data_1CQT
# 
_entry.id   1CQT 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CQT         
NDB   PD0092       
RCSB  RCSB009498   
WWPDB D_1000009498 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CQT 
_pdbx_database_status.recvd_initial_deposition_date   1999-08-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chasman, D.I.' 1 
'Cepek, K.'     2 
'Sharp, P.A.'   3 
'Pabo, C.O.'    4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
;
'Genes Dev.'            13 2650 2657 1999 GEDEEP US 0890-9369 2056 ? 10541551 10.1101/gad.13.20.2650         
1       'Crystal Structure of the Oct-1 POU Domain Bound to an Octamer Site: DNA Recognition with Tethered DNA-Binding Modules' 
'Cell(Cambridge,Mass.)' 77 21   ?    1994 CELLB5 US 0092-8674 0998 ? ?        '10.1016/0092-8674(94)90231-3' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chasman, D.' 1 
primary 'Cepek, K.'   2 
primary 'Sharp, P.A.' 3 
primary 'Pabo, C.O.'  4 
1       'Klemm, J.D.' 5 
1       'Rould, M.A.' 6 
1       'Aurora, R.'  7 
1       'Herr, W.'    8 
1       'Pabo, C.O.'  9 
# 
_cell.entry_id           1CQT 
_cell.length_a           93.722 
_cell.length_b           93.722 
_cell.length_c           152.651 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CQT 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     tetragonal 
_symmetry.Int_Tables_number                92 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn 
;DNA (5'-D(*TP*GP*TP*AP*TP*GP*CP*AP*AP*AP*TP*AP*AP*GP*G)-3')
;
4657.060  2 ? ? ?                                    ? 
2 polymer syn 
;DNA (5'-D(*AP*CP*CP*TP*TP*AP*TP*TP*TP*GP*CP*AP*TP*AP*C)-3')
;
4518.959  2 ? ? ?                                    ? 
3 polymer man 'POU DOMAIN, CLASS 2, TRANSCRIPTION FACTOR 1'                 18758.367 2 ? ? 'OCT-1 POU DOMAIN, RESIDUES 278-439' ? 
4 polymer man 'POU DOMAIN, CLASS 2, ASSOCIATING FACTOR 1'                   4874.669  2 ? ? 'OCA-B PEPTIDE, RESIDUES 1-44'       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'OCTAMER-BINDING TRANSCRIPTION FACTOR 1, OTF-1, NF-A1' 
4 'OCT-BINDING FACTOR, OCA-B, OBF-1, BOB1'               
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DT)(DG)(DT)(DA)(DT)(DG)(DC)(DA)(DA)(DA)(DT)(DA)(DA)(DG)(DG)' TGTATGCAAATAAGG M,O ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DC)(DT)(DT)(DA)(DT)(DT)(DT)(DG)(DC)(DA)(DT)(DA)(DC)' ACCTTATTTGCATAC N,P ? 
3 'polypeptide(L)'        no no 
;GSREEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENL
SSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKR
INP
;
;GSREEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMCKLKPLLEKWLNDAENL
SSDSSLSSPSALNSPGIEGLSRRRKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKR
INP
;
A,B ? 
4 'polypeptide(L)'        no no MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAA MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAA I,J ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DG  n 
1 3   DT  n 
1 4   DA  n 
1 5   DT  n 
1 6   DG  n 
1 7   DC  n 
1 8   DA  n 
1 9   DA  n 
1 10  DA  n 
1 11  DT  n 
1 12  DA  n 
1 13  DA  n 
1 14  DG  n 
1 15  DG  n 
2 1   DA  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DT  n 
2 6   DA  n 
2 7   DT  n 
2 8   DT  n 
2 9   DT  n 
2 10  DG  n 
2 11  DC  n 
2 12  DA  n 
2 13  DT  n 
2 14  DA  n 
2 15  DC  n 
3 1   GLY n 
3 2   SER n 
3 3   ARG n 
3 4   GLU n 
3 5   GLU n 
3 6   PRO n 
3 7   SER n 
3 8   ASP n 
3 9   LEU n 
3 10  GLU n 
3 11  GLU n 
3 12  LEU n 
3 13  GLU n 
3 14  GLN n 
3 15  PHE n 
3 16  ALA n 
3 17  LYS n 
3 18  THR n 
3 19  PHE n 
3 20  LYS n 
3 21  GLN n 
3 22  ARG n 
3 23  ARG n 
3 24  ILE n 
3 25  LYS n 
3 26  LEU n 
3 27  GLY n 
3 28  PHE n 
3 29  THR n 
3 30  GLN n 
3 31  GLY n 
3 32  ASP n 
3 33  VAL n 
3 34  GLY n 
3 35  LEU n 
3 36  ALA n 
3 37  MET n 
3 38  GLY n 
3 39  LYS n 
3 40  LEU n 
3 41  TYR n 
3 42  GLY n 
3 43  ASN n 
3 44  ASP n 
3 45  PHE n 
3 46  SER n 
3 47  GLN n 
3 48  THR n 
3 49  THR n 
3 50  ILE n 
3 51  SER n 
3 52  ARG n 
3 53  PHE n 
3 54  GLU n 
3 55  ALA n 
3 56  LEU n 
3 57  ASN n 
3 58  LEU n 
3 59  SER n 
3 60  PHE n 
3 61  LYS n 
3 62  ASN n 
3 63  MET n 
3 64  CYS n 
3 65  LYS n 
3 66  LEU n 
3 67  LYS n 
3 68  PRO n 
3 69  LEU n 
3 70  LEU n 
3 71  GLU n 
3 72  LYS n 
3 73  TRP n 
3 74  LEU n 
3 75  ASN n 
3 76  ASP n 
3 77  ALA n 
3 78  GLU n 
3 79  ASN n 
3 80  LEU n 
3 81  SER n 
3 82  SER n 
3 83  ASP n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  SER n 
3 88  SER n 
3 89  PRO n 
3 90  SER n 
3 91  ALA n 
3 92  LEU n 
3 93  ASN n 
3 94  SER n 
3 95  PRO n 
3 96  GLY n 
3 97  ILE n 
3 98  GLU n 
3 99  GLY n 
3 100 LEU n 
3 101 SER n 
3 102 ARG n 
3 103 ARG n 
3 104 ARG n 
3 105 LYS n 
3 106 LYS n 
3 107 ARG n 
3 108 THR n 
3 109 SER n 
3 110 ILE n 
3 111 GLU n 
3 112 THR n 
3 113 ASN n 
3 114 ILE n 
3 115 ARG n 
3 116 VAL n 
3 117 ALA n 
3 118 LEU n 
3 119 GLU n 
3 120 LYS n 
3 121 SER n 
3 122 PHE n 
3 123 LEU n 
3 124 GLU n 
3 125 ASN n 
3 126 GLN n 
3 127 LYS n 
3 128 PRO n 
3 129 THR n 
3 130 SER n 
3 131 GLU n 
3 132 GLU n 
3 133 ILE n 
3 134 THR n 
3 135 MET n 
3 136 ILE n 
3 137 ALA n 
3 138 ASP n 
3 139 GLN n 
3 140 LEU n 
3 141 ASN n 
3 142 MET n 
3 143 GLU n 
3 144 LYS n 
3 145 GLU n 
3 146 VAL n 
3 147 ILE n 
3 148 ARG n 
3 149 VAL n 
3 150 TRP n 
3 151 PHE n 
3 152 CYS n 
3 153 ASN n 
3 154 ARG n 
3 155 ARG n 
3 156 GLN n 
3 157 LYS n 
3 158 GLU n 
3 159 LYS n 
3 160 ARG n 
3 161 ILE n 
3 162 ASN n 
3 163 PRO n 
4 1   MET n 
4 2   LEU n 
4 3   TRP n 
4 4   GLN n 
4 5   LYS n 
4 6   PRO n 
4 7   THR n 
4 8   ALA n 
4 9   PRO n 
4 10  GLU n 
4 11  GLN n 
4 12  ALA n 
4 13  PRO n 
4 14  ALA n 
4 15  PRO n 
4 16  ALA n 
4 17  ARG n 
4 18  PRO n 
4 19  TYR n 
4 20  GLN n 
4 21  GLY n 
4 22  VAL n 
4 23  ARG n 
4 24  VAL n 
4 25  LYS n 
4 26  GLU n 
4 27  PRO n 
4 28  VAL n 
4 29  LYS n 
4 30  GLU n 
4 31  LEU n 
4 32  LEU n 
4 33  ARG n 
4 34  ARG n 
4 35  LYS n 
4 36  ARG n 
4 37  GLY n 
4 38  HIS n 
4 39  ALA n 
4 40  SER n 
4 41  SER n 
4 42  GLY n 
4 43  ALA n 
4 44  ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ?      ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? 
? ? ? ? ? ? ? PLASMID ? ? ? 'SEE REFERENCE 1' ? ? 
4 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? B-CELL ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? 
? ? ? ? ? ? ? PLASMID ? ? ? PGEX              ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PO2F1_HUMAN 3 ? ? P14859 ? 
