.00 ? 37 LEU A CD1  8  
ATOM 8152  C CD2  . LEU A 1 37 ? -5.704  -2.511  -6.108  1.00 0.00 ? 37 LEU A CD2  8  
ATOM 8153  H H    . LEU A 1 37 ? -7.518  1.746   -4.044  1.00 0.00 ? 37 LEU A H    8  
ATOM 8154  H HA   . LEU A 1 37 ? -8.391  -0.545  -5.591  1.00 0.00 ? 37 LEU A HA   8  
ATOM 8155  H HB2  . LEU A 1 37 ? -5.900  0.573   -4.851  1.00 0.00 ? 37 LEU A HB2  8  
ATOM 8156  H HB3  . LEU A 1 37 ? -5.966  -1.025  -4.133  1.00 0.00 ? 37 LEU A HB3  8  
ATOM 8157  H HG   . LEU A 1 37 ? -6.782  -0.897  -6.963  1.00 0.00 ? 37 LEU A HG   8  
ATOM 8158  H HD11 . LEU A 1 37 ? -4.140  0.063   -6.027  1.00 0.00 ? 37 LEU A HD11 8  
ATOM 8159  H HD12 . LEU A 1 37 ? -5.066  0.504   -7.462  1.00 0.00 ? 37 LEU A HD12 8  
ATOM 8160  H HD13 . LEU A 1 37 ? -4.170  -1.016  -7.423  1.00 0.00 ? 37 LEU A HD13 8  
ATOM 8161  H HD21 . LEU A 1 37 ? -6.358  -2.915  -5.350  1.00 0.00 ? 37 LEU A HD21 8  
ATOM 8162  H HD22 . LEU A 1 37 ? -4.676  -2.665  -5.816  1.00 0.00 ? 37 LEU A HD22 8  
ATOM 8163  H HD23 . LEU A 1 37 ? -5.890  -3.010  -7.048  1.00 0.00 ? 37 LEU A HD23 8  
ATOM 8164  N N    . THR A 1 38 ? -8.710  -2.345  -3.841  1.00 0.00 ? 38 THR A N    8  
ATOM 8165  C CA   . THR A 1 38 ? -9.168  -3.271  -2.813  1.00 0.00 ? 38 THR A CA   8  
ATOM 8166  C C    . THR A 1 38 ? -8.487  -4.622  -2.937  1.00 0.00 ? 38 THR A C    8  
ATOM 8167  O O    . THR A 1 38 ? -7.806  -4.900  -3.922  1.00 0.00 ? 38 THR A O    8  
ATOM 8168  C CB   . THR A 1 38 ? -10.680 -3.471  -2.908  1.00 0.00 ? 38 THR A CB   8  
ATOM 8169  O OG1  . THR A 1 38 ? -11.237 -2.637  -3.910  1.00 0.00 ? 38 THR A OG1  8  
ATOM 8170  C CG2  . THR A 1 38 ? -11.397 -3.181  -1.611  1.00 0.00 ? 38 THR A CG2  8  
ATOM 8171  H H    . THR A 1 38 ? -8.696  -2.636  -4.777  1.00 0.00 ? 38 THR A H    8  
ATOM 8172  H HA   . THR A 1 38 ? -8.929  -2.846  -1.850  1.00 0.00 ? 38 THR A HA   8  
ATOM 8173  H HB   . THR A 1 38 ? -10.881 -4.507  -3.172  1.00 0.00 ? 38 THR A HB   8  
ATOM 8174  H HG1  . THR A 1 38 ? -11.189 -1.721  -3.626  1.00 0.00 ? 38 THR A HG1  8  
ATOM 8175  H HG21 . THR A 1 38 ? -11.864 -4.084  -1.250  1.00 0.00 ? 38 THR A HG21 8  
ATOM 8176  H HG22 . THR A 1 38 ? -12.150 -2.426  -1.778  1.00 0.00 ? 38 THR A HG22 8  
ATOM 8177  H HG23 . THR A 1 38 ? -10.684 -2.827  -0.882  1.00 0.00 ? 38 THR A HG23 8  
ATOM 8178  N N    . ILE A 1 39 ? -8.729  -5.479  -1.955  1.00 0.00 ? 39 ILE A N    8  
ATOM 8179  C CA   . ILE A 1 39 ? -8.196  -6.827  -1.985  1.00 0.00 ? 39 ILE A CA   8  
ATOM 8180  C C    . ILE A 1 39 ? -8.653  -7.530  -3.253  1.00 0.00 ? 39 ILE A C    8  
ATOM 8181  O O    . ILE A 1 39 ? -7.921  -8.326  -3.839  1.00 0.00 ? 39 ILE A O    8  
ATOM 8182  C CB   . ILE A 1 39 ? -8.651  -7.639  -0.760  1.00 0.00 ? 39 ILE A CB   8  
ATOM 8183  C CG1  . ILE A 1 39 ? -7.915  -8.979  -0.711  1.00 0.00 ? 39 ILE A CG1  8  
ATOM 8184  C CG2  . ILE A 1 39 ? -10.156 -7.857  -0.785  1.00 0.00 ? 39 ILE A CG2  8  
ATOM 8185  C CD1  . ILE A 1 39 ? -6.407  -8.844  -0.752  1.00 0.00 ? 39 ILE A CD1  8  
ATOM 8186  H H    . ILE A 1 39 ? -9.310  -5.211  -1.215  1.00 0.00 ? 39 ILE A H    8  
ATOM 8187  H HA   . ILE A 1 39 ? -7.120  -6.764  -1.977  1.00 0.00 ? 39 ILE A HA   8  
ATOM 8188  H HB   . ILE A 1 39 ? -8.413  -7.071  0.124   1.00 0.00 ? 39 ILE A HB   8  
ATOM 8189  H HG12 . ILE A 1 39 ? -8.177  -9.494  0.201   1.00 0.00 ? 39 ILE A HG12 8  
ATOM 8190  H HG13 . ILE A 1 39 ? -8.216  -9.577  -1.557  1.00 0.00 ? 39 ILE A HG13 8  
ATOM 8191  H HG21 . ILE A 1 39 ? -10.658 -6.901  -0.807  1.00 0.00 ? 39 ILE A HG21 8  
ATOM 8192  H HG22 . ILE A 1 39 ? -10.457 -8.401  0.099   1.00 0.00 ? 39 ILE A HG22 8  
ATOM 8193  H HG23 . ILE A 1 39 ? -10.423 -8.425  -1.665  1.00 0.00 ? 39 ILE A HG23 8  
ATOM 8194  H HD11 . ILE A 1 39 ? -6.110  -8.420  -1.700  1.00 0.00 ? 39 ILE A HD11 8  
ATOM 8195  H HD12 . ILE A 1 39 ? -5.956  -9.818  -0.635  1.00 0.00 ? 39 ILE A HD12 8  
ATOM 8196  H HD13 . ILE A 1 39 ? -6.082  -8.196  0.049   1.00 0.00 ? 39 ILE A HD13 8  
ATOM 8197  N N    . GLU A 1 40 ? -9.868  -7.203  -3.679  1.00 0.00 ? 40 GLU A N    8  
ATOM 8198  C CA   . GLU A 1 40 ? -10.435 -7.786  -4.885  1.00 0.00 ? 40 GLU A CA   8  
ATOM 8199  C C    . GLU A 1 40 ? -9.557  -7.485  -6.094  1.00 0.00 ? 40 GLU A C    8  
ATOM 8200  O O    . GLU A 1 40 ? -9.378  -8.329  -6.972  1.00 0.00 ? 40 GLU A O    8  
ATOM 8201  C CB   . GLU A 1 40 ? -11.856 -7.270  -5.123  1.00 0.00 ? 40 GLU A CB   8  
ATOM 8202  C CG   . GLU A 1 40 ? -12.016 -5.776  -4.897  1.00 0.00 ? 40 GLU A CG   8  
ATOM 8203  C CD   . GLU A 1 40 ? -13.050 -5.156  -5.816  1.00 0.00 ? 40 GLU A CD   8  
ATOM 8204  O OE1  . GLU A 1 40 ? -14.250 -5.463  -5.651  1.00 0.00 ? 40 GLU A OE1  8  
ATOM 8205  O OE2  . GLU A 1 40 ? -12.661 -4.362  -6.698  1.00 0.00 ? 40 GLU A OE2  8  
ATOM 8206  H H    . GLU A 1 40 ? -10.395 -6.559  -3.162  1.00 0.00 ? 40 GLU A H    8  
ATOM 8207  H HA   . GLU A 1 40 ? -10.473 -8.849  -4.740  1.00 0.00 ? 40 GLU A HA   8  
ATOM 8208  H HB2  . GLU A 1 40 ? -12.139 -7.488  -6.142  1.00 0.00 ? 40 GLU A HB2  8  
ATOM 8209  H HB3  . GLU A 1 40 ? -12.530 -7.786  -4.454  1.00 0.00 ? 40 GLU A HB3  8  
ATOM 8210  H HG2  . GLU A 1 40 ? -12.321 -5.612  -3.874  1.00 0.00 ? 40 GLU A HG2  8  
ATOM 8211  H HG3  . GLU A 1 40 ? -11.066 -5.293  -5.072  1.00 0.00 ? 40 GLU A HG3  8  
ATOM 8212  N N    . ASP A 1 41 ? -9.016  -6.271  -6.135  1.00 0.00 ? 41 ASP A N    8  
ATOM 8213  C CA   . ASP A 1 41 ? -8.136  -5.861  -7.223  1.00 0.00 ? 41 ASP A CA   8  
ATOM 8214  C C    . ASP A 1 41 ? -6.700  -6.288  -6.941  1.00 0.00 ? 41 ASP A C    8  
ATOM 8215  O O    . ASP A 1 41 ? -5.908  -6.499  -7.859  1.00 0.00 ? 41 ASP A O    8  
ATOM 8216  C CB   . ASP A 1 41 ? -8.204  -4.345  -7.415  1.00 0.00 ? 41 ASP A CB   8  
ATOM 8217  C CG   . ASP A 1 41 ? -9.529  -3.894  -7.996  1.00 0.00 ? 41 ASP A CG   8  
ATOM 8218  O OD1  . ASP A 1 41 ? -10.455 -4.728  -8.079  1.00 0.00 ? 41 ASP A OD1  8  
ATOM 8219  O OD2  . ASP A 1 41 ? -9.641  -2.708  -8.368  1.00 0.00 ? 41 ASP A OD2  8  
ATOM 8220  H H    . ASP A 1 41 ? -9.185  -5.647  -5.397  1.00 0.00 ? 41 ASP A H    8  
ATOM 8221  H HA   . ASP A 1 41 ? -8.475  -6.347  -8.126  1.00 0.00 ? 41 ASP A HA   8  
ATOM 8222  H HB2  . ASP A 1 41 ? -8.068  -3.862  -6.458  1.00 0.00 ? 41 ASP A HB2  8  
ATOM 8223  H HB3  . ASP A 1 41 ? -7.414  -4.036  -8.084  1.00 0.00 ? 41 ASP A HB3  8  
ATOM 8224  N N    . LEU A 1 42 ? -6.377  -6.413  -5.659  1.00 0.00 ? 42 LEU A N    8  
ATOM 8225  C CA   . LEU A 1 42 ? -5.044  -6.813  -5.230  1.00 0.00 ? 42 LEU A CA   8  
ATOM 8226  C C    . LEU A 1 42 ? -4.641  -8.129  -5.884  1.00 0.00 ? 42 LEU A C    8  
ATOM 8227  O O    . LEU A 1 42 ? -3.677  -8.188  -6.647  1.00 0.00 ? 42 LEU A O    8  
ATOM 8228  C CB   . LEU A 1 42 ? -5.014  -6.963  -3.705  1.00 0.00 ? 42 LEU A CB   8  
ATOM 8229  C CG   . LEU A 1 42 ? -4.766  -5.682  -2.881  1.00 0.00 ? 42 LEU A CG   8  
ATOM 8230  C CD1  . LEU A 1 42 ? -3.348  -5.680  -2.338  1.00 0.00 ? 42 LEU A CD1  8  
ATOM 8231  C CD2  . LEU A 1 42 ? -5.029  -4.407  -3.680  1.00 0.00 ? 42 LEU A CD2  8  
ATOM 8232  H H    . LEU A 1 42 ? -7.056  -6.229  -4.978  1.00 0.00 ? 42 LEU A H    8  
ATOM 8233  H HA   . LEU A 1 42 ? -4.349  -6.043  -5.528  1.00 0.00 ? 42 LEU A HA   8  
ATOM 8234  H HB2  . LEU A 1 42 ? -5.960  -7.379  -3.395  1.00 0.00 ? 42 LEU A HB2  8  
ATOM 8235  H HB3  . LEU A 1 42 ? -4.237  -7.672  -3.457  1.00 0.00 ? 42 LEU A HB3  8  
ATOM 8236  H HG   . LEU A 1 42 ? -5.441  -5.680  -2.037  1.00 0.00 ? 42 LEU A HG   8  
ATOM 8237  H HD11 . LEU A 1 42 ? -2.668  -6.022  -3.104  1.00 0.00 ? 42 LEU A HD11 8  
ATOM 8238  H HD12 . LEU A 1 42 ? -3.289  -6.340  -1.485  1.00 0.00 ? 42 LEU A HD12 8  
ATOM 8239  H HD13 . LEU A 1 42 ? -3.078  -4.678  -2.037  1.00 0.00 ? 42 LEU A HD13 8  
ATOM 8240  H HD21 . LEU A 1 42 ? -4.101  -4.048  -4.100  1.00 0.00 ? 42 LEU A HD21 8  
ATOM 8241  H HD22 . LEU A 1 42 ? -5.442  -3.653  -3.026  1.00 0.00 ? 42 LEU A HD22 8  
ATOM 8242  H HD23 . LEU A 1 42 ? -5.726  -4.610  -4.474  1.00 0.00 ? 42 LEU A HD23 8  
ATOM 8243  N N    . GLY A 1 43 ? -5.400  -9.180  -5.588  1.00 0.00 ? 43 GLY A N    8  
ATOM 8244  C CA   . GLY A 1 43 ? -5.123  -10.482 -6.165  1.00 0.00 ? 43 GLY A CA   8  
ATOM 8245  C C    . GLY A 1 43 ? -5.078  -10.444 -7.679  1.00 0.00 ? 43 GLY A C    8  
ATOM 8246  O O    . GLY A 1 43 ? -4.507  -11.332 -8.312  1.00 0.00 ? 43 GLY A O    8  
ATOM 8247  H H    . GLY A 1 43 ? -6.159  -9.067  -4.979  1.00 0.00 ? 43 GLY A H    8  
ATOM 8248  H HA2  . GLY A 1 43 ? -4.171  -10.833 -5.795  1.00 0.00 ? 43 GLY A HA2  8  
ATOM 8249  H HA3  . GLY A 1 43 ? -5.894  -11.171 -5.855  1.00 0.00 ? 43 GLY A HA3  8  
ATOM 8250  N N    . ALA A 1 44 ? -5.685  -9.415  -8.264  1.00 0.00 ? 44 ALA A N    8  
ATOM 8251  C CA   . ALA A 1 44 ? -5.693  -9.259  -9.712  1.00 0.00 ? 44 ALA A CA   8  
ATOM 8252  C C    . ALA A 1 44 ? -4.272  -9.106  -10.236 1.00 0.00 ? 44 ALA A C    8  
ATOM 8253  O O    . ALA A 1 44 ? -3.923  -9.635  -11.291 1.00 0.00 ? 44 ALA A O    8  
ATOM 8254  C CB   . ALA A 1 44 ? -6.539  -8.059  -10.113 1.00 0.00 ? 44 ALA A CB   8  
ATOM 8255  H H    . ALA A 1 44 ? -6.112  -8.732  -7.706  1.00 0.00 ? 44 ALA A H    8  
ATOM 8256  H HA   . ALA A 1 44 ? -6.136  -10.144 -10.144 1.00 0.00 ? 44 ALA A HA   8  
ATOM 8257  H HB1  . ALA A 1 44 ? -5.924  -7.172  -10.122 1.00 0.00 ? 44 ALA A HB1  8  
ATOM 8258  H HB2  . ALA A 1 44 ? -7.343  -7.934  -9.403  1.00 0.00 ? 44 ALA A HB2  8  
ATOM 8259  H HB3  . ALA A 1 44 ? -6.951  -8.222  -11.098 1.00 0.00 ? 44 ALA A HB3  8  
ATOM 8260  N N    . LEU A 1 45 ? -3.453  -8.393  -9.473  1.00 0.00 ? 45 LEU A N    8  
ATOM 8261  C CA   . LEU A 1 45 ? -2.063  -8.172  -9.828  1.00 0.00 ? 45 LEU A CA   8  
ATOM 8262  C C    . LEU A 1 45 ? -1.291  -9.489  -9.915  1.00 0.00 ? 45 LEU A C    8  
ATOM 8263  O O    . LEU A 1 45 ? -0.205  -9.541  -10.490 1.00 0.00 ? 45 LEU A O    8  
ATOM 8264  C CB   . LEU A 1 45 ? -1.422  -7.256  -8.790  1.00 0.00 ? 45 LEU A CB   8  
ATOM 8265  C CG   . LEU A 1 45 ? -1.822  -5.787  -8.902  1.00 0.00 ? 45 LEU A CG   8  
ATOM 8266  C CD1  . LEU A 1 45 ? -3.336  -5.640  -8.889  1.00 0.00 ? 45 LEU A CD1  8  
ATOM 8267  C CD2  . LEU A 1 45 ? -1.198  -4.981  -7.776  1.00 0.00 ? 45 LEU A CD2  8  
ATOM 8268  H H    . LEU A 1 45 ? -3.795  -8.004  -8.641  1.00 0.00 ? 45 LEU A H    8  
ATOM 8269  H HA   . LEU A 1 45 ? -2.038  -7.687  -10.792 1.00 0.00 ? 45 LEU A HA   8  
ATOM 8270  H HB2  . LEU A 1 45 ? -1.707  -7.607  -7.809  1.00 0.00 ? 45 LEU A HB2  8  
ATOM 8271  H HB3  . LEU A 1 45 ? -0.349  -7.330  -8.884  1.00 0.00 ? 45 LEU A HB3  8  
ATOM 8272  H HG   . LEU A 1 45 ? -1.461  -5.396  -9.838  1.00 0.00 ? 45 LEU A HG   8  
ATOM 8273  H HD11 . LEU A 1 45 ? -3.734  -6.102  -7.997  1.00 0.00 ? 45 LEU A HD11 8  
ATOM 8274  H HD12 . LEU A 1 45 ? -3.753  -6.123  -9.760  1.00 0.00 ? 45 LEU A HD12 8  
ATOM 8275  H HD13 . LEU A 1 45 ? -3.596  -4.592  -8.898  1.00 0.00 ? 45 LEU A HD13 8  
ATOM 8276  H HD21 . LEU A 1 45 ? -0.135  -5.165  -7.748  1.00 0.00 ? 45 LEU A HD21 8  
ATOM 8277  H HD22 . LEU A 1 45 ? -1.641  -5.277  -6.837  1.00 0.00 ? 45 LEU A HD22 8  
ATOM 8278  H HD23 . LEU A 1 45 ? -1.378  -3.930  -7.944  1.00 0.00 ? 45 LEU A HD23 8  
ATOM 8279  N N    . LYS A 1 46 ? -1.871  -10.557 -9.365  1.00 0.00 ? 46 LYS A N    8  
ATOM 8280  C CA   . LYS A 1 46 ? -1.233  -11.874 -9.378  1.00 0.00 ? 46 LYS A CA   8  
ATOM 8281  C C    . LYS A 1 46 ? -0.093  -11.940 -8.371  1.00 0.00 ? 46 LYS A C    8  
ATOM 8282  O O    . LYS A 1 46 ? 0.780   -12.804 -8.459  1.00 0.00 ? 46 LYS A O    8  
ATOM 8283  C CB   . LYS A 1 46 ? -0.710  -12.211 -10.778 1.00 0.00 ? 46 LYS A CB   8  
ATOM 8284  C CG   . LYS A 1 46 ? -1.546  -11.609 -11.891 1.00 0.00 ? 46 LYS A CG   8  
ATOM 8285  C CD   . LYS A 1 46 ? -1.835  -12.621 -12.986 1.00 0.00 ? 46 LYS A CD   8  
ATOM 8286  C CE   . LYS A 1 46 ? -3.164  -12.339 -13.668 1.00 0.00 ? 46 LYS A CE   8  
ATOM 8287  N NZ   . LYS A 1 46 ? -3.604  -13.479 -14.519 1.00 0.00 ? 46 LYS A NZ   8  
ATOM 8288  H H    . LYS A 1 46 ? -2.734  -10.454 -8.915  1.00 0.00 ? 46 LYS A H    8  
ATOM 8289  H HA   . LYS A 1 46 ? -1.979  -12.601 -9.098  1.00 0.00 ? 46 LYS A HA   8  
ATOM 8290  H HB2  . LYS A 1 46 ? 0.300   -11.839 -10.872 1.00 0.00 ? 46 LYS A HB2  8  
ATOM 8291  H HB3  . LYS A 1 46 ? -0.705  -13.284 -10.900 1.00 0.00 ? 46 LYS A HB3  8  
ATOM 8292  H HG2  . LYS A 1 46 ? -2.479  -11.263 -11.471 1.00 0.00 ? 46 LYS A HG2  8  
ATOM 8293  H HG3  . LYS A 1 46 ? -1.010  -10.773 -12.315 1.00 0.00 ? 46 LYS A HG3  8  
ATOM 8294  H HD2  . LYS A 1 46 ? -1.047  -12.577 -13.722 1.00 0.00 ? 46 LYS A HD2  8  
ATOM 8295  H HD3  . LYS A 1 46 ? -1.868  -13.609 -12.550 1.00 0.00 ? 46 LYS A HD3  8  
ATOM 8296  H HE2  . LYS A 1 46 ? -3.912  -12.157 -12.911 1.00 0.00 ? 46 LYS A HE2  8  
ATOM 8297  H HE3  . LYS A 1 46 ? -3.055  -11.461 -14.287 1.00 0.00 ? 46 LYS A HE3  8  
ATOM 8298  H HZ1  . LYS A 1 46 ? -3.968  -13.127 -15.428 1.00 0.00 ? 46 LYS A HZ1  8  
ATOM 8299  H HZ2  . LYS A 1 46 ? -4.356  -14.014 -14.040 1.00 0.00 ? 46 LYS A HZ2  8  
ATOM 8300  H HZ3  . LYS A 1 46 ? -2.804  -14.117 -14.703 1.00 0.00 ? 46 LYS A HZ3  8  
ATOM 8301  N N    . ILE A 1 47 ? -0.110  -11.024 -7.413  1.00 0.00 ? 47 ILE A N    8  
ATOM 8302  C CA   . ILE A 1 47 ? 0.914   -10.987 -6.374  1.00 0.00 ? 47 ILE A CA   8  
ATOM 8303  C C    . ILE A 1 47 ? 0.628   -12.036 -5.304  1.00 0.00 ? 47 ILE A C    8  
ATOM 8304  O O    . ILE A 1 47 ? -0.521  -12.227 -4.906  1.00 0.00 ? 47 ILE A O    8  
ATOM 8305  C CB   . ILE A 1 47 ? 1.000   -9.600  -5.707  1.00 0.00 ? 47 ILE A CB   8  
ATOM 8306  C CG1  . ILE A 1 47 ? 0.821   -8.494  -6.747  1.00 0.00 ? 47 ILE A CG1  8  
ATOM 8307  C CG2  . ILE A 1 47 ? 2.328   -9.437  -4.988  1.00 0.00 ? 47 ILE A CG2  8  
ATOM 8308  C CD1  . ILE A 1 47 ? 1.809   -8.569  -7.889  1.00 0.00 ? 47 ILE A CD1  8  
ATOM 8309  H H    . ILE A 1 47 ? -0.836  -10.370 -7.393  1.00 0.00 ? 47 ILE A H    8  
ATOM 8310  H HA   . ILE A 1 47 ? 1.866   -11.202 -6.835  1.00 0.00 ? 47 ILE A HA   8  
ATOM 8311  H HB   . ILE A 1 47 ? 0.211   -9.528  -4.974  1.00 0.00 ? 47 ILE A HB   8  
ATOM 8312  H HG12 . ILE A 1 47 ? -0.172  -8.562  -7.164  1.00 0.00 ? 47 ILE A HG12 8  
ATOM 8313  H HG13 . ILE A 1 47 ? 0.939   -7.534  -6.266  1.00 0.00 ? 47 ILE A HG13 8  
ATOM 8314  H HG21 . ILE A 1 47 ? 3.133   -9.717  -5.651  1.00 0.00 ? 47 ILE A HG21 8  
ATOM 8315  H HG22 . ILE A 1 47 ? 2.344   -10.071 -4.113  1.00 0.00 ? 47 ILE A HG22 8  
ATOM 8316  H HG23 . ILE A 1 47 ? 2.451   -8.407  -4.689  1.00 0.00 ? 47 ILE A HG23 8  
ATOM 8317  H HD11 . ILE A 1 47 ? 1.948   -7.583  -8.308  1.00 0.00 ? 47 ILE A HD11 8  
ATOM 8318  H HD12 . ILE A 1 47 ? 1.430   -9.234  -8.651  1.00 0.00 ? 47 ILE A HD12 8  
ATOM 8319  H HD13 . ILE A 1 47 ? 2.755   -8.941  -7.523  1.00 0.00 ? 47 ILE A HD13 8  
ATOM 8320  N N    . PRO A 1 48 ? 1.668   -12.742 -4.831  1.00 0.00 ? 48 PRO A N    8  
ATOM 8321  C CA   . PRO A 1 48 ? 1.514   -13.772 -3.804  1.00 0.00 ? 48 PRO A CA   8  
ATOM 8322  C C    . PRO A 1 48 ? 0.576   -13.332 -2.685  1.00 0.00 ? 48 PRO A C    8  
ATOM 8323  O O    . PRO A 1 48 ? 0.373   -12.138 -2.467  1.00 0.00 ? 48 PRO A O    8  
ATOM 8324  C CB   . PRO A 1 48 ? 2.936   -13.950 -3.280  1.00 0.00 ? 48 PRO A CB   8  
ATOM 8325  C CG   . PRO A 1 48 ? 3.805   -13.633 -4.447  1.00 0.00 ? 48 PRO A CG   8  
ATOM 8326  C CD   . PRO A 1 48 ? 3.076   -12.582 -5.246  1.00 0.00 ? 48 PRO A CD   8  
ATOM 8327  H HA   . PRO A 1 48 ? 1.161   -14.702 -4.224  1.00 0.00 ? 48 PRO A HA   8  
ATOM 8328  H HB2  . PRO A 1 48 ? 3.108   -13.268 -2.460  1.00 0.00 ? 48 PRO A HB2  8  
ATOM 8329  H HB3  . PRO A 1 48 ? 3.075   -14.967 -2.945  1.00 0.00 ? 48 PRO A HB3  8  
ATOM 8330  H HG2  . PRO A 1 48 ? 4.754   -13.249 -4.104  1.00 0.00 ? 48 PRO A HG2  8  
ATOM 8331  H HG3  . PRO A 1 48 ? 3.954   -14.521 -5.044  1.00 0.00 ? 48 PRO A HG3  8  
ATOM 8332  H HD2  . PRO A 1 48 ? 3.442   -11.598 -4.994  1.00 0.00 ? 48 PRO A HD2  8  
ATOM 8333  H HD3  . PRO A 1 48 ? 3.188   -12.768 -6.304  1.00 0.00 ? 48 PRO A HD3  8  
ATOM 8334  N N    . GLU A 1 49 ? 0.009   -14.304 -1.979  1.00 0.00 ? 49 GLU A N    8  
ATOM 8335  C CA   . GLU A 1 49 ? -0.911  -14.014 -0.884  1.00 0.00 ? 49 GLU A CA   8  
ATOM 8336  C C    . GLU A 1 49 ? -0.160  -13.857 0.434   1.00 0.00 ? 49 GLU A C    8  
ATOM 8337  O O    . GLU A 1 49 ? -0.555  -14.420 1.455   1.00 0.00 ? 49 GLU A O    8  
ATOM 8338  C CB   . GLU A 1 49 ? -1.953  -15.127 -0.761  1.00 0.00 ? 49 GLU A CB   8  
ATOM 8339  C CG   . GLU A 1 49 ? -3.374  -14.614 -0.595  1.00 0.00 ? 49 GLU A CG   8  
ATOM 8340  C CD   . GLU A 1 49 ? -4.375  -15.730 -0.365  1.00 0.00 ? 49 GLU A CD   8  
ATOM 8341  O OE1  . GLU A 1 49 ? -4.228  -16.462 0.637   1.00 0.00 ? 49 GLU A OE1  8  
ATOM 8342  O OE2  . GLU A 1 49 ? -5.304  -15.874 -1.187  1.00 0.00 ? 49 GLU A OE2  8  
ATOM 8343  H H    . GLU A 1 49 ? 0.208   -15.237 -2.201  1.00 0.00 ? 49 GLU A H    8  
ATOM 8344  H HA   . GLU A 1 49 ? -1.413  -13.086 -1.112  1.00 0.00 ? 49 GLU A HA   8  
ATOM 8345  H HB2  . GLU A 1 49 ? -1.917  -15.739 -1.650  1.00 0.00 ? 49 GLU A HB2  8  
ATOM 8346  H HB3  . GLU A 1 49 ? -1.712  -15.739 0.096   1.00 0.00 ? 49 GLU A HB3  8  
ATOM 8347  H HG2  . GLU A 1 49 ? -3.404  -13.944 0.252   1.00 0.00 ? 49 GLU A HG2  8  
ATOM 8348  H HG3  . GLU A 1 49 ? -3.657  -14.077 -1.488  1.00 0.00 ? 49 GLU A HG3  8  
ATOM 8349  N N    . GLN A 1 50 ? 0.928   -13.094 0.403   1.00 0.00 ? 50 GLN A N    8  
ATOM 8350  C CA   . GLN A 1 50 ? 1.732   -12.861 1.597   1.00 0.00 ? 50 GLN A CA   8  
ATOM 8351  C C    . GLN A 1 50 ? 1.177   -11.700 2.413   1.00 0.00 ? 50 GLN A C    8  
ATOM 8352  O O    . GLN A 1 50 ? 1.057   -11.789 3.635   1.00 0.00 ? 50 GLN A O    8  
ATOM 8353  C CB   . GLN A 1 50 ? 3.186   -12.579 1.210   1.00 0.00 ? 50 GLN A CB   8  
ATOM 8354  C CG   . GLN A 1 50 ? 3.726   -13.518 0.145   1.00 0.00 ? 50 GLN A CG   8  
ATOM 8355  C CD   . GLN A 1 50 ? 4.895   -12.931 -0.614  1.00 0.00 ? 50 GLN A CD   8  
ATOM 8356  O OE1  . GLN A 1 50 ? 4.918   -11.740 -0.920  1.00 0.00 ? 50 GLN A OE1  8  
ATOM 8357  N NE2  . GLN A 1 50 ? 5.874   -13.770 -0.923  1.00 0.00 ? 50 GLN A NE2  8  
ATOM 8358  H H    . GLN A 1 50 ? 1.191   -12.670 -0.439  1.00 0.00 ? 50 GLN A H    8  
ATOM 8359  H HA   . GLN A 1 50 ? 1.697   -13.758 2.199   1.00 0.00 ? 50 GLN A HA   8  
ATOM 8360  H HB2  . GLN A 1 50 ? 3.257   -11.568 0.837   1.00 0.00 ? 50 GLN A HB2  8  
ATOM 8361  H HB3  . GLN A 1 50 ? 3.805   -12.672 2.090   1.00 0.00 ? 50 GLN A HB3  8  
ATOM 8362  H HG2  . GLN A 1 50 ? 4.051   -14.432 0.619   1.00 0.00 ? 50 GLN A HG2  8  
ATOM 8363  H HG3  . GLN A 1 50 ? 2.936   -13.740 -0.557  1.00 0.00 ? 50 GLN A HG3  8  
ATOM 8364  H HE21 . GLN A 1 50 ? 5.787   -14.706 -0.646  1.00 0.00 ? 50 GLN A HE21 8  
ATOM 8365  H HE22 . GLN A 1 50 ? 6.643   -13.421 -1.414  1.00 0.00 ? 50 GLN A HE22 8  
ATOM 8366  N N    . TYR A 1 51 ? 0.854   -10.603 1.734   1.00 0.00 ? 51 TYR A N    8  
ATOM 8367  C CA   . TYR A 1 51 ? 0.321   -9.422  2.403   1.00 0.00 ? 51 TYR A CA   8  
ATOM 8368  C C    . TYR A 1 51 ? -0.792  -8.773  1.585   1.00 0.00 ? 51 TYR A C    8  
ATOM 8369  O O    . TYR A 1 51 ? -1.091  -7.592  1.759   1.00 0.00 ? 51 TYR A O    8  
ATOM 8370  C CB   . TYR A 1 51 ? 1.439   -8.407  2.654   1.00 0.00 ? 51 TYR A CB   8  
ATOM 8371  C CG   . TYR A 1 51 ? 2.766   -9.041  3.011   1.00 0.00 ? 51 TYR A CG   8  
ATOM 8372  C CD1  . TYR A 1 51 ? 2.974   -9.601  4.266   1.00 0.00 ? 51 TYR A CD1  8  
ATOM 8373  C CD2  . TYR A 1 51 ? 3.807   -9.082  2.093   1.00 0.00 ? 51 TYR A CD2  8  
ATOM 8374  C CE1  . TYR A 1 51 ? 4.184   -10.182 4.595   1.00 0.00 ? 51 TYR A CE1  8  
ATOM 8375  C CE2  . TYR A 1 51 ? 5.020   -9.661  2.415   1.00 0.00 ? 51 TYR A CE2  8  
ATOM 8376  C CZ   . TYR A 1 51 ? 5.203   -10.210 3.666   1.00 0.00 ? 51 TYR A CZ   8  
ATOM 8377  O OH   . TYR A 1 51 ? 6.410   -10.788 3.990   1.00 0.00 ? 51 TYR A OH   8  
ATOM 8378  H H    . TYR A 1 51 ? 0.976   -10.588 0.761   1.00 0.00 ? 51 TYR A H    8  
ATOM 8379  H HA   . TYR A 1 51 ? -0.085  -9.737  3.353   1.00 0.00 ? 51 TYR A HA   8  
ATOM 8380  H HB2  . TYR A 1 51 ? 1.584   -7.814  1.763   1.00 0.00 ? 51 TYR A HB2  8  
ATOM 8381  H HB3  . TYR A 1 51 ? 1.151   -7.760  3.468   1.00 0.00 ? 51 TYR A HB3  8  
ATOM 8382  H HD1  . TYR A 1 51 ? 2.175   -9.578  4.990   1.00 0.00 ? 51 TYR A HD1  8  
ATOM 8383  H HD2  . TYR A 1 51 ? 3.660   -8.652  1.113   1.00 0.00 ? 51 TYR A HD2  8  
ATOM 8384  H HE1  . TYR A 1 51 ? 4.328   -10.612 5.576   1.00 0.00 ? 51 TYR A HE1  8  
ATOM 8385  H HE2  . TYR A 1 51 ? 5.818   -9.683  1.687   1.00 0.00 ? 51 TYR A HE2  8  
ATOM 8386  H HH   . TYR A 1 51 ? 6.795   -11.186 3.206   1.00 0.00 ? 51 TYR A HH   8  
ATOM 8387  N N    . ARG A 1 52 ? -1.407  -9.549  0.696   1.00 0.00 ? 52 ARG A N    8  
ATOM 8388  C CA   . ARG A 1 52 ? -2.494  -9.040  -0.134  1.00 0.00 ? 52 ARG A CA   8  
ATOM 8389  C C    . ARG A 1 52 ? -3.550  -8.353  0.726   1.00 0.00 ? 52 ARG A C    8  
ATOM 8390  O O    . ARG A 1 52 ? -3.853  -7.174  0.536   1.00 0.00 ? 52 ARG A O    8  
ATOM 8391  C CB   . ARG A 1 52 ? -3.131  -10.181 -0.931  1.00 0.00 ? 52 ARG A CB   8  
ATOM 8392  C CG   . ARG A 1 52 ? -3.428  -9.824  -2.381  1.00 0.00 ? 52 ARG A CG   8  
ATOM 8393  C CD   . ARG A 1 52 ? -3.143  -10.993 -3.308  1.00 0.00 ? 52 ARG A CD   8  
ATOM 8394  N NE   . ARG A 1 52 ? -4.267  -11.921 -3.380  1.00 0.00 ? 52 ARG A NE   8  
ATOM 8395  C CZ   . ARG A 1 52 ? -4.209  -13.103 -3.985  1.00 0.00 ? 52 ARG A CZ   8  
ATOM 8396  N NH1  . ARG A 1 52 ? -3.086  -13.499 -4.567  1.00 0.00 ? 52 ARG A NH1  8  
ATOM 8397  N NH2  . ARG A 1 52 ? -5.276  -13.890 -4.010  1.00 0.00 ? 52 ARG A NH2  8  
ATOM 8398  H H    . ARG A 1 52 ? -1.132  -10.486 0.604   1.00 0.00 ? 52 ARG A H    8  
ATOM 8399  H HA   . ARG A 1 52 ? -2.077  -8.318  -0.820  1.00 0.00 ? 52 ARG A HA   8  
ATOM 8400  H HB2  . ARG A 1 52 ? -2.463  -11.028 -0.922  1.00 0.00 ? 52 ARG A HB2  8  
ATOM 8401  H HB3  . ARG A 1 52 ? -4.059  -10.460 -0.455  1.00 0.00 ? 52 ARG A HB3  8  
ATOM 8402  H HG2  . ARG A 1 52 ? -4.470  -9.552  -2.471  1.00 0.00 ? 52 ARG A HG2  8  
ATOM 8403  H HG3  . ARG A 1 52 ? -2.810  -8.987  -2.670  1.00 0.00 ? 52 ARG A HG3  8  
ATOM 8404  H HD2  . ARG A 1 52 ? -2.942  -10.609 -4.298  1.00 0.00 ? 52 ARG A HD2  8  
ATOM 8405  H HD3  . ARG A 1 52 ? -2.275  -11.522 -2.944  1.00 0.00 ? 52 ARG A HD3  8  
ATOM 8406  H HE   . ARG A 1 52 ? -5.108  -11.649 -2.958  1.00 0.00 ? 52 ARG A HE   8  
ATOM 8407  H HH11 . ARG A 1 52 ? -2.279  -12.909 -4.551  1.00 0.00 ? 52 ARG A HH11 8  
ATOM 8408  H HH12 . ARG A 1 52 ? -3.045  -14.389 -5.021  1.00 0.00 ? 52 ARG A HH12 8  
ATOM 8409  H HH21 . ARG A 1 52 ? -6.125  -13.596 -3.572  1.00 0.00 ? 52 ARG A HH21 8  
ATOM 8410  H HH22 . ARG A 1 52 ? -5.231  -14.780 -4.464  1.00 0.00 ? 52 ARG A HH22 8  
ATOM 8411  N N    . MET A 1 53 ? -4.096  -9.095  1.685   1.00 0.00 ? 53 MET A N    8  
ATOM 8412  C CA   . MET A 1 53 ? -5.106  -8.554  2.586   1.00 0.00 ? 53 MET A CA   8  
ATOM 8413  C C    . MET A 1 53 ? -4.547  -7.374  3.373   1.00 0.00 ? 53 MET A C    8  
ATOM 8414  O O    . MET A 1 53 ? -5.223  -6.360  3.552   1.00 0.00 ? 53 MET A O    8  
ATOM 8415  C CB   . MET A 1 53 ? -5.598  -9.638  3.547   1.00 0.00 ? 53 MET A CB   8  
ATOM 8416  C CG   . MET A 1 53 ? -6.220  -10.837 2.848   1.00 0.00 ? 53 MET A CG   8  
ATOM 8417  S SD   . MET A 1 53 ? -5.275  -12.353 3.095   1.00 0.00 ? 53 MET A SD   8  
ATOM 8418  C CE   . MET A 1 53 ? -6.353  -13.247 4.210   1.00 0.00 ? 53 MET A CE   8  
ATOM 8419  H H    . MET A 1 53 ? -3.807  -10.025 1.793   1.00 0.00 ? 53 MET A H    8  
ATOM 8420  H HA   . MET A 1 53 ? -5.935  -8.212  1.986   1.00 0.00 ? 53 MET A HA   8  
ATOM 8421  H HB2  . MET A 1 53 ? -4.763  -9.987  4.137   1.00 0.00 ? 53 MET A HB2  8  
ATOM 8422  H HB3  . MET A 1 53 ? -6.339  -9.210  4.206   1.00 0.00 ? 53 MET A HB3  8  
ATOM 8423  H HG2  . MET A 1 53 ? -7.216  -10.985 3.235   1.00 0.00 ? 53 MET A HG2  8  
ATOM 8424  H HG3  . MET A 1 53 ? -6.273  -10.632 1.789   1.00 0.00 ? 53 MET A HG3  8  
ATOM 8425  H HE1  . MET A 1 53 ? -6.058  -14.285 4.243   1.00 0.00 ? 53 MET A HE1  8  
ATOM 8426  H HE2  . MET A 1 53 ? -7.373  -13.174 3.861   1.00 0.00 ? 53 MET A HE2  8  
ATOM 8427  H HE3  . MET A 1 53 ? -6.281  -12.821 5.200   1.00 0.00 ? 53 MET A HE3  8  
ATOM 8428  N N    . THR A 1 54 ? -3.308  -7.509  3.834   1.00 0.00 ? 54 THR A N    8  
ATOM 8429  C CA   . THR A 1 54 ? -2.655  -6.446  4.588   1.00 0.00 ? 54 THR A CA   8  
ATOM 8430  C C    . THR A 1 54 ? -2.679  -5.140  3.804   1.00 0.00 ? 54 THR A C    8  
ATOM 8431  O O    . THR A 1 54 ? -3.027  -4.087  4.339   1.00 0.00 ? 54 THR A O    8  
ATOM 8432  C CB   . THR A 1 54 ? -1.209  -6.830  4.911   1.00 0.00 ? 54 THR A CB   8  
ATOM 8433  O OG1  . THR A 1 54 ? -1.170  -7.950  5.779   1.00 0.00 ? 54 THR A OG1  8  
ATOM 8434  C CG2  . THR A 1 54 ? -0.423  -5.713  5.566   1.00 0.00 ? 54 THR A CG2  8  
ATOM 8435  H H    . THR A 1 54 ? -2.817  -8.338  3.653   1.00 0.00 ? 54 THR A H    8  
ATOM 8436  H HA   . THR A 1 54 ? -3.199  -6.310  5.510   1.00 0.00 ? 54 THR A HA   8  
ATOM 8437  H HB   . THR A 1 54 ? -0.703  -7.093  3.994   1.00 0.00 ? 54 THR A HB   8  
ATOM 8438  H HG1  . THR A 1 54 ? -1.606  -8.694  5.360   1.00 0.00 ? 54 THR A HG1  8  
ATOM 8439  H HG21 . THR A 1 54 ? 0.630   -5.951  5.538   1.00 0.00 ? 54 THR A HG21 8  
ATOM 8440  H HG22 . THR A 1 54 ? -0.740  -5.603  6.592   1.00 0.00 ? 54 THR A HG22 8  
ATOM 8441  H HG23 . THR A 1 54 ? -0.598  -4.788  5.033   1.00 0.00 ? 54 THR A HG23 8  
ATOM 8442  N N    . ILE A 1 55 ? -2.307  -5.219  2.531   1.00 0.00 ? 55 ILE A N    8  
ATOM 8443  C CA   . ILE A 1 55 ? -2.286  -4.047  1.667   1.00 0.00 ? 55 ILE A CA   8  
ATOM 8444  C C    . ILE A 1 55 ? -3.682  -3.457  1.509   1.00 0.00 ? 55 ILE A C    8  
ATOM 8445  O O    . ILE A 1 55 ? -3.847  -2.239  1.441   1.00 0.00 ? 55 ILE A O    8  
ATOM 8446  C CB   . ILE A 1 55 ? -1.723  -4.386  0.275   1.00 0.00 ? 55 ILE A CB   8  
ATOM 8447  C CG1  . ILE A 1 55 ? -0.326  -4.994  0.400   1.00 0.00 ? 55 ILE A CG1  8  
ATOM 8448  C CG2  . ILE A 1 55 ? -1.689  -3.144  -0.602  1.00 0.00 ? 55 ILE A CG2  8  
ATOM 8449  C CD1  . ILE A 1 55 ? -0.066  -6.118  -0.580  1.00 0.00 ? 55 ILE A CD1  8  
ATOM 8450  H H    . ILE A 1 55 ? -2.042  -6.089  2.163   1.00 0.00 ? 55 ILE A H    8  
ATOM 8451  H HA   . ILE A 1 55 ? -1.642  -3.311  2.121   1.00 0.00 ? 55 ILE A HA   8  
ATOM 8452  H HB   . ILE A 1 55 ? -2.381  -5.105  -0.188  1.00 0.00 ? 55 ILE A HB   8  
ATOM 8453  H HG12 . ILE A 1 55 ? 0.412   -4.226  0.225   1.00 0.00 ? 55 ILE A HG12 8  
ATOM 8454  H HG13 . ILE A 1 55 ? -0.199  -5.389  1.397   1.00 0.00 ? 55 ILE A HG13 8  
ATOM 8455  H HG21 . ILE A 1 55 ? -1.150  -3.360  -1.513  1.00 0.00 ? 55 ILE A HG21 8  
ATOM 8456  H HG22 . ILE A 1 55 ? -1.195  -2.343  -0.073  1.00 0.00 ? 55 ILE A HG22 8  
ATOM 8457  H HG23 . ILE A 1 55 ? -2.698  -2.845  -0.844  1.00 0.00 ? 55 ILE A HG23 8  
ATOM 8458  H HD11 . ILE A 1 55 ? -1.000  -6.436  -1.018  1.00 0.00 ? 55 ILE A HD11 8  
ATOM 8459  H HD12 . ILE A 1 55 ? 0.391   -6.948  -0.063  1.00 0.00 ? 55 ILE A HD12 8  
ATOM 8460  H HD13 . ILE A 1 55 ? 0.598   -5.771  -1.358  1.00 0.00 ? 55 ILE A HD13 8  
ATOM 8461  N N    . TRP A 1 56 ? -4.684  -4.328  1.449   1.00 0.00 ? 56 TRP A N    8  
ATOM 8462  C CA   . TRP A 1 56 ? -6.065  -3.891  1.302   1.00 0.00 ? 56 TRP A CA   8  
ATOM 8463  C C    . TRP A 1 56 ? -6.508  -3.086  2.524   1.00 0.00 ? 56 TRP A C    8  
ATOM 8464  O O    . TRP A 1 56 ? -7.024  -1.977  2.394   1.00 0.00 ? 56 TRP A O    8  
ATOM 8465  C CB   . TRP A 1 56 ? -6.970  -5.110  1.094   1.00 0.00 ? 56 TRP A CB   8  
ATOM 8466  C CG   . TRP A 1 56 ? -8.433  -4.829  1.261   1.00 0.00 ? 56 TRP A CG   8  
ATOM 8467  C CD1  . TRP A 1 56 ? -9.115  -3.726  0.837   1.00 0.00 ? 56 TRP A CD1  8  
ATOM 8468  C CD2  . TRP A 1 56 ? -9.389  -5.672  1.905   1.00 0.00 ? 56 TRP A CD2  8  
ATOM 8469  N NE1  . TRP A 1 56 ? -10.442 -3.835  1.179   1.00 0.00 ? 56 TRP A NE1  8  
ATOM 8470  C CE2  . TRP A 1 56 ? -10.633 -5.020  1.834   1.00 0.00 ? 56 TRP A CE2  8  
ATOM 8471  C CE3  . TRP A 1 56 ? -9.313  -6.914  2.534   1.00 0.00 ? 56 TRP A CE3  8  
ATOM 8472  C CZ2  . TRP A 1 56 ? -11.791 -5.567  2.367   1.00 0.00 ? 56 TRP A CZ2  8  
ATOM 8473  C CZ3  . TRP A 1 56 ? -10.468 -7.462  3.065   1.00 0.00 ? 56 TRP A CZ3  8  
ATOM 8474  C CH2  . TRP A 1 56 ? -11.694 -6.787  2.978   1.00 0.00 ? 56 TRP A CH2  8  
ATOM 8475  H H    . TRP A 1 56 ? -4.492  -5.289  1.510   1.00 0.00 ? 56 TRP A H    8  
ATOM 8476  H HA   . TRP A 1 56 ? -6.121  -3.257  0.429   1.00 0.00 ? 56 TRP A HA   8  
ATOM 8477  H HB2  . TRP A 1 56 ? -6.819  -5.492  0.096   1.00 0.00 ? 56 TRP A HB2  8  
ATOM 8478  H HB3  . TRP A 1 56 ? -6.698  -5.874  1.809   1.00 0.00 ? 56 TRP A HB3  8  
ATOM 8479  H HD1  . TRP A 1 56 ? -8.665  -2.896  0.312   1.00 0.00 ? 56 TRP A HD1  8  
ATOM 8480  H HE1  . TRP A 1 56 ? -11.139 -3.176  0.986   1.00 0.00 ? 56 TRP A HE1  8  
ATOM 8481  H HE3  . TRP A 1 56 ? -8.374  -7.445  2.609   1.00 0.00 ? 56 TRP A HE3  8  
ATOM 8482  H HZ2  . TRP A 1 56 ? -12.740 -5.055  2.304   1.00 0.00 ? 56 TRP A HZ2  8  
ATOM 8483  H HZ3  . TRP A 1 56 ? -10.430 -8.424  3.556   1.00 0.00 ? 56 TRP A HZ3  8  
ATOM 8484  H HH2  . TRP A 1 56 ? -12.570 -7.251  3.407   1.00 0.00 ? 56 TRP A HH2  8  
ATOM 8485  N N    . ARG A 1 57 ? -6.295  -3.650  3.707   1.00 0.00 ? 57 ARG A N    8  
ATOM 8486  C CA   . ARG A 1 57 ? -6.669  -2.982  4.948   1.00 0.00 ? 57 ARG A CA   8  
ATOM 8487  C C    . ARG A 1 57 ? -5.927  -1.657  5.097   1.00 0.00 ? 57 ARG A C    8  
ATOM 8488  O O    . ARG A 1 57 ? -6.460  -0.695  5.650   1.00 0.00 ? 57 ARG A O    8  
ATOM 8489  C CB   . ARG A 1 57 ? -6.378  -3.885  6.150   1.00 0.00 ? 57 ARG A CB   8  
ATOM 8490  C CG   . ARG A 1 57 ? -4.900  -4.183  6.344   1.00 0.00 ? 57 ARG A CG   8  
ATOM 8491  C CD   . ARG A 1 57 ? -4.589  -4.542  7.788   1.00 0.00 ? 57 ARG A CD   8  
ATOM 8492  N NE   . ARG A 1 57 ? -5.051  -5.884  8.130   1.00 0.00 ? 57 ARG A NE   8  
ATOM 8493  C CZ   . ARG A 1 57 ? -4.744  -6.500  9.267   1.00 0.00 ? 57 ARG A CZ   8  
ATOM 8494  N NH1  . ARG A 1 57 ? -3.976  -5.898  10.164  1.00 0.00 ? 57 ARG A NH1  8  
ATOM 8495  N NH2  . ARG A 1 57 ? -5.203  -7.722  9.505   1.00 0.00 ? 57 ARG A NH2  8  
ATOM 8496  H H    . ARG A 1 57 ? -5.879  -4.537  3.747   1.00 0.00 ? 57 ARG A H    8  
ATOM 8497  H HA   . ARG A 1 57 ? -7.729  -2.783  4.908   1.00 0.00 ? 57 ARG A HA   8  
ATOM 8498  H HB2  . ARG A 1 57 ? -6.746  -3.404  7.043   1.00 0.00 ? 57 ARG A HB2  8  
ATOM 8499  H HB3  . ARG A 1 57 ? -6.896  -4.822  6.014   1.00 0.00 ? 57 ARG A HB3  8  
ATOM 8500  H HG2  . ARG A 1 57 ? -4.624  -5.011  5.710   1.00 0.00 ? 57 ARG A HG2  8  
ATOM 8501  H HG3  . ARG A 1 57 ? -4.326  -3.311  6.070   1.00 0.00 ? 57 ARG A HG3  8  
ATOM 8502  H HD2  . ARG A 1 57 ? -3.520  -4.493  7.935   1.00 0.00 ? 57 ARG A HD2  8  
ATOM 8503  H HD3  . ARG A 1 57 ? -5.075  -3.828  8.436   1.00 0.00 ? 57 ARG A HD3  8  
ATOM 8504  H HE   . ARG A 1 57 ? -5.620  -6.348  7.481   1.00 0.00 ? 57 ARG A HE   8  
ATOM 8505  H HH11 . ARG A 1 57 ? -3.628  -4.978  9.986   1.00 0.00 ? 57 ARG A HH11 8  
ATOM 8506  H HH12 . ARG A 1 57 ? -3.746  -6.364  11.018  1.00 0.00 ? 57 ARG A HH12 8  
ATOM 8507  H HH21 . ARG A 1 57 ? -5.783  -8.179  8.831   1.00 0.00 ? 57 ARG A HH21 8  
ATOM 8508  H HH22 . ARG A 1 57 ? -4.970  -8.184  10.360  1.00 0.00 ? 57 ARG A HH22 8  
ATOM 8509  N N    . GLY A 1 58 ? -4.698  -1.612  4.593   1.00 0.00 ? 58 GLY A N    8  
ATOM 8510  C CA   . GLY A 1 58 ? -3.909  -0.397  4.672   1.00 0.00 ? 58 GLY A CA   8  
ATOM 8511  C C    . GLY A 1 58 ? -4.335  0.627   3.643   1.00 0.00 ? 58 GLY A C    8  
ATOM 8512  O O    . GLY A 1 58 ? -4.150  1.829   3.837   1.00 0.00 ? 58 GLY A O    8  
ATOM 8513  H H    . GLY A 1 58 ? -4.326  -2.407  4.159   1.00 0.00 ? 58 GLY A H    8  
ATOM 8514  H HA2  . GLY A 1 58 ? -4.020  0.029   5.659   1.00 0.00 ? 58 GLY A HA2  8  
ATOM 8515  H HA3  . GLY A 1 58 ? -2.870  -0.644  4.512   1.00 0.00 ? 58 GLY A HA3  8  
ATOM 8516  N N    . LEU A 1 59 ? -4.915  0.150   2.546   1.00 0.00 ? 59 LEU A N    8  
ATOM 8517  C CA   . LEU A 1 59 ? -5.382  1.031   1.485   1.00 0.00 ? 59 LEU A CA   8  
ATOM 8518  C C    . LEU A 1 59 ? -6.713  1.670   1.864   1.00 0.00 ? 59 LEU A C    8  
ATOM 8519  O O    . LEU A 1 59 ? -6.985  2.819   1.514   1.00 0.00 ? 59 LEU A O    8  
ATOM 8520  C CB   . LEU A 1 59 ? -5.528  0.254   0.176   1.00 0.00 ? 59 LEU A CB   8  
ATOM 8521  C CG   . LEU A 1 59 ? -4.581  0.692   -0.942  1.00 0.00 ? 59 LEU A CG   8  
ATOM 8522  C CD1  . LEU A 1 59 ? -3.134  0.611   -0.479  1.00 0.00 ? 59 LEU A CD1  8  
ATOM 8523  C CD2  . LEU A 1 59 ? -4.794  -0.159  -2.185  1.00 0.00 ? 59 LEU A CD2  8  
ATOM 8524  H H    . LEU A 1 59 ? -5.039  -0.817  2.454   1.00 0.00 ? 59 LEU A H    8  
ATOM 8525  H HA   . LEU A 1 59 ? -4.646  1.810   1.353   1.00 0.00 ? 59 LEU A HA   8  
ATOM 8526  H HB2  . LEU A 1 59 ? -5.348  -0.792  0.381   1.00 0.00 ? 59 LEU A HB2  8  
ATOM 8527  H HB3  . LEU A 1 59 ? -6.543  0.364   -0.176  1.00 0.00 ? 59 LEU A HB3  8  
ATOM 8528  H HG   . LEU A 1 59 ? -4.791  1.719   -1.201  1.00 0.00 ? 59 LEU A HG   8  
ATOM 8529  H HD11 . LEU A 1 59 ? -2.639  -0.202  -0.988  1.00 0.00 ? 59 LEU A HD11 8  
ATOM 8530  H HD12 . LEU A 1 59 ? -3.108  0.439   0.587   1.00 0.00 ? 59 LEU A HD12 8  
ATOM 8531  H HD13 . LEU A 1 59 ? -2.631  1.539   -0.707  1.00 0.00 ? 59 LEU A HD13 8  
ATOM 8532  H HD21 . LEU A 1 59 ? -4.860  0.481   -3.052  1.00 0.00 ? 59 LEU A HD21 8  
ATOM 8533  H HD22 . LEU A 1 59 ? -5.708  -0.723  -2.083  1.00 0.00 ? 59 LEU A HD22 8  
ATOM 8534  H HD23 . LEU A 1 59 ? -3.963  -0.839  -2.302  1.00 0.00 ? 59 LEU A HD23 8  
ATOM 8535  N N    . GLN A 1 60 ? -7.537  0.918   2.587   1.00 0.00 ? 60 GLN A N    8  
ATOM 8536  C CA   . GLN A 1 60 ? -8.832  1.419   3.031   1.00 0.00 ? 60 GLN A CA   8  
ATOM 8537  C C    . GLN A 1 60 ? -8.652  2.434   4.152   1.00 0.00 ? 60 GLN A C    8  
ATOM 8538  O O    . GLN A 1 60 ? -9.446  3.363   4.297   1.00 0.00 ? 60 GLN A O    8  
ATOM 8539  C CB   . GLN A 1 60 ? -9.715  0.263   3.507   1.00 0.00 ? 60 GLN A CB   8  
ATOM 8540  C CG   . GLN A 1 60 ? -9.082  -0.571  4.609   1.00 0.00 ? 60 GLN A CG   8  
ATOM 8541  C CD   . GLN A 1 60 ? -9.995  -1.677  5.103   1.00 0.00 ? 60 GLN A CD   8  
ATOM 8542  O OE1  . GLN A 1 60 ? -10.309 -1.755  6.290   1.00 0.00 ? 60 GLN A OE1  8  
ATOM 8543  N NE2  . GLN A 1 60 ? -10.427 -2.541  4.191   1.00 0.00 ? 60 GLN A NE2  8  
ATOM 8544  H H    . GLN A 1 60 ? -7.258  0.014   2.845   1.00 0.00 ? 60 GLN A H    8  
ATOM 8545  H HA   . GLN A 1 60 ? -9.306  1.906   2.192   1.00 0.00 ? 60 GLN A HA   8  
ATOM 8546  H HB2  . GLN A 1 60 ? -10.645 0.665   3.879   1.00 0.00 ? 60 GLN A HB2  8  
ATOM 8547  H HB3  . GLN A 1 60 ? -9.922  -0.386  2.669   1.00 0.00 ? 60 GLN A HB3  8  
ATOM 8548  H HG2  . GLN A 1 60 ? -8.175  -1.016  4.230   1.00 0.00 ? 60 GLN A HG2  8  
ATOM 8549  H HG3  . GLN A 1 60 ? -8.844  0.075   5.441   1.00 0.00 ? 60 GLN A HG3  8  
ATOM 8550  H HE21 . GLN A 1 60 ? -10.136 -2.419  3.263   1.00 0.00 ? 60 GLN A HE21 8  
ATOM 8551  H HE22 . GLN A 1 60 ? -11.018 -3.266  4.483   1.00 0.00 ? 60 GLN A HE22 8  
ATOM 8552  N N    . ASP A 1 61 ? -7.594  2.255   4.938   1.00 0.00 ? 61 ASP A N    8  
ATOM 8553  C CA   . ASP A 1 61 ? -7.294  3.165   6.036   1.00 0.00 ? 61 ASP A CA   8  
ATOM 8554  C C    . ASP A 1 61 ? -6.948  4.550   5.504   1.00 0.00 ? 61 ASP A C    8  
ATOM 8555  O O    . ASP A 1 61 ? -7.239  5.562   6.140   1.00 0.00 ? 61 ASP A O    8  
ATOM 8556  C CB   . ASP A 1 61 ? -6.135  2.622   6.874   1.00 0.00 ? 61 ASP A CB   8  
ATOM 8557  C CG   . ASP A 1 61 ? -6.595  2.067   8.208   1.00 0.00 ? 61 ASP A CG   8  
ATOM 8558  O OD1  . ASP A 1 61 ? -7.709  1.502   8.263   1.00 0.00 ? 61 ASP A OD1  8  
ATOM 8559  O OD2  . ASP A 1 61 ? -5.843  2.195   9.196   1.00 0.00 ? 61 ASP A OD2  8  
ATOM 8560  H H    . ASP A 1 61 ? -6.994  1.500   4.765   1.00 0.00 ? 61 ASP A H    8  
ATOM 8561  H HA   . ASP A 1 61 ? -8.176  3.239   6.657   1.00 0.00 ? 61 ASP A HA   8  
ATOM 8562  H HB2  . ASP A 1 61 ? -5.642  1.831   6.328   1.00 0.00 ? 61 ASP A HB2  8  
ATOM 8563  H HB3  . ASP A 1 61 ? -5.430  3.419   7.062   1.00 0.00 ? 61 ASP A HB3  8  
ATOM 8564  N N    . LEU A 1 62 ? -6.328  4.584   4.329   1.00 0.00 ? 62 LEU A N    8  
ATOM 8565  C CA   . LEU A 1 62 ? -5.949  5.843   3.700   1.00 0.00 ? 62 LEU A CA   8  
ATOM 8566  C C    . LEU A 1 62 ? -7.179  6.705   3.436   1.00 0.00 ? 62 LEU A C    8  
ATOM 8567  O O    . LEU A 1 62 ? -7.230  7.871   3.827   1.00 0.00 ? 62 LEU A O    8  
ATOM 8568  C CB   . LEU A 1 62 ? -5.208  5.579   2.389   1.00 0.00 ? 62 LEU A CB   8  
ATOM 8569  C CG   . LEU A 1 62 ? -3.851  4.891   2.541   1.00 0.00 ? 62 LEU A CG   8  
ATOM 8570  C CD1  . LEU A 1 62 ? -3.543  4.045   1.316   1.00 0.00 ? 62 LEU A CD1  8  
ATOM 8571  C CD2  . LEU A 1 62 ? -2.756  5.920   2.772   1.00 0.00 ? 62 LEU A CD2  8  
ATOM 8572  H H    . LEU A 1 62 ? -6.128  3.742   3.869   1.00 0.00 ? 62 LEU A H    8  
ATOM 8573  H HA   . LEU A 1 62 ? -5.293  6.370   4.379   1.00 0.00 ? 62 LEU A HA   8  
ATOM 8574  H HB2  . LEU A 1 62 ? -5.834  4.959   1.763   1.00 0.00 ? 62 LEU A HB2  8  
ATOM 8575  H HB3  . LEU A 1 62 ? -5.054  6.524   1.890   1.00 0.00 ? 62 LEU A HB3  8  
ATOM 8576  H HG   . LEU A 1 62 ? -3.880  4.236   3.400   1.00 0.00 ? 62 LEU A HG   8  
ATOM 8577  H HD11 . LEU A 1 62 ? -2.928  3.204   1.602   1.00 0.00 ? 62 LEU A HD11 8  
ATOM 8578  H HD12 . LEU A 1 62 ? -3.016  4.644   0.588   1.00 0.00 ? 62 LEU A HD12 8  
ATOM 8579  H HD13 . LEU A 1 62 ? -4.466  3.686   0.885   1.00 0.00 ? 62 LEU A HD13 8  
ATOM 8580  H HD21 . LEU A 1 62 ? -1.802  5.500   2.495   1.00 0.00 ? 62 LEU A HD21 8  
ATOM 8581  H HD22 . LEU A 1 62 ? -2.738  6.199   3.815   1.00 0.00 ? 62 LEU A HD22 8  
ATOM 8582  H HD23 . LEU A 1 62 ? -2.953  6.795   2.170   1.00 0.00 ? 62 LEU A HD23 8  
ATOM 8583  N N    . LYS A 1 63 ? -8.169  6.118   2.774   1.00 0.00 ? 63 LYS A N    8  
ATOM 8584  C CA   . LYS A 1 63 ? -9.406  6.823   2.459   1.00 0.00 ? 63 LYS A CA   8  
ATOM 8585  C C    . LYS A 1 63 ? -9.990  7.476   3.707   1.00 0.00 ? 63 LYS A C    8  
ATOM 8586  O O    . LYS A 1 63 ? -10.262 8.677   3.721   1.00 0.00 ? 63 LYS A O    8  
ATOM 8587  C CB   . LYS A 1 63 ? -10.426 5.857   1.853   1.00 0.00 ? 63 LYS A CB   8  
ATOM 8588  C CG   . LYS A 1 63 ? -11.758 6.509   1.515   1.00 0.00 ? 63 LYS A CG   8  
ATOM 8589  C CD   . LYS A 1 63 ? -11.603 7.584   0.451   1.00 0.00 ? 63 LYS A CD   8  
ATOM 8590  C CE   . LYS A 1 63 ? -11.556 6.985   -0.945  1.00 0.00 ? 63 LYS A CE   8  
ATOM 8591  N NZ   . LYS A 1 63 ? -12.815 6.267   -1.284  1.00 0.00 ? 63 LYS A NZ   8  
ATOM 8592  H H    . LYS A 1 63 ? -8.067  5.184   2.492   1.00 0.00 ? 63 LYS A H    8  
ATOM 8593  H HA   . LYS A 1 63 ? -9.175  7.592   1.737   1.00 0.00 ? 63 LYS A HA   8  
ATOM 8594  H HB2  . LYS A 1 63 ? -10.014 5.438   0.947   1.00 0.00 ? 63 LYS A HB2  8  
ATOM 8595  H HB3  . LYS A 1 63 ? -10.610 5.060   2.556   1.00 0.00 ? 63 LYS A HB3  8  
ATOM 8596  H HG2  . LYS A 1 63 ? -12.435 5.751   1.151   1.00 0.00 ? 63 LYS A HG2  8  
ATOM 8597  H HG3  . LYS A 1 63 ? -12.164 6.958   2.410   1.00 0.00 ? 63 LYS A HG3  8  
ATOM 8598  H HD2  . LYS A 1 63 ? -12.441 8.261   0.514   1.00 0.00 ? 63 LYS A HD2  8  
ATOM 8599  H HD3  . LYS A 1 63 ? -10.686 8.126   0.631   1.00 0.00 ? 63 LYS A HD3  8  
ATOM 8600  H HE2  . LYS A 1 63 ? -11.403 7.781   -1.659  1.00 0.00 ? 63 LYS A HE2  8  
ATOM 8601  H HE3  . LYS A 1 63 ? -10.730 6.290   -0.998  1.00 0.00 ? 63 LYS A HE3  8  
ATOM 8602  H HZ1  . LYS A 1 63 ? -12.679 5.241   -1.190  1.00 0.00 ? 63 LYS A HZ1  8  
ATOM 8603  H HZ2  . LYS A 1 63 ? -13.096 6.480   -2.263  1.00 0.00 ? 63 LYS A HZ2  8  
ATOM 8604  H HZ3  . LYS A 1 63 ? -13.580 6.564   -0.644  1.00 0.00 ? 63 LYS A HZ3  8  
ATOM 8605  N N    . GLN A 1 64 ? -10.181 6.679   4.753   1.00 0.00 ? 64 GLN A N    8  
ATOM 8606  C CA   . GLN A 1 64 ? -10.737 7.179   6.004   1.00 0.00 ? 64 GLN A CA   8  
ATOM 8607  C C    . GLN A 1 64 ? -9.924  8.358   6.529   1.00 0.00 ? 64 GLN A C    8  
ATOM 8608  O O    . GLN A 1 64 ? -10.365 9.506   6.465   1.00 0.00 ? 64 GLN A O    8  
ATOM 8609  C CB   . GLN A 1 64 ? -10.776 6.065   7.051   1.00 0.00 ? 64 GLN A CB   8  
ATOM 8610  C CG   . GLN A 1 64 ? -11.632 4.878   6.643   1.00 0.00 ? 64 GLN A CG   8  
ATOM 8611  C CD   . GLN A 1 64 ? -11.969 3.970   7.810   1.00 0.00 ? 64 GLN A CD   8  
ATOM 8612  O OE1  . GLN A 1 64 ? -12.971 4.169   8.497   1.00 0.00 ? 64 GLN A OE1  8  
ATOM 8613  N NE2  . GLN A 1 64 ? -11.133 2.963   8.037   1.00 0.00 ? 64 GLN A NE2  8  
ATOM 8614  H H    . GLN A 1 64 ? -9.946  5.730   4.679   1.00 0.00 ? 64 GLN A H    8  