2 UNP OBF1_HUMAN  4 ? ? Q16633 ? 
3 PDB 1CQT        1 ? ? 1CQT   ? 
4 PDB 1CQT        2 ? ? 1CQT   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CQT A 1 ? 162 ? P14859 277 ? 439 ? -2  160 
2 1 1CQT B 1 ? 163 ? P14859 277 ? 439 ? 498 661 
3 2 1CQT I 1 ? 44  ? Q16633 1   ? 44  ? 285 328 
4 2 1CQT J 1 ? 44  ? Q16633 1   ? 44  ? 785 828 
5 3 1CQT M 1 ? 15  ? 1CQT   201 ? 215 ? 201 215 
6 4 1CQT N 1 ? 15  ? 1CQT   216 ? 230 ? 216 230 
7 3 1CQT O 1 ? 15  ? 1CQT   701 ? 715 ? 701 715 
8 4 1CQT P 1 ? 15  ? 1CQT   716 ? 730 ? 716 730 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1CQT GLY A 1 ? UNP P14859 PRO 277 CONFLICT -2  1 
1 1CQT ARG A 3 ? UNP P14859 LEU 279 CONFLICT 0   2 
2 1CQT GLY B 1 ? UNP P14859 PRO 277 CONFLICT 498 3 
2 1CQT ARG B 3 ? UNP P14859 LEU 279 CONFLICT 500 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1CQT 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.85 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.50 
_exptl_crystal_grow.pdbx_details    'pH 7.50, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           103.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1997-09-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9669 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             0.9669 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CQT 
_reflns.observed_criterion_sigma_I   0.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.000 
_reflns.d_resolution_high            3.200 
_reflns.number_obs                   11803 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.0840000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.4500 
_reflns.B_iso_Wilson_estimate        41.70 
_reflns.pdbx_redundancy              14.80 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.20 
_reflns_shell.d_res_low              3.35 
_reflns_shell.percent_possible_all   97.8 
_reflns_shell.Rmerge_I_obs           0.3750000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        5.89 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1CQT 
_refine.ls_number_reflns_obs                     11708 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            3.20 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_R_factor_obs                          0.2640000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2640000 
_refine.ls_R_factor_R_free                       0.3260000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.000 
_refine.ls_number_reflns_R_free                  1139 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2466 
_refine_hist.pdbx_number_atoms_nucleic_acid   1183 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3649 
_refine_hist.d_res_high                       3.20 
_refine_hist.d_res_low                        30.0 
# 
_struct.entry_id                  1CQT 
_struct.title                     
'CRYSTAL STRUCTURE OF A TERNARY COMPLEX CONTAINING AN OCA-B PEPTIDE, THE OCT-1 POU DOMAIN, AND AN OCTAMER ELEMENT' 
_struct.pdbx_descriptor           
'POU DOMAIN, CLASS 2, TRANSCRIPTION FACTOR 1/POU DOMAIN, CLASS 2, ASSOCIATING FACTOR 1/DNA COMPLEX' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CQT 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            
'POU DOMAIN, PROTEIN-DNA COMPLEX, OCT1, OCA-B, PROTEIN-DNA INTERFACE, GENE REGULATION/DNA, GENE REGULATION-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP E 8   ? LEU E 26  ? ASP A 5   LEU A 23  1 ? 19 
HELX_P HELX_P2  2  THR E 29  ? MET E 37  ? THR A 26  MET A 34  1 ? 9  
HELX_P HELX_P3  3  MET E 37  ? GLY E 42  ? MET A 34  GLY A 39  1 ? 6  
HELX_P HELX_P4  4  SER E 46  ? ALA E 55  ? SER A 43  ALA A 52  1 ? 10 
HELX_P HELX_P5  5  SER E 59  ? LYS E 65  ? SER A 56  LYS A 62  1 ? 7  
HELX_P HELX_P6  6  LEU E 66  ? ASP E 76  ? LEU A 63  ASP A 73  1 ? 11 
HELX_P HELX_P7  7  GLU E 111 ? LEU E 123 ? GLU A 109 LEU A 121 1 ? 13 
HELX_P HELX_P8  8  THR E 129 ? ASP E 138 ? THR A 127 ASP A 136 1 ? 10 
HELX_P HELX_P9  9  GLN E 139 ? ASN E 141 ? GLN A 137 ASN A 139 5 ? 3  
HELX_P HELX_P10 10 GLU E 143 ? ASN E 162 ? GLU A 141 ASN A 160 1 ? 20 
HELX_P HELX_P11 12 GLU F 10  ? LEU F 26  ? GLU B 507 LEU B 523 1 ? 17 
HELX_P HELX_P12 13 GLN F 30  ? MET F 37  ? GLN B 527 MET B 534 1 ? 8  
HELX_P HELX_P13 14 SER F 46  ? LEU F 56  ? SER B 543 LEU B 553 1 ? 11 
HELX_P HELX_P14 15 SER F 59  ? ALA F 77  ? SER B 556 ALA B 574 1 ? 19 
HELX_P HELX_P15 16 GLU F 111 ? LEU F 123 ? GLU B 609 LEU B 621 1 ? 13 
HELX_P HELX_P16 17 LYS F 144 ? ASN F 162 ? LYS B 642 ASN B 660 1 ? 19 
HELX_P HELX_P17 11 PRO G 27  ? LYS G 35  ? PRO I 311 LYS I 319 1 ? 9  
HELX_P HELX_P18 18 PRO H 27  ? LYS H 35  ? PRO J 811 LYS J 819 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DG 2  N1 ? ? ? 1_555 B DC 15 N3 ? ? M DG 202 N DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2  hydrog ? ? A DG 2  N2 ? ? ? 1_555 B DC 15 O2 ? ? M DG 202 N DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3  hydrog ? ? A DG 2  O6 ? ? ? 1_555 B DC 15 N4 ? ? M DG 202 N DC 230 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 14 N1 ? ? M DT 203 N DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 14 N6 ? ? M DT 203 N DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6  hydrog ? ? A DA 4  N1 ? ? ? 1_555 B DT 13 N3 ? ? M DA 204 N DT 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog7  hydrog ? ? A DA 4  N6 ? ? ? 1_555 B DT 13 O4 ? ? M DA 204 N DT 228 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog8  hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 12 N1 ? ? M DT 205 N DA 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog9  hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 12 N6 ? ? M DT 205 N DA 227 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 11 N3 ? ? M DG 206 N DC 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 11 O2 ? ? M DG 206 N DC 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 11 N4 ? ? M DG 206 N DC 226 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13 hydrog ? ? A DC 7  N3 ? ? ? 1_555 B DG 10 N1 ? ? M DC 207 N DG 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog14 hydrog ? ? A DC 7  N4 ? ? ? 1_555 B DG 10 O6 ? ? M DC 207 N DG 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog15 hydrog ? ? A DC 7  O2 ? ? ? 1_555 B DG 10 N2 ? ? M DC 207 N DG 225 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog16 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 9  N3 ? ? M DA 208 N DT 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog17 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 9  O4 ? ? M DA 208 N DT 224 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog18 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 8  N3 ? ? M DA 209 N DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog19 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 8  O4 ? ? M DA 209 N DT 223 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 7  N3 ? ? M DA 210 N DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 7  O4 ? ? M DA 210 N DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22 hydrog ? ? A DT 11 N3 ? ? ? 1_555 B DA 6  N1 ? ? M DT 211 N DA 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23 hydrog ? ? A DT 11 O4 ? ? ? 1_555 B DA 6  N6 ? ? M DT 211 N DA 221 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24 hydrog ? ? A DA 12 N1 ? ? ? 1_555 B DT 5  N3 ? ? M DA 212 N DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog25 hydrog ? ? A DA 12 N6 ? ? ? 1_555 B DT 5  O4 ? ? M DA 212 N DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog26 hydrog ? ? A DA 13 N1 ? ? ? 1_555 B DT 4  N3 ? ? M DA 213 N DT 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27 hydrog ? ? A DA 13 N6 ? ? ? 1_555 B DT 4  O4 ? ? M DA 213 N DT 219 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28 hydrog ? ? A DG 14 N1 ? ? ? 1_555 B DC 3  N3 ? ? M DG 214 N DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog29 hydrog ? ? A DG 14 N2 ? ? ? 1_555 B DC 3  O2 ? ? M DG 214 N DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30 hydrog ? ? A DG 14 O6 ? ? ? 1_555 B DC 3  N4 ? ? M DG 214 N DC 218 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 2  N3 ? ? M DG 215 N DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 2  O2 ? ? M DG 215 N DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 2  N4 ? ? M DG 215 N DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34 hydrog ? ? C DG 2  N1 ? ? ? 1_555 D DC 15 O2 ? ? O DG 702 P DC 730 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog35 hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 14 N1 ? ? O DT 703 P DA 729 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36 hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 14 N6 ? ? O DT 703 P DA 729 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37 hydrog ? ? C DA 4  N1 ? ? ? 1_555 D DT 13 N3 ? ? O DA 704 P DT 728 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38 hydrog ? ? C DA 4  N6 ? ? ? 1_555 D DT 13 O4 ? ? O DA 704 P DT 728 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DC 11 N4 ? ? O DT 705 P DC 726 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR' ? ? 