ATOM 8615  H HA   . GLN A 1 64 ? -11.745 7.513   5.808   1.00 0.00 ? 64 GLN A HA   8  
ATOM 8616  H HB2  . GLN A 1 64 ? -9.769  5.713   7.224   1.00 0.00 ? 64 GLN A HB2  8  
ATOM 8617  H HB3  . GLN A 1 64 ? -11.170 6.466   7.972   1.00 0.00 ? 64 GLN A HB3  8  
ATOM 8618  H HG2  . GLN A 1 64 ? -12.553 5.246   6.215   1.00 0.00 ? 64 GLN A HG2  8  
ATOM 8619  H HG3  . GLN A 1 64 ? -11.097 4.302   5.903   1.00 0.00 ? 64 GLN A HG3  8  
ATOM 8620  H HE21 . GLN A 1 64 ? -10.357 2.865   7.447   1.00 0.00 ? 64 GLN A HE21 8  
ATOM 8621  H HE22 . GLN A 1 64 ? -11.328 2.360   8.784   1.00 0.00 ? 64 GLN A HE22 8  
ATOM 8622  N N    . GLY A 1 65 ? -8.738  8.067   7.050   1.00 0.00 ? 65 GLY A N    8  
ATOM 8623  C CA   . GLY A 1 65 ? -7.884  9.112   7.582   1.00 0.00 ? 65 GLY A CA   8  
ATOM 8624  C C    . GLY A 1 65 ? -7.615  8.938   9.064   1.00 0.00 ? 65 GLY A C    8  
ATOM 8625  O O    . GLY A 1 65 ? -6.519  8.540   9.460   1.00 0.00 ? 65 GLY A O    8  
ATOM 8626  H H    . GLY A 1 65 ? -8.440  7.134   7.077   1.00 0.00 ? 65 GLY A H    8  
ATOM 8627  H HA2  . GLY A 1 65 ? -6.944  9.100   7.052   1.00 0.00 ? 65 GLY A HA2  8  
ATOM 8628  H HA3  . GLY A 1 65 ? -8.363  10.068  7.425   1.00 0.00 ? 65 GLY A HA3  8  
ATOM 8629  N N    . HIS A 1 66 ? -8.618  9.233   9.883   1.00 0.00 ? 66 HIS A N    8  
ATOM 8630  C CA   . HIS A 1 66 ? -8.488  9.101   11.330  1.00 0.00 ? 66 HIS A CA   8  
ATOM 8631  C C    . HIS A 1 66 ? -9.331  7.941   11.848  1.00 0.00 ? 66 HIS A C    8  
ATOM 8632  O O    . HIS A 1 66 ? -10.498 7.799   11.483  1.00 0.00 ? 66 HIS A O    8  
ATOM 8633  C CB   . HIS A 1 66 ? -8.909  10.401  12.019  1.00 0.00 ? 66 HIS A CB   8  
ATOM 8634  C CG   . HIS A 1 66 ? -8.142  10.689  13.273  1.00 0.00 ? 66 HIS A CG   8  
ATOM 8635  N ND1  . HIS A 1 66 ? -8.167  11.914  13.907  1.00 0.00 ? 66 HIS A ND1  8  
ATOM 8636  C CD2  . HIS A 1 66 ? -7.323  9.903   14.013  1.00 0.00 ? 66 HIS A CD2  8  
ATOM 8637  C CE1  . HIS A 1 66 ? -7.398  11.869  14.980  1.00 0.00 ? 66 HIS A CE1  8  
ATOM 8638  N NE2  . HIS A 1 66 ? -6.876  10.661  15.066  1.00 0.00 ? 66 HIS A NE2  8  
ATOM 8639  H H    . HIS A 1 66 ? -9.468  9.544   9.507   1.00 0.00 ? 66 HIS A H    8  
ATOM 8640  H HA   . HIS A 1 66 ? -7.450  8.905   11.552  1.00 0.00 ? 66 HIS A HA   8  
ATOM 8641  H HB2  . HIS A 1 66 ? -8.757  11.225  11.339  1.00 0.00 ? 66 HIS A HB2  8  
ATOM 8642  H HB3  . HIS A 1 66 ? -9.956  10.340  12.277  1.00 0.00 ? 66 HIS A HB3  8  
ATOM 8643  H HD1  . HIS A 1 66 ? -8.673  12.701  13.613  1.00 0.00 ? 66 HIS A HD1  8  
ATOM 8644  H HD2  . HIS A 1 66 ? -7.071  8.871   13.810  1.00 0.00 ? 66 HIS A HD2  8  
ATOM 8645  H HE1  . HIS A 1 66 ? -7.226  12.682  15.670  1.00 0.00 ? 66 HIS A HE1  8  
ATOM 8646  H HE2  . HIS A 1 66 ? -6.266  10.355  15.770  1.00 0.00 ? 66 HIS A HE2  8  
ATOM 8647  N N    . ASP A 1 67 ? -8.728  7.110   12.694  1.00 0.00 ? 67 ASP A N    8  
ATOM 8648  C CA   . ASP A 1 67 ? -9.417  5.965   13.269  1.00 0.00 ? 67 ASP A CA   8  
ATOM 8649  C C    . ASP A 1 67 ? -8.497  5.195   14.202  1.00 0.00 ? 67 ASP A C    8  
ATOM 8650  O O    . ASP A 1 67 ? -7.301  5.052   13.945  1.00 0.00 ? 67 ASP A O    8  
ATOM 8651  C CB   . ASP A 1 67 ? -9.938  5.042   12.181  1.00 0.00 ? 67 ASP A CB   8  
ATOM 8652  C CG   . ASP A 1 67 ? -10.884 3.985   12.717  1.00 0.00 ? 67 ASP A CG   8  
ATOM 8653  O OD1  . ASP A 1 67 ? -10.554 3.358   13.745  1.00 0.00 ? 67 ASP A OD1  8  
ATOM 8654  O OD2  . ASP A 1 67 ? -11.955 3.783   12.106  1.00 0.00 ? 67 ASP A OD2  8  
ATOM 8655  H H    . ASP A 1 67 ? -7.801  7.280   12.953  1.00 0.00 ? 67 ASP A H    8  
ATOM 8656  H HA   . ASP A 1 67 ? -10.251 6.328   13.829  1.00 0.00 ? 67 ASP A HA   8  
ATOM 8657  H HB2  . ASP A 1 67 ? -10.461 5.624   11.443  1.00 0.00 ? 67 ASP A HB2  8  
ATOM 8658  H HB3  . ASP A 1 67 ? -9.106  4.554   11.727  1.00 0.00 ? 67 ASP A HB3  8  
ATOM 8659  N N    . TYR A 1 68 ? -9.069  4.707   15.287  1.00 0.00 ? 68 TYR A N    8  
ATOM 8660  C CA   . TYR A 1 68 ? -8.318  3.947   16.280  1.00 0.00 ? 68 TYR A CA   8  
ATOM 8661  C C    . TYR A 1 68 ? -7.277  4.825   16.965  1.00 0.00 ? 68 TYR A C    8  
ATOM 8662  O O    . TYR A 1 68 ? -7.560  5.323   18.074  1.00 0.00 ? 68 TYR A O    8  
ATOM 8663  C CB   . TYR A 1 68 ? -7.636  2.744   15.625  1.00 0.00 ? 68 TYR A CB   8  
ATOM 8664  C CG   . TYR A 1 68 ? -8.417  1.456   15.756  1.00 0.00 ? 68 TYR A CG   8  
ATOM 8665  C CD1  . TYR A 1 68 ? -9.806  1.464   15.791  1.00 0.00 ? 68 TYR A CD1  8  
ATOM 8666  C CD2  . TYR A 1 68 ? -7.765  0.233   15.844  1.00 0.00 ? 68 TYR A CD2  8  
ATOM 8667  C CE1  . TYR A 1 68 ? -10.523 0.287   15.910  1.00 0.00 ? 68 TYR A CE1  8  
ATOM 8668  C CE2  . TYR A 1 68 ? -8.474  -0.948  15.964  1.00 0.00 ? 68 TYR A CE2  8  
ATOM 8669  C CZ   . TYR A 1 68 ? -9.853  -0.915  15.996  1.00 0.00 ? 68 TYR A CZ   8  
ATOM 8670  O OH   . TYR A 1 68 ? -10.562 -2.087  16.115  1.00 0.00 ? 68 TYR A OH   8  
ATOM 8671  O OXT  . TYR A 1 68 ? -6.185  5.006   16.386  1.00 0.00 ? 68 TYR A OXT  8  
ATOM 8672  H H    . TYR A 1 68 ? -10.024 4.863   15.421  1.00 0.00 ? 68 TYR A H    8  
ATOM 8673  H HA   . TYR A 1 68 ? -9.017  3.593   17.023  1.00 0.00 ? 68 TYR A HA   8  
ATOM 8674  H HB2  . TYR A 1 68 ? -7.499  2.946   14.573  1.00 0.00 ? 68 TYR A HB2  8  
ATOM 8675  H HB3  . TYR A 1 68 ? -6.671  2.594   16.086  1.00 0.00 ? 68 TYR A HB3  8  
ATOM 8676  H HD1  . TYR A 1 68 ? -10.328 2.406   15.724  1.00 0.00 ? 68 TYR A HD1  8  
ATOM 8677  H HD2  . TYR A 1 68 ? -6.686  0.210   15.818  1.00 0.00 ? 68 TYR A HD2  8  
ATOM 8678  H HE1  . TYR A 1 68 ? -11.602 0.313   15.936  1.00 0.00 ? 68 TYR A HE1  8  
ATOM 8679  H HE2  . TYR A 1 68 ? -7.949  -1.888  16.031  1.00 0.00 ? 68 TYR A HE2  8  
ATOM 8680  H HH   . TYR A 1 68 ? -11.034 -2.093  16.951  1.00 0.00 ? 68 TYR A HH   8  
ATOM 8681  N N    . TYR A 1 1  ? 4.442   9.477   11.061  1.00 0.00 ? 1  TYR A N    9  
ATOM 8682  C CA   . TYR A 1 1  ? 4.322   10.073  9.705   1.00 0.00 ? 1  TYR A CA   9  
ATOM 8683  C C    . TYR A 1 1  ? 5.694   10.376  9.114   1.00 0.00 ? 1  TYR A C    9  
ATOM 8684  O O    . TYR A 1 1  ? 6.407   11.257  9.592   1.00 0.00 ? 1  TYR A O    9  
ATOM 8685  C CB   . TYR A 1 1  ? 3.498   11.359  9.811   1.00 0.00 ? 1  TYR A CB   9  
ATOM 8686  C CG   . TYR A 1 1  ? 2.896   11.803  8.498   1.00 0.00 ? 1  TYR A CG   9  
ATOM 8687  C CD1  . TYR A 1 1  ? 2.243   10.898  7.671   1.00 0.00 ? 1  TYR A CD1  9  
ATOM 8688  C CD2  . TYR A 1 1  ? 2.979   13.127  8.085   1.00 0.00 ? 1  TYR A CD2  9  
ATOM 8689  C CE1  . TYR A 1 1  ? 1.690   11.298  6.469   1.00 0.00 ? 1  TYR A CE1  9  
ATOM 8690  C CE2  . TYR A 1 1  ? 2.429   13.536  6.884   1.00 0.00 ? 1  TYR A CE2  9  
ATOM 8691  C CZ   . TYR A 1 1  ? 1.786   12.618  6.080   1.00 0.00 ? 1  TYR A CZ   9  
ATOM 8692  O OH   . TYR A 1 1  ? 1.237   13.020  4.884   1.00 0.00 ? 1  TYR A OH   9  
ATOM 8693  H H1   . TYR A 1 1  ? 5.262   8.838   11.054  1.00 0.00 ? 1  TYR A H1   9  
ATOM 8694  H H2   . TYR A 1 1  ? 3.562   8.956   11.257  1.00 0.00 ? 1  TYR A H2   9  
ATOM 8695  H H3   . TYR A 1 1  ? 4.576   10.255  11.738  1.00 0.00 ? 1  TYR A H3   9  
ATOM 8696  H HA   . TYR A 1 1  ? 3.808   9.372   9.066   1.00 0.00 ? 1  TYR A HA   9  
ATOM 8697  H HB2  . TYR A 1 1  ? 2.690   11.202  10.510  1.00 0.00 ? 1  TYR A HB2  9  
ATOM 8698  H HB3  . TYR A 1 1  ? 4.131   12.155  10.172  1.00 0.00 ? 1  TYR A HB3  9  
ATOM 8699  H HD1  . TYR A 1 1  ? 2.169   9.865   7.977   1.00 0.00 ? 1  TYR A HD1  9  
ATOM 8700  H HD2  . TYR A 1 1  ? 3.483   13.844  8.716   1.00 0.00 ? 1  TYR A HD2  9  
ATOM 8701  H HE1  . TYR A 1 1  ? 1.187   10.579  5.841   1.00 0.00 ? 1  TYR A HE1  9  
ATOM 8702  H HE2  . TYR A 1 1  ? 2.504   14.569  6.580   1.00 0.00 ? 1  TYR A HE2  9  
ATOM 8703  H HH   . TYR A 1 1  ? 1.014   13.953  4.931   1.00 0.00 ? 1  TYR A HH   9  
ATOM 8704  N N    . HIS A 1 2  ? 6.057   9.638   8.070   1.00 0.00 ? 2  HIS A N    9  
ATOM 8705  C CA   . HIS A 1 2  ? 7.344   9.828   7.410   1.00 0.00 ? 2  HIS A CA   9  
ATOM 8706  C C    . HIS A 1 2  ? 7.174   9.898   5.896   1.00 0.00 ? 2  HIS A C    9  
ATOM 8707  O O    . HIS A 1 2  ? 7.879   9.219   5.151   1.00 0.00 ? 2  HIS A O    9  
ATOM 8708  C CB   . HIS A 1 2  ? 8.302   8.693   7.776   1.00 0.00 ? 2  HIS A CB   9  
ATOM 8709  C CG   . HIS A 1 2  ? 8.521   8.545   9.249   1.00 0.00 ? 2  HIS A CG   9  
ATOM 8710  N ND1  . HIS A 1 2  ? 8.862   9.599   10.071  1.00 0.00 ? 2  HIS A ND1  9  
ATOM 8711  C CD2  . HIS A 1 2  ? 8.444   7.456   10.051  1.00 0.00 ? 2  HIS A CD2  9  
ATOM 8712  C CE1  . HIS A 1 2  ? 8.986   9.165   11.313  1.00 0.00 ? 2  HIS A CE1  9  
ATOM 8713  N NE2  . HIS A 1 2  ? 8.738   7.869   11.327  1.00 0.00 ? 2  HIS A NE2  9  
ATOM 8714  H H    . HIS A 1 2  ? 5.445   8.951   7.733   1.00 0.00 ? 2  HIS A H    9  
ATOM 8715  H HA   . HIS A 1 2  ? 7.758   10.764  7.756   1.00 0.00 ? 2  HIS A HA   9  
ATOM 8716  H HB2  . HIS A 1 2  ? 7.904   7.761   7.403   1.00 0.00 ? 2  HIS A HB2  9  
ATOM 8717  H HB3  . HIS A 1 2  ? 9.262   8.879   7.315   1.00 0.00 ? 2  HIS A HB3  9  
ATOM 8718  H HD1  . HIS A 1 2  ? 8.995   10.527  9.786   1.00 0.00 ? 2  HIS A HD1  9  
ATOM 8719  H HD2  . HIS A 1 2  ? 8.198   6.449   9.743   1.00 0.00 ? 2  HIS A HD2  9  
ATOM 8720  H HE1  . HIS A 1 2  ? 9.246   9.768   12.170  1.00 0.00 ? 2  HIS A HE1  9  
ATOM 8721  H HE2  . HIS A 1 2  ? 8.759   7.296   12.121  1.00 0.00 ? 2  HIS A HE2  9  
ATOM 8722  N N    . ALA A 1 3  ? 6.232   10.722  5.449   1.00 0.00 ? 3  ALA A N    9  
ATOM 8723  C CA   . ALA A 1 3  ? 5.971   10.883  4.023   1.00 0.00 ? 3  ALA A CA   9  
ATOM 8724  C C    . ALA A 1 3  ? 7.166   11.480  3.312   1.00 0.00 ? 3  ALA A C    9  
ATOM 8725  O O    . ALA A 1 3  ? 8.233   11.652  3.900   1.00 0.00 ? 3  ALA A O    9  
ATOM 8726  C CB   . ALA A 1 3  ? 4.731   11.736  3.800   1.00 0.00 ? 3  ALA A CB   9  
ATOM 8727  H H    . ALA A 1 3  ? 5.703   11.238  6.093   1.00 0.00 ? 3  ALA A H    9  
ATOM 8728  H HA   . ALA A 1 3  ? 5.790   9.904   3.601   1.00 0.00 ? 3  ALA A HA   9  
ATOM 8729  H HB1  . ALA A 1 3  ? 4.453   12.217  4.726   1.00 0.00 ? 3  ALA A HB1  9  
ATOM 8730  H HB2  . ALA A 1 3  ? 3.919   11.111  3.461   1.00 0.00 ? 3  ALA A HB2  9  
ATOM 8731  H HB3  . ALA A 1 3  ? 4.942   12.489  3.053   1.00 0.00 ? 3  ALA A HB3  9  
ATOM 8732  N N    . ASP A 1 4  ? 6.993   11.754  2.027   1.00 0.00 ? 4  ASP A N    9  
ATOM 8733  C CA   . ASP A 1 4  ? 8.092   12.236  1.208   1.00 0.00 ? 4  ASP A CA   9  
ATOM 8734  C C    . ASP A 1 4  ? 9.216   11.210  1.268   1.00 0.00 ? 4  ASP A C    9  
ATOM 8735  O O    . ASP A 1 4  ? 10.241  11.440  1.908   1.00 0.00 ? 4  ASP A O    9  
ATOM 8736  C CB   . ASP A 1 4  ? 8.582   13.597  1.703   1.00 0.00 ? 4  ASP A CB   9  
ATOM 8737  C CG   . ASP A 1 4  ? 9.418   14.323  0.668   1.00 0.00 ? 4  ASP A CG   9  
ATOM 8738  O OD1  . ASP A 1 4  ? 8.884   14.623  -0.421  1.00 0.00 ? 4  ASP A OD1  9  
ATOM 8739  O OD2  . ASP A 1 4  ? 10.606  14.590  0.944   1.00 0.00 ? 4  ASP A OD2  9  
ATOM 8740  H H    . ASP A 1 4  ? 6.133   11.547  1.608   1.00 0.00 ? 4  ASP A H    9  
ATOM 8741  H HA   . ASP A 1 4  ? 7.744   12.326  0.190   1.00 0.00 ? 4  ASP A HA   9  
ATOM 8742  H HB2  . ASP A 1 4  ? 7.729   14.213  1.945   1.00 0.00 ? 4  ASP A HB2  9  
ATOM 8743  H HB3  . ASP A 1 4  ? 9.183   13.456  2.590   1.00 0.00 ? 4  ASP A HB3  9  
ATOM 8744  N N    . PRO A 1 5  ? 8.977   10.002  0.718   1.00 0.00 ? 5  PRO A N    9  
ATOM 8745  C CA   . PRO A 1 5  ? 7.761   9.663   -0.030  1.00 0.00 ? 5  PRO A CA   9  
ATOM 8746  C C    . PRO A 1 5  ? 6.604   9.252   0.873   1.00 0.00 ? 5  PRO A C    9  
ATOM 8747  O O    . PRO A 1 5  ? 6.794   8.542   1.861   1.00 0.00 ? 5  PRO A O    9  
ATOM 8748  C CB   . PRO A 1 5  ? 8.192   8.474   -0.907  1.00 0.00 ? 5  PRO A CB   9  
ATOM 8749  C CG   . PRO A 1 5  ? 9.630   8.210   -0.576  1.00 0.00 ? 5  PRO A CG   9  
ATOM 8750  C CD   . PRO A 1 5  ? 9.896   8.875   0.742   1.00 0.00 ? 5  PRO A CD   9  
ATOM 8751  H HA   . PRO A 1 5  ? 7.446   10.480  -0.662  1.00 0.00 ? 5  PRO A HA   9  
ATOM 8752  H HB2  . PRO A 1 5  ? 7.575   7.619   -0.677  1.00 0.00 ? 5  PRO A HB2  9  
ATOM 8753  H HB3  . PRO A 1 5  ? 8.073   8.734   -1.948  1.00 0.00 ? 5  PRO A HB3  9  
ATOM 8754  H HG2  . PRO A 1 5  ? 9.796   7.145   -0.497  1.00 0.00 ? 5  PRO A HG2  9  
ATOM 8755  H HG3  . PRO A 1 5  ? 10.265  8.631   -1.342  1.00 0.00 ? 5  PRO A HG3  9  
ATOM 8756  H HD2  . PRO A 1 5  ? 9.654   8.213   1.563   1.00 0.00 ? 5  PRO A HD2  9  
ATOM 8757  H HD3  . PRO A 1 5  ? 10.922  9.208   0.805   1.00 0.00 ? 5  PRO A HD3  9  
ATOM 8758  N N    . SER A 1 6  ? 5.401   9.688   0.513   1.00 0.00 ? 6  SER A N    9  
ATOM 8759  C CA   . SER A 1 6  ? 4.204   9.355   1.274   1.00 0.00 ? 6  SER A CA   9  
ATOM 8760  C C    . SER A 1 6  ? 3.634   8.009   0.836   1.00 0.00 ? 6  SER A C    9  
ATOM 8761  O O    . SER A 1 6  ? 2.931   7.345   1.597   1.00 0.00 ? 6  SER A O    9  
ATOM 8762  C CB   . SER A 1 6  ? 3.147   10.449  1.102   1.00 0.00 ? 6  SER A CB   9  
ATOM 8763  O OG   . SER A 1 6  ? 2.733   10.549  -0.250  1.00 0.00 ? 6  SER A OG   9  
ATOM 8764  H H    . SER A 1 6  ? 5.317   10.245  -0.289  1.00 0.00 ? 6  SER A H    9  
ATOM 8765  H HA   . SER A 1 6  ? 4.478   9.293   2.316   1.00 0.00 ? 6  SER A HA   9  
ATOM 8766  H HB2  . SER A 1 6  ? 2.286   10.214  1.712   1.00 0.00 ? 6  SER A HB2  9  
ATOM 8767  H HB3  . SER A 1 6  ? 3.560   11.398  1.411   1.00 0.00 ? 6  SER A HB3  9  
ATOM 8768  H HG   . SER A 1 6  ? 3.257   11.219  -0.696  1.00 0.00 ? 6  SER A HG   9  
ATOM 8769  N N    . LEU A 1 7  ? 3.941   7.613   -0.396  1.00 0.00 ? 7  LEU A N    9  
ATOM 8770  C CA   . LEU A 1 7  ? 3.446   6.354   -0.938  1.00 0.00 ? 7  LEU A CA   9  
ATOM 8771  C C    . LEU A 1 7  ? 4.466   5.235   -0.761  1.00 0.00 ? 7  LEU A C    9  
ATOM 8772  O O    . LEU A 1 7  ? 4.140   4.163   -0.255  1.00 0.00 ? 7  LEU A O    9  
ATOM 8773  C CB   . LEU A 1 7  ? 3.107   6.518   -2.422  1.00 0.00 ? 7  LEU A CB   9  
ATOM 8774  C CG   . LEU A 1 7  ? 2.744   5.223   -3.159  1.00 0.00 ? 7  LEU A CG   9  
ATOM 8775  C CD1  . LEU A 1 7  ? 4.001   4.455   -3.537  1.00 0.00 ? 7  LEU A CD1  9  
ATOM 8776  C CD2  . LEU A 1 7  ? 1.824   4.359   -2.311  1.00 0.00 ? 7  LEU A CD2  9  
ATOM 8777  H H    . LEU A 1 7  ? 4.500   8.189   -0.958  1.00 0.00 ? 7  LEU A H    9  
ATOM 8778  H HA   . LEU A 1 7  ? 2.547   6.093   -0.399  1.00 0.00 ? 7  LEU A HA   9  
ATOM 8779  H HB2  . LEU A 1 7  ? 2.272   7.198   -2.504  1.00 0.00 ? 7  LEU A HB2  9  
ATOM 8780  H HB3  . LEU A 1 7  ? 3.959   6.961   -2.917  1.00 0.00 ? 7  LEU A HB3  9  
ATOM 8781  H HG   . LEU A 1 7  ? 2.221   5.472   -4.070  1.00 0.00 ? 7  LEU A HG   9  
ATOM 8782  H HD11 . LEU A 1 7  ? 4.803   5.150   -3.733  1.00 0.00 ? 7  LEU A HD11 9  
ATOM 8783  H HD12 . LEU A 1 7  ? 3.809   3.868   -4.422  1.00 0.00 ? 7  LEU A HD12 9  
ATOM 8784  H HD13 . LEU A 1 7  ? 4.281   3.800   -2.726  1.00 0.00 ? 7  LEU A HD13 9  
ATOM 8785  H HD21 . LEU A 1 7  ? 1.423   4.949   -1.500  1.00 0.00 ? 7  LEU A HD21 9  
ATOM 8786  H HD22 . LEU A 1 7  ? 2.382   3.527   -1.907  1.00 0.00 ? 7  LEU A HD22 9  
ATOM 8787  H HD23 . LEU A 1 7  ? 1.015   3.988   -2.921  1.00 0.00 ? 7  LEU A HD23 9  
ATOM 8788  N N    . VAL A 1 8  ? 5.695   5.484   -1.195  1.00 0.00 ? 8  VAL A N    9  
ATOM 8789  C CA   . VAL A 1 8  ? 6.756   4.487   -1.101  1.00 0.00 ? 8  VAL A CA   9  
ATOM 8790  C C    . VAL A 1 8  ? 6.910   3.965   0.325   1.00 0.00 ? 8  VAL A C    9  
ATOM 8791  O O    . VAL A 1 8  ? 6.777   2.766   0.577   1.00 0.00 ? 8  VAL A O    9  
ATOM 8792  C CB   . VAL A 1 8  ? 8.105   5.060   -1.574  1.00 0.00 ? 8  VAL A CB   9  
ATOM 8793  C CG1  . VAL A 1 8  ? 9.180   3.986   -1.547  1.00 0.00 ? 8  VAL A CG1  9  
ATOM 8794  C CG2  . VAL A 1 8  ? 7.972   5.659   -2.965  1.00 0.00 ? 8  VAL A CG2  9  
ATOM 8795  H H    . VAL A 1 8  ? 5.893   6.356   -1.599  1.00 0.00 ? 8  VAL A H    9  
ATOM 8796  H HA   . VAL A 1 8  ? 6.496   3.662   -1.748  1.00 0.00 ? 8  VAL A HA   9  
ATOM 8797  H HB   . VAL A 1 8  ? 8.397   5.847   -0.894  1.00 0.00 ? 8  VAL A HB   9  
ATOM 8798  H HG11 . VAL A 1 8  ? 8.820   3.130   -0.995  1.00 0.00 ? 8  VAL A HG11 9  
ATOM 8799  H HG12 . VAL A 1 8  ? 10.066  4.375   -1.068  1.00 0.00 ? 8  VAL A HG12 9  
ATOM 8800  H HG13 . VAL A 1 8  ? 9.417   3.688   -2.557  1.00 0.00 ? 8  VAL A HG13 9  
ATOM 8801  H HG21 . VAL A 1 8  ? 8.951   5.902   -3.349  1.00 0.00 ? 8  VAL A HG21 9  
ATOM 8802  H HG22 . VAL A 1 8  ? 7.372   6.557   -2.915  1.00 0.00 ? 8  VAL A HG22 9  
ATOM 8803  H HG23 . VAL A 1 8  ? 7.495   4.945   -3.621  1.00 0.00 ? 8  VAL A HG23 9  
ATOM 8804  N N    . SER A 1 9  ? 7.195   4.872   1.254   1.00 0.00 ? 9  SER A N    9  
ATOM 8805  C CA   . SER A 1 9  ? 7.387   4.504   2.653   1.00 0.00 ? 9  SER A CA   9  
ATOM 8806  C C    . SER A 1 9  ? 6.181   3.750   3.208   1.00 0.00 ? 9  SER A C    9  
ATOM 8807  O O    . SER A 1 9  ? 6.285   3.063   4.225   1.00 0.00 ? 9  SER A O    9  
ATOM 8808  C CB   . SER A 1 9  ? 7.649   5.752   3.495   1.00 0.00 ? 9  SER A CB   9  
ATOM 8809  O OG   . SER A 1 9  ? 8.394   6.712   2.767   1.00 0.00 ? 9  SER A OG   9  
ATOM 8810  H H    . SER A 1 9  ? 7.298   5.810   0.990   1.00 0.00 ? 9  SER A H    9  
ATOM 8811  H HA   . SER A 1 9  ? 8.252   3.860   2.708   1.00 0.00 ? 9  SER A HA   9  
ATOM 8812  H HB2  . SER A 1 9  ? 6.708   6.190   3.789   1.00 0.00 ? 9  SER A HB2  9  
ATOM 8813  H HB3  . SER A 1 9  ? 8.209   5.474   4.376   1.00 0.00 ? 9  SER A HB3  9  
ATOM 8814  H HG   . SER A 1 9  ? 9.332   6.554   2.895   1.00 0.00 ? 9  SER A HG   9  
ATOM 8815  N N    . PHE A 1 10 ? 5.035   3.884   2.546   1.00 0.00 ? 10 PHE A N    9  
ATOM 8816  C CA   . PHE A 1 10 ? 3.816   3.221   2.997   1.00 0.00 ? 10 PHE A CA   9  
ATOM 8817  C C    . PHE A 1 10 ? 3.674   1.836   2.376   1.00 0.00 ? 10 PHE A C    9  
ATOM 8818  O O    . PHE A 1 10 ? 3.561   0.838   3.084   1.00 0.00 ? 10 PHE A O    9  
ATOM 8819  C CB   . PHE A 1 10 ? 2.592   4.073   2.656   1.00 0.00 ? 10 PHE A CB   9  
ATOM 8820  C CG   . PHE A 1 10 ? 2.317   5.161   3.655   1.00 0.00 ? 10 PHE A CG   9  
ATOM 8821  C CD1  . PHE A 1 10 ? 3.357   5.774   4.338   1.00 0.00 ? 10 PHE A CD1  9  
ATOM 8822  C CD2  . PHE A 1 10 ? 1.019   5.573   3.907   1.00 0.00 ? 10 PHE A CD2  9  
ATOM 8823  C CE1  . PHE A 1 10 ? 3.105   6.775   5.256   1.00 0.00 ? 10 PHE A CE1  9  
ATOM 8824  C CE2  . PHE A 1 10 ? 0.761   6.575   4.824   1.00 0.00 ? 10 PHE A CE2  9  
ATOM 8825  C CZ   . PHE A 1 10 ? 1.806   7.177   5.499   1.00 0.00 ? 10 PHE A CZ   9  
ATOM 8826  H H    . PHE A 1 10 ? 5.004   4.449   1.747   1.00 0.00 ? 10 PHE A H    9  
ATOM 8827  H HA   . PHE A 1 10 ? 3.880   3.112   4.070   1.00 0.00 ? 10 PHE A HA   9  
ATOM 8828  H HB2  . PHE A 1 10 ? 2.743   4.537   1.692   1.00 0.00 ? 10 PHE A HB2  9  
ATOM 8829  H HB3  . PHE A 1 10 ? 1.721   3.437   2.610   1.00 0.00 ? 10 PHE A HB3  9  
ATOM 8830  H HD1  . PHE A 1 10 ? 4.372   5.459   4.149   1.00 0.00 ? 10 PHE A HD1  9  
ATOM 8831  H HD2  . PHE A 1 10 ? 0.202   5.105   3.380   1.00 0.00 ? 10 PHE A HD2  9  
ATOM 8832  H HE1  . PHE A 1 10 ? 3.923   7.243   5.783   1.00 0.00 ? 10 PHE A HE1  9  
ATOM 8833  H HE2  . PHE A 1 10 ? -0.255  6.887   5.013   1.00 0.00 ? 10 PHE A HE2  9  
ATOM 8834  H HZ   . PHE A 1 10 ? 1.607   7.959   6.217   1.00 0.00 ? 10 PHE A HZ   9  
ATOM 8835  N N    . LEU A 1 11 ? 3.677   1.783   1.047   1.00 0.00 ? 11 LEU A N    9  
ATOM 8836  C CA   . LEU A 1 11 ? 3.546   0.521   0.326   1.00 0.00 ? 11 LEU A CA   9  
ATOM 8837  C C    . LEU A 1 11 ? 4.458   -0.548  0.916   1.00 0.00 ? 11 LEU A C    9  
ATOM 8838  O O    . LEU A 1 11 ? 4.045   -1.689  1.122   1.00 0.00 ? 11 LEU A O    9  
ATOM 8839  C CB   . LEU A 1 11 ? 3.879   0.727   -1.151  1.00 0.00 ? 11 LEU A CB   9  
ATOM 8840  C CG   . LEU A 1 11 ? 3.356   -0.359  -2.094  1.00 0.00 ? 11 LEU A CG   9  
ATOM 8841  C CD1  . LEU A 1 11 ? 4.138   -1.650  -1.905  1.00 0.00 ? 11 LEU A CD1  9  
ATOM 8842  C CD2  . LEU A 1 11 ? 1.870   -0.595  -1.866  1.00 0.00 ? 11 LEU A CD2  9  
ATOM 8843  H H    . LEU A 1 11 ? 3.768   2.612   0.538   1.00 0.00 ? 11 LEU A H    9  
ATOM 8844  H HA   . LEU A 1 11 ? 2.523   0.192   0.418   1.00 0.00 ? 11 LEU A HA   9  
ATOM 8845  H HB2  . LEU A 1 11 ? 3.464   1.674   -1.462  1.00 0.00 ? 11 LEU A HB2  9  
ATOM 8846  H HB3  . LEU A 1 11 ? 4.953   0.774   -1.250  1.00 0.00 ? 11 LEU A HB3  9  
ATOM 8847  H HG   . LEU A 1 11 ? 3.490   -0.035  -3.116  1.00 0.00 ? 11 LEU A HG   9  
ATOM 8848  H HD11 . LEU A 1 11 ? 5.095   -1.429  -1.457  1.00 0.00 ? 11 LEU A HD11 9  
ATOM 8849  H HD12 . LEU A 1 11 ? 4.290   -2.123  -2.865  1.00 0.00 ? 11 LEU A HD12 9  
ATOM 8850  H HD13 . LEU A 1 11 ? 3.583   -2.316  -1.260  1.00 0.00 ? 11 LEU A HD13 9  
ATOM 8851  H HD21 . LEU A 1 11 ? 1.445   -1.076  -2.735  1.00 0.00 ? 11 LEU A HD21 9  
ATOM 8852  H HD22 . LEU A 1 11 ? 1.377   0.352   -1.702  1.00 0.00 ? 11 LEU A HD22 9  
ATOM 8853  H HD23 . LEU A 1 11 ? 1.735   -1.226  -1.001  1.00 0.00 ? 11 LEU A HD23 9  
ATOM 8854  N N    . THR A 1 12 ? 5.697   -0.166  1.187   1.00 0.00 ? 12 THR A N    9  
ATOM 8855  C CA   . THR A 1 12 ? 6.669   -1.083  1.765   1.00 0.00 ? 12 THR A CA   9  
ATOM 8856  C C    . THR A 1 12 ? 6.509   -1.151  3.279   1.00 0.00 ? 12 THR A C    9  
ATOM 8857  O O    . THR A 1 12 ? 6.439   -2.236  3.858   1.00 0.00 ? 12 THR A O    9  
ATOM 8858  C CB   . THR A 1 12 ? 8.090   -0.641  1.413   1.00 0.00 ? 12 THR A CB   9  
ATOM 8859  O OG1  . THR A 1 12 ? 8.230   -0.477  0.013   1.00 0.00 ? 12 THR A OG1  9  
ATOM 8860  C CG2  . THR A 1 12 ? 9.152   -1.616  1.871   1.00 0.00 ? 12 THR A CG2  9  
ATOM 8861  H H    . THR A 1 12 ? 5.962   0.760   1.005   1.00 0.00 ? 12 THR A H    9  
ATOM 8862  H HA   . THR A 1 12 ? 6.489   -2.064  1.350   1.00 0.00 ? 12 THR A HA   9  
ATOM 8863  H HB   . THR A 1 12 ? 8.287   0.308   1.888   1.00 0.00 ? 12 THR A HB   9  
ATOM 8864  H HG1  . THR A 1 12 ? 9.126   -0.197  -0.189  1.00 0.00 ? 12 THR A HG1  9  
ATOM 8865  H HG21 . THR A 1 12 ? 9.773   -1.893  1.033   1.00 0.00 ? 12 THR A HG21 9  
ATOM 8866  H HG22 . THR A 1 12 ? 8.680   -2.498  2.277   1.00 0.00 ? 12 THR A HG22 9  
ATOM 8867  H HG23 . THR A 1 12 ? 9.761   -1.152  2.633   1.00 0.00 ? 12 THR A HG23 9  
ATOM 8868  N N    . GLY A 1 13 ? 6.446   0.019   3.910   1.00 0.00 ? 13 GLY A N    9  
ATOM 8869  C CA   . GLY A 1 13 ? 6.290   0.079   5.351   1.00 0.00 ? 13 GLY A CA   9  
ATOM 8870  C C    . GLY A 1 13 ? 5.114   -0.743  5.835   1.00 0.00 ? 13 GLY A C    9  
ATOM 8871  O O    . GLY A 1 13 ? 5.104   -1.222  6.969   1.00 0.00 ? 13 GLY A O    9  
ATOM 8872  H H    . GLY A 1 13 ? 6.496   0.849   3.390   1.00 0.00 ? 13 GLY A H    9  
ATOM 8873  H HA2  . GLY A 1 13 ? 7.191   -0.293  5.817   1.00 0.00 ? 13 GLY A HA2  9  
ATOM 8874  H HA3  . GLY A 1 13 ? 6.143   1.108   5.646   1.00 0.00 ? 13 GLY A HA3  9  
ATOM 8875  N N    . LEU A 1 14 ? 4.123   -0.908  4.968   1.00 0.00 ? 14 LEU A N    9  
ATOM 8876  C CA   . LEU A 1 14 ? 2.943   -1.690  5.294   1.00 0.00 ? 14 LEU A CA   9  
ATOM 8877  C C    . LEU A 1 14 ? 3.314   -3.137  5.609   1.00 0.00 ? 14 LEU A C    9  
ATOM 8878  O O    . LEU A 1 14 ? 2.527   -3.873  6.204   1.00 0.00 ? 14 LEU A O    9  
ATOM 8879  C CB   . LEU A 1 14 ? 1.967   -1.648  4.116   1.00 0.00 ? 14 LEU A CB   9  
ATOM 8880  C CG   . LEU A 1 14 ? 0.487   -1.761  4.472   1.00 0.00 ? 14 LEU A CG   9  
ATOM 8881  C CD1  . LEU A 1 14 ? 0.152   -0.913  5.690   1.00 0.00 ? 14 LEU A CD1  9  
ATOM 8882  C CD2  . LEU A 1 14 ? -0.371  -1.351  3.287   1.00 0.00 ? 14 LEU A CD2  9  
ATOM 8883  H H    . LEU A 1 14 ? 4.194   -0.511  4.076   1.00 0.00 ? 14 LEU A H    9  
ATOM 8884  H HA   . LEU A 1 14 ? 2.481   -1.249  6.164   1.00 0.00 ? 14 LEU A HA   9  
ATOM 8885  H HB2  . LEU A 1 14 ? 2.114   -0.717  3.590   1.00 0.00 ? 14 LEU A HB2  9  
ATOM 8886  H HB3  . LEU A 1 14 ? 2.215   -2.458  3.446   1.00 0.00 ? 14 LEU A HB3  9  
ATOM 8887  H HG   . LEU A 1 14 ? 0.262   -2.788  4.707   1.00 0.00 ? 14 LEU A HG   9  
ATOM 8888  H HD11 . LEU A 1 14 ? 0.683   0.025   5.631   1.00 0.00 ? 14 LEU A HD11 9  
ATOM 8889  H HD12 . LEU A 1 14 ? 0.448   -1.438  6.586   1.00 0.00 ? 14 LEU A HD12 9  
ATOM 8890  H HD13 . LEU A 1 14 ? -0.911  -0.724  5.717   1.00 0.00 ? 14 LEU A HD13 9  
ATOM 8891  H HD21 . LEU A 1 14 ? -1.356  -1.780  3.388   1.00 0.00 ? 14 LEU A HD21 9  
ATOM 8892  H HD22 . LEU A 1 14 ? 0.086   -1.706  2.374   1.00 0.00 ? 14 LEU A HD22 9  
ATOM 8893  H HD23 . LEU A 1 14 ? -0.448  -0.274  3.254   1.00 0.00 ? 14 LEU A HD23 9  
ATOM 8894  N N    . GLY A 1 15 ? 4.517   -3.538  5.207   1.00 0.00 ? 15 GLY A N    9  
ATOM 8895  C CA   . GLY A 1 15 ? 4.963   -4.897  5.438   1.00 0.00 ? 15 GLY A CA   9  
ATOM 8896  C C    . GLY A 1 15 ? 5.178   -5.660  4.145   1.00 0.00 ? 15 GLY A C    9  
ATOM 8897  O O    . GLY A 1 15 ? 5.252   -6.889  4.149   1.00 0.00 ? 15 GLY A O    9  
ATOM 8898  H H    . GLY A 1 15 ? 5.101   -2.914  4.728   1.00 0.00 ? 15 GLY A H    9  
ATOM 8899  H HA2  . GLY A 1 15 ? 5.892   -4.871  5.988   1.00 0.00 ? 15 GLY A HA2  9  
ATOM 8900  H HA3  . GLY A 1 15 ? 4.221   -5.413  6.030   1.00 0.00 ? 15 GLY A HA3  9  
ATOM 8901  N N    . CYS A 1 16 ? 5.278   -4.931  3.035   1.00 0.00 ? 16 CYS A N    9  
ATOM 8902  C CA   . CYS A 1 16 ? 5.480   -5.555  1.732   1.00 0.00 ? 16 CYS A CA   9  
ATOM 8903  C C    . CYS A 1 16 ? 6.674   -4.940  1.005   1.00 0.00 ? 16 CYS A C    9  
ATOM 8904  O O    . CYS A 1 16 ? 6.507   -4.220  0.021   1.00 0.00 ? 16 CYS A O    9  
ATOM 8905  C CB   . CYS A 1 16 ? 4.220   -5.408  0.876   1.00 0.00 ? 16 CYS A CB   9  
ATOM 8906  S SG   . CYS A 1 16 ? 2.685   -5.783  1.756   1.00 0.00 ? 16 CYS A SG   9  
ATOM 8907  H H    . CYS A 1 16 ? 5.208   -3.953  3.091   1.00 0.00 ? 16 CYS A H    9  
ATOM 8908  H HA   . CYS A 1 16 ? 5.675   -6.604  1.894   1.00 0.00 ? 16 CYS A HA   9  
ATOM 8909  H HB2  . CYS A 1 16 ? 4.153   -4.392  0.519   1.00 0.00 ? 16 CYS A HB2  9  
ATOM 8910  H HB3  . CYS A 1 16 ? 4.287   -6.079  0.033   1.00 0.00 ? 16 CYS A HB3  9  
ATOM 8911  H HG   . CYS A 1 16 ? 2.075   -5.055  1.611   1.00 0.00 ? 16 CYS A HG   9  
ATOM 8912  N N    . PRO A 1 17 ? 7.900   -5.232  1.473   1.00 0.00 ? 17 PRO A N    9  
ATOM 8913  C CA   . PRO A 1 17 ? 9.123   -4.702  0.869   1.00 0.00 ? 17 PRO A CA   9  
ATOM 8914  C C    . PRO A 1 17 ? 9.599   -5.525  -0.327  1.00 0.00 ? 17 PRO A C    9  
ATOM 8915  O O    . PRO A 1 17 ? 10.719  -5.344  -0.805  1.00 0.00 ? 17 PRO A O    9  
ATOM 8916  C CB   . PRO A 1 17 ? 10.126  -4.801  2.014   1.00 0.00 ? 17 PRO A CB   9  
ATOM 8917  C CG   . PRO A 1 17 ? 9.690   -5.999  2.789   1.00 0.00 ? 17 PRO A CG   9  
ATOM 8918  C CD   . PRO A 1 17 ? 8.190   -6.079  2.646   1.00 0.00 ? 17 PRO A CD   9  
ATOM 8919  H HA   . PRO A 1 17 ? 9.006   -3.671  0.575   1.00 0.00 ? 17 PRO A HA   9  
ATOM 8920  H HB2  . PRO A 1 17 ? 11.122  -4.929  1.615   1.00 0.00 ? 17 PRO A HB2  9  
ATOM 8921  H HB3  . PRO A 1 17 ? 10.083  -3.903  2.614   1.00 0.00 ? 17 PRO A HB3  9  
ATOM 8922  H HG2  . PRO A 1 17 ? 10.152  -6.886  2.381   1.00 0.00 ? 17 PRO A HG2  9  
ATOM 8923  H HG3  . PRO A 1 17 ? 9.960   -5.880  3.828   1.00 0.00 ? 17 PRO A HG3  9  
ATOM 8924  H HD2  . PRO A 1 17 ? 7.883   -7.099  2.468   1.00 0.00 ? 17 PRO A HD2  9  
ATOM 8925  H HD3  . PRO A 1 17 ? 7.707   -5.689  3.530   1.00 0.00 ? 17 PRO A HD3  9  
ATOM 8926  N N    . ASN A 1 18 ? 8.748   -6.427  -0.809  1.00 0.00 ? 18 ASN A N    9  
ATOM 8927  C CA   . ASN A 1 18 ? 9.096   -7.268  -1.949  1.00 0.00 ? 18 ASN A CA   9  
ATOM 8928  C C    . ASN A 1 18 ? 7.921   -7.420  -2.914  1.00 0.00 ? 18 ASN A C    9  
ATOM 8929  O O    . ASN A 1 18 ? 7.922   -8.304  -3.770  1.00 0.00 ? 18 ASN A O    9  
ATOM 8930  C CB   . ASN A 1 18 ? 9.550   -8.647  -1.465  1.00 0.00 ? 18 ASN A CB   9  
ATOM 8931  C CG   . ASN A 1 18 ? 8.550   -9.287  -0.521  1.00 0.00 ? 18 ASN A CG   9  
ATOM 8932  O OD1  . ASN A 1 18 ? 8.609   -9.088  0.692   1.00 0.00 ? 18 ASN A OD1  9  
ATOM 8933  N ND2  . ASN A 1 18 ? 7.627   -10.063 -1.075  1.00 0.00 ? 18 ASN A ND2  9  
ATOM 8934  H H    . ASN A 1 18 ? 7.868   -6.531  -0.392  1.00 0.00 ? 18 ASN A H    9  
ATOM 8935  H HA   . ASN A 1 18 ? 9.914   -6.794  -2.471  1.00 0.00 ? 18 ASN A HA   9  
ATOM 8936  H HB2  . ASN A 1 18 ? 9.678   -9.297  -2.318  1.00 0.00 ? 18 ASN A HB2  9  
ATOM 8937  H HB3  . ASN A 1 18 ? 10.493  -8.548  -0.947  1.00 0.00 ? 18 ASN A HB3  9  
ATOM 8938  H HD21 . ASN A 1 18 ? 7.641   -10.178 -2.048  1.00 0.00 ? 18 ASN A HD21 9  
ATOM 8939  H HD22 . ASN A 1 18 ? 6.968   -10.490 -0.489  1.00 0.00 ? 18 ASN A HD22 9  
ATOM 8940  N N    . CYS A 1 19 ? 6.923   -6.547  -2.783  1.00 0.00 ? 19 CYS A N    9  
ATOM 8941  C CA   . CYS A 1 19 ? 5.748   -6.597  -3.646  1.00 0.00 ? 19 CYS A CA   9  
ATOM 8942  C C    . CYS A 1 19 ? 5.633   -5.335  -4.497  1.00 0.00 ? 19 CYS A C    9  
ATOM 8943  O O    . CYS A 1 19 ? 5.000   -5.343  -5.553  1.00 0.00 ? 19 CYS A O    9  
ATOM 8944  C CB   . CYS A 1 19 ? 4.482   -6.776  -2.808  1.00 0.00 ? 19 CYS A CB   9  
ATOM 8945  S SG   . CYS A 1 19 ? 4.522   -8.211  -1.709  1.00 0.00 ? 19 CYS A SG   9  
ATOM 8946  H H    . CYS A 1 19 ? 6.970   -5.865  -2.082  1.00 0.00 ? 19 CYS A H    9  
ATOM 8947  H HA   . CYS A 1 19 ? 5.857   -7.447  -4.304  1.00 0.00 ? 19 CYS A HA   9  
ATOM 8948  H HB2  . CYS A 1 19 ? 4.337   -5.898  -2.196  1.00 0.00 ? 19 CYS A HB2  9  
ATOM 8949  H HB3  . CYS A 1 19 ? 3.635   -6.892  -3.467  1.00 0.00 ? 19 CYS A HB3  9  
ATOM 8950  H HG   . CYS A 1 19 ? 3.803   -8.122  -1.078  1.00 0.00 ? 19 CYS A HG   9  
ATOM 8951  N N    . ILE A 1 20 ? 6.249   -4.250  -4.035  1.00 0.00 ? 20 ILE A N    9  
ATOM 8952  C CA   . ILE A 1 20 ? 6.208   -2.981  -4.754  1.00 0.00 ? 20 ILE A CA   9  
ATOM 8953  C C    . ILE A 1 20 ? 6.546   -3.170  -6.229  1.00 0.00 ? 20 ILE A C    9  
ATOM 8954  O O    . ILE A 1 20 ? 5.891   -2.602  -7.103  1.00 0.00 ? 20 ILE A O    9  
ATOM 8955  C CB   . ILE A 1 20 ? 7.182   -1.957  -4.143  1.00 0.00 ? 20 ILE A CB   9  
ATOM 8956  C CG1  . ILE A 1 20 ? 7.083   -0.623  -4.886  1.00 0.00 ? 20 ILE A CG1  9  
ATOM 8957  C CG2  . ILE A 1 20 ? 8.605   -2.491  -4.188  1.00 0.00 ? 20 ILE A CG2  9  
ATOM 8958  C CD1  . ILE A 1 20 ? 7.032   0.580   -3.969  1.00 0.00 ? 20 ILE A CD1  9  
ATOM 8959  H H    . ILE A 1 20 ? 6.737   -4.301  -3.187  1.00 0.00 ? 20 ILE A H    9  
ATOM 8960  H HA   . ILE A 1 20 ? 5.206   -2.587  -4.673  1.00 0.00 ? 20 ILE A HA   9  
ATOM 8961  H HB   . ILE A 1 20 ? 6.911   -1.809  -3.107  1.00 0.00 ? 20 ILE A HB   9  
ATOM 8962  H HG12 . ILE A 1 20 ? 7.943   -0.512  -5.528  1.00 0.00 ? 20 ILE A HG12 9  
ATOM 8963  H HG13 . ILE A 1 20 ? 6.186   -0.619  -5.486  1.00 0.00 ? 20 ILE A HG13 9  
ATOM 8964  H HG21 . ILE A 1 20 ? 8.591   -3.562  -4.052  1.00 0.00 ? 20 ILE A HG21 9  
ATOM 8965  H HG22 . ILE A 1 20 ? 9.185   -2.034  -3.401  1.00 0.00 ? 20 ILE A HG22 9  
ATOM 8966  H HG23 . ILE A 1 20 ? 9.047   -2.255  -5.145  1.00 0.00 ? 20 ILE A HG23 9  
ATOM 8967  H HD11 . ILE A 1 20 ? 6.321   0.399   -3.177  1.00 0.00 ? 20 ILE A HD11 9  
ATOM 8968  H HD12 . ILE A 1 20 ? 6.727   1.451   -4.533  1.00 0.00 ? 20 ILE A HD12 9  
ATOM 8969  H HD13 . ILE A 1 20 ? 8.009   0.752   -3.544  1.00 0.00 ? 20 ILE A HD13 9  
ATOM 8970  N N    . GLU A 1 21 ? 7.571   -3.969  -6.500  1.00 0.00 ? 21 GLU A N    9  
ATOM 8971  C CA   . GLU A 1 21 ? 7.993   -4.229  -7.872  1.00 0.00 ? 21 GLU A CA   9  
ATOM 8972  C C    . GLU A 1 21 ? 6.837   -4.775  -8.703  1.00 0.00 ? 21 GLU A C    9  
ATOM 8973  O O    . GLU A 1 21 ? 6.655   -4.390  -9.858  1.00 0.00 ? 21 GLU A O    9  
ATOM 8974  C CB   . GLU A 1 21 ? 9.159   -5.219  -7.888  1.00 0.00 ? 21 GLU A CB   9  
ATOM 8975  C CG   . GLU A 1 21 ? 8.878   -6.504  -7.126  1.00 0.00 ? 21 GLU A CG   9  
ATOM 8976  C CD   . GLU A 1 21 ? 10.065  -6.968  -6.308  1.00 0.00 ? 21 GLU A CD   9  
ATOM 8977  O OE1  . GLU A 1 21 ? 10.195  -6.527  -5.146  1.00 0.00 ? 21 GLU A OE1  9  
ATOM 8978  O OE2  . GLU A 1 21 ? 10.867  -7.771  -6.828  1.00 0.00 ? 21 GLU A OE2  9  
ATOM 8979  H H    . GLU A 1 21 ? 8.055   -4.394  -5.762  1.00 0.00 ? 21 GLU A H    9  
ATOM 8980  H HA   . GLU A 1 21 ? 8.319   -3.294  -8.300  1.00 0.00 ? 21 GLU A HA   9  
ATOM 8981  H HB2  . GLU A 1 21 ? 9.384   -5.475  -8.913  1.00 0.00 ? 21 GLU A HB2  9  
ATOM 8982  H HB3  . GLU A 1 21 ? 10.023  -4.745  -7.447  1.00 0.00 ? 21 GLU A HB3  9  
ATOM 8983  H HG2  . GLU A 1 21 ? 8.044   -6.337  -6.460  1.00 0.00 ? 21 GLU A HG2  9  
ATOM 8984  H HG3  . GLU A 1 21 ? 8.623   -7.278  -7.834  1.00 0.00 ? 21 GLU A HG3  9  
ATOM 8985  N N    . TYR A 1 22 ? 6.060   -5.676  -8.110  1.00 0.00 ? 22 TYR A N    9  
ATOM 8986  C CA   . TYR A 1 22 ? 4.916   -6.267  -8.795  1.00 0.00 ? 22 TYR A CA   9  
ATOM 8987  C C    . TYR A 1 22 ? 3.769   -5.269  -8.886  1.00 0.00 ? 22 TYR A C    9  
ATOM 8988  O O    . TYR A 1 22 ? 3.017   -5.256  -9.860  1.00 0.00 ? 22 TYR A O    9  
ATOM 8989  C CB   . TYR A 1 22 ? 4.453   -7.529  -8.064  1.00 0.00 ? 22 TYR A CB   9  
ATOM 8990  C CG   . TYR A 1 22 ? 5.542   -8.562  -7.882  1.00 0.00 ? 22 TYR A CG   9  
ATOM 8991  C CD1  . TYR A 1 22 ? 6.469   -8.447  -6.854  1.00 0.00 ? 22 TYR A CD1  9  
ATOM 8992  C CD2  . TYR A 1 22 ? 5.642   -9.652  -8.737  1.00 0.00 ? 22 TYR A CD2  9  
ATOM 8993  C CE1  . TYR A 1 22 ? 7.466   -9.390  -6.683  1.00 0.00 ? 22 TYR A CE1  9  
ATOM 8994  C CE2  . TYR A 1 22 ? 6.636   -10.599 -8.574  1.00 0.00 ? 22 TYR A CE2  9  
ATOM 8995  C CZ   . TYR A 1 22 ? 7.545   -10.463 -7.545  1.00 0.00 ? 22 TYR A CZ   9  
ATOM 8996  O OH   . TYR A 1 22 ? 8.536   -11.403 -7.379  1.00 0.00 ? 22 TYR A OH   9  
ATOM 8997  H H    . TYR A 1 22 ? 6.253   -5.938  -7.185  1.00 0.00 ? 22 TYR A H    9  
ATOM 8998  H HA   . TYR A 1 22 ? 5.228   -6.532  -9.794  1.00 0.00 ? 22 TYR A HA   9  
ATOM 8999  H HB2  . TYR A 1 22 ? 4.088   -7.256  -7.084  1.00 0.00 ? 22 TYR A HB2  9  
ATOM 9000  H HB3  . TYR A 1 22 ? 3.652   -7.988  -8.624  1.00 0.00 ? 22 TYR A HB3  9  
ATOM 9001  H HD1  . TYR A 1 22 ? 6.405   -7.606  -6.179  1.00 0.00 ? 22 TYR A HD1  9  
ATOM 9002  H HD2  . TYR A 1 22 ? 4.929   -9.755  -9.541  1.00 0.00 ? 22 TYR A HD2  9  
ATOM 9003  H HE1  . TYR A 1 22 ? 8.178   -9.282  -5.879  1.00 0.00 ? 22 TYR A HE1  9  
ATOM 9004  H HE2  . TYR A 1 22 ? 6.697   -11.438 -9.249  1.00 0.00 ? 22 TYR A HE2  9  
ATOM 9005  H HH   . TYR A 1 22 ? 8.735   -11.496 -6.445  1.00 0.00 ? 22 TYR A HH   9  
ATOM 9006  N N    . PHE A 1 23 ? 3.649   -4.429  -7.864  1.00 0.00 ? 23 PHE A N    9  
ATOM 9007  C CA   . PHE A 1 23 ? 2.601   -3.419  -7.820  1.00 0.00 ? 23 PHE A CA   9  
ATOM 9008  C C    . PHE A 1 23 ? 2.908   -2.275  -8.782  1.00 0.00 ? 23 PHE A C    9  
ATOM 9009  O O    . PHE A 1 23 ? 2.071   -1.896  -9.602  1.00 0.00 ? 23 PHE A O    9  
ATOM 9010  C CB   . PHE A 1 23 ? 2.455   -2.878  -6.396  1.00 0.00 ? 23 PHE A CB   9  
ATOM 9011  C CG   . PHE A 1 23 ? 1.455   -3.629  -5.565  1.00 0.00 ? 23 PHE A CG   9  
ATOM 9012  C CD1  . PHE A 1 23 ? 0.101   -3.540  -5.838  1.00 0.00 ? 23 PHE A CD1  9  
ATOM 9013  C CD2  . PHE A 1 23 ? 1.872   -4.418  -4.505  1.00 0.00 ? 23 PHE A CD2  9  
ATOM 9014  C CE1  . PHE A 1 23 ? -0.822  -4.229  -5.073  1.00 0.00 ? 23 PHE A CE1  9  
ATOM 9015  C CE2  . PHE A 1 23 ? 0.954   -5.110  -3.737  1.00 0.00 ? 23 PHE A CE2  9  
ATOM 9016  C CZ   . PHE A 1 23 ? -0.394  -5.015  -4.021  1.00 0.00 ? 23 PHE A CZ   9  
ATOM 9017  H H    . PHE A 1 23 ? 4.281   -4.491  -7.119  1.00 0.00 ? 23 PHE A H    9  
ATOM 9018  H HA   . PHE A 1 23 ? 1.674   -3.886  -8.118  1.00 0.00 ? 23 PHE A HA   9  
ATOM 9019  H HB2  . PHE A 1 23 ? 3.411   -2.934  -5.898  1.00 0.00 ? 23 PHE A HB2  9  
ATOM 9020  H HB3  . PHE A 1 23 ? 2.140   -1.848  -6.442  1.00 0.00 ? 23 PHE A HB3  9  
ATOM 9021  H HD1  . PHE A 1 23 ? -0.234  -2.927  -6.661  1.00 0.00 ? 23 PHE A HD1  9  
ATOM 9022  H HD2  . PHE A 1 23 ? 2.925   -4.494  -4.281  1.00 0.00 ? 23 PHE A HD2  9  
ATOM 9023  H HE1  . PHE A 1 23 ? -1.875  -4.153  -5.299  1.00 0.00 ? 23 PHE A HE1  9  
ATOM 9024  H HE2  . PHE A 1 23 ? 1.291   -5.724  -2.913  1.00 0.00 ? 23 PHE A HE2  9  
ATOM 9025  H HZ   . PHE A 1 23 ? -1.113  -5.554  -3.422  1.00 0.00 ? 23 PHE A HZ   9  
ATOM 9026  N N    . THR A 1 24 ? 4.117   -1.732  -8.677  1.00 0.00 ? 24 THR A N    9  
ATOM 9027  C CA   . THR A 1 24 ? 4.541   -0.628  -9.533  1.00 0.00 ? 24 THR A CA   9  
ATOM 9028  C C    . THR A 1 24 ? 4.247   -0.920  -11.002 1.00 0.00 ? 24 THR A C    9  
ATOM 9029  O O    . THR A 1 24 ? 3.933   -0.015  -11.774 1.00 0.00 ? 24 THR A O    9  
ATOM 9030  C CB   . THR A 1 24 ? 6.037   -0.363  -9.350  1.00 0.00 ? 24 THR A CB   9  
ATOM 9031  O OG1  . THR A 1 24 ? 6.789   -1.532  -9.625  1.00 0.00 ? 24 THR A OG1  9  
ATOM 9032  C CG2  . THR A 1 24 ? 6.398   0.101   -7.957  1.00 0.00 ? 24 THR A CG2  9  
ATOM 9033  H H    . THR A 1 24 ? 4.738   -2.076  -8.000  1.00 0.00 ? 24 THR A H    9  
ATOM 9034  H HA   . THR A 1 24 ? 3.991   0.251   -9.236  1.00 0.00 ? 24 THR A HA   9  
ATOM 9035  H HB   . THR A 1 24 ? 6.342   0.408   -10.042 1.00 0.00 ? 24 THR A HB   9  
ATOM 9036  H HG1  . THR A 1 24 ? 7.189   -1.459  -10.494 1.00 0.00 ? 24 THR A HG1  9  
ATOM 9037  H HG21 . THR A 1 24 ? 7.172   -0.536  -7.555  1.00 0.00 ? 24 THR A HG21 9  
ATOM 9038  H HG22 . THR A 1 24 ? 5.524   0.049   -7.323  1.00 0.00 ? 24 THR A HG22 9  
ATOM 9039  H HG23 . THR A 1 24 ? 6.753   1.120   -7.997  1.00 0.00 ? 24 THR A HG23 9  
ATOM 9040  N N    . SER A 1 25 ? 4.361   -2.188  -11.382 1.00 0.00 ? 25 SER A N    9  
ATOM 9041  C CA   . SER A 1 25 ? 4.131   -2.601  -12.762 1.00 0.00 ? 25 SER A CA   9  
ATOM 9042  C C    . SER A 1 25 ? 2.833   -2.016  -13.314 1.00 0.00 ? 25 SER A C    9  
ATOM 9043  O O    . SER A 1 25 ? 2.691   -1.834  -14.522 1.00 0.00 ? 25 SER A O    9  
ATOM 9044  C CB   . SER A 1 25 ? 4.089   -4.127  -12.853 1.00 0.00 ? 25 SER A CB   9  
ATOM 9045  O OG   . SER A 1 25 ? 5.037   -4.716  -11.980 1.00 0.00 ? 25 SER A OG   9  
ATOM 9046  H H    . SER A 1 25 ? 4.624   -2.861  -10.720 1.00 0.00 ? 25 SER A H    9  
ATOM 9047  H HA   . SER A 1 25 ? 4.955   -2.236  -13.356 1.00 0.00 ? 25 SER A HA   9  
ATOM 9048  H HB2  . SER A 1 25 ? 3.103   -4.475  -12.581 1.00 0.00 ? 25 SER A HB2  9  
ATOM 9049  H HB3  . SER A 1 25 ? 4.312   -4.432  -13.866 1.00 0.00 ? 25 SER A HB3  9  
ATOM 9050  H HG   . SER A 1 25 ? 5.087   -5.660  -12.151 1.00 0.00 ? 25 SER A HG   9  
ATOM 9051  N N    . GLN A 1 26 ? 1.886   -1.731  -12.426 1.00 0.00 ? 26 GLN A N    9  
ATOM 9052  C CA   . GLN A 1 26 ? 0.594   -1.187  -12.837 1.00 0.00 ? 26 GLN A CA   9  
ATOM 9053  C C    . GLN A 1 26 ? 0.530   0.318   -12.598 1.00 0.00 ? 26 GLN A C    9  
ATOM 9054  O O    . GLN A 1 26 ? -0.171  1.040   -13.308 1.00 0.00 ? 26 GLN A O    9  
ATOM 9055  C CB   . GLN A 1 26 ? -0.546  -1.876  -12.080 1.00 0.00 ? 26 GLN A CB   9  
ATOM 9056  C CG   . GLN A 1 26 ? -0.247  -3.315  -11.690 1.00 0.00 ? 26 GLN A CG   9  
ATOM 9057  C CD   . GLN A 1 26 ? -0.354  -4.273  -12.861 1.00 0.00 ? 26 GLN A CD   9  
ATOM 9058  O OE1  . GLN A 1 26 ? -0.878  -3.922  -13.918 1.00 0.00 ? 26 GLN A OE1  9  
ATOM 9059  N NE2  . GLN A 1 26 ? 0.145   -5.489  -12.677 1.00 0.00 ? 26 GLN A NE2  9  
ATOM 9060  H H    . GLN A 1 26 ? 2.051   -1.907  -11.476 1.00 0.00 ? 26 GLN A H    9  
ATOM 9061  H HA   . GLN A 1 26 ? 0.479   -1.375  -13.894 1.00 0.00 ? 26 GLN A HA   9  
ATOM 9062  H HB2  . GLN A 1 26 ? -0.752  -1.317  -11.180 1.00 0.00 ? 26 GLN A HB2  9  
ATOM 9063  H HB3  . GLN A 1 26 ? -1.428  -1.873  -12.704 1.00 0.00 ? 26 GLN A HB3  9  
ATOM 9064  H HG2  . GLN A 1 26 ? 0.756   -3.366  -11.292 1.00 0.00 ? 26 GLN A HG2  9  
ATOM 9065  H HG3  . GLN A 1 26 ? -0.950  -3.621  -10.929 1.00 0.00 ? 26 GLN A HG3  9  
ATOM 9066  H HE21 . GLN A 1 26 ? 0.549   -5.698  -11.808 1.00 0.00 ? 26 GLN A HE21 9  
ATOM 9067  H HE22 . GLN A 1 26 ? 0.090   -6.129  -13.418 1.00 0.00 ? 26 GLN A HE22 9  
ATOM 9068  N N    . GLY A 1 27 ? 1.257   0.783   -11.589 1.00 0.00 ? 27 GLY A N    9  
ATOM 9069  C CA   . GLY A 1 27 ? 1.255   2.196   -11.259 1.00 0.00 ? 27 GLY A CA   9  
ATOM 9070  C C    . GLY A 1 27 ? 0.949   2.439   -9.795  1.00 0.00 ? 27 GLY A C    9  
ATOM 9071  O O    . GLY A 1 27 ? 0.151   3.312   -9.455  1.00 0.00 ? 27 GLY A O    9  
ATOM 9072  H H    . GLY A 1 27 ? 1.789   0.158   -11.053 1.00 0.00 ? 27 GLY A H    9  
ATOM 9073  H HA2  . GLY A 1 27 ? 2.227   2.610   -11.484 1.00 0.00 ? 27 GLY A HA2  9  
ATOM 9074  H HA3  . GLY A 1 27 ? 0.511   2.697   -11.860 1.00 0.00 ? 27 GLY A HA3  9  
ATOM 9075  N N    . LEU A 1 28 ? 1.596   1.667   -8.930  1.00 0.00 ? 28 LEU A N    9  
ATOM 9076  C CA   . LEU A 1 28 ? 1.386   1.782   -7.493  1.00 0.00 ? 28 LEU A CA   9  
ATOM 9077  C C    . LEU A 1 28 ? 2.490   2.610   -6.844  1.00 0.00 ? 28 LEU A C    9  
ATOM 9078  O O    . LEU A 1 28 ? 2.953   2.297   -5.747  1.00 0.00 ? 28 LEU A O    9  
ATOM 9079  C CB   . LEU A 1 28 ? 1.330   0.391   -6.857  1.00 0.00 ? 28 LEU A CB   9  
ATOM 9080  C CG   . LEU A 1 28 ? 0.006   0.041   -6.177  1.00 0.00 ? 28 LEU A CG   9  
ATOM 9081  C CD1  . LEU A 1 28 ? -0.147  0.816   -4.879  1.00 0.00 ? 28 LEU A CD1  9  
ATOM 9082  C CD2  . LEU A 1 28 ? -1.162  0.322   -7.109  1.00 0.00 ? 28 LEU A CD2  9  
ATOM 9083  H H    . LEU A 1 28 ? 2.211   0.984   -9.268  1.00 0.00 ? 28 LEU A H    9  
ATOM 9084  H HA   . LEU A 1 28 ? 0.440   2.279   -7.336  1.00 0.00 ? 28 LEU A HA   9  
ATOM 9085  H HB2  . LEU A 1 28 ? 1.519   -0.341  -7.627  1.00 0.00 ? 28 LEU A HB2  9  
ATOM 9086  H HB3  . LEU A 1 28 ? 2.116   0.322   -6.120  1.00 0.00 ? 28 LEU A HB3  9  
ATOM 9087  H HG   . LEU A 1 28 ? -0.003  -1.013  -5.940  1.00 0.00 ? 28 LEU A HG   9  
ATOM 9088  H HD11 . LEU A 1 28 ? 0.493   1.687   -4.902  1.00 0.00 ? 28 LEU A HD11 9  
ATOM 9089  H HD12 . LEU A 1 28 ? 0.134   0.187   -4.047  1.00 0.00 ? 28 LEU A HD12 9  
ATOM 9090  H HD13 . LEU A 1 28 ? -1.174  1.127   -4.765  1.00 0.00 ? 28 LEU A HD13 9  
ATOM 9091  H HD21 . LEU A 1 28 ? -0.874  0.100   -8.126  1.00 0.00 ? 28 LEU A HD21 9  
ATOM 9092  H HD22 . LEU A 1 28 ? -1.441  1.362   -7.033  1.00 0.00 ? 28 LEU A HD22 9  
ATOM 9093  H HD23 . LEU A 1 28 ? -2.003  -0.298  -6.831  1.00 0.00 ? 28 LEU A HD23 9  
ATOM 9094  N N    . GLN A 1 29 ? 2.893   3.678   -7.521  1.00 0.00 ? 29 GLN A N    9  
ATOM 9095  C CA   . GLN A 1 29 ? 3.921   4.570   -7.000  1.00 0.00 ? 29 GLN A CA   9  
ATOM 9096  C C    . GLN A 1 29 ? 3.270   5.796   -6.372  1.00 0.00 ? 29 GLN A C    9  
ATOM 9097  O O    . GLN A 1 29 ? 3.787   6.370   -5.413  1.00 0.00 ? 29 GLN A O    9  
ATOM 9098  C CB   . GLN A 1 29 ? 4.888   4.994   -8.110  1.00 0.00 ? 29 GLN A CB   9  
ATOM 9099  C CG   . GLN A 1 29 ? 5.057   3.955   -9.209  1.00 0.00 ? 29 GLN A CG   9  
ATOM 9100  C CD   . GLN A 1 29 ? 6.243   4.242   -10.108 1.00 0.00 ? 29 GLN A CD   9  
ATOM 9101  O OE1  . GLN A 1 29 ? 6.086   4.493   -11.303 1.00 0.00 ? 29 GLN A OE1  9  
ATOM 9102  N NE2  . GLN A 1 29 ? 7.441   4.202   -9.536  1.00 0.00 ? 29 GLN A NE2  9  
ATOM 9103  H H    . GLN A 1 29 ? 2.475   3.883   -8.384  1.00 0.00 ? 29 GLN A H    9  
ATOM 9104  H HA   . GLN A 1 29 ? 4.470   4.037   -6.238  1.00 0.00 ? 29 GLN A HA   9  
ATOM 9105  H HB2  . GLN A 1 29 ? 4.524   5.906   -8.559  1.00 0.00 ? 29 GLN A HB2  9  
ATOM 9106  H HB3  . GLN A 1 29 ? 5.858   5.180   -7.672  1.00 0.00 ? 29 GLN A HB3  9  
ATOM 9107  H HG2  . GLN A 1 29 ? 5.196   2.987   -8.752  1.00 0.00 ? 29 GLN A HG2  9  
ATOM 9108  H HG3  . GLN A 1 29 ? 4.162   3.941   -9.814  1.00 0.00 ? 29 GLN A HG3  9  
ATOM 9109  H HE21 . GLN A 1 29 ? 7.491   3.995   -8.580  1.00 0.00 ? 29 GLN A HE21 9  
ATOM 9110  H HE22 . GLN A 1 29 ? 8.226   4.384   -10.095 1.00 0.00 ? 29 GLN A HE22 9  
ATOM 9111  N N    . SER A 1 30 ? 2.110   6.168   -6.904  1.00 0.00 ? 30 SER A N    9  
ATOM 9112  C CA   . SER A 1 30 ? 1.343   7.287   -6.375  1.00 0.00 ? 30 SER A CA   9  
ATOM 9113  C C    . SER A 1 30 ? 0.114   6.772   -5.641  1.00 0.00 ? 30 SER A C    9  
ATOM 9114  O O    . SER A 1 30 ? -0.813  6.260   -6.261  1.00 0.00 ? 30 SER A O    9  
ATOM 9115  C CB   . SER A 1 30 ? 0.922   8.229   -7.504  1.00 0.00 ? 30 SER A CB   9  
ATOM 9116  O OG   . SER A 1 30 ? 1.827   8.157   -8.593  1.00 0.00 ? 30 SER A OG   9  
ATOM 9117  H H    . SER A 1 30 ? 1.743   5.649   -7.652  1.00 0.00 ? 30 SER A H    9  
ATOM 9118  H HA   . SER A 1 30 ? 1.966   7.823   -5.679  1.00 0.00 ? 30 SER A HA   9  
ATOM 9119  H HB2  . SER A 1 30 ? -0.062  7.954   -7.852  1.00 0.00 ? 30 SER A HB2  9  
ATOM 9120  H HB3  . SER A 1 30 ? 0.904   9.244   -7.136  1.00 0.00 ? 30 SER A HB3  9  
ATOM 9121  H HG   . SER A 1 30 ? 1.703   7.326   -9.059  1.00 0.00 ? 30 SER A HG   9  
ATOM 9122  N N    . ILE A 1 31 ? 0.123   6.890   -4.314  1.00 0.00 ? 31 ILE A N    9  
ATOM 9123  C CA   . ILE A 1 31 ? -0.978  6.391   -3.490  1.00 0.00 ? 31 ILE A CA   9  
ATOM 9124  C C    . ILE A 1 31 ? -2.342  6.744   -4.095  1.00 0.00 ? 31 ILE A C    9  
ATOM 9125  O O    . ILE A 1 31 ? -3.324  6.030   -3.897  1.00 0.00 ? 31 ILE A O    9  
ATOM 9126  C CB   . ILE A 1 31 ? -0.880  6.908   -2.033  1.00 0.00 ? 31 ILE A CB   9  
ATOM 9127  C CG1  . ILE A 1 31 ? -1.614  5.951   -1.092  1.00 0.00 ? 31 ILE A CG1  9  
ATOM 9128  C CG2  . ILE A 1 31 ? -1.432  8.322   -1.896  1.00 0.00 ? 31 ILE A CG2  9  
ATOM 9129  C CD1  . ILE A 1 31 ? -0.684  5.061   -0.296  1.00 0.00 ? 31 ILE A CD1  9  
ATOM 9130  H H    . ILE A 1 31 ? 0.902   7.291   -3.877  1.00 0.00 ? 31 ILE A H    9  
ATOM 9131  H HA   . ILE A 1 31 ? -0.891  5.318   -3.457  1.00 0.00 ? 31 ILE A HA   9  
ATOM 9132  H HB   . ILE A 1 31 ? 0.164   6.934   -1.761  1.00 0.00 ? 31 ILE A HB   9  
ATOM 9133  H HG12 . ILE A 1 31 ? -2.204  6.524   -0.393  1.00 0.00 ? 31 ILE A HG12 9  
ATOM 9134  H HG13 . ILE A 1 31 ? -2.265  5.314   -1.672  1.00 0.00 ? 31 ILE A HG13 9  
ATOM 9135  H HG21 . ILE A 1 31 ? -0.872  8.990   -2.532  1.00 0.00 ? 31 ILE A HG21 9  
ATOM 9136  H HG22 . ILE A 1 31 ? -1.348  8.644   -0.869  1.00 0.00 ? 31 ILE A HG22 9  
ATOM 9137  H HG23 . ILE A 1 31 ? -2.471  8.328   -2.192  1.00 0.00 ? 31 ILE A HG23 9  
ATOM 9138  H HD11 . ILE A 1 31 ? 0.148   5.645   0.070   1.00 0.00 ? 31 ILE A HD11 9  
ATOM 9139  H HD12 . ILE A 1 31 ? -0.316  4.267   -0.929  1.00 0.00 ? 31 ILE A HD12 9  
ATOM 9140  H HD13 . ILE A 1 31 ? -1.218  4.634   0.540   1.00 0.00 ? 31 ILE A HD13 9  
ATOM 9141  N N    . TYR A 1 32 ? -2.391  7.846   -4.833  1.00 0.00 ? 32 TYR A N    9  
ATOM 9142  C CA   . TYR A 1 32 ? -3.627  8.275   -5.474  1.00 0.00 ? 32 TYR A CA   9  
ATOM 9143  C C    . TYR A 1 32 ? -4.145  7.199   -6.426  1.00 0.00 ? 32 TYR A C    9  
ATOM 9144  O O    . TYR A 1 32 ? -5.338  7.142   -6.723  1.00 0.00 ? 32 TYR A O    9  
ATOM 9145  C CB   . TYR A 1 32 ? -3.402  9.580   -6.239  1.00 0.00 ? 32 TYR A CB   9  
ATOM 9146  C CG   . TYR A 1 32 ? -3.655  10.820  -5.412  1.00 0.00 ? 32 TYR A CG   9  
ATOM 9147  C CD1  . TYR A 1 32 ? -4.945  11.171  -5.034  1.00 0.00 ? 32 TYR A CD1  9  
ATOM 9148  C CD2  . TYR A 1 32 ? -2.606  11.637  -5.012  1.00 0.00 ? 32 TYR A CD2  9  
ATOM 9149  C CE1  . TYR A 1 32 ? -5.181  12.305  -4.278  1.00 0.00 ? 32 TYR A CE1  9  
ATOM 9150  C CE2  . TYR A 1 32 ? -2.835  12.772  -4.257  1.00 0.00 ? 32 TYR A CE2  9  
ATOM 9151  C CZ   . TYR A 1 32 ? -4.123  13.100  -3.893  1.00 0.00 ? 32 TYR A CZ   9  
ATOM 9152  O OH   . TYR A 1 32 ? -4.356  14.230  -3.141  1.00 0.00 ? 32 TYR A OH   9  
ATOM 9153  H H    . TYR A 1 32 ? -1.576  8.376   -4.961  1.00 0.00 ? 32 TYR A H    9  
ATOM 9154  H HA   . TYR A 1 32 ? -4.363  8.440   -4.701  1.00 0.00 ? 32 TYR A HA   9  
ATOM 9155  H HB2  . TYR A 1 32 ? -2.378  9.614   -6.582  1.00 0.00 ? 32 TYR A HB2  9  
ATOM 9156  H HB3  . TYR A 1 32 ? -4.063  9.607   -7.092  1.00 0.00 ? 32 TYR A HB3  9  
ATOM 9157  H HD1  . TYR A 1 32 ? -5.771  10.546  -5.337  1.00 0.00 ? 32 TYR A HD1  9  
ATOM 9158  H HD2  . TYR A 1 32 ? -1.599  11.377  -5.299  1.00 0.00 ? 32 TYR A HD2  9  
ATOM 9159  H HE1  . TYR A 1 32 ? -6.191  12.562  -3.995  1.00 0.00 ? 32 TYR A HE1  9  
ATOM 9160  H HE2  . TYR A 1 32 ? -2.006  13.395  -3.955  1.00 0.00 ? 32 TYR A HE2  9  
ATOM 9161  H HH   . TYR A 1 32 ? -4.396  14.996  -3.718  1.00 0.00 ? 32 TYR A HH   9  
ATOM 9162  N N    . HIS A 1 33 ? -3.239  6.347   -6.897  1.00 0.00 ? 33 HIS A N    9  
ATOM 9163  C CA   . HIS A 1 33 ? -3.600  5.279   -7.825  1.00 0.00 ? 33 HIS A CA   9  
ATOM 9164  C C    . HIS A 1 33 ? -4.213  4.080   -7.098  1.00 0.00 ? 33 HIS A C    9  
ATOM 9165  O O    . HIS A 1 33 ? -4.810  3.207   -7.728  1.00 0.00 ? 33 HIS A O    9  
ATOM 9166  C CB   . HIS A 1 33 ? -2.369  4.832   -8.616  1.00 0.00 ? 33 HIS A CB   9  
ATOM 9167  C CG   . HIS A 1 33 ? -2.689  4.325   -9.989  1.00 0.00 ? 33 HIS A CG   9  
ATOM 9168  N ND1  . HIS A 1 33 ? -3.019  5.157   -11.040 1.00 0.00 ? 33 HIS A ND1  9  
ATOM 9169  C CD2  . HIS A 1 33 ? -2.726  3.065   -10.484 1.00 0.00 ? 33 HIS A CD2  9  
ATOM 9170  C CE1  . HIS A 1 33 ? -3.247  4.430   -12.120 1.00 0.00 ? 33 HIS A CE1  9  
ATOM 9171  N NE2  . HIS A 1 33 ? -3.075  3.158   -11.808 1.00 0.00 ? 33 HIS A NE2  9  
ATOM 9172  H H    . HIS A 1 33 ? -2.298  6.448   -6.629  1.00 0.00 ? 33 HIS A H    9  
ATOM 9173  H HA   . HIS A 1 33 ? -4.333  5.676   -8.513  1.00 0.00 ? 33 HIS A HA   9  
ATOM 9174  H HB2  . HIS A 1 33 ? -1.693  5.667   -8.719  1.00 0.00 ? 33 HIS A HB2  9  
ATOM 9175  H HB3  . HIS A 1 33 ? -1.873  4.038   -8.076  1.00 0.00 ? 33 HIS A HB3  9  
ATOM 9176  H HD1  . HIS A 1 33 ? -3.079  6.134   -11.000 1.00 0.00 ? 33 HIS A HD1  9  
ATOM 9177  H HD2  . HIS A 1 33 ? -2.519  2.156   -9.936  1.00 0.00 ? 33 HIS A HD2  9  
ATOM 9178  H HE1  . HIS A 1 33 ? -3.525  4.809   -13.091 1.00 0.00 ? 33 HIS A HE1  9  
ATOM 9179  H HE2  . HIS A 1 33 ? -3.180  2.405   -12.425 1.00 0.00 ? 33 HIS A HE2  9  
ATOM 9180  N N    . LEU A 1 34 ? -4.059  4.035   -5.777  1.00 0.00 ? 34 LEU A N    9  
ATOM 9181  C CA   . LEU A 1 34 ? -4.599  2.934   -4.984  1.00 0.00 ? 34 LEU A CA   9  
ATOM 9182  C C    . LEU A 1 34 ? -5.685  3.410   -4.021  1.00 0.00 ? 34 LEU A C    9  
ATOM 9183  O O    . LEU A 1 34 ? -6.271  2.608   -3.295  1.00 0.00 ? 34 LEU A O    9  
ATOM 9184  C CB   . LEU A 1 34 ? -3.484  2.241   -4.194  1.00 0.00 ? 34 LEU A CB   9  
ATOM 9185  C CG   . LEU A 1 34 ? -2.315  3.139   -3.764  1.00 0.00 ? 34 LEU A CG   9  
ATOM 9186  C CD1  . LEU A 1 34 ? -1.453  2.435   -2.729  1.00 0.00 ? 34 LEU A CD1  9  
ATOM 9187  C CD2  . LEU A 1 34 ? -1.473  3.531   -4.969  1.00 0.00 ? 34 LEU A CD2  9  
ATOM 9188  H H    . LEU A 1 34 ? -3.575  4.755   -5.324  1.00 0.00 ? 34 LEU A H    9  
ATOM 9189  H HA   . LEU A 1 34 ? -5.035  2.222   -5.669  1.00 0.00 ? 34 LEU A HA   9  
ATOM 9190  H HB2  . LEU A 1 34 ? -3.920  1.808   -3.307  1.00 0.00 ? 34 LEU A HB2  9  
ATOM 9191  H HB3  . LEU A 1 34 ? -3.091  1.443   -4.804  1.00 0.00 ? 34 LEU A HB3  9  
ATOM 9192  H HG   . LEU A 1 34 ? -2.703  4.042   -3.310  1.00 0.00 ? 34 LEU A HG   9  
ATOM 9193  H HD11 . LEU A 1 34 ? -1.581  2.912   -1.770  1.00 0.00 ? 34 LEU A HD11 9  
ATOM 9194  H HD12 . LEU A 1 34 ? -0.416  2.495   -3.026  1.00 0.00 ? 34 LEU A HD12 9  
ATOM 9195  H HD13 . LEU A 1 34 ? -1.748  1.399   -2.660  1.00 0.00 ? 34 LEU A HD13 9  
ATOM 9196  H HD21 . LEU A 1 34 ? -0.428  3.392   -4.738  1.00 0.00 ? 34 LEU A HD21 9  
ATOM 9197  H HD22 . LEU A 1 34 ? -1.653  4.565   -5.210  1.00 0.00 ? 34 LEU A HD22 9  
ATOM 9198  H HD23 . LEU A 1 34 ? -1.741  2.912   -5.813  1.00 0.00 ? 34 LEU A HD23 9  
ATOM 9199  N N    . GLN A 1 35 ? -5.954  4.711   -4.016  1.00 0.00 ? 35 GLN A N    9  
ATOM 9200  C CA   . GLN A 1 35 ? -6.958  5.276   -3.126  1.00 0.00 ? 35 GLN A CA   9  
ATOM 9201  C C    . GLN A 1 35 ? -8.272  4.505   -3.204  1.00 0.00 ? 35 GLN A C    9  
ATOM 9202  O O    . GLN A 1 35 ? -8.975  4.361   -2.203  1.00 0.00 ? 35 GLN A O    9  
ATOM 9203  C CB   . GLN A 1 35 ? -7.199  6.746   -3.470  1.00 0.00 ? 35 GLN A CB   9  
ATOM 9204  C CG   . GLN A 1 35 ? -7.696  7.566   -2.294  1.00 0.00 ? 35 GLN A CG   9  
ATOM 9205  C CD   . GLN A 1 35 ? -6.878  8.822   -2.070  1.00 0.00 ? 35 GLN A CD   9  
ATOM 9206  O OE1  . GLN A 1 35 ? -6.569  9.552   -3.012  1.00 0.00 ? 35 GLN A OE1  9  
ATOM 9207  N NE2  . GLN A 1 35 ? -6.521  9.082   -0.817  1.00 0.00 ? 35 GLN A NE2  9  
ATOM 9208  H H    . GLN A 1 35 ? -5.454  5.309   -4.606  1.00 0.00 ? 35 GLN A H    9  
ATOM 9209  H HA   . GLN A 1 35 ? -6.577  5.210   -2.119  1.00 0.00 ? 35 GLN A HA   9  
ATOM 9210  H HB2  . GLN A 1 35 ? -6.274  7.179   -3.819  1.00 0.00 ? 35 GLN A HB2  9  
ATOM 9211  H HB3  . GLN A 1 35 ? -7.934  6.803   -4.259  1.00 0.00 ? 35 GLN A HB3  9  
ATOM 9212  H HG2  . GLN A 1 35 ? -8.722  7.849   -2.477  1.00 0.00 ? 35 GLN A HG2  9  
ATOM 9213  H HG3  . GLN A 1 35 ? -7.645  6.957   -1.402  1.00 0.00 ? 35 GLN A HG3  9  
ATOM 9214  H HE21 . GLN A 1 35 ? -6.803  8.457   -0.117  1.00 0.00 ? 35 GLN A HE21 9  
ATOM 9215  H HE22 . GLN A 1 35 ? -5.992  9.888   -0.644  1.00 0.00 ? 35 GLN A HE22 9  
ATOM 9216  N N    . ASN A 1 36 ? -8.606  4.022   -4.395  1.00 0.00 ? 36 ASN A N    9  
ATOM 9217  C CA   . ASN A 1 36 ? -9.852  3.291   -4.596  1.00 0.00 ? 36 ASN A CA   9  
ATOM 9218  C C    . ASN A 1 36 ? -9.608  1.800   -4.821  1.00 0.00 ? 36 ASN A C    9  
ATOM 9219  O O    . ASN A 1 36 ? -10.498 1.083   -5.278  1.00 0.00 ? 36 ASN A O    9  
ATOM 9220  C CB   . ASN A 1 36 ? -10.616 3.874   -5.786  1.00 0.00 ? 36 ASN A CB   9  
ATOM 9221  C CG   . ASN A 1 36 ? -11.708 4.832   -5.359  1.00 0.00 ? 36 ASN A CG   9  
ATOM 9222  O OD1  . ASN A 1 36 ? -12.784 4.416   -4.929  1.00 0.00 ? 36 ASN A OD1  9  
ATOM 9223  N ND2  . ASN A 1 36 ? -11.435 6.126   -5.479  1.00 0.00 ? 36 ASN A ND2  9  
ATOM 9224  H H    . ASN A 1 36 ? -8.014  4.181   -5.158  1.00 0.00 ? 36 ASN A H    9  
ATOM 9225  H HA   . ASN A 1 36 ? -10.450 3.412   -3.705  1.00 0.00 ? 36 ASN A HA   9  
ATOM 9226  H HB2  . ASN A 1 36 ? -9.928  4.409   -6.422  1.00 0.00 ? 36 ASN A HB2  9  
ATOM 9227  H HB3  . ASN A 1 36 ? -11.068 3.069   -6.347  1.00 0.00 ? 36 ASN A HB3  9  
ATOM 9228  H HD21 . ASN A 1 36 ? -10.557 6.382   -5.830  1.00 0.00 ? 36 ASN A HD21 9  
ATOM 9229  H HD22 . ASN A 1 36 ? -12.120 6.769   -5.212  1.00 0.00 ? 36 ASN A HD22 9  
ATOM 9230  N N    . LEU A 1 37 ? -8.407  1.330   -4.492  1.00 0.00 ? 37 LEU A N    9  
ATOM 9231  C CA   . LEU A 1 37 ? -8.076  -0.081  -4.655  1.00 0.00 ? 37 LEU A CA   9  
ATOM 9232  C C    . LEU A 1 37 ? -8.523  -0.887  -3.437  1.00 0.00 ? 37 LEU A C    9  
ATOM 9233  O O    . LEU A 1 37 ? -8.676  -0.344  -2.343  1.00 0.00 ? 37 LEU A O    9  
ATOM 9234  C CB   . LEU A 1 37 ? -6.573  -0.256  -4.872  1.00 0.00 ? 37 LEU A CB   9  
ATOM 9235  C CG   . LEU A 1 37 ? -6.169  -1.579  -5.525  1.00 0.00 ? 37 LEU A CG   9  
ATOM 9236  C CD1  . LEU A 1 37 ? -6.754  -1.679  -6.924  1.00 0.00 ? 37 LEU A CD1  9  
ATOM 9237  C CD2  . LEU A 1 37 ? -4.655  -1.716  -5.570  1.00 0.00 ? 37 LEU A CD2  9  
ATOM 9238  H H    . LEU A 1 37 ? -7.734  1.939   -4.125  1.00 0.00 ? 37 LEU A H    9  
ATOM 9239  H HA   . LEU A 1 37 ? -8.602  -0.445  -5.524  1.00 0.00 ? 37 LEU A HA   9  
ATOM 9240  H HB2  . LEU A 1 37 ? -6.219  0.554   -5.494  1.00 0.00 ? 37 LEU A HB2  9  
ATOM 9241  H HB3  . LEU A 1 37 ? -6.085  -0.189  -3.914  1.00 0.00 ? 37 LEU A HB3  9  
ATOM 9242  H HG   . LEU A 1 37 ? -6.562  -2.396  -4.940  1.00 0.00 ? 37 LEU A HG   9  
ATOM 9243  H HD11 . LEU A 1 37 ? -7.822  -1.823  -6.857  1.00 0.00 ? 37 LEU A HD11 9  
ATOM 9244  H HD12 . LEU A 1 37 ? -6.310  -2.517  -7.441  1.00 0.00 ? 37 LEU A HD12 9  
ATOM 9245  H HD13 . LEU A 1 37 ? -6.547  -0.769  -7.467  1.00 0.00 ? 37 LEU A HD13 9  
ATOM 9246  H HD21 . LEU A 1 37 ? -4.248  -1.534  -4.587  1.00 0.00 ? 37 LEU A HD21 9  
ATOM 9247  H HD22 . LEU A 1 37 ? -4.248  -1.000  -6.268  1.00 0.00 ? 37 LEU A HD22 9  
ATOM 9248  H HD23 . LEU A 1 37 ? -4.394  -2.716  -5.887  1.00 0.00 ? 37 LEU A HD23 9  
ATOM 9249  N N    . THR A 1 38 ? -8.737  -2.184  -3.637  1.00 0.00 ? 38 THR A N    9  
ATOM 9250  C CA   . THR A 1 38 ? -9.161  -3.068  -2.554  1.00 0.00 ? 38 THR A CA   9  
ATOM 9251  C C    . THR A 1 38 ? -8.462  -4.413  -2.640  1.00 0.00 ? 38 THR A C    9  
ATOM 9252  O O    . THR A 1 38 ? -7.774  -4.709  -3.616  1.00 0.00 ? 38 THR A O    9  
ATOM 9253  C CB   . THR A 1 38 ? -10.674 -3.294  -2.604  1.00 0.00 ? 38 THR A CB   9  
ATOM 9254  O OG1  . THR A 1 38 ? -11.271 -2.484  -3.601  1.00 0.00 ? 38 THR A OG1  9  
ATOM 9255  C CG2  . THR A 1 38 ? -11.362 -2.996  -1.291  1.00 0.00 ? 38 THR A CG2  9  
ATOM 9256  H H    . THR A 1 38 ? -8.596  -2.561  -4.530  1.00 0.00 ? 38 THR A H    9  
ATOM 9257  H HA   . THR A 1 38 ? -8.903  -2.596  -1.616  1.00 0.00 ? 38 THR A HA   9  
ATOM 9258  H HB   . THR A 1 38 ? -10.864 -4.335  -2.847  1.00 0.00 ? 38 THR A HB   9  
ATOM 9259  H HG1  . THR A 1 38 ? -10.860 -2.665  -4.450  1.00 0.00 ? 38 THR A HG1  9  
ATOM 9260  H HG21 . THR A 1 38 ? -11.875 -2.049  -1.359  1.00 0.00 ? 38 THR A HG21 9  
ATOM 9261  H HG22 . THR A 1 38 ? -10.626 -2.950  -0.502  1.00 0.00 ? 38 THR A HG22 9  
ATOM 9262  H HG23 . THR A 1 38 ? -12.075 -3.777  -1.073  1.00 0.00 ? 38 THR A HG23 9  
ATOM 9263  N N    . ILE A 1 39 ? -8.690  -5.248  -1.635  1.00 0.00 ? 39 ILE A N    9  
ATOM 9264  C CA   . ILE A 1 39 ? -8.143  -6.591  -1.634  1.00 0.00 ? 39 ILE A CA   9  
ATOM 9265  C C    . ILE A 1 39 ? -8.613  -7.332  -2.872  1.00 0.00 ? 39 ILE A C    9  
ATOM 9266  O O    . ILE A 1 39 ? -7.877  -8.123  -3.462  1.00 0.00 ? 39 ILE A O    9  
ATOM 9267  C CB   . ILE A 1 39 ? -8.578  -7.375  -0.387  1.00 0.00 ? 39 ILE A CB   9  
ATOM 9268  C CG1  . ILE A 1 39 ? -7.937  -8.764  -0.380  1.00 0.00 ? 39 ILE A CG1  9  
ATOM 9269  C CG2  . ILE A 1 39 ? -10.093 -7.486  -0.331  1.00 0.00 ? 39 ILE A CG2  9  
ATOM 9270  C CD1  . ILE A 1 39 ? -6.440  -8.739  -0.593  1.00 0.00 ? 39 ILE A CD1  9  
ATOM 9271  H H    . ILE A 1 39 ? -9.278  -4.968  -0.902  1.00 0.00 ? 39 ILE A H    9  
ATOM 9272  H HA   . ILE A 1 39 ? -7.068  -6.522  -1.644  1.00 0.00 ? 39 ILE A HA   9  
ATOM 9273  H HB   . ILE A 1 39 ? -8.252  -6.829  0.480   1.00 0.00 ? 39 ILE A HB   9  
ATOM 9274  H HG12 . ILE A 1 39 ? -8.130  -9.237  0.570   1.00 0.00 ? 39 ILE A HG12 9  
ATOM 9275  H HG13 . ILE A 1 39 ? -8.374  -9.357  -1.170  1.00 0.00 ? 39 ILE A HG13 9  
ATOM 9276  H HG21 . ILE A 1 39 ? -10.412 -8.358  -0.883  1.00 0.00 ? 39 ILE A HG21 9  
ATOM 9277  H HG22 . ILE A 1 39 ? -10.535 -6.603  -0.769  1.00 0.00 ? 39 ILE A HG22 9  
ATOM 9278  H HG23 . ILE A 1 39 ? -10.409 -7.575  0.697   1.00 0.00 ? 39 ILE A HG23 9  
ATOM 9279  H HD11 . ILE A 1 39 ? -5.991  -8.025  0.082   1.00 0.00 ? 39 ILE A HD11 9  
ATOM 9280  H HD12 . ILE A 1 39 ? -6.225  -8.455  -1.612  1.00 0.00 ? 39 ILE A HD12 9  
ATOM 9281  H HD13 . ILE A 1 39 ? -6.033  -9.721  -0.399  1.00 0.00 ? 39 ILE A HD13 9  
ATOM 9282  N N    . GLU A 1 40 ? -9.844  -7.041  -3.272  1.00 0.00 ? 40 GLU A N    9  
ATOM 9283  C CA   . GLU A 1 40 ? -10.431 -7.664  -4.446  1.00 0.00 ? 40 GLU A CA   9  
ATOM 9284  C C    . GLU A 1 40 ? -9.587  -7.382  -5.685  1.00 0.00 ? 40 GLU A C    9  
ATOM 9285  O O    . GLU A 1 40 ? -9.413  -8.250  -6.541  1.00 0.00 ? 40 GLU A O    9  
ATOM 9286  C CB   . GLU A 1 40 ? -11.867 -7.177  -4.660  1.00 0.00 ? 40 GLU A CB   9  
ATOM 9287  C CG   . GLU A 1 40 ? -12.033 -5.670  -4.552  1.00 0.00 ? 40 GLU A CG   9  
ATOM 9288  C CD   . GLU A 1 40 ? -12.851 -5.090  -5.689  1.00 0.00 ? 40 GLU A CD   9  
ATOM 9289  O OE1  . GLU A 1 40 ? -12.701 -5.568  -6.833  1.00 0.00 ? 40 GLU A OE1  9  
ATOM 9290  O OE2  . GLU A 1 40 ? -13.641 -4.156  -5.437  1.00 0.00 ? 40 GLU A OE2  9  
ATOM 9291  H H    . GLU A 1 40 ? -10.374 -6.400  -2.751  1.00 0.00 ? 40 GLU A H    9  
ATOM 9292  H HA   . GLU A 1 40 ? -10.448 -8.723  -4.274  1.00 0.00 ? 40 GLU A HA   9  
ATOM 9293  H HB2  . GLU A 1 40 ? -12.195 -7.481  -5.643  1.00 0.00 ? 40 GLU A HB2  9  
ATOM 9294  H HB3  . GLU A 1 40 ? -12.504 -7.639  -3.921  1.00 0.00 ? 40 GLU A HB3  9  
ATOM 9295  H HG2  . GLU A 1 40 ? -12.529 -5.441  -3.620  1.00 0.00 ? 40 GLU A HG2  9  
ATOM 9296  H HG3  . GLU A 1 40 ? -11.058 -5.211  -4.562  1.00 0.00 ? 40 GLU A HG3  9  
ATOM 9297  N N    . ASP A 1 41 ? -9.071  -6.161  -5.779  1.00 0.00 ? 41 ASP A N    9  
ATOM 9298  C CA   . ASP A 1 41 ? -8.229  -5.772  -6.903  1.00 0.00 ? 41 ASP A CA   9  
ATOM 9299  C C    . ASP A 1 41 ? -6.777  -6.158  -6.645  1.00 0.00 ? 41 ASP A C    9  
ATOM 9300  O O    . ASP A 1 41 ? -6.039  -6.496  -7.570  1.00 0.00 ? 41 ASP A O    9  
ATOM 9301  C CB   . ASP A 1 41 ? -8.337  -4.267  -7.155  1.00 0.00 ? 41 ASP A CB   9  
ATOM 9302  C CG   . ASP A 1 41 ? -9.665  -3.877  -7.774  1.00 0.00 ? 41 ASP A CG   9  
ATOM 9303  O OD1  . ASP A 1 41 ? -9.827  -4.062  -8.998  1.00 0.00 ? 41 ASP A OD1  9  
ATOM 9304  O OD2  . ASP A 1 41 ? -10.543 -3.384  -7.034  1.00 0.00 ? 41 ASP A OD2  9  
ATOM 9305  H H    . ASP A 1 41 ? -9.232  -5.516  -5.060  1.00 0.00 ? 41 ASP A H    9  
ATOM 9306  H HA   . ASP A 1 41 ? -8.579  -6.301  -7.777  1.00 0.00 ? 41 ASP A HA   9  
ATOM 9307  H HB2  . ASP A 1 41 ? -8.230  -3.741  -6.217  1.00 0.00 ? 41 ASP A HB2  9  
ATOM 9308  H HB3  . ASP A 1 41 ? -7.547  -3.963  -7.824  1.00 0.00 ? 41 ASP A HB3  9  
ATOM 9309  N N    . LEU A 1 42 ? -6.378  -6.112  -5.377  1.00 0.00 ? 42 LEU A N    9  
ATOM 9310  C CA   . LEU A 1 42 ? -5.019  -6.467  -4.987  1.00 0.00 ? 42 LEU A CA   9  
ATOM 9311  C C    . LEU A 1 42 ? -4.651  -7.838  -5.539  1.00 0.00 ? 42 LEU A C    9  
ATOM 9312  O O    . LEU A 1 42 ? -3.566  -8.029  -6.087  1.00 0.00 ? 42 LEU A O    9  
ATOM 9313  C CB   . LEU A 1 42 ? -4.881  -6.467  -3.456  1.00 0.00 ? 42 LEU A CB   9  
ATOM 9314  C CG   . LEU A 1 42 ? -4.966  -5.101  -2.738  1.00 0.00 ? 42 LEU A CG   9  
ATOM 9315  C CD1  . LEU A 1 42 ? -3.769  -4.918  -1.822  1.00 0.00 ? 42 LEU A CD1  9  
ATOM 9316  C CD2  . LEU A 1 42 ? -5.060  -3.930  -3.713  1.00 0.00 ? 42 LEU A CD2  9  
ATOM 9317  H H    . LEU A 1 42 ? -7.015  -5.842  -4.688  1.00 0.00 ? 42 LEU A H    9  
ATOM 9318  H HA   . LEU A 1 42 ? -4.349  -5.730  -5.404  1.00 0.00 ? 42 LEU A HA   9  
ATOM 9319  H HB2  . LEU A 1 42 ? -5.660  -7.100  -3.055  1.00 0.00 ? 42 LEU A HB2  9  
ATOM 9320  H HB3  . LEU A 1 42 ? -3.928  -6.911  -3.210  1.00 0.00 ? 42 LEU A HB3  9  
ATOM 9321  H HG   . LEU A 1 42 ? -5.851  -5.085  -2.120  1.00 0.00 ? 42 LEU A HG   9  
ATOM 9322  H HD11 . LEU A 1 42 ? -3.900  -4.020  -1.237  1.00 0.00 ? 42 LEU A HD11 9  
ATOM 9323  H HD12 . LEU A 1 42 ? -2.870  -4.836  -2.415  1.00 0.00 ? 42 LEU A HD12 9  
ATOM 9324  H HD13 . LEU A 1 42 ? -3.689  -5.768  -1.161  1.00 0.00 ? 42 LEU A HD13 9  
ATOM 9325  H HD21 . LEU A 1 42 ? -4.117  -3.812  -4.225  1.00 0.00 ? 42 LEU A HD21 9  
ATOM 9326  H HD22 . LEU A 1 42 ? -5.289  -3.026  -3.167  1.00 0.00 ? 42 LEU A HD22 9  
ATOM 9327  H HD23 . LEU A 1 42 ? -5.838  -4.121  -4.433  1.00 0.00 ? 42 LEU A HD23 9  
ATOM 9328  N N    . GLY A 1 43 ? -5.570  -8.787  -5.396  1.00 0.00 ? 43 GLY A N    9  
ATOM 9329  C CA   . GLY A 1 43 ? -5.339  -10.126 -5.903  1.00 0.00 ? 43 GLY A CA   9  
ATOM 9330  C C    . GLY A 1 43 ? -5.530  -10.223 -7.408  1.00 0.00 ? 43 GLY A C    9  
ATOM 9331  O O    . GLY A 1 43 ? -5.369  -11.296 -7.988  1.00 0.00 ? 43 GLY A O    9  
ATOM 9332  H H    . GLY A 1 43 ? -6.422  -8.570  -4.960  1.00 0.00 ? 43 GLY A H    9  
ATOM 9333  H HA2  . GLY A 1 43 ? -4.329  -10.420 -5.662  1.00 0.00 ? 43 GLY A HA2  9  
ATOM 9334  H HA3  . GLY A 1 43 ? -6.026  -10.806 -5.420  1.00 0.00 ? 43 GLY A HA3  9  
ATOM 9335  N N    . ALA A 1 44 ? -5.878  -9.104  -8.040  1.00 0.00 ? 44 ALA A N    9  
ATOM 9336  C CA   . ALA A 1 44 ? -6.065  -9.073  -9.485  1.00 0.00 ? 44 ALA A CA   9  
ATOM 9337  C C    . ALA A 1 44 ? -4.732  -8.848  -10.184 1.00 0.00 ? 44 ALA A C    9  
ATOM 9338  O O    . ALA A 1 44 ? -4.485  -9.379  -11.267 1.00 0.00 ? 44 ALA A O    9  
ATOM 9339  C CB   . ALA A 1 44 ? -7.061  -7.988  -9.870  1.00 0.00 ? 44 ALA A CB   9  
ATOM 9340  H H    . ALA A 1 44 ? -5.977  -8.275  -7.531  1.00 0.00 ? 44 ALA A H    9  
ATOM 9341  H HA   . ALA A 1 44 ? -6.469  -10.026 -9.792  1.00 0.00 ? 44 ALA A HA   9  
ATOM 9342  H HB1  . ALA A 1 44 ? -7.401  -7.478  -8.980  1.00 0.00 ? 44 ALA A HB1  9  
ATOM 9343  H HB2  . ALA A 1 44 ? -7.905  -8.436  -10.372 1.00 0.00 ? 44 ALA A HB2  9  
ATOM 9344  H HB3  . ALA A 1 44 ? -6.584  -7.279  -10.531 1.00 0.00 ? 44 ALA A HB3  9  
ATOM 9345  N N    . LEU A 1 45 ? -3.865  -8.076  -9.536  1.00 0.00 ? 45 LEU A N    9  
ATOM 9346  C CA   . LEU A 1 45 ? -2.545  -7.781  -10.071 1.00 0.00 ? 45 LEU A CA   9  
ATOM 9347  C C    . LEU A 1 45 ? -1.712  -9.052  -10.252 1.00 0.00 ? 45 LEU A C    9  
ATOM 9348  O O    . LEU A 1 45 ? -0.694  -9.039  -10.943 1.00 0.00 ? 45 LEU A O    9  
ATOM 9349  C CB   . LEU A 1 45 ? -1.824  -6.819  -9.132  1.00 0.00 ? 45 LEU A CB   9  
ATOM 9350  C CG   . LEU A 1 45 ? -2.314  -5.373  -9.188  1.00 0.00 ? 45 LEU A CG   9  
ATOM 9351  C CD1  . LEU A 1 45 ? -3.810  -5.299  -8.928  1.00 0.00 ? 45 LEU A CD1  9  
ATOM 9352  C CD2  . LEU A 1 45 ? -1.557  -4.523  -8.185  1.00 0.00 ? 45 LEU A CD2  9  
ATOM 9353  H H    . LEU A 1 45 ? -4.124  -7.685  -8.674  1.00 0.00 ? 45 LEU A H    9  
ATOM 9354  H HA   . LEU A 1 45 ? -2.674  -7.309  -11.033 1.00 0.00 ? 45 LEU A HA   9  
ATOM 9355  H HB2  . LEU A 1 45 ? -1.947  -7.178  -8.121  1.00 0.00 ? 45 LEU A HB2  9  
ATOM 9356  H HB3  . LEU A 1 45 ? -0.772  -6.832  -9.373  1.00 0.00 ? 45 LEU A HB3  9  
ATOM 9357  H HG   . LEU A 1 45 ? -2.129  -4.978  -10.173 1.00 0.00 ? 45 LEU A HG   9  
ATOM 9358  H HD11 . LEU A 1 45 ? -4.337  -5.842  -9.698  1.00 0.00 ? 45 LEU A HD11 9  
ATOM 9359  H HD12 . LEU A 1 45 ? -4.124  -4.266  -8.936  1.00 0.00 ? 45 LEU A HD12 9  
ATOM 9360  H HD13 . LEU A 1 45 ? -4.028  -5.735  -7.965  1.00 0.00 ? 45 LEU A HD13 9  
ATOM 9361  H HD21 . LEU A 1 45 ? -0.591  -4.260  -8.590  1.00 0.00 ? 45 LEU A HD21 9  
ATOM 9362  H HD22 . LEU A 1 45 ? -1.425  -5.083  -7.272  1.00 0.00 ? 45 LEU A HD22 9  
ATOM 9363  H HD23 . LEU A 1 45 ? -2.118  -3.623  -7.979  1.00 0.00 ? 45 LEU A HD23 9  
ATOM 9364  N N    . LYS A 1 46 ? -2.154  -10.150 -9.636  1.00 0.00 ? 46 LYS A N    9  
ATOM 9365  C CA   . LYS A 1 46 ? -1.435  -11.424 -9.715  1.00 0.00 ? 46 LYS A CA   9  
ATOM 9366  C C    . LYS A 1 46 ? -0.206  -11.417 -8.814  1.00 0.00 ? 46 LYS A C    9  
ATOM 9367  O O    . LYS A 1 46 ? 0.695   -12.242 -8.966  1.00 0.00 ? 46 LYS A O    9  
ATOM 9368  C CB   . LYS A 1 46 ? -1.022  -11.729 -11.157 1.00 0.00 ? 46 LYS A CB   9  
ATOM 9369  C CG   . LYS A 1 46 ? -2.002  -11.206 -12.190 1.00 0.00 ? 46 LYS A CG   9  
ATOM 9370  C CD   . LYS A 1 46 ? -2.404  -12.289 -13.178 1.00 0.00 ? 46 LYS A CD   9  
ATOM 9371  C CE   . LYS A 1 46 ? -3.624  -11.879 -13.987 1.00 0.00 ? 46 LYS A CE   9  
ATOM 9372  N NZ   . LYS A 1 46 ? -3.251  -11.385 -15.341 1.00 0.00 ? 46 LYS A NZ   9  
ATOM 9373  H H    . LYS A 1 46 ? -2.961  -10.097 -9.088  1.00 0.00 ? 46 LYS A H    9  
ATOM 9374  H HA   . LYS A 1 46 ? -2.105  -12.196 -9.373  1.00 0.00 ? 46 LYS A HA   9  
ATOM 9375  H HB2  . LYS A 1 46 ? -0.057  -11.281 -11.347 1.00 0.00 ? 46 LYS A HB2  9  
ATOM 9376  H HB3  . LYS A 1 46 ? -0.942  -12.800 -11.277 1.00 0.00 ? 46 LYS A HB3  9  
ATOM 9377  H HG2  . LYS A 1 46 ? -2.883  -10.849 -11.678 1.00 0.00 ? 46 LYS A HG2  9  
ATOM 9378  H HG3  . LYS A 1 46 ? -1.540  -10.392 -12.726 1.00 0.00 ? 46 LYS A HG3  9  
ATOM 9379  H HD2  . LYS A 1 46 ? -1.581  -12.470 -13.853 1.00 0.00 ? 46 LYS A HD2  9  
ATOM 9380  H HD3  . LYS A 1 46 ? -2.633  -13.193 -12.633 1.00 0.00 ? 46 LYS A HD3  9  
ATOM 9381  H HE2  . LYS A 1 46 ? -4.274  -12.735 -14.092 1.00 0.00 ? 46 LYS A HE2  9  
ATOM 9382  H HE3  . LYS A 1 46 ? -4.144  -11.094 -13.458 1.00 0.00 ? 46 LYS A HE3  9  
ATOM 9383  H HZ1  . LYS A 1 46 ? -3.997  -11.623 -16.026 1.00 0.00 ? 46 LYS A HZ1  9  
ATOM 9384  H HZ2  . LYS A 1 46 ? -2.360  -11.823 -15.648 1.00 0.00 ? 46 LYS A HZ2  9  
ATOM 9385  H HZ3  . LYS A 1 46 ? -3.129  -10.352 -15.324 1.00 0.00 ? 46 LYS A HZ3  9  
ATOM 9386  N N    . ILE A 1 47 ? -0.182  -10.483 -7.874  1.00 0.00 ? 47 ILE A N    9  
ATOM 9387  C CA   . ILE A 1 47 ? 0.921   -10.373 -6.927  1.00 0.00 ? 47 ILE A CA   9  
ATOM 9388  C C    . ILE A 1 47 ? 0.702   -11.308 -5.742  1.00 0.00 ? 47 ILE A C    9  
ATOM 9389  O O    . ILE A 1 47 ? -0.416  -11.431 -5.241  1.00 0.00 ? 47 ILE A O    9  
ATOM 9390  C CB   . ILE A 1 47 ? 1.078   -8.928  -6.412  1.00 0.00 ? 47 ILE A CB   9  
ATOM 9391  C CG1  . ILE A 1 47 ? 0.841   -7.930  -7.545  1.00 0.00 ? 47 ILE A CG1  9  
ATOM 9392  C CG2  . ILE A 1 47 ? 2.456   -8.722  -5.807  1.00 0.00 ? 47 ILE A CG2  9  
ATOM 9393  C CD1  . ILE A 1 47 ? 0.933   -6.486  -7.105  1.00 0.00 ? 47 ILE A CD1  9  
ATOM 9394  H H    . ILE A 1 47 ? -0.936  -9.864  -7.801  1.00 0.00 ? 47 ILE A H    9  
ATOM 9395  H HA   . ILE A 1 47 ? 1.831   -10.654 -7.438  1.00 0.00 ? 47 ILE A HA   9  
ATOM 9396  H HB   . ILE A 1 47 ? 0.344   -8.766  -5.637  1.00 0.00 ? 47 ILE A HB   9  
ATOM 9397  H HG12 . ILE A 1 47 ? 1.579   -8.090  -8.318  1.00 0.00 ? 47 ILE A HG12 9  
ATOM 9398  H HG13 . ILE A 1 47 ? -0.143  -8.091  -7.955  1.00 0.00 ? 47 ILE A HG13 9  
ATOM 9399  H HG21 . ILE A 1 47 ? 3.208   -9.076  -6.495  1.00 0.00 ? 47 ILE A HG21 9  
ATOM 9400  H HG22 . ILE A 1 47 ? 2.529   -9.270  -4.880  1.00 0.00 ? 47 ILE A HG22 9  
ATOM 9401  H HG23 . ILE A 1 47 ? 2.610   -7.669  -5.616  1.00 0.00 ? 47 ILE A HG23 9  
ATOM 9402  H HD11 . ILE A 1 47 ? 0.699   -5.841  -7.939  1.00 0.00 ? 47 ILE A HD11 9  
ATOM 9403  H HD12 . ILE A 1 47 ? 1.935   -6.279  -6.758  1.00 0.00 ? 47 ILE A HD12 9  
ATOM 9404  H HD13 . ILE A 1 47 ? 0.230   -6.308  -6.305  1.00 0.00 ? 47 ILE A HD13 9  
ATOM 9405  N N    . PRO A 1 48 ? 1.764   -11.995 -5.281  1.00 0.00 ? 48 PRO A N    9  
ATOM 9406  C CA   . PRO A 1 48 ? 1.676   -12.924 -4.154  1.00 0.00 ? 48 PRO A CA   9  
ATOM 9407  C C    . PRO A 1 48 ? 0.750   -12.420 -3.051  1.00 0.00 ? 48 PRO A C    9  
ATOM 9408  O O    . PRO A 1 48 ? 0.745   -11.234 -2.724  1.00 0.00 ? 48 PRO A O    9  
ATOM 9409  C CB   . PRO A 1 48 ? 3.118   -12.989 -3.665  1.00 0.00 ? 48 PRO A CB   9  
ATOM 9410  C CG   . PRO A 1 48 ? 3.934   -12.813 -4.902  1.00 0.00 ? 48 PRO A CG   9  
ATOM 9411  C CD   . PRO A 1 48 ? 3.137   -11.915 -5.817  1.00 0.00 ? 48 PRO A CD   9  
ATOM 9412  H HA   . PRO A 1 48 ? 1.356   -13.905 -4.472  1.00 0.00 ? 48 PRO A HA   9  
ATOM 9413  H HB2  . PRO A 1 48 ? 3.298   -12.197 -2.954  1.00 0.00 ? 48 PRO A HB2  9  
ATOM 9414  H HB3  . PRO A 1 48 ? 3.302   -13.947 -3.202  1.00 0.00 ? 48 PRO A HB3  9  
ATOM 9415  H HG2  . PRO A 1 48 ? 4.878   -12.350 -4.654  1.00 0.00 ? 48 PRO A HG2  9  
ATOM 9416  H HG3  . PRO A 1 48 ? 4.099   -13.771 -5.371  1.00 0.00 ? 48 PRO A HG3  9  
ATOM 9417  H HD2  . PRO A 1 48 ? 3.510   -10.904 -5.768  1.00 0.00 ? 48 PRO A HD2  9  
ATOM 9418  H HD3  . PRO A 1 48 ? 3.176   -12.282 -6.832  1.00 0.00 ? 48 PRO A HD3  9  
ATOM 9419  N N    . GLU A 1 49 ? -0.043  -13.329 -2.491  1.00 0.00 ? 49 GLU A N    9  
ATOM 9420  C CA   . GLU A 1 49 ? -0.991  -12.973 -1.442  1.00 0.00 ? 49 GLU A CA   9  
ATOM 9421  C C    . GLU A 1 49 ? -0.377  -13.140 -0.055  1.00 0.00 ? 49 GLU A C    9  
ATOM 9422  O O    . GLU A 1 49 ? -1.094  -13.286 0.935   1.00 0.00 ? 49 GLU A O    9  
ATOM 9423  C CB   . GLU A 1 49 ? -2.252  -13.830 -1.559  1.00 0.00 ? 49 GLU A CB   9  
ATOM 9424  C CG   . GLU A 1 49 ? -2.023  -15.298 -1.237  1.00 0.00 ? 49 GLU A CG   9  
ATOM 9425  C CD   . GLU A 1 49 ? -1.935  -16.160 -2.482  1.00 0.00 ? 49 GLU A CD   9  
ATOM 9426  O OE1  . GLU A 1 49 ? -2.997  -16.561 -3.002  1.00 0.00 ? 49 GLU A OE1  9  
ATOM 9427  O OE2  . GLU A 1 49 ? -0.805  -16.435 -2.936  1.00 0.00 ? 49 GLU A OE2  9  
ATOM 9428  H H    . GLU A 1 49 ? -0.001  -14.256 -2.802  1.00 0.00 ? 49 GLU A H    9  
ATOM 9429  H HA   . GLU A 1 49 ? -1.260  -11.936 -1.579  1.00 0.00 ? 49 GLU A HA   9  
ATOM 9430  H HB2  . GLU A 1 49 ? -2.998  -13.448 -0.879  1.00 0.00 ? 49 GLU A HB2  9  
ATOM 9431  H HB3  . GLU A 1 49 ? -2.628  -13.761 -2.569  1.00 0.00 ? 49 GLU A HB3  9  
ATOM 9432  H HG2  . GLU A 1 49 ? -1.099  -15.392 -0.686  1.00 0.00 ? 49 GLU A HG2  9  
ATOM 9433  H HG3  . GLU A 1 49 ? -2.842  -15.653 -0.630  1.00 0.00 ? 49 GLU A HG3  9  
ATOM 9434  N N    . GLN A 1 50 ? 0.950   -13.111 0.014   1.00 0.00 ? 50 GLN A N    9  
ATOM 9435  C CA   . GLN A 1 50 ? 1.647   -13.244 1.287   1.00 0.00 ? 50 GLN A CA   9  
ATOM 9436  C C    . GLN A 1 50 ? 1.161   -12.189 2.275   1.00 0.00 ? 50 GLN A C    9  
ATOM 9437  O O    . GLN A 1 50 ? 1.047   -12.448 3.473   1.00 0.00 ? 50 GLN A O    9  
ATOM 9438  C CB   . GLN A 1 50 ? 3.158   -13.112 1.085   1.00 0.00 ? 50 GLN A CB   9  
ATOM 9439  C CG   . GLN A 1 50 ? 3.670   -13.817 -0.160  1.00 0.00 ? 50 GLN A CG   9  
ATOM 9440  C CD   . GLN A 1 50 ? 5.099   -14.294 -0.014  1.00 0.00 ? 50 GLN A CD   9  
ATOM 9441  O OE1  . GLN A 1 50 ? 5.500   -14.780 1.044   1.00 0.00 ? 50 GLN A OE1  9  
ATOM 9442  N NE2  . GLN A 1 50 ? 5.874   -14.157 -1.080  1.00 0.00 ? 50 GLN A NE2  9  
ATOM 9443  H H    . GLN A 1 50 ? 1.471   -12.985 -0.805  1.00 0.00 ? 50 GLN A H    9  
ATOM 9444  H HA   . GLN A 1 50 ? 1.427   -14.223 1.686   1.00 0.00 ? 50 GLN A HA   9  
ATOM 9445  H HB2  . GLN A 1 50 ? 3.409   -12.065 1.008   1.00 0.00 ? 50 GLN A HB2  9  
ATOM 9446  H HB3  . GLN A 1 50 ? 3.662   -13.532 1.943   1.00 0.00 ? 50 GLN A HB3  9  
ATOM 9447  H HG2  . GLN A 1 50 ? 3.042   -14.671 -0.360  1.00 0.00 ? 50 GLN A HG2  9  
ATOM 9448  H HG3  . GLN A 1 50 ? 3.624   -13.132 -0.992  1.00 0.00 ? 50 GLN A HG3  9  
ATOM 9449  H HE21 . GLN A 1 50 ? 5.484   -13.762 -1.888  1.00 0.00 ? 50 GLN A HE21 9  
ATOM 9450  H HE22 . GLN A 1 50 ? 6.802   -14.456 -1.017  1.00 0.00 ? 50 GLN A HE22 9  
ATOM 9451  N N    . TYR A 1 51 ? 0.871   -11.000 1.758   1.00 0.00 ? 51 TYR A N    9  
ATOM 9452  C CA   . TYR A 1 51 ? 0.385   -9.901  2.586   1.00 0.00 ? 51 TYR A CA   9  
ATOM 9453  C C    . TYR A 1 51 ? -0.710  -9.129  1.857   1.00 0.00 ? 51 TYR A C    9  
ATOM 9454  O O    . TYR A 1 51 ? -0.888  -7.930  2.071   1.00 0.00 ? 51 TYR A O    9  
ATOM 9455  C CB   . TYR A 1 51 ? 1.529   -8.952  2.958   1.00 0.00 ? 51 TYR A CB   9  
ATOM 9456  C CG   . TYR A 1 51 ? 2.886   -9.618  3.032   1.00 0.00 ? 51 TYR A CG   9  
ATOM 9457  C CD1  . TYR A 1 51 ? 3.124   -10.659 3.921   1.00 0.00 ? 51 TYR A CD1  9  
ATOM 9458  C CD2  . TYR A 1 51 ? 3.929   -9.205  2.212   1.00 0.00 ? 51 TYR A CD2  9  
ATOM 9459  C CE1  . TYR A 1 51 ? 4.361   -11.269 3.990   1.00 0.00 ? 51 TYR A CE1  9  
ATOM 9460  C CE2  . TYR A 1 51 ? 5.169   -9.810  2.276   1.00 0.00 ? 51 TYR A CE2  9  
ATOM 9461  C CZ   . TYR A 1 51 ? 5.381   -10.842 3.165   1.00 0.00 ? 51 TYR A CZ   9  
ATOM 9462  O OH   . TYR A 1 51 ? 6.614   -11.446 3.233   1.00 0.00 ? 51 TYR A OH   9  
ATOM 9463  H H    . TYR A 1 51 ? 0.978   -10.860 0.795   1.00 0.00 ? 51 TYR A H    9  
ATOM 9464  H HA   . TYR A 1 51 ? -0.030  -10.324 3.488   1.00 0.00 ? 51 TYR A HA   9  
ATOM 9465  H HB2  . TYR A 1 51 ? 1.589   -8.165  2.220   1.00 0.00 ? 51 TYR A HB2  9  
ATOM 9466  H HB3  . TYR A 1 51 ? 1.324   -8.516  3.924   1.00 0.00 ? 51 TYR A HB3  9  
ATOM 9467  H HD1  . TYR A 1 51 ? 2.323   -10.993 4.565   1.00 0.00 ? 51 TYR A HD1  9  
ATOM 9468  H HD2  . TYR A 1 51 ? 3.760   -8.397  1.516   1.00 0.00 ? 51 TYR A HD2  9  
ATOM 9469  H HE1  . TYR A 1 51 ? 4.527   -12.077 4.688   1.00 0.00 ? 51 TYR A HE1  9  
ATOM 9470  H HE2  . TYR A 1 51 ? 5.968   -9.475  1.630   1.00 0.00 ? 51 TYR A HE2  9  
ATOM 9471  H HH   . TYR A 1 51 ? 7.302   -10.785 3.118   1.00 0.00 ? 51 TYR A HH   9  
ATOM 9472  N N    . ARG A 1 52 ? -1.434  -9.825  0.986   1.00 0.00 ? 52 ARG A N    9  
ATOM 9473  C CA   . ARG A 1 52 ? -2.507  -9.211  0.213   1.00 0.00 ? 52 ARG A CA   9  
ATOM 9474  C C    . ARG A 1 52 ? -3.438  -8.404  1.112   1.00 0.00 ? 52 ARG A C    9  
ATOM 9475  O O    . ARG A 1 52 ? -3.623  -7.203  0.911   1.00 0.00 ? 52 ARG A O    9  
ATOM 9476  C CB   . ARG A 1 52 ? -3.301  -10.291 -0.523  1.00 0.00 ? 52 ARG A CB   9  
ATOM 9477  C CG   . ARG A 1 52 ? -3.598  -9.951  -1.975  1.00 0.00 ? 52 ARG A CG   9  
ATOM 9478  C CD   . ARG A 1 52 ? -3.762  -11.208 -2.811  1.00 0.00 ? 52 ARG A CD   9  
ATOM 9479  N NE   . ARG A 1 52 ? -4.862  -12.041 -2.336  1.00 0.00 ? 52 ARG A NE   9  
ATOM 9480  C CZ   . ARG A 1 52 ? -5.438  -12.988 -3.068  1.00 0.00 ? 52 ARG A CZ   9  
ATOM 9481  N NH1  . ARG A 1 52 ? -5.019  -13.219 -4.305  1.00 0.00 ? 52 ARG A NH1  9  
ATOM 9482  N NH2  . ARG A 1 52 ? -6.435  -13.704 -2.566  1.00 0.00 ? 52 ARG A NH2  9  
ATOM 9483  H H    . ARG A 1 52 ? -1.243  -10.777 0.857   1.00 0.00 ? 52 ARG A H    9  
ATOM 9484  H HA   . ARG A 1 52 ? -2.058  -8.547  -0.510  1.00 0.00 ? 52 ARG A HA   9  
ATOM 9485  H HB2  . ARG A 1 52 ? -2.738  -11.212 -0.501  1.00 0.00 ? 52 ARG A HB2  9  
ATOM 9486  H HB3  . ARG A 1 52 ? -4.238  -10.442 -0.010  1.00 0.00 ? 52 ARG A HB3  9  
ATOM 9487  H HG2  . ARG A 1 52 ? -4.513  -9.377  -2.023  1.00 0.00 ? 52 ARG A HG2  9  
ATOM 9488  H HG3  . ARG A 1 52 ? -2.783  -9.367  -2.374  1.00 0.00 ? 52 ARG A HG3  9  
ATOM 9489  H HD2  . ARG A 1 52 ? -3.956  -10.921 -3.833  1.00 0.00 ? 52 ARG A HD2  9  
ATOM 9490  H HD3  . ARG A 1 52 ? -2.845  -11.777 -2.765  1.00 0.00 ? 52 ARG A HD3  9  
ATOM 9491  H HE   . ARG A 1 52 ? -5.187  -11.887 -1.424  1.00 0.00 ? 52 ARG A HE   9  
ATOM 9492  H HH11 . ARG A 1 52 ? -4.268  -12.680 -4.688  1.00 0.00 ? 52 ARG A HH11 9  
ATOM 9493  H HH12 . ARG A 1 52 ? -5.453  -13.932 -4.856  1.00 0.00 ? 52 ARG A HH12 9  
ATOM 9494  H HH21 . ARG A 1 52 ? -6.753  -13.533 -1.633  1.00 0.00 ? 52 ARG A HH21 9  
ATOM 9495  H HH22 . ARG A 1 52 ? -6.867  -14.416 -3.118  1.00 0.00 ? 52 ARG A HH22 9  
ATOM 9496  N N    . MET A 1 53 ? -4.024  -9.069  2.102   1.00 0.00 ? 53 MET A N    9  
ATOM 9497  C CA   . MET A 1 53 ? -4.940  -8.413  3.027   1.00 0.00 ? 53 MET A CA   9  
ATOM 9498  C C    . MET A 1 53 ? -4.272  -7.220  3.703   1.00 0.00 ? 53 MET A C    9  
ATOM 9499  O O    . MET A 1 53 ? -4.855  -6.139  3.791   1.00 0.00 ? 53 MET A O    9  
ATOM 9500  C CB   . MET A 1 53 ? -5.432  -9.403  4.085   1.00 0.00 ? 53 MET A CB   9  
ATOM 9501  C CG   . MET A 1 53 ? -4.326  -10.256 4.685   1.00 0.00 ? 53 MET A CG   9  
ATOM 9502  S SD   . MET A 1 53 ? -4.729  -12.012 4.692   1.00 0.00 ? 53 MET A SD   9  
ATOM 9503  C CE   . MET A 1 53 ? -6.161  -12.029 5.768   1.00 0.00 ? 53 MET A CE   9  
ATOM 9504  H H    . MET A 1 53 ? -3.840  -10.026 2.210   1.00 0.00 ? 53 MET A H    9  
ATOM 9505  H HA   . MET A 1 53 ? -5.784  -8.057  2.456   1.00 0.00 ? 53 MET A HA   9  
ATOM 9506  H HB2  . MET A 1 53 ? -5.906  -8.852  4.884   1.00 0.00 ? 53 MET A HB2  9  
ATOM 9507  H HB3  . MET A 1 53 ? -6.159  -10.062 3.634   1.00 0.00 ? 53 MET A HB3  9  
ATOM 9508  H HG2  . MET A 1 53 ? -3.424  -10.110 4.108   1.00 0.00 ? 53 MET A HG2  9  
ATOM 9509  H HG3  . MET A 1 53 ? -4.156  -9.935  5.702   1.00 0.00 ? 53 MET A HG3  9  
ATOM 9510  H HE1  . MET A 1 53 ? -7.059  -11.948 5.173   1.00 0.00 ? 53 MET A HE1  9  
ATOM 9511  H HE2  . MET A 1 53 ? -6.107  -11.195 6.453   1.00 0.00 ? 53 MET A HE2  9  
ATOM 9512  H HE3  . MET A 1 53 ? -6.181  -12.952 6.327   1.00 0.00 ? 53 MET A HE3  9  
ATOM 9513  N N    . THR A 1 54 ? -3.049  -7.422  4.181   1.00 0.00 ? 54 THR A N    9  
ATOM 9514  C CA   . THR A 1 54 ? -2.303  -6.357  4.842   1.00 0.00 ? 54 THR A CA   9  
ATOM 9515  C C    . THR A 1 54 ? -2.284  -5.098  3.982   1.00 0.00 ? 54 THR A C    9  
ATOM 9516  O O    . THR A 1 54 ? -2.607  -4.005  4.451   1.00 0.00 ? 54 THR A O    9  
ATOM 9517  C CB   . THR A 1 54 ? -0.870  -6.814  5.131   1.00 0.00 ? 54 THR A CB   9  
ATOM 9518  O OG1  . THR A 1 54 ? -0.863  -7.876  6.069   1.00 0.00 ? 54 THR A OG1  9  
ATOM 9519  C CG2  . THR A 1 54 ? 0.016   -5.713  5.673   1.00 0.00 ? 54 THR A CG2  9  
ATOM 9520  H H    . THR A 1 54 ? -2.634  -8.305  4.078   1.00 0.00 ? 54 THR A H    9  
ATOM 9521  H HA   . THR A 1 54 ? -2.798  -6.135  5.775   1.00 0.00 ? 54 THR A HA   9  
ATOM 9522  H HB   . THR A 1 54 ? -0.425  -7.170  4.213   1.00 0.00 ? 54 THR A HB   9  
ATOM 9523  H HG1  . THR A 1 54 ? -1.324  -7.603  6.866   1.00 0.00 ? 54 THR A HG1  9  
ATOM 9524  H HG21 . THR A 1 54 ? -0.295  -5.463  6.677   1.00 0.00 ? 54 THR A HG21 9  
ATOM 9525  H HG22 . THR A 1 54 ? -0.067  -4.839  5.042   1.00 0.00 ? 54 THR A HG22 9  
ATOM 9526  H HG23 . THR A 1 54 ? 1.041   -6.051  5.687   1.00 0.00 ? 54 THR A HG23 9  
ATOM 9527  N N    . ILE A 1 55 ? -1.911  -5.262  2.717   1.00 0.00 ? 55 ILE A N    9  
ATOM 9528  C CA   . ILE A 1 55 ? -1.859  -4.141  1.790   1.00 0.00 ? 55 ILE A CA   9  
ATOM 9529  C C    . ILE A 1 55 ? -3.218  -3.454  1.703   1.00 0.00 ? 55 ILE A C    9  
ATOM 9530  O O    . ILE A 1 55 ? -3.323  -2.242  1.891   1.00 0.00 ? 55 ILE A O    9  
ATOM 9531  C CB   . ILE A 1 55 ? -1.417  -4.583  0.384   1.00 0.00 ? 55 ILE A CB   9  
ATOM 9532  C CG1  . ILE A 1 55 ? -0.100  -5.357  0.461   1.00 0.00 ? 55 ILE A CG1  9  
ATOM 9533  C CG2  . ILE A 1 55 ? -1.273  -3.375  -0.528  1.00 0.00 ? 55 ILE A CG2  9  
ATOM 9534  C CD1  . ILE A 1 55 ? -0.035  -6.536  -0.484  1.00 0.00 ? 55 ILE A CD1  9  
ATOM 9535  H H    . ILE A 1 55 ? -1.675  -6.159  2.399   1.00 0.00 ? 55 ILE A H    9  
ATOM 9536  H HA   . ILE A 1 55 ? -1.134  -3.435  2.163   1.00 0.00 ? 55 ILE A HA   9  
ATOM 9537  H HB   . ILE A 1 55 ? -2.182  -5.226  -0.024  1.00 0.00 ? 55 ILE A HB   9  
ATOM 9538  H HG12 . ILE A 1 55 ? 0.715   -4.692  0.218   1.00 0.00 ? 55 ILE A HG12 9  
ATOM 9539  H HG13 . ILE A 1 55 ? 0.033   -5.729  1.467   1.00 0.00 ? 55 ILE A HG13 9  