hydrog40 hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 12 N1 ? ? O DT 705 P DA 727 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41 hydrog ? ? C DT 5  O4 ? ? ? 1_555 D DA 12 N6 ? ? O DT 705 P DA 727 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 11 N3 ? ? O DG 706 P DC 726 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 11 O2 ? ? O DG 706 P DC 726 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 11 N4 ? ? O DG 706 P DC 726 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45 hydrog ? ? C DC 7  N3 ? ? ? 1_555 D DG 10 N1 ? ? O DC 707 P DG 725 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46 hydrog ? ? C DC 7  N4 ? ? ? 1_555 D DG 10 O6 ? ? O DC 707 P DG 725 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47 hydrog ? ? C DC 7  O2 ? ? ? 1_555 D DG 10 N2 ? ? O DC 707 P DG 725 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 9  N3 ? ? O DA 708 P DT 724 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 9  O4 ? ? O DA 708 P DT 724 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 8  N3 ? ? O DA 709 P DT 723 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 8  O4 ? ? O DA 709 P DT 723 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 7  N3 ? ? O DA 710 P DT 722 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 7  O4 ? ? O DA 710 P DT 722 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog54 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 6  N1 ? ? O DT 711 P DA 721 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55 hydrog ? ? C DT 11 O4 ? ? ? 1_555 D DA 6  N6 ? ? O DT 711 P DA 721 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56 hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 4  O4 ? ? O DA 712 P DT 719 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog57 hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DT 5  N3 ? ? O DA 712 P DT 720 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58 hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DT 5  O4 ? ? O DA 712 P DT 720 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59 hydrog ? ? C DA 13 N1 ? ? ? 1_555 D DT 4  N3 ? ? O DA 713 P DT 719 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60 hydrog ? ? C DA 13 N6 ? ? ? 1_555 D DT 4  O4 ? ? O DA 713 P DT 719 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61 hydrog ? ? C DG 15 N1 ? ? ? 1_555 D DC 2  O2 ? ? O DG 715 P DC 717 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1CQT 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CQT 
_atom_sites.fract_transf_matrix[1][1]   0.010670 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010670 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006551 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    O "O5'" . DT  A 1 1   ? 19.563 51.022 33.093  1.00 75.43  ? 201 DT  M "O5'" 1 
ATOM 2    C "C5'" . DT  A 1 1   ? 19.686 51.314 31.697  1.00 72.19  ? 201 DT  M "C5'" 1 
ATOM 3    C "C4'" . DT  A 1 1   ? 18.501 50.825 30.897  1.00 61.50  ? 201 DT  M "C4'" 1 
ATOM 4    O "O4'" . DT  A 1 1   ? 18.726 51.109 29.499  1.00 56.56  ? 201 DT  M "O4'" 1 
ATOM 5    C "C3'" . DT  A 1 1   ? 18.257 49.321 30.970  1.00 55.83  ? 201 DT  M "C3'" 1 
ATOM 6    O "O3'" . DT  A 1 1   ? 16.869 49.071 30.754  1.00 62.40  ? 201 DT  M "O3'" 1 
ATOM 7    C "C2'" . DT  A 1 1   ? 19.066 48.792 29.803  1.00 53.32  ? 201 DT  M "C2'" 1 
ATOM 8    C "C1'" . DT  A 1 1   ? 18.957 49.909 28.776  1.00 49.73  ? 201 DT  M "C1'" 1 
ATOM 9    N N1    . DT  A 1 1   ? 20.193 50.099 28.003  1.00 43.13  ? 201 DT  M N1    1 
ATOM 10   C C2    . DT  A 1 1   ? 20.097 50.448 26.677  1.00 40.65  ? 201 DT  M C2    1 
ATOM 11   O O2    . DT  A 1 1   ? 19.032 50.625 26.101  1.00 35.48  ? 201 DT  M O2    1 
ATOM 12   N N3    . DT  A 1 1   ? 21.307 50.587 26.043  1.00 43.00  ? 201 DT  M N3    1 
ATOM 13   C C4    . DT  A 1 1   ? 22.568 50.419 26.589  1.00 42.91  ? 201 DT  M C4    1 
ATOM 14   O O4    . DT  A 1 1   ? 23.571 50.567 25.889  1.00 44.44  ? 201 DT  M O4    1 
ATOM 15   C C5    . DT  A 1 1   ? 22.587 50.066 27.987  1.00 41.06  ? 201 DT  M C5    1 
ATOM 16   C C7    . DT  A 1 1   ? 23.906 49.875 28.667  1.00 41.14  ? 201 DT  M C7    1 
ATOM 17   C C6    . DT  A 1 1   ? 21.415 49.926 28.614  1.00 39.59  ? 201 DT  M C6    1 
ATOM 18   P P     . DG  A 1 2   ? 16.290 47.583 30.917  1.00 68.51  ? 202 DG  M P     1 
ATOM 19   O OP1   . DG  A 1 2   ? 15.827 47.455 32.321  1.00 70.88  ? 202 DG  M OP1   1 
ATOM 20   O OP2   . DG  A 1 2   ? 17.309 46.633 30.393  1.00 68.53  ? 202 DG  M OP2   1 
ATOM 21   O "O5'" . DG  A 1 2   ? 15.016 47.579 29.958  1.00 65.54  ? 202 DG  M "O5'" 1 
ATOM 22   C "C5'" . DG  A 1 2   ? 14.783 46.493 29.038  1.00 62.12  ? 202 DG  M "C5'" 1 
ATOM 23   C "C4'" . DG  A 1 2   ? 14.368 47.010 27.678  1.00 54.26  ? 202 DG  M "C4'" 1 
ATOM 24   O "O4'" . DG  A 1 2   ? 15.438 47.766 27.060  1.00 46.13  ? 202 DG  M "O4'" 1 
ATOM 25   C "C3'" . DG  A 1 2   ? 14.057 45.882 26.700  1.00 48.28  ? 202 DG  M "C3'" 1 
ATOM 26   O "O3'" . DG  A 1 2   ? 12.952 46.208 25.859  1.00 49.15  ? 202 DG  M "O3'" 1 
ATOM 27   C "C2'" . DG  A 1 2   ? 15.342 45.708 25.912  1.00 42.21  ? 202 DG  M "C2'" 1 
ATOM 28   C "C1'" . DG  A 1 2   ? 15.925 47.108 25.898  1.00 39.06  ? 202 DG  M "C1'" 1 
ATOM 29   N N9    . DG  A 1 2   ? 17.382 47.108 25.975  1.00 35.21  ? 202 DG  M N9    1 
ATOM 30   C C8    . DG  A 1 2   ? 18.156 46.884 27.089  1.00 34.20  ? 202 DG  M C8    1 
ATOM 31   N N7    . DG  A 1 2   ? 19.436 46.973 26.849  1.00 33.90  ? 202 DG  M N7    1 
ATOM 32   C C5    . DG  A 1 2   ? 19.510 47.270 25.494  1.00 33.52  ? 202 DG  M C5    1 
ATOM 33   C C6    . DG  A 1 2   ? 20.637 47.497 24.661  1.00 32.09  ? 202 DG  M C6    1 
ATOM 34   O O6    . DG  A 1 2   ? 21.835 47.480 24.966  1.00 30.49  ? 202 DG  M O6    1 
ATOM 35   N N1    . DG  A 1 2   ? 20.257 47.769 23.351  1.00 27.43  ? 202 DG  M N1    1 
ATOM 36   C C2    . DG  A 1 2   ? 18.960 47.816 22.903  1.00 28.88  ? 202 DG  M C2    1 
ATOM 37   N N2    . DG  A 1 2   ? 18.784 48.096 21.610  1.00 33.19  ? 202 DG  M N2    1 
ATOM 38   N N3    . DG  A 1 2   ? 17.904 47.607 23.664  1.00 30.28  ? 202 DG  M N3    1 
ATOM 39   C C4    . DG  A 1 2   ? 18.249 47.345 24.940  1.00 33.39  ? 202 DG  M C4    1 
ATOM 40   P P     . DT  A 1 3   ? 12.281 45.049 24.977  1.00 56.76  ? 203 DT  M P     1 
ATOM 41   O OP1   . DT  A 1 3   ? 10.799 45.127 25.039  1.00 45.68  ? 203 DT  M OP1   1 
ATOM 42   O OP2   . DT  A 1 3   ? 12.963 43.792 25.381  1.00 63.18  ? 203 DT  M OP2   1 
ATOM 43   O "O5'" . DT  A 1 3   ? 12.784 45.403 23.510  1.00 57.41  ? 203 DT  M "O5'" 1 
ATOM 44   C "C5'" . DT  A 1 3   ? 14.162 45.738 23.288  1.00 53.91  ? 203 DT  M "C5'" 1 
ATOM 45   C "C4'" . DT  A 1 3   ? 14.409 45.975 21.818  1.00 52.34  ? 203 DT  M "C4'" 1 
ATOM 46   O "O4'" . DT  A 1 3   ? 15.822 46.218 21.643  1.00 48.00  ? 203 DT  M "O4'" 1 
ATOM 47   C "C3'" . DT  A 1 3   ? 14.088 44.772 20.936  1.00 47.91  ? 203 DT  M "C3'" 1 