ATOM 9540  H HG21 . ILE A 1 55 ? -2.247  -3.065  -0.874  1.00 0.00 ? 55 ILE A HG21 9  
ATOM 9541  H HG22 . ILE A 1 55 ? -0.656  -3.635  -1.376  1.00 0.00 ? 55 ILE A HG22 9  
ATOM 9542  H HG23 . ILE A 1 55 ? -0.811  -2.566  0.019   1.00 0.00 ? 55 ILE A HG23 9  
ATOM 9543  H HD11 . ILE A 1 55 ? -0.920  -6.552  -1.102  1.00 0.00 ? 55 ILE A HD11 9  
ATOM 9544  H HD12 . ILE A 1 55 ? 0.023   -7.452  0.086   1.00 0.00 ? 55 ILE A HD12 9  
ATOM 9545  H HD13 . ILE A 1 55 ? 0.840   -6.447  -1.111  1.00 0.00 ? 55 ILE A HD13 9  
ATOM 9546  N N    . TRP A 1 56 ? -4.260  -4.239  1.445   1.00 0.00 ? 56 TRP A N    9  
ATOM 9547  C CA   . TRP A 1 56 ? -5.614  -3.713  1.377   1.00 0.00 ? 56 TRP A CA   9  
ATOM 9548  C C    . TRP A 1 56 ? -5.931  -2.909  2.638   1.00 0.00 ? 56 TRP A C    9  
ATOM 9549  O O    . TRP A 1 56 ? -6.428  -1.788  2.561   1.00 0.00 ? 56 TRP A O    9  
ATOM 9550  C CB   . TRP A 1 56 ? -6.606  -4.869  1.198   1.00 0.00 ? 56 TRP A CB   9  
ATOM 9551  C CG   . TRP A 1 56 ? -8.029  -4.522  1.518   1.00 0.00 ? 56 TRP A CG   9  
ATOM 9552  C CD1  . TRP A 1 56 ? -8.693  -3.380  1.181   1.00 0.00 ? 56 TRP A CD1  9  
ATOM 9553  C CD2  . TRP A 1 56 ? -8.955  -5.326  2.251   1.00 0.00 ? 56 TRP A CD2  9  
ATOM 9554  N NE1  . TRP A 1 56 ? -9.982  -3.430  1.657   1.00 0.00 ? 56 TRP A NE1  9  
ATOM 9555  C CE2  . TRP A 1 56 ? -10.164 -4.614  2.315   1.00 0.00 ? 56 TRP A CE2  9  
ATOM 9556  C CE3  . TRP A 1 56 ? -8.878  -6.583  2.853   1.00 0.00 ? 56 TRP A CE3  9  
ATOM 9557  C CZ2  . TRP A 1 56 ? -11.289 -5.112  2.958   1.00 0.00 ? 56 TRP A CZ2  9  
ATOM 9558  C CZ3  . TRP A 1 56 ? -9.997  -7.082  3.495   1.00 0.00 ? 56 TRP A CZ3  9  
ATOM 9559  C CH2  . TRP A 1 56 ? -11.190 -6.347  3.542   1.00 0.00 ? 56 TRP A CH2  9  
ATOM 9560  H H    . TRP A 1 56 ? -4.118  -5.202  1.320   1.00 0.00 ? 56 TRP A H    9  
ATOM 9561  H HA   . TRP A 1 56 ? -5.674  -3.058  0.520   1.00 0.00 ? 56 TRP A HA   9  
ATOM 9562  H HB2  . TRP A 1 56 ? -6.572  -5.203  0.171   1.00 0.00 ? 56 TRP A HB2  9  
ATOM 9563  H HB3  . TRP A 1 56 ? -6.312  -5.685  1.842   1.00 0.00 ? 56 TRP A HB3  9  
ATOM 9564  H HD1  . TRP A 1 56 ? -8.256  -2.566  0.623   1.00 0.00 ? 56 TRP A HD1  9  
ATOM 9565  H HE1  . TRP A 1 56 ? -10.661 -2.735  1.544   1.00 0.00 ? 56 TRP A HE1  9  
ATOM 9566  H HE3  . TRP A 1 56 ? -7.963  -7.160  2.824   1.00 0.00 ? 56 TRP A HE3  9  
ATOM 9567  H HZ2  . TRP A 1 56 ? -12.211 -4.554  3.000   1.00 0.00 ? 56 TRP A HZ2  9  
ATOM 9568  H HZ3  . TRP A 1 56 ? -9.958  -8.051  3.968   1.00 0.00 ? 56 TRP A HZ3  9  
ATOM 9569  H HH2  . TRP A 1 56 ? -12.040 -6.774  4.054   1.00 0.00 ? 56 TRP A HH2  9  
ATOM 9570  N N    . ARG A 1 57 ? -5.621  -3.488  3.794   1.00 0.00 ? 57 ARG A N    9  
ATOM 9571  C CA   . ARG A 1 57 ? -5.853  -2.821  5.073   1.00 0.00 ? 57 ARG A CA   9  
ATOM 9572  C C    . ARG A 1 57 ? -5.282  -1.410  5.053   1.00 0.00 ? 57 ARG A C    9  
ATOM 9573  O O    . ARG A 1 57 ? -5.911  -0.464  5.528   1.00 0.00 ? 57 ARG A O    9  
ATOM 9574  C CB   . ARG A 1 57 ? -5.220  -3.622  6.213   1.00 0.00 ? 57 ARG A CB   9  
ATOM 9575  C CG   . ARG A 1 57 ? -5.650  -5.079  6.247   1.00 0.00 ? 57 ARG A CG   9  
ATOM 9576  C CD   . ARG A 1 57 ? -6.536  -5.370  7.447   1.00 0.00 ? 57 ARG A CD   9  
ATOM 9577  N NE   . ARG A 1 57 ? -7.237  -6.644  7.315   1.00 0.00 ? 57 ARG A NE   9  
ATOM 9578  C CZ   . ARG A 1 57 ? -8.279  -6.991  8.063   1.00 0.00 ? 57 ARG A CZ   9  
ATOM 9579  N NH1  . ARG A 1 57 ? -8.738  -6.161  8.990   1.00 0.00 ? 57 ARG A NH1  9  
ATOM 9580  N NH2  . ARG A 1 57 ? -8.864  -8.167  7.884   1.00 0.00 ? 57 ARG A NH2  9  
ATOM 9581  H H    . ARG A 1 57 ? -5.221  -4.380  3.787   1.00 0.00 ? 57 ARG A H    9  
ATOM 9582  H HA   . ARG A 1 57 ? -6.918  -2.763  5.229   1.00 0.00 ? 57 ARG A HA   9  
ATOM 9583  H HB2  . ARG A 1 57 ? -4.146  -3.589  6.108   1.00 0.00 ? 57 ARG A HB2  9  
ATOM 9584  H HB3  . ARG A 1 57 ? -5.495  -3.167  7.153   1.00 0.00 ? 57 ARG A HB3  9  
ATOM 9585  H HG2  . ARG A 1 57 ? -6.199  -5.303  5.343   1.00 0.00 ? 57 ARG A HG2  9  
ATOM 9586  H HG3  . ARG A 1 57 ? -4.771  -5.703  6.301   1.00 0.00 ? 57 ARG A HG3  9  
ATOM 9587  H HD2  . ARG A 1 57 ? -5.921  -5.399  8.333   1.00 0.00 ? 57 ARG A HD2  9  
ATOM 9588  H HD3  . ARG A 1 57 ? -7.264  -4.578  7.540   1.00 0.00 ? 57 ARG A HD3  9  
ATOM 9589  H HE   . ARG A 1 57 ? -6.914  -7.271  6.635   1.00 0.00 ? 57 ARG A HE   9  
ATOM 9590  H HH11 . ARG A 1 57 ? -8.300  -5.273  9.128   1.00 0.00 ? 57 ARG A HH11 9  
ATOM 9591  H HH12 . ARG A 1 57 ? -9.522  -6.425  9.551   1.00 0.00 ? 57 ARG A HH12 9  
ATOM 9592  H HH21 . ARG A 1 57 ? -8.521  -8.795  7.186   1.00 0.00 ? 57 ARG A HH21 9  
ATOM 9593  H HH22 . ARG A 1 57 ? -9.648  -8.427  8.448   1.00 0.00 ? 57 ARG A HH22 9  
ATOM 9594  N N    . GLY A 1 58 ? -4.088  -1.275  4.494   1.00 0.00 ? 58 GLY A N    9  
ATOM 9595  C CA   . GLY A 1 58 ? -3.466  0.027   4.384   1.00 0.00 ? 58 GLY A CA   9  
ATOM 9596  C C    . GLY A 1 58 ? -4.059  0.840   3.251   1.00 0.00 ? 58 GLY A C    9  
ATOM 9597  O O    . GLY A 1 58 ? -3.971  2.068   3.247   1.00 0.00 ? 58 GLY A O    9  
ATOM 9598  H H    . GLY A 1 58 ? -3.641  -2.062  4.123   1.00 0.00 ? 58 GLY A H    9  
ATOM 9599  H HA2  . GLY A 1 58 ? -3.605  0.562   5.311   1.00 0.00 ? 58 GLY A HA2  9  
ATOM 9600  H HA3  . GLY A 1 58 ? -2.408  -0.103  4.208   1.00 0.00 ? 58 GLY A HA3  9  
ATOM 9601  N N    . LEU A 1 59 ? -4.673  0.152   2.290   1.00 0.00 ? 59 LEU A N    9  
ATOM 9602  C CA   . LEU A 1 59 ? -5.289  0.818   1.151   1.00 0.00 ? 59 LEU A CA   9  
ATOM 9603  C C    . LEU A 1 59 ? -6.709  1.265   1.481   1.00 0.00 ? 59 LEU A C    9  
ATOM 9604  O O    . LEU A 1 59 ? -7.237  2.194   0.874   1.00 0.00 ? 59 LEU A O    9  
ATOM 9605  C CB   . LEU A 1 59 ? -5.282  -0.090  -0.069  1.00 0.00 ? 59 LEU A CB   9  
ATOM 9606  C CG   . LEU A 1 59 ? -4.407  0.414   -1.210  1.00 0.00 ? 59 LEU A CG   9  
ATOM 9607  C CD1  . LEU A 1 59 ? -3.018  0.747   -0.691  1.00 0.00 ? 59 LEU A CD1  9  
ATOM 9608  C CD2  . LEU A 1 59 ? -4.326  -0.620  -2.320  1.00 0.00 ? 59 LEU A CD2  9  
ATOM 9609  H H    . LEU A 1 59 ? -4.711  -0.824  2.349   1.00 0.00 ? 59 LEU A H    9  
ATOM 9610  H HA   . LEU A 1 59 ? -4.696  1.691   0.932   1.00 0.00 ? 59 LEU A HA   9  
ATOM 9611  H HB2  . LEU A 1 59 ? -4.918  -1.057  0.236   1.00 0.00 ? 59 LEU A HB2  9  
ATOM 9612  H HB3  . LEU A 1 59 ? -6.295  -0.196  -0.428  1.00 0.00 ? 59 LEU A HB3  9  
ATOM 9613  H HG   . LEU A 1 59 ? -4.843  1.319   -1.616  1.00 0.00 ? 59 LEU A HG   9  
ATOM 9614  H HD11 . LEU A 1 59 ? -2.833  1.802   -0.812  1.00 0.00 ? 59 LEU A HD11 9  
ATOM 9615  H HD12 . LEU A 1 59 ? -2.281  0.185   -1.245  1.00 0.00 ? 59 LEU A HD12 9  
ATOM 9616  H HD13 . LEU A 1 59 ? -2.954  0.489   0.356   1.00 0.00 ? 59 LEU A HD13 9  
ATOM 9617  H HD21 . LEU A 1 59 ? -5.257  -1.166  -2.373  1.00 0.00 ? 59 LEU A HD21 9  
ATOM 9618  H HD22 . LEU A 1 59 ? -3.518  -1.305  -2.117  1.00 0.00 ? 59 LEU A HD22 9  
ATOM 9619  H HD23 . LEU A 1 59 ? -4.148  -0.123  -3.262  1.00 0.00 ? 59 LEU A HD23 9  
ATOM 9620  N N    . GLN A 1 60 ? -7.332  0.598   2.442   1.00 0.00 ? 60 GLN A N    9  
ATOM 9621  C CA   . GLN A 1 60 ? -8.632  1.037   2.916   1.00 0.00 ? 60 GLN A CA   9  
ATOM 9622  C C    . GLN A 1 60 ? -8.455  2.298   3.768   1.00 0.00 ? 60 GLN A C    9  
ATOM 9623  O O    . GLN A 1 60 ? -9.421  2.997   4.069   1.00 0.00 ? 60 GLN A O    9  
ATOM 9624  C CB   . GLN A 1 60 ? -9.332  -0.064  3.719   1.00 0.00 ? 60 GLN A CB   9  
ATOM 9625  C CG   . GLN A 1 60 ? -8.470  -0.674  4.812   1.00 0.00 ? 60 GLN A CG   9  
ATOM 9626  C CD   . GLN A 1 60 ? -9.220  -1.699  5.639   1.00 0.00 ? 60 GLN A CD   9  
ATOM 9627  O OE1  . GLN A 1 60 ? -9.745  -1.387  6.709   1.00 0.00 ? 60 GLN A OE1  9  
ATOM 9628  N NE2  . GLN A 1 60 ? -9.277  -2.931  5.146   1.00 0.00 ? 60 GLN A NE2  9  
ATOM 9629  H H    . GLN A 1 60 ? -6.850  -0.097  2.936   1.00 0.00 ? 60 GLN A H    9  
ATOM 9630  H HA   . GLN A 1 60 ? -9.235  1.283   2.054   1.00 0.00 ? 60 GLN A HA   9  
ATOM 9631  H HB2  . GLN A 1 60 ? -10.216 0.351   4.179   1.00 0.00 ? 60 GLN A HB2  9  
ATOM 9632  H HB3  . GLN A 1 60 ? -9.627  -0.853  3.042   1.00 0.00 ? 60 GLN A HB3  9  
ATOM 9633  H HG2  . GLN A 1 60 ? -7.621  -1.157  4.355   1.00 0.00 ? 60 GLN A HG2  9  
ATOM 9634  H HG3  . GLN A 1 60 ? -8.128  0.115   5.466   1.00 0.00 ? 60 GLN A HG3  9  
ATOM 9635  H HE21 . GLN A 1 60 ? -8.837  -3.105  4.288   1.00 0.00 ? 60 GLN A HE21 9  
ATOM 9636  H HE22 . GLN A 1 60 ? -9.756  -3.614  5.659   1.00 0.00 ? 60 GLN A HE22 9  
ATOM 9637  N N    . ASP A 1 61 ? -7.194  2.602   4.112   1.00 0.00 ? 61 ASP A N    9  
ATOM 9638  C CA   . ASP A 1 61 ? -6.865  3.788   4.880   1.00 0.00 ? 61 ASP A CA   9  
ATOM 9639  C C    . ASP A 1 61 ? -6.831  5.015   3.973   1.00 0.00 ? 61 ASP A C    9  
ATOM 9640  O O    . ASP A 1 61 ? -7.278  6.094   4.359   1.00 0.00 ? 61 ASP A O    9  
ATOM 9641  C CB   . ASP A 1 61 ? -5.511  3.601   5.569   1.00 0.00 ? 61 ASP A CB   9  
ATOM 9642  C CG   . ASP A 1 61 ? -5.592  3.804   7.068   1.00 0.00 ? 61 ASP A CG   9  
ATOM 9643  O OD1  . ASP A 1 61 ? -6.687  3.602   7.636   1.00 0.00 ? 61 ASP A OD1  9  
ATOM 9644  O OD2  . ASP A 1 61 ? -4.563  4.165   7.676   1.00 0.00 ? 61 ASP A OD2  9  
ATOM 9645  H H    . ASP A 1 61 ? -6.465  2.017   3.831   1.00 0.00 ? 61 ASP A H    9  
ATOM 9646  H HA   . ASP A 1 61 ? -7.630  3.925   5.630   1.00 0.00 ? 61 ASP A HA   9  
ATOM 9647  H HB2  . ASP A 1 61 ? -5.152  2.596   5.378   1.00 0.00 ? 61 ASP A HB2  9  
ATOM 9648  H HB3  . ASP A 1 61 ? -4.807  4.313   5.165   1.00 0.00 ? 61 ASP A HB3  9  
ATOM 9649  N N    . LEU A 1 62 ? -6.317  4.844   2.753   1.00 0.00 ? 62 LEU A N    9  
ATOM 9650  C CA   . LEU A 1 62 ? -6.273  5.948   1.792   1.00 0.00 ? 62 LEU A CA   9  
ATOM 9651  C C    . LEU A 1 62 ? -7.658  6.568   1.652   1.00 0.00 ? 62 LEU A C    9  
ATOM 9652  O O    . LEU A 1 62 ? -7.797  7.754   1.354   1.00 0.00 ? 62 LEU A O    9  
ATOM 9653  C CB   . LEU A 1 62 ? -5.796  5.491   0.403   1.00 0.00 ? 62 LEU A CB   9  
ATOM 9654  C CG   . LEU A 1 62 ? -4.926  4.238   0.347   1.00 0.00 ? 62 LEU A CG   9  
ATOM 9655  C CD1  . LEU A 1 62 ? -4.502  3.963   -1.087  1.00 0.00 ? 62 LEU A CD1  9  
ATOM 9656  C CD2  . LEU A 1 62 ? -3.714  4.370   1.243   1.00 0.00 ? 62 LEU A CD2  9  
ATOM 9657  H H    . LEU A 1 62 ? -5.993  3.958   2.489   1.00 0.00 ? 62 LEU A H    9  
ATOM 9658  H HA   . LEU A 1 62 ? -5.591  6.694   2.173   1.00 0.00 ? 62 LEU A HA   9  
ATOM 9659  H HB2  . LEU A 1 62 ? -6.671  5.303   -0.202  1.00 0.00 ? 62 LEU A HB2  9  
ATOM 9660  H HB3  . LEU A 1 62 ? -5.243  6.302   -0.045  1.00 0.00 ? 62 LEU A HB3  9  
ATOM 9661  H HG   . LEU A 1 62 ? -5.500  3.400   0.691   1.00 0.00 ? 62 LEU A HG   9  
ATOM 9662  H HD11 . LEU A 1 62 ? -4.564  4.876   -1.662  1.00 0.00 ? 62 LEU A HD11 9  
ATOM 9663  H HD12 . LEU A 1 62 ? -5.155  3.221   -1.519  1.00 0.00 ? 62 LEU A HD12 9  
ATOM 9664  H HD13 . LEU A 1 62 ? -3.485  3.600   -1.099  1.00 0.00 ? 62 LEU A HD13 9  
ATOM 9665  H HD21 . LEU A 1 62 ? -3.059  5.131   0.848   1.00 0.00 ? 62 LEU A HD21 9  
ATOM 9666  H HD22 . LEU A 1 62 ? -3.190  3.422   1.274   1.00 0.00 ? 62 LEU A HD22 9  
ATOM 9667  H HD23 . LEU A 1 62 ? -4.031  4.642   2.238   1.00 0.00 ? 62 LEU A HD23 9  
ATOM 9668  N N    . LYS A 1 63 ? -8.677  5.742   1.858   1.00 0.00 ? 63 LYS A N    9  
ATOM 9669  C CA   . LYS A 1 63 ? -10.061 6.177   1.728   1.00 0.00 ? 63 LYS A CA   9  
ATOM 9670  C C    . LYS A 1 63 ? -10.609 6.710   3.050   1.00 0.00 ? 63 LYS A C    9  
ATOM 9671  O O    . LYS A 1 63 ? -10.872 7.905   3.184   1.00 0.00 ? 63 LYS A O    9  
ATOM 9672  C CB   . LYS A 1 63 ? -10.926 5.013   1.235   1.00 0.00 ? 63 LYS A CB   9  
ATOM 9673  C CG   . LYS A 1 63 ? -12.077 5.442   0.339   1.00 0.00 ? 63 LYS A CG   9  
ATOM 9674  C CD   . LYS A 1 63 ? -12.979 6.452   1.028   1.00 0.00 ? 63 LYS A CD   9  
ATOM 9675  C CE   . LYS A 1 63 ? -12.688 7.869   0.560   1.00 0.00 ? 63 LYS A CE   9  
ATOM 9676  N NZ   . LYS A 1 63 ? -13.629 8.304   -0.508  1.00 0.00 ? 63 LYS A NZ   9  
ATOM 9677  H H    . LYS A 1 63 ? -8.491  4.805   2.077   1.00 0.00 ? 63 LYS A H    9  
ATOM 9678  H HA   . LYS A 1 63 ? -10.089 6.970   0.996   1.00 0.00 ? 63 LYS A HA   9  
ATOM 9679  H HB2  . LYS A 1 63 ? -10.303 4.330   0.677   1.00 0.00 ? 63 LYS A HB2  9  
ATOM 9680  H HB3  . LYS A 1 63 ? -11.335 4.494   2.089   1.00 0.00 ? 63 LYS A HB3  9  
ATOM 9681  H HG2  . LYS A 1 63 ? -11.674 5.888   -0.559  1.00 0.00 ? 63 LYS A HG2  9  
ATOM 9682  H HG3  . LYS A 1 63 ? -12.661 4.571   0.078   1.00 0.00 ? 63 LYS A HG3  9  
ATOM 9683  H HD2  . LYS A 1 63 ? -14.008 6.213   0.802   1.00 0.00 ? 63 LYS A HD2  9  
ATOM 9684  H HD3  . LYS A 1 63 ? -12.821 6.395   2.094   1.00 0.00 ? 63 LYS A HD3  9  
ATOM 9685  H HE2  . LYS A 1 63 ? -12.779 8.539   1.402   1.00 0.00 ? 63 LYS A HE2  9  
ATOM 9686  H HE3  . LYS A 1 63 ? -11.679 7.907   0.176   1.00 0.00 ? 63 LYS A HE3  9  
ATOM 9687  H HZ1  . LYS A 1 63 ? -13.105 8.752   -1.287  1.00 0.00 ? 63 LYS A HZ1  9  
ATOM 9688  H HZ2  . LYS A 1 63 ? -14.313 8.989   -0.126  1.00 0.00 ? 63 LYS A HZ2  9  
ATOM 9689  H HZ3  . LYS A 1 63 ? -14.150 7.484   -0.883  1.00 0.00 ? 63 LYS A HZ3  9  
ATOM 9690  N N    . GLN A 1 64 ? -10.798 5.817   4.016   1.00 0.00 ? 64 GLN A N    9  
ATOM 9691  C CA   . GLN A 1 64 ? -11.350 6.198   5.313   1.00 0.00 ? 64 GLN A CA   9  
ATOM 9692  C C    . GLN A 1 64 ? -10.258 6.414   6.344   1.00 0.00 ? 64 GLN A C    9  
ATOM 9693  O O    . GLN A 1 64 ? -10.442 6.159   7.533   1.00 0.00 ? 64 GLN A O    9  
ATOM 9694  C CB   . GLN A 1 64 ? -12.309 5.134   5.803   1.00 0.00 ? 64 GLN A CB   9  
ATOM 9695  C CG   . GLN A 1 64 ? -13.740 5.417   5.407   1.00 0.00 ? 64 GLN A CG   9  
ATOM 9696  C CD   . GLN A 1 64 ? -14.696 5.384   6.585   1.00 0.00 ? 64 GLN A CD   9  
ATOM 9697  O OE1  . GLN A 1 64 ? -15.634 4.588   6.615   1.00 0.00 ? 64 GLN A OE1  9  
ATOM 9698  N NE2  . GLN A 1 64 ? -14.462 6.253   7.561   1.00 0.00 ? 64 GLN A NE2  9  
ATOM 9699  H H    . GLN A 1 64 ? -10.584 4.875   3.846   1.00 0.00 ? 64 GLN A H    9  
ATOM 9700  H HA   . GLN A 1 64 ? -11.891 7.124   5.181   1.00 0.00 ? 64 GLN A HA   9  
ATOM 9701  H HB2  . GLN A 1 64 ? -12.018 4.181   5.387   1.00 0.00 ? 64 GLN A HB2  9  
ATOM 9702  H HB3  . GLN A 1 64 ? -12.249 5.086   6.878   1.00 0.00 ? 64 GLN A HB3  9  
ATOM 9703  H HG2  . GLN A 1 64 ? -13.776 6.399   4.958   1.00 0.00 ? 64 GLN A HG2  9  
ATOM 9704  H HG3  . GLN A 1 64 ? -14.053 4.679   4.685   1.00 0.00 ? 64 GLN A HG3  9  
ATOM 9705  H HE21 . GLN A 1 64 ? -13.696 6.857   7.468   1.00 0.00 ? 64 GLN A HE21 9  
ATOM 9706  H HE22 . GLN A 1 64 ? -15.064 6.254   8.334   1.00 0.00 ? 64 GLN A HE22 9  
ATOM 9707  N N    . GLY A 1 65 ? -9.135  6.897   5.869   1.00 0.00 ? 65 GLY A N    9  
ATOM 9708  C CA   . GLY A 1 65 ? -8.004  7.165   6.740   1.00 0.00 ? 65 GLY A CA   9  
ATOM 9709  C C    . GLY A 1 65 ? -7.471  8.582   6.605   1.00 0.00 ? 65 GLY A C    9  
ATOM 9710  O O    . GLY A 1 65 ? -6.526  8.959   7.297   1.00 0.00 ? 65 GLY A O    9  
ATOM 9711  H H    . GLY A 1 65 ? -9.076  7.073   4.912   1.00 0.00 ? 65 GLY A H    9  
ATOM 9712  H HA2  . GLY A 1 65 ? -8.310  7.006   7.762   1.00 0.00 ? 65 GLY A HA2  9  
ATOM 9713  H HA3  . GLY A 1 65 ? -7.211  6.471   6.503   1.00 0.00 ? 65 GLY A HA3  9  
ATOM 9714  N N    . HIS A 1 66 ? -8.074  9.371   5.718   1.00 0.00 ? 66 HIS A N    9  
ATOM 9715  C CA   . HIS A 1 66 ? -7.643  10.749  5.509   1.00 0.00 ? 66 HIS A CA   9  
ATOM 9716  C C    . HIS A 1 66 ? -8.845  11.671  5.324   1.00 0.00 ? 66 HIS A C    9  
ATOM 9717  O O    . HIS A 1 66 ? -9.697  11.433  4.468   1.00 0.00 ? 66 HIS A O    9  
ATOM 9718  C CB   . HIS A 1 66 ? -6.723  10.838  4.290   1.00 0.00 ? 66 HIS A CB   9  
ATOM 9719  C CG   . HIS A 1 66 ? -5.267  10.788  4.634   1.00 0.00 ? 66 HIS A CG   9  
ATOM 9720  N ND1  . HIS A 1 66 ? -4.599  9.614   4.919   1.00 0.00 ? 66 HIS A ND1  9  
ATOM 9721  C CD2  . HIS A 1 66 ? -4.345  11.775  4.734   1.00 0.00 ? 66 HIS A CD2  9  
ATOM 9722  C CE1  . HIS A 1 66 ? -3.333  9.882   5.182   1.00 0.00 ? 66 HIS A CE1  9  
ATOM 9723  N NE2  . HIS A 1 66 ? -3.153  11.185  5.076   1.00 0.00 ? 66 HIS A NE2  9  
ATOM 9724  H H    . HIS A 1 66 ? -8.821  9.021   5.192   1.00 0.00 ? 66 HIS A H    9  
ATOM 9725  H HA   . HIS A 1 66 ? -7.097  11.061  6.386   1.00 0.00 ? 66 HIS A HA   9  
ATOM 9726  H HB2  . HIS A 1 66 ? -6.936  10.013  3.626   1.00 0.00 ? 66 HIS A HB2  9  
ATOM 9727  H HB3  . HIS A 1 66 ? -6.910  11.767  3.773   1.00 0.00 ? 66 HIS A HB3  9  
ATOM 9728  H HD1  . HIS A 1 66 ? -4.996  8.718   4.929   1.00 0.00 ? 66 HIS A HD1  9  
ATOM 9729  H HD2  . HIS A 1 66 ? -4.516  12.831  4.575   1.00 0.00 ? 66 HIS A HD2  9  
ATOM 9730  H HE1  . HIS A 1 66 ? -2.573  9.159   5.439   1.00 0.00 ? 66 HIS A HE1  9  
ATOM 9731  H HE2  . HIS A 1 66 ? -2.305  11.654  5.219   1.00 0.00 ? 66 HIS A HE2  9  
ATOM 9732  N N    . ASP A 1 67 ? -8.916  12.717  6.144   1.00 0.00 ? 67 ASP A N    9  
ATOM 9733  C CA   . ASP A 1 67 ? -10.007 13.677  6.077   1.00 0.00 ? 67 ASP A CA   9  
ATOM 9734  C C    . ASP A 1 67 ? -9.970  14.612  7.277   1.00 0.00 ? 67 ASP A C    9  
ATOM 9735  O O    . ASP A 1 67 ? -9.598  14.213  8.380   1.00 0.00 ? 67 ASP A O    9  
ATOM 9736  C CB   . ASP A 1 67 ? -11.360 12.963  6.024   1.00 0.00 ? 67 ASP A CB   9  
ATOM 9737  C CG   . ASP A 1 67 ? -11.433 11.789  6.981   1.00 0.00 ? 67 ASP A CG   9  
ATOM 9738  O OD1  . ASP A 1 67 ? -11.581 12.025  8.199   1.00 0.00 ? 67 ASP A OD1  9  
ATOM 9739  O OD2  . ASP A 1 67 ? -11.344 10.635  6.514   1.00 0.00 ? 67 ASP A OD2  9  
ATOM 9740  H H    . ASP A 1 67 ? -8.208  12.857  6.802   1.00 0.00 ? 67 ASP A H    9  
ATOM 9741  H HA   . ASP A 1 67 ? -9.881  14.260  5.177   1.00 0.00 ? 67 ASP A HA   9  
ATOM 9742  H HB2  . ASP A 1 67 ? -12.139 13.665  6.283   1.00 0.00 ? 67 ASP A HB2  9  
ATOM 9743  H HB3  . ASP A 1 67 ? -11.529 12.596  5.022   1.00 0.00 ? 67 ASP A HB3  9  
ATOM 9744  N N    . TYR A 1 68 ? -10.379 15.854  7.052   1.00 0.00 ? 68 TYR A N    9  
ATOM 9745  C CA   . TYR A 1 68 ? -10.411 16.874  8.102   1.00 0.00 ? 68 TYR A CA   9  
ATOM 9746  C C    . TYR A 1 68 ? -10.887 16.300  9.435   1.00 0.00 ? 68 TYR A C    9  
ATOM 9747  O O    . TYR A 1 68 ? -12.094 15.998  9.550   1.00 0.00 ? 68 TYR A O    9  
ATOM 9748  C CB   . TYR A 1 68 ? -11.332 18.018  7.681   1.00 0.00 ? 68 TYR A CB   9  
ATOM 9749  C CG   . TYR A 1 68 ? -10.606 19.188  7.053   1.00 0.00 ? 68 TYR A CG   9  
ATOM 9750  C CD1  . TYR A 1 68 ? -9.902  19.038  5.865   1.00 0.00 ? 68 TYR A CD1  9  
ATOM 9751  C CD2  . TYR A 1 68 ? -10.630 20.444  7.647   1.00 0.00 ? 68 TYR A CD2  9  
ATOM 9752  C CE1  . TYR A 1 68 ? -9.240  20.106  5.288   1.00 0.00 ? 68 TYR A CE1  9  
ATOM 9753  C CE2  . TYR A 1 68 ? -9.970  21.516  7.077   1.00 0.00 ? 68 TYR A CE2  9  
ATOM 9754  C CZ   . TYR A 1 68 ? -9.277  21.342  5.899   1.00 0.00 ? 68 TYR A CZ   9  
ATOM 9755  O OH   . TYR A 1 68 ? -8.619  22.406  5.328   1.00 0.00 ? 68 TYR A OH   9  
ATOM 9756  O OXT  . TYR A 1 68 ? -10.049 16.155  10.350  1.00 0.00 ? 68 TYR A OXT  9  
ATOM 9757  H H    . TYR A 1 68 ? -10.658 16.096  6.147   1.00 0.00 ? 68 TYR A H    9  
ATOM 9758  H HA   . TYR A 1 68 ? -9.409  17.255  8.225   1.00 0.00 ? 68 TYR A HA   9  
ATOM 9759  H HB2  . TYR A 1 68 ? -12.047 17.647  6.961   1.00 0.00 ? 68 TYR A HB2  9  
ATOM 9760  H HB3  . TYR A 1 68 ? -11.858 18.384  8.549   1.00 0.00 ? 68 TYR A HB3  9  
ATOM 9761  H HD1  . TYR A 1 68 ? -9.875  18.069  5.389   1.00 0.00 ? 68 TYR A HD1  9  
ATOM 9762  H HD2  . TYR A 1 68 ? -11.173 20.577  8.571   1.00 0.00 ? 68 TYR A HD2  9  
ATOM 9763  H HE1  . TYR A 1 68 ? -8.697  19.969  4.365   1.00 0.00 ? 68 TYR A HE1  9  
ATOM 9764  H HE2  . TYR A 1 68 ? -9.999  22.484  7.556   1.00 0.00 ? 68 TYR A HE2  9  
ATOM 9765  H HH   . TYR A 1 68 ? -7.871  22.653  5.877   1.00 0.00 ? 68 TYR A HH   9  
ATOM 9766  N N    . TYR A 1 1  ? 10.998  21.681  -6.567  1.00 0.00 ? 1  TYR A N    10 
ATOM 9767  C CA   . TYR A 1 1  ? 10.698  20.605  -5.586  1.00 0.00 ? 1  TYR A CA   10 
ATOM 9768  C C    . TYR A 1 1  ? 9.235   20.186  -5.660  1.00 0.00 ? 1  TYR A C    10 
ATOM 9769  O O    . TYR A 1 1  ? 8.334   21.004  -5.473  1.00 0.00 ? 1  TYR A O    10 
ATOM 9770  C CB   . TYR A 1 1  ? 11.026  21.119  -4.183  1.00 0.00 ? 1  TYR A CB   10 
ATOM 9771  C CG   . TYR A 1 1  ? 12.334  21.874  -4.102  1.00 0.00 ? 1  TYR A CG   10 
ATOM 9772  C CD1  . TYR A 1 1  ? 13.525  21.211  -3.837  1.00 0.00 ? 1  TYR A CD1  10 
ATOM 9773  C CD2  . TYR A 1 1  ? 12.374  23.251  -4.284  1.00 0.00 ? 1  TYR A CD2  10 
ATOM 9774  C CE1  . TYR A 1 1  ? 14.722  21.898  -3.758  1.00 0.00 ? 1  TYR A CE1  10 
ATOM 9775  C CE2  . TYR A 1 1  ? 13.567  23.945  -4.208  1.00 0.00 ? 1  TYR A CE2  10 
ATOM 9776  C CZ   . TYR A 1 1  ? 14.737  23.264  -3.945  1.00 0.00 ? 1  TYR A CZ   10 
ATOM 9777  O OH   . TYR A 1 1  ? 15.926  23.952  -3.869  1.00 0.00 ? 1  TYR A OH   10 
ATOM 9778  H H1   . TYR A 1 1  ? 12.006  21.611  -6.816  1.00 0.00 ? 1  TYR A H1   10 
ATOM 9779  H H2   . TYR A 1 1  ? 10.785  22.592  -6.113  1.00 0.00 ? 1  TYR A H2   10 
ATOM 9780  H H3   . TYR A 1 1  ? 10.394  21.527  -7.400  1.00 0.00 ? 1  TYR A H3   10 
ATOM 9781  H HA   . TYR A 1 1  ? 11.322  19.752  -5.810  1.00 0.00 ? 1  TYR A HA   10 
ATOM 9782  H HB2  . TYR A 1 1  ? 10.240  21.783  -3.858  1.00 0.00 ? 1  TYR A HB2  10 
ATOM 9783  H HB3  . TYR A 1 1  ? 11.086  20.280  -3.506  1.00 0.00 ? 1  TYR A HB3  10 
ATOM 9784  H HD1  . TYR A 1 1  ? 13.510  20.141  -3.691  1.00 0.00 ? 1  TYR A HD1  10 
ATOM 9785  H HD2  . TYR A 1 1  ? 11.457  23.780  -4.490  1.00 0.00 ? 1  TYR A HD2  10 
ATOM 9786  H HE1  . TYR A 1 1  ? 15.637  21.365  -3.553  1.00 0.00 ? 1  TYR A HE1  10 
ATOM 9787  H HE2  . TYR A 1 1  ? 13.579  25.015  -4.354  1.00 0.00 ? 1  TYR A HE2  10 
ATOM 9788  H HH   . TYR A 1 1  ? 15.789  24.776  -3.396  1.00 0.00 ? 1  TYR A HH   10 
ATOM 9789  N N    . HIS A 1 2  ? 9.004   18.906  -5.928  1.00 0.00 ? 2  HIS A N    10 
ATOM 9790  C CA   . HIS A 1 2  ? 7.649   18.379  -6.023  1.00 0.00 ? 2  HIS A CA   10 
ATOM 9791  C C    . HIS A 1 2  ? 7.661   16.857  -6.113  1.00 0.00 ? 2  HIS A C    10 
ATOM 9792  O O    . HIS A 1 2  ? 8.335   16.281  -6.967  1.00 0.00 ? 2  HIS A O    10 
ATOM 9793  C CB   . HIS A 1 2  ? 6.935   18.967  -7.242  1.00 0.00 ? 2  HIS A CB   10 
ATOM 9794  C CG   . HIS A 1 2  ? 7.690   18.785  -8.521  1.00 0.00 ? 2  HIS A CG   10 
ATOM 9795  N ND1  . HIS A 1 2  ? 7.111   18.302  -9.676  1.00 0.00 ? 2  HIS A ND1  10 
ATOM 9796  C CD2  . HIS A 1 2  ? 8.988   19.022  -8.825  1.00 0.00 ? 2  HIS A CD2  10 
ATOM 9797  C CE1  . HIS A 1 2  ? 8.019   18.250  -10.633 1.00 0.00 ? 2  HIS A CE1  10 
ATOM 9798  N NE2  . HIS A 1 2  ? 9.166   18.682  -10.143 1.00 0.00 ? 2  HIS A NE2  10 
ATOM 9799  H H    . HIS A 1 2  ? 9.763   18.302  -6.066  1.00 0.00 ? 2  HIS A H    10 
ATOM 9800  H HA   . HIS A 1 2  ? 7.117   18.670  -5.130  1.00 0.00 ? 2  HIS A HA   10 
ATOM 9801  H HB2  . HIS A 1 2  ? 5.973   18.489  -7.353  1.00 0.00 ? 2  HIS A HB2  10 
ATOM 9802  H HB3  . HIS A 1 2  ? 6.791   20.026  -7.089  1.00 0.00 ? 2  HIS A HB3  10 
ATOM 9803  H HD1  . HIS A 1 2  ? 6.173   18.035  -9.777  1.00 0.00 ? 2  HIS A HD1  10 
ATOM 9804  H HD2  . HIS A 1 2  ? 9.744   19.408  -8.154  1.00 0.00 ? 2  HIS A HD2  10 
ATOM 9805  H HE1  . HIS A 1 2  ? 7.851   17.912  -11.646 1.00 0.00 ? 2  HIS A HE1  10 
ATOM 9806  H HE2  . HIS A 1 2  ? 10.007  18.748  -10.642 1.00 0.00 ? 2  HIS A HE2  10 
ATOM 9807  N N    . ALA A 1 3  ? 6.912   16.213  -5.226  1.00 0.00 ? 3  ALA A N    10 
ATOM 9808  C CA   . ALA A 1 3  ? 6.838   14.758  -5.200  1.00 0.00 ? 3  ALA A CA   10 
ATOM 9809  C C    . ALA A 1 3  ? 5.738   14.283  -4.257  1.00 0.00 ? 3  ALA A C    10 
ATOM 9810  O O    . ALA A 1 3  ? 5.118   15.084  -3.556  1.00 0.00 ? 3  ALA A O    10 
ATOM 9811  C CB   . ALA A 1 3  ? 8.179   14.170  -4.791  1.00 0.00 ? 3  ALA A CB   10 
ATOM 9812  H H    . ALA A 1 3  ? 6.399   16.729  -4.569  1.00 0.00 ? 3  ALA A H    10 
ATOM 9813  H HA   . ALA A 1 3  ? 6.613   14.416  -6.199  1.00 0.00 ? 3  ALA A HA   10 
ATOM 9814  H HB1  . ALA A 1 3  ? 8.130   13.842  -3.763  1.00 0.00 ? 3  ALA A HB1  10 
ATOM 9815  H HB2  . ALA A 1 3  ? 8.948   14.922  -4.892  1.00 0.00 ? 3  ALA A HB2  10 
ATOM 9816  H HB3  . ALA A 1 3  ? 8.412   13.329  -5.427  1.00 0.00 ? 3  ALA A HB3  10 
ATOM 9817  N N    . ASP A 1 4  ? 5.504   12.976  -4.243  1.00 0.00 ? 4  ASP A N    10 
ATOM 9818  C CA   . ASP A 1 4  ? 4.481   12.392  -3.383  1.00 0.00 ? 4  ASP A CA   10 
ATOM 9819  C C    . ASP A 1 4  ? 5.062   11.261  -2.536  1.00 0.00 ? 4  ASP A C    10 
ATOM 9820  O O    . ASP A 1 4  ? 4.730   10.093  -2.733  1.00 0.00 ? 4  ASP A O    10 
ATOM 9821  C CB   . ASP A 1 4  ? 3.318   11.865  -4.225  1.00 0.00 ? 4  ASP A CB   10 
ATOM 9822  C CG   . ASP A 1 4  ? 2.643   12.958  -5.029  1.00 0.00 ? 4  ASP A CG   10 
ATOM 9823  O OD1  . ASP A 1 4  ? 2.162   13.934  -4.417  1.00 0.00 ? 4  ASP A OD1  10 
ATOM 9824  O OD2  . ASP A 1 4  ? 2.598   12.839  -6.271  1.00 0.00 ? 4  ASP A OD2  10 
ATOM 9825  H H    . ASP A 1 4  ? 6.033   12.390  -4.823  1.00 0.00 ? 4  ASP A H    10 
ATOM 9826  H HA   . ASP A 1 4  ? 4.118   13.168  -2.725  1.00 0.00 ? 4  ASP A HA   10 
ATOM 9827  H HB2  . ASP A 1 4  ? 3.687   11.116  -4.909  1.00 0.00 ? 4  ASP A HB2  10 
ATOM 9828  H HB3  . ASP A 1 4  ? 2.582   11.418  -3.571  1.00 0.00 ? 4  ASP A HB3  10 
ATOM 9829  N N    . PRO A 1 5  ? 5.944   11.597  -1.579  1.00 0.00 ? 5  PRO A N    10 
ATOM 9830  C CA   . PRO A 1 5  ? 6.573   10.602  -0.702  1.00 0.00 ? 5  PRO A CA   10 
ATOM 9831  C C    . PRO A 1 5  ? 5.547   9.721   0.003   1.00 0.00 ? 5  PRO A C    10 
ATOM 9832  O O    . PRO A 1 5  ? 5.795   8.543   0.254   1.00 0.00 ? 5  PRO A O    10 
ATOM 9833  C CB   . PRO A 1 5  ? 7.336   11.451  0.317   1.00 0.00 ? 5  PRO A CB   10 
ATOM 9834  C CG   . PRO A 1 5  ? 7.579   12.750  -0.371  1.00 0.00 ? 5  PRO A CG   10 
ATOM 9835  C CD   . PRO A 1 5  ? 6.400   12.967  -1.277  1.00 0.00 ? 5  PRO A CD   10 
ATOM 9836  H HA   . PRO A 1 5  ? 7.267   9.979   -1.246  1.00 0.00 ? 5  PRO A HA   10 
ATOM 9837  H HB2  . PRO A 1 5  ? 6.733   11.582  1.204   1.00 0.00 ? 5  PRO A HB2  10 
ATOM 9838  H HB3  . PRO A 1 5  ? 8.264   10.962  0.575   1.00 0.00 ? 5  PRO A HB3  10 
ATOM 9839  H HG2  . PRO A 1 5  ? 7.644   13.545  0.356   1.00 0.00 ? 5  PRO A HG2  10 
ATOM 9840  H HG3  . PRO A 1 5  ? 8.490   12.694  -0.949  1.00 0.00 ? 5  PRO A HG3  10 
ATOM 9841  H HD2  . PRO A 1 5  ? 5.628   13.526  -0.767  1.00 0.00 ? 5  PRO A HD2  10 
ATOM 9842  H HD3  . PRO A 1 5  ? 6.705   13.479  -2.177  1.00 0.00 ? 5  PRO A HD3  10 
ATOM 9843  N N    . SER A 1 6  ? 4.397   10.304  0.325   1.00 0.00 ? 6  SER A N    10 
ATOM 9844  C CA   . SER A 1 6  ? 3.335   9.574   1.007   1.00 0.00 ? 6  SER A CA   10 
ATOM 9845  C C    . SER A 1 6  ? 2.769   8.474   0.116   1.00 0.00 ? 6  SER A C    10 
ATOM 9846  O O    . SER A 1 6  ? 1.667   8.599   -0.418  1.00 0.00 ? 6  SER A O    10 
ATOM 9847  C CB   . SER A 1 6  ? 2.218   10.532  1.425   1.00 0.00 ? 6  SER A CB   10 
ATOM 9848  O OG   . SER A 1 6  ? 2.189   10.701  2.831   1.00 0.00 ? 6  SER A OG   10 
ATOM 9849  H H    . SER A 1 6  ? 4.260   11.247  0.101   1.00 0.00 ? 6  SER A H    10 
ATOM 9850  H HA   . SER A 1 6  ? 3.760   9.121   1.890   1.00 0.00 ? 6  SER A HA   10 
ATOM 9851  H HB2  . SER A 1 6  ? 2.382   11.494  0.963   1.00 0.00 ? 6  SER A HB2  10 
ATOM 9852  H HB3  . SER A 1 6  ? 1.267   10.135  1.103   1.00 0.00 ? 6  SER A HB3  10 
ATOM 9853  H HG   . SER A 1 6  ? 1.719   11.510  3.048   1.00 0.00 ? 6  SER A HG   10 
ATOM 9854  N N    . LEU A 1 7  ? 3.529   7.394   -0.039  1.00 0.00 ? 7  LEU A N    10 
ATOM 9855  C CA   . LEU A 1 7  ? 3.099   6.270   -0.862  1.00 0.00 ? 7  LEU A CA   10 
ATOM 9856  C C    . LEU A 1 7  ? 4.068   5.099   -0.739  1.00 0.00 ? 7  LEU A C    10 
ATOM 9857  O O    . LEU A 1 7  ? 3.717   4.045   -0.210  1.00 0.00 ? 7  LEU A O    10 
ATOM 9858  C CB   . LEU A 1 7  ? 2.979   6.698   -2.326  1.00 0.00 ? 7  LEU A CB   10 
ATOM 9859  C CG   . LEU A 1 7  ? 2.659   5.569   -3.312  1.00 0.00 ? 7  LEU A CG   10 
ATOM 9860  C CD1  . LEU A 1 7  ? 3.916   4.783   -3.649  1.00 0.00 ? 7  LEU A CD1  10 
ATOM 9861  C CD2  . LEU A 1 7  ? 1.588   4.646   -2.748  1.00 0.00 ? 7  LEU A CD2  10 
ATOM 9862  H H    . LEU A 1 7  ? 4.397   7.351   0.414   1.00 0.00 ? 7  LEU A H    10 
ATOM 9863  H HA   . LEU A 1 7  ? 2.128   5.955   -0.507  1.00 0.00 ? 7  LEU A HA   10 
ATOM 9864  H HB2  . LEU A 1 7  ? 2.199   7.441   -2.399  1.00 0.00 ? 7  LEU A HB2  10 
ATOM 9865  H HB3  . LEU A 1 7  ? 3.912   7.151   -2.624  1.00 0.00 ? 7  LEU A HB3  10 
ATOM 9866  H HG   . LEU A 1 7  ? 2.279   5.997   -4.228  1.00 0.00 ? 7  LEU A HG   10 
ATOM 9867  H HD11 . LEU A 1 7  ? 3.808   4.334   -4.625  1.00 0.00 ? 7  LEU A HD11 10 
ATOM 9868  H HD12 . LEU A 1 7  ? 4.066   4.008   -2.913  1.00 0.00 ? 7  LEU A HD12 10 
ATOM 9869  H HD13 . LEU A 1 7  ? 4.767   5.449   -3.651  1.00 0.00 ? 7  LEU A HD13 10 
ATOM 9870  H HD21 . LEU A 1 7  ? 1.953   4.184   -1.842  1.00 0.00 ? 7  LEU A HD21 10 
ATOM 9871  H HD22 . LEU A 1 7  ? 1.353   3.881   -3.472  1.00 0.00 ? 7  LEU A HD22 10 
ATOM 9872  H HD23 . LEU A 1 7  ? 0.699   5.218   -2.527  1.00 0.00 ? 7  LEU A HD23 10 
ATOM 9873  N N    . VAL A 1 8  ? 5.286   5.287   -1.237  1.00 0.00 ? 8  VAL A N    10 
ATOM 9874  C CA   . VAL A 1 8  ? 6.301   4.241   -1.185  1.00 0.00 ? 8  VAL A CA   10 
ATOM 9875  C C    . VAL A 1 8  ? 6.601   3.836   0.254   1.00 0.00 ? 8  VAL A C    10 
ATOM 9876  O O    . VAL A 1 8  ? 6.723   2.650   0.562   1.00 0.00 ? 8  VAL A O    10 
ATOM 9877  C CB   . VAL A 1 8  ? 7.610   4.693   -1.862  1.00 0.00 ? 8  VAL A CB   10 
ATOM 9878  C CG1  . VAL A 1 8  ? 7.357   5.079   -3.311  1.00 0.00 ? 8  VAL A CG1  10 
ATOM 9879  C CG2  . VAL A 1 8  ? 8.237   5.847   -1.096  1.00 0.00 ? 8  VAL A CG2  10 
ATOM 9880  H H    . VAL A 1 8  ? 5.506   6.148   -1.649  1.00 0.00 ? 8  VAL A H    10 
ATOM 9881  H HA   . VAL A 1 8  ? 5.924   3.383   -1.721  1.00 0.00 ? 8  VAL A HA   10 
ATOM 9882  H HB   . VAL A 1 8  ? 8.302   3.864   -1.850  1.00 0.00 ? 8  VAL A HB   10 
ATOM 9883  H HG11 . VAL A 1 8  ? 6.806   6.007   -3.345  1.00 0.00 ? 8  VAL A HG11 10 
ATOM 9884  H HG12 . VAL A 1 8  ? 6.785   4.302   -3.796  1.00 0.00 ? 8  VAL A HG12 10 
ATOM 9885  H HG13 . VAL A 1 8  ? 8.301   5.202   -3.821  1.00 0.00 ? 8  VAL A HG13 10 
ATOM 9886  H HG21 . VAL A 1 8  ? 7.523   6.653   -1.010  1.00 0.00 ? 8  VAL A HG21 10 
ATOM 9887  H HG22 . VAL A 1 8  ? 9.112   6.197   -1.623  1.00 0.00 ? 8  VAL A HG22 10 
ATOM 9888  H HG23 . VAL A 1 8  ? 8.521   5.512   -0.109  1.00 0.00 ? 8  VAL A HG23 10 
ATOM 9889  N N    . SER A 1 9  ? 6.721   4.828   1.130   1.00 0.00 ? 9  SER A N    10 
ATOM 9890  C CA   . SER A 1 9  ? 7.008   4.575   2.536   1.00 0.00 ? 9  SER A CA   10 
ATOM 9891  C C    . SER A 1 9  ? 5.948   3.671   3.157   1.00 0.00 ? 9  SER A C    10 
ATOM 9892  O O    . SER A 1 9  ? 6.247   2.852   4.025   1.00 0.00 ? 9  SER A O    10 
ATOM 9893  C CB   . SER A 1 9  ? 7.086   5.895   3.305   1.00 0.00 ? 9  SER A CB   10 
ATOM 9894  O OG   . SER A 1 9  ? 6.751   5.716   4.670   1.00 0.00 ? 9  SER A OG   10 
ATOM 9895  H H    . SER A 1 9  ? 6.614   5.752   0.823   1.00 0.00 ? 9  SER A H    10 
ATOM 9896  H HA   . SER A 1 9  ? 7.965   4.079   2.593   1.00 0.00 ? 9  SER A HA   10 
ATOM 9897  H HB2  . SER A 1 9  ? 8.091   6.284   3.243   1.00 0.00 ? 9  SER A HB2  10 
ATOM 9898  H HB3  . SER A 1 9  ? 6.398   6.604   2.869   1.00 0.00 ? 9  SER A HB3  10 
ATOM 9899  H HG   . SER A 1 9  ? 7.357   6.222   5.218   1.00 0.00 ? 9  SER A HG   10 
ATOM 9900  N N    . PHE A 1 10 ? 4.706   3.829   2.709   1.00 0.00 ? 10 PHE A N    10 
ATOM 9901  C CA   . PHE A 1 10 ? 3.601   3.031   3.226   1.00 0.00 ? 10 PHE A CA   10 
ATOM 9902  C C    . PHE A 1 10 ? 3.530   1.678   2.528   1.00 0.00 ? 10 PHE A C    10 
ATOM 9903  O O    . PHE A 1 10 ? 3.347   0.646   3.172   1.00 0.00 ? 10 PHE A O    10 
ATOM 9904  C CB   . PHE A 1 10 ? 2.278   3.779   3.048   1.00 0.00 ? 10 PHE A CB   10 
ATOM 9905  C CG   . PHE A 1 10 ? 1.451   3.847   4.300   1.00 0.00 ? 10 PHE A CG   10 
ATOM 9906  C CD1  . PHE A 1 10 ? 1.406   2.773   5.175   1.00 0.00 ? 10 PHE A CD1  10 
ATOM 9907  C CD2  . PHE A 1 10 ? 0.718   4.983   4.600   1.00 0.00 ? 10 PHE A CD2  10 
ATOM 9908  C CE1  . PHE A 1 10 ? 0.645   2.833   6.327   1.00 0.00 ? 10 PHE A CE1  10 
ATOM 9909  C CE2  . PHE A 1 10 ? -0.045  5.049   5.751   1.00 0.00 ? 10 PHE A CE2  10 
ATOM 9910  C CZ   . PHE A 1 10 ? -0.081  3.973   6.616   1.00 0.00 ? 10 PHE A CZ   10 
ATOM 9911  H H    . PHE A 1 10 ? 4.530   4.501   2.018   1.00 0.00 ? 10 PHE A H    10 
ATOM 9912  H HA   . PHE A 1 10 ? 3.776   2.868   4.279   1.00 0.00 ? 10 PHE A HA   10 
ATOM 9913  H HB2  . PHE A 1 10 ? 2.485   4.792   2.732   1.00 0.00 ? 10 PHE A HB2  10 
ATOM 9914  H HB3  . PHE A 1 10 ? 1.691   3.284   2.288   1.00 0.00 ? 10 PHE A HB3  10 
ATOM 9915  H HD1  . PHE A 1 10 ? 1.972   1.883   4.950   1.00 0.00 ? 10 PHE A HD1  10 
ATOM 9916  H HD2  . PHE A 1 10 ? 0.746   5.826   3.925   1.00 0.00 ? 10 PHE A HD2  10 
ATOM 9917  H HE1  . PHE A 1 10 ? 0.618   1.990   7.002   1.00 0.00 ? 10 PHE A HE1  10 
ATOM 9918  H HE2  . PHE A 1 10 ? -0.611  5.941   5.974   1.00 0.00 ? 10 PHE A HE2  10 
ATOM 9919  H HZ   . PHE A 1 10 ? -0.677  4.022   7.516   1.00 0.00 ? 10 PHE A HZ   10 
ATOM 9920  N N    . LEU A 1 11 ? 3.683   1.687   1.205   1.00 0.00 ? 11 LEU A N    10 
ATOM 9921  C CA   . LEU A 1 11 ? 3.639   0.459   0.417   1.00 0.00 ? 11 LEU A CA   10 
ATOM 9922  C C    . LEU A 1 11 ? 4.509   -0.623  1.041   1.00 0.00 ? 11 LEU A C    10 
ATOM 9923  O O    . LEU A 1 11 ? 4.043   -1.726  1.326   1.00 0.00 ? 11 LEU A O    10 
ATOM 9924  C CB   . LEU A 1 11 ? 4.106   0.737   -1.013  1.00 0.00 ? 11 LEU A CB   10 
ATOM 9925  C CG   . LEU A 1 11 ? 3.690   -0.312  -2.046  1.00 0.00 ? 11 LEU A CG   10 
ATOM 9926  C CD1  . LEU A 1 11 ? 4.483   -1.595  -1.851  1.00 0.00 ? 11 LEU A CD1  10 
ATOM 9927  C CD2  . LEU A 1 11 ? 2.197   -0.583  -1.956  1.00 0.00 ? 11 LEU A CD2  10 
ATOM 9928  H H    . LEU A 1 11 ? 3.828   2.541   0.748   1.00 0.00 ? 11 LEU A H    10 
ATOM 9929  H HA   . LEU A 1 11 ? 2.618   0.115   0.395   1.00 0.00 ? 11 LEU A HA   10 
ATOM 9930  H HB2  . LEU A 1 11 ? 3.707   1.692   -1.320  1.00 0.00 ? 11 LEU A HB2  10 
ATOM 9931  H HB3  . LEU A 1 11 ? 5.185   0.802   -1.009  1.00 0.00 ? 11 LEU A HB3  10 
ATOM 9932  H HG   . LEU A 1 11 ? 3.903   0.065   -3.036  1.00 0.00 ? 11 LEU A HG   10 
ATOM 9933  H HD11 . LEU A 1 11 ? 3.946   -2.252  -1.183  1.00 0.00 ? 11 LEU A HD11 10 
ATOM 9934  H HD12 . LEU A 1 11 ? 5.448   -1.361  -1.427  1.00 0.00 ? 11 LEU A HD12 10 
ATOM 9935  H HD13 . LEU A 1 11 ? 4.618   -2.083  -2.804  1.00 0.00 ? 11 LEU A HD13 10 
ATOM 9936  H HD21 . LEU A 1 11 ? 1.883   -1.154  -2.818  1.00 0.00 ? 11 LEU A HD21 10 
ATOM 9937  H HD22 . LEU A 1 11 ? 1.661   0.353   -1.930  1.00 0.00 ? 11 LEU A HD22 10 
ATOM 9938  H HD23 . LEU A 1 11 ? 1.987   -1.144  -1.057  1.00 0.00 ? 11 LEU A HD23 10 
ATOM 9939  N N    . THR A 1 12 ? 5.776   -0.295  1.255   1.00 0.00 ? 12 THR A N    10 
ATOM 9940  C CA   . THR A 1 12 ? 6.717   -1.230  1.855   1.00 0.00 ? 12 THR A CA   10 
ATOM 9941  C C    . THR A 1 12 ? 6.432   -1.404  3.341   1.00 0.00 ? 12 THR A C    10 
ATOM 9942  O O    . THR A 1 12 ? 6.337   -2.528  3.838   1.00 0.00 ? 12 THR A O    10 
ATOM 9943  C CB   . THR A 1 12 ? 8.152   -0.736  1.655   1.00 0.00 ? 12 THR A CB   10 
ATOM 9944  O OG1  . THR A 1 12 ? 8.443   -0.591  0.276   1.00 0.00 ? 12 THR A OG1  10 
ATOM 9945  C CG2  . THR A 1 12 ? 9.193   -1.656  2.251   1.00 0.00 ? 12 THR A CG2  10 
ATOM 9946  H H    . THR A 1 12 ? 6.082   0.602   1.010   1.00 0.00 ? 12 THR A H    10 
ATOM 9947  H HA   . THR A 1 12 ? 6.600   -2.183  1.361   1.00 0.00 ? 12 THR A HA   10 
ATOM 9948  H HB   . THR A 1 12 ? 8.257   0.229   2.129   1.00 0.00 ? 12 THR A HB   10 
ATOM 9949  H HG1  . THR A 1 12 ? 7.859   0.069   -0.107  1.00 0.00 ? 12 THR A HG1  10 
ATOM 9950  H HG21 . THR A 1 12 ? 9.960   -1.855  1.516   1.00 0.00 ? 12 THR A HG21 10 
ATOM 9951  H HG22 . THR A 1 12 ? 8.727   -2.584  2.546   1.00 0.00 ? 12 THR A HG22 10 
ATOM 9952  H HG23 . THR A 1 12 ? 9.637   -1.185  3.116   1.00 0.00 ? 12 THR A HG23 10 
ATOM 9953  N N    . GLY A 1 13 ? 6.291   -0.283  4.044   1.00 0.00 ? 13 GLY A N    10 
ATOM 9954  C CA   . GLY A 1 13 ? 6.015   -0.327  5.469   1.00 0.00 ? 13 GLY A CA   10 
ATOM 9955  C C    . GLY A 1 13 ? 4.852   -1.237  5.802   1.00 0.00 ? 13 GLY A C    10 
ATOM 9956  O O    . GLY A 1 13 ? 4.798   -1.821  6.885   1.00 0.00 ? 13 GLY A O    10 
ATOM 9957  H H    . GLY A 1 13 ? 6.369   0.582   3.589   1.00 0.00 ? 13 GLY A H    10 
ATOM 9958  H HA2  . GLY A 1 13 ? 6.895   -0.681  5.985   1.00 0.00 ? 13 GLY A HA2  10 
ATOM 9959  H HA3  . GLY A 1 13 ? 5.787   0.672   5.811   1.00 0.00 ? 13 GLY A HA3  10 
ATOM 9960  N N    . LEU A 1 14 ? 3.919   -1.356  4.867   1.00 0.00 ? 14 LEU A N    10 
ATOM 9961  C CA   . LEU A 1 14 ? 2.756   -2.207  5.044   1.00 0.00 ? 14 LEU A CA   10 
ATOM 9962  C C    . LEU A 1 14 ? 3.157   -3.675  5.166   1.00 0.00 ? 14 LEU A C    10 
ATOM 9963  O O    . LEU A 1 14 ? 2.356   -4.513  5.579   1.00 0.00 ? 14 LEU A O    10 
ATOM 9964  C CB   . LEU A 1 14 ? 1.817   -2.021  3.853   1.00 0.00 ? 14 LEU A CB   10 
ATOM 9965  C CG   . LEU A 1 14 ? 0.361   -1.714  4.199   1.00 0.00 ? 14 LEU A CG   10 
ATOM 9966  C CD1  . LEU A 1 14 ? 0.277   -0.685  5.315   1.00 0.00 ? 14 LEU A CD1  10 
ATOM 9967  C CD2  . LEU A 1 14 ? -0.375  -1.220  2.965   1.00 0.00 ? 14 LEU A CD2  10 
ATOM 9968  H H    . LEU A 1 14 ? 4.023   -0.873  4.021   1.00 0.00 ? 14 LEU A H    10 
ATOM 9969  H HA   . LEU A 1 14 ? 2.256   -1.904  5.951   1.00 0.00 ? 14 LEU A HA   10 
ATOM 9970  H HB2  . LEU A 1 14 ? 2.197   -1.209  3.252   1.00 0.00 ? 14 LEU A HB2  10 
ATOM 9971  H HB3  . LEU A 1 14 ? 1.846   -2.919  3.261   1.00 0.00 ? 14 LEU A HB3  10 
ATOM 9972  H HG   . LEU A 1 14 ? -0.122  -2.619  4.540   1.00 0.00 ? 14 LEU A HG   10 
ATOM 9973  H HD11 . LEU A 1 14 ? -0.660  -0.152  5.246   1.00 0.00 ? 14 LEU A HD11 10 
ATOM 9974  H HD12 . LEU A 1 14 ? 1.096   0.014   5.221   1.00 0.00 ? 14 LEU A HD12 10 
ATOM 9975  H HD13 . LEU A 1 14 ? 0.339   -1.183  6.270   1.00 0.00 ? 14 LEU A HD13 10 
ATOM 9976  H HD21 . LEU A 1 14 ? 0.028   -1.706  2.089   1.00 0.00 ? 14 LEU A HD21 10 
ATOM 9977  H HD22 . LEU A 1 14 ? -0.247  -0.152  2.874   1.00 0.00 ? 14 LEU A HD22 10 
ATOM 9978  H HD23 . LEU A 1 14 ? -1.427  -1.449  3.056   1.00 0.00 ? 14 LEU A HD23 10 
ATOM 9979  N N    . GLY A 1 15 ? 4.399   -3.983  4.798   1.00 0.00 ? 15 GLY A N    10 
ATOM 9980  C CA   . GLY A 1 15 ? 4.870   -5.350  4.852   1.00 0.00 ? 15 GLY A CA   10 
ATOM 9981  C C    . GLY A 1 15 ? 5.228   -5.890  3.480   1.00 0.00 ? 15 GLY A C    10 
ATOM 9982  O O    . GLY A 1 15 ? 5.419   -7.096  3.314   1.00 0.00 ? 15 GLY A O    10 
ATOM 9983  H H    . GLY A 1 15 ? 4.992   -3.280  4.463   1.00 0.00 ? 15 GLY A H    10 
ATOM 9984  H HA2  . GLY A 1 15 ? 5.744   -5.394  5.485   1.00 0.00 ? 15 GLY A HA2  10 
ATOM 9985  H HA3  . GLY A 1 15 ? 4.097   -5.970  5.281   1.00 0.00 ? 15 GLY A HA3  10 
ATOM 9986  N N    . CYS A 1 16 ? 5.320   -5.000  2.492   1.00 0.00 ? 16 CYS A N    10 
ATOM 9987  C CA   . CYS A 1 16 ? 5.654   -5.407  1.131   1.00 0.00 ? 16 CYS A CA   10 
ATOM 9988  C C    . CYS A 1 16 ? 7.008   -4.844  0.707   1.00 0.00 ? 16 CYS A C    10 
ATOM 9989  O O    . CYS A 1 16 ? 7.089   -4.033  -0.216  1.00 0.00 ? 16 CYS A O    10 
ATOM 9990  C CB   . CYS A 1 16 ? 4.569   -4.943  0.158   1.00 0.00 ? 16 CYS A CB   10 
ATOM 9991  S SG   . CYS A 1 16 ? 3.202   -6.110  -0.034  1.00 0.00 ? 16 CYS A SG   10 
ATOM 9992  H H    . CYS A 1 16 ? 5.155   -4.050  2.681   1.00 0.00 ? 16 CYS A H    10 
ATOM 9993  H HA   . CYS A 1 16 ? 5.706   -6.485  1.113   1.00 0.00 ? 16 CYS A HA   10 
ATOM 9994  H HB2  . CYS A 1 16 ? 4.157   -4.008  0.509   1.00 0.00 ? 16 CYS A HB2  10 
ATOM 9995  H HB3  . CYS A 1 16 ? 5.012   -4.792  -0.815  1.00 0.00 ? 16 CYS A HB3  10 
ATOM 9996  H HG   . CYS A 1 16 ? 2.885   -6.340  0.841   1.00 0.00 ? 16 CYS A HG   10 
ATOM 9997  N N    . PRO A 1 17 ? 8.094   -5.275  1.371   1.00 0.00 ? 17 PRO A N    10 
ATOM 9998  C CA   . PRO A 1 17 ? 9.449   -4.812  1.050   1.00 0.00 ? 17 PRO A CA   10 
ATOM 9999  C C    . PRO A 1 17 ? 9.958   -5.379  -0.270  1.00 0.00 ? 17 PRO A C    10 
ATOM 10000 O O    . PRO A 1 17 ? 10.893  -4.844  -0.866  1.00 0.00 ? 17 PRO A O    10 
ATOM 10001 C CB   . PRO A 1 17 ? 10.286  -5.337  2.217   1.00 0.00 ? 17 PRO A CB   10 
ATOM 10002 C CG   . PRO A 1 17 ? 9.548   -6.538  2.698   1.00 0.00 ? 17 PRO A CG   10 
ATOM 10003 C CD   . PRO A 1 17 ? 8.089   -6.243  2.483   1.00 0.00 ? 17 PRO A CD   10 
ATOM 10004 H HA   . PRO A 1 17 ? 9.501   -3.734  1.020   1.00 0.00 ? 17 PRO A HA   10 
ATOM 10005 H HB2  . PRO A 1 17 ? 11.275  -5.594  1.867   1.00 0.00 ? 17 PRO A HB2  10 
ATOM 10006 H HB3  . PRO A 1 17 ? 10.355  -4.581  2.985   1.00 0.00 ? 17 PRO A HB3  10 
ATOM 10007 H HG2  . PRO A 1 17 ? 9.844   -7.404  2.125   1.00 0.00 ? 17 PRO A HG2  10 
ATOM 10008 H HG3  . PRO A 1 17 ? 9.748   -6.696  3.748   1.00 0.00 ? 17 PRO A HG3  10 
ATOM 10009 H HD2  . PRO A 1 17 ? 7.558   -7.142  2.209   1.00 0.00 ? 17 PRO A HD2  10 
ATOM 10010 H HD3  . PRO A 1 17 ? 7.659   -5.806  3.372   1.00 0.00 ? 17 PRO A HD3  10 
ATOM 10011 N N    . ASN A 1 18 ? 9.343   -6.469  -0.720  1.00 0.00 ? 18 ASN A N    10 
ATOM 10012 C CA   . ASN A 1 18 ? 9.731   -7.102  -1.972  1.00 0.00 ? 18 ASN A CA   10 
ATOM 10013 C C    . ASN A 1 18 ? 8.518   -7.326  -2.867  1.00 0.00 ? 18 ASN A C    10 
ATOM 10014 O O    . ASN A 1 18 ? 8.536   -8.183  -3.751  1.00 0.00 ? 18 ASN A O    10 
ATOM 10015 C CB   . ASN A 1 18 ? 10.431  -8.434  -1.698  1.00 0.00 ? 18 ASN A CB   10 
ATOM 10016 C CG   . ASN A 1 18 ? 11.933  -8.345  -1.878  1.00 0.00 ? 18 ASN A CG   10 
ATOM 10017 O OD1  . ASN A 1 18 ? 12.698  -8.622  -0.954  1.00 0.00 ? 18 ASN A OD1  10 
ATOM 10018 N ND2  . ASN A 1 18 ? 12.364  -7.957  -3.072  1.00 0.00 ? 18 ASN A ND2  10 
ATOM 10019 H H    . ASN A 1 18 ? 8.601   -6.848  -0.204  1.00 0.00 ? 18 ASN A H    10 
ATOM 10020 H HA   . ASN A 1 18 ? 10.419  -6.440  -2.478  1.00 0.00 ? 18 ASN A HA   10 
ATOM 10021 H HB2  . ASN A 1 18 ? 10.226  -8.739  -0.682  1.00 0.00 ? 18 ASN A HB2  10 
ATOM 10022 H HB3  . ASN A 1 18 ? 10.049  -9.181  -2.377  1.00 0.00 ? 18 ASN A HB3  10 
ATOM 10023 H HD21 . ASN A 1 18 ? 11.698  -7.753  -3.760  1.00 0.00 ? 18 ASN A HD21 10 
ATOM 10024 H HD22 . ASN A 1 18 ? 13.331  -7.891  -3.216  1.00 0.00 ? 18 ASN A HD22 10 
ATOM 10025 N N    . CYS A 1 19 ? 7.461   -6.553  -2.631  1.00 0.00 ? 19 CYS A N    10 
ATOM 10026 C CA   . CYS A 1 19 ? 6.241   -6.670  -3.417  1.00 0.00 ? 19 CYS A CA   10 
ATOM 10027 C C    . CYS A 1 19 ? 6.031   -5.427  -4.275  1.00 0.00 ? 19 CYS A C    10 
ATOM 10028 O O    . CYS A 1 19 ? 5.442   -5.498  -5.354  1.00 0.00 ? 19 CYS A O    10 
ATOM 10029 C CB   . CYS A 1 19 ? 5.036   -6.882  -2.500  1.00 0.00 ? 19 CYS A CB   10 
ATOM 10030 S SG   . CYS A 1 19 ? 4.036   -8.329  -2.916  1.00 0.00 ? 19 CYS A SG   10 
ATOM 10031 H H    . CYS A 1 19 ? 7.504   -5.886  -1.915  1.00 0.00 ? 19 CYS A H    10 
ATOM 10032 H HA   . CYS A 1 19 ? 6.347   -7.524  -4.065  1.00 0.00 ? 19 CYS A HA   10 
ATOM 10033 H HB2  . CYS A 1 19 ? 5.384   -7.006  -1.485  1.00 0.00 ? 19 CYS A HB2  10 
ATOM 10034 H HB3  . CYS A 1 19 ? 4.396   -6.014  -2.552  1.00 0.00 ? 19 CYS A HB3  10 
ATOM 10035 H HG   . CYS A 1 19 ? 3.114   -8.061  -2.917  1.00 0.00 ? 19 CYS A HG   10 
ATOM 10036 N N    . ILE A 1 20 ? 6.524   -4.293  -3.791  1.00 0.00 ? 20 ILE A N    10 
ATOM 10037 C CA   . ILE A 1 20 ? 6.398   -3.034  -4.516  1.00 0.00 ? 20 ILE A CA   10 
ATOM 10038 C C    . ILE A 1 20 ? 6.834   -3.193  -5.969  1.00 0.00 ? 20 ILE A C    10 
ATOM 10039 O O    . ILE A 1 20 ? 6.255   -2.588  -6.871  1.00 0.00 ? 20 ILE A O    10 
ATOM 10040 C CB   . ILE A 1 20 ? 7.244   -1.927  -3.861  1.00 0.00 ? 20 ILE A CB   10 
ATOM 10041 C CG1  . ILE A 1 20 ? 7.086   -0.611  -4.627  1.00 0.00 ? 20 ILE A CG1  10 
ATOM 10042 C CG2  . ILE A 1 20 ? 8.703   -2.348  -3.814  1.00 0.00 ? 20 ILE A CG2  10 
ATOM 10043 C CD1  . ILE A 1 20 ? 6.790   0.579   -3.739  1.00 0.00 ? 20 ILE A CD1  10 
ATOM 10044 H H    . ILE A 1 20 ? 6.987   -4.302  -2.927  1.00 0.00 ? 20 ILE A H    10 
ATOM 10045 H HA   . ILE A 1 20 ? 5.363   -2.733  -4.491  1.00 0.00 ? 20 ILE A HA   10 
ATOM 10046 H HB   . ILE A 1 20 ? 6.899   -1.793  -2.847  1.00 0.00 ? 20 ILE A HB   10 
ATOM 10047 H HG12 . ILE A 1 20 ? 8.001   -0.403  -5.163  1.00 0.00 ? 20 ILE A HG12 10 
ATOM 10048 H HG13 . ILE A 1 20 ? 6.274   -0.707  -5.331  1.00 0.00 ? 20 ILE A HG13 10 
ATOM 10049 H HG21 . ILE A 1 20 ? 9.204   -1.824  -3.015  1.00 0.00 ? 20 ILE A HG21 10 
ATOM 10050 H HG22 . ILE A 1 20 ? 9.175   -2.108  -4.756  1.00 0.00 ? 20 ILE A HG22 10 
ATOM 10051 H HG23 . ILE A 1 20 ? 8.763   -3.413  -3.642  1.00 0.00 ? 20 ILE A HG23 10 
ATOM 10052 H HD11 . ILE A 1 20 ? 5.858   0.416   -3.218  1.00 0.00 ? 20 ILE A HD11 10 
ATOM 10053 H HD12 . ILE A 1 20 ? 6.713   1.470   -4.346  1.00 0.00 ? 20 ILE A HD12 10 
ATOM 10054 H HD13 . ILE A 1 20 ? 7.588   0.700   -3.021  1.00 0.00 ? 20 ILE A HD13 10 
ATOM 10055 N N    . GLU A 1 21 ? 7.862   -4.005  -6.188  1.00 0.00 ? 21 GLU A N    10 
ATOM 10056 C CA   . GLU A 1 21 ? 8.370   -4.245  -7.532  1.00 0.00 ? 21 GLU A CA   10 
ATOM 10057 C C    . GLU A 1 21 ? 7.260   -4.763  -8.441  1.00 0.00 ? 21 GLU A C    10 
ATOM 10058 O O    . GLU A 1 21 ? 7.119   -4.319  -9.581  1.00 0.00 ? 21 GLU A O    10 
ATOM 10059 C CB   . GLU A 1 21 ? 9.524   -5.247  -7.494  1.00 0.00 ? 21 GLU A CB   10 
ATOM 10060 C CG   . GLU A 1 21 ? 9.228   -6.484  -6.661  1.00 0.00 ? 21 GLU A CG   10 
ATOM 10061 C CD   . GLU A 1 21 ? 10.360  -6.838  -5.718  1.00 0.00 ? 21 GLU A CD   10 
ATOM 10062 O OE1  . GLU A 1 21 ? 10.499  -6.161  -4.678  1.00 0.00 ? 21 GLU A OE1  10 
ATOM 10063 O OE2  . GLU A 1 21 ? 11.105  -7.795  -6.017  1.00 0.00 ? 21 GLU A OE2  10 
ATOM 10064 H H    . GLU A 1 21 ? 8.283   -4.462  -5.430  1.00 0.00 ? 21 GLU A H    10 
ATOM 10065 H HA   . GLU A 1 21 ? 8.731   -3.306  -7.924  1.00 0.00 ? 21 GLU A HA   10 
ATOM 10066 H HB2  . GLU A 1 21 ? 9.745   -5.564  -8.503  1.00 0.00 ? 21 GLU A HB2  10 
ATOM 10067 H HB3  . GLU A 1 21 ? 10.394  -4.760  -7.080  1.00 0.00 ? 21 GLU A HB3  10 
ATOM 10068 H HG2  . GLU A 1 21 ? 8.336   -6.304  -6.078  1.00 0.00 ? 21 GLU A HG2  10 
ATOM 10069 H HG3  . GLU A 1 21 ? 9.060   -7.318  -7.326  1.00 0.00 ? 21 GLU A HG3  10 
ATOM 10070 N N    . TYR A 1 22 ? 6.473   -5.700  -7.925  1.00 0.00 ? 22 TYR A N    10 
ATOM 10071 C CA   . TYR A 1 22 ? 5.364   -6.266  -8.681  1.00 0.00 ? 22 TYR A CA   10 
ATOM 10072 C C    . TYR A 1 22 ? 4.229   -5.256  -8.802  1.00 0.00 ? 22 TYR A C    10 
ATOM 10073 O O    . TYR A 1 22 ? 3.563   -5.171  -9.834  1.00 0.00 ? 22 TYR A O    10 
ATOM 10074 C CB   . TYR A 1 22 ? 4.857   -7.544  -8.007  1.00 0.00 ? 22 TYR A CB   10 
ATOM 10075 C CG   . TYR A 1 22 ? 5.932   -8.583  -7.782  1.00 0.00 ? 22 TYR A CG   10 
ATOM 10076 C CD1  . TYR A 1 22 ? 6.792   -8.496  -6.695  1.00 0.00 ? 22 TYR A CD1  10 
ATOM 10077 C CD2  . TYR A 1 22 ? 6.085   -9.654  -8.655  1.00 0.00 ? 22 TYR A CD2  10 
ATOM 10078 C CE1  . TYR A 1 22 ? 7.775   -9.444  -6.484  1.00 0.00 ? 22 TYR A CE1  10 
ATOM 10079 C CE2  . TYR A 1 22 ? 7.065   -10.606 -8.450  1.00 0.00 ? 22 TYR A CE2  10 
ATOM 10080 C CZ   . TYR A 1 22 ? 7.907   -10.497 -7.365  1.00 0.00 ? 22 TYR A CZ   10 
ATOM 10081 O OH   . TYR A 1 22 ? 8.885   -11.443 -7.159  1.00 0.00 ? 22 TYR A OH   10 
ATOM 10082 H H    . TYR A 1 22 ? 6.630   -6.004  -7.006  1.00 0.00 ? 22 TYR A H    10 
ATOM 10083 H HA   . TYR A 1 22 ? 5.724   -6.507  -9.670  1.00 0.00 ? 22 TYR A HA   10 
ATOM 10084 H HB2  . TYR A 1 22 ? 4.434   -7.291  -7.045  1.00 0.00 ? 22 TYR A HB2  10 
ATOM 10085 H HB3  . TYR A 1 22 ? 4.090   -7.989  -8.625  1.00 0.00 ? 22 TYR A HB3  10 
ATOM 10086 H HD1  . TYR A 1 22 ? 6.687   -7.671  -6.006  1.00 0.00 ? 22 TYR A HD1  10 
ATOM 10087 H HD2  . TYR A 1 22 ? 5.423   -9.736  -9.504  1.00 0.00 ? 22 TYR A HD2  10 
ATOM 10088 H HE1  . TYR A 1 22 ? 8.435   -9.358  -5.634  1.00 0.00 ? 22 TYR A HE1  10 
ATOM 10089 H HE2  . TYR A 1 22 ? 7.169   -11.431 -9.142  1.00 0.00 ? 22 TYR A HE2  10 
ATOM 10090 H HH   . TYR A 1 22 ? 9.635   -11.038 -6.718  1.00 0.00 ? 22 TYR A HH   10 
ATOM 10091 N N    . PHE A 1 23 ? 4.024   -4.484  -7.740  1.00 0.00 ? 23 PHE A N    10 
ATOM 10092 C CA   . PHE A 1 23 ? 2.979   -3.471  -7.719  1.00 0.00 ? 23 PHE A CA   10 
ATOM 10093 C C    . PHE A 1 23 ? 3.317   -2.319  -8.659  1.00 0.00 ? 23 PHE A C    10 
ATOM 10094 O O    . PHE A 1 23 ? 2.497   -1.918  -9.485  1.00 0.00 ? 23 PHE A O    10 
ATOM 10095 C CB   . PHE A 1 23 ? 2.786   -2.947  -6.293  1.00 0.00 ? 23 PHE A CB   10 
ATOM 10096 C CG   . PHE A 1 23 ? 1.923   -3.834  -5.441  1.00 0.00 ? 23 PHE A CG   10 
ATOM 10097 C CD1  . PHE A 1 23 ? 0.552   -3.878  -5.632  1.00 0.00 ? 23 PHE A CD1  10 
ATOM 10098 C CD2  . PHE A 1 23 ? 2.484   -4.621  -4.448  1.00 0.00 ? 23 PHE A CD2  10 
ATOM 10099 C CE1  . PHE A 1 23 ? -0.245  -4.692  -4.850  1.00 0.00 ? 23 PHE A CE1  10 
ATOM 10100 C CE2  . PHE A 1 23 ? 1.692   -5.437  -3.663  1.00 0.00 ? 23 PHE A CE2  10 
ATOM 10101 C CZ   . PHE A 1 23 ? 0.326   -5.474  -3.864  1.00 0.00 ? 23 PHE A CZ   10 
ATOM 10102 H H    . PHE A 1 23 ? 4.590   -4.602  -6.949  1.00 0.00 ? 23 PHE A H    10 
ATOM 10103 H HA   . PHE A 1 23 ? 2.062   -3.935  -8.051  1.00 0.00 ? 23 PHE A HA   10 
ATOM 10104 H HB2  . PHE A 1 23 ? 3.750   -2.862  -5.815  1.00 0.00 ? 23 PHE A HB2  10 
ATOM 10105 H HB3  . PHE A 1 23 ? 2.322   -1.974  -6.334  1.00 0.00 ? 23 PHE A HB3  10 
ATOM 10106 H HD1  . PHE A 1 23 ? 0.104   -3.269  -6.403  1.00 0.00 ? 23 PHE A HD1  10 
ATOM 10107 H HD2  . PHE A 1 23 ? 3.551   -4.595  -4.290  1.00 0.00 ? 23 PHE A HD2  10 
ATOM 10108 H HE1  . PHE A 1 23 ? -1.312  -4.718  -5.010  1.00 0.00 ? 23 PHE A HE1  10 
ATOM 10109 H HE2  . PHE A 1 23 ? 2.141   -6.047  -2.891  1.00 0.00 ? 23 PHE A HE2  10 
ATOM 10110 H HZ   . PHE A 1 23 ? -0.295  -6.111  -3.251  1.00 0.00 ? 23 PHE A HZ   10 
ATOM 10111 N N    . THR A 1 24 ? 4.533   -1.794  -8.535  1.00 0.00 ? 24 THR A N    10 
ATOM 10112 C CA   . THR A 1 24 ? 4.980   -0.688  -9.378  1.00 0.00 ? 24 THR A CA   10 
ATOM 10113 C C    . THR A 1 24 ? 4.716   -0.978  -10.851 1.00 0.00 ? 24 THR A C    10 
ATOM 10114 O O    . THR A 1 24 ? 4.333   -0.086  -11.610 1.00 0.00 ? 24 THR A O    10 
ATOM 10115 C CB   . THR A 1 24 ? 6.470   -0.424  -9.161  1.00 0.00 ? 24 THR A CB   10 
ATOM 10116 O OG1  . THR A 1 24 ? 7.232   -1.583  -9.455  1.00 0.00 ? 24 THR A OG1  10 
ATOM 10117 C CG2  . THR A 1 24 ? 6.805   0.000   -7.749  1.00 0.00 ? 24 THR A CG2  10 
ATOM 10118 H H    . THR A 1 24 ? 5.144   -2.155  -7.857  1.00 0.00 ? 24 THR A H    10 
ATOM 10119 H HA   . THR A 1 24 ? 4.422   0.192   -9.091  1.00 0.00 ? 24 THR A HA   10 
ATOM 10120 H HB   . THR A 1 24 ? 6.786   0.367   -9.825  1.00 0.00 ? 24 THR A HB   10 
ATOM 10121 H HG1  . THR A 1 24 ? 6.817   -2.349  -9.050  1.00 0.00 ? 24 THR A HG1  10 
ATOM 10122 H HG21 . THR A 1 24 ? 7.354   0.929   -7.773  1.00 0.00 ? 24 THR A HG21 10 
ATOM 10123 H HG22 . THR A 1 24 ? 7.407   -0.763  -7.277  1.00 0.00 ? 24 THR A HG22 10 
ATOM 10124 H HG23 . THR A 1 24 ? 5.891   0.136   -7.189  1.00 0.00 ? 24 THR A HG23 10 
ATOM 10125 N N    . SER A 1 25 ? 4.922   -2.229  -11.253 1.00 0.00 ? 25 SER A N    10 
ATOM 10126 C CA   . SER A 1 25 ? 4.710   -2.632  -12.639 1.00 0.00 ? 25 SER A CA   10 
ATOM 10127 C C    . SER A 1 25 ? 3.314   -2.243  -13.119 1.00 0.00 ? 25 SER A C    10 
ATOM 10128 O O    . SER A 1 25 ? 3.077   -2.109  -14.319 1.00 0.00 ? 25 SER A O    10 
ATOM 10129 C CB   . SER A 1 25 ? 4.906   -4.142  -12.788 1.00 0.00 ? 25 SER A CB   10 
ATOM 10130 O OG   . SER A 1 25 ? 5.718   -4.442  -13.910 1.00 0.00 ? 25 SER A OG   10 
ATOM 10131 H H    . SER A 1 25 ? 5.229   -2.895  -10.602 1.00 0.00 ? 25 SER A H    10 
ATOM 10132 H HA   . SER A 1 25 ? 5.441   -2.121  -13.247 1.00 0.00 ? 25 SER A HA   10 
ATOM 10133 H HB2  . SER A 1 25 ? 5.384   -4.530  -11.900 1.00 0.00 ? 25 SER A HB2  10 
ATOM 10134 H HB3  . SER A 1 25 ? 3.945   -4.618  -12.917 1.00 0.00 ? 25 SER A HB3  10 
ATOM 10135 H HG   . SER A 1 25 ? 6.232   -5.232  -13.731 1.00 0.00 ? 25 SER A HG   10 
ATOM 10136 N N    . GLN A 1 26 ? 2.397   -2.053  -12.177 1.00 0.00 ? 26 GLN A N    10 
ATOM 10137 C CA   . GLN A 1 26 ? 1.026   -1.681  -12.509 1.00 0.00 ? 26 GLN A CA   10 
ATOM 10138 C C    . GLN A 1 26 ? 0.813   -0.181  -12.334 1.00 0.00 ? 26 GLN A C    10 
ATOM 10139 O O    . GLN A 1 26 ? -0.085  0.403   -12.940 1.00 0.00 ? 26 GLN A O    10 
ATOM 10140 C CB   . GLN A 1 26 ? 0.029   -2.446  -11.630 1.00 0.00 ? 26 GLN A CB   10 
ATOM 10141 C CG   . GLN A 1 26 ? 0.515   -3.818  -11.184 1.00 0.00 ? 26 GLN A CG   10 
ATOM 10142 C CD   . GLN A 1 26 ? 0.367   -4.869  -12.266 1.00 0.00 ? 26 GLN A CD   10 
ATOM 10143 O OE1  . GLN A 1 26 ? -0.383  -4.689  -13.226 1.00 0.00 ? 26 GLN A OE1  10 
ATOM 10144 N NE2  . GLN A 1 26 ? 1.081   -5.978  -12.113 1.00 0.00 ? 26 GLN A NE2  10 
ATOM 10145 H H    . GLN A 1 26 ? 2.642   -2.176  -11.237 1.00 0.00 ? 26 GLN A H    10 
ATOM 10146 H HA   . GLN A 1 26 ? 0.854   -1.939  -13.543 1.00 0.00 ? 26 GLN A HA   10 
ATOM 10147 H HB2  . GLN A 1 26 ? -0.176  -1.859  -10.747 1.00 0.00 ? 26 GLN A HB2  10 
ATOM 10148 H HB3  . GLN A 1 26 ? -0.889  -2.579  -12.182 1.00 0.00 ? 26 GLN A HB3  10 
ATOM 10149 H HG2  . GLN A 1 26 ? 1.556   -3.748  -10.910 1.00 0.00 ? 26 GLN A HG2  10 
ATOM 10150 H HG3  . GLN A 1 26 ? -0.062  -4.127  -10.326 1.00 0.00 ? 26 GLN A HG3  10 
ATOM 10151 H HE21 . GLN A 1 26 ? 1.657   -6.053  -11.323 1.00 0.00 ? 26 GLN A HE21 10 
ATOM 10152 H HE22 . GLN A 1 26 ? 1.003   -6.676  -12.795 1.00 0.00 ? 26 GLN A HE22 10 
ATOM 10153 N N    . GLY A 1 27 ? 1.644   0.438   -11.501 1.00 0.00 ? 27 GLY A N    10 
ATOM 10154 C CA   . GLY A 1 27 ? 1.521   1.860   -11.253 1.00 0.00 ? 27 GLY A CA   10 
ATOM 10155 C C    . GLY A 1 27 ? 1.196   2.161   -9.805  1.00 0.00 ? 27 GLY A C    10 
ATOM 10156 O O    . GLY A 1 27 ? 0.327   2.984   -9.514  1.00 0.00 ? 27 GLY A O    10 
ATOM 10157 H H    . GLY A 1 27 ? 2.336   -0.079  -11.040 1.00 0.00 ? 27 GLY A H    10 
ATOM 10158 H HA2  . GLY A 1 27 ? 2.453   2.341   -11.510 1.00 0.00 ? 27 GLY A HA2  10 
ATOM 10159 H HA3  . GLY A 1 27 ? 0.737   2.259   -11.879 1.00 0.00 ? 27 GLY A HA3  10 
ATOM 10160 N N    . LEU A 1 28 ? 1.895   1.493   -8.894  1.00 0.00 ? 28 LEU A N    10 
ATOM 10161 C CA   . LEU A 1 28 ? 1.675   1.688   -7.467  1.00 0.00 ? 28 LEU A CA   10 
ATOM 10162 C C    . LEU A 1 28 ? 2.725   2.621   -6.877  1.00 0.00 ? 28 LEU A C    10 
ATOM 10163 O O    . LEU A 1 28 ? 3.189   2.425   -5.754  1.00 0.00 ? 28 LEU A O    10 
ATOM 10164 C CB   . LEU A 1 28 ? 1.695   0.342   -6.738  1.00 0.00 ? 28 LEU A CB   10 
ATOM 10165 C CG   . LEU A 1 28 ? 0.364   -0.070  -6.105  1.00 0.00 ? 28 LEU A CG   10 
ATOM 10166 C CD1  . LEU A 1 28 ? 0.115   0.713   -4.823  1.00 0.00 ? 28 LEU A CD1  10 
ATOM 10167 C CD2  . LEU A 1 28 ? -0.779  0.135   -7.088  1.00 0.00 ? 28 LEU A CD2  10 
ATOM 10168 H H    . LEU A 1 28 ? 2.572   0.847   -9.190  1.00 0.00 ? 28 LEU A H    10 
ATOM 10169 H HA   . LEU A 1 28 ? 0.702   2.139   -7.344  1.00 0.00 ? 28 LEU A HA   10 
ATOM 10170 H HB2  . LEU A 1 28 ? 1.985   -0.421  -7.445  1.00 0.00 ? 28 LEU A HB2  10 
ATOM 10171 H HB3  . LEU A 1 28 ? 2.441   0.387   -5.959  1.00 0.00 ? 28 LEU A HB3  10 
ATOM 10172 H HG   . LEU A 1 28 ? 0.402   -1.120  -5.852  1.00 0.00 ? 28 LEU A HG   10 
ATOM 10173 H HD11 . LEU A 1 28 ? 0.370   0.102   -3.971  1.00 0.00 ? 28 LEU A HD11 10 
ATOM 10174 H HD12 . LEU A 1 28 ? -0.927  0.991   -4.768  1.00 0.00 ? 28 LEU A HD12 10 
ATOM 10175 H HD13 . LEU A 1 28 ? 0.726   1.605   -4.823  1.00 0.00 ? 28 LEU A HD13 10 
ATOM 10176 H HD21 . LEU A 1 28 ? -0.462  -0.164  -8.076  1.00 0.00 ? 28 LEU A HD21 10 
ATOM 10177 H HD22 . LEU A 1 28 ? -1.060  1.179   -7.101  1.00 0.00 ? 28 LEU A HD22 10 
ATOM 10178 H HD23 . LEU A 1 28 ? -1.627  -0.462  -6.785  1.00 0.00 ? 28 LEU A HD23 10 
ATOM 10179 N N    . GLN A 1 29 ? 3.081   3.651   -7.637  1.00 0.00 ? 29 GLN A N    10 
ATOM 10180 C CA   . GLN A 1 29 ? 4.052   4.638   -7.183  1.00 0.00 ? 29 GLN A CA   10 
ATOM 10181 C C    . GLN A 1 29 ? 3.335   5.880   -6.662  1.00 0.00 ? 29 GLN A C    10 
ATOM 10182 O O    . GLN A 1 29 ? 3.848   6.593   -5.801  1.00 0.00 ? 29 GLN A O    10 
ATOM 10183 C CB   . GLN A 1 29 ? 5.003   5.016   -8.319  1.00 0.00 ? 29 GLN A CB   10 
ATOM 10184 C CG   . GLN A 1 29 ? 4.349   5.853   -9.407  1.00 0.00 ? 29 GLN A CG   10 
ATOM 10185 C CD   . GLN A 1 29 ? 5.157   5.875   -10.690 1.00 0.00 ? 29 GLN A CD   10 
ATOM 10186 O OE1  . GLN A 1 29 ? 6.320   6.278   -10.697 1.00 0.00 ? 29 GLN A OE1  10 
ATOM 10187 N NE2  . GLN A 1 29 ? 4.543   5.439   -11.783 1.00 0.00 ? 29 GLN A NE2  10 
ATOM 10188 H H    . GLN A 1 29 ? 2.665   3.762   -8.517  1.00 0.00 ? 29 GLN A H    10 
ATOM 10189 H HA   . GLN A 1 29 ? 4.620   4.198   -6.378  1.00 0.00 ? 29 GLN A HA   10 
ATOM 10190 H HB2  . GLN A 1 29 ? 5.829   5.578   -7.908  1.00 0.00 ? 29 GLN A HB2  10 
ATOM 10191 H HB3  . GLN A 1 29 ? 5.383   4.111   -8.769  1.00 0.00 ? 29 GLN A HB3  10 
ATOM 10192 H HG2  . GLN A 1 29 ? 3.373   5.444   -9.619  1.00 0.00 ? 29 GLN A HG2  10 
ATOM 10193 H HG3  . GLN A 1 29 ? 4.244   6.867   -9.049  1.00 0.00 ? 29 GLN A HG3  10 
ATOM 10194 H HE21 . GLN A 1 29 ? 3.615   5.132   -11.701 1.00 0.00 ? 29 GLN A HE21 10 
ATOM 10195 H HE22 . GLN A 1 29 ? 5.041   5.441   -12.626 1.00 0.00 ? 29 GLN A HE22 10 
ATOM 10196 N N    . SER A 1 30 ? 2.133   6.118   -7.181  1.00 0.00 ? 30 SER A N    10 
ATOM 10197 C CA   . SER A 1 30 ? 1.317   7.244   -6.749  1.00 0.00 ? 30 SER A CA   10 
ATOM 10198 C C    . SER A 1 30 ? 0.095   6.746   -5.994  1.00 0.00 ? 30 SER A C    10 
ATOM 10199 O O    . SER A 1 30 ? -0.825  6.190   -6.591  1.00 0.00 ? 30 SER A O    10 
ATOM 10200 C CB   . SER A 1 30 ? 0.885   8.086   -7.952  1.00 0.00 ? 30 SER A CB   10 
ATOM 10201 O OG   . SER A 1 30 ? 1.742   7.872   -9.059  1.00 0.00 ? 30 SER A OG   10 
ATOM 10202 H H    . SER A 1 30 ? 1.771   5.501   -7.852  1.00 0.00 ? 30 SER A H    10 
ATOM 10203 H HA   . SER A 1 30 ? 1.910   7.853   -6.086  1.00 0.00 ? 30 SER A HA   10 
ATOM 10204 H HB2  . SER A 1 30 ? -0.121  7.813   -8.234  1.00 0.00 ? 30 SER A HB2  10 
ATOM 10205 H HB3  . SER A 1 30 ? 0.913   9.131   -7.686  1.00 0.00 ? 30 SER A HB3  10 
ATOM 10206 H HG   . SER A 1 30 ? 1.250   7.995   -9.874  1.00 0.00 ? 30 SER A HG   10 
ATOM 10207 N N    . ILE A 1 31 ? 0.095   6.930   -4.675  1.00 0.00 ? 31 ILE A N    10 
ATOM 10208 C CA   . ILE A 1 31 ? -1.011  6.469   -3.841  1.00 0.00 ? 31 ILE A CA   10 
ATOM 10209 C C    . ILE A 1 31 ? -2.361  6.816   -4.472  1.00 0.00 ? 31 ILE A C    10 
ATOM 10210 O O    . ILE A 1 31 ? -3.348  6.103   -4.288  1.00 0.00 ? 31 ILE A O    10 
ATOM 10211 C CB   . ILE A 1 31 ? -0.927  7.041   -2.408  1.00 0.00 ? 31 ILE A CB   10 
ATOM 10212 C CG1  . ILE A 1 31 ? -1.749  6.173   -1.454  1.00 0.00 ? 31 ILE A CG1  10 
ATOM 10213 C CG2  . ILE A 1 31 ? -1.397  8.490   -2.356  1.00 0.00 ? 31 ILE A CG2  10 
ATOM 10214 C CD1  . ILE A 1 31 ? -0.925  5.531   -0.361  1.00 0.00 ? 31 ILE A CD1  10 
ATOM 10215 H H    . ILE A 1 31 ? 0.863   7.367   -4.253  1.00 0.00 ? 31 ILE A H    10 
ATOM 10216 H HA   . ILE A 1 31 ? -0.933  5.397   -3.768  1.00 0.00 ? 31 ILE A HA   10 
ATOM 10217 H HB   . ILE A 1 31 ? 0.107   7.019   -2.100  1.00 0.00 ? 31 ILE A HB   10 
ATOM 10218 H HG12 . ILE A 1 31 ? -2.507  6.782   -0.985  1.00 0.00 ? 31 ILE A HG12 10 
ATOM 10219 H HG13 . ILE A 1 31 ? -2.224  5.382   -2.018  1.00 0.00 ? 31 ILE A HG13 10 
ATOM 10220 H HG21 . ILE A 1 31 ? -0.879  9.064   -3.110  1.00 0.00 ? 31 ILE A HG21 10 
ATOM 10221 H HG22 . ILE A 1 31 ? -1.186  8.902   -1.381  1.00 0.00 ? 31 ILE A HG22 10 
ATOM 10222 H HG23 . ILE A 1 31 ? -2.460  8.527   -2.543  1.00 0.00 ? 31 ILE A HG23 10 
ATOM 10223 H HD11 . ILE A 1 31 ? 0.125   5.659   -0.580  1.00 0.00 ? 31 ILE A HD11 10 
ATOM 10224 H HD12 . ILE A 1 31 ? -1.156  4.477   -0.308  1.00 0.00 ? 31 ILE A HD12 10 
ATOM 10225 H HD13 . ILE A 1 31 ? -1.155  5.999   0.585   1.00 0.00 ? 31 ILE A HD13 10 
ATOM 10226 N N    . TYR A 1 32 ? -2.383  7.904   -5.234  1.00 0.00 ? 32 TYR A N    10 
ATOM 10227 C CA   . TYR A 1 32 ? -3.594  8.333   -5.920  1.00 0.00 ? 32 TYR A CA   10 
ATOM 10228 C C    . TYR A 1 32 ? -4.147  7.207   -6.789  1.00 0.00 ? 32 TYR A C    10 
ATOM 10229 O O    . TYR A 1 32 ? -5.331  7.196   -7.129  1.00 0.00 ? 32 TYR A O    10 
ATOM 10230 C CB   . TYR A 1 32 ? -3.309  9.562   -6.785  1.00 0.00 ? 32 TYR A CB   10 
ATOM 10231 C CG   . TYR A 1 32 ? -3.058  10.822  -5.989  1.00 0.00 ? 32 TYR A CG   10 
ATOM 10232 C CD1  . TYR A 1 32 ? -4.113  11.612  -5.551  1.00 0.00 ? 32 TYR A CD1  10 
ATOM 10233 C CD2  . TYR A 1 32 ? -1.764  11.226  -5.681  1.00 0.00 ? 32 TYR A CD2  10 
ATOM 10234 C CE1  . TYR A 1 32 ? -3.888  12.766  -4.826  1.00 0.00 ? 32 TYR A CE1  10 
ATOM 10235 C CE2  . TYR A 1 32 ? -1.531  12.379  -4.956  1.00 0.00 ? 32 TYR A CE2  10 
ATOM 10236 C CZ   . TYR A 1 32 ? -2.596  13.145  -4.531  1.00 0.00 ? 32 TYR A CZ   10 
ATOM 10237 O OH   . TYR A 1 32 ? -2.367  14.293  -3.808  1.00 0.00 ? 32 TYR A OH   10 
ATOM 10238 H H    . TYR A 1 32 ? -1.559  8.421   -5.352  1.00 0.00 ? 32 TYR A H    10 
ATOM 10239 H HA   . TYR A 1 32 ? -4.327  8.588   -5.171  1.00 0.00 ? 32 TYR A HA   10 
ATOM 10240 H HB2  . TYR A 1 32 ? -2.435  9.372   -7.390  1.00 0.00 ? 32 TYR A HB2  10 
ATOM 10241 H HB3  . TYR A 1 32 ? -4.156  9.742   -7.431  1.00 0.00 ? 32 TYR A HB3  10 
ATOM 10242 H HD1  . TYR A 1 32 ? -5.125  11.312  -5.784  1.00 0.00 ? 32 TYR A HD1  10 
ATOM 10243 H HD2  . TYR A 1 32 ? -0.932  10.624  -6.015  1.00 0.00 ? 32 TYR A HD2  10 
ATOM 10244 H HE1  . TYR A 1 32 ? -4.722  13.366  -4.493  1.00 0.00 ? 32 TYR A HE1  10 
ATOM 10245 H HE2  . TYR A 1 32 ? -0.519  12.676  -4.725  1.00 0.00 ? 32 TYR A HE2  10 
ATOM 10246 H HH   . TYR A 1 32 ? -2.477  14.110  -2.873  1.00 0.00 ? 32 TYR A HH   10 
ATOM 10247 N N    . HIS A 1 33 ? -3.280  6.265   -7.155  1.00 0.00 ? 33 HIS A N    10 
ATOM 10248 C CA   . HIS A 1 33 ? -3.682  5.137   -7.985  1.00 0.00 ? 33 HIS A CA   10 
ATOM 10249 C C    . HIS A 1 33 ? -4.287  4.027   -7.133  1.00 0.00 ? 33 HIS A C    10 
ATOM 10250 O O    . HIS A 1 33 ? -5.089  3.227   -7.616  1.00 0.00 ? 33 HIS A O    10 
ATOM 10251 C CB   . HIS A 1 33 ? -2.481  4.600   -8.763  1.00 0.00 ? 33 HIS A CB   10 
ATOM 10252 C CG   . HIS A 1 33 ? -2.831  4.079   -10.122 1.00 0.00 ? 33 HIS A CG   10 
ATOM 10253 N ND1  . HIS A 1 33 ? -3.137  4.900   -11.188 1.00 0.00 ? 33 HIS A ND1  10 
ATOM 10254 C CD2  . HIS A 1 33 ? -2.922  2.811   -10.589 1.00 0.00 ? 33 HIS A CD2  10 
ATOM 10255 C CE1  . HIS A 1 33 ? -3.402  4.160   -12.251 1.00 0.00 ? 33 HIS A CE1  10 
ATOM 10256 N NE2  . HIS A 1 33 ? -3.278  2.890   -11.913 1.00 0.00 ? 33 HIS A NE2  10 
ATOM 10257 H H    . HIS A 1 33 ? -2.348  6.326   -6.852  1.00 0.00 ? 33 HIS A H    10 
ATOM 10258 H HA   . HIS A 1 33 ? -4.429  5.487   -8.683  1.00 0.00 ? 33 HIS A HA   10 
ATOM 10259 H HB2  . HIS A 1 33 ? -1.758  5.393   -8.889  1.00 0.00 ? 33 HIS A HB2  10 
ATOM 10260 H HB3  . HIS A 1 33 ? -2.029  3.793   -8.205  1.00 0.00 ? 33 HIS A HB3  10 
ATOM 10261 H HD1  . HIS A 1 33 ? -3.158  5.879   -11.169 1.00 0.00 ? 33 HIS A HD1  10 
ATOM 10262 H HD2  . HIS A 1 33 ? -2.747  1.906   -10.025 1.00 0.00 ? 33 HIS A HD2  10 
ATOM 10263 H HE1  . HIS A 1 33 ? -3.672  4.530   -13.228 1.00 0.00 ? 33 HIS A HE1  10 
ATOM 10264 H HE2  . HIS A 1 33 ? -3.418  2.128   -12.513 1.00 0.00 ? 33 HIS A HE2  10 
ATOM 10265 N N    . LEU A 1 34 ? -3.894  3.982   -5.865  1.00 0.00 ? 34 LEU A N    10 
ATOM 10266 C CA   . LEU A 1 34 ? -4.405  2.976   -4.944  1.00 0.00 ? 34 LEU A CA   10 
ATOM 10267 C C    . LEU A 1 34 ? -5.364  3.590   -3.930  1.00 0.00 ? 34 LEU A C    10 
ATOM 10268 O O    . LEU A 1 34 ? -5.629  3.010   -2.877  1.00 0.00 ? 34 LEU A O    10 
ATOM 10269 C CB   . LEU A 1 34 ? -3.251  2.303   -4.216  1.00 0.00 ? 34 LEU A CB   10 
ATOM 10270 C CG   . LEU A 1 34 ? -2.075  3.224   -3.882  1.00 0.00 ? 34 LEU A CG   10 
ATOM 10271 C CD1  . LEU A 1 34 ? -1.296  2.683   -2.692  1.00 0.00 ? 34 LEU A CD1  10 
ATOM 10272 C CD2  . LEU A 1 34 ? -1.163  3.386   -5.089  1.00 0.00 ? 34 LEU A CD2  10 
ATOM 10273 H H    . LEU A 1 34 ? -3.259  4.651   -5.536  1.00 0.00 ? 34 LEU A H    10 
ATOM 10274 H HA   . LEU A 1 34 ? -4.936  2.238   -5.523  1.00 0.00 ? 34 LEU A HA   10 
ATOM 10275 H HB2  . LEU A 1 34 ? -3.629  1.883   -3.298  1.00 0.00 ? 34 LEU A HB2  10 
ATOM 10276 H HB3  . LEU A 1 34 ? -2.891  1.500   -4.837  1.00 0.00 ? 34 LEU A HB3  10 
ATOM 10277 H HG   . LEU A 1 34 ? -2.454  4.202   -3.615  1.00 0.00 ? 34 LEU A HG   10 
ATOM 10278 H HD11 . LEU A 1 34 ? -1.596  3.208   -1.797  1.00 0.00 ? 34 LEU A HD11 10 
ATOM 10279 H HD12 . LEU A 1 34 ? -0.239  2.830   -2.858  1.00 0.00 ? 34 LEU A HD12 10 
ATOM 10280 H HD13 . LEU A 1 34 ? -1.501  1.630   -2.577  1.00 0.00 ? 34 LEU A HD13 10 
ATOM 10281 H HD21 . LEU A 1 34 ? -1.357  2.593   -5.796  1.00 0.00 ? 34 LEU A HD21 10 
ATOM 10282 H HD22 . LEU A 1 34 ? -0.132  3.341   -4.770  1.00 0.00 ? 34 LEU A HD22 10 
ATOM 10283 H HD23 . LEU A 1 34 ? -1.351  4.340   -5.557  1.00 0.00 ? 34 LEU A HD23 10 
ATOM 10284 N N    . GLN A 1 35 ? -5.872  4.768   -4.256  1.00 0.00 ? 35 GLN A N    10 
ATOM 10285 C CA   . GLN A 1 35 ? -6.807  5.473   -3.393  1.00 0.00 ? 35 GLN A CA   10 
ATOM 10286 C C    . GLN A 1 35 ? -8.057  4.650   -3.156  1.00 0.00 ? 35 GLN A C    10 
ATOM 10287 O O    . GLN A 1 35 ? -8.580  4.581   -2.043  1.00 0.00 ? 35 GLN A O    10 
ATOM 10288 C CB   . GLN A 1 35 ? -7.206  6.788   -4.057  1.00 0.00 ? 35 GLN A CB   10 
ATOM 10289 C CG   . GLN A 1 35 ? -6.365  7.965   -3.626  1.00 0.00 ? 35 GLN A CG   10 
ATOM 10290 C CD   . GLN A 1 35 ? -7.062  8.843   -2.606  1.00 0.00 ? 35 GLN A CD   10 
ATOM 10291 O OE1  . GLN A 1 35 ? -7.722  9.821   -2.958  1.00 0.00 ? 35 GLN A OE1  10 
ATOM 10292 N NE2  . GLN A 1 35 ? -6.920  8.498   -1.331  1.00 0.00 ? 35 GLN A NE2  10 
ATOM 10293 H H    . GLN A 1 35 ? -5.623  5.172   -5.110  1.00 0.00 ? 35 GLN A H    10 
ATOM 10294 H HA   . GLN A 1 35 ? -6.322  5.671   -2.451  1.00 0.00 ? 35 GLN A HA   10 
ATOM 10295 H HB2  . GLN A 1 35 ? -7.102  6.678   -5.128  1.00 0.00 ? 35 GLN A HB2  10 
ATOM 10296 H HB3  . GLN A 1 35 ? -8.239  6.999   -3.822  1.00 0.00 ? 35 GLN A HB3  10 
ATOM 10297 H HG2  . GLN A 1 35 ? -5.448  7.592   -3.197  1.00 0.00 ? 35 GLN A HG2  10 
ATOM 10298 H HG3  . GLN A 1 35 ? -6.142  8.558   -4.498  1.00 0.00 ? 35 GLN A HG3  10 
ATOM 10299 H HE21 . GLN A 1 35 ? -6.380  7.708   -1.123  1.00 0.00 ? 35 GLN A HE21 10 
ATOM 10300 H HE22 . GLN A 1 35 ? -7.361  9.049   -0.650  1.00 0.00 ? 35 GLN A HE22 10 
ATOM 10301 N N    . ASN A 1 36 ? -8.552  4.076   -4.234  1.00 0.00 ? 36 ASN A N    10 
ATOM 10302 C CA   . ASN A 1 36 ? -9.790  3.303   -4.204  1.00 0.00 ? 36 ASN A CA   10 
ATOM 10303 C C    . ASN A 1 36 ? -9.533  1.804   -4.247  1.00 0.00 ? 36 ASN A C    10 
ATOM 10304 O O    . ASN A 1 36 ? -10.409 1.007   -3.915  1.00 0.00 ? 36 ASN A O    10 
ATOM 10305 C CB   . ASN A 1 36 ? -10.681 3.710   -5.376  1.00 0.00 ? 36 ASN A CB   10 
ATOM 10306 C CG   . ASN A 1 36 ? -9.903  4.017   -6.634  1.00 0.00 ? 36 ASN A CG   10 
ATOM 10307 O OD1  . ASN A 1 36 ? -9.790  3.188   -7.538  1.00 0.00 ? 36 ASN A OD1  10 
ATOM 10308 N ND2  . ASN A 1 36 ? -9.353  5.221   -6.684  1.00 0.00 ? 36 ASN A ND2  10 
ATOM 10309 H H    . ASN A 1 36 ? -8.087  4.206   -5.085  1.00 0.00 ? 36 ASN A H    10 
ATOM 10310 H HA   . ASN A 1 36 ? -10.298 3.540   -3.283  1.00 0.00 ? 36 ASN A HA   10 
ATOM 10311 H HB2  . ASN A 1 36 ? -11.381 2.920   -5.588  1.00 0.00 ? 36 ASN A HB2  10 
ATOM 10312 H HB3  . ASN A 1 36 ? -11.214 4.596   -5.101  1.00 0.00 ? 36 ASN A HB3  10 
ATOM 10313 H HD21 . ASN A 1 36 ? -9.490  5.817   -5.919  1.00 0.00 ? 36 ASN A HD21 10 
ATOM 10314 H HD22 . ASN A 1 36 ? -8.833  5.463   -7.472  1.00 0.00 ? 36 ASN A HD22 10 
ATOM 10315 N N    . LEU A 1 37 ? -8.325  1.425   -4.637  1.00 0.00 ? 37 LEU A N    10 
ATOM 10316 C CA   . LEU A 1 37 ? -7.964  0.009   -4.740  1.00 0.00 ? 37 LEU A CA   10 
ATOM 10317 C C    . LEU A 1 37 ? -8.449  -0.784  -3.529  1.00 0.00 ? 37 LEU A C    10 
ATOM 10318 O O    . LEU A 1 37 ? -8.612  -0.238  -2.438  1.00 0.00 ? 37 LEU A O    10 
ATOM 10319 C CB   . LEU A 1 37 ? -6.450  -0.158  -4.878  1.00 0.00 ? 37 LEU A CB   10 
ATOM 10320 C CG   . LEU A 1 37 ? -6.016  -1.447  -5.579  1.00 0.00 ? 37 LEU A CG   10 
ATOM 10321 C CD1  . LEU A 1 37 ? -6.540  -1.483  -7.005  1.00 0.00 ? 37 LEU A CD1  10 
ATOM 10322 C CD2  . LEU A 1 37 ? -4.503  -1.588  -5.557  1.00 0.00 ? 37 LEU A CD2  10 
ATOM 10323 H H    . LEU A 1 37 ? -7.678  2.108   -4.906  1.00 0.00 ? 37 LEU A H    10 
ATOM 10324 H HA   . LEU A 1 37 ? -8.441  -0.386  -5.624  1.00 0.00 ? 37 LEU A HA   10 
ATOM 10325 H HB2  . LEU A 1 37 ? -6.058  0.683   -5.429  1.00 0.00 ? 37 LEU A HB2  10 
ATOM 10326 H HB3  . LEU A 1 37 ? -6.019  -0.149  -3.889  1.00 0.00 ? 37 LEU A HB3  10 
ATOM 10327 H HG   . LEU A 1 37 ? -6.436  -2.290  -5.052  1.00 0.00 ? 37 LEU A HG   10 
ATOM 10328 H HD11 . LEU A 1 37 ? -7.587  -1.752  -6.997  1.00 0.00 ? 37 LEU A HD11 10 
ATOM 10329 H HD12 . LEU A 1 37 ? -5.985  -2.214  -7.575  1.00 0.00 ? 37 LEU A HD12 10 
ATOM 10330 H HD13 . LEU A 1 37 ? -6.423  -0.509  -7.457  1.00 0.00 ? 37 LEU A HD13 10 
ATOM 10331 H HD21 . LEU A 1 37 ? -4.134  -1.357  -4.569  1.00 0.00 ? 37 LEU A HD21 10 
ATOM 10332 H HD22 . LEU A 1 37 ? -4.067  -0.907  -6.274  1.00 0.00 ? 37 LEU A HD22 10 
ATOM 10333 H HD23 . LEU A 1 37 ? -4.234  -2.603  -5.814  1.00 0.00 ? 37 LEU A HD23 10 
ATOM 10334 N N    . THR A 1 38 ? -8.673  -2.078  -3.735  1.00 0.00 ? 38 THR A N    10 
ATOM 10335 C CA   . THR A 1 38 ? -9.133  -2.959  -2.667  1.00 0.00 ? 38 THR A CA   10 
ATOM 10336 C C    . THR A 1 38 ? -8.441  -4.310  -2.747  1.00 0.00 ? 38 THR A C    10 
ATOM 10337 O O    . THR A 1 38 ? -7.662  -4.565  -3.665  1.00 0.00 ? 38 THR A O    10 
ATOM 10338 C CB   . THR A 1 38 ? -10.645 -3.170  -2.764  1.00 0.00 ? 38 THR A CB   10 
ATOM 10339 O OG1  . THR A 1 38 ? -11.222 -2.252  -3.677  1.00 0.00 ? 38 THR A OG1  10 
ATOM 10340 C CG2  . THR A 1 38 ? -11.355 -3.014  -1.439  1.00 0.00 ? 38 THR A CG2  10 
ATOM 10341 H H    . THR A 1 38 ? -8.520  -2.451  -4.628  1.00 0.00 ? 38 THR A H    10 
ATOM 10342 H HA   . THR A 1 38 ? -8.896  -2.495  -1.721  1.00 0.00 ? 38 THR A HA   10 
ATOM 10343 H HB   . THR A 1 38 ? -10.835 -4.175  -3.123  1.00 0.00 ? 38 THR A HB   10 
ATOM 10344 H HG1  . THR A 1 38 ? -12.086 -2.572  -3.949  1.00 0.00 ? 38 THR A HG1  10 
ATOM 10345 H HG21 . THR A 1 38 ? -10.786 -2.354  -0.802  1.00 0.00 ? 38 THR A HG21 10 
ATOM 10346 H HG22 . THR A 1 38 ? -11.449 -3.979  -0.967  1.00 0.00 ? 38 THR A HG22 10 
ATOM 10347 H HG23 . THR A 1 38 ? -12.338 -2.596  -1.605  1.00 0.00 ? 38 THR A HG23 10 
ATOM 10348 N N    . ILE A 1 39 ? -8.762  -5.186  -1.805  1.00 0.00 ? 39 ILE A N    10 
ATOM 10349 C CA   . ILE A 1 39 ? -8.224  -6.534  -1.819  1.00 0.00 ? 39 ILE A CA   10 
ATOM 10350 C C    . ILE A 1 39 ? -8.678  -7.246  -3.083  1.00 0.00 ? 39 ILE A C    10 
ATOM 10351 O O    . ILE A 1 39 ? -7.957  -8.065  -3.652  1.00 0.00 ? 39 ILE A O    10 
ATOM 10352 C CB   . ILE A 1 39 ? -8.673  -7.340  -0.587  1.00 0.00 ? 39 ILE A CB   10 
ATOM 10353 C CG1  . ILE A 1 39 ? -7.932  -8.677  -0.528  1.00 0.00 ? 39 ILE A CG1  10 
ATOM 10354 C CG2  . ILE A 1 39 ? -10.178 -7.563  -0.608  1.00 0.00 ? 39 ILE A CG2  10 
ATOM 10355 C CD1  . ILE A 1 39 ? -6.464  -8.541  -0.187  1.00 0.00 ? 39 ILE A CD1  10 
ATOM 10356 H H    . ILE A 1 39 ? -9.417  -4.938  -1.120  1.00 0.00 ? 39 ILE A H    10 
ATOM 10357 H HA   . ILE A 1 39 ? -7.148  -6.468  -1.815  1.00 0.00 ? 39 ILE A HA   10 
ATOM 10358 H HB   . ILE A 1 39 ? -8.437  -6.764  0.292   1.00 0.00 ? 39 ILE A HB   10 
ATOM 10359 H HG12 . ILE A 1 39 ? -8.390  -9.303  0.224   1.00 0.00 ? 39 ILE A HG12 10 
ATOM 10360 H HG13 . ILE A 1 39 ? -8.005  -9.164  -1.489  1.00 0.00 ? 39 ILE A HG13 10 
ATOM 10361 H HG21 . ILE A 1 39 ? -10.680 -6.618  -0.758  1.00 0.00 ? 39 ILE A HG21 10 
ATOM 10362 H HG22 . ILE A 1 39 ? -10.492 -7.992  0.333   1.00 0.00 ? 39 ILE A HG22 10 
ATOM 10363 H HG23 . ILE A 1 39 ? -10.431 -8.237  -1.412  1.00 0.00 ? 39 ILE A HG23 10 
ATOM 10364 H HD11 . ILE A 1 39 ? -6.249  -7.515  0.074   1.00 0.00 ? 39 ILE A HD11 10 
ATOM 10365 H HD12 . ILE A 1 39 ? -5.868  -8.827  -1.041  1.00 0.00 ? 39 ILE A HD12 10 
ATOM 10366 H HD13 . ILE A 1 39 ? -6.227  -9.182  0.649   1.00 0.00 ? 39 ILE A HD13 10 
ATOM 10367 N N    . GLU A 1 40 ? -9.879  -6.891  -3.526  1.00 0.00 ? 40 GLU A N    10 
ATOM 10368 C CA   . GLU A 1 40 ? -10.455 -7.461  -4.735  1.00 0.00 ? 40 GLU A CA   10 
ATOM 10369 C C    . GLU A 1 40 ? -9.532  -7.238  -5.929  1.00 0.00 ? 40 GLU A C    10 
ATOM 10370 O O    . GLU A 1 40 ? -9.267  -8.159  -6.703  1.00 0.00 ? 40 GLU A O    10 
ATOM 10371 C CB   . GLU A 1 40 ? -11.826 -6.842  -5.012  1.00 0.00 ? 40 GLU A CB   10 
ATOM 10372 C CG   . GLU A 1 40 ? -12.834 -7.073  -3.897  1.00 0.00 ? 40 GLU A CG   10 
ATOM 10373 C CD   . GLU A 1 40 ? -13.598 -8.373  -4.062  1.00 0.00 ? 40 GLU A CD   10 
ATOM 10374 O OE1  . GLU A 1 40 ? -12.986 -9.447  -3.884  1.00 0.00 ? 40 GLU A OE1  10 
ATOM 10375 O OE2  . GLU A 1 40 ? -14.807 -8.316  -4.371  1.00 0.00 ? 40 GLU A OE2  10 
ATOM 10376 H H    . GLU A 1 40 ? -10.392 -6.227  -3.021  1.00 0.00 ? 40 GLU A H    10 
ATOM 10377 H HA   . GLU A 1 40 ? -10.572 -8.519  -4.576  1.00 0.00 ? 40 GLU A HA   10 
ATOM 10378 H HB2  . GLU A 1 40 ? -11.709 -5.777  -5.146  1.00 0.00 ? 40 GLU A HB2  10 
ATOM 10379 H HB3  . GLU A 1 40 ? -12.224 -7.269  -5.922  1.00 0.00 ? 40 GLU A HB3  10 
ATOM 10380 H HG2  . GLU A 1 40 ? -12.308 -7.100  -2.955  1.00 0.00 ? 40 GLU A HG2  10 
ATOM 10381 H HG3  . GLU A 1 40 ? -13.540 -6.256  -3.892  1.00 0.00 ? 40 GLU A HG3  10 
ATOM 10382 N N    . ASP A 1 41 ? -9.044  -6.009  -6.070  1.00 0.00 ? 41 ASP A N    10 
ATOM 10383 C CA   . ASP A 1 41 ? -8.146  -5.664  -7.166  1.00 0.00 ? 41 ASP A CA   10 
ATOM 10384 C C    . ASP A 1 41 ? -6.707  -6.040  -6.826  1.00 0.00 ? 41 ASP A C    10 
ATOM 10385 O O    . ASP A 1 41 ? -5.921  -6.388  -7.708  1.00 0.00 ? 41 ASP A O    10 
ATOM 10386 C CB   . ASP A 1 41 ? -8.235  -4.169  -7.476  1.00 0.00 ? 41 ASP A CB   10 
ATOM 10387 C CG   . ASP A 1 41 ? -9.123  -3.879  -8.670  1.00 0.00 ? 41 ASP A CG   10 
ATOM 10388 O OD1  . ASP A 1 41 ? -9.788  -4.816  -9.157  1.00 0.00 ? 41 ASP A OD1  10 
ATOM 10389 O OD2  . ASP A 1 41 ? -9.152  -2.713  -9.119  1.00 0.00 ? 41 ASP A OD2  10 
ATOM 10390 H H    . ASP A 1 41 ? -9.290  -5.319  -5.418  1.00 0.00 ? 41 ASP A H    10 
ATOM 10391 H HA   . ASP A 1 41 ? -8.455  -6.223  -8.036  1.00 0.00 ? 41 ASP A HA   10 
ATOM 10392 H HB2  . ASP A 1 41 ? -8.638  -3.652  -6.617  1.00 0.00 ? 41 ASP A HB2  10 
ATOM 10393 H HB3  . ASP A 1 41 ? -7.246  -3.791  -7.686  1.00 0.00 ? 41 ASP A HB3  10 
ATOM 10394 N N    . LEU A 1 42 ? -6.371  -5.972  -5.541  1.00 0.00 ? 42 LEU A N    10 
ATOM 10395 C CA   . LEU A 1 42 ? -5.031  -6.317  -5.076  1.00 0.00 ? 42 LEU A CA   10 
ATOM 10396 C C    . LEU A 1 42 ? -4.610  -7.672  -5.632  1.00 0.00 ? 42 LEU A C    10 
ATOM 10397 O O    . LEU A 1 42 ? -3.521  -7.819  -6.188  1.00 0.00 ? 42 LEU A O    10 
ATOM 10398 C CB   . LEU A 1 42 ? -4.995  -6.355  -3.540  1.00 0.00 ? 42 LEU A CB   10 
ATOM 10399 C CG   . LEU A 1 42 ? -4.975  -5.000  -2.797  1.00 0.00 ? 42 LEU A CG   10 
ATOM 10400 C CD1  . LEU A 1 42 ? -3.728  -4.895  -1.934  1.00 0.00 ? 42 LEU A CD1  10 
ATOM 10401 C CD2  . LEU A 1 42 ? -5.056  -3.807  -3.745  1.00 0.00 ? 42 LEU A CD2  10 
ATOM 10402 H H    . LEU A 1 42 ? -7.045  -5.694  -4.888  1.00 0.00 ? 42 LEU A H    10 
ATOM 10403 H HA   . LEU A 1 42 ? -4.347  -5.561  -5.431  1.00 0.00 ? 42 LEU A HA   10 
ATOM 10404 H HB2  . LEU A 1 42 ? -5.861  -6.903  -3.204  1.00 0.00 ? 42 LEU A HB2  10 
ATOM 10405 H HB3  . LEU A 1 42 ? -4.114  -6.907  -3.245  1.00 0.00 ? 42 LEU A HB3  10 
ATOM 10406 H HG   . LEU A 1 42 ? -5.829  -4.953  -2.138  1.00 0.00 ? 42 LEU A HG   10 
ATOM 10407 H HD11 . LEU A 1 42 ? -2.851  -4.937  -2.562  1.00 0.00 ? 42 LEU A HD11 10 
ATOM 10408 H HD12 . LEU A 1 42 ? -3.708  -5.714  -1.231  1.00 0.00 ? 42 LEU A HD12 10 
ATOM 10409 H HD13 . LEU A 1 42 ? -3.741  -3.959  -1.396  1.00 0.00 ? 42 LEU A HD13 10 
ATOM 10410 H HD21 . LEU A 1 42 ? -5.738  -4.030  -4.549  1.00 0.00 ? 42 LEU A HD21 10 
ATOM 10411 H HD22 . LEU A 1 42 ? -4.077  -3.600  -4.148  1.00 0.00 ? 42 LEU A HD22 10 
ATOM 10412 H HD23 . LEU A 1 42 ? -5.412  -2.942  -3.203  1.00 0.00 ? 42 LEU A HD23 10 
ATOM 10413 N N    . GLY A 1 43 ? -5.490  -8.654  -5.479  1.00 0.00 ? 43 GLY A N    10 
ATOM 10414 C CA   . GLY A 1 43 ? -5.217  -9.986  -5.989  1.00 0.00 ? 43 GLY A CA   10 
ATOM 10415 C C    . GLY A 1 43 ? -5.296  -10.053 -7.501  1.00 0.00 ? 43 GLY A C    10 
ATOM 10416 O O    . GLY A 1 43 ? -4.785  -10.989 -8.114  1.00 0.00 ? 43 GLY A O    10 
ATOM 10417 H H    . GLY A 1 43 ? -6.345  -8.466  -5.039  1.00 0.00 ? 43 GLY A H    10 
ATOM 10418 H HA2  . GLY A 1 43 ? -4.228  -10.283 -5.678  1.00 0.00 ? 43 GLY A HA2  10 
ATOM 10419 H HA3  . GLY A 1 43 ? -5.937  -10.674 -5.570  1.00 0.00 ? 43 GLY A HA3  10 
ATOM 10420 N N    . ALA A 1 44 ? -5.942  -9.058  -8.101  1.00 0.00 ? 44 ALA A N    10 
ATOM 10421 C CA   . ALA A 1 44 ? -6.068  -8.998  -9.551  1.00 0.00 ? 44 ALA A CA   10 
ATOM 10422 C C    . ALA A 1 44 ? -4.696  -8.891  -10.198 1.00 0.00 ? 44 ALA A C    10 
ATOM 10423 O O    . ALA A 1 44 ? -4.438  -9.489  -11.243 1.00 0.00 ? 44 ALA A O    10 
ATOM 10424 C CB   . ALA A 1 44 ? -6.945  -7.825  -9.955  1.00 0.00 ? 44 ALA A CB   10 
ATOM 10425 H H    . ALA A 1 44 ? -6.316  -8.334  -7.560  1.00 0.00 ? 44 ALA A H    10 
ATOM 10426 H HA   . ALA A 1 44 ? -6.547  -9.908  -9.884  1.00 0.00 ? 44 ALA A HA   10 
ATOM 10427 H HB1  . ALA A 1 44 ? -7.834  -7.811  -9.344  1.00 0.00 ? 44 ALA A HB1  10 
ATOM 10428 H HB2  . ALA A 1 44 ? -7.223  -7.923  -10.994 1.00 0.00 ? 44 ALA A HB2  10 
ATOM 10429 H HB3  . ALA A 1 44 ? -6.398  -6.903  -9.815  1.00 0.00 ? 44 ALA A HB3  10 
ATOM 10430 N N    . LEU A 1 45 ? -3.813  -8.134  -9.557  1.00 0.00 ? 45 LEU A N    10 
ATOM 10431 C CA   . LEU A 1 45 ? -2.456  -7.954  -10.044 1.00 0.00 ? 45 LEU A CA   10 
ATOM 10432 C C    . LEU A 1 45 ? -1.804  -9.294  -10.355 1.00 0.00 ? 45 LEU A C    10 
ATOM 10433 O O    . LEU A 1 45 ? -0.923  -9.383  -11.208 1.00 0.00 ? 45 LEU A O    10 
ATOM 10434 C CB   . LEU A 1 45 ? -1.636  -7.209  -8.997  1.00 0.00 ? 45 LEU A CB   10 
ATOM 10435 C CG   . LEU A 1 45 ? -1.870  -5.700  -8.954  1.00 0.00 ? 45 LEU A CG   10 
ATOM 10436 C CD1  . LEU A 1 45 ? -3.347  -5.391  -8.760  1.00 0.00 ? 45 LEU A CD1  10 
ATOM 10437 C CD2  . LEU A 1 45 ? -1.045  -5.066  -7.848  1.00 0.00 ? 45 LEU A CD2  10 
ATOM 10438 H H    . LEU A 1 45 ? -4.079  -7.690  -8.723  1.00 0.00 ? 45 LEU A H    10 
ATOM 10439 H HA   . LEU A 1 45 ? -2.498  -7.366  -10.945 1.00 0.00 ? 45 LEU A HA   10 
ATOM 10440 H HB2  . LEU A 1 45 ? -1.873  -7.618  -8.026  1.00 0.00 ? 45 LEU A HB2  10 
ATOM 10441 H HB3  . LEU A 1 45 ? -0.592  -7.390  -9.196  1.00 0.00 ? 45 LEU A HB3  10 
ATOM 10442 H HG   . LEU A 1 45 ? -1.563  -5.272  -9.893  1.00 0.00 ? 45 LEU A HG   10 
ATOM 10443 H HD11 . LEU A 1 45 ? -3.485  -4.322  -8.701  1.00 0.00 ? 45 LEU A HD11 10 
ATOM 10444 H HD12 . LEU A 1 45 ? -3.693  -5.849  -7.846  1.00 0.00 ? 45 LEU A HD12 10 
ATOM 10445 H HD13 . LEU A 1 45 ? -3.909  -5.781  -9.595  1.00 0.00 ? 45 LEU A HD13 10 
ATOM 10446 H HD21 . LEU A 1 45 ? -1.172  -3.994  -7.875  1.00 0.00 ? 45 LEU A HD21 10 
ATOM 10447 H HD22 . LEU A 1 45 ? -0.003  -5.309  -7.989  1.00 0.00 ? 45 LEU A HD22 10 
ATOM 10448 H HD23 . LEU A 1 45 ? -1.378  -5.444  -6.892  1.00 0.00 ? 45 LEU A HD23 10 
ATOM 10449 N N    . LYS A 1 46 ? -2.258  -10.327 -9.658  1.00 0.00 ? 46 LYS A N    10 
ATOM 10450 C CA   . LYS A 1 46 ? -1.733  -11.684 -9.810  1.00 0.00 ? 46 LYS A CA   10 
ATOM 10451 C C    . LYS A 1 46 ? -0.478  -11.879 -8.956  1.00 0.00 ? 46 LYS A C    10 
ATOM 10452 O O    . LYS A 1 46 ? 0.309   -12.797 -9.189  1.00 0.00 ? 46 LYS A O    10 
ATOM 10453 C CB   . LYS A 1 46 ? -1.481  -12.025 -11.297 1.00 0.00 ? 46 LYS A CB   10 
ATOM 10454 C CG   . LYS A 1 46 ? -0.052  -11.812 -11.794 1.00 0.00 ? 46 LYS A CG   10 
ATOM 10455 C CD   . LYS A 1 46 ? 0.659   -13.135 -12.033 1.00 0.00 ? 46 LYS A CD   10 
ATOM 10456 C CE   . LYS A 1 46 ? 0.027   -13.907 -13.180 1.00 0.00 ? 46 LYS A CE   10 
ATOM 10457 N NZ   . LYS A 1 46 ? 0.929   -14.973 -13.697 1.00 0.00 ? 46 LYS A NZ   10 
ATOM 10458 H H    . LYS A 1 46 ? -2.950  -10.166 -8.987  1.00 0.00 ? 46 LYS A H    10 
ATOM 10459 H HA   . LYS A 1 46 ? -2.491  -12.356 -9.437  1.00 0.00 ? 46 LYS A HA   10 
ATOM 10460 H HB2  . LYS A 1 46 ? -1.734  -13.063 -11.456 1.00 0.00 ? 46 LYS A HB2  10 
ATOM 10461 H HB3  . LYS A 1 46 ? -2.135  -11.414 -11.903 1.00 0.00 ? 46 LYS A HB3  10 
ATOM 10462 H HG2  . LYS A 1 46 ? -0.086  -11.262 -12.722 1.00 0.00 ? 46 LYS A HG2  10 
ATOM 10463 H HG3  . LYS A 1 46 ? 0.498   -11.243 -11.059 1.00 0.00 ? 46 LYS A HG3  10 
ATOM 10464 H HD2  . LYS A 1 46 ? 1.693   -12.938 -12.273 1.00 0.00 ? 46 LYS A HD2  10 
ATOM 10465 H HD3  . LYS A 1 46 ? 0.602   -13.732 -11.136 1.00 0.00 ? 46 LYS A HD3  10 