ATOM 48   O "O3'" . DT  A 1 3   ? 13.675 45.235 19.642  1.00 54.60  ? 203 DT  M "O3'" 1 
ATOM 49   C "C2'" . DT  A 1 3   ? 15.399 44.006 20.922  1.00 44.73  ? 203 DT  M "C2'" 1 
ATOM 50   C "C1'" . DT  A 1 3   ? 16.451 45.100 21.039  1.00 41.89  ? 203 DT  M "C1'" 1 
ATOM 51   N N1    . DT  A 1 3   ? 17.613 44.755 21.874  1.00 39.55  ? 203 DT  M N1    1 
ATOM 52   C C2    . DT  A 1 3   ? 18.865 44.980 21.351  1.00 40.59  ? 203 DT  M C2    1 
ATOM 53   O O2    . DT  A 1 3   ? 19.044 45.448 20.238  1.00 46.28  ? 203 DT  M O2    1 
ATOM 54   N N3    . DT  A 1 3   ? 19.905 44.647 22.178  1.00 36.36  ? 203 DT  M N3    1 
ATOM 55   C C4    . DT  A 1 3   ? 19.821 44.133 23.451  1.00 36.97  ? 203 DT  M C4    1 
ATOM 56   O O4    . DT  A 1 3   ? 20.855 43.892 24.069  1.00 37.72  ? 203 DT  M O4    1 
ATOM 57   C C5    . DT  A 1 3   ? 18.472 43.923 23.944  1.00 35.48  ? 203 DT  M C5    1 
ATOM 58   C C7    . DT  A 1 3   ? 18.274 43.375 25.320  1.00 32.50  ? 203 DT  M C7    1 
ATOM 59   C C6    . DT  A 1 3   ? 17.450 44.235 23.139  1.00 35.43  ? 203 DT  M C6    1 
ATOM 60   P P     . DA  A 1 4   ? 13.366 44.176 18.471  1.00 63.02  ? 204 DA  M P     1 
ATOM 61   O OP1   . DA  A 1 4   ? 13.063 44.893 17.202  1.00 51.58  ? 204 DA  M OP1   1 
ATOM 62   O OP2   . DA  A 1 4   ? 12.404 43.168 18.988  1.00 59.42  ? 204 DA  M OP2   1 
ATOM 63   O "O5'" . DA  A 1 4   ? 14.774 43.459 18.304  1.00 56.95  ? 204 DA  M "O5'" 1 
ATOM 64   C "C5'" . DA  A 1 4   ? 15.110 42.785 17.094  1.00 49.65  ? 204 DA  M "C5'" 1 
ATOM 65   C "C4'" . DA  A 1 4   ? 16.177 43.561 16.362  1.00 43.50  ? 204 DA  M "C4'" 1 
ATOM 66   O "O4'" . DA  A 1 4   ? 17.226 43.951 17.276  1.00 42.02  ? 204 DA  M "O4'" 1 
ATOM 67   C "C3'" . DA  A 1 4   ? 16.853 42.710 15.298  1.00 45.02  ? 204 DA  M "C3'" 1 
ATOM 68   O "O3'" . DA  A 1 4   ? 17.227 43.530 14.194  1.00 52.41  ? 204 DA  M "O3'" 1 
ATOM 69   C "C2'" . DA  A 1 4   ? 18.035 42.110 16.036  1.00 42.27  ? 204 DA  M "C2'" 1 
ATOM 70   C "C1'" . DA  A 1 4   ? 18.392 43.161 17.075  1.00 38.55  ? 204 DA  M "C1'" 1 
ATOM 71   N N9    . DA  A 1 4   ? 18.738 42.570 18.367  1.00 37.04  ? 204 DA  M N9    1 
ATOM 72   C C8    . DA  A 1 4   ? 17.851 42.160 19.333  1.00 34.24  ? 204 DA  M C8    1 
ATOM 73   N N7    . DA  A 1 4   ? 18.426 41.693 20.413  1.00 34.24  ? 204 DA  M N7    1 
ATOM 74   C C5    . DA  A 1 4   ? 19.783 41.793 20.139  1.00 34.94  ? 204 DA  M C5    1 
ATOM 75   C C6    . DA  A 1 4   ? 20.926 41.452 20.888  1.00 35.07  ? 204 DA  M C6    1 
ATOM 76   N N6    . DA  A 1 4   ? 20.876 40.935 22.118  1.00 34.36  ? 204 DA  M N6    1 
ATOM 77   N N1    . DA  A 1 4   ? 22.135 41.662 20.323  1.00 35.49  ? 204 DA  M N1    1 
ATOM 78   C C2    . DA  A 1 4   ? 22.178 42.182 19.088  1.00 39.23  ? 204 DA  M C2    1 
ATOM 79   N N3    . DA  A 1 4   ? 21.175 42.547 18.285  1.00 37.65  ? 204 DA  M N3    1 
ATOM 80   C C4    . DA  A 1 4   ? 19.989 42.323 18.878  1.00 35.51  ? 204 DA  M C4    1 
ATOM 81   P P     . DT  A 1 5   ? 17.272 42.894 12.723  1.00 57.87  ? 205 DT  M P     1 
ATOM 82   O OP1   . DT  A 1 5   ? 17.094 43.981 11.725  1.00 59.62  ? 205 DT  M OP1   1 
ATOM 83   O OP2   . DT  A 1 5   ? 16.319 41.746 12.738  1.00 50.05  ? 205 DT  M OP2   1 
ATOM 84   O "O5'" . DT  A 1 5   ? 18.772 42.368 12.619  1.00 50.82  ? 205 DT  M "O5'" 1 
ATOM 85   C "C5'" . DT  A 1 5   ? 19.550 42.194 13.809  1.00 39.62  ? 205 DT  M "C5'" 1 
ATOM 86   C "C4'" . DT  A 1 5   ? 20.971 41.816 13.476  1.00 47.39  ? 205 DT  M "C4'" 1 
ATOM 87   O "O4'" . DT  A 1 5   ? 21.605 41.498 14.737  1.00 45.91  ? 205 DT  M "O4'" 1 
ATOM 88   C "C3'" . DT  A 1 5   ? 21.111 40.559 12.615  1.00 52.83  ? 205 DT  M "C3'" 1 
ATOM 89   O "O3'" . DT  A 1 5   ? 22.335 40.628 11.862  1.00 49.63  ? 205 DT  M "O3'" 1 
ATOM 90   C "C2'" . DT  A 1 5   ? 21.129 39.450 13.653  1.00 50.36  ? 205 DT  M "C2'" 1 
ATOM 91   C "C1'" . DT  A 1 5   ? 21.831 40.096 14.841  1.00 43.10  ? 205 DT  M "C1'" 1 
ATOM 92   N N1    . DT  A 1 5   ? 21.325 39.648 16.154  1.00 34.48  ? 205 DT  M N1    1 
ATOM 93   C C2    . DT  A 1 5   ? 22.238 39.387 17.151  1.00 30.54  ? 205 DT  M C2    1 
ATOM 94   O O2    . DT  A 1 5   ? 23.444 39.506 17.006  1.00 29.05  ? 205 DT  M O2    1 
ATOM 95   N N3    . DT  A 1 5   ? 21.686 38.977 18.336  1.00 28.11  ? 205 DT  M N3    1 
ATOM 96   C C4    . DT  A 1 5   ? 20.346 38.792 18.618  1.00 28.13  ? 205 DT  M C4    1 
ATOM 97   O O4    . DT  A 1 5   ? 20.005 38.394 19.728  1.00 27.44  ? 205 DT  M O4    1 
ATOM 98   C C5    . DT  A 1 5   ? 19.440 39.089 17.532  1.00 29.37  ? 205 DT  M C5    1 
ATOM 99   C C7    . DT  A 1 5   ? 17.967 38.931 17.750  1.00 25.20  ? 205 DT  M C7    1 
ATOM 100  C C6    . DT  A 1 5   ? 19.970 39.497 16.369  1.00 32.06  ? 205 DT  M C6    1 
ATOM 101  P P     . DG  A 1 6   ? 22.734 39.453 10.834  1.00 39.45  ? 206 DG  M P     1 
ATOM 102  O OP1   . DG  A 1 6   ? 22.849 40.084 9.493   1.00 44.11  ? 206 DG  M OP1   1 
ATOM 103  O OP2   . DG  A 1 6   ? 21.851 38.270 11.014  1.00 39.76  ? 206 DG  M OP2   1 
ATOM 104  O "O5'" . DG  A 1 6   ? 24.206 39.063 11.297  1.00 24.93  ? 206 DG  M "O5'" 1 
ATOM 105  C "C5'" . DG  A 1 6   ? 25.209 40.076 11.425  1.00 7.77   ? 206 DG  M "C5'" 1 
ATOM 106  C "C4'" . DG  A 1 6   ? 26.451 39.493 12.055  1.00 28.29  ? 206 DG  M "C4'" 1 
ATOM 107  O "O4'" . DG  A 1 6   ? 26.145 39.072 13.404  1.00 32.34  ? 206 DG  M "O4'" 1 
ATOM 108  C "C3'" . DG  A 1 6   ? 26.976 38.254 11.337  1.00 33.25  ? 206 DG  M "C3'" 1 
ATOM 109  O "O3'" . DG  A 1 6   ? 28.401 38.225 11.402  1.00 35.36  ? 206 DG  M "O3'" 1 
ATOM 110  C "C2'" . DG  A 1 6   ? 26.375 37.106 12.126  1.00 34.04  ? 206 DG  M "C2'" 1 
ATOM 111  C "C1'" . DG  A 1 6   ? 26.300 37.665 13.540  1.00 30.85  ? 206 DG  M "C1'" 1 
ATOM 112  N N9    . DG  A 1 6   ? 25.156 37.170 14.299  1.00 27.24  ? 206 DG  M N9    1 
ATOM 113  C C8    . DG  A 1 6   ? 23.847 37.122 13.880  1.00 23.07  ? 206 DG  M C8    1 
ATOM 114  N N7    . DG  A 1 6   ? 23.039 36.632 14.779  1.00 23.98  ? 206 DG  M N7    1 
ATOM 115  C C5    . DG  A 1 6   ? 23.862 36.335 15.856  1.00 26.45  ? 206 DG  M C5    1 
ATOM 116  C C6    . DG  A 1 6   ? 23.549 35.772 17.124  1.00 26.66  ? 206 DG  M C6    1 
ATOM 117  O O6    . DG  A 1 6   ? 22.452 35.383 17.542  1.00 23.35  ? 206 DG  M O6    1 
ATOM 118  N N1    . DG  A 1 6   ? 24.679 35.660 17.930  1.00 26.44  ? 206 DG  M N1    1 
ATOM 119  C C2    . DG  A 1 6   ? 25.953 36.016 17.551  1.00 29.71  ? 206 DG  M C2    1 
ATOM 120  N N2    . DG  A 1 6   ? 26.915 35.802 18.463  1.00 32.43  ? 206 DG  M N2    1 
ATOM 121  N N3    . DG  A 1 6   ? 26.262 36.532 16.367  1.00 27.45  ? 206 DG  M N3    1 
ATOM 122  C C4    . DG  A 1 6   ? 25.173 36.664 15.577  1.00 26.79  ? 206 DG  M C4    1 
ATOM 123  P P     . DC  A 1 7   ? 29.187 36.960 10.814  1.00 36.36  ? 207 DC  M P     1 
ATOM 124  O OP1   . DC  A 1 7   ? 30.604 37.369 10.623  1.00 36.32  ? 207 DC  M OP1   1 