ATOM 10466 H HE2  . LYS A 1 46 ? -0.888  -14.359 -12.831 1.00 0.00 ? 46 LYS A HE2  10 
ATOM 10467 H HE3  . LYS A 1 46 ? -0.195  -13.217 -13.980 1.00 0.00 ? 46 LYS A HE3  10 
ATOM 10468 H HZ1  . LYS A 1 46 ? 0.443   -15.527 -14.432 1.00 0.00 ? 46 LYS A HZ1  10 
ATOM 10469 H HZ2  . LYS A 1 46 ? 1.210   -15.611 -12.925 1.00 0.00 ? 46 LYS A HZ2  10 
ATOM 10470 H HZ3  . LYS A 1 46 ? 1.785   -14.549 -14.110 1.00 0.00 ? 46 LYS A HZ3  10 
ATOM 10471 N N    . ILE A 1 47 ? -0.306  -11.015 -7.958  1.00 0.00 ? 47 ILE A N    10 
ATOM 10472 C CA   . ILE A 1 47 ? 0.837   -11.107 -7.055  1.00 0.00 ? 47 ILE A CA   10 
ATOM 10473 C C    . ILE A 1 47 ? 0.547   -12.087 -5.919  1.00 0.00 ? 47 ILE A C    10 
ATOM 10474 O O    . ILE A 1 47 ? -0.552  -12.092 -5.363  1.00 0.00 ? 47 ILE A O    10 
ATOM 10475 C CB   . ILE A 1 47 ? 1.202   -9.733  -6.455  1.00 0.00 ? 47 ILE A CB   10 
ATOM 10476 C CG1  . ILE A 1 47 ? 1.020   -8.624  -7.494  1.00 0.00 ? 47 ILE A CG1  10 
ATOM 10477 C CG2  . ILE A 1 47 ? 2.632   -9.745  -5.937  1.00 0.00 ? 47 ILE A CG2  10 
ATOM 10478 C CD1  . ILE A 1 47 ? 1.297   -7.237  -6.957  1.00 0.00 ? 47 ILE A CD1  10 
ATOM 10479 H H    . ILE A 1 47 ? -0.973  -10.313 -7.812  1.00 0.00 ? 47 ILE A H    10 
ATOM 10480 H HA   . ILE A 1 47 ? 1.683   -11.465 -7.623  1.00 0.00 ? 47 ILE A HA   10 
ATOM 10481 H HB   . ILE A 1 47 ? 0.545   -9.546  -5.618  1.00 0.00 ? 47 ILE A HB   10 
ATOM 10482 H HG12 . ILE A 1 47 ? 1.693   -8.799  -8.320  1.00 0.00 ? 47 ILE A HG12 10 
ATOM 10483 H HG13 . ILE A 1 47 ? 0.003   -8.642  -7.854  1.00 0.00 ? 47 ILE A HG13 10 
ATOM 10484 H HG21 . ILE A 1 47 ? 3.304   -9.992  -6.744  1.00 0.00 ? 47 ILE A HG21 10 
ATOM 10485 H HG22 . ILE A 1 47 ? 2.724   -10.481 -5.153  1.00 0.00 ? 47 ILE A HG22 10 
ATOM 10486 H HG23 . ILE A 1 47 ? 2.881   -8.770  -5.546  1.00 0.00 ? 47 ILE A HG23 10 
ATOM 10487 H HD11 . ILE A 1 47 ? 2.138   -7.273  -6.279  1.00 0.00 ? 47 ILE A HD11 10 
ATOM 10488 H HD12 . ILE A 1 47 ? 0.426   -6.874  -6.432  1.00 0.00 ? 47 ILE A HD12 10 
ATOM 10489 H HD13 . ILE A 1 47 ? 1.525   -6.572  -7.777  1.00 0.00 ? 47 ILE A HD13 10 
ATOM 10490 N N    . PRO A 1 48 ? 1.524   -12.939 -5.565  1.00 0.00 ? 48 PRO A N    10 
ATOM 10491 C CA   . PRO A 1 48 ? 1.361   -13.924 -4.495  1.00 0.00 ? 48 PRO A CA   10 
ATOM 10492 C C    . PRO A 1 48 ? 0.633   -13.354 -3.282  1.00 0.00 ? 48 PRO A C    10 
ATOM 10493 O O    . PRO A 1 48 ? 0.871   -12.215 -2.881  1.00 0.00 ? 48 PRO A O    10 
ATOM 10494 C CB   . PRO A 1 48 ? 2.801   -14.284 -4.142  1.00 0.00 ? 48 PRO A CB   10 
ATOM 10495 C CG   . PRO A 1 48 ? 3.544   -14.126 -5.425  1.00 0.00 ? 48 PRO A CG   10 
ATOM 10496 C CD   . PRO A 1 48 ? 2.866   -13.007 -6.174  1.00 0.00 ? 48 PRO A CD   10 
ATOM 10497 H HA   . PRO A 1 48 ? 0.841   -14.804 -4.844  1.00 0.00 ? 48 PRO A HA   10 
ATOM 10498 H HB2  . PRO A 1 48 ? 3.169   -13.608 -3.384  1.00 0.00 ? 48 PRO A HB2  10 
ATOM 10499 H HB3  . PRO A 1 48 ? 2.843   -15.301 -3.781  1.00 0.00 ? 48 PRO A HB3  10 
ATOM 10500 H HG2  . PRO A 1 48 ? 4.574   -13.871 -5.222  1.00 0.00 ? 48 PRO A HG2  10 
ATOM 10501 H HG3  . PRO A 1 48 ? 3.491   -15.043 -5.993  1.00 0.00 ? 48 PRO A HG3  10 
ATOM 10502 H HD2  . PRO A 1 48 ? 3.402   -12.080 -6.029  1.00 0.00 ? 48 PRO A HD2  10 
ATOM 10503 H HD3  . PRO A 1 48 ? 2.799   -13.244 -7.225  1.00 0.00 ? 48 PRO A HD3  10 
ATOM 10504 N N    . GLU A 1 49 ? -0.257  -14.153 -2.704  1.00 0.00 ? 49 GLU A N    10 
ATOM 10505 C CA   . GLU A 1 49 ? -1.027  -13.726 -1.541  1.00 0.00 ? 49 GLU A CA   10 
ATOM 10506 C C    . GLU A 1 49 ? -0.168  -13.725 -0.282  1.00 0.00 ? 49 GLU A C    10 
ATOM 10507 O O    . GLU A 1 49 ? -0.454  -14.441 0.677   1.00 0.00 ? 49 GLU A O    10 
ATOM 10508 C CB   . GLU A 1 49 ? -2.239  -14.638 -1.343  1.00 0.00 ? 49 GLU A CB   10 
ATOM 10509 C CG   . GLU A 1 49 ? -3.216  -14.130 -0.295  1.00 0.00 ? 49 GLU A CG   10 
ATOM 10510 C CD   . GLU A 1 49 ? -4.573  -14.799 -0.389  1.00 0.00 ? 49 GLU A CD   10 
ATOM 10511 O OE1  . GLU A 1 49 ? -4.925  -15.278 -1.488  1.00 0.00 ? 49 GLU A OE1  10 
ATOM 10512 O OE2  . GLU A 1 49 ? -5.284  -14.846 0.636   1.00 0.00 ? 49 GLU A OE2  10 
ATOM 10513 H H    . GLU A 1 49 ? -0.405  -15.050 -3.071  1.00 0.00 ? 49 GLU A H    10 
ATOM 10514 H HA   . GLU A 1 49 ? -1.371  -12.720 -1.727  1.00 0.00 ? 49 GLU A HA   10 
ATOM 10515 H HB2  . GLU A 1 49 ? -2.766  -14.727 -2.281  1.00 0.00 ? 49 GLU A HB2  10 
ATOM 10516 H HB3  . GLU A 1 49 ? -1.895  -15.615 -1.039  1.00 0.00 ? 49 GLU A HB3  10 
ATOM 10517 H HG2  . GLU A 1 49 ? -2.805  -14.321 0.685   1.00 0.00 ? 49 GLU A HG2  10 
ATOM 10518 H HG3  . GLU A 1 49 ? -3.346  -13.066 -0.428  1.00 0.00 ? 49 GLU A HG3  10 
ATOM 10519 N N    . GLN A 1 50 ? 0.885   -12.913 -0.290  1.00 0.00 ? 50 GLN A N    10 
ATOM 10520 C CA   . GLN A 1 50 ? 1.777   -12.810 0.858   1.00 0.00 ? 50 GLN A CA   10 
ATOM 10521 C C    . GLN A 1 50 ? 1.235   -11.806 1.871   1.00 0.00 ? 50 GLN A C    10 
ATOM 10522 O O    . GLN A 1 50 ? 1.093   -12.116 3.053   1.00 0.00 ? 50 GLN A O    10 
ATOM 10523 C CB   . GLN A 1 50 ? 3.179   -12.394 0.408   1.00 0.00 ? 50 GLN A CB   10 
ATOM 10524 C CG   . GLN A 1 50 ? 3.681   -13.161 -0.803  1.00 0.00 ? 50 GLN A CG   10 
ATOM 10525 C CD   . GLN A 1 50 ? 4.435   -12.284 -1.779  1.00 0.00 ? 50 GLN A CD   10 
ATOM 10526 O OE1  . GLN A 1 50 ? 4.120   -11.106 -1.946  1.00 0.00 ? 50 GLN A OE1  10 
ATOM 10527 N NE2  . GLN A 1 50 ? 5.442   -12.857 -2.424  1.00 0.00 ? 50 GLN A NE2  10 
ATOM 10528 H H    . GLN A 1 50 ? 1.059   -12.363 -1.081  1.00 0.00 ? 50 GLN A H    10 
ATOM 10529 H HA   . GLN A 1 50 ? 1.831   -13.782 1.326   1.00 0.00 ? 50 GLN A HA   10 
ATOM 10530 H HB2  . GLN A 1 50 ? 3.169   -11.342 0.163   1.00 0.00 ? 50 GLN A HB2  10 
ATOM 10531 H HB3  . GLN A 1 50 ? 3.869   -12.557 1.223   1.00 0.00 ? 50 GLN A HB3  10 
ATOM 10532 H HG2  . GLN A 1 50 ? 4.342   -13.945 -0.470  1.00 0.00 ? 50 GLN A HG2  10 
ATOM 10533 H HG3  . GLN A 1 50 ? 2.835   -13.598 -1.314  1.00 0.00 ? 50 GLN A HG3  10 
ATOM 10534 H HE21 . GLN A 1 50 ? 5.635   -13.799 -2.238  1.00 0.00 ? 50 GLN A HE21 10 
ATOM 10535 H HE22 . GLN A 1 50 ? 5.950   -12.315 -3.059  1.00 0.00 ? 50 GLN A HE22 10 
ATOM 10536 N N    . TYR A 1 51 ? 0.929   -10.604 1.395   1.00 0.00 ? 51 TYR A N    10 
ATOM 10537 C CA   . TYR A 1 51 ? 0.392   -9.554  2.251   1.00 0.00 ? 51 TYR A CA   10 
ATOM 10538 C C    . TYR A 1 51 ? -0.703  -8.777  1.528   1.00 0.00 ? 51 TYR A C    10 
ATOM 10539 O O    . TYR A 1 51 ? -0.827  -7.564  1.690   1.00 0.00 ? 51 TYR A O    10 
ATOM 10540 C CB   . TYR A 1 51 ? 1.505   -8.598  2.689   1.00 0.00 ? 51 TYR A CB   10 
ATOM 10541 C CG   . TYR A 1 51 ? 2.848   -9.267  2.872   1.00 0.00 ? 51 TYR A CG   10 
ATOM 10542 C CD1  . TYR A 1 51 ? 3.698   -9.468  1.790   1.00 0.00 ? 51 TYR A CD1  10 
ATOM 10543 C CD2  . TYR A 1 51 ? 3.268   -9.697  4.125   1.00 0.00 ? 51 TYR A CD2  10 
ATOM 10544 C CE1  . TYR A 1 51 ? 4.926   -10.079 1.953   1.00 0.00 ? 51 TYR A CE1  10 
ATOM 10545 C CE2  . TYR A 1 51 ? 4.495   -10.308 4.294   1.00 0.00 ? 51 TYR A CE2  10 
ATOM 10546 C CZ   . TYR A 1 51 ? 5.321   -10.497 3.206   1.00 0.00 ? 51 TYR A CZ   10 
ATOM 10547 O OH   . TYR A 1 51 ? 6.544   -11.105 3.372   1.00 0.00 ? 51 TYR A OH   10 
ATOM 10548 H H    . TYR A 1 51 ? 1.062   -10.421 0.441   1.00 0.00 ? 51 TYR A H    10 
ATOM 10549 H HA   . TYR A 1 51 ? -0.034  -10.025 3.126   1.00 0.00 ? 51 TYR A HA   10 
ATOM 10550 H HB2  . TYR A 1 51 ? 1.618   -7.824  1.944   1.00 0.00 ? 51 TYR A HB2  10 
ATOM 10551 H HB3  . TYR A 1 51 ? 1.229   -8.146  3.631   1.00 0.00 ? 51 TYR A HB3  10 
ATOM 10552 H HD1  . TYR A 1 51 ? 3.387   -9.140  0.810   1.00 0.00 ? 51 TYR A HD1  10 
ATOM 10553 H HD2  . TYR A 1 51 ? 2.619   -9.548  4.974   1.00 0.00 ? 51 TYR A HD2  10 
ATOM 10554 H HE1  . TYR A 1 51 ? 5.573   -10.227 1.100   1.00 0.00 ? 51 TYR A HE1  10 
ATOM 10555 H HE2  . TYR A 1 51 ? 4.804   -10.636 5.277   1.00 0.00 ? 51 TYR A HE2  10 
ATOM 10556 H HH   . TYR A 1 51 ? 7.198   -10.663 2.826   1.00 0.00 ? 51 TYR A HH   10 
ATOM 10557 N N    . ARG A 1 52 ? -1.485  -9.485  0.719   1.00 0.00 ? 52 ARG A N    10 
ATOM 10558 C CA   . ARG A 1 52 ? -2.562  -8.864  -0.039  1.00 0.00 ? 52 ARG A CA   10 
ATOM 10559 C C    . ARG A 1 52 ? -3.575  -8.203  0.889   1.00 0.00 ? 52 ARG A C    10 
ATOM 10560 O O    . ARG A 1 52 ? -3.892  -7.024  0.736   1.00 0.00 ? 52 ARG A O    10 
ATOM 10561 C CB   . ARG A 1 52 ? -3.257  -9.912  -0.908  1.00 0.00 ? 52 ARG A CB   10 
ATOM 10562 C CG   . ARG A 1 52 ? -3.417  -9.495  -2.360  1.00 0.00 ? 52 ARG A CG   10 
ATOM 10563 C CD   . ARG A 1 52 ? -3.155  -10.659 -3.299  1.00 0.00 ? 52 ARG A CD   10 
ATOM 10564 N NE   . ARG A 1 52 ? -4.312  -11.542 -3.407  1.00 0.00 ? 52 ARG A NE   10 
ATOM 10565 C CZ   . ARG A 1 52 ? -4.393  -12.552 -4.267  1.00 0.00 ? 52 ARG A CZ   10 
ATOM 10566 N NH1  . ARG A 1 52 ? -3.388  -12.801 -5.095  1.00 0.00 ? 52 ARG A NH1  10 
ATOM 10567 N NH2  . ARG A 1 52 ? -5.479  -13.311 -4.301  1.00 0.00 ? 52 ARG A NH2  10 
ATOM 10568 H H    . ARG A 1 52 ? -1.333  -10.448 0.629   1.00 0.00 ? 52 ARG A H    10 
ATOM 10569 H HA   . ARG A 1 52 ? -2.127  -8.109  -0.678  1.00 0.00 ? 52 ARG A HA   10 
ATOM 10570 H HB2  . ARG A 1 52 ? -2.680  -10.825 -0.880  1.00 0.00 ? 52 ARG A HB2  10 
ATOM 10571 H HB3  . ARG A 1 52 ? -4.238  -10.106 -0.499  1.00 0.00 ? 52 ARG A HB3  10 
ATOM 10572 H HG2  . ARG A 1 52 ? -4.425  -9.140  -2.517  1.00 0.00 ? 52 ARG A HG2  10 
ATOM 10573 H HG3  . ARG A 1 52 ? -2.715  -8.704  -2.578  1.00 0.00 ? 52 ARG A HG3  10 
ATOM 10574 H HD2  . ARG A 1 52 ? -2.915  -10.270 -4.277  1.00 0.00 ? 52 ARG A HD2  10 
ATOM 10575 H HD3  . ARG A 1 52 ? -2.316  -11.226 -2.922  1.00 0.00 ? 52 ARG A HD3  10 
ATOM 10576 H HE   . ARG A 1 52 ? -5.067  -11.377 -2.803  1.00 0.00 ? 52 ARG A HE   10 
ATOM 10577 H HH11 . ARG A 1 52 ? -2.567  -12.230 -5.071  1.00 0.00 ? 52 ARG A HH11 10 
ATOM 10578 H HH12 . ARG A 1 52 ? -3.450  -13.560 -5.743  1.00 0.00 ? 52 ARG A HH12 10 
ATOM 10579 H HH21 . ARG A 1 52 ? -6.239  -13.124 -3.677  1.00 0.00 ? 52 ARG A HH21 10 
ATOM 10580 H HH22 . ARG A 1 52 ? -5.540  -14.070 -4.950  1.00 0.00 ? 52 ARG A HH22 10 
ATOM 10581 N N    . MET A 1 53 ? -4.078  -8.968  1.851   1.00 0.00 ? 53 MET A N    10 
ATOM 10582 C CA   . MET A 1 53 ? -5.055  -8.451  2.803   1.00 0.00 ? 53 MET A CA   10 
ATOM 10583 C C    . MET A 1 53 ? -4.477  -7.281  3.592   1.00 0.00 ? 53 MET A C    10 
ATOM 10584 O O    . MET A 1 53 ? -5.159  -6.285  3.833   1.00 0.00 ? 53 MET A O    10 
ATOM 10585 C CB   . MET A 1 53 ? -5.508  -9.556  3.760   1.00 0.00 ? 53 MET A CB   10 
ATOM 10586 C CG   . MET A 1 53 ? -4.382  -10.475 4.211   1.00 0.00 ? 53 MET A CG   10 
ATOM 10587 S SD   . MET A 1 53 ? -4.801  -11.408 5.695   1.00 0.00 ? 53 MET A SD   10 
ATOM 10588 C CE   . MET A 1 53 ? -3.663  -10.690 6.877   1.00 0.00 ? 53 MET A CE   10 
ATOM 10589 H H    . MET A 1 53 ? -3.786  -9.900  1.923   1.00 0.00 ? 53 MET A H    10 
ATOM 10590 H HA   . MET A 1 53 ? -5.909  -8.101  2.241   1.00 0.00 ? 53 MET A HA   10 
ATOM 10591 H HB2  . MET A 1 53 ? -5.943  -9.100  4.637   1.00 0.00 ? 53 MET A HB2  10 
ATOM 10592 H HB3  . MET A 1 53 ? -6.258  -10.157 3.268   1.00 0.00 ? 53 MET A HB3  10 
ATOM 10593 H HG2  . MET A 1 53 ? -4.165  -11.171 3.414   1.00 0.00 ? 53 MET A HG2  10 
ATOM 10594 H HG3  . MET A 1 53 ? -3.507  -9.877  4.414   1.00 0.00 ? 53 MET A HG3  10 
ATOM 10595 H HE1  . MET A 1 53 ? -3.652  -9.616  6.760   1.00 0.00 ? 53 MET A HE1  10 
ATOM 10596 H HE2  . MET A 1 53 ? -2.671  -11.080 6.706   1.00 0.00 ? 53 MET A HE2  10 
ATOM 10597 H HE3  . MET A 1 53 ? -3.980  -10.939 7.879   1.00 0.00 ? 53 MET A HE3  10 
ATOM 10598 N N    . THR A 1 54 ? -3.214  -7.406  3.992   1.00 0.00 ? 54 THR A N    10 
ATOM 10599 C CA   . THR A 1 54 ? -2.543  -6.352  4.743   1.00 0.00 ? 54 THR A CA   10 
ATOM 10600 C C    . THR A 1 54 ? -2.516  -5.057  3.941   1.00 0.00 ? 54 THR A C    10 
ATOM 10601 O O    . THR A 1 54 ? -2.832  -3.986  4.457   1.00 0.00 ? 54 THR A O    10 
ATOM 10602 C CB   . THR A 1 54 ? -1.116  -6.773  5.099   1.00 0.00 ? 54 THR A CB   10 
ATOM 10603 O OG1  . THR A 1 54 ? -1.128  -7.890  5.972   1.00 0.00 ? 54 THR A OG1  10 
ATOM 10604 C CG2  . THR A 1 54 ? -0.315  -5.676  5.766   1.00 0.00 ? 54 THR A CG2  10 
ATOM 10605 H H    . THR A 1 54 ? -2.719  -8.220  3.764   1.00 0.00 ? 54 THR A H    10 
ATOM 10606 H HA   . THR A 1 54 ? -3.101  -6.186  5.653   1.00 0.00 ? 54 THR A HA   10 
ATOM 10607 H HB   . THR A 1 54 ? -0.598  -7.054  4.194   1.00 0.00 ? 54 THR A HB   10 
ATOM 10608 H HG1  . THR A 1 54 ? -1.435  -7.617  6.838   1.00 0.00 ? 54 THR A HG1  10 
ATOM 10609 H HG21 . THR A 1 54 ? 0.713   -5.994  5.870   1.00 0.00 ? 54 THR A HG21 10 
ATOM 10610 H HG22 . THR A 1 54 ? -0.728  -5.470  6.742   1.00 0.00 ? 54 THR A HG22 10 
ATOM 10611 H HG23 . THR A 1 54 ? -0.355  -4.780  5.162   1.00 0.00 ? 54 THR A HG23 10 
ATOM 10612 N N    . ILE A 1 55 ? -2.134  -5.167  2.673   1.00 0.00 ? 55 ILE A N    10 
ATOM 10613 C CA   . ILE A 1 55 ? -2.076  -4.009  1.793   1.00 0.00 ? 55 ILE A CA   10 
ATOM 10614 C C    . ILE A 1 55 ? -3.444  -3.339  1.695   1.00 0.00 ? 55 ILE A C    10 
ATOM 10615 O O    . ILE A 1 55 ? -3.562  -2.122  1.838   1.00 0.00 ? 55 ILE A O    10 
ATOM 10616 C CB   . ILE A 1 55 ? -1.590  -4.402  0.384   1.00 0.00 ? 55 ILE A CB   10 
ATOM 10617 C CG1  . ILE A 1 55 ? -0.192  -5.018  0.458   1.00 0.00 ? 55 ILE A CG1  10 
ATOM 10618 C CG2  . ILE A 1 55 ? -1.590  -3.194  -0.544  1.00 0.00 ? 55 ILE A CG2  10 
ATOM 10619 C CD1  . ILE A 1 55 ? 0.089   -6.014  -0.645  1.00 0.00 ? 55 ILE A CD1  10 
ATOM 10620 H H    . ILE A 1 55 ? -1.899  -6.050  2.319   1.00 0.00 ? 55 ILE A H    10 
ATOM 10621 H HA   . ILE A 1 55 ? -1.370  -3.309  2.210   1.00 0.00 ? 55 ILE A HA   10 
ATOM 10622 H HB   . ILE A 1 55 ? -2.277  -5.133  -0.016  1.00 0.00 ? 55 ILE A HB   10 
ATOM 10623 H HG12 . ILE A 1 55 ? 0.545   -4.231  0.391   1.00 0.00 ? 55 ILE A HG12 10 
ATOM 10624 H HG13 . ILE A 1 55 ? -0.081  -5.529  1.403   1.00 0.00 ? 55 ILE A HG13 10 
ATOM 10625 H HG21 . ILE A 1 55 ? -0.813  -2.507  -0.239  1.00 0.00 ? 55 ILE A HG21 10 
ATOM 10626 H HG22 . ILE A 1 55 ? -2.549  -2.700  -0.491  1.00 0.00 ? 55 ILE A HG22 10 
ATOM 10627 H HG23 . ILE A 1 55 ? -1.407  -3.519  -1.557  1.00 0.00 ? 55 ILE A HG23 10 
ATOM 10628 H HD11 . ILE A 1 55 ? -0.784  -6.112  -1.273  1.00 0.00 ? 55 ILE A HD11 10 
ATOM 10629 H HD12 . ILE A 1 55 ? 0.329   -6.974  -0.211  1.00 0.00 ? 55 ILE A HD12 10 
ATOM 10630 H HD13 . ILE A 1 55 ? 0.923   -5.670  -1.238  1.00 0.00 ? 55 ILE A HD13 10 
ATOM 10631 N N    . TRP A 1 56 ? -4.475  -4.145  1.466   1.00 0.00 ? 56 TRP A N    10 
ATOM 10632 C CA   . TRP A 1 56 ? -5.839  -3.638  1.376   1.00 0.00 ? 56 TRP A CA   10 
ATOM 10633 C C    . TRP A 1 56 ? -6.200  -2.859  2.640   1.00 0.00 ? 56 TRP A C    10 
ATOM 10634 O O    . TRP A 1 56 ? -6.516  -1.672  2.582   1.00 0.00 ? 56 TRP A O    10 
ATOM 10635 C CB   . TRP A 1 56 ? -6.810  -4.810  1.161   1.00 0.00 ? 56 TRP A CB   10 
ATOM 10636 C CG   . TRP A 1 56 ? -8.248  -4.483  1.438   1.00 0.00 ? 56 TRP A CG   10 
ATOM 10637 C CD1  . TRP A 1 56 ? -8.958  -3.425  0.952   1.00 0.00 ? 56 TRP A CD1  10 
ATOM 10638 C CD2  . TRP A 1 56 ? -9.146  -5.220  2.274   1.00 0.00 ? 56 TRP A CD2  10 
ATOM 10639 N NE1  . TRP A 1 56 ? -10.245 -3.462  1.433   1.00 0.00 ? 56 TRP A NE1  10 
ATOM 10640 C CE2  . TRP A 1 56 ? -10.383 -4.552  2.245   1.00 0.00 ? 56 TRP A CE2  10 
ATOM 10641 C CE3  . TRP A 1 56 ? -9.026  -6.380  3.044   1.00 0.00 ? 56 TRP A CE3  10 
ATOM 10642 C CZ2  . TRP A 1 56 ? -11.490 -5.001  2.951   1.00 0.00 ? 56 TRP A CZ2  10 
ATOM 10643 C CZ3  . TRP A 1 56 ? -10.128 -6.829  3.748   1.00 0.00 ? 56 TRP A CZ3  10 
ATOM 10644 C CH2  . TRP A 1 56 ? -11.348 -6.140  3.697   1.00 0.00 ? 56 TRP A CH2  10 
ATOM 10645 H H    . TRP A 1 56 ? -4.319  -5.108  1.371   1.00 0.00 ? 56 TRP A H    10 
ATOM 10646 H HA   . TRP A 1 56 ? -5.892  -2.973  0.527   1.00 0.00 ? 56 TRP A HA   10 
ATOM 10647 H HB2  . TRP A 1 56 ? -6.739  -5.138  0.134   1.00 0.00 ? 56 TRP A HB2  10 
ATOM 10648 H HB3  . TRP A 1 56 ? -6.525  -5.624  1.811   1.00 0.00 ? 56 TRP A HB3  10 
ATOM 10649 H HD1  . TRP A 1 56 ? -8.555  -2.676  0.287   1.00 0.00 ? 56 TRP A HD1  10 
ATOM 10650 H HE1  . TRP A 1 56 ? -10.951 -2.815  1.229   1.00 0.00 ? 56 TRP A HE1  10 
ATOM 10651 H HE3  . TRP A 1 56 ? -8.092  -6.922  3.094   1.00 0.00 ? 56 TRP A HE3  10 
ATOM 10652 H HZ2  . TRP A 1 56 ? -12.434 -4.478  2.918   1.00 0.00 ? 56 TRP A HZ2  10 
ATOM 10653 H HZ3  . TRP A 1 56 ? -10.056 -7.723  4.348   1.00 0.00 ? 56 TRP A HZ3  10 
ATOM 10654 H HH2  . TRP A 1 56 ? -12.183 -6.525  4.262   1.00 0.00 ? 56 TRP A HH2  10 
ATOM 10655 N N    . ARG A 1 57 ? -6.139  -3.540  3.780   1.00 0.00 ? 57 ARG A N    10 
ATOM 10656 C CA   . ARG A 1 57 ? -6.460  -2.926  5.065   1.00 0.00 ? 57 ARG A CA   10 
ATOM 10657 C C    . ARG A 1 57 ? -5.767  -1.575  5.219   1.00 0.00 ? 57 ARG A C    10 
ATOM 10658 O O    . ARG A 1 57 ? -6.348  -0.625  5.741   1.00 0.00 ? 57 ARG A O    10 
ATOM 10659 C CB   . ARG A 1 57 ? -6.051  -3.854  6.211   1.00 0.00 ? 57 ARG A CB   10 
ATOM 10660 C CG   . ARG A 1 57 ? -6.544  -5.283  6.042   1.00 0.00 ? 57 ARG A CG   10 
ATOM 10661 C CD   . ARG A 1 57 ? -7.568  -5.651  7.106   1.00 0.00 ? 57 ARG A CD   10 
ATOM 10662 N NE   . ARG A 1 57 ? -7.249  -6.917  7.759   1.00 0.00 ? 57 ARG A NE   10 
ATOM 10663 C CZ   . ARG A 1 57 ? -8.135  -7.635  8.443   1.00 0.00 ? 57 ARG A CZ   10 
ATOM 10664 N NH1  . ARG A 1 57 ? -9.386  -7.213  8.560   1.00 0.00 ? 57 ARG A NH1  10 
ATOM 10665 N NH2  . ARG A 1 57 ? -7.769  -8.777  9.011   1.00 0.00 ? 57 ARG A NH2  10 
ATOM 10666 H H    . ARG A 1 57 ? -5.883  -4.485  3.754   1.00 0.00 ? 57 ARG A H    10 
ATOM 10667 H HA   . ARG A 1 57 ? -7.527  -2.772  5.099   1.00 0.00 ? 57 ARG A HA   10 
ATOM 10668 H HB2  . ARG A 1 57 ? -4.972  -3.873  6.275   1.00 0.00 ? 57 ARG A HB2  10 
ATOM 10669 H HB3  . ARG A 1 57 ? -6.451  -3.464  7.135   1.00 0.00 ? 57 ARG A HB3  10 
ATOM 10670 H HG2  . ARG A 1 57 ? -7.000  -5.383  5.070   1.00 0.00 ? 57 ARG A HG2  10 
ATOM 10671 H HG3  . ARG A 1 57 ? -5.702  -5.955  6.119   1.00 0.00 ? 57 ARG A HG3  10 
ATOM 10672 H HD2  . ARG A 1 57 ? -7.591  -4.869  7.850   1.00 0.00 ? 57 ARG A HD2  10 
ATOM 10673 H HD3  . ARG A 1 57 ? -8.538  -5.731  6.639   1.00 0.00 ? 57 ARG A HD3  10 
ATOM 10674 H HE   . ARG A 1 57 ? -6.330  -7.248  7.686   1.00 0.00 ? 57 ARG A HE   10 
ATOM 10675 H HH11 . ARG A 1 57 ? -9.664  -6.353  8.134   1.00 0.00 ? 57 ARG A HH11 10 
ATOM 10676 H HH12 . ARG A 1 57 ? -10.051 -7.755  9.074   1.00 0.00 ? 57 ARG A HH12 10 
ATOM 10677 H HH21 . ARG A 1 57 ? -6.827  -9.098  8.925   1.00 0.00 ? 57 ARG A HH21 10 
ATOM 10678 H HH22 . ARG A 1 57 ? -8.437  -9.316  9.525   1.00 0.00 ? 57 ARG A HH22 10 
ATOM 10679 N N    . GLY A 1 58 ? -4.523  -1.500  4.764   1.00 0.00 ? 58 GLY A N    10 
ATOM 10680 C CA   . GLY A 1 58 ? -3.776  -0.261  4.847   1.00 0.00 ? 58 GLY A CA   10 
ATOM 10681 C C    . GLY A 1 58 ? -4.230  0.746   3.810   1.00 0.00 ? 58 GLY A C    10 
ATOM 10682 O O    . GLY A 1 58 ? -4.109  1.954   4.011   1.00 0.00 ? 58 GLY A O    10 
ATOM 10683 H H    . GLY A 1 58 ? -4.116  -2.288  4.350   1.00 0.00 ? 58 GLY A H    10 
ATOM 10684 H HA2  . GLY A 1 58 ? -3.911  0.165   5.831   1.00 0.00 ? 58 GLY A HA2  10 
ATOM 10685 H HA3  . GLY A 1 58 ? -2.728  -0.471  4.696   1.00 0.00 ? 58 GLY A HA3  10 
ATOM 10686 N N    . LEU A 1 59 ? -4.763  0.242   2.702   1.00 0.00 ? 59 LEU A N    10 
ATOM 10687 C CA   . LEU A 1 59 ? -5.252  1.097   1.632   1.00 0.00 ? 59 LEU A CA   10 
ATOM 10688 C C    . LEU A 1 59 ? -6.619  1.673   1.982   1.00 0.00 ? 59 LEU A C    10 
ATOM 10689 O O    . LEU A 1 59 ? -6.932  2.810   1.632   1.00 0.00 ? 59 LEU A O    10 
ATOM 10690 C CB   . LEU A 1 59 ? -5.331  0.309   0.322   1.00 0.00 ? 59 LEU A CB   10 
ATOM 10691 C CG   . LEU A 1 59 ? -4.378  0.777   -0.779  1.00 0.00 ? 59 LEU A CG   10 
ATOM 10692 C CD1  . LEU A 1 59 ? -3.000  1.084   -0.208  1.00 0.00 ? 59 LEU A CD1  10 
ATOM 10693 C CD2  . LEU A 1 59 ? -4.278  -0.276  -1.874  1.00 0.00 ? 59 LEU A CD2  10 
ATOM 10694 H H    . LEU A 1 59 ? -4.835  -0.730  2.606   1.00 0.00 ? 59 LEU A H    10 
ATOM 10695 H HA   . LEU A 1 59 ? -4.551  1.911   1.511   1.00 0.00 ? 59 LEU A HA   10 
ATOM 10696 H HB2  . LEU A 1 59 ? -5.116  -0.728  0.538   1.00 0.00 ? 59 LEU A HB2  10 
ATOM 10697 H HB3  . LEU A 1 59 ? -6.341  0.377   -0.054  1.00 0.00 ? 59 LEU A HB3  10 
ATOM 10698 H HG   . LEU A 1 59 ? -4.766  1.684   -1.220  1.00 0.00 ? 59 LEU A HG   10 
ATOM 10699 H HD11 . LEU A 1 59 ? -2.244  0.840   -0.939  1.00 0.00 ? 59 LEU A HD11 10 
ATOM 10700 H HD12 . LEU A 1 59 ? -2.842  0.495   0.684   1.00 0.00 ? 59 LEU A HD12 10 
ATOM 10701 H HD13 . LEU A 1 59 ? -2.938  2.133   0.038   1.00 0.00 ? 59 LEU A HD13 10 
ATOM 10702 H HD21 . LEU A 1 59 ? -5.031  -1.033  -1.715  1.00 0.00 ? 59 LEU A HD21 10 
ATOM 10703 H HD22 . LEU A 1 59 ? -3.298  -0.730  -1.847  1.00 0.00 ? 59 LEU A HD22 10 
ATOM 10704 H HD23 . LEU A 1 59 ? -4.432  0.189   -2.835  1.00 0.00 ? 59 LEU A HD23 10 
ATOM 10705 N N    . GLN A 1 60 ? -7.429  0.880   2.678   1.00 0.00 ? 60 GLN A N    10 
ATOM 10706 C CA   . GLN A 1 60 ? -8.754  1.325   3.092   1.00 0.00 ? 60 GLN A CA   10 
ATOM 10707 C C    . GLN A 1 60 ? -8.637  2.390   4.175   1.00 0.00 ? 60 GLN A C    10 
ATOM 10708 O O    . GLN A 1 60 ? -9.503  3.255   4.310   1.00 0.00 ? 60 GLN A O    10 
ATOM 10709 C CB   . GLN A 1 60 ? -9.581  0.144   3.601   1.00 0.00 ? 60 GLN A CB   10 
ATOM 10710 C CG   . GLN A 1 60 ? -8.910  -0.626  4.725   1.00 0.00 ? 60 GLN A CG   10 
ATOM 10711 C CD   . GLN A 1 60 ? -9.773  -1.752  5.259   1.00 0.00 ? 60 GLN A CD   10 
ATOM 10712 O OE1  . GLN A 1 60 ? -10.386 -1.630  6.319   1.00 0.00 ? 60 GLN A OE1  10 
ATOM 10713 N NE2  . GLN A 1 60 ? -9.825  -2.857  4.524   1.00 0.00 ? 60 GLN A NE2  10 
ATOM 10714 H H    . GLN A 1 60 ? -7.120  -0.014  2.940   1.00 0.00 ? 60 GLN A H    10 
ATOM 10715 H HA   . GLN A 1 60 ? -9.243  1.756   2.230   1.00 0.00 ? 60 GLN A HA   10 
ATOM 10716 H HB2  . GLN A 1 60 ? -10.529 0.513   3.962   1.00 0.00 ? 60 GLN A HB2  10 
ATOM 10717 H HB3  . GLN A 1 60 ? -9.757  -0.537  2.782   1.00 0.00 ? 60 GLN A HB3  10 
ATOM 10718 H HG2  . GLN A 1 60 ? -7.986  -1.045  4.353   1.00 0.00 ? 60 GLN A HG2  10 
ATOM 10719 H HG3  . GLN A 1 60 ? -8.694  0.056   5.535   1.00 0.00 ? 60 GLN A HG3  10 
ATOM 10720 H HE21 . GLN A 1 60 ? -9.310  -2.883  3.691   1.00 0.00 ? 60 GLN A HE21 10 
ATOM 10721 H HE22 . GLN A 1 60 ? -10.376 -3.601  4.846   1.00 0.00 ? 60 GLN A HE22 10 
ATOM 10722 N N    . ASP A 1 61 ? -7.550  2.326   4.939   1.00 0.00 ? 61 ASP A N    10 
ATOM 10723 C CA   . ASP A 1 61 ? -7.300  3.293   5.999   1.00 0.00 ? 61 ASP A CA   10 
ATOM 10724 C C    . ASP A 1 61 ? -7.065  4.679   5.412   1.00 0.00 ? 61 ASP A C    10 
ATOM 10725 O O    . ASP A 1 61 ? -7.351  5.694   6.050   1.00 0.00 ? 61 ASP A O    10 
ATOM 10726 C CB   . ASP A 1 61 ? -6.088  2.866   6.829   1.00 0.00 ? 61 ASP A CB   10 
ATOM 10727 C CG   . ASP A 1 61 ? -6.345  2.956   8.321   1.00 0.00 ? 61 ASP A CG   10 
ATOM 10728 O OD1  . ASP A 1 61 ? -6.759  4.038   8.787   1.00 0.00 ? 61 ASP A OD1  10 
ATOM 10729 O OD2  . ASP A 1 61 ? -6.133  1.945   9.022   1.00 0.00 ? 61 ASP A OD2  10 
ATOM 10730 H H    . ASP A 1 61 ? -6.892  1.619   4.774   1.00 0.00 ? 61 ASP A H    10 
ATOM 10731 H HA   . ASP A 1 61 ? -8.172  3.324   6.635   1.00 0.00 ? 61 ASP A HA   10 
ATOM 10732 H HB2  . ASP A 1 61 ? -5.835  1.844   6.586   1.00 0.00 ? 61 ASP A HB2  10 
ATOM 10733 H HB3  . ASP A 1 61 ? -5.251  3.506   6.588   1.00 0.00 ? 61 ASP A HB3  10 
ATOM 10734 N N    . LEU A 1 62 ? -6.546  4.713   4.190   1.00 0.00 ? 62 LEU A N    10 
ATOM 10735 C CA   . LEU A 1 62 ? -6.278  5.971   3.505   1.00 0.00 ? 62 LEU A CA   10 
ATOM 10736 C C    . LEU A 1 62 ? -7.573  6.737   3.260   1.00 0.00 ? 62 LEU A C    10 
ATOM 10737 O O    . LEU A 1 62 ? -7.677  7.921   3.580   1.00 0.00 ? 62 LEU A O    10 
ATOM 10738 C CB   . LEU A 1 62 ? -5.568  5.708   2.176   1.00 0.00 ? 62 LEU A CB   10 
ATOM 10739 C CG   . LEU A 1 62 ? -4.105  5.283   2.298   1.00 0.00 ? 62 LEU A CG   10 
ATOM 10740 C CD1  . LEU A 1 62 ? -3.703  4.423   1.111   1.00 0.00 ? 62 LEU A CD1  10 
ATOM 10741 C CD2  . LEU A 1 62 ? -3.203  6.503   2.409   1.00 0.00 ? 62 LEU A CD2  10 
ATOM 10742 H H    . LEU A 1 62 ? -6.344  3.870   3.734   1.00 0.00 ? 62 LEU A H    10 
ATOM 10743 H HA   . LEU A 1 62 ? -5.636  6.564   4.140   1.00 0.00 ? 62 LEU A HA   10 
ATOM 10744 H HB2  . LEU A 1 62 ? -6.103  4.929   1.651   1.00 0.00 ? 62 LEU A HB2  10 
ATOM 10745 H HB3  . LEU A 1 62 ? -5.610  6.611   1.585   1.00 0.00 ? 62 LEU A HB3  10 
ATOM 10746 H HG   . LEU A 1 62 ? -3.981  4.693   3.195   1.00 0.00 ? 62 LEU A HG   10 
ATOM 10747 H HD11 . LEU A 1 62 ? -4.566  3.883   0.751   1.00 0.00 ? 62 LEU A HD11 10 
ATOM 10748 H HD12 . LEU A 1 62 ? -2.940  3.722   1.415   1.00 0.00 ? 62 LEU A HD12 10 
ATOM 10749 H HD13 . LEU A 1 62 ? -3.318  5.054   0.324   1.00 0.00 ? 62 LEU A HD13 10 
ATOM 10750 H HD21 . LEU A 1 62 ? -3.597  7.174   3.157   1.00 0.00 ? 62 LEU A HD21 10 
ATOM 10751 H HD22 . LEU A 1 62 ? -3.164  7.009   1.456   1.00 0.00 ? 62 LEU A HD22 10 
ATOM 10752 H HD23 . LEU A 1 62 ? -2.208  6.191   2.692   1.00 0.00 ? 62 LEU A HD23 10 
ATOM 10753 N N    . LYS A 1 63 ? -8.559  6.049   2.696   1.00 0.00 ? 63 LYS A N    10 
ATOM 10754 C CA   . LYS A 1 63 ? -9.852  6.660   2.407   1.00 0.00 ? 63 LYS A CA   10 
ATOM 10755 C C    . LYS A 1 63 ? -10.400 7.387   3.632   1.00 0.00 ? 63 LYS A C    10 
ATOM 10756 O O    . LYS A 1 63 ? -10.890 8.512   3.531   1.00 0.00 ? 63 LYS A O    10 
ATOM 10757 C CB   . LYS A 1 63 ? -10.849 5.597   1.944   1.00 0.00 ? 63 LYS A CB   10 
ATOM 10758 C CG   . LYS A 1 63 ? -12.241 6.145   1.678   1.00 0.00 ? 63 LYS A CG   10 
ATOM 10759 C CD   . LYS A 1 63 ? -12.202 7.319   0.713   1.00 0.00 ? 63 LYS A CD   10 
ATOM 10760 C CE   . LYS A 1 63 ? -11.631 6.913   -0.635  1.00 0.00 ? 63 LYS A CE   10 
ATOM 10761 N NZ   . LYS A 1 63 ? -12.570 6.046   -1.399  1.00 0.00 ? 63 LYS A NZ   10 
ATOM 10762 H H    . LYS A 1 63 ? -8.413  5.108   2.464   1.00 0.00 ? 63 LYS A H    10 
ATOM 10763 H HA   . LYS A 1 63 ? -9.708  7.378   1.613   1.00 0.00 ? 63 LYS A HA   10 
ATOM 10764 H HB2  . LYS A 1 63 ? -10.482 5.148   1.033   1.00 0.00 ? 63 LYS A HB2  10 
ATOM 10765 H HB3  . LYS A 1 63 ? -10.925 4.836   2.706   1.00 0.00 ? 63 LYS A HB3  10 
ATOM 10766 H HG2  . LYS A 1 63 ? -12.851 5.363   1.251   1.00 0.00 ? 63 LYS A HG2  10 
ATOM 10767 H HG3  . LYS A 1 63 ? -12.674 6.473   2.612   1.00 0.00 ? 63 LYS A HG3  10 
ATOM 10768 H HD2  . LYS A 1 63 ? -13.206 7.691   0.571   1.00 0.00 ? 63 LYS A HD2  10 
ATOM 10769 H HD3  . LYS A 1 63 ? -11.584 8.098   1.136   1.00 0.00 ? 63 LYS A HD3  10 
ATOM 10770 H HE2  . LYS A 1 63 ? -11.429 7.805   -1.210  1.00 0.00 ? 63 LYS A HE2  10 
ATOM 10771 H HE3  . LYS A 1 63 ? -10.708 6.375   -0.474  1.00 0.00 ? 63 LYS A HE3  10 
ATOM 10772 H HZ1  . LYS A 1 63 ? -12.432 6.183   -2.421  1.00 0.00 ? 63 LYS A HZ1  10 
ATOM 10773 H HZ2  . LYS A 1 63 ? -13.553 6.285   -1.158  1.00 0.00 ? 63 LYS A HZ2  10 
ATOM 10774 H HZ3  . LYS A 1 63 ? -12.402 5.047   -1.167  1.00 0.00 ? 63 LYS A HZ3  10 
ATOM 10775 N N    . GLN A 1 64 ? -10.320 6.733   4.786   1.00 0.00 ? 64 GLN A N    10 
ATOM 10776 C CA   . GLN A 1 64 ? -10.815 7.314   6.029   1.00 0.00 ? 64 GLN A CA   10 
ATOM 10777 C C    . GLN A 1 64 ? -9.795  8.276   6.628   1.00 0.00 ? 64 GLN A C    10 
ATOM 10778 O O    . GLN A 1 64 ? -10.155 9.214   7.339   1.00 0.00 ? 64 GLN A O    10 
ATOM 10779 C CB   . GLN A 1 64 ? -11.141 6.209   7.036   1.00 0.00 ? 64 GLN A CB   10 
ATOM 10780 C CG   . GLN A 1 64 ? -11.881 5.032   6.423   1.00 0.00 ? 64 GLN A CG   10 
ATOM 10781 C CD   . GLN A 1 64 ? -11.712 3.756   7.223   1.00 0.00 ? 64 GLN A CD   10 
ATOM 10782 O OE1  . GLN A 1 64 ? -10.618 3.447   7.697   1.00 0.00 ? 64 GLN A OE1  10 
ATOM 10783 N NE2  . GLN A 1 64 ? -12.797 3.007   7.378   1.00 0.00 ? 64 GLN A NE2  10 
ATOM 10784 H H    . GLN A 1 64 ? -9.922  5.838   4.802   1.00 0.00 ? 64 GLN A H    10 
ATOM 10785 H HA   . GLN A 1 64 ? -11.717 7.862   5.803   1.00 0.00 ? 64 GLN A HA   10 
ATOM 10786 H HB2  . GLN A 1 64 ? -10.220 5.844   7.464   1.00 0.00 ? 64 GLN A HB2  10 
ATOM 10787 H HB3  . GLN A 1 64 ? -11.756 6.623   7.821   1.00 0.00 ? 64 GLN A HB3  10 
ATOM 10788 H HG2  . GLN A 1 64 ? -12.933 5.270   6.373   1.00 0.00 ? 64 GLN A HG2  10 
ATOM 10789 H HG3  . GLN A 1 64 ? -11.503 4.865   5.425   1.00 0.00 ? 64 GLN A HG3  10 
ATOM 10790 H HE21 . GLN A 1 64 ? -13.635 3.316   6.972   1.00 0.00 ? 64 GLN A HE21 10 
ATOM 10791 H HE22 . GLN A 1 64 ? -12.717 2.177   7.891   1.00 0.00 ? 64 GLN A HE22 10 
ATOM 10792 N N    . GLY A 1 65 ? -8.521  8.038   6.338   1.00 0.00 ? 65 GLY A N    10 
ATOM 10793 C CA   . GLY A 1 65 ? -7.470  8.890   6.860   1.00 0.00 ? 65 GLY A CA   10 
ATOM 10794 C C    . GLY A 1 65 ? -6.877  9.798   5.802   1.00 0.00 ? 65 GLY A C    10 
ATOM 10795 O O    . GLY A 1 65 ? -5.868  9.463   5.180   1.00 0.00 ? 65 GLY A O    10 
ATOM 10796 H H    . GLY A 1 65 ? -8.293  7.274   5.768   1.00 0.00 ? 65 GLY A H    10 
ATOM 10797 H HA2  . GLY A 1 65 ? -7.877  9.499   7.653   1.00 0.00 ? 65 GLY A HA2  10 
ATOM 10798 H HA3  . GLY A 1 65 ? -6.685  8.268   7.265   1.00 0.00 ? 65 GLY A HA3  10 
ATOM 10799 N N    . HIS A 1 66 ? -7.502  10.954  5.597   1.00 0.00 ? 66 HIS A N    10 
ATOM 10800 C CA   . HIS A 1 66 ? -7.024  11.916  4.610   1.00 0.00 ? 66 HIS A CA   10 
ATOM 10801 C C    . HIS A 1 66 ? -6.370  13.114  5.290   1.00 0.00 ? 66 HIS A C    10 
ATOM 10802 O O    . HIS A 1 66 ? -6.392  14.227  4.766   1.00 0.00 ? 66 HIS A O    10 
ATOM 10803 C CB   . HIS A 1 66 ? -8.176  12.386  3.722   1.00 0.00 ? 66 HIS A CB   10 
ATOM 10804 C CG   . HIS A 1 66 ? -7.770  12.644  2.305   1.00 0.00 ? 66 HIS A CG   10 
ATOM 10805 N ND1  . HIS A 1 66 ? -8.305  13.662  1.541   1.00 0.00 ? 66 HIS A ND1  10 
ATOM 10806 C CD2  . HIS A 1 66 ? -6.873  12.012  1.511   1.00 0.00 ? 66 HIS A CD2  10 
ATOM 10807 C CE1  . HIS A 1 66 ? -7.753  13.643  0.340   1.00 0.00 ? 66 HIS A CE1  10 
ATOM 10808 N NE2  . HIS A 1 66 ? -6.884  12.652  0.297   1.00 0.00 ? 66 HIS A NE2  10 
ATOM 10809 H H    . HIS A 1 66 ? -8.299  11.167  6.126   1.00 0.00 ? 66 HIS A H    10 
ATOM 10810 H HA   . HIS A 1 66 ? -6.287  11.420  3.996   1.00 0.00 ? 66 HIS A HA   10 
ATOM 10811 H HB2  . HIS A 1 66 ? -8.948  11.629  3.714   1.00 0.00 ? 66 HIS A HB2  10 
ATOM 10812 H HB3  . HIS A 1 66 ? -8.582  13.303  4.125   1.00 0.00 ? 66 HIS A HB3  10 
ATOM 10813 H HD1  . HIS A 1 66 ? -8.985  14.302  1.835   1.00 0.00 ? 66 HIS A HD1  10 
ATOM 10814 H HD2  . HIS A 1 66 ? -6.263  11.162  1.783   1.00 0.00 ? 66 HIS A HD2  10 
ATOM 10815 H HE1  . HIS A 1 66 ? -7.979  14.323  -0.469  1.00 0.00 ? 66 HIS A HE1  10 
ATOM 10816 H HE2  . HIS A 1 66 ? -6.334  12.415  -0.479  1.00 0.00 ? 66 HIS A HE2  10 
ATOM 10817 N N    . ASP A 1 67 ? -5.788  12.877  6.461   1.00 0.00 ? 67 ASP A N    10 
ATOM 10818 C CA   . ASP A 1 67 ? -5.125  13.934  7.215   1.00 0.00 ? 67 ASP A CA   10 
ATOM 10819 C C    . ASP A 1 67 ? -4.374  13.356  8.409   1.00 0.00 ? 67 ASP A C    10 
ATOM 10820 O O    . ASP A 1 67 ? -4.941  12.613  9.210   1.00 0.00 ? 67 ASP A O    10 
ATOM 10821 C CB   . ASP A 1 67 ? -6.144  14.971  7.691   1.00 0.00 ? 67 ASP A CB   10 
ATOM 10822 C CG   . ASP A 1 67 ? -7.453  14.340  8.126   1.00 0.00 ? 67 ASP A CG   10 
ATOM 10823 O OD1  . ASP A 1 67 ? -8.294  14.054  7.248   1.00 0.00 ? 67 ASP A OD1  10 
ATOM 10824 O OD2  . ASP A 1 67 ? -7.636  14.130  9.344   1.00 0.00 ? 67 ASP A OD2  10 
ATOM 10825 H H    . ASP A 1 67 ? -5.802  11.968  6.826   1.00 0.00 ? 67 ASP A H    10 
ATOM 10826 H HA   . ASP A 1 67 ? -4.415  14.415  6.557   1.00 0.00 ? 67 ASP A HA   10 
ATOM 10827 H HB2  . ASP A 1 67 ? -5.732  15.513  8.529   1.00 0.00 ? 67 ASP A HB2  10 
ATOM 10828 H HB3  . ASP A 1 67 ? -6.348  15.661  6.886   1.00 0.00 ? 67 ASP A HB3  10 
ATOM 10829 N N    . TYR A 1 68 ? -3.096  13.698  8.517   1.00 0.00 ? 68 TYR A N    10 
ATOM 10830 C CA   . TYR A 1 68 ? -2.264  13.209  9.609   1.00 0.00 ? 68 TYR A CA   10 
ATOM 10831 C C    . TYR A 1 68 ? -2.118  11.692  9.543   1.00 0.00 ? 68 TYR A C    10 
ATOM 10832 O O    . TYR A 1 68 ? -3.150  10.994  9.635   1.00 0.00 ? 68 TYR A O    10 
ATOM 10833 C CB   . TYR A 1 68 ? -2.860  13.616  10.956  1.00 0.00 ? 68 TYR A CB   10 
ATOM 10834 C CG   . TYR A 1 68 ? -2.197  14.826  11.573  1.00 0.00 ? 68 TYR A CG   10 
ATOM 10835 C CD1  . TYR A 1 68 ? -0.819  14.874  11.749  1.00 0.00 ? 68 TYR A CD1  10 
ATOM 10836 C CD2  . TYR A 1 68 ? -2.949  15.922  11.978  1.00 0.00 ? 68 TYR A CD2  10 
ATOM 10837 C CE1  . TYR A 1 68 ? -0.211  15.979  12.313  1.00 0.00 ? 68 TYR A CE1  10 
ATOM 10838 C CE2  . TYR A 1 68 ? -2.346  17.031  12.541  1.00 0.00 ? 68 TYR A CE2  10 
ATOM 10839 C CZ   . TYR A 1 68 ? -0.978  17.054  12.706  1.00 0.00 ? 68 TYR A CZ   10 
ATOM 10840 O OH   . TYR A 1 68 ? -0.375  18.156  13.268  1.00 0.00 ? 68 TYR A OH   10 
ATOM 10841 O OXT  . TYR A 1 68 ? -0.973  11.214  9.397   1.00 0.00 ? 68 TYR A OXT  10 
ATOM 10842 H H    . TYR A 1 68 ? -2.701  14.290  7.844   1.00 0.00 ? 68 TYR A H    10 
ATOM 10843 H HA   . TYR A 1 68 ? -1.287  13.656  9.509   1.00 0.00 ? 68 TYR A HA   10 
ATOM 10844 H HB2  . TYR A 1 68 ? -3.908  13.842  10.825  1.00 0.00 ? 68 TYR A HB2  10 
ATOM 10845 H HB3  . TYR A 1 68 ? -2.758  12.793  11.648  1.00 0.00 ? 68 TYR A HB3  10 
ATOM 10846 H HD1  . TYR A 1 68 ? -0.221  14.029  11.441  1.00 0.00 ? 68 TYR A HD1  10 
ATOM 10847 H HD2  . TYR A 1 68 ? -4.020  15.901  11.847  1.00 0.00 ? 68 TYR A HD2  10 
ATOM 10848 H HE1  . TYR A 1 68 ? 0.861   15.997  12.442  1.00 0.00 ? 68 TYR A HE1  10 
ATOM 10849 H HE2  . TYR A 1 68 ? -2.948  17.873  12.850  1.00 0.00 ? 68 TYR A HE2  10 
ATOM 10850 H HH   . TYR A 1 68 ? 0.436   18.355  12.792  1.00 0.00 ? 68 TYR A HH   10 
ATOM 10851 N N    . TYR A 1 1  ? 11.836  15.969  -12.784 1.00 0.00 ? 1  TYR A N    11 
ATOM 10852 C CA   . TYR A 1 1  ? 12.338  16.425  -11.462 1.00 0.00 ? 1  TYR A CA   11 
ATOM 10853 C C    . TYR A 1 1  ? 11.195  16.601  -10.468 1.00 0.00 ? 1  TYR A C    11 
ATOM 10854 O O    . TYR A 1 1  ? 10.946  17.703  -9.980  1.00 0.00 ? 1  TYR A O    11 
ATOM 10855 C CB   . TYR A 1 1  ? 13.078  17.752  -11.653 1.00 0.00 ? 1  TYR A CB   11 
ATOM 10856 C CG   . TYR A 1 1  ? 14.583  17.610  -11.681 1.00 0.00 ? 1  TYR A CG   11 
ATOM 10857 C CD1  . TYR A 1 1  ? 15.263  17.005  -10.631 1.00 0.00 ? 1  TYR A CD1  11 
ATOM 10858 C CD2  . TYR A 1 1  ? 15.324  18.083  -12.756 1.00 0.00 ? 1  TYR A CD2  11 
ATOM 10859 C CE1  . TYR A 1 1  ? 16.638  16.875  -10.653 1.00 0.00 ? 1  TYR A CE1  11 
ATOM 10860 C CE2  . TYR A 1 1  ? 16.701  17.957  -12.785 1.00 0.00 ? 1  TYR A CE2  11 
ATOM 10861 C CZ   . TYR A 1 1  ? 17.352  17.352  -11.732 1.00 0.00 ? 1  TYR A CZ   11 
ATOM 10862 O OH   . TYR A 1 1  ? 18.722  17.224  -11.756 1.00 0.00 ? 1  TYR A OH   11 
ATOM 10863 H H1   . TYR A 1 1  ? 12.655  15.647  -13.340 1.00 0.00 ? 1  TYR A H1   11 
ATOM 10864 H H2   . TYR A 1 1  ? 11.366  16.776  -13.241 1.00 0.00 ? 1  TYR A H2   11 
ATOM 10865 H H3   . TYR A 1 1  ? 11.167  15.191  -12.617 1.00 0.00 ? 1  TYR A H3   11 
ATOM 10866 H HA   . TYR A 1 1  ? 13.026  15.684  -11.081 1.00 0.00 ? 1  TYR A HA   11 
ATOM 10867 H HB2  . TYR A 1 1  ? 12.769  18.195  -12.589 1.00 0.00 ? 1  TYR A HB2  11 
ATOM 10868 H HB3  . TYR A 1 1  ? 12.823  18.418  -10.842 1.00 0.00 ? 1  TYR A HB3  11 
ATOM 10869 H HD1  . TYR A 1 1  ? 14.700  16.633  -9.787  1.00 0.00 ? 1  TYR A HD1  11 
ATOM 10870 H HD2  . TYR A 1 1  ? 14.811  18.557  -13.580 1.00 0.00 ? 1  TYR A HD2  11 
ATOM 10871 H HE1  . TYR A 1 1  ? 17.148  16.401  -9.827  1.00 0.00 ? 1  TYR A HE1  11 
ATOM 10872 H HE2  . TYR A 1 1  ? 17.260  18.330  -13.630 1.00 0.00 ? 1  TYR A HE2  11 
ATOM 10873 H HH   . TYR A 1 1  ? 18.969  16.549  -12.392 1.00 0.00 ? 1  TYR A HH   11 
ATOM 10874 N N    . HIS A 1 2  ? 10.502  15.506  -10.174 1.00 0.00 ? 2  HIS A N    11 
ATOM 10875 C CA   . HIS A 1 2  ? 9.385   15.540  -9.236  1.00 0.00 ? 2  HIS A CA   11 
ATOM 10876 C C    . HIS A 1 2  ? 9.457   14.369  -8.262  1.00 0.00 ? 2  HIS A C    11 
ATOM 10877 O O    . HIS A 1 2  ? 9.642   13.222  -8.666  1.00 0.00 ? 2  HIS A O    11 
ATOM 10878 C CB   . HIS A 1 2  ? 8.056   15.508  -9.994  1.00 0.00 ? 2  HIS A CB   11 
ATOM 10879 C CG   . HIS A 1 2  ? 7.355   16.830  -10.024 1.00 0.00 ? 2  HIS A CG   11 
ATOM 10880 N ND1  . HIS A 1 2  ? 7.815   17.912  -10.747 1.00 0.00 ? 2  HIS A ND1  11 
ATOM 10881 C CD2  . HIS A 1 2  ? 6.218   17.245  -9.414  1.00 0.00 ? 2  HIS A CD2  11 
ATOM 10882 C CE1  . HIS A 1 2  ? 6.994   18.933  -10.580 1.00 0.00 ? 2  HIS A CE1  11 
ATOM 10883 N NE2  . HIS A 1 2  ? 6.018   18.554  -9.777  1.00 0.00 ? 2  HIS A NE2  11 
ATOM 10884 H H    . HIS A 1 2  ? 10.748  14.655  -10.594 1.00 0.00 ? 2  HIS A H    11 
ATOM 10885 H HA   . HIS A 1 2  ? 9.451   16.461  -8.678  1.00 0.00 ? 2  HIS A HA   11 
ATOM 10886 H HB2  . HIS A 1 2  ? 8.239   15.206  -11.015 1.00 0.00 ? 2  HIS A HB2  11 
ATOM 10887 H HB3  . HIS A 1 2  ? 7.398   14.794  -9.523  1.00 0.00 ? 2  HIS A HB3  11 
ATOM 10888 H HD1  . HIS A 1 2  ? 8.625   17.929  -11.300 1.00 0.00 ? 2  HIS A HD1  11 
ATOM 10889 H HD2  . HIS A 1 2  ? 5.588   16.656  -8.764  1.00 0.00 ? 2  HIS A HD2  11 
ATOM 10890 H HE1  . HIS A 1 2  ? 7.102   19.911  -11.026 1.00 0.00 ? 2  HIS A HE1  11 
ATOM 10891 H HE2  . HIS A 1 2  ? 5.271   19.119  -9.488  1.00 0.00 ? 2  HIS A HE2  11 
ATOM 10892 N N    . ALA A 1 3  ? 9.316   14.670  -6.975  1.00 0.00 ? 3  ALA A N    11 
ATOM 10893 C CA   . ALA A 1 3  ? 9.369   13.643  -5.942  1.00 0.00 ? 3  ALA A CA   11 
ATOM 10894 C C    . ALA A 1 3  ? 7.971   13.291  -5.447  1.00 0.00 ? 3  ALA A C    11 
ATOM 10895 O O    . ALA A 1 3  ? 7.012   14.026  -5.684  1.00 0.00 ? 3  ALA A O    11 
ATOM 10896 C CB   . ALA A 1 3  ? 10.242  14.105  -4.785  1.00 0.00 ? 3  ALA A CB   11 
ATOM 10897 H H    . ALA A 1 3  ? 9.174   15.604  -6.715  1.00 0.00 ? 3  ALA A H    11 
ATOM 10898 H HA   . ALA A 1 3  ? 9.820   12.761  -6.371  1.00 0.00 ? 3  ALA A HA   11 
ATOM 10899 H HB1  . ALA A 1 3  ? 9.632   14.620  -4.058  1.00 0.00 ? 3  ALA A HB1  11 
ATOM 10900 H HB2  . ALA A 1 3  ? 11.004  14.774  -5.154  1.00 0.00 ? 3  ALA A HB2  11 
ATOM 10901 H HB3  . ALA A 1 3  ? 10.708  13.248  -4.321  1.00 0.00 ? 3  ALA A HB3  11 
ATOM 10902 N N    . ASP A 1 4  ? 7.863   12.160  -4.759  1.00 0.00 ? 4  ASP A N    11 
ATOM 10903 C CA   . ASP A 1 4  ? 6.583   11.706  -4.227  1.00 0.00 ? 4  ASP A CA   11 
ATOM 10904 C C    . ASP A 1 4  ? 6.792   10.644  -3.150  1.00 0.00 ? 4  ASP A C    11 
ATOM 10905 O O    . ASP A 1 4  ? 6.333   9.510   -3.288  1.00 0.00 ? 4  ASP A O    11 
ATOM 10906 C CB   . ASP A 1 4  ? 5.710   11.145  -5.351  1.00 0.00 ? 4  ASP A CB   11 
ATOM 10907 C CG   . ASP A 1 4  ? 4.235   11.159  -5.001  1.00 0.00 ? 4  ASP A CG   11 
ATOM 10908 O OD1  . ASP A 1 4  ? 3.823   10.358  -4.136  1.00 0.00 ? 4  ASP A OD1  11 
ATOM 10909 O OD2  . ASP A 1 4  ? 3.492   11.971  -5.591  1.00 0.00 ? 4  ASP A OD2  11 
ATOM 10910 H H    . ASP A 1 4  ? 8.664   11.617  -4.603  1.00 0.00 ? 4  ASP A H    11 
ATOM 10911 H HA   . ASP A 1 4  ? 6.087   12.557  -3.785  1.00 0.00 ? 4  ASP A HA   11 
ATOM 10912 H HB2  . ASP A 1 4  ? 5.855   11.738  -6.242  1.00 0.00 ? 4  ASP A HB2  11 
ATOM 10913 H HB3  . ASP A 1 4  ? 6.003   10.125  -5.551  1.00 0.00 ? 4  ASP A HB3  11 
ATOM 10914 N N    . PRO A 1 5  ? 7.497   10.998  -2.062  1.00 0.00 ? 5  PRO A N    11 
ATOM 10915 C CA   . PRO A 1 5  ? 7.768   10.069  -0.960  1.00 0.00 ? 5  PRO A CA   11 
ATOM 10916 C C    . PRO A 1 5  ? 6.499   9.654   -0.224  1.00 0.00 ? 5  PRO A C    11 
ATOM 10917 O O    . PRO A 1 5  ? 6.471   8.628   0.455   1.00 0.00 ? 5  PRO A O    11 
ATOM 10918 C CB   . PRO A 1 5  ? 8.690   10.867  -0.032  1.00 0.00 ? 5  PRO A CB   11 
ATOM 10919 C CG   . PRO A 1 5  ? 8.418   12.295  -0.355  1.00 0.00 ? 5  PRO A CG   11 
ATOM 10920 C CD   . PRO A 1 5  ? 8.080   12.330  -1.819  1.00 0.00 ? 5  PRO A CD   11 
ATOM 10921 H HA   . PRO A 1 5  ? 8.284   9.186   -1.308  1.00 0.00 ? 5  PRO A HA   11 
ATOM 10922 H HB2  . PRO A 1 5  ? 8.451   10.642  0.997   1.00 0.00 ? 5  PRO A HB2  11 
ATOM 10923 H HB3  . PRO A 1 5  ? 9.719   10.606  -0.232  1.00 0.00 ? 5  PRO A HB3  11 
ATOM 10924 H HG2  . PRO A 1 5  ? 7.584   12.652  0.231   1.00 0.00 ? 5  PRO A HG2  11 
ATOM 10925 H HG3  . PRO A 1 5  ? 9.297   12.891  -0.159  1.00 0.00 ? 5  PRO A HG3  11 
ATOM 10926 H HD2  . PRO A 1 5  ? 7.361   13.110  -2.022  1.00 0.00 ? 5  PRO A HD2  11 
ATOM 10927 H HD3  . PRO A 1 5  ? 8.973   12.473  -2.410  1.00 0.00 ? 5  PRO A HD3  11 
ATOM 10928 N N    . SER A 1 6  ? 5.448   10.456  -0.364  1.00 0.00 ? 6  SER A N    11 
ATOM 10929 C CA   . SER A 1 6  ? 4.177   10.168  0.290   1.00 0.00 ? 6  SER A CA   11 
ATOM 10930 C C    . SER A 1 6  ? 3.439   9.042   -0.426  1.00 0.00 ? 6  SER A C    11 
ATOM 10931 O O    . SER A 1 6  ? 2.354   9.245   -0.972  1.00 0.00 ? 6  SER A O    11 
ATOM 10932 C CB   . SER A 1 6  ? 3.303   11.423  0.328   1.00 0.00 ? 6  SER A CB   11 
ATOM 10933 O OG   . SER A 1 6  ? 1.956   11.099  0.626   1.00 0.00 ? 6  SER A OG   11 
ATOM 10934 H H    . SER A 1 6  ? 5.530   11.260  -0.919  1.00 0.00 ? 6  SER A H    11 
ATOM 10935 H HA   . SER A 1 6  ? 4.389   9.856   1.302   1.00 0.00 ? 6  SER A HA   11 
ATOM 10936 H HB2  . SER A 1 6  ? 3.675   12.096  1.087   1.00 0.00 ? 6  SER A HB2  11 
ATOM 10937 H HB3  . SER A 1 6  ? 3.337   11.913  -0.635  1.00 0.00 ? 6  SER A HB3  11 
ATOM 10938 H HG   . SER A 1 6  ? 1.792   11.244  1.561   1.00 0.00 ? 6  SER A HG   11 
ATOM 10939 N N    . LEU A 1 7  ? 4.036   7.855   -0.420  1.00 0.00 ? 7  LEU A N    11 
ATOM 10940 C CA   . LEU A 1 7  ? 3.439   6.693   -1.067  1.00 0.00 ? 7  LEU A CA   11 
ATOM 10941 C C    . LEU A 1 7  ? 4.297   5.452   -0.850  1.00 0.00 ? 7  LEU A C    11 
ATOM 10942 O O    . LEU A 1 7  ? 3.847   4.471   -0.257  1.00 0.00 ? 7  LEU A O    11 
ATOM 10943 C CB   . LEU A 1 7  ? 3.263   6.951   -2.568  1.00 0.00 ? 7  LEU A CB   11 
ATOM 10944 C CG   . LEU A 1 7  ? 2.837   5.734   -3.396  1.00 0.00 ? 7  LEU A CG   11 
ATOM 10945 C CD1  . LEU A 1 7  ? 4.034   4.846   -3.698  1.00 0.00 ? 7  LEU A CD1  11 
ATOM 10946 C CD2  . LEU A 1 7  ? 1.753   4.945   -2.675  1.00 0.00 ? 7  LEU A CD2  11 
ATOM 10947 H H    . LEU A 1 7  ? 4.899   7.757   0.033   1.00 0.00 ? 7  LEU A H    11 
ATOM 10948 H HA   . LEU A 1 7  ? 2.469   6.528   -0.623  1.00 0.00 ? 7  LEU A HA   11 
ATOM 10949 H HB2  . LEU A 1 7  ? 2.518   7.722   -2.693  1.00 0.00 ? 7  LEU A HB2  11 
ATOM 10950 H HB3  . LEU A 1 7  ? 4.202   7.314   -2.960  1.00 0.00 ? 7  LEU A HB3  11 
ATOM 10951 H HG   . LEU A 1 7  ? 2.430   6.074   -4.337  1.00 0.00 ? 7  LEU A HG   11 
ATOM 10952 H HD11 . LEU A 1 7  ? 3.912   4.396   -4.672  1.00 0.00 ? 7  LEU A HD11 11 
ATOM 10953 H HD12 . LEU A 1 7  ? 4.105   4.070   -2.951  1.00 0.00 ? 7  LEU A HD12 11 
ATOM 10954 H HD13 . LEU A 1 7  ? 4.936   5.441   -3.686  1.00 0.00 ? 7  LEU A HD13 11 
ATOM 10955 H HD21 . LEU A 1 7  ? 2.195   4.085   -2.193  1.00 0.00 ? 7  LEU A HD21 11 
ATOM 10956 H HD22 . LEU A 1 7  ? 1.012   4.617   -3.389  1.00 0.00 ? 7  LEU A HD22 11 
ATOM 10957 H HD23 . LEU A 1 7  ? 1.286   5.572   -1.932  1.00 0.00 ? 7  LEU A HD23 11 
ATOM 10958 N N    . VAL A 1 8  ? 5.536   5.503   -1.329  1.00 0.00 ? 8  VAL A N    11 
ATOM 10959 C CA   . VAL A 1 8  ? 6.458   4.384   -1.182  1.00 0.00 ? 8  VAL A CA   11 
ATOM 10960 C C    . VAL A 1 8  ? 6.680   4.049   0.289   1.00 0.00 ? 8  VAL A C    11 
ATOM 10961 O O    . VAL A 1 8  ? 6.678   2.881   0.678   1.00 0.00 ? 8  VAL A O    11 
ATOM 10962 C CB   . VAL A 1 8  ? 7.817   4.683   -1.841  1.00 0.00 ? 8  VAL A CB   11 
ATOM 10963 C CG1  . VAL A 1 8  ? 8.690   3.438   -1.856  1.00 0.00 ? 8  VAL A CG1  11 
ATOM 10964 C CG2  . VAL A 1 8  ? 7.621   5.223   -3.249  1.00 0.00 ? 8  VAL A CG2  11 
ATOM 10965 H H    . VAL A 1 8  ? 5.837   6.314   -1.789  1.00 0.00 ? 8  VAL A H    11 
ATOM 10966 H HA   . VAL A 1 8  ? 6.024   3.527   -1.676  1.00 0.00 ? 8  VAL A HA   11 
ATOM 10967 H HB   . VAL A 1 8  ? 8.319   5.441   -1.257  1.00 0.00 ? 8  VAL A HB   11 
ATOM 10968 H HG11 . VAL A 1 8  ? 8.063   2.559   -1.821  1.00 0.00 ? 8  VAL A HG11 11 
ATOM 10969 H HG12 . VAL A 1 8  ? 9.345   3.447   -0.997  1.00 0.00 ? 8  VAL A HG12 11 
ATOM 10970 H HG13 . VAL A 1 8  ? 9.280   3.423   -2.760  1.00 0.00 ? 8  VAL A HG13 11 
ATOM 10971 H HG21 . VAL A 1 8  ? 7.296   6.253   -3.199  1.00 0.00 ? 8  VAL A HG21 11 
ATOM 10972 H HG22 . VAL A 1 8  ? 6.872   4.635   -3.760  1.00 0.00 ? 8  VAL A HG22 11 
ATOM 10973 H HG23 . VAL A 1 8  ? 8.553   5.166   -3.790  1.00 0.00 ? 8  VAL A HG23 11 
ATOM 10974 N N    . SER A 1 9  ? 6.868   5.083   1.105   1.00 0.00 ? 9  SER A N    11 
ATOM 10975 C CA   . SER A 1 9  ? 7.088   4.899   2.535   1.00 0.00 ? 9  SER A CA   11 
ATOM 10976 C C    . SER A 1 9  ? 5.977   4.057   3.153   1.00 0.00 ? 9  SER A C    11 
ATOM 10977 O O    . SER A 1 9  ? 6.221   3.252   4.053   1.00 0.00 ? 9  SER A O    11 
ATOM 10978 C CB   . SER A 1 9  ? 7.171   6.257   3.237   1.00 0.00 ? 9  SER A CB   11 
ATOM 10979 O OG   . SER A 1 9  ? 6.763   6.163   4.591   1.00 0.00 ? 9  SER A OG   11 
ATOM 10980 H H    . SER A 1 9  ? 6.857   5.990   0.735   1.00 0.00 ? 9  SER A H    11 
ATOM 10981 H HA   . SER A 1 9  ? 8.027   4.382   2.660   1.00 0.00 ? 9  SER A HA   11 
ATOM 10982 H HB2  . SER A 1 9  ? 8.190   6.611   3.207   1.00 0.00 ? 9  SER A HB2  11 
ATOM 10983 H HB3  . SER A 1 9  ? 6.530   6.962   2.729   1.00 0.00 ? 9  SER A HB3  11 
ATOM 10984 H HG   . SER A 1 9  ? 6.552   7.038   4.924   1.00 0.00 ? 9  SER A HG   11 
ATOM 10985 N N    . PHE A 1 10 ? 4.758   4.248   2.664   1.00 0.00 ? 10 PHE A N    11 
ATOM 10986 C CA   . PHE A 1 10 ? 3.608   3.505   3.165   1.00 0.00 ? 10 PHE A CA   11 
ATOM 10987 C C    . PHE A 1 10 ? 3.528   2.128   2.517   1.00 0.00 ? 10 PHE A C    11 
ATOM 10988 O O    . PHE A 1 10 ? 3.340   1.120   3.198   1.00 0.00 ? 10 PHE A O    11 
ATOM 10989 C CB   . PHE A 1 10 ? 2.317   4.281   2.899   1.00 0.00 ? 10 PHE A CB   11 
ATOM 10990 C CG   . PHE A 1 10 ? 1.870   5.123   4.059   1.00 0.00 ? 10 PHE A CG   11 
ATOM 10991 C CD1  . PHE A 1 10 ? 2.463   6.350   4.310   1.00 0.00 ? 10 PHE A CD1  11 
ATOM 10992 C CD2  . PHE A 1 10 ? 0.857   4.689   4.899   1.00 0.00 ? 10 PHE A CD2  11 
ATOM 10993 C CE1  . PHE A 1 10 ? 2.056   7.128   5.377   1.00 0.00 ? 10 PHE A CE1  11 
ATOM 10994 C CE2  . PHE A 1 10 ? 0.445   5.462   5.967   1.00 0.00 ? 10 PHE A CE2  11 
ATOM 10995 C CZ   . PHE A 1 10 ? 1.044   6.683   6.207   1.00 0.00 ? 10 PHE A CZ   11 
ATOM 10996 H H    . PHE A 1 10 ? 4.627   4.904   1.947   1.00 0.00 ? 10 PHE A H    11 
ATOM 10997 H HA   . PHE A 1 10 ? 3.733   3.380   4.232   1.00 0.00 ? 10 PHE A HA   11 
ATOM 10998 H HB2  . PHE A 1 10 ? 2.467   4.936   2.053   1.00 0.00 ? 10 PHE A HB2  11 
ATOM 10999 H HB3  . PHE A 1 10 ? 1.526   3.583   2.671   1.00 0.00 ? 10 PHE A HB3  11 
ATOM 11000 H HD1  . PHE A 1 10 ? 3.254   6.699   3.662   1.00 0.00 ? 10 PHE A HD1  11 
ATOM 11001 H HD2  . PHE A 1 10 ? 0.388   3.735   4.713   1.00 0.00 ? 10 PHE A HD2  11 
ATOM 11002 H HE1  . PHE A 1 10 ? 2.526   8.082   5.562   1.00 0.00 ? 10 PHE A HE1  11 
ATOM 11003 H HE2  . PHE A 1 10 ? -0.347  5.112   6.615   1.00 0.00 ? 10 PHE A HE2  11 
ATOM 11004 H HZ   . PHE A 1 10 ? 0.724   7.289   7.041   1.00 0.00 ? 10 PHE A HZ   11 
ATOM 11005 N N    . LEU A 1 11 ? 3.675   2.093   1.197   1.00 0.00 ? 11 LEU A N    11 
ATOM 11006 C CA   . LEU A 1 11 ? 3.626   0.839   0.454   1.00 0.00 ? 11 LEU A CA   11 
ATOM 11007 C C    . LEU A 1 11 ? 4.541   -0.203  1.089   1.00 0.00 ? 11 LEU A C    11 
ATOM 11008 O O    . LEU A 1 11 ? 4.240   -1.397  1.081   1.00 0.00 ? 11 LEU A O    11 
ATOM 11009 C CB   . LEU A 1 11 ? 4.035   1.071   -1.001  1.00 0.00 ? 11 LEU A CB   11 
ATOM 11010 C CG   . LEU A 1 11 ? 3.577   -0.009  -1.983  1.00 0.00 ? 11 LEU A CG   11 
ATOM 11011 C CD1  . LEU A 1 11 ? 4.444   -1.250  -1.850  1.00 0.00 ? 11 LEU A CD1  11 
ATOM 11012 C CD2  . LEU A 1 11 ? 2.112   -0.352  -1.754  1.00 0.00 ? 11 LEU A CD2  11 
ATOM 11013 H H    . LEU A 1 11 ? 3.825   2.929   0.709   1.00 0.00 ? 11 LEU A H    11 
ATOM 11014 H HA   . LEU A 1 11 ? 2.610   0.475   0.484   1.00 0.00 ? 11 LEU A HA   11 
ATOM 11015 H HB2  . LEU A 1 11 ? 3.624   2.018   -1.322  1.00 0.00 ? 11 LEU A HB2  11 
ATOM 11016 H HB3  . LEU A 1 11 ? 5.112   1.133   -1.043  1.00 0.00 ? 11 LEU A HB3  11 
ATOM 11017 H HG   . LEU A 1 11 ? 3.679   0.363   -2.993  1.00 0.00 ? 11 LEU A HG   11 
ATOM 11018 H HD11 . LEU A 1 11 ? 4.583   -1.699  -2.822  1.00 0.00 ? 11 LEU A HD11 11 
ATOM 11019 H HD12 . LEU A 1 11 ? 3.961   -1.958  -1.192  1.00 0.00 ? 11 LEU A HD12 11 
ATOM 11020 H HD13 . LEU A 1 11 ? 5.406   -0.976  -1.439  1.00 0.00 ? 11 LEU A HD13 11 
ATOM 11021 H HD21 . LEU A 1 11 ? 2.030   -1.051  -0.936  1.00 0.00 ? 11 LEU A HD21 11 
ATOM 11022 H HD22 . LEU A 1 11 ? 1.701   -0.793  -2.649  1.00 0.00 ? 11 LEU A HD22 11 
ATOM 11023 H HD23 . LEU A 1 11 ? 1.566   0.549   -1.513  1.00 0.00 ? 11 LEU A HD23 11 
ATOM 11024 N N    . THR A 1 12 ? 5.656   0.260   1.644   1.00 0.00 ? 12 THR A N    11 
ATOM 11025 C CA   . THR A 1 12 ? 6.616   -0.628  2.287   1.00 0.00 ? 12 THR A CA   11 
ATOM 11026 C C    . THR A 1 12 ? 6.199   -0.934  3.720   1.00 0.00 ? 12 THR A C    11 
ATOM 11027 O O    . THR A 1 12 ? 5.945   -2.090  4.070   1.00 0.00 ? 12 THR A O    11 
ATOM 11028 C CB   . THR A 1 12 ? 8.010   -0.001  2.275   1.00 0.00 ? 12 THR A CB   11 
ATOM 11029 O OG1  . THR A 1 12 ? 8.239   0.689   1.057   1.00 0.00 ? 12 THR A OG1  11 
ATOM 11030 C CG2  . THR A 1 12 ? 9.123   -1.011  2.451   1.00 0.00 ? 12 THR A CG2  11 
ATOM 11031 H H    . THR A 1 12 ? 5.838   1.222   1.618   1.00 0.00 ? 12 THR A H    11 
ATOM 11032 H HA   . THR A 1 12 ? 6.640   -1.551  1.726   1.00 0.00 ? 12 THR A HA   11 
ATOM 11033 H HB   . THR A 1 12 ? 8.081   0.709   3.085   1.00 0.00 ? 12 THR A HB   11 
ATOM 11034 H HG1  . THR A 1 12 ? 8.101   1.629   1.192   1.00 0.00 ? 12 THR A HG1  11 
ATOM 11035 H HG21 . THR A 1 12 ? 8.732   -1.896  2.930   1.00 0.00 ? 12 THR A HG21 11 
ATOM 11036 H HG22 . THR A 1 12 ? 9.903   -0.584  3.063   1.00 0.00 ? 12 THR A HG22 11 
ATOM 11037 H HG23 . THR A 1 12 ? 9.526   -1.273  1.484   1.00 0.00 ? 12 THR A HG23 11 
ATOM 11038 N N    . GLY A 1 13 ? 6.128   0.111   4.547   1.00 0.00 ? 13 GLY A N    11 
ATOM 11039 C CA   . GLY A 1 13 ? 5.734   -0.058  5.939   1.00 0.00 ? 13 GLY A CA   11 
ATOM 11040 C C    . GLY A 1 13 ? 4.505   -0.929  6.075   1.00 0.00 ? 13 GLY A C    11 
ATOM 11041 O O    . GLY A 1 13 ? 4.329   -1.628  7.073   1.00 0.00 ? 13 GLY A O    11 
ATOM 11042 H H    . GLY A 1 13 ? 6.328   1.006   4.202   1.00 0.00 ? 13 GLY A H    11 
ATOM 11043 H HA2  . GLY A 1 13 ? 6.549   -0.512  6.482   1.00 0.00 ? 13 GLY A HA2  11 
ATOM 11044 H HA3  . GLY A 1 13 ? 5.525   0.913   6.364   1.00 0.00 ? 13 GLY A HA3  11 
ATOM 11045 N N    . LEU A 1 14 ? 3.673   -0.901  5.045   1.00 0.00 ? 14 LEU A N    11 
ATOM 11046 C CA   . LEU A 1 14 ? 2.477   -1.723  4.993   1.00 0.00 ? 14 LEU A CA   11 
ATOM 11047 C C    . LEU A 1 14 ? 2.814   -3.182  5.269   1.00 0.00 ? 14 LEU A C    11 
ATOM 11048 O O    . LEU A 1 14 ? 1.961   -3.961  5.694   1.00 0.00 ? 14 LEU A O    11 
ATOM 11049 C CB   . LEU A 1 14 ? 1.856   -1.598  3.605   1.00 0.00 ? 14 LEU A CB   11 
ATOM 11050 C CG   . LEU A 1 14 ? 0.580   -2.403  3.376   1.00 0.00 ? 14 LEU A CG   11 
ATOM 11051 C CD1  . LEU A 1 14 ? -0.463  -1.541  2.677   1.00 0.00 ? 14 LEU A CD1  11 
ATOM 11052 C CD2  . LEU A 1 14 ? 0.887   -3.654  2.567   1.00 0.00 ? 14 LEU A CD2  11 
ATOM 11053 H H    . LEU A 1 14 ? 3.895   -0.339  4.274   1.00 0.00 ? 14 LEU A H    11 
ATOM 11054 H HA   . LEU A 1 14 ? 1.782   -1.366  5.737   1.00 0.00 ? 14 LEU A HA   11 
ATOM 11055 H HB2  . LEU A 1 14 ? 1.636   -0.561  3.429   1.00 0.00 ? 14 LEU A HB2  11 
ATOM 11056 H HB3  . LEU A 1 14 ? 2.591   -1.916  2.880   1.00 0.00 ? 14 LEU A HB3  11 
ATOM 11057 H HG   . LEU A 1 14 ? 0.174   -2.711  4.329   1.00 0.00 ? 14 LEU A HG   11 
ATOM 11058 H HD11 . LEU A 1 14 ? -1.443  -1.775  3.064   1.00 0.00 ? 14 LEU A HD11 11 
ATOM 11059 H HD12 . LEU A 1 14 ? -0.436  -1.733  1.615   1.00 0.00 ? 14 LEU A HD12 11 
ATOM 11060 H HD13 . LEU A 1 14 ? -0.245  -0.499  2.859   1.00 0.00 ? 14 LEU A HD13 11 
ATOM 11061 H HD21 . LEU A 1 14 ? 1.921   -3.928  2.711   1.00 0.00 ? 14 LEU A HD21 11 
ATOM 11062 H HD22 . LEU A 1 14 ? 0.709   -3.459  1.519   1.00 0.00 ? 14 LEU A HD22 11 
ATOM 11063 H HD23 . LEU A 1 14 ? 0.253   -4.463  2.897   1.00 0.00 ? 14 LEU A HD23 11 
ATOM 11064 N N    . GLY A 1 15 ? 4.063   -3.544  5.005   1.00 0.00 ? 15 GLY A N    11 
ATOM 11065 C CA   . GLY A 1 15 ? 4.496   -4.912  5.175   1.00 0.00 ? 15 GLY A CA   11 
ATOM 11066 C C    . GLY A 1 15 ? 4.858   -5.556  3.849   1.00 0.00 ? 15 GLY A C    11 
ATOM 11067 O O    . GLY A 1 15 ? 4.986   -6.777  3.761   1.00 0.00 ? 15 GLY A O    11 
ATOM 11068 H H    . GLY A 1 15 ? 4.688   -2.882  4.645   1.00 0.00 ? 15 GLY A H    11 
ATOM 11069 H HA2  . GLY A 1 15 ? 5.362   -4.929  5.821   1.00 0.00 ? 15 GLY A HA2  11 
ATOM 11070 H HA3  . GLY A 1 15 ? 3.700   -5.479  5.635   1.00 0.00 ? 15 GLY A HA3  11 
ATOM 11071 N N    . CYS A 1 16 ? 5.013   -4.731  2.810   1.00 0.00 ? 16 CYS A N    11 
ATOM 11072 C CA   . CYS A 1 16 ? 5.352   -5.234  1.484   1.00 0.00 ? 16 CYS A CA   11 
ATOM 11073 C C    . CYS A 1 16 ? 6.660   -4.628  0.984   1.00 0.00 ? 16 CYS A C    11 
ATOM 11074 O O    . CYS A 1 16 ? 6.677   -3.904  -0.012  1.00 0.00 ? 16 CYS A O    11 
ATOM 11075 C CB   . CYS A 1 16 ? 4.225   -4.925  0.498   1.00 0.00 ? 16 CYS A CB   11 
ATOM 11076 S SG   . CYS A 1 16 ? 2.696   -5.835  0.812   1.00 0.00 ? 16 CYS A SG   11 
ATOM 11077 H H    . CYS A 1 16 ? 4.895   -3.763  2.937   1.00 0.00 ? 16 CYS A H    11 
ATOM 11078 H HA   . CYS A 1 16 ? 5.471   -6.305  1.558   1.00 0.00 ? 16 CYS A HA   11 
ATOM 11079 H HB2  . CYS A 1 16 ? 3.994   -3.871  0.546   1.00 0.00 ? 16 CYS A HB2  11 
ATOM 11080 H HB3  . CYS A 1 16 ? 4.553   -5.171  -0.501  1.00 0.00 ? 16 CYS A HB3  11 
ATOM 11081 H HG   . CYS A 1 16 ? 2.931   -6.715  1.115   1.00 0.00 ? 16 CYS A HG   11 
ATOM 11082 N N    . PRO A 1 17 ? 7.780   -4.922  1.667   1.00 0.00 ? 17 PRO A N    11 
ATOM 11083 C CA   . PRO A 1 17 ? 9.096   -4.405  1.282   1.00 0.00 ? 17 PRO A CA   11 
ATOM 11084 C C    . PRO A 1 17 ? 9.643   -5.068  0.020   1.00 0.00 ? 17 PRO A C    11 
ATOM 11085 O O    . PRO A 1 17 ? 10.635  -4.612  -0.549  1.00 0.00 ? 17 PRO A O    11 
ATOM 11086 C CB   . PRO A 1 17 ? 9.974   -4.743  2.487   1.00 0.00 ? 17 PRO A CB   11 
ATOM 11087 C CG   . PRO A 1 17 ? 9.329   -5.940  3.097   1.00 0.00 ? 17 PRO A CG   11 
ATOM 11088 C CD   . PRO A 1 17 ? 7.851   -5.779  2.865   1.00 0.00 ? 17 PRO A CD   11 
ATOM 11089 H HA   . PRO A 1 17 ? 9.074   -3.333  1.142   1.00 0.00 ? 17 PRO A HA   11 
ATOM 11090 H HB2  . PRO A 1 17 ? 10.978  -4.962  2.155   1.00 0.00 ? 17 PRO A HB2  11 
ATOM 11091 H HB3  . PRO A 1 17 ? 9.988   -3.910  3.172   1.00 0.00 ? 17 PRO A HB3  11 
ATOM 11092 H HG2  . PRO A 1 17 ? 9.688   -6.837  2.612   1.00 0.00 ? 17 PRO A HG2  11 
ATOM 11093 H HG3  . PRO A 1 17 ? 9.542   -5.973  4.155   1.00 0.00 ? 17 PRO A HG3  11 
ATOM 11094 H HD2  . PRO A 1 17 ? 7.391   -6.738  2.681   1.00 0.00 ? 17 PRO A HD2  11 
ATOM 11095 H HD3  . PRO A 1 17 ? 7.387   -5.295  3.712   1.00 0.00 ? 17 PRO A HD3  11 
ATOM 11096 N N    . ASN A 1 18 ? 8.997   -6.149  -0.414  1.00 0.00 ? 18 ASN A N    11 
ATOM 11097 C CA   . ASN A 1 18 ? 9.427   -6.864  -1.610  1.00 0.00 ? 18 ASN A CA   11 
ATOM 11098 C C    . ASN A 1 18 ? 8.252   -7.130  -2.547  1.00 0.00 ? 18 ASN A C    11 
ATOM 11099 O O    . ASN A 1 18 ? 8.322   -8.007  -3.408  1.00 0.00 ? 18 ASN A O    11 
ATOM 11100 C CB   . ASN A 1 18 ? 10.092  -8.186  -1.222  1.00 0.00 ? 18 ASN A CB   11 
ATOM 11101 C CG   . ASN A 1 18 ? 11.564  -8.022  -0.899  1.00 0.00 ? 18 ASN A CG   11 
ATOM 11102 O OD1  . ASN A 1 18 ? 12.011  -6.940  -0.520  1.00 0.00 ? 18 ASN A OD1  11 
ATOM 11103 N ND2  . ASN A 1 18 ? 12.325  -9.101  -1.046  1.00 0.00 ? 18 ASN A ND2  11 
ATOM 11104 H H    . ASN A 1 18 ? 8.212   -6.469  0.075   1.00 0.00 ? 18 ASN A H    11 
ATOM 11105 H HA   . ASN A 1 18 ? 10.147  -6.245  -2.124  1.00 0.00 ? 18 ASN A HA   11 
ATOM 11106 H HB2  . ASN A 1 18 ? 9.594   -8.591  -0.353  1.00 0.00 ? 18 ASN A HB2  11 
ATOM 11107 H HB3  . ASN A 1 18 ? 9.998   -8.883  -2.042  1.00 0.00 ? 18 ASN A HB3  11 
ATOM 11108 H HD21 . ASN A 1 18 ? 11.900  -9.929  -1.351  1.00 0.00 ? 18 ASN A HD21 11 
ATOM 11109 H HD22 . ASN A 1 18 ? 13.281  -9.023  -0.843  1.00 0.00 ? 18 ASN A HD22 11 
ATOM 11110 N N    . CYS A 1 19 ? 7.172   -6.369  -2.378  1.00 0.00 ? 19 CYS A N    11 
ATOM 11111 C CA   . CYS A 1 19 ? 5.991   -6.528  -3.218  1.00 0.00 ? 19 CYS A CA   11 
ATOM 11112 C C    . CYS A 1 19 ? 5.798   -5.315  -4.119  1.00 0.00 ? 19 CYS A C    11 
ATOM 11113 O O    . CYS A 1 19 ? 5.218   -5.417  -5.200  1.00 0.00 ? 19 CYS A O    11 
ATOM 11114 C CB   . CYS A 1 19 ? 4.747   -6.740  -2.354  1.00 0.00 ? 19 CYS A CB   11 
ATOM 11115 S SG   . CYS A 1 19 ? 3.682   -8.092  -2.907  1.00 0.00 ? 19 CYS A SG   11 
ATOM 11116 H H    . CYS A 1 19 ? 7.171   -5.684  -1.679  1.00 0.00 ? 19 CYS A H    11 
ATOM 11117 H HA   . CYS A 1 19 ? 6.142   -7.399  -3.837  1.00 0.00 ? 19 CYS A HA   11 
ATOM 11118 H HB2  . CYS A 1 19 ? 5.053   -6.956  -1.341  1.00 0.00 ? 19 CYS A HB2  11 
ATOM 11119 H HB3  . CYS A 1 19 ? 4.156   -5.835  -2.360  1.00 0.00 ? 19 CYS A HB3  11 
ATOM 11120 H HG   . CYS A 1 19 ? 4.226   -8.721  -3.387  1.00 0.00 ? 19 CYS A HG   11 
ATOM 11121 N N    . ILE A 1 20 ? 6.290   -4.167  -3.667  1.00 0.00 ? 20 ILE A N    11 
ATOM 11122 C CA   . ILE A 1 20 ? 6.180   -2.932  -4.431  1.00 0.00 ? 20 ILE A CA   11 
ATOM 11123 C C    . ILE A 1 20 ? 6.639   -3.134  -5.871  1.00 0.00 ? 20 ILE A C    11 
ATOM 11124 O O    . ILE A 1 20 ? 6.094   -2.533  -6.797  1.00 0.00 ? 20 ILE A O    11 
ATOM 11125 C CB   . ILE A 1 20 ? 7.013   -1.807  -3.792  1.00 0.00 ? 20 ILE A CB   11 
ATOM 11126 C CG1  . ILE A 1 20 ? 6.821   -0.497  -4.560  1.00 0.00 ? 20 ILE A CG1  11 
ATOM 11127 C CG2  . ILE A 1 20 ? 8.481   -2.200  -3.761  1.00 0.00 ? 20 ILE A CG2  11 
ATOM 11128 C CD1  . ILE A 1 20 ? 6.951   0.737   -3.694  1.00 0.00 ? 20 ILE A CD1  11 
ATOM 11129 H H    . ILE A 1 20 ? 6.743   -4.152  -2.798  1.00 0.00 ? 20 ILE A H    11 
ATOM 11130 H HA   . ILE A 1 20 ? 5.143   -2.630  -4.433  1.00 0.00 ? 20 ILE A HA   11 
ATOM 11131 H HB   . ILE A 1 20 ? 6.679   -1.675  -2.774  1.00 0.00 ? 20 ILE A HB   11 
ATOM 11132 H HG12 . ILE A 1 20 ? 7.565   -0.433  -5.340  1.00 0.00 ? 20 ILE A HG12 11 
ATOM 11133 H HG13 . ILE A 1 20 ? 5.837   -0.488  -5.003  1.00 0.00 ? 20 ILE A HG13 11 
ATOM 11134 H HG21 . ILE A 1 20 ? 8.563   -3.272  -3.649  1.00 0.00 ? 20 ILE A HG21 11 
ATOM 11135 H HG22 . ILE A 1 20 ? 8.968   -1.712  -2.930  1.00 0.00 ? 20 ILE A HG22 11 
ATOM 11136 H HG23 . ILE A 1 20 ? 8.954   -1.899  -4.683  1.00 0.00 ? 20 ILE A HG23 11 
ATOM 11137 H HD11 . ILE A 1 20 ? 6.858   1.620   -4.310  1.00 0.00 ? 20 ILE A HD11 11 
ATOM 11138 H HD12 . ILE A 1 20 ? 7.916   0.737   -3.208  1.00 0.00 ? 20 ILE A HD12 11 
ATOM 11139 H HD13 . ILE A 1 20 ? 6.172   0.735   -2.946  1.00 0.00 ? 20 ILE A HD13 11 
ATOM 11140 N N    . GLU A 1 21 ? 7.645   -3.981  -6.054  1.00 0.00 ? 21 GLU A N    11 
ATOM 11141 C CA   . GLU A 1 21 ? 8.171   -4.266  -7.383  1.00 0.00 ? 21 GLU A CA   11 
ATOM 11142 C C    . GLU A 1 21 ? 7.063   -4.748  -8.310  1.00 0.00 ? 21 GLU A C    11 
ATOM 11143 O O    . GLU A 1 21 ? 6.956   -4.304  -9.453  1.00 0.00 ? 21 GLU A O    11 
ATOM 11144 C CB   . GLU A 1 21 ? 9.273   -5.320  -7.300  1.00 0.00 ? 21 GLU A CB   11 
ATOM 11145 C CG   . GLU A 1 21 ? 10.425  -4.928  -6.390  1.00 0.00 ? 21 GLU A CG   11 
ATOM 11146 C CD   . GLU A 1 21 ? 11.605  -4.360  -7.153  1.00 0.00 ? 21 GLU A CD   11 
ATOM 11147 O OE1  . GLU A 1 21 ? 11.476  -4.149  -8.377  1.00 0.00 ? 21 GLU A OE1  11 
ATOM 11148 O OE2  . GLU A 1 21 ? 12.660  -4.126  -6.526  1.00 0.00 ? 21 GLU A OE2  11 
ATOM 11149 H H    . GLU A 1 21 ? 8.037   -4.434  -5.277  1.00 0.00 ? 21 GLU A H    11 
ATOM 11150 H HA   . GLU A 1 21 ? 8.585   -3.351  -7.780  1.00 0.00 ? 21 GLU A HA   11 
ATOM 11151 H HB2  . GLU A 1 21 ? 8.847   -6.240  -6.930  1.00 0.00 ? 21 GLU A HB2  11 
ATOM 11152 H HB3  . GLU A 1 21 ? 9.666   -5.491  -8.292  1.00 0.00 ? 21 GLU A HB3  11 
ATOM 11153 H HG2  . GLU A 1 21 ? 10.075  -4.181  -5.691  1.00 0.00 ? 21 GLU A HG2  11 
ATOM 11154 H HG3  . GLU A 1 21 ? 10.752  -5.802  -5.848  1.00 0.00 ? 21 GLU A HG3  11 
ATOM 11155 N N    . TYR A 1 22 ? 6.241   -5.664  -7.809  1.00 0.00 ? 22 TYR A N    11 
ATOM 11156 C CA   . TYR A 1 22 ? 5.132   -6.201  -8.587  1.00 0.00 ? 22 TYR A CA   11 
ATOM 11157 C C    . TYR A 1 22 ? 4.006   -5.179  -8.683  1.00 0.00 ? 22 TYR A C    11 
ATOM 11158 O O    . TYR A 1 22 ? 3.347   -5.058  -9.715  1.00 0.00 ? 22 TYR A O    11 
ATOM 11159 C CB   . TYR A 1 22 ? 4.615   -7.493  -7.953  1.00 0.00 ? 22 TYR A CB   11 
ATOM 11160 C CG   . TYR A 1 22 ? 5.688   -8.544  -7.765  1.00 0.00 ? 22 TYR A CG   11 
ATOM 11161 C CD1  . TYR A 1 22 ? 6.543   -8.502  -6.671  1.00 0.00 ? 22 TYR A CD1  11 
ATOM 11162 C CD2  . TYR A 1 22 ? 5.848   -9.571  -8.686  1.00 0.00 ? 22 TYR A CD2  11 
ATOM 11163 C CE1  . TYR A 1 22 ? 7.525   -9.459  -6.498  1.00 0.00 ? 22 TYR A CE1  11 
ATOM 11164 C CE2  . TYR A 1 22 ? 6.828   -10.531 -8.520  1.00 0.00 ? 22 TYR A CE2  11 
ATOM 11165 C CZ   . TYR A 1 22 ? 7.663   -10.470 -7.425  1.00 0.00 ? 22 TYR A CZ   11 
ATOM 11166 O OH   . TYR A 1 22 ? 8.640   -11.424 -7.256  1.00 0.00 ? 22 TYR A OH   11 
ATOM 11167 H H    . TYR A 1 22 ? 6.374   -5.974  -6.888  1.00 0.00 ? 22 TYR A H    11 
ATOM 11168 H HA   . TYR A 1 22 ? 5.495   -6.415  -9.581  1.00 0.00 ? 22 TYR A HA   11 
ATOM 11169 H HB2  . TYR A 1 22 ? 4.197   -7.269  -6.983  1.00 0.00 ? 22 TYR A HB2  11 
ATOM 11170 H HB3  . TYR A 1 22 ? 3.845   -7.913  -8.583  1.00 0.00 ? 22 TYR A HB3  11 
ATOM 11171 H HD1  . TYR A 1 22 ? 6.431   -7.710  -5.947  1.00 0.00 ? 22 TYR A HD1  11 
ATOM 11172 H HD2  . TYR A 1 22 ? 5.193   -9.615  -9.543  1.00 0.00 ? 22 TYR A HD2  11 
ATOM 11173 H HE1  . TYR A 1 22 ? 8.179   -9.410  -5.640  1.00 0.00 ? 22 TYR A HE1  11 
ATOM 11174 H HE2  . TYR A 1 22 ? 6.937   -11.322 -9.247  1.00 0.00 ? 22 TYR A HE2  11 
ATOM 11175 H HH   . TYR A 1 22 ? 9.159   -11.497 -8.060  1.00 0.00 ? 22 TYR A HH   11 
ATOM 11176 N N    . PHE A 1 23 ? 3.806   -4.432  -7.603  1.00 0.00 ? 23 PHE A N    11 
ATOM 11177 C CA   . PHE A 1 23 ? 2.777   -3.404  -7.563  1.00 0.00 ? 23 PHE A CA   11 
ATOM 11178 C C    . PHE A 1 23 ? 3.112   -2.269  -8.523  1.00 0.00 ? 23 PHE A C    11 
ATOM 11179 O O    . PHE A 1 23 ? 2.254   -1.801  -9.273  1.00 0.00 ? 23 PHE A O    11 
ATOM 11180 C CB   . PHE A 1 23 ? 2.633   -2.862  -6.140  1.00 0.00 ? 23 PHE A CB   11 
ATOM 11181 C CG   . PHE A 1 23 ? 1.443   -3.412  -5.408  1.00 0.00 ? 23 PHE A CG   11 
ATOM 11182 C CD1  . PHE A 1 23 ? 0.194   -3.427  -6.005  1.00 0.00 ? 23 PHE A CD1  11 
ATOM 11183 C CD2  . PHE A 1 23 ? 1.576   -3.922  -4.127  1.00 0.00 ? 23 PHE A CD2  11 
ATOM 11184 C CE1  . PHE A 1 23 ? -0.903  -3.935  -5.336  1.00 0.00 ? 23 PHE A CE1  11 
ATOM 11185 C CE2  . PHE A 1 23 ? 0.483   -4.432  -3.453  1.00 0.00 ? 23 PHE A CE2  11 
ATOM 11186 C CZ   . PHE A 1 23 ? -0.758  -4.441  -4.060  1.00 0.00 ? 23 PHE A CZ   11 
ATOM 11187 H H    . PHE A 1 23 ? 4.372   -4.573  -6.815  1.00 0.00 ? 23 PHE A H    11 
ATOM 11188 H HA   . PHE A 1 23 ? 1.843   -3.855  -7.866  1.00 0.00 ? 23 PHE A HA   11 
ATOM 11189 H HB2  . PHE A 1 23 ? 3.517   -3.115  -5.575  1.00 0.00 ? 23 PHE A HB2  11 
ATOM 11190 H HB3  . PHE A 1 23 ? 2.532   -1.789  -6.179  1.00 0.00 ? 23 PHE A HB3  11 
ATOM 11191 H HD1  . PHE A 1 23 ? 0.079   -3.034  -7.005  1.00 0.00 ? 23 PHE A HD1  11 
ATOM 11192 H HD2  . PHE A 1 23 ? 2.546   -3.917  -3.652  1.00 0.00 ? 23 PHE A HD2  11 
ATOM 11193 H HE1  . PHE A 1 23 ? -1.872  -3.940  -5.813  1.00 0.00 ? 23 PHE A HE1  11 
ATOM 11194 H HE2  . PHE A 1 23 ? 0.599   -4.826  -2.454  1.00 0.00 ? 23 PHE A HE2  11 
ATOM 11195 H HZ   . PHE A 1 23 ? -1.614  -4.838  -3.535  1.00 0.00 ? 23 PHE A HZ   11 
ATOM 11196 N N    . THR A 1 24 ? 4.370   -1.841  -8.506  1.00 0.00 ? 24 THR A N    11 
ATOM 11197 C CA   . THR A 1 24 ? 4.825   -0.768  -9.383  1.00 0.00 ? 24 THR A CA   11 
ATOM 11198 C C    . THR A 1 24 ? 4.601   -1.129  -10.849 1.00 0.00 ? 24 THR A C    11 
ATOM 11199 O O    . THR A 1 24 ? 4.311   -0.264  -11.675 1.00 0.00 ? 24 THR A O    11 
ATOM 11200 C CB   . THR A 1 24 ? 6.307   -0.480  -9.141  1.00 0.00 ? 24 THR A CB   11 
ATOM 11201 O OG1  . THR A 1 24 ? 7.079   -1.656  -9.315  1.00 0.00 ? 24 THR A OG1  11 
ATOM 11202 C CG2  . THR A 1 24 ? 6.594   0.058   -7.758  1.00 0.00 ? 24 THR A CG2  11 
ATOM 11203 H H    . THR A 1 24 ? 5.008   -2.256  -7.887  1.00 0.00 ? 24 THR A H    11 
ATOM 11204 H HA   . THR A 1 24 ? 4.252   0.117   -9.151  1.00 0.00 ? 24 THR A HA   11 
ATOM 11205 H HB   . THR A 1 24 ? 6.643   0.255   -9.857  1.00 0.00 ? 24 THR A HB   11 
ATOM 11206 H HG1  . THR A 1 24 ? 8.012   -1.429  -9.327  1.00 0.00 ? 24 THR A HG1  11 
ATOM 11207 H HG21 . THR A 1 24 ? 6.533   1.136   -7.772  1.00 0.00 ? 24 THR A HG21 11 
ATOM 11208 H HG22 . THR A 1 24 ? 7.587   -0.242  -7.454  1.00 0.00 ? 24 THR A HG22 11 
ATOM 11209 H HG23 . THR A 1 24 ? 5.870   -0.335  -7.061  1.00 0.00 ? 24 THR A HG23 11 
ATOM 11210 N N    . SER A 1 25 ? 4.742   -2.413  -11.163 1.00 0.00 ? 25 SER A N    11 
ATOM 11211 C CA   . SER A 1 25 ? 4.563   -2.891  -12.530 1.00 0.00 ? 25 SER A CA   11 
ATOM 11212 C C    . SER A 1 25 ? 3.237   -2.413  -13.111 1.00 0.00 ? 25 SER A C    11 
ATOM 11213 O O    . SER A 1 25 ? 3.082   -2.315  -14.328 1.00 0.00 ? 25 SER A O    11 
ATOM 11214 C CB   . SER A 1 25 ? 4.626   -4.420  -12.568 1.00 0.00 ? 25 SER A CB   11 
ATOM 11215 O OG   . SER A 1 25 ? 5.847   -4.895  -12.027 1.00 0.00 ? 25 SER A OG   11 
ATOM 11216 H H    . SER A 1 25 ? 4.978   -3.054  -10.460 1.00 0.00 ? 25 SER A H    11 
ATOM 11217 H HA   . SER A 1 25 ? 5.369   -2.491  -13.128 1.00 0.00 ? 25 SER A HA   11 
ATOM 11218 H HB2  . SER A 1 25 ? 3.808   -4.827  -11.992 1.00 0.00 ? 25 SER A HB2  11 
ATOM 11219 H HB3  . SER A 1 25 ? 4.546   -4.755  -13.592 1.00 0.00 ? 25 SER A HB3  11 
ATOM 11220 H HG   . SER A 1 25 ? 5.978   -5.810  -12.288 1.00 0.00 ? 25 SER A HG   11 
ATOM 11221 N N    . GLN A 1 26 ? 2.282   -2.116  -12.236 1.00 0.00 ? 26 GLN A N    11 
ATOM 11222 C CA   . GLN A 1 26 ? 0.967   -1.653  -12.667 1.00 0.00 ? 26 GLN A CA   11 
ATOM 11223 C C    . GLN A 1 26 ? 0.853   -0.139  -12.531 1.00 0.00 ? 26 GLN A C    11 
ATOM 11224 O O    . GLN A 1 26 ? 0.239   0.526   -13.365 1.00 0.00 ? 26 GLN A O    11 
ATOM 11225 C CB   . GLN A 1 26 ? -0.137  -2.332  -11.851 1.00 0.00 ? 26 GLN A CB   11 
ATOM 11226 C CG   . GLN A 1 26 ? 0.216   -3.736  -11.386 1.00 0.00 ? 26 GLN A CG   11 
ATOM 11227 C CD   . GLN A 1 26 ? 0.208   -4.744  -12.518 1.00 0.00 ? 26 GLN A CD   11 
ATOM 11228 O OE1  . GLN A 1 26 ? -0.276  -4.461  -13.614 1.00 0.00 ? 26 GLN A OE1  11 
ATOM 11229 N NE2  . GLN A 1 26 ? 0.744   -5.931  -12.258 1.00 0.00 ? 26 GLN A NE2  11 
ATOM 11230 H H    . GLN A 1 26 ? 2.463   -2.216  -11.278 1.00 0.00 ? 26 GLN A H    11 
ATOM 11231 H HA   . GLN A 1 26 ? 0.849   -1.917  -13.708 1.00 0.00 ? 26 GLN A HA   11 
ATOM 11232 H HB2  . GLN A 1 26 ? -0.345  -1.729  -10.979 1.00 0.00 ? 26 GLN A HB2  11 
ATOM 11233 H HB3  . GLN A 1 26 ? -1.029  -2.392  -12.457 1.00 0.00 ? 26 GLN A HB3  11 
ATOM 11234 H HG2  . GLN A 1 26 ? 1.202   -3.718  -10.947 1.00 0.00 ? 26 GLN A HG2  11 
ATOM 11235 H HG3  . GLN A 1 26 ? -0.502  -4.047  -10.642 1.00 0.00 ? 26 GLN A HG3  11 
ATOM 11236 H HE21 . GLN A 1 26 ? 1.110   -6.086  -11.362 1.00 0.00 ? 26 GLN A HE21 11 
ATOM 11237 H HE22 . GLN A 1 26 ? 0.753   -6.602  -12.972 1.00 0.00 ? 26 GLN A HE22 11 
ATOM 11238 N N    . GLY A 1 27 ? 1.446   0.400   -11.470 1.00 0.00 ? 27 GLY A N    11 
ATOM 11239 C CA   . GLY A 1 27 ? 1.394   1.831   -11.237 1.00 0.00 ? 27 GLY A CA   11 
ATOM 11240 C C    . GLY A 1 27 ? 1.110   2.168   -9.789  1.00 0.00 ? 27 GLY A C    11 
ATOM 11241 O O    . GLY A 1 27 ? 0.288   3.036   -9.495  1.00 0.00 ? 27 GLY A O    11 
ATOM 11242 H H    . GLY A 1 27 ? 1.918   -0.182  -10.837 1.00 0.00 ? 27 GLY A H    11 
ATOM 11243 H HA2  . GLY A 1 27 ? 2.342   2.266   -11.516 1.00 0.00 ? 27 GLY A HA2  11 
ATOM 11244 H HA3  . GLY A 1 27 ? 0.618   2.258   -11.854 1.00 0.00 ? 27 GLY A HA3  11 
ATOM 11245 N N    . LEU A 1 28 ? 1.798   1.485   -8.882  1.00 0.00 ? 28 LEU A N    11 
ATOM 11246 C CA   . LEU A 1 28 ? 1.614   1.714   -7.456  1.00 0.00 ? 28 LEU A CA   11 
ATOM 11247 C C    . LEU A 1 28 ? 2.714   2.611   -6.901  1.00 0.00 ? 28 LEU A C    11 
ATOM 11248 O O    . LEU A 1 28 ? 3.208   2.396   -5.794  1.00 0.00 ? 28 LEU A O    11 
ATOM 11249 C CB   . LEU A 1 28 ? 1.589   0.382   -6.705  1.00 0.00 ? 28 LEU A CB   11 
ATOM 11250 C CG   . LEU A 1 28 ? 0.299   0.098   -5.931  1.00 0.00 ? 28 LEU A CG   11 
ATOM 11251 C CD1  . LEU A 1 28 ? 0.208   0.993   -4.705  1.00 0.00 ? 28 LEU A CD1  11 
ATOM 11252 C CD2  . LEU A 1 28 ? -0.918  0.285   -6.827  1.00 0.00 ? 28 LEU A CD2  11 
ATOM 11253 H H    . LEU A 1 28 ? 2.436   0.803   -9.178  1.00 0.00 ? 28 LEU A H    11 
ATOM 11254 H HA   . LEU A 1 28 ? 0.663   2.209   -7.322  1.00 0.00 ? 28 LEU A HA   11 
ATOM 11255 H HB2  . LEU A 1 28 ? 1.736   -0.413  -7.421  1.00 0.00 ? 28 LEU A HB2  11 
ATOM 11256 H HB3  . LEU A 1 28 ? 2.413   0.369   -6.007  1.00 0.00 ? 28 LEU A HB3  11 
ATOM 11257 H HG   . LEU A 1 28 ? 0.310   -0.928  -5.594  1.00 0.00 ? 28 LEU A HG   11 
ATOM 11258 H HD11 . LEU A 1 28 ? 0.652   0.491   -3.858  1.00 0.00 ? 28 LEU A HD11 11 
ATOM 11259 H HD12 . LEU A 1 28 ? -0.829  1.209   -4.492  1.00 0.00 ? 28 LEU A HD12 11 
ATOM 11260 H HD13 . LEU A 1 28 ? 0.736   1.917   -4.894  1.00 0.00 ? 28 LEU A HD13 11 
ATOM 11261 H HD21 . LEU A 1 28 ? -0.628  0.809   -7.727  1.00 0.00 ? 28 LEU A HD21 11 
ATOM 11262 H HD22 . LEU A 1 28 ? -1.667  0.859   -6.303  1.00 0.00 ? 28 LEU A HD22 11 
ATOM 11263 H HD23 . LEU A 1 28 ? -1.323  -0.681  -7.090  1.00 0.00 ? 28 LEU A HD23 11 
ATOM 11264 N N    . GLN A 1 29 ? 3.077   3.631   -7.670  1.00 0.00 ? 29 GLN A N    11 
ATOM 11265 C CA   . GLN A 1 29 ? 4.096   4.584   -7.247  1.00 0.00 ? 29 GLN A CA   11 
ATOM 11266 C C    . GLN A 1 29 ? 3.436   5.841   -6.695  1.00 0.00 ? 29 GLN A C    11 
ATOM 11267 O O    . GLN A 1 29 ? 3.981   6.512   -5.818  1.00 0.00 ? 29 GLN A O    11 
ATOM 11268 C CB   . GLN A 1 29 ? 5.014   4.943   -8.417  1.00 0.00 ? 29 GLN A CB   11 
ATOM 11269 C CG   . GLN A 1 29 ? 4.284   5.081   -9.744  1.00 0.00 ? 29 GLN A CG   11 
ATOM 11270 C CD   . GLN A 1 29 ? 5.195   5.544   -10.865 1.00 0.00 ? 29 GLN A CD   11 
ATOM 11271 O OE1  . GLN A 1 29 ? 5.420   6.741   -11.043 1.00 0.00 ? 29 GLN A OE1  11 
ATOM 11272 N NE2  . GLN A 1 29 ? 5.725   4.595   -11.628 1.00 0.00 ? 29 GLN A NE2  11 
ATOM 11273 H H    . GLN A 1 29 ? 2.635   3.758   -8.536  1.00 0.00 ? 29 GLN A H    11 
ATOM 11274 H HA   . GLN A 1 29 ? 4.681   4.123   -6.465  1.00 0.00 ? 29 GLN A HA   11 
ATOM 11275 H HB2  . GLN A 1 29 ? 5.502   5.881   -8.201  1.00 0.00 ? 29 GLN A HB2  11 
ATOM 11276 H HB3  . GLN A 1 29 ? 5.764   4.172   -8.522  1.00 0.00 ? 29 GLN A HB3  11 
ATOM 11277 H HG2  . GLN A 1 29 ? 3.868   4.122   -10.013 1.00 0.00 ? 29 GLN A HG2  11 
ATOM 11278 H HG3  . GLN A 1 29 ? 3.487   5.799   -9.630  1.00 0.00 ? 29 GLN A HG3  11 
ATOM 11279 H HE21 . GLN A 1 29 ? 5.501   3.661   -11.428 1.00 0.00 ? 29 GLN A HE21 11 
ATOM 11280 H HE22 . GLN A 1 29 ? 6.317   4.866   -12.359 1.00 0.00 ? 29 GLN A HE22 11 
ATOM 11281 N N    . SER A 1 30 ? 2.244   6.136   -7.202  1.00 0.00 ? 30 SER A N    11 
ATOM 11282 C CA   . SER A 1 30 ? 1.476   7.286   -6.744  1.00 0.00 ? 30 SER A CA   11 
ATOM 11283 C C    . SER A 1 30 ? 0.230   6.821   -6.003  1.00 0.00 ? 30 SER A C    11 
ATOM 11284 O O    . SER A 1 30 ? -0.682  6.257   -6.604  1.00 0.00 ? 30 SER A O    11 
ATOM 11285 C CB   . SER A 1 30 ? 1.084   8.173   -7.927  1.00 0.00 ? 30 SER A CB   11 
ATOM 11286 O OG   . SER A 1 30 ? 1.464   7.581   -9.158  1.00 0.00 ? 30 SER A OG   11 
ATOM 11287 H H    . SER A 1 30 ? 1.858   5.549   -7.888  1.00 0.00 ? 30 SER A H    11 
ATOM 11288 H HA   . SER A 1 30 ? 2.092   7.852   -6.066  1.00 0.00 ? 30 SER A HA   11 
ATOM 11289 H HB2  . SER A 1 30 ? 0.014   8.318   -7.928  1.00 0.00 ? 30 SER A HB2  11 
ATOM 11290 H HB3  . SER A 1 30 ? 1.577   9.129   -7.836  1.00 0.00 ? 30 SER A HB3  11 
ATOM 11291 H HG   . SER A 1 30 ? 1.021   8.032   -9.881  1.00 0.00 ? 30 SER A HG   11 
ATOM 11292 N N    . ILE A 1 31 ? 0.203   7.039   -4.689  1.00 0.00 ? 31 ILE A N    11 
ATOM 11293 C CA   . ILE A 1 31 ? -0.926  6.611   -3.866  1.00 0.00 ? 31 ILE A CA   11 
ATOM 11294 C C    . ILE A 1 31 ? -2.260  6.978   -4.522  1.00 0.00 ? 31 ILE A C    11 
ATOM 11295 O O    . ILE A 1 31 ? -3.271  6.307   -4.318  1.00 0.00 ? 31 ILE A O    11 
ATOM 11296 C CB   . ILE A 1 31 ? -0.851  7.204   -2.440  1.00 0.00 ? 31 ILE A CB   11 
ATOM 11297 C CG1  . ILE A 1 31 ? -1.717  6.383   -1.483  1.00 0.00 ? 31 ILE A CG1  11 
ATOM 11298 C CG2  . ILE A 1 31 ? -1.276  8.667   -2.424  1.00 0.00 ? 31 ILE A CG2  11 
ATOM 11299 C CD1  . ILE A 1 31 ? -0.918  5.635   -0.438  1.00 0.00 ? 31 ILE A CD1  11 
ATOM 11300 H H    . ILE A 1 31 ? 0.966   7.481   -4.262  1.00 0.00 ? 31 ILE A H    11 
ATOM 11301 H HA   . ILE A 1 31 ? -0.873  5.538   -3.776  1.00 0.00 ? 31 ILE A HA   11 
ATOM 11302 H HB   . ILE A 1 31 ? 0.177   7.156   -2.113  1.00 0.00 ? 31 ILE A HB   11 
ATOM 11303 H HG12 . ILE A 1 31 ? -2.400  7.043   -0.969  1.00 0.00 ? 31 ILE A HG12 11 
ATOM 11304 H HG13 . ILE A 1 31 ? -2.280  5.657   -2.051  1.00 0.00 ? 31 ILE A HG13 11 
ATOM 11305 H HG21 . ILE A 1 31 ? -1.165  9.063   -1.426  1.00 0.00 ? 31 ILE A HG21 11 
ATOM 11306 H HG22 . ILE A 1 31 ? -2.308  8.742   -2.731  1.00 0.00 ? 31 ILE A HG22 11 
ATOM 11307 H HG23 . ILE A 1 31 ? -0.655  9.229   -3.107  1.00 0.00 ? 31 ILE A HG23 11 
ATOM 11308 H HD11 . ILE A 1 31 ? -0.556  4.708   -0.858  1.00 0.00 ? 31 ILE A HD11 11 
ATOM 11309 H HD12 . ILE A 1 31 ? -1.547  5.424   0.413   1.00 0.00 ? 31 ILE A HD12 11 
ATOM 11310 H HD13 . ILE A 1 31 ? -0.080  6.240   -0.125  1.00 0.00 ? 31 ILE A HD13 11 
ATOM 11311 N N    . TYR A 1 32 ? -2.247  8.043   -5.315  1.00 0.00 ? 32 TYR A N    11 
ATOM 11312 C CA   . TYR A 1 32 ? -3.445  8.478   -6.021  1.00 0.00 ? 32 TYR A CA   11 
ATOM 11313 C C    . TYR A 1 32 ? -3.977  7.360   -6.914  1.00 0.00 ? 32 TYR A C    11 
ATOM 11314 O O    . TYR A 1 32 ? -5.156  7.343   -7.267  1.00 0.00 ? 32 TYR A O    11 
ATOM 11315 C CB   . TYR A 1 32 ? -3.147  9.722   -6.859  1.00 0.00 ? 32 TYR A CB   11 
ATOM 11316 C CG   . TYR A 1 32 ? -2.709  10.914  -6.039  1.00 0.00 ? 32 TYR A CG   11 
ATOM 11317 C CD1  . TYR A 1 32 ? -3.635  11.676  -5.338  1.00 0.00 ? 32 TYR A CD1  11 
ATOM 11318 C CD2  . TYR A 1 32 ? -1.369  11.275  -5.963  1.00 0.00 ? 32 TYR A CD2  11 
ATOM 11319 C CE1  . TYR A 1 32 ? -3.238  12.766  -4.586  1.00 0.00 ? 32 TYR A CE1  11 
ATOM 11320 C CE2  . TYR A 1 32 ? -0.965  12.364  -5.214  1.00 0.00 ? 32 TYR A CE2  11 
ATOM 11321 C CZ   . TYR A 1 32 ? -1.902  13.105  -4.527  1.00 0.00 ? 32 TYR A CZ   11 
ATOM 11322 O OH   . TYR A 1 32 ? -1.504  14.189  -3.780  1.00 0.00 ? 32 TYR A OH   11 
ATOM 11323 H H    . TYR A 1 32 ? -1.408  8.532   -5.449  1.00 0.00 ? 32 TYR A H    11 
ATOM 11324 H HA   . TYR A 1 32 ? -4.194  8.721   -5.282  1.00 0.00 ? 32 TYR A HA   11 
ATOM 11325 H HB2  . TYR A 1 32 ? -2.358  9.494   -7.561  1.00 0.00 ? 32 TYR A HB2  11 
ATOM 11326 H HB3  . TYR A 1 32 ? -4.037  10.002  -7.403  1.00 0.00 ? 32 TYR A HB3  11 
ATOM 11327 H HD1  . TYR A 1 32 ? -4.680  11.408  -5.387  1.00 0.00 ? 32 TYR A HD1  11 
ATOM 11328 H HD2  . TYR A 1 32 ? -0.637  10.692  -6.503  1.00 0.00 ? 32 TYR A HD2  11 
ATOM 11329 H HE1  . TYR A 1 32 ? -3.973  13.346  -4.049  1.00 0.00 ? 32 TYR A HE1  11 
ATOM 11330 H HE2  . TYR A 1 32 ? 0.081   12.629  -5.168  1.00 0.00 ? 32 TYR A HE2  11 
ATOM 11331 H HH   . TYR A 1 32 ? -1.236  13.895  -2.906  1.00 0.00 ? 32 TYR A HH   11 
ATOM 11332 N N    . HIS A 1 33 ? -3.101  6.425   -7.271  1.00 0.00 ? 33 HIS A N    11 
ATOM 11333 C CA   . HIS A 1 33 ? -3.485  5.296   -8.110  1.00 0.00 ? 33 HIS A CA   11 
ATOM 11334 C C    . HIS A 1 33 ? -4.132  4.192   -7.278  1.00 0.00 ? 33 HIS A C    11 
ATOM 11335 O O    . HIS A 1 33 ? -4.851  3.343   -7.808  1.00 0.00 ? 33 HIS A O    11 
ATOM 11336 C CB   . HIS A 1 33 ? -2.259  4.743   -8.842  1.00 0.00 ? 33 HIS A CB   11 
ATOM 11337 C CG   . HIS A 1 33 ? -2.454  4.600   -10.318 1.00 0.00 ? 33 HIS A CG   11 
ATOM 11338 N ND1  . HIS A 1 33 ? -3.186  3.578   -10.885 1.00 0.00 ? 33 HIS A ND1  11 
ATOM 11339 C CD2  . HIS A 1 33 ? -2.005  5.355   -11.349 1.00 0.00 ? 33 HIS A CD2  11 
ATOM 11340 C CE1  . HIS A 1 33 ? -3.181  3.712   -12.199 1.00 0.00 ? 33 HIS A CE1  11 
ATOM 11341 N NE2  . HIS A 1 33 ? -2.470  4.781   -12.505 1.00 0.00 ? 33 HIS A NE2  11 
ATOM 11342 H H    . HIS A 1 33 ? -2.173  6.486   -6.952  1.00 0.00 ? 33 HIS A H    11 
ATOM 11343 H HA   . HIS A 1 33 ? -4.200  5.651   -8.838  1.00 0.00 ? 33 HIS A HA   11 
ATOM 11344 H HB2  . HIS A 1 33 ? -1.423  5.409   -8.680  1.00 0.00 ? 33 HIS A HB2  11 
ATOM 11345 H HB3  . HIS A 1 33 ? -2.019  3.769   -8.442  1.00 0.00 ? 33 HIS A HB3  11 
ATOM 11346 H HD1  . HIS A 1 33 ? -3.643  2.863   -10.396 1.00 0.00 ? 33 HIS A HD1  11 
ATOM 11347 H HD2  . HIS A 1 33 ? -1.393  6.243   -11.275 1.00 0.00 ? 33 HIS A HD2  11 
ATOM 11348 H HE1  . HIS A 1 33 ? -3.673  3.057   -12.904 1.00 0.00 ? 33 HIS A HE1  11 
ATOM 11349 H HE2  . HIS A 1 33 ? -2.305  5.110   -13.413 1.00 0.00 ? 33 HIS A HE2  11 
ATOM 11350 N N    . LEU A 1 34 ? -3.871  4.206   -5.973  1.00 0.00 ? 34 LEU A N    11 
ATOM 11351 C CA   . LEU A 1 34 ? -4.422  3.203   -5.072  1.00 0.00 ? 34 LEU A CA   11 
ATOM 11352 C C    . LEU A 1 34 ? -5.393  3.828   -4.075  1.00 0.00 ? 34 LEU A C    11 
ATOM 11353 O O    . LEU A 1 34 ? -5.664  3.260   -3.018  1.00 0.00 ? 34 LEU A O    11 
ATOM 11354 C CB   . LEU A 1 34 ? -3.294  2.502   -4.322  1.00 0.00 ? 34 LEU A CB   11 
ATOM 11355 C CG   . LEU A 1 34 ? -2.110  3.398   -3.946  1.00 0.00 ? 34 LEU A CG   11 
ATOM 11356 C CD1  . LEU A 1 34 ? -1.383  2.836   -2.735  1.00 0.00 ? 34 LEU A CD1  11 
ATOM 11357 C CD2  . LEU A 1 34 ? -1.156  3.541   -5.124  1.00 0.00 ? 34 LEU A CD2  11 
ATOM 11358 H H    . LEU A 1 34 ? -3.290  4.904   -5.608  1.00 0.00 ? 34 LEU A H    11 
ATOM 11359 H HA   . LEU A 1 34 ? -4.955  2.477   -5.668  1.00 0.00 ? 34 LEU A HA   11 
ATOM 11360 H HB2  . LEU A 1 34 ? -3.700  2.077   -3.416  1.00 0.00 ? 34 LEU A HB2  11 
ATOM 11361 H HB3  . LEU A 1 34 ? -2.930  1.703   -4.943  1.00 0.00 ? 34 LEU A HB3  11 
ATOM 11362 H HG   . LEU A 1 34 ? -2.474  4.384   -3.690  1.00 0.00 ? 34 LEU A HG   11 
ATOM 11363 H HD11 . LEU A 1 34 ? -1.742  3.325   -1.842  1.00 0.00 ? 34 LEU A HD11 11 
ATOM 11364 H HD12 . LEU A 1 34 ? -0.323  3.009   -2.840  1.00 0.00 ? 34 LEU A HD12 11 
ATOM 11365 H HD13 . LEU A 1 34 ? -1.569  1.775   -2.664  1.00 0.00 ? 34 LEU A HD13 11 
ATOM 11366 H HD21 . LEU A 1 34 ? -0.146  3.644   -4.758  1.00 0.00 ? 34 LEU A HD21 11 
ATOM 11367 H HD22 . LEU A 1 34 ? -1.421  4.417   -5.697  1.00 0.00 ? 34 LEU A HD22 11 
ATOM 11368 H HD23 . LEU A 1 34 ? -1.225  2.667   -5.752  1.00 0.00 ? 34 LEU A HD23 11 
ATOM 11369 N N    . GLN A 1 35 ? -5.912  4.998   -4.419  1.00 0.00 ? 35 GLN A N    11 
ATOM 11370 C CA   . GLN A 1 35 ? -6.850  5.702   -3.554  1.00 0.00 ? 35 GLN A CA   11 
ATOM 11371 C C    . GLN A 1 35 ? -8.184  4.966   -3.464  1.00 0.00 ? 35 GLN A C    11 
ATOM 11372 O O    . GLN A 1 35 ? -8.967  5.198   -2.543  1.00 0.00 ? 35 GLN A O    11 
ATOM 11373 C CB   . GLN A 1 35 ? -7.077  7.125   -4.068  1.00 0.00 ? 35 GLN A CB   11 
ATOM 11374 C CG   . GLN A 1 35 ? -7.919  7.980   -3.135  1.00 0.00 ? 35 GLN A CG   11 
ATOM 11375 C CD   . GLN A 1 35 ? -7.125  9.098   -2.492  1.00 0.00 ? 35 GLN A CD   11 
ATOM 11376 O OE1  . GLN A 1 35 ? -6.858  10.125  -3.118  1.00 0.00 ? 35 GLN A OE1  11 
ATOM 11377 N NE2  . GLN A 1 35 ? -6.741  8.906   -1.236  1.00 0.00 ? 35 GLN A NE2  11 
ATOM 11378 H H    . GLN A 1 35 ? -5.653  5.400   -5.273  1.00 0.00 ? 35 GLN A H    11 
ATOM 11379 H HA   . GLN A 1 35 ? -6.414  5.751   -2.567  1.00 0.00 ? 35 GLN A HA   11 
ATOM 11380 H HB2  . GLN A 1 35 ? -6.120  7.606   -4.197  1.00 0.00 ? 35 GLN A HB2  11 
ATOM 11381 H HB3  . GLN A 1 35 ? -7.578  7.074   -5.024  1.00 0.00 ? 35 GLN A HB3  11 
ATOM 11382 H HG2  . GLN A 1 35 ? -8.732  8.413   -3.699  1.00 0.00 ? 35 GLN A HG2  11 
ATOM 11383 H HG3  . GLN A 1 35 ? -8.320  7.349   -2.354  1.00 0.00 ? 35 GLN A HG3  11 
ATOM 11384 H HE21 . GLN A 1 35 ? -6.989  8.064   -0.800  1.00 0.00 ? 35 GLN A HE21 11 
ATOM 11385 H HE22 . GLN A 1 35 ? -6.225  9.614   -0.796  1.00 0.00 ? 35 GLN A HE22 11 
ATOM 11386 N N    . ASN A 1 36 ? -8.444  4.081   -4.424  1.00 0.00 ? 36 ASN A N    11 
ATOM 11387 C CA   . ASN A 1 36 ? -9.696  3.331   -4.447  1.00 0.00 ? 36 ASN A CA   11 
ATOM 11388 C C    . ASN A 1 36 ? -9.460  1.848   -4.724  1.00 0.00 ? 36 ASN A C    11 
ATOM 11389 O O    . ASN A 1 36 ? -10.384 1.129   -5.104  1.00 0.00 ? 36 ASN A O    11 
ATOM 11390 C CB   . ASN A 1 36 ? -10.633 3.908   -5.508  1.00 0.00 ? 36 ASN A CB   11 
ATOM 11391 C CG   . ASN A 1 36 ? -11.428 5.091   -4.997  1.00 0.00 ? 36 ASN A CG   11 