ATOM 125  O OP2   . DC  A 1 7   ? 28.400 36.458 9.659   1.00 36.26  ? 207 DC  M OP2   1 
ATOM 126  O "O5'" . DC  A 1 7   ? 29.112 35.923 12.020  1.00 34.14  ? 207 DC  M "O5'" 1 
ATOM 127  C "C5'" . DC  A 1 7   ? 29.807 36.212 13.246  1.00 36.84  ? 207 DC  M "C5'" 1 
ATOM 128  C "C4'" . DC  A 1 7   ? 30.071 34.947 14.030  1.00 33.46  ? 207 DC  M "C4'" 1 
ATOM 129  O "O4'" . DC  A 1 7   ? 28.882 34.541 14.743  1.00 24.41  ? 207 DC  M "O4'" 1 
ATOM 130  C "C3'" . DC  A 1 7   ? 30.517 33.724 13.229  1.00 21.53  ? 207 DC  M "C3'" 1 
ATOM 131  O "O3'" . DC  A 1 7   ? 31.456 32.987 14.031  1.00 23.55  ? 207 DC  M "O3'" 1 
ATOM 132  C "C2'" . DC  A 1 7   ? 29.205 32.997 12.987  1.00 15.79  ? 207 DC  M "C2'" 1 
ATOM 133  C "C1'" . DC  A 1 7   ? 28.458 33.267 14.284  1.00 12.67  ? 207 DC  M "C1'" 1 
ATOM 134  N N1    . DC  A 1 7   ? 26.994 33.294 14.227  1.00 4.21   ? 207 DC  M N1    1 
ATOM 135  C C2    . DC  A 1 7   ? 26.293 33.013 15.402  1.00 3.33   ? 207 DC  M C2    1 
ATOM 136  O O2    . DC  A 1 7   ? 26.935 32.741 16.429  1.00 4.51   ? 207 DC  M O2    1 
ATOM 137  N N3    . DC  A 1 7   ? 24.945 33.043 15.396  1.00 2.00   ? 207 DC  M N3    1 
ATOM 138  C C4    . DC  A 1 7   ? 24.300 33.328 14.269  1.00 4.02   ? 207 DC  M C4    1 
ATOM 139  N N4    . DC  A 1 7   ? 22.969 33.315 14.300  1.00 7.65   ? 207 DC  M N4    1 
ATOM 140  C C5    . DC  A 1 7   ? 24.990 33.625 13.053  1.00 4.82   ? 207 DC  M C5    1 
ATOM 141  C C6    . DC  A 1 7   ? 26.326 33.593 13.075  1.00 2.00   ? 207 DC  M C6    1 
ATOM 142  P P     . DA  A 1 8   ? 31.513 31.379 13.956  1.00 34.10  ? 208 DA  M P     1 
ATOM 143  O OP1   . DA  A 1 8   ? 32.709 30.933 14.729  1.00 29.01  ? 208 DA  M OP1   1 
ATOM 144  O OP2   . DA  A 1 8   ? 31.345 30.956 12.540  1.00 31.70  ? 208 DA  M OP2   1 
ATOM 145  O "O5'" . DA  A 1 8   ? 30.219 30.901 14.758  1.00 39.46  ? 208 DA  M "O5'" 1 
ATOM 146  C "C5'" . DA  A 1 8   ? 30.196 30.917 16.204  1.00 37.48  ? 208 DA  M "C5'" 1 
ATOM 147  C "C4'" . DA  A 1 8   ? 29.427 29.730 16.737  1.00 22.09  ? 208 DA  M "C4'" 1 
ATOM 148  O "O4'" . DA  A 1 8   ? 28.008 29.893 16.514  1.00 12.71  ? 208 DA  M "O4'" 1 
ATOM 149  C "C3'" . DA  A 1 8   ? 29.799 28.414 16.057  1.00 20.49  ? 208 DA  M "C3'" 1 
ATOM 150  O "O3'" . DA  A 1 8   ? 29.538 27.336 16.952  1.00 20.02  ? 208 DA  M "O3'" 1 
ATOM 151  C "C2'" . DA  A 1 8   ? 28.759 28.317 14.960  1.00 18.54  ? 208 DA  M "C2'" 1 
ATOM 152  C "C1'" . DA  A 1 8   ? 27.559 28.796 15.745  1.00 12.22  ? 208 DA  M "C1'" 1 
ATOM 153  N N9    . DA  A 1 8   ? 26.420 29.237 14.956  1.00 16.93  ? 208 DA  M N9    1 
ATOM 154  C C8    . DA  A 1 8   ? 26.340 29.648 13.649  1.00 21.59  ? 208 DA  M C8    1 
ATOM 155  N N7    . DA  A 1 8   ? 25.116 29.935 13.268  1.00 22.47  ? 208 DA  M N7    1 
ATOM 156  C C5    . DA  A 1 8   ? 24.352 29.712 14.406  1.00 18.67  ? 208 DA  M C5    1 
ATOM 157  C C6    . DA  A 1 8   ? 22.987 29.831 14.661  1.00 18.38  ? 208 DA  M C6    1 
ATOM 158  N N6    . DA  A 1 8   ? 22.104 30.249 13.756  1.00 19.43  ? 208 DA  M N6    1 
ATOM 159  N N1    . DA  A 1 8   ? 22.548 29.507 15.896  1.00 20.67  ? 208 DA  M N1    1 
ATOM 160  C C2    . DA  A 1 8   ? 23.436 29.105 16.809  1.00 19.53  ? 208 DA  M C2    1 
ATOM 161  N N3    . DA  A 1 8   ? 24.748 28.964 16.691  1.00 20.01  ? 208 DA  M N3    1 
ATOM 162  C C4    . DA  A 1 8   ? 25.144 29.285 15.450  1.00 18.81  ? 208 DA  M C4    1 
ATOM 163  P P     . DA  A 1 9   ? 30.720 26.750 17.858  1.00 30.92  ? 209 DA  M P     1 
ATOM 164  O OP1   . DA  A 1 9   ? 31.885 27.679 17.824  1.00 44.78  ? 209 DA  M OP1   1 
ATOM 165  O OP2   . DA  A 1 9   ? 30.901 25.318 17.481  1.00 20.63  ? 209 DA  M OP2   1 
ATOM 166  O "O5'" . DA  A 1 9   ? 30.093 26.818 19.317  1.00 26.64  ? 209 DA  M "O5'" 1 
ATOM 167  C "C5'" . DA  A 1 9   ? 29.711 25.604 19.962  1.00 23.75  ? 209 DA  M "C5'" 1 
ATOM 168  C "C4'" . DA  A 1 9   ? 28.380 25.753 20.659  1.00 17.49  ? 209 DA  M "C4'" 1 
ATOM 169  O "O4'" . DA  A 1 9   ? 27.384 26.381 19.816  1.00 10.54  ? 209 DA  M "O4'" 1 
ATOM 170  C "C3'" . DA  A 1 9   ? 27.842 24.364 20.981  1.00 19.83  ? 209 DA  M "C3'" 1 
ATOM 171  O "O3'" . DA  A 1 9   ? 27.381 24.265 22.325  1.00 19.66  ? 209 DA  M "O3'" 1 
ATOM 172  C "C2'" . DA  A 1 9   ? 26.791 24.095 19.918  1.00 9.95   ? 209 DA  M "C2'" 1 
ATOM 173  C "C1'" . DA  A 1 9   ? 26.309 25.485 19.554  1.00 7.95   ? 209 DA  M "C1'" 1 
ATOM 174  N N9    . DA  A 1 9   ? 25.929 25.639 18.145  1.00 8.95   ? 209 DA  M N9    1 
ATOM 175  C C8    . DA  A 1 9   ? 26.744 25.869 17.066  1.00 11.06  ? 209 DA  M C8    1 
ATOM 176  N N7    . DA  A 1 9   ? 26.093 26.016 15.935  1.00 12.54  ? 209 DA  M N7    1 
ATOM 177  C C5    . DA  A 1 9   ? 24.761 25.859 16.294  1.00 10.37  ? 209 DA  M C5    1 
ATOM 178  C C6    . DA  A 1 9   ? 23.568 25.906 15.550  1.00 11.14  ? 209 DA  M C6    1 
ATOM 179  N N6    . DA  A 1 9   ? 23.515 26.126 14.237  1.00 8.34   ? 209 DA  M N6    1 
ATOM 180  N N1    . DA  A 1 9   ? 22.408 25.708 16.214  1.00 15.27  ? 209 DA  M N1    1 
ATOM 181  C C2    . DA  A 1 9   ? 22.455 25.468 17.533  1.00 17.15  ? 209 DA  M C2    1 
ATOM 182  N N3    . DA  A 1 9   ? 23.511 25.398 18.340  1.00 16.13  ? 209 DA  M N3    1 
ATOM 183  C C4    . DA  A 1 9   ? 24.650 25.611 17.652  1.00 12.15  ? 209 DA  M C4    1 
ATOM 184  P P     . DA  A 1 10  ? 27.329 22.821 23.010  1.00 17.13  ? 210 DA  M P     1 
ATOM 185  O OP1   . DA  A 1 10  ? 27.288 22.951 24.483  1.00 24.69  ? 210 DA  M OP1   1 
ATOM 186  O OP2   . DA  A 1 10  ? 28.392 22.010 22.360  1.00 16.07  ? 210 DA  M OP2   1 
ATOM 187  O "O5'" . DA  A 1 10  ? 25.898 22.300 22.565  1.00 12.78  ? 210 DA  M "O5'" 1 
ATOM 188  C "C5'" . DA  A 1 10  ? 24.984 23.202 21.939  1.00 8.83   ? 210 DA  M "C5'" 1 
ATOM 189  C "C4'" . DA  A 1 10  ? 23.565 22.777 22.199  1.00 15.49  ? 210 DA  M "C4'" 1 
ATOM 190  O "O4'" . DA  A 1 10  ? 22.872 23.029 20.959  1.00 17.37  ? 210 DA  M "O4'" 1 
ATOM 191  C "C3'" . DA  A 1 10  ? 23.368 21.286 22.470  1.00 15.34  ? 210 DA  M "C3'" 1 
ATOM 192  O "O3'" . DA  A 1 10  ? 22.177 21.134 23.260  1.00 25.74  ? 210 DA  M "O3'" 1 
ATOM 193  C "C2'" . DA  A 1 10  ? 23.294 20.697 21.073  1.00 15.43  ? 210 DA  M "C2'" 1 
ATOM 194  C "C1'" . DA  A 1 10  ? 22.694 21.819 20.236  1.00 16.73  ? 210 DA  M "C1'" 1 
ATOM 195  N N9    . DA  A 1 10  ? 23.310 22.006 18.922  1.00 13.88  ? 210 DA  M N9    1 
ATOM 196  C C8    . DA  A 1 10  ? 24.645 22.090 18.617  1.00 13.54  ? 210 DA  M C8    1 
ATOM 197  N N7    . DA  A 1 10  ? 24.884 22.292 17.343  1.00 13.45  ? 210 DA  M N7    1 
ATOM 198  C C5    . DA  A 1 10  ? 23.622 22.334 16.771  1.00 10.05  ? 210 DA  M C5    1 
ATOM 199  C C6    . DA  A 1 10  ? 23.191 22.511 15.447  1.00 9.40   ? 210 DA  M C6    1 
ATOM 200  N N6    . DA  A 1 10  ? 24.016 22.667 14.414  1.00 2.00   ? 210 DA  M N6    1 
ATOM 201  N N1    . DA  A 1 10  ? 21.861 22.511 15.217  1.00 15.77  ? 210 DA  M N1    1 
ATOM 202  C C2    . DA  A 1 10  ? 21.028 22.328 16.252  1.00 17.28  ? 210 DA  M C2    1 
ATOM 203  N N3    . DA  A 1 10  ? 21.313 22.139 17.537  1.00 15.92  ? 210 DA  M N3    1 
ATOM 204  C C4    . DA  A 1 10  ? 22.643 22.156 17.732  1.00 12.42  ? 210 DA  M C4    1 
ATOM 205  P P     . DT  A 1 11  ? 21.511 19.686 23.489  1.00 30.43  ? 211 DT  M P     1 
ATOM 206  O OP1   . DT  A 1 11  ? 21.141 19.575 24.919  1.00 33.48  ? 211 DT  M OP1   1 
ATOM 207  O OP2   . DT  A 1 11  ? 22.394 18.655 22.874  1.00 28.64  ? 211 DT  M OP2   1 
ATOM 208  O "O5'" . DT  A 1 11  ? 20.166 19.785 22.646  1.00 18.80  ? 211 DT  M "O5'" 1 
ATOM 209  C "C5'" . DT  A 1 11  ? 20.222 20.300 21.312  1.00 26.82  ? 211 DT  M "C5'" 1 
ATOM 210  C "C4'" . DT  A 1 11  ? 18.964 19.962 20.557  1.00 28.07  ? 211 DT  M "C4'" 1 
ATOM 211  O "O4'" . DT  A 1 11  ? 19.239 20.207 19.161  1.00 25.98  ? 211 DT  M "O4'" 1 
ATOM 212  C "C3'" . DT  A 1 11  ? 18.567 18.491 20.636  1.00 30.38  ? 211 DT  M "C3'" 1 
ATOM 213  O "O3'" . DT  A 1 11  ? 17.142 18.417 20.487  1.00 39.95  ? 211 DT  M "O3'" 1 
ATOM 214  C "C2'" . DT  A 1 11  ? 19.343 17.872 19.489  1.00 26.78  ? 211 DT  M "C2'" 1 
ATOM 215  C "C1'" . DT  A 1 11  ? 19.321 18.981 18.454  1.00 21.87  ? 211 DT  M "C1'" 1 
ATOM 216  N N1    . DT  A 1 11  ? 20.507 19.049 17.589  1.00 20.04  ? 211 DT  M N1    1 
ATOM 217  C C2    . DT  A 1 11  ? 20.292 19.335 16.260  1.00 21.16  ? 211 DT  M C2    1 
ATOM 218  O O2    . DT  A 1 11  ? 19.188 19.598 15.807  1.00 26.29  ? 211 DT  M O2    1 
ATOM 219  N N3    . DT  A 1 11  ? 21.421 19.324 15.480  1.00 15.61  ? 211 DT  M N3    1 
ATOM 220  C C4    . DT  A 1 11  ? 22.717 19.092 15.899  1.00 10.28  ? 211 DT  M C4    1 
ATOM 221  O O4    . DT  A 1 11  ? 23.636 19.089 15.085  1.00 5.21   ? 211 DT  M O4    1 
ATOM 222  C C5    . DT  A 1 11  ? 22.872 18.855 17.314  1.00 11.65  ? 211 DT  M C5    1 
ATOM 223  C C7    . DT  A 1 11  ? 24.250 18.660 17.858  1.00 14.23  ? 211 DT  M C7    1 
ATOM 224  C C6    . DT  A 1 11  ? 21.774 18.829 18.081  1.00 13.32  ? 211 DT  M C6    1 
ATOM 225  P P     . DA  A 1 12  ? 16.427 17.028 20.107  1.00 49.05  ? 212 DA  M P     1 
ATOM 226  O OP1   . DA  A 1 12  ? 15.064 17.088 20.716  1.00 30.61  ? 212 DA  M OP1   1 
ATOM 227  O OP2   . DA  A 1 12  ? 17.326 15.878 20.399  1.00 32.13  ? 212 DA  M OP2   1 
ATOM 228  O "O5'" . DA  A 1 12  ? 16.256 17.143 18.530  1.00 46.37  ? 212 DA  M "O5'" 1 
ATOM 229  C "C5'" . DA  A 1 12  ? 15.460 18.205 17.978  1.00 58.18  ? 212 DA  M "C5'" 1 
ATOM 230  C "C4'" . DA  A 1 12  ? 14.913 17.799 16.631  1.00 55.57  ? 212 DA  M "C4'" 1 
ATOM 231  O "O4'" . DA  A 1 12  ? 15.974 17.790 15.650  1.00 54.59  ? 212 DA  M "O4'" 1 
ATOM 232  C "C3'" . DA  A 1 12  ? 14.331 16.392 16.625  1.00 54.60  ? 212 DA  M "C3'" 1 
ATOM 233  O "O3'" . DA  A 1 12  ? 13.262 16.358 15.679  1.00 66.14  ? 212 DA  M "O3'" 1 
ATOM 234  C "C2'" . DA  A 1 12  ? 15.516 15.543 16.197  1.00 55.63  ? 212 DA  M "C2'" 1 
ATOM 235  C "C1'" . DA  A 1 12  ? 16.243 16.463 15.226  1.00 51.80  ? 212 DA  M "C1'" 1 
ATOM 236  N N9    . DA  A 1 12  ? 17.697 16.309 15.174  1.00 47.54  ? 212 DA  M N9    1 
ATOM 237  C C8    . DA  A 1 12  ? 18.566 15.931 16.168  1.00 46.87  ? 212 DA  M C8    1 
ATOM 238  N N7    . DA  A 1 12  ? 19.820 15.900 15.785  1.00 44.91  ? 212 DA  M N7    1 
ATOM 239  C C5    . DA  A 1 12  ? 19.771 16.280 14.451  1.00 43.16  ? 212 DA  M C5    1 
ATOM 240  C C6    . DA  A 1 12  ? 20.765 16.435 13.472  1.00 43.06  ? 212 DA  M C6    1 
ATOM 241  N N6    . DA  A 1 12  ? 22.060 16.212 13.689  1.00 45.46  ? 212 DA  M N6    1 
ATOM 242  N N1    . DA  A 1 12  ? 20.380 16.830 12.241  1.00 43.16  ? 212 DA  M N1    1 
ATOM 243  C C2    . DA  A 1 12  ? 19.082 17.046 12.017  1.00 44.47  ? 212 DA  M C2    1 
ATOM 244  N N3    . DA  A 1 12  ? 18.054 16.930 12.852  1.00 43.87  ? 212 DA  M N3    1 
ATOM 245  C C4    . DA  A 1 12  ? 18.471 16.538 14.066  1.00 43.16  ? 212 DA  M C4    1 
ATOM 246  P P     . DA  A 1 13  ? 12.582 14.957 15.293  1.00 77.12  ? 213 DA  M P     1 
ATOM 247  O OP1   . DA  A 1 13  ? 11.209 15.272 14.822  1.00 75.53  ? 213 DA  M OP1   1 
ATOM 248  O OP2   . DA  A 1 13  ? 12.771 14.018 16.428  1.00 75.12  ? 213 DA  M OP2   1 
ATOM 249  O "O5'" . DA  A 1 13  ? 13.466 14.428 14.075  1.00 75.61  ? 213 DA  M "O5'" 1 
ATOM 250  C "C5'" . DA  A 1 13  ? 13.480 15.110 12.802  1.00 71.09  ? 213 DA  M "C5'" 1 
ATOM 251  C "C4'" . DA  A 1 13  ? 14.104 14.228 11.743  1.00 65.11  ? 213 DA  M "C4'" 1 
ATOM 252  O "O4'" . DA  A 1 13  ? 15.542 14.180 11.895  1.00 57.92  ? 213 DA  M "O4'" 1 
ATOM 253  C "C3'" . DA  A 1 13  ? 13.645 12.770 11.780  1.00 61.62  ? 213 DA  M "C3'" 1 
ATOM 254  O "O3'" . DA  A 1 13  ? 13.689 12.220 10.459  1.00 66.03  ? 213 DA  M "O3'" 1 
ATOM 255  C "C2'" . DA  A 1 13  ? 14.723 12.104 12.614  1.00 56.71  ? 213 DA  M "C2'" 1 
ATOM 256  C "C1'" . DA  A 1 13  ? 15.938 12.828 12.071  1.00 50.82  ? 213 DA  M "C1'" 1 
ATOM 257  N N9    . DA  A 1 13  ? 17.137 12.809 12.900  1.00 42.83  ? 213 DA  M N9    1 
ATOM 258  C C8    . DA  A 1 13  ? 17.316 12.622 14.249  1.00 37.07  ? 213 DA  M C8    1 
ATOM 259  N N7    . DA  A 1 13  ? 18.571 12.660 14.622  1.00 32.63  ? 213 DA  M N7    1 
ATOM 260  C C5    . DA  A 1 13  ? 19.261 12.893 13.441  1.00 35.14  ? 213 DA  M C5    1 
ATOM 261  C C6    . DA  A 1 13  ? 20.626 13.042 13.148  1.00 36.48  ? 213 DA  M C6    1 
ATOM 262  N N6    . DA  A 1 13  ? 21.594 12.962 14.062  1.00 34.47  ? 213 DA  M N6    1 
ATOM 263  N N1    . DA  A 1 13  ? 20.971 13.274 11.862  1.00 34.60  ? 213 DA  M N1    1 
ATOM 264  C C2    . DA  A 1 13  ? 20.006 13.339 10.938  1.00 35.43  ? 213 DA  M C2    1 
ATOM 265  N N3    . DA  A 1 13  ? 18.693 13.208 11.087  1.00 37.32  ? 213 DA  M N3    1 
ATOM 266  C C4    . DA  A 1 13  ? 18.390 12.988 12.376  1.00 37.55  ? 213 DA  M C4    1 
ATOM 267  P P     . DG  A 1 14  ? 13.073 10.762 10.180  1.00 68.50  ? 214 DG  M P     1 
ATOM 268  O OP1   . DG  A 1 14  ? 11.794 10.956 9.445   1.00 71.71  ? 214 DG  M OP1   1 
ATOM 269  O OP2   . DG  A 1 14  ? 13.090 9.979  11.440  1.00 69.81  ? 214 DG  M OP2   1 
ATOM 270  O "O5'" . DG  A 1 14  ? 14.108 10.090 9.179   1.00 63.73  ? 214 DG  M "O5'" 1 
ATOM 271  C "C5'" . DG  A 1 14  ? 14.327 10.643 7.872   1.00 62.40  ? 214 DG  M "C5'" 1 
ATOM 272  C "C4'" . DG  A 1 14  ? 15.563 10.030 7.260   1.00 59.31  ? 214 DG  M "C4'" 1 
ATOM 273  O "O4'" . DG  A 1 14  ? 16.720 10.381 8.058   1.00 59.02  ? 214 DG  M "O4'" 1 
ATOM 274  C "C3'" . DG  A 1 14  ? 15.537 8.503  7.219   1.00 58.63  ? 214 DG  M "C3'" 1 
ATOM 275  O "O3'" . DG  A 1 14  ? 16.202 8.059  6.035   1.00 61.77  ? 214 DG  M "O3'" 1 
ATOM 276  C "C2'" . DG  A 1 14  ? 16.333 8.112  8.449   1.00 57.69  ? 214 DG  M "C2'" 1 
ATOM 277  C "C1'" . DG  A 1 14  ? 17.395 9.195  8.448   1.00 54.07  ? 214 DG  M "C1'" 1 
ATOM 278  N N9    . DG  A 1 14  ? 18.048 9.439  9.729   1.00 50.03  ? 214 DG  M N9    1 