ATOM 11392 O OD1  . ASN A 1 36 ? -12.371 4.934   -4.223  1.00 0.00 ? 36 ASN A OD1  11 
ATOM 11393 N ND2  . ASN A 1 36 ? -11.049 6.287   -5.434  1.00 0.00 ? 36 ASN A ND2  11 
ATOM 11394 H H    . ASN A 1 36 ? -7.790  3.940   -5.138  1.00 0.00 ? 36 ASN A H    11 
ATOM 11395 H HA   . ASN A 1 36 ? -10.158 3.433   -3.476  1.00 0.00 ? 36 ASN A HA   11 
ATOM 11396 H HB2  . ASN A 1 36 ? -10.048 4.235   -6.355  1.00 0.00 ? 36 ASN A HB2  11 
ATOM 11397 H HB3  . ASN A 1 36 ? -11.323 3.141   -5.824  1.00 0.00 ? 36 ASN A HB3  11 
ATOM 11398 H HD21 . ASN A 1 36 ? -10.289 6.335   -6.050  1.00 0.00 ? 36 ASN A HD21 11 
ATOM 11399 H HD22 . ASN A 1 36 ? -11.546 7.070   -5.122  1.00 0.00 ? 36 ASN A HD22 11 
ATOM 11400 N N    . LEU A 1 37 ? -8.227  1.390   -4.532  1.00 0.00 ? 37 LEU A N    11 
ATOM 11401 C CA   . LEU A 1 37 ? -7.896  -0.012  -4.762  1.00 0.00 ? 37 LEU A CA   11 
ATOM 11402 C C    . LEU A 1 37 ? -8.292  -0.863  -3.559  1.00 0.00 ? 37 LEU A C    11 
ATOM 11403 O O    . LEU A 1 37 ? -8.225  -0.412  -2.416  1.00 0.00 ? 37 LEU A O    11 
ATOM 11404 C CB   . LEU A 1 37 ? -6.401  -0.172  -5.052  1.00 0.00 ? 37 LEU A CB   11 
ATOM 11405 C CG   . LEU A 1 37 ? -6.065  -0.663  -6.461  1.00 0.00 ? 37 LEU A CG   11 
ATOM 11406 C CD1  . LEU A 1 37 ? -4.725  -0.103  -6.917  1.00 0.00 ? 37 LEU A CD1  11 
ATOM 11407 C CD2  . LEU A 1 37 ? -6.050  -2.184  -6.506  1.00 0.00 ? 37 LEU A CD2  11 
ATOM 11408 H H    . LEU A 1 37 ? -7.527  2.004   -4.225  1.00 0.00 ? 37 LEU A H    11 
ATOM 11409 H HA   . LEU A 1 37 ? -8.458  -0.345  -5.622  1.00 0.00 ? 37 LEU A HA   11 
ATOM 11410 H HB2  . LEU A 1 37 ? -5.922  0.784   -4.900  1.00 0.00 ? 37 LEU A HB2  11 
ATOM 11411 H HB3  . LEU A 1 37 ? -5.992  -0.878  -4.344  1.00 0.00 ? 37 LEU A HB3  11 
ATOM 11412 H HG   . LEU A 1 37 ? -6.823  -0.315  -7.148  1.00 0.00 ? 37 LEU A HG   11 
ATOM 11413 H HD11 . LEU A 1 37 ? -4.220  -0.833  -7.532  1.00 0.00 ? 37 LEU A HD11 11 
ATOM 11414 H HD12 . LEU A 1 37 ? -4.117  0.124   -6.054  1.00 0.00 ? 37 LEU A HD12 11 
ATOM 11415 H HD13 . LEU A 1 37 ? -4.889  0.799   -7.489  1.00 0.00 ? 37 LEU A HD13 11 
ATOM 11416 H HD21 . LEU A 1 37 ? -6.200  -2.515  -7.523  1.00 0.00 ? 37 LEU A HD21 11 
ATOM 11417 H HD22 . LEU A 1 37 ? -6.843  -2.569  -5.882  1.00 0.00 ? 37 LEU A HD22 11 
ATOM 11418 H HD23 . LEU A 1 37 ? -5.099  -2.545  -6.145  1.00 0.00 ? 37 LEU A HD23 11 
ATOM 11419 N N    . THR A 1 38 ? -8.714  -2.095  -3.825  1.00 0.00 ? 38 THR A N    11 
ATOM 11420 C CA   . THR A 1 38 ? -9.138  -3.007  -2.768  1.00 0.00 ? 38 THR A CA   11 
ATOM 11421 C C    . THR A 1 38 ? -8.489  -4.372  -2.926  1.00 0.00 ? 38 THR A C    11 
ATOM 11422 O O    . THR A 1 38 ? -7.840  -4.651  -3.934  1.00 0.00 ? 38 THR A O    11 
ATOM 11423 C CB   . THR A 1 38 ? -10.659 -3.174  -2.794  1.00 0.00 ? 38 THR A CB   11 
ATOM 11424 O OG1  . THR A 1 38 ? -11.237 -2.334  -3.778  1.00 0.00 ? 38 THR A OG1  11 
ATOM 11425 C CG2  . THR A 1 38 ? -11.319 -2.855  -1.472  1.00 0.00 ? 38 THR A CG2  11 
ATOM 11426 H H    . THR A 1 38 ? -8.754  -2.395  -4.757  1.00 0.00 ? 38 THR A H    11 
ATOM 11427 H HA   . THR A 1 38 ? -8.842  -2.583  -1.819  1.00 0.00 ? 38 THR A HA   11 
ATOM 11428 H HB   . THR A 1 38 ? -10.895 -4.203  -3.041  1.00 0.00 ? 38 THR A HB   11 
ATOM 11429 H HG1  . THR A 1 38 ? -11.398 -2.841  -4.578  1.00 0.00 ? 38 THR A HG1  11 
ATOM 11430 H HG21 . THR A 1 38 ? -12.153 -2.190  -1.638  1.00 0.00 ? 38 THR A HG21 11 
ATOM 11431 H HG22 . THR A 1 38 ? -10.602 -2.379  -0.819  1.00 0.00 ? 38 THR A HG22 11 
ATOM 11432 H HG23 . THR A 1 38 ? -11.671 -3.769  -1.018  1.00 0.00 ? 38 THR A HG23 11 
ATOM 11433 N N    . ILE A 1 39 ? -8.707  -5.236  -1.942  1.00 0.00 ? 39 ILE A N    11 
ATOM 11434 C CA   . ILE A 1 39 ? -8.209  -6.598  -2.013  1.00 0.00 ? 39 ILE A CA   11 
ATOM 11435 C C    . ILE A 1 39 ? -8.765  -7.271  -3.254  1.00 0.00 ? 39 ILE A C    11 
ATOM 11436 O O    . ILE A 1 39 ? -8.085  -8.050  -3.921  1.00 0.00 ? 39 ILE A O    11 
ATOM 11437 C CB   . ILE A 1 39 ? -8.611  -7.414  -0.774  1.00 0.00 ? 39 ILE A CB   11 
ATOM 11438 C CG1  . ILE A 1 39 ? -8.014  -8.821  -0.847  1.00 0.00 ? 39 ILE A CG1  11 
ATOM 11439 C CG2  . ILE A 1 39 ? -10.125 -7.481  -0.652  1.00 0.00 ? 39 ILE A CG2  11 
ATOM 11440 C CD1  . ILE A 1 39 ? -6.502  -8.840  -0.839  1.00 0.00 ? 39 ILE A CD1  11 
ATOM 11441 H H    . ILE A 1 39 ? -9.264  -4.968  -1.182  1.00 0.00 ? 39 ILE A H    11 
ATOM 11442 H HA   . ILE A 1 39 ? -7.134  -6.565  -2.074  1.00 0.00 ? 39 ILE A HA   11 
ATOM 11443 H HB   . ILE A 1 39 ? -8.230  -6.909  0.097   1.00 0.00 ? 39 ILE A HB   11 
ATOM 11444 H HG12 . ILE A 1 39 ? -8.358  -9.395  0.001   1.00 0.00 ? 39 ILE A HG12 11 
ATOM 11445 H HG13 . ILE A 1 39 ? -8.346  -9.299  -1.758  1.00 0.00 ? 39 ILE A HG13 11 
ATOM 11446 H HG21 . ILE A 1 39 ? -10.390 -8.062  0.218   1.00 0.00 ? 39 ILE A HG21 11 
ATOM 11447 H HG22 . ILE A 1 39 ? -10.538 -7.945  -1.536  1.00 0.00 ? 39 ILE A HG22 11 
ATOM 11448 H HG23 . ILE A 1 39 ? -10.522 -6.481  -0.551  1.00 0.00 ? 39 ILE A HG23 11 
ATOM 11449 H HD11 . ILE A 1 39 ? -6.130  -7.836  -0.693  1.00 0.00 ? 39 ILE A HD11 11 
ATOM 11450 H HD12 . ILE A 1 39 ? -6.141  -9.224  -1.781  1.00 0.00 ? 39 ILE A HD12 11 
ATOM 11451 H HD13 . ILE A 1 39 ? -6.154  -9.472  -0.036  1.00 0.00 ? 39 ILE A HD13 11 
ATOM 11452 N N    . GLU A 1 40 ? -10.008 -6.926  -3.571  1.00 0.00 ? 40 GLU A N    11 
ATOM 11453 C CA   . GLU A 1 40 ? -10.674 -7.456  -4.749  1.00 0.00 ? 40 GLU A CA   11 
ATOM 11454 C C    . GLU A 1 40 ? -9.817  -7.232  -5.987  1.00 0.00 ? 40 GLU A C    11 
ATOM 11455 O O    . GLU A 1 40 ? -9.645  -8.132  -6.810  1.00 0.00 ? 40 GLU A O    11 
ATOM 11456 C CB   . GLU A 1 40 ? -12.039 -6.791  -4.933  1.00 0.00 ? 40 GLU A CB   11 
ATOM 11457 C CG   . GLU A 1 40 ? -12.973 -6.979  -3.748  1.00 0.00 ? 40 GLU A CG   11 
ATOM 11458 C CD   . GLU A 1 40 ? -14.056 -8.005  -4.016  1.00 0.00 ? 40 GLU A CD   11 
ATOM 11459 O OE1  . GLU A 1 40 ? -15.070 -7.646  -4.650  1.00 0.00 ? 40 GLU A OE1  11 
ATOM 11460 O OE2  . GLU A 1 40 ? -13.889 -9.168  -3.593  1.00 0.00 ? 40 GLU A OE2  11 
ATOM 11461 H H    . GLU A 1 40 ? -10.483 -6.289  -2.996  1.00 0.00 ? 40 GLU A H    11 
ATOM 11462 H HA   . GLU A 1 40 ? -10.813 -8.513  -4.603  1.00 0.00 ? 40 GLU A HA   11 
ATOM 11463 H HB2  . GLU A 1 40 ? -11.892 -5.732  -5.083  1.00 0.00 ? 40 GLU A HB2  11 
ATOM 11464 H HB3  . GLU A 1 40 ? -12.514 -7.207  -5.809  1.00 0.00 ? 40 GLU A HB3  11 
ATOM 11465 H HG2  . GLU A 1 40 ? -12.393 -7.303  -2.898  1.00 0.00 ? 40 GLU A HG2  11 
ATOM 11466 H HG3  . GLU A 1 40 ? -13.442 -6.033  -3.523  1.00 0.00 ? 40 GLU A HG3  11 
ATOM 11467 N N    . ASP A 1 41 ? -9.272  -6.026  -6.106  1.00 0.00 ? 41 ASP A N    11 
ATOM 11468 C CA   . ASP A 1 41 ? -8.418  -5.679  -7.236  1.00 0.00 ? 41 ASP A CA   11 
ATOM 11469 C C    . ASP A 1 41 ? -6.978  -6.113  -6.978  1.00 0.00 ? 41 ASP A C    11 
ATOM 11470 O O    . ASP A 1 41 ? -6.268  -6.514  -7.899  1.00 0.00 ? 41 ASP A O    11 
ATOM 11471 C CB   . ASP A 1 41 ? -8.470  -4.172  -7.498  1.00 0.00 ? 41 ASP A CB   11 
ATOM 11472 C CG   . ASP A 1 41 ? -9.670  -3.769  -8.333  1.00 0.00 ? 41 ASP A CG   11 
ATOM 11473 O OD1  . ASP A 1 41 ? -10.091 -4.572  -9.193  1.00 0.00 ? 41 ASP A OD1  11 
ATOM 11474 O OD2  . ASP A 1 41 ? -10.187 -2.651  -8.129  1.00 0.00 ? 41 ASP A OD2  11 
ATOM 11475 H H    . ASP A 1 41 ? -9.444  -5.354  -5.412  1.00 0.00 ? 41 ASP A H    11 
ATOM 11476 H HA   . ASP A 1 41 ? -8.790  -6.202  -8.104  1.00 0.00 ? 41 ASP A HA   11 
ATOM 11477 H HB2  . ASP A 1 41 ? -8.520  -3.650  -6.555  1.00 0.00 ? 41 ASP A HB2  11 
ATOM 11478 H HB3  . ASP A 1 41 ? -7.573  -3.874  -8.022  1.00 0.00 ? 41 ASP A HB3  11 
ATOM 11479 N N    . LEU A 1 42 ? -6.557  -6.040  -5.717  1.00 0.00 ? 42 LEU A N    11 
ATOM 11480 C CA   . LEU A 1 42 ? -5.205  -6.435  -5.339  1.00 0.00 ? 42 LEU A CA   11 
ATOM 11481 C C    . LEU A 1 42 ? -4.881  -7.824  -5.881  1.00 0.00 ? 42 LEU A C    11 
ATOM 11482 O O    . LEU A 1 42 ? -3.929  -7.999  -6.642  1.00 0.00 ? 42 LEU A O    11 
ATOM 11483 C CB   . LEU A 1 42 ? -5.046  -6.423  -3.810  1.00 0.00 ? 42 LEU A CB   11 
ATOM 11484 C CG   . LEU A 1 42 ? -5.159  -5.054  -3.104  1.00 0.00 ? 42 LEU A CG   11 
ATOM 11485 C CD1  . LEU A 1 42 ? -4.063  -4.915  -2.062  1.00 0.00 ? 42 LEU A CD1  11 
ATOM 11486 C CD2  . LEU A 1 42 ? -5.101  -3.888  -4.087  1.00 0.00 ? 42 LEU A CD2  11 
ATOM 11487 H H    . LEU A 1 42 ? -7.172  -5.718  -5.026  1.00 0.00 ? 42 LEU A H    11 
ATOM 11488 H HA   . LEU A 1 42 ? -4.518  -5.724  -5.771  1.00 0.00 ? 42 LEU A HA   11 
ATOM 11489 H HB2  . LEU A 1 42 ? -5.799  -7.075  -3.395  1.00 0.00 ? 42 LEU A HB2  11 
ATOM 11490 H HB3  . LEU A 1 42 ? -4.077  -6.837  -3.575  1.00 0.00 ? 42 LEU A HB3  11 
ATOM 11491 H HG   . LEU A 1 42 ? -6.106  -5.004  -2.587  1.00 0.00 ? 42 LEU A HG   11 
ATOM 11492 H HD11 . LEU A 1 42 ? -3.225  -5.537  -2.337  1.00 0.00 ? 42 LEU A HD11 11 
ATOM 11493 H HD12 . LEU A 1 42 ? -4.442  -5.226  -1.098  1.00 0.00 ? 42 LEU A HD12 11 
ATOM 11494 H HD13 . LEU A 1 42 ? -3.747  -3.884  -2.009  1.00 0.00 ? 42 LEU A HD13 11 
ATOM 11495 H HD21 . LEU A 1 42 ? -4.185  -3.943  -4.658  1.00 0.00 ? 42 LEU A HD21 11 
ATOM 11496 H HD22 . LEU A 1 42 ? -5.131  -2.956  -3.542  1.00 0.00 ? 42 LEU A HD22 11 
ATOM 11497 H HD23 . LEU A 1 42 ? -5.946  -3.939  -4.758  1.00 0.00 ? 42 LEU A HD23 11 
ATOM 11498 N N    . GLY A 1 43 ? -5.684  -8.808  -5.487  1.00 0.00 ? 43 GLY A N    11 
ATOM 11499 C CA   . GLY A 1 43 ? -5.476  -10.165 -5.952  1.00 0.00 ? 43 GLY A CA   11 
ATOM 11500 C C    . GLY A 1 43 ? -5.504  -10.270 -7.464  1.00 0.00 ? 43 GLY A C    11 
ATOM 11501 O O    . GLY A 1 43 ? -5.001  -11.236 -8.036  1.00 0.00 ? 43 GLY A O    11 
ATOM 11502 H H    . GLY A 1 43 ? -6.430  -8.607  -4.885  1.00 0.00 ? 43 GLY A H    11 
ATOM 11503 H HA2  . GLY A 1 43 ? -4.517  -10.514 -5.596  1.00 0.00 ? 43 GLY A HA2  11 
ATOM 11504 H HA3  . GLY A 1 43 ? -6.251  -10.797 -5.543  1.00 0.00 ? 43 GLY A HA3  11 
ATOM 11505 N N    . ALA A 1 44 ? -6.100  -9.273  -8.114  1.00 0.00 ? 44 ALA A N    11 
ATOM 11506 C CA   . ALA A 1 44 ? -6.184  -9.254  -9.568  1.00 0.00 ? 44 ALA A CA   11 
ATOM 11507 C C    . ALA A 1 44 ? -4.796  -9.160  -10.189 1.00 0.00 ? 44 ALA A C    11 
ATOM 11508 O O    . ALA A 1 44 ? -4.497  -9.830  -11.177 1.00 0.00 ? 44 ALA A O    11 
ATOM 11509 C CB   . ALA A 1 44 ? -7.054  -8.097  -10.034 1.00 0.00 ? 44 ALA A CB   11 
ATOM 11510 H H    . ALA A 1 44 ? -6.478  -8.527  -7.603  1.00 0.00 ? 44 ALA A H    11 
ATOM 11511 H HA   . ALA A 1 44 ? -6.651  -10.174 -9.889  1.00 0.00 ? 44 ALA A HA   11 
ATOM 11512 H HB1  . ALA A 1 44 ? -7.626  -8.401  -10.897 1.00 0.00 ? 44 ALA A HB1  11 
ATOM 11513 H HB2  . ALA A 1 44 ? -6.426  -7.257  -10.295 1.00 0.00 ? 44 ALA A HB2  11 
ATOM 11514 H HB3  . ALA A 1 44 ? -7.726  -7.809  -9.239  1.00 0.00 ? 44 ALA A HB3  11 
ATOM 11515 N N    . LEU A 1 45 ? -3.947  -8.332  -9.589  1.00 0.00 ? 45 LEU A N    11 
ATOM 11516 C CA   . LEU A 1 45 ? -2.584  -8.149  -10.063 1.00 0.00 ? 45 LEU A CA   11 
ATOM 11517 C C    . LEU A 1 45 ? -1.902  -9.489  -10.312 1.00 0.00 ? 45 LEU A C    11 
ATOM 11518 O O    . LEU A 1 45 ? -1.013  -9.597  -11.153 1.00 0.00 ? 45 LEU A O    11 
ATOM 11519 C CB   . LEU A 1 45 ? -1.793  -7.352  -9.033  1.00 0.00 ? 45 LEU A CB   11 
ATOM 11520 C CG   . LEU A 1 45 ? -2.032  -5.843  -9.068  1.00 0.00 ? 45 LEU A CG   11 
ATOM 11521 C CD1  . LEU A 1 45 ? -3.513  -5.529  -8.933  1.00 0.00 ? 45 LEU A CD1  11 
ATOM 11522 C CD2  . LEU A 1 45 ? -1.240  -5.157  -7.968  1.00 0.00 ? 45 LEU A CD2  11 
ATOM 11523 H H    . LEU A 1 45 ? -4.244  -7.829  -8.802  1.00 0.00 ? 45 LEU A H    11 
ATOM 11524 H HA   . LEU A 1 45 ? -2.621  -7.598  -10.989 1.00 0.00 ? 45 LEU A HA   11 
ATOM 11525 H HB2  . LEU A 1 45 ? -2.056  -7.714  -8.050  1.00 0.00 ? 45 LEU A HB2  11 
ATOM 11526 H HB3  . LEU A 1 45 ? -0.742  -7.538  -9.195  1.00 0.00 ? 45 LEU A HB3  11 
ATOM 11527 H HG   . LEU A 1 45 ? -1.696  -5.456  -10.015 1.00 0.00 ? 45 LEU A HG   11 
ATOM 11528 H HD11 . LEU A 1 45 ? -3.903  -6.003  -8.044  1.00 0.00 ? 45 LEU A HD11 11 
ATOM 11529 H HD12 . LEU A 1 45 ? -4.041  -5.901  -9.799  1.00 0.00 ? 45 LEU A HD12 11 
ATOM 11530 H HD13 . LEU A 1 45 ? -3.650  -4.460  -8.861  1.00 0.00 ? 45 LEU A HD13 11 
ATOM 11531 H HD21 . LEU A 1 45 ? -0.193  -5.144  -8.232  1.00 0.00 ? 45 LEU A HD21 11 
ATOM 11532 H HD22 . LEU A 1 45 ? -1.371  -5.699  -7.043  1.00 0.00 ? 45 LEU A HD22 11 
ATOM 11533 H HD23 . LEU A 1 45 ? -1.594  -4.146  -7.847  1.00 0.00 ? 45 LEU A HD23 11 
ATOM 11534 N N    . LYS A 1 46 ? -2.341  -10.500 -9.571  1.00 0.00 ? 46 LYS A N    11 
ATOM 11535 C CA   . LYS A 1 46 ? -1.786  -11.851 -9.662  1.00 0.00 ? 46 LYS A CA   11 
ATOM 11536 C C    . LYS A 1 46 ? -0.507  -11.974 -8.834  1.00 0.00 ? 46 LYS A C    11 
ATOM 11537 O O    . LYS A 1 46 ? 0.292   -12.889 -9.036  1.00 0.00 ? 46 LYS A O    11 
ATOM 11538 C CB   . LYS A 1 46 ? -1.562  -12.265 -11.135 1.00 0.00 ? 46 LYS A CB   11 
ATOM 11539 C CG   . LYS A 1 46 ? -0.153  -12.038 -11.678 1.00 0.00 ? 46 LYS A CG   11 
ATOM 11540 C CD   . LYS A 1 46 ? 0.598   -13.350 -11.855 1.00 0.00 ? 46 LYS A CD   11 
ATOM 11541 C CE   . LYS A 1 46 ? 0.014   -14.178 -12.989 1.00 0.00 ? 46 LYS A CE   11 
ATOM 11542 N NZ   . LYS A 1 46 ? -0.112  -13.390 -14.246 1.00 0.00 ? 46 LYS A NZ   11 
ATOM 11543 H H    . LYS A 1 46 ? -3.041  -10.324 -8.912  1.00 0.00 ? 46 LYS A H    11 
ATOM 11544 H HA   . LYS A 1 46 ? -2.520  -12.519 -9.235  1.00 0.00 ? 46 LYS A HA   11 
ATOM 11545 H HB2  . LYS A 1 46 ? -1.789  -13.316 -11.232 1.00 0.00 ? 46 LYS A HB2  11 
ATOM 11546 H HB3  . LYS A 1 46 ? -2.248  -11.707 -11.754 1.00 0.00 ? 46 LYS A HB3  11 
ATOM 11547 H HG2  . LYS A 1 46 ? -0.225  -11.548 -12.638 1.00 0.00 ? 46 LYS A HG2  11 
ATOM 11548 H HG3  . LYS A 1 46 ? 0.394   -11.409 -10.994 1.00 0.00 ? 46 LYS A HG3  11 
ATOM 11549 H HD2  . LYS A 1 46 ? 1.633   -13.135 -12.076 1.00 0.00 ? 46 LYS A HD2  11 
ATOM 11550 H HD3  . LYS A 1 46 ? 0.533   -13.917 -10.939 1.00 0.00 ? 46 LYS A HD3  11 
ATOM 11551 H HE2  . LYS A 1 46 ? 0.660   -15.025 -13.169 1.00 0.00 ? 46 LYS A HE2  11 
ATOM 11552 H HE3  . LYS A 1 46 ? -0.965  -14.529 -12.695 1.00 0.00 ? 46 LYS A HE3  11 
ATOM 11553 H HZ1  . LYS A 1 46 ? -0.160  -14.028 -15.065 1.00 0.00 ? 46 LYS A HZ1  11 
ATOM 11554 H HZ2  . LYS A 1 46 ? 0.709   -12.761 -14.357 1.00 0.00 ? 46 LYS A HZ2  11 
ATOM 11555 H HZ3  . LYS A 1 46 ? -0.976  -12.811 -14.220 1.00 0.00 ? 46 LYS A HZ3  11 
ATOM 11556 N N    . ILE A 1 47 ? -0.326  -11.054 -7.890  1.00 0.00 ? 47 ILE A N    11 
ATOM 11557 C CA   . ILE A 1 47 ? 0.842   -11.075 -7.018  1.00 0.00 ? 47 ILE A CA   11 
ATOM 11558 C C    . ILE A 1 47 ? 0.692   -12.151 -5.947  1.00 0.00 ? 47 ILE A C    11 
ATOM 11559 O O    . ILE A 1 47 ? -0.388  -12.328 -5.384  1.00 0.00 ? 47 ILE A O    11 
ATOM 11560 C CB   . ILE A 1 47 ? 1.058   -9.709  -6.334  1.00 0.00 ? 47 ILE A CB   11 
ATOM 11561 C CG1  . ILE A 1 47 ? 0.832   -8.571  -7.330  1.00 0.00 ? 47 ILE A CG1  11 
ATOM 11562 C CG2  . ILE A 1 47 ? 2.455   -9.624  -5.741  1.00 0.00 ? 47 ILE A CG2  11 
ATOM 11563 C CD1  . ILE A 1 47 ? 1.087   -7.199  -6.747  1.00 0.00 ? 47 ILE A CD1  11 
ATOM 11564 H H    . ILE A 1 47 ? -1.002  -10.357 -7.766  1.00 0.00 ? 47 ILE A H    11 
ATOM 11565 H HA   . ILE A 1 47 ? 1.709   -11.294 -7.622  1.00 0.00 ? 47 ILE A HA   11 
ATOM 11566 H HB   . ILE A 1 47 ? 0.345   -9.621  -5.527  1.00 0.00 ? 47 ILE A HB   11 
ATOM 11567 H HG12 . ILE A 1 47 ? 1.496   -8.701  -8.172  1.00 0.00 ? 47 ILE A HG12 11 
ATOM 11568 H HG13 . ILE A 1 47 ? -0.190  -8.600  -7.674  1.00 0.00 ? 47 ILE A HG13 11 
ATOM 11569 H HG21 . ILE A 1 47 ? 2.619   -10.465 -5.085  1.00 0.00 ? 47 ILE A HG21 11 
ATOM 11570 H HG22 . ILE A 1 47 ? 2.551   -8.705  -5.182  1.00 0.00 ? 47 ILE A HG22 11 
ATOM 11571 H HG23 . ILE A 1 47 ? 3.184   -9.639  -6.537  1.00 0.00 ? 47 ILE A HG23 11 
ATOM 11572 H HD11 . ILE A 1 47 ? 2.053   -7.187  -6.262  1.00 0.00 ? 47 ILE A HD11 11 
ATOM 11573 H HD12 . ILE A 1 47 ? 0.319   -6.966  -6.025  1.00 0.00 ? 47 ILE A HD12 11 
ATOM 11574 H HD13 . ILE A 1 47 ? 1.074   -6.463  -7.538  1.00 0.00 ? 47 ILE A HD13 11 
ATOM 11575 N N    . PRO A 1 48 ? 1.770   -12.900 -5.661  1.00 0.00 ? 48 PRO A N    11 
ATOM 11576 C CA   . PRO A 1 48 ? 1.758   -13.959 -4.654  1.00 0.00 ? 48 PRO A CA   11 
ATOM 11577 C C    . PRO A 1 48 ? 0.975   -13.560 -3.407  1.00 0.00 ? 48 PRO A C    11 
ATOM 11578 O O    . PRO A 1 48 ? 1.157   -12.467 -2.871  1.00 0.00 ? 48 PRO A O    11 
ATOM 11579 C CB   . PRO A 1 48 ? 3.245   -14.167 -4.319  1.00 0.00 ? 48 PRO A CB   11 
ATOM 11580 C CG   . PRO A 1 48 ? 4.002   -13.169 -5.143  1.00 0.00 ? 48 PRO A CG   11 
ATOM 11581 C CD   . PRO A 1 48 ? 3.094   -12.767 -6.269  1.00 0.00 ? 48 PRO A CD   11 
ATOM 11582 H HA   . PRO A 1 48 ? 1.347   -14.875 -5.054  1.00 0.00 ? 48 PRO A HA   11 
ATOM 11583 H HB2  . PRO A 1 48 ? 3.401   -14.002 -3.264  1.00 0.00 ? 48 PRO A HB2  11 
ATOM 11584 H HB3  . PRO A 1 48 ? 3.531   -15.178 -4.572  1.00 0.00 ? 48 PRO A HB3  11 
ATOM 11585 H HG2  . PRO A 1 48 ? 4.250   -12.309 -4.538  1.00 0.00 ? 48 PRO A HG2  11 
ATOM 11586 H HG3  . PRO A 1 48 ? 4.901   -13.623 -5.532  1.00 0.00 ? 48 PRO A HG3  11 
ATOM 11587 H HD2  . PRO A 1 48 ? 3.286   -11.748 -6.568  1.00 0.00 ? 48 PRO A HD2  11 
ATOM 11588 H HD3  . PRO A 1 48 ? 3.206   -13.440 -7.106  1.00 0.00 ? 48 PRO A HD3  11 
ATOM 11589 N N    . GLU A 1 49 ? 0.092   -14.448 -2.962  1.00 0.00 ? 49 GLU A N    11 
ATOM 11590 C CA   . GLU A 1 49 ? -0.733  -14.186 -1.789  1.00 0.00 ? 49 GLU A CA   11 
ATOM 11591 C C    . GLU A 1 49 ? 0.109   -14.143 -0.519  1.00 0.00 ? 49 GLU A C    11 
ATOM 11592 O O    . GLU A 1 49 ? -0.063  -14.965 0.381   1.00 0.00 ? 49 GLU A O    11 
ATOM 11593 C CB   . GLU A 1 49 ? -1.817  -15.257 -1.656  1.00 0.00 ? 49 GLU A CB   11 
ATOM 11594 C CG   . GLU A 1 49 ? -2.855  -14.942 -0.591  1.00 0.00 ? 49 GLU A CG   11 
ATOM 11595 C CD   . GLU A 1 49 ? -3.279  -16.168 0.192   1.00 0.00 ? 49 GLU A CD   11 
ATOM 11596 O OE1  . GLU A 1 49 ? -2.390  -16.936 0.618   1.00 0.00 ? 49 GLU A OE1  11 
ATOM 11597 O OE2  . GLU A 1 49 ? -4.498  -16.362 0.379   1.00 0.00 ? 49 GLU A OE2  11 
ATOM 11598 H H    . GLU A 1 49 ? -0.012  -15.298 -3.439  1.00 0.00 ? 49 GLU A H    11 
ATOM 11599 H HA   . GLU A 1 49 ? -1.205  -13.225 -1.926  1.00 0.00 ? 49 GLU A HA   11 
ATOM 11600 H HB2  . GLU A 1 49 ? -2.325  -15.359 -2.604  1.00 0.00 ? 49 GLU A HB2  11 
ATOM 11601 H HB3  . GLU A 1 49 ? -1.350  -16.198 -1.405  1.00 0.00 ? 49 GLU A HB3  11 
ATOM 11602 H HG2  . GLU A 1 49 ? -2.438  -14.220 0.096   1.00 0.00 ? 49 GLU A HG2  11 
ATOM 11603 H HG3  . GLU A 1 49 ? -3.727  -14.520 -1.070  1.00 0.00 ? 49 GLU A HG3  11 
ATOM 11604 N N    . GLN A 1 50 ? 1.016   -13.174 -0.449  1.00 0.00 ? 50 GLN A N    11 
ATOM 11605 C CA   . GLN A 1 50 ? 1.874   -13.014 0.719   1.00 0.00 ? 50 GLN A CA   11 
ATOM 11606 C C    . GLN A 1 50 ? 1.174   -12.189 1.793   1.00 0.00 ? 50 GLN A C    11 
ATOM 11607 O O    . GLN A 1 50 ? 0.952   -12.662 2.907   1.00 0.00 ? 50 GLN A O    11 
ATOM 11608 C CB   . GLN A 1 50 ? 3.191   -12.344 0.324   1.00 0.00 ? 50 GLN A CB   11 
ATOM 11609 C CG   . GLN A 1 50 ? 3.803   -12.906 -0.950  1.00 0.00 ? 50 GLN A CG   11 
ATOM 11610 C CD   . GLN A 1 50 ? 5.134   -13.583 -0.710  1.00 0.00 ? 50 GLN A CD   11 
ATOM 11611 O OE1  . GLN A 1 50 ? 5.319   -14.285 0.284   1.00 0.00 ? 50 GLN A OE1  11 
ATOM 11612 N NE2  . GLN A 1 50 ? 6.071   -13.376 -1.626  1.00 0.00 ? 50 GLN A NE2  11 
ATOM 11613 H H    . GLN A 1 50 ? 1.102   -12.544 -1.196  1.00 0.00 ? 50 GLN A H    11 
ATOM 11614 H HA   . GLN A 1 50 ? 2.083   -13.998 1.115   1.00 0.00 ? 50 GLN A HA   11 
ATOM 11615 H HB2  . GLN A 1 50 ? 3.015   -11.289 0.177   1.00 0.00 ? 50 GLN A HB2  11 
ATOM 11616 H HB3  . GLN A 1 50 ? 3.902   -12.473 1.126   1.00 0.00 ? 50 GLN A HB3  11 
ATOM 11617 H HG2  . GLN A 1 50 ? 3.122   -13.626 -1.375  1.00 0.00 ? 50 GLN A HG2  11 
ATOM 11618 H HG3  . GLN A 1 50 ? 3.954   -12.097 -1.649  1.00 0.00 ? 50 GLN A HG3  11 
ATOM 11619 H HE21 . GLN A 1 50 ? 5.851   -12.805 -2.391  1.00 0.00 ? 50 GLN A HE21 11 
ATOM 11620 H HE22 . GLN A 1 50 ? 6.941   -13.801 -1.499  1.00 0.00 ? 50 GLN A HE22 11 
ATOM 11621 N N    . TYR A 1 51 ? 0.835   -10.950 1.449   1.00 0.00 ? 51 TYR A N    11 
ATOM 11622 C CA   . TYR A 1 51 ? 0.154   -10.057 2.378   1.00 0.00 ? 51 TYR A CA   11 
ATOM 11623 C C    . TYR A 1 51 ? -0.915  -9.243  1.659   1.00 0.00 ? 51 TYR A C    11 
ATOM 11624 O O    . TYR A 1 51 ? -1.129  -8.070  1.966   1.00 0.00 ? 51 TYR A O    11 
ATOM 11625 C CB   . TYR A 1 51 ? 1.161   -9.118  3.047   1.00 0.00 ? 51 TYR A CB   11 
ATOM 11626 C CG   . TYR A 1 51 ? 2.494   -9.769  3.340   1.00 0.00 ? 51 TYR A CG   11 
ATOM 11627 C CD1  . TYR A 1 51 ? 2.637   -10.658 4.398   1.00 0.00 ? 51 TYR A CD1  11 
ATOM 11628 C CD2  . TYR A 1 51 ? 3.609   -9.492  2.560   1.00 0.00 ? 51 TYR A CD2  11 
ATOM 11629 C CE1  . TYR A 1 51 ? 3.854   -11.253 4.669   1.00 0.00 ? 51 TYR A CE1  11 
ATOM 11630 C CE2  . TYR A 1 51 ? 4.829   -10.084 2.824   1.00 0.00 ? 51 TYR A CE2  11 
ATOM 11631 C CZ   . TYR A 1 51 ? 4.947   -10.964 3.879   1.00 0.00 ? 51 TYR A CZ   11 
ATOM 11632 O OH   . TYR A 1 51 ? 6.160   -11.554 4.147   1.00 0.00 ? 51 TYR A OH   11 
ATOM 11633 H H    . TYR A 1 51 ? 1.036   -10.635 0.544   1.00 0.00 ? 51 TYR A H    11 
ATOM 11634 H HA   . TYR A 1 51 ? -0.320  -10.663 3.135   1.00 0.00 ? 51 TYR A HA   11 
ATOM 11635 H HB2  . TYR A 1 51 ? 1.340   -8.274  2.399   1.00 0.00 ? 51 TYR A HB2  11 
ATOM 11636 H HB3  . TYR A 1 51 ? 0.749   -8.769  3.982   1.00 0.00 ? 51 TYR A HB3  11 
ATOM 11637 H HD1  . TYR A 1 51 ? 1.779   -10.882 5.014   1.00 0.00 ? 51 TYR A HD1  11 
ATOM 11638 H HD2  . TYR A 1 51 ? 3.514   -8.802  1.734   1.00 0.00 ? 51 TYR A HD2  11 
ATOM 11639 H HE1  . TYR A 1 51 ? 3.946   -11.942 5.496   1.00 0.00 ? 51 TYR A HE1  11 
ATOM 11640 H HE2  . TYR A 1 51 ? 5.685   -9.856  2.205   1.00 0.00 ? 51 TYR A HE2  11 
ATOM 11641 H HH   . TYR A 1 51 ? 6.685   -11.584 3.343   1.00 0.00 ? 51 TYR A HH   11 
ATOM 11642 N N    . ARG A 1 52 ? -1.576  -9.871  0.691   1.00 0.00 ? 52 ARG A N    11 
ATOM 11643 C CA   . ARG A 1 52 ? -2.614  -9.209  -0.081  1.00 0.00 ? 52 ARG A CA   11 
ATOM 11644 C C    . ARG A 1 52 ? -3.617  -8.505  0.829   1.00 0.00 ? 52 ARG A C    11 
ATOM 11645 O O    . ARG A 1 52 ? -3.980  -7.353  0.591   1.00 0.00 ? 52 ARG A O    11 
ATOM 11646 C CB   . ARG A 1 52 ? -3.330  -10.231 -0.963  1.00 0.00 ? 52 ARG A CB   11 
ATOM 11647 C CG   . ARG A 1 52 ? -3.506  -9.772  -2.400  1.00 0.00 ? 52 ARG A CG   11 
ATOM 11648 C CD   . ARG A 1 52 ? -2.496  -10.433 -3.323  1.00 0.00 ? 52 ARG A CD   11 
ATOM 11649 N NE   . ARG A 1 52 ? -1.185  -9.794  -3.248  1.00 0.00 ? 52 ARG A NE   11 
ATOM 11650 C CZ   . ARG A 1 52 ? -0.934  -8.571  -3.705  1.00 0.00 ? 52 ARG A CZ   11 
ATOM 11651 N NH1  . ARG A 1 52 ? -1.903  -7.859  -4.265  1.00 0.00 ? 52 ARG A NH1  11 
ATOM 11652 N NH2  . ARG A 1 52 ? 0.285   -8.058  -3.601  1.00 0.00 ? 52 ARG A NH2  11 
ATOM 11653 H H    . ARG A 1 52 ? -1.359  -10.804 0.490   1.00 0.00 ? 52 ARG A H    11 
ATOM 11654 H HA   . ARG A 1 52 ? -2.139  -8.471  -0.711  1.00 0.00 ? 52 ARG A HA   11 
ATOM 11655 H HB2  . ARG A 1 52 ? -2.758  -11.147 -0.968  1.00 0.00 ? 52 ARG A HB2  11 
ATOM 11656 H HB3  . ARG A 1 52 ? -4.305  -10.428 -0.546  1.00 0.00 ? 52 ARG A HB3  11 
ATOM 11657 H HG2  . ARG A 1 52 ? -4.502  -10.027 -2.730  1.00 0.00 ? 52 ARG A HG2  11 
ATOM 11658 H HG3  . ARG A 1 52 ? -3.372  -8.702  -2.444  1.00 0.00 ? 52 ARG A HG3  11 
ATOM 11659 H HD2  . ARG A 1 52 ? -2.395  -11.471 -3.043  1.00 0.00 ? 52 ARG A HD2  11 
ATOM 11660 H HD3  . ARG A 1 52 ? -2.859  -10.369 -4.338  1.00 0.00 ? 52 ARG A HD3  11 
ATOM 11661 H HE   . ARG A 1 52 ? -0.455  -10.302 -2.838  1.00 0.00 ? 52 ARG A HE   11 
ATOM 11662 H HH11 . ARG A 1 52 ? -2.823  -8.242  -4.345  1.00 0.00 ? 52 ARG A HH11 11 
ATOM 11663 H HH12 . ARG A 1 52 ? -1.713  -6.940  -4.607  1.00 0.00 ? 52 ARG A HH12 11 
ATOM 11664 H HH21 . ARG A 1 52 ? 1.017   -8.592  -3.179  1.00 0.00 ? 52 ARG A HH21 11 
ATOM 11665 H HH22 . ARG A 1 52 ? 0.471   -7.138  -3.944  1.00 0.00 ? 52 ARG A HH22 11 
ATOM 11666 N N    . MET A 1 53 ? -4.057  -9.201  1.872   1.00 0.00 ? 53 MET A N    11 
ATOM 11667 C CA   . MET A 1 53 ? -5.016  -8.635  2.813   1.00 0.00 ? 53 MET A CA   11 
ATOM 11668 C C    . MET A 1 53 ? -4.434  -7.411  3.512   1.00 0.00 ? 53 MET A C    11 
ATOM 11669 O O    . MET A 1 53 ? -5.084  -6.369  3.603   1.00 0.00 ? 53 MET A O    11 
ATOM 11670 C CB   . MET A 1 53 ? -5.427  -9.683  3.850   1.00 0.00 ? 53 MET A CB   11 
ATOM 11671 C CG   . MET A 1 53 ? -4.251  -10.351 4.540   1.00 0.00 ? 53 MET A CG   11 
ATOM 11672 S SD   . MET A 1 53 ? -4.521  -12.110 4.829   1.00 0.00 ? 53 MET A SD   11 
ATOM 11673 C CE   . MET A 1 53 ? -3.841  -12.808 3.326   1.00 0.00 ? 53 MET A CE   11 
ATOM 11674 H H    . MET A 1 53 ? -3.732  -10.115 2.010   1.00 0.00 ? 53 MET A H    11 
ATOM 11675 H HA   . MET A 1 53 ? -5.889  -8.332  2.252   1.00 0.00 ? 53 MET A HA   11 
ATOM 11676 H HB2  . MET A 1 53 ? -6.036  -9.206  4.604   1.00 0.00 ? 53 MET A HB2  11 
ATOM 11677 H HB3  . MET A 1 53 ? -6.011  -10.447 3.360   1.00 0.00 ? 53 MET A HB3  11 
ATOM 11678 H HG2  . MET A 1 53 ? -3.373  -10.234 3.922   1.00 0.00 ? 53 MET A HG2  11 
ATOM 11679 H HG3  . MET A 1 53 ? -4.086  -9.866  5.492   1.00 0.00 ? 53 MET A HG3  11 
ATOM 11680 H HE1  . MET A 1 53 ? -2.854  -12.403 3.157   1.00 0.00 ? 53 MET A HE1  11 
ATOM 11681 H HE2  . MET A 1 53 ? -4.479  -12.559 2.492   1.00 0.00 ? 53 MET A HE2  11 
ATOM 11682 H HE3  . MET A 1 53 ? -3.778  -13.881 3.425   1.00 0.00 ? 53 MET A HE3  11 
ATOM 11683 N N    . THR A 1 54 ? -3.206  -7.540  4.004   1.00 0.00 ? 54 THR A N    11 
ATOM 11684 C CA   . THR A 1 54 ? -2.536  -6.436  4.681   1.00 0.00 ? 54 THR A CA   11 
ATOM 11685 C C    . THR A 1 54 ? -2.519  -5.198  3.793   1.00 0.00 ? 54 THR A C    11 
ATOM 11686 O O    . THR A 1 54 ? -2.716  -4.079  4.264   1.00 0.00 ? 54 THR A O    11 
ATOM 11687 C CB   . THR A 1 54 ? -1.102  -6.830  5.053   1.00 0.00 ? 54 THR A CB   11 
ATOM 11688 O OG1  . THR A 1 54 ? -1.104  -7.832  6.055   1.00 0.00 ? 54 THR A OG1  11 
ATOM 11689 C CG2  . THR A 1 54 ? -0.266  -5.671  5.562   1.00 0.00 ? 54 THR A CG2  11 
ATOM 11690 H H    . THR A 1 54 ? -2.733  -8.392  3.895   1.00 0.00 ? 54 THR A H    11 
ATOM 11691 H HA   . THR A 1 54 ? -3.088  -6.213  5.581   1.00 0.00 ? 54 THR A HA   11 
ATOM 11692 H HB   . THR A 1 54 ? -0.611  -7.227  4.178   1.00 0.00 ? 54 THR A HB   11 
ATOM 11693 H HG1  . THR A 1 54 ? -1.828  -7.675  6.665   1.00 0.00 ? 54 THR A HG1  11 
ATOM 11694 H HG21 . THR A 1 54 ? -0.645  -5.347  6.520   1.00 0.00 ? 54 THR A HG21 11 
ATOM 11695 H HG22 . THR A 1 54 ? -0.316  -4.851  4.859   1.00 0.00 ? 54 THR A HG22 11 
ATOM 11696 H HG23 . THR A 1 54 ? 0.761   -5.989  5.671   1.00 0.00 ? 54 THR A HG23 11 
ATOM 11697 N N    . ILE A 1 55 ? -2.279  -5.410  2.503   1.00 0.00 ? 55 ILE A N    11 
ATOM 11698 C CA   . ILE A 1 55 ? -2.224  -4.312  1.550   1.00 0.00 ? 55 ILE A CA   11 
ATOM 11699 C C    . ILE A 1 55 ? -3.570  -3.604  1.449   1.00 0.00 ? 55 ILE A C    11 
ATOM 11700 O O    . ILE A 1 55 ? -3.668  -2.406  1.718   1.00 0.00 ? 55 ILE A O    11 
ATOM 11701 C CB   . ILE A 1 55 ? -1.786  -4.791  0.157   1.00 0.00 ? 55 ILE A CB   11 
ATOM 11702 C CG1  . ILE A 1 55 ? -0.481  -5.582  0.257   1.00 0.00 ? 55 ILE A CG1  11 
ATOM 11703 C CG2  . ILE A 1 55 ? -1.619  -3.604  -0.778  1.00 0.00 ? 55 ILE A CG2  11 
ATOM 11704 C CD1  . ILE A 1 55 ? -0.381  -6.714  -0.742  1.00 0.00 ? 55 ILE A CD1  11 
ATOM 11705 H H    . ILE A 1 55 ? -2.124  -6.325  2.189   1.00 0.00 ? 55 ILE A H    11 
ATOM 11706 H HA   . ILE A 1 55 ? -1.493  -3.608  1.904   1.00 0.00 ? 55 ILE A HA   11 
ATOM 11707 H HB   . ILE A 1 55 ? -2.560  -5.429  -0.241  1.00 0.00 ? 55 ILE A HB   11 
ATOM 11708 H HG12 . ILE A 1 55 ? 0.351   -4.914  0.086   1.00 0.00 ? 55 ILE A HG12 11 
ATOM 11709 H HG13 . ILE A 1 55 ? -0.400  -6.006  1.247   1.00 0.00 ? 55 ILE A HG13 11 
ATOM 11710 H HG21 . ILE A 1 55 ? -2.521  -3.010  -0.772  1.00 0.00 ? 55 ILE A HG21 11 
ATOM 11711 H HG22 . ILE A 1 55 ? -1.426  -3.957  -1.777  1.00 0.00 ? 55 ILE A HG22 11 
ATOM 11712 H HG23 . ILE A 1 55 ? -0.788  -2.998  -0.442  1.00 0.00 ? 55 ILE A HG23 11 
ATOM 11713 H HD11 . ILE A 1 55 ? 0.445   -6.530  -1.413  1.00 0.00 ? 55 ILE A HD11 11 
ATOM 11714 H HD12 . ILE A 1 55 ? -1.298  -6.776  -1.309  1.00 0.00 ? 55 ILE A HD12 11 
ATOM 11715 H HD13 . ILE A 1 55 ? -0.218  -7.644  -0.217  1.00 0.00 ? 55 ILE A HD13 11 
ATOM 11716 N N    . TRP A 1 56 ? -4.611  -4.347  1.086   1.00 0.00 ? 56 TRP A N    11 
ATOM 11717 C CA   . TRP A 1 56 ? -5.950  -3.783  0.992   1.00 0.00 ? 56 TRP A CA   11 
ATOM 11718 C C    . TRP A 1 56 ? -6.290  -3.012  2.270   1.00 0.00 ? 56 TRP A C    11 
ATOM 11719 O O    . TRP A 1 56 ? -6.789  -1.887  2.217   1.00 0.00 ? 56 TRP A O    11 
ATOM 11720 C CB   . TRP A 1 56 ? -6.964  -4.907  0.741   1.00 0.00 ? 56 TRP A CB   11 
ATOM 11721 C CG   . TRP A 1 56 ? -8.383  -4.541  1.046   1.00 0.00 ? 56 TRP A CG   11 
ATOM 11722 C CD1  . TRP A 1 56 ? -9.012  -3.367  0.754   1.00 0.00 ? 56 TRP A CD1  11 
ATOM 11723 C CD2  . TRP A 1 56 ? -9.344  -5.354  1.720   1.00 0.00 ? 56 TRP A CD2  11 
ATOM 11724 N NE1  . TRP A 1 56 ? -10.310 -3.406  1.201   1.00 0.00 ? 56 TRP A NE1  11 
ATOM 11725 C CE2  . TRP A 1 56 ? -10.537 -4.616  1.796   1.00 0.00 ? 56 TRP A CE2  11 
ATOM 11726 C CE3  . TRP A 1 56 ? -9.311  -6.640  2.263   1.00 0.00 ? 56 TRP A CE3  11 
ATOM 11727 C CZ2  . TRP A 1 56 ? -11.686 -5.114  2.391   1.00 0.00 ? 56 TRP A CZ2  11 
ATOM 11728 C CZ3  . TRP A 1 56 ? -10.455 -7.139  2.858   1.00 0.00 ? 56 TRP A CZ3  11 
ATOM 11729 C CH2  . TRP A 1 56 ? -11.630 -6.378  2.917   1.00 0.00 ? 56 TRP A CH2  11 
ATOM 11730 H H    . TRP A 1 56 ? -4.483  -5.301  0.897   1.00 0.00 ? 56 TRP A H    11 
ATOM 11731 H HA   . TRP A 1 56 ? -5.966  -3.098  0.156   1.00 0.00 ? 56 TRP A HA   11 
ATOM 11732 H HB2  . TRP A 1 56 ? -6.914  -5.197  -0.298  1.00 0.00 ? 56 TRP A HB2  11 
ATOM 11733 H HB3  . TRP A 1 56 ? -6.702  -5.756  1.355   1.00 0.00 ? 56 TRP A HB3  11 
ATOM 11734 H HD1  . TRP A 1 56 ? -8.544  -2.538  0.244   1.00 0.00 ? 56 TRP A HD1  11 
ATOM 11735 H HE1  . TRP A 1 56 ? -10.970 -2.688  1.108   1.00 0.00 ? 56 TRP A HE1  11 
ATOM 11736 H HE3  . TRP A 1 56 ? -8.409  -7.237  2.224   1.00 0.00 ? 56 TRP A HE3  11 
ATOM 11737 H HZ2  . TRP A 1 56 ? -12.595 -4.536  2.443   1.00 0.00 ? 56 TRP A HZ2  11 
ATOM 11738 H HZ3  . TRP A 1 56 ? -10.450 -8.132  3.283   1.00 0.00 ? 56 TRP A HZ3  11 
ATOM 11739 H HH2  . TRP A 1 56 ? -12.501 -6.807  3.390   1.00 0.00 ? 56 TRP A HH2  11 
ATOM 11740 N N    . ARG A 1 57 ? -5.992  -3.621  3.412   1.00 0.00 ? 57 ARG A N    11 
ATOM 11741 C CA   . ARG A 1 57 ? -6.244  -2.992  4.703   1.00 0.00 ? 57 ARG A CA   11 
ATOM 11742 C C    . ARG A 1 57 ? -5.563  -1.631  4.779   1.00 0.00 ? 57 ARG A C    11 
ATOM 11743 O O    . ARG A 1 57 ? -6.193  -0.626  5.109   1.00 0.00 ? 57 ARG A O    11 
ATOM 11744 C CB   . ARG A 1 57 ? -5.745  -3.888  5.840   1.00 0.00 ? 57 ARG A CB   11 
ATOM 11745 C CG   . ARG A 1 57 ? -6.271  -5.312  5.771   1.00 0.00 ? 57 ARG A CG   11 
ATOM 11746 C CD   . ARG A 1 57 ? -7.178  -5.631  6.949   1.00 0.00 ? 57 ARG A CD   11 
ATOM 11747 N NE   . ARG A 1 57 ? -7.096  -7.036  7.338   1.00 0.00 ? 57 ARG A NE   11 
ATOM 11748 C CZ   . ARG A 1 57 ? -7.675  -7.533  8.427   1.00 0.00 ? 57 ARG A CZ   11 
ATOM 11749 N NH1  . ARG A 1 57 ? -8.374  -6.741  9.230   1.00 0.00 ? 57 ARG A NH1  11 
ATOM 11750 N NH2  . ARG A 1 57 ? -7.555  -8.821  8.714   1.00 0.00 ? 57 ARG A NH2  11 
ATOM 11751 H H    . ARG A 1 57 ? -5.589  -4.512  3.384   1.00 0.00 ? 57 ARG A H    11 
ATOM 11752 H HA   . ARG A 1 57 ? -7.308  -2.853  4.802   1.00 0.00 ? 57 ARG A HA   11 
ATOM 11753 H HB2  . ARG A 1 57 ? -4.667  -3.923  5.809   1.00 0.00 ? 57 ARG A HB2  11 
ATOM 11754 H HB3  . ARG A 1 57 ? -6.055  -3.459  6.782   1.00 0.00 ? 57 ARG A HB3  11 
ATOM 11755 H HG2  . ARG A 1 57 ? -6.830  -5.437  4.855   1.00 0.00 ? 57 ARG A HG2  11 
ATOM 11756 H HG3  . ARG A 1 57 ? -5.434  -5.995  5.780   1.00 0.00 ? 57 ARG A HG3  11 
ATOM 11757 H HD2  . ARG A 1 57 ? -6.887  -5.017  7.788   1.00 0.00 ? 57 ARG A HD2  11 
ATOM 11758 H HD3  . ARG A 1 57 ? -8.197  -5.402  6.675   1.00 0.00 ? 57 ARG A HD3  11 
ATOM 11759 H HE   . ARG A 1 57 ? -6.585  -7.639  6.760   1.00 0.00 ? 57 ARG A HE   11 
ATOM 11760 H HH11 . ARG A 1 57 ? -8.465  -5.768  9.016   1.00 0.00 ? 57 ARG A HH11 11 
ATOM 11761 H HH12 . ARG A 1 57 ? -8.808  -7.117  10.048  1.00 0.00 ? 57 ARG A HH12 11 
ATOM 11762 H HH21 . ARG A 1 57 ? -7.029  -9.421  8.111   1.00 0.00 ? 57 ARG A HH21 11 
ATOM 11763 H HH22 . ARG A 1 57 ? -7.991  -9.194  9.534   1.00 0.00 ? 57 ARG A HH22 11 
ATOM 11764 N N    . GLY A 1 58 ? -4.274  -1.608  4.467   1.00 0.00 ? 58 GLY A N    11 
ATOM 11765 C CA   . GLY A 1 58 ? -3.529  -0.365  4.484   1.00 0.00 ? 58 GLY A CA   11 
ATOM 11766 C C    . GLY A 1 58 ? -4.153  0.678   3.583   1.00 0.00 ? 58 GLY A C    11 
ATOM 11767 O O    . GLY A 1 58 ? -4.248  1.851   3.949   1.00 0.00 ? 58 GLY A O    11 
ATOM 11768 H H    . GLY A 1 58 ? -3.832  -2.439  4.201   1.00 0.00 ? 58 GLY A H    11 
ATOM 11769 H HA2  . GLY A 1 58 ? -3.502  0.014   5.495   1.00 0.00 ? 58 GLY A HA2  11 
ATOM 11770 H HA3  . GLY A 1 58 ? -2.519  -0.555  4.153   1.00 0.00 ? 58 GLY A HA3  11 
ATOM 11771 N N    . LEU A 1 59 ? -4.592  0.246   2.407   1.00 0.00 ? 59 LEU A N    11 
ATOM 11772 C CA   . LEU A 1 59 ? -5.238  1.140   1.457   1.00 0.00 ? 59 LEU A CA   11 
ATOM 11773 C C    . LEU A 1 59 ? -6.518  1.709   2.055   1.00 0.00 ? 59 LEU A C    11 
ATOM 11774 O O    . LEU A 1 59 ? -6.897  2.846   1.774   1.00 0.00 ? 59 LEU A O    11 
ATOM 11775 C CB   . LEU A 1 59 ? -5.549  0.398   0.157   1.00 0.00 ? 59 LEU A CB   11 
ATOM 11776 C CG   . LEU A 1 59 ? -4.890  0.982   -1.092  1.00 0.00 ? 59 LEU A CG   11 
ATOM 11777 C CD1  . LEU A 1 59 ? -3.398  1.175   -0.869  1.00 0.00 ? 59 LEU A CD1  11 
ATOM 11778 C CD2  . LEU A 1 59 ? -5.141  0.084   -2.291  1.00 0.00 ? 59 LEU A CD2  11 
ATOM 11779 H H    . LEU A 1 59 ? -4.498  -0.703  2.181   1.00 0.00 ? 59 LEU A H    11 
ATOM 11780 H HA   . LEU A 1 59 ? -4.558  1.953   1.250   1.00 0.00 ? 59 LEU A HA   11 
ATOM 11781 H HB2  . LEU A 1 59 ? -5.223  -0.626  0.265   1.00 0.00 ? 59 LEU A HB2  11 
ATOM 11782 H HB3  . LEU A 1 59 ? -6.619  0.403   0.009   1.00 0.00 ? 59 LEU A HB3  11 
ATOM 11783 H HG   . LEU A 1 59 ? -5.323  1.948   -1.302  1.00 0.00 ? 59 LEU A HG   11 
ATOM 11784 H HD11 . LEU A 1 59 ? -3.128  0.801   0.106   1.00 0.00 ? 59 LEU A HD11 11 
ATOM 11785 H HD12 . LEU A 1 59 ? -3.156  2.225   -0.933  1.00 0.00 ? 59 LEU A HD12 11 
ATOM 11786 H HD13 . LEU A 1 59 ? -2.849  0.633   -1.626  1.00 0.00 ? 59 LEU A HD13 11 
ATOM 11787 H HD21 . LEU A 1 59 ? -6.132  0.268   -2.675  1.00 0.00 ? 59 LEU A HD21 11 
ATOM 11788 H HD22 . LEU A 1 59 ? -5.057  -0.950  -1.990  1.00 0.00 ? 59 LEU A HD22 11 
ATOM 11789 H HD23 . LEU A 1 59 ? -4.412  0.296   -3.059  1.00 0.00 ? 59 LEU A HD23 11 
ATOM 11790 N N    . GLN A 1 60 ? -7.178  0.909   2.885   1.00 0.00 ? 60 GLN A N    11 
ATOM 11791 C CA   . GLN A 1 60 ? -8.401  1.342   3.546   1.00 0.00 ? 60 GLN A CA   11 
ATOM 11792 C C    . GLN A 1 60 ? -8.088  2.398   4.597   1.00 0.00 ? 60 GLN A C    11 
ATOM 11793 O O    . GLN A 1 60 ? -8.925  3.244   4.913   1.00 0.00 ? 60 GLN A O    11 
ATOM 11794 C CB   . GLN A 1 60 ? -9.108  0.149   4.193   1.00 0.00 ? 60 GLN A CB   11 
ATOM 11795 C CG   . GLN A 1 60 ? -9.673  -0.841  3.187   1.00 0.00 ? 60 GLN A CG   11 
ATOM 11796 C CD   . GLN A 1 60 ? -10.573 -1.876  3.830   1.00 0.00 ? 60 GLN A CD   11 
ATOM 11797 O OE1  . GLN A 1 60 ? -11.740 -1.609  4.118   1.00 0.00 ? 60 GLN A OE1  11 
ATOM 11798 N NE2  . GLN A 1 60 ? -10.032 -3.067  4.063   1.00 0.00 ? 60 GLN A NE2  11 
ATOM 11799 H H    . GLN A 1 60 ? -6.817  0.017   3.079   1.00 0.00 ? 60 GLN A H    11 
ATOM 11800 H HA   . GLN A 1 60 ? -9.049  1.774   2.798   1.00 0.00 ? 60 GLN A HA   11 
ATOM 11801 H HB2  . GLN A 1 60 ? -8.404  -0.374  4.824   1.00 0.00 ? 60 GLN A HB2  11 
ATOM 11802 H HB3  . GLN A 1 60 ? -9.922  0.514   4.802   1.00 0.00 ? 60 GLN A HB3  11 
ATOM 11803 H HG2  . GLN A 1 60 ? -10.245 -0.298  2.449   1.00 0.00 ? 60 GLN A HG2  11 
ATOM 11804 H HG3  . GLN A 1 60 ? -8.853  -1.350  2.703   1.00 0.00 ? 60 GLN A HG3  11 
ATOM 11805 H HE21 . GLN A 1 60 ? -9.097  -3.208  3.809   1.00 0.00 ? 60 GLN A HE21 11 
ATOM 11806 H HE22 . GLN A 1 60 ? -10.592 -3.756  4.478   1.00 0.00 ? 60 GLN A HE22 11 
ATOM 11807 N N    . ASP A 1 61 ? -6.870  2.351   5.126   1.00 0.00 ? 61 ASP A N    11 
ATOM 11808 C CA   . ASP A 1 61 ? -6.432  3.316   6.125   1.00 0.00 ? 61 ASP A CA   11 
ATOM 11809 C C    . ASP A 1 61 ? -6.433  4.724   5.541   1.00 0.00 ? 61 ASP A C    11 
ATOM 11810 O O    . ASP A 1 61 ? -6.708  5.698   6.241   1.00 0.00 ? 61 ASP A O    11 
ATOM 11811 C CB   . ASP A 1 61 ? -5.033  2.960   6.631   1.00 0.00 ? 61 ASP A CB   11 
ATOM 11812 C CG   . ASP A 1 61 ? -4.949  2.951   8.144   1.00 0.00 ? 61 ASP A CG   11 
ATOM 11813 O OD1  . ASP A 1 61 ? -5.614  2.099   8.770   1.00 0.00 ? 61 ASP A OD1  11 
ATOM 11814 O OD2  . ASP A 1 61 ? -4.221  3.798   8.703   1.00 0.00 ? 61 ASP A OD2  11 
ATOM 11815 H H    . ASP A 1 61 ? -6.244  1.658   4.827   1.00 0.00 ? 61 ASP A H    11 
ATOM 11816 H HA   . ASP A 1 61 ? -7.127  3.279   6.950   1.00 0.00 ? 61 ASP A HA   11 
ATOM 11817 H HB2  . ASP A 1 61 ? -4.764  1.978   6.268   1.00 0.00 ? 61 ASP A HB2  11 
ATOM 11818 H HB3  . ASP A 1 61 ? -4.326  3.684   6.254   1.00 0.00 ? 61 ASP A HB3  11 
ATOM 11819 N N    . LEU A 1 62 ? -6.131  4.820   4.249   1.00 0.00 ? 62 LEU A N    11 
ATOM 11820 C CA   . LEU A 1 62 ? -6.111  6.105   3.563   1.00 0.00 ? 62 LEU A CA   11 
ATOM 11821 C C    . LEU A 1 62 ? -7.507  6.714   3.523   1.00 0.00 ? 62 LEU A C    11 
ATOM 11822 O O    . LEU A 1 62 ? -7.701  7.877   3.877   1.00 0.00 ? 62 LEU A O    11 
ATOM 11823 C CB   . LEU A 1 62 ? -5.576  5.936   2.140   1.00 0.00 ? 62 LEU A CB   11 
ATOM 11824 C CG   . LEU A 1 62 ? -4.142  5.411   2.046   1.00 0.00 ? 62 LEU A CG   11 
ATOM 11825 C CD1  . LEU A 1 62 ? -3.928  4.671   0.735   1.00 0.00 ? 62 LEU A CD1  11 
ATOM 11826 C CD2  . LEU A 1 62 ? -3.148  6.554   2.184   1.00 0.00 ? 62 LEU A CD2  11 
ATOM 11827 H H    . LEU A 1 62 ? -5.928  4.005   3.743   1.00 0.00 ? 62 LEU A H    11 
ATOM 11828 H HA   . LEU A 1 62 ? -5.456  6.766   4.112   1.00 0.00 ? 62 LEU A HA   11 
ATOM 11829 H HB2  . LEU A 1 62 ? -6.223  5.252   1.613   1.00 0.00 ? 62 LEU A HB2  11 
ATOM 11830 H HB3  . LEU A 1 62 ? -5.618  6.897   1.646   1.00 0.00 ? 62 LEU A HB3  11 
ATOM 11831 H HG   . LEU A 1 62 ? -3.966  4.716   2.854   1.00 0.00 ? 62 LEU A HG   11 
ATOM 11832 H HD11 . LEU A 1 62 ? -3.124  3.960   0.850   1.00 0.00 ? 62 LEU A HD11 11 
ATOM 11833 H HD12 . LEU A 1 62 ? -3.675  5.378   -0.042  1.00 0.00 ? 62 LEU A HD12 11 
ATOM 11834 H HD13 . LEU A 1 62 ? -4.834  4.148   0.464   1.00 0.00 ? 62 LEU A HD13 11 
ATOM 11835 H HD21 . LEU A 1 62 ? -3.596  7.352   2.757   1.00 0.00 ? 62 LEU A HD21 11 
ATOM 11836 H HD22 . LEU A 1 62 ? -2.881  6.919   1.204   1.00 0.00 ? 62 LEU A HD22 11 
ATOM 11837 H HD23 . LEU A 1 62 ? -2.262  6.201   2.691   1.00 0.00 ? 62 LEU A HD23 11 
ATOM 11838 N N    . LYS A 1 63 ? -8.479  5.915   3.096   1.00 0.00 ? 63 LYS A N    11 
ATOM 11839 C CA   . LYS A 1 63 ? -9.861  6.367   3.019   1.00 0.00 ? 63 LYS A CA   11 
ATOM 11840 C C    . LYS A 1 63 ? -10.409 6.668   4.409   1.00 0.00 ? 63 LYS A C    11 
ATOM 11841 O O    . LYS A 1 63 ? -10.818 7.793   4.696   1.00 0.00 ? 63 LYS A O    11 
ATOM 11842 C CB   . LYS A 1 63 ? -10.728 5.306   2.335   1.00 0.00 ? 63 LYS A CB   11 
ATOM 11843 C CG   . LYS A 1 63 ? -11.657 5.870   1.271   1.00 0.00 ? 63 LYS A CG   11 
ATOM 11844 C CD   . LYS A 1 63 ? -12.393 7.105   1.770   1.00 0.00 ? 63 LYS A CD   11 
ATOM 11845 C CE   . LYS A 1 63 ? -11.948 8.356   1.029   1.00 0.00 ? 63 LYS A CE   11 
ATOM 11846 N NZ   . LYS A 1 63 ? -11.650 9.478   1.961   1.00 0.00 ? 63 LYS A NZ   11 
ATOM 11847 H H    . LYS A 1 63 ? -8.261  4.997   2.832   1.00 0.00 ? 63 LYS A H    11 
ATOM 11848 H HA   . LYS A 1 63 ? -9.883  7.272   2.431   1.00 0.00 ? 63 LYS A HA   11 
ATOM 11849 H HB2  . LYS A 1 63 ? -10.082 4.579   1.868   1.00 0.00 ? 63 LYS A HB2  11 
ATOM 11850 H HB3  . LYS A 1 63 ? -11.330 4.811   3.083   1.00 0.00 ? 63 LYS A HB3  11 
ATOM 11851 H HG2  . LYS A 1 63 ? -11.075 6.137   0.403   1.00 0.00 ? 63 LYS A HG2  11 
ATOM 11852 H HG3  . LYS A 1 63 ? -12.383 5.117   1.003   1.00 0.00 ? 63 LYS A HG3  11 
ATOM 11853 H HD2  . LYS A 1 63 ? -13.453 6.966   1.617   1.00 0.00 ? 63 LYS A HD2  11 
ATOM 11854 H HD3  . LYS A 1 63 ? -12.192 7.232   2.823   1.00 0