ATOM 279  C C8    . DG  A 1 14  ? 17.460 9.533  10.967  1.00 46.33  ? 214 DG  M C8    1 
ATOM 280  N N7    . DG  A 1 14  ? 18.322 9.732  11.927  1.00 46.09  ? 214 DG  M N7    1 
ATOM 281  C C5    . DG  A 1 14  ? 19.551 9.778  11.284  1.00 44.34  ? 214 DG  M C5    1 
ATOM 282  C C6    . DG  A 1 14  ? 20.855 9.968  11.806  1.00 40.53  ? 214 DG  M C6    1 
ATOM 283  O O6    . DG  A 1 14  ? 21.188 10.113 12.986  1.00 43.32  ? 214 DG  M O6    1 
ATOM 284  N N1    . DG  A 1 14  ? 21.819 9.967  10.802  1.00 37.99  ? 214 DG  M N1    1 
ATOM 285  C C2    . DG  A 1 14  ? 21.561 9.789  9.464   1.00 41.94  ? 214 DG  M C2    1 
ATOM 286  N N2    . DG  A 1 14  ? 22.620 9.812  8.635   1.00 39.44  ? 214 DG  M N2    1 
ATOM 287  N N3    . DG  A 1 14  ? 20.350 9.598  8.965   1.00 44.29  ? 214 DG  M N3    1 
ATOM 288  C C4    . DG  A 1 14  ? 19.400 9.607  9.926   1.00 46.77  ? 214 DG  M C4    1 
ATOM 289  P P     . DG  A 1 15  ? 16.151 6.508  5.622   1.00 68.00  ? 215 DG  M P     1 
ATOM 290  O OP1   . DG  A 1 15  ? 16.774 6.409  4.276   1.00 64.48  ? 215 DG  M OP1   1 
ATOM 291  O OP2   . DG  A 1 15  ? 14.769 5.999  5.841   1.00 64.61  ? 215 DG  M OP2   1 
ATOM 292  O "O5'" . DG  A 1 15  ? 17.109 5.786  6.670   1.00 65.04  ? 215 DG  M "O5'" 1 
ATOM 293  C "C5'" . DG  A 1 15  ? 18.215 6.488  7.260   1.00 62.06  ? 215 DG  M "C5'" 1 
ATOM 294  C "C4'" . DG  A 1 15  ? 19.361 6.588  6.280   1.00 60.75  ? 215 DG  M "C4'" 1 
ATOM 295  O "O4'" . DG  A 1 15  ? 20.453 7.226  6.972   1.00 58.04  ? 215 DG  M "O4'" 1 
ATOM 296  C "C3'" . DG  A 1 15  ? 19.929 5.239  5.853   1.00 59.96  ? 215 DG  M "C3'" 1 
ATOM 297  O "O3'" . DG  A 1 15  ? 20.833 5.417  4.759   1.00 60.79  ? 215 DG  M "O3'" 1 
ATOM 298  C "C2'" . DG  A 1 15  ? 20.793 4.874  7.045   1.00 55.06  ? 215 DG  M "C2'" 1 
ATOM 299  C "C1'" . DG  A 1 15  ? 21.277 6.226  7.560   1.00 52.35  ? 215 DG  M "C1'" 1 
ATOM 300  N N9    . DG  A 1 15  ? 21.117 6.344  9.003   1.00 45.68  ? 215 DG  M N9    1 
ATOM 301  C C8    . DG  A 1 15  ? 19.934 6.316  9.703   1.00 42.42  ? 215 DG  M C8    1 
ATOM 302  N N7    . DG  A 1 15  ? 20.097 6.462  10.988  1.00 41.47  ? 215 DG  M N7    1 
ATOM 303  C C5    . DG  A 1 15  ? 21.471 6.586  11.145  1.00 42.74  ? 215 DG  M C5    1 
ATOM 304  C C6    . DG  A 1 15  ? 22.244 6.761  12.316  1.00 42.59  ? 215 DG  M C6    1 
ATOM 305  O O6    . DG  A 1 15  ? 21.848 6.848  13.486  1.00 42.65  ? 215 DG  M O6    1 
ATOM 306  N N1    . DG  A 1 15  ? 23.605 6.835  12.024  1.00 41.10  ? 215 DG  M N1    1 
ATOM 307  C C2    . DG  A 1 15  ? 24.151 6.758  10.762  1.00 40.92  ? 215 DG  M C2    1 
ATOM 308  N N2    . DG  A 1 15  ? 25.490 6.857  10.677  1.00 38.64  ? 215 DG  M N2    1 
ATOM 309  N N3    . DG  A 1 15  ? 23.436 6.596  9.661   1.00 40.73  ? 215 DG  M N3    1 
ATOM 310  C C4    . DG  A 1 15  ? 22.115 6.516  9.927   1.00 42.89  ? 215 DG  M C4    1 
ATOM 311  O "O5'" . DA  B 2 1   ? 27.602 3.937  22.093  1.00 65.09  ? 216 DA  N "O5'" 1 
ATOM 312  C "C5'" . DA  B 2 1   ? 29.012 3.976  21.866  1.00 63.99  ? 216 DA  N "C5'" 1 
ATOM 313  C "C4'" . DA  B 2 1   ? 29.376 4.838  20.679  1.00 58.35  ? 216 DA  N "C4'" 1 
ATOM 314  O "O4'" . DA  B 2 1   ? 28.524 4.479  19.563  1.00 41.75  ? 216 DA  N "O4'" 1 
ATOM 315  C "C3'" . DA  B 2 1   ? 29.202 6.349  20.877  1.00 56.15  ? 216 DA  N "C3'" 1 
ATOM 316  O "O3'" . DA  B 2 1   ? 30.260 7.055  20.198  1.00 57.74  ? 216 DA  N "O3'" 1 
ATOM 317  C "C2'" . DA  B 2 1   ? 27.847 6.606  20.247  1.00 44.17  ? 216 DA  N "C2'" 1 
ATOM 318  C "C1'" . DA  B 2 1   ? 27.933 5.663  19.063  1.00 36.30  ? 216 DA  N "C1'" 1 
ATOM 319  N N9    . DA  B 2 1   ? 26.643 5.331  18.474  1.00 28.23  ? 216 DA  N N9    1 
ATOM 320  C C8    . DA  B 2 1   ? 25.402 5.391  19.059  1.00 27.67  ? 216 DA  N C8    1 
ATOM 321  N N7    . DA  B 2 1   ? 24.416 5.129  18.236  1.00 21.63  ? 216 DA  N N7    1 
ATOM 322  C C5    . DA  B 2 1   ? 25.054 4.863  17.036  1.00 18.42  ? 216 DA  N C5    1 
ATOM 323  C C6    . DA  B 2 1   ? 24.562 4.550  15.771  1.00 15.34  ? 216 DA  N C6    1 
ATOM 324  N N6    . DA  B 2 1   ? 23.259 4.515  15.483  1.00 9.34   ? 216 DA  N N6    1 
ATOM 325  N N1    . DA  B 2 1   ? 25.464 4.304  14.797  1.00 18.04  ? 216 DA  N N1    1 
ATOM 326  C C2    . DA  B 2 1   ? 26.775 4.416  15.084  1.00 17.05  ? 216 DA  N C2    1 
ATOM 327  N N3    . DA  B 2 1   ? 27.359 4.744  16.230  1.00 12.80  ? 216 DA  N N3    1 
ATOM 328  C C4    . DA  B 2 1   ? 26.428 4.951  17.175  1.00 20.95  ? 216 DA  N C4    1 
ATOM 329  P P     . DC  B 2 2   ? 30.021 8.542  19.611  1.00 65.99  ? 217 DC  N P     1 
ATOM 330  O OP1   . DC  B 2 2   ? 31.267 9.316  19.855  1.00 69.55  ? 217 DC  N OP1   1 
ATOM 331  O OP2   . DC  B 2 2   ? 28.715 9.103  20.057  1.00 61.15  ? 217 DC  N OP2   1 
ATOM 332  O "O5'" . DC  B 2 2   ? 29.909 8.310  18.038  1.00 62.62  ? 217 DC  N "O5'" 1 
ATOM 333  C "C5'" . DC  B 2 2   ? 31.002 7.730  17.297  1.00 59.48  ? 217 DC  N "C5'" 1 
ATOM 334  C "C4'" . DC  B 2 2   ? 30.979 8.209  15.863  1.00 50.46  ? 217 DC  N "C4'" 1 
ATOM 335  O "O4'" . DC  B 2 2   ? 29.902 7.552  15.145  1.00 39.57  ? 217 DC  N "O4'" 1 
ATOM 336  C "C3'" . DC  B 2 2   ? 30.742 9.715  15.731  1.00 48.67  ? 217 DC  N "C3'" 1 
ATOM 337  O "O3'" . DC  B 2 2   ? 31.582 10.328 14.746  1.00 42.38  ? 217 DC  N "O3'" 1 
ATOM 338  C "C2'" . DC  B 2 2   ? 29.289 9.811  15.312  1.00 39.61  ? 217 DC  N "C2'" 1 
ATOM 339  C "C1'" . DC  B 2 2   ? 29.039 8.515  14.558  1.00 33.70  ? 217 DC  N "C1'" 1 
ATOM 340  N N1    . DC  B 2 2   ? 27.649 8.097  14.791  1.00 27.71  ? 217 DC  N N1    1 
ATOM 341  C C2    . DC  B 2 2   ? 26.925 7.446  13.779  1.00 23.72  ? 217 DC  N C2    1 
ATOM 342  O O2    . DC  B 2 2   ? 27.506 7.109  12.732  1.00 20.87  ? 217 DC  N O2    1 
ATOM 343  N N3    . DC  B 2 2   ? 25.608 7.195  13.979  1.00 20.95  ? 217 DC  N N3    1 
ATOM 344  C C4    . DC  B 2 2   ? 25.029 7.540  15.135  1.00 21.80  ? 217 DC  N C4    1 
ATOM 345  N N4    . DC  B 2 2   ? 23.726 7.310  15.289  1.00 23.07  ? 217 DC  N N4    1 
ATOM 346  C C5    . DC  B 2 2   ? 25.758 8.144  16.192  1.00 23.29  ? 217 DC  N C5    1 
ATOM 347  C C6    . DC  B 2 2   ? 27.051 8.396  15.983  1.00 25.42  ? 217 DC  N C6    1 
ATOM 348  P P     . DC  B 2 3   ? 31.166 11.754 14.123  1.00 34.60  ? 218 DC  N P     1 
ATOM 349  O OP1   . DC  B 2 3   ? 32.429 12.470 13.783  1.00 33.10  ? 218 DC  N OP1   1 
ATOM 350  O OP2   . DC  B 2 3   ? 30.174 12.402 15.020  1.00 20.82  ? 218 DC  N OP2   1 
ATOM 351  O "O5'" . DC  B 2 3   ? 30.402 11.354 12.781  1.00 28.08  ? 218 DC  N "O5'" 1 
ATOM 352  C "C5'" . DC  B 2 3   ? 31.060 10.551 11.781  1.00 33.81  ? 218 DC  N "C5'" 1 
ATOM 353  C "C4'" . DC  B 2 3   ? 30.383 10.715 10.441  1.00 30.33  ? 218 DC  N "C4'" 1 
ATOM 354  O "O4'" . DC  B 2 3   ? 29.102 10.043 10.487  1.00 29.94  ? 218 DC  N "O4'" 1 
ATOM 355  C "C3'" . DC  B 2 3   ? 30.102 12.171 10.076  1.00 36.70  ? 218 DC  N "C3'" 1 
ATOM 356  O "O3'" . DC  B 2 3   ? 30.483 12.491 8.740   1.00 37.55  ? 218 DC  N "O3'" 1 
ATOM 357  C "C2'" . DC  B 2 3   ? 28.601 12.320 10.237  1.00 34.28  ? 218 DC  N "C2'" 1 
ATOM 358  C "C1'" . DC  B 2 3   ? 28.045 10.912 10.121  1.00 27.81  ? 218 DC  N "C1'" 1 
ATOM 359  N N1    . DC  B 2 3   ? 26.976 10.751 11.113  1.00 25.06  ? 218 DC  N N1    1 
ATOM 360  C C2    . DC  B 2 3   ? 25.666 10.510 10.685  1.00 24.40  ? 218 DC  N C2    1 
ATOM 361  O O2    . DC  B 2 3   ? 25.445 10.369 9.473   1.00 22.24  ? 218 DC  N O2    1 
ATOM 362  N N3    . DC  B 2 3   ? 24.675 10.443 11.608  1.00 24.52  ? 218 DC  N N3    1 
ATOM 363  C C4    . DC  B 2 3   ? 24.960 10.603 12.906  1.00 24.81  ? 218 DC  N C4    1 
ATOM 364  N N4    . DC  B 2 3   ? 23.959 10.548 13.786  1.00 25.51  ? 218 DC  N N4    1 
ATOM 365  C C5    . DC  B 2 3   ? 26.289 10.826 13.364  1.00 25.16  ? 218 DC  N C5    1 
ATOM 366  C C6    . DC  B 2 3   ? 27.257 10.881 12.444  1.00 25.20  ? 218 DC  N C6    1 
ATOM 367  P P     . DT  B 2 4   ? 30.090 13.931 8.142   1.00 38.88  ? 219 DT  N P     1 
ATOM 368  O OP1   . DT  B 2 4   ? 30.953 14.160 6.946   1.00 27.93  ? 219 DT  N OP1   1 
ATOM 369  O OP2   . DT  B 2 4   ? 30.114 14.913 9.255   1.00 32.18  ? 219 DT  N OP2   1 
ATOM 370  O "O5'" . DT  B 2 4   ? 28.562 13.731 7.728   1.00 22.99  ? 219 DT  N "O5'" 1 
ATOM 371  C "C5'" . DT  B 2 4   ? 28.195 12.778 6.712   1.00 17.69  ? 219 DT  N "C5'" 1 
ATOM 372  C "C4'" . DT  B 2 4   ? 26.838 13.103 6.136   1.00 14.78  ? 219 DT  N "C4'" 1 
ATOM 373  O "O4'" . DT  B 2 4   ? 25.828 12.603 7.042   1.00 16.69  ? 219 DT  N "O4'" 1 
ATOM 374  C "C3'" . DT  B 2 4   ? 26.561 14.595 5.939   1.00 21.79  ? 219 DT  N "C3'" 1 
ATOM 375  O "O3'" . DT  B 2 4   ? 26.086 14.937 4.637   1.00 24.86  ? 219 DT  N "O3'" 1 
ATOM 376  C "C2'" . DT  B 2 4   ? 25.480 14.924 6.950   1.00 23.92  ? 219 DT  N "C2'" 1 
ATOM 377  C "C1'" . DT  B 2 4   ? 24.860 13.596 7.340   1.00 16.87  ? 219 DT  N "C1'" 1 
ATOM 378  N N1    . DT  B 2 4   ? 24.671 13.611 8.797   1.00 15.00  ? 219 DT  N N1    1 
ATOM 379  C C2    . DT  B 2 4   ? 23.403 13.505 9.325   1.00 16.40  ? 219 DT  N C2    1 
ATOM 380  O O2    . DT  B 2 4   ? 22.401 13.371 8.645   1.00 16.04  ? 219 DT  N O2    1 
ATOM 381  N N3    . DT  B 2 4   ? 23.350 13.581 10.693  1.00 16.46  ? 219 DT  N N3    1 
ATOM 382  C C4    . DT  B 2 4   ? 24.406 13.769 11.561  1.00 16.30  ? 219 DT  N C4    1 
ATOM 383  O O4    . DT  B 2 4   ? 24.194 13.819 12.770  1.00 16.52  ? 219 DT  N O4    1 
ATOM 384  C C5    . DT  B 2 4   ? 25.708 13.888 10.934  1.00 15.50  ? 219 DT  N C5    1 
ATOM 385  C C7    . DT  B 2 4   ? 26.911 14.153 11.783  1.00 16.22  ? 219 DT  N C7    1 
ATOM 386  C C6    . DT  B 2 4   ? 25.774 13.774 9.605   1.00 12.70  ? 219 DT  N C6    1 
ATOM 387  P P     . DT  B 2 5   ? 25.918 16.491 4.247   1.00 33.45  ? 220 DT  N P     1 
ATOM 388  O OP1   . DT  B 2 5   ? 26.158 16.606 2.784   1.00 36.59  ? 220 DT  N OP1   1 
ATOM 389  O OP2   . DT  B 2 5   ? 26.716 17.322 5.190   1.00 29.28  ? 220 DT  N OP2   1 
ATOM 390  O "O5'" . DT  B 2 5   ? 24.377 16.789 4.512   1.00 22.83  ? 220 DT  N "O5'" 1 
ATOM 391  C "C5'" . DT  B 2 5   ? 23.378 16.066 3.783   1.00 14.17  ? 220 DT  N "C5'" 1 
ATOM 392  C "C4'" . DT  B 2 5   ? 21.994 16.522 4.181   1.00 13.88  ? 220 DT  N "C4'" 1 
ATOM 393  O "O4'" . DT  B 2 5   ? 21.724 16.168 5.556   1.00 18.84  ? 220 DT  N "O4'" 1 
ATOM 394  C "C3'" . DT  B 2 5   ? 21.724 18.018 4.061   1.00 8.93   ? 220 DT  N "C3'" 1 
ATOM 395  O "O3'" . DT  B 2 5   ? 20.401 18.166 3.542   1.00 22.71  ? 220 DT  N "O3'" 1 
ATOM 396  C "C2'" . DT  B 2 5   ? 21.845 18.514 5.493   1.00 19.05  ? 220 DT  N "C2'" 1 
ATOM 397  C "C1'" . DT  B 2 5   ? 21.387 17.318 6.319   1.00 17.58  ? 220 DT  N "C1'" 1 
ATOM 398  N N1    . DT  B 2 5   ? 22.043 17.175 7.637   1.00 15.55  ? 220 DT  N N1    1 
ATOM 399  C C2    . DT  B 2 5   ? 21.266 17.003 8.764   1.00 14.17  ? 220 DT  N C2    1 
ATOM 400  O O2    . DT  B 2 5   ? 20.045 16.987 8.748   1.00 14.79  ? 220 DT  N O2    1 
ATOM 401  N N3    . DT  B 2 5   ? 21.976 16.849 9.926   1.00 12.23  ? 220 DT  N N3    1 
ATOM 402  C C4    . DT  B 2 5   ? 23.349 16.868 10.078  1.00 14.39  ? 220 DT  N C4    1 
ATOM 403  O O4    . DT  B 2 5   ? 23.841 16.734 11.197  1.00 16.77  ? 220 DT  N O4    1 
ATOM 404  C C5    . DT  B 2 5   ? 24.102 17.058 8.857   1.00 13.34  ? 220 DT  N C5    1 
ATOM 405  C C7    . DT  B 2 5   ? 25.597 17.089 8.919   1.00 12.17  ? 220 DT  N C7    1 
ATOM 406  C C6    . DT  B 2 5   ? 23.419 17.201 7.716   1.00 13.43  ? 220 DT  N C6    1 
ATOM 407  P P     . DA  B 2 6   ? 19.717 19.617 3.487   1.00 37.19  ? 221 DA  N P     1 
ATOM 408  O OP1   . DA  B 2 6   ? 18.535 19.530 2.582   1.00 33.07  ? 221 DA  N OP1   1 
ATOM 409  O OP2   . DA  B 2 6   ? 20.790 20.605 3.202   1.00 36.48  ? 221 DA  N OP2   1 
ATOM 410  O "O5'" . DA  B 2 6   ? 19.173 19.804 4.973   1.00 31.79  ? 221 DA  N "O5'" 1 
ATOM 411  C "C5'" . DA  B 2 6   ? 18.253 18.838 5.510   1.00 26.76  ? 221 DA  N "C5'" 1 
ATOM 412  C "C4'" . DA  B 2 6   ? 17.286 19.496 6.463   1.00 20.87  ? 221 DA  N "C4'" 1 
ATOM 413  O "O4'" . DA  B 2 6   ? 17.746 19.342 7.822   1.00 12.67  ? 221 DA  N "O4'" 1 
ATOM 414  C "C3'" . DA  B 2 6   ? 17.079 20.992 6.254   1.00 19.28  ? 221 DA  N "C3'" 1 
ATOM 415  O "O3'" . DA  B 2 6   ? 15.718 21.307 6.574   1.00 29.49  ? 221 DA  N "O3'" 1 
ATOM 416  C "C2'" . DA  B 2 6   ? 18.080 21.595 7.223   1.00 14.89  ? 221 DA  N "C2'" 1 
ATOM 417  C "C1'" . DA  B 2 6   ? 18.118 20.590 8.363   1.00 7.34   ? 221 DA  N "C1'" 1 
ATOM 418  N N9    . DA  B 2 6   ? 19.436 20.406 8.961   1.00 8.54   ? 221 DA  N N9    1 
ATOM 419  C C8    . DA  B 2 6   ? 20.656 20.296 8.341   1.00 5.93   ? 221 DA  N C8    1 
ATOM 420  N N7    . DA  B 2 6   ? 21.650 20.105 9.175   1.00 10.07  ? 221 DA  N N7    1 
ATOM 421  C C5    . DA  B 2 6   ? 21.040 20.094 10.426  1.00 12.91  ? 221 DA  N C5    1 
ATOM 422  C C6    . DA  B 2 6   ? 21.543 19.937 11.733  1.00 14.05  ? 221 DA  N C6    1 
ATOM 423  N N6    . DA  B 2 6   ? 22.838 19.761 12.011  1.00 14.89  ? 221 DA  N N6    1 
ATOM 424  N N1    . DA  B 2 6   ? 20.660 19.982 12.760  1.00 6.62   ? 221 DA  N N1    1 
ATOM 425  C C2    . DA  B 2 6   ? 19.368 20.181 12.483  1.00 5.85   ? 221 DA  N C2    1 
ATOM 426  N N3    . DA  B 2 6   ? 18.776 20.342 11.302  1.00 8.86   ? 221 DA  N N3    1 
ATOM 427  C C4    . DA  B 2 6   ? 19.676 20.286 10.303  1.00 11.01  ? 221 DA  N C4    1 
ATOM 428  P P     . DT  B 2 7   ? 15.256 22.839 6.737   1.00 39.07  ? 222 DT  N P     1 
ATOM 429  O OP1   . DT  B 2 7   ? 13.968 23.007 6.026   1.00 41.30  ? 222 DT  N OP1   1 
ATOM 430  O OP2   . DT  B 2 7   ? 16.387 23.772 6.460   1.00 33.29  ? 222 DT  N OP2   1 
ATOM 431  O "O5'" . DT  B 2 7   ? 14.944 22.934 8.288   1.00 32.27  ? 222 DT  N "O5'" 1 
ATOM 432  C "C5'" . DT  B 2 7   ? 15.928 22.508 9.223   1.00 23.43  ? 222 DT  N "C5'" 1 
ATOM 433  C "C4'" . DT  B 2 7   ? 15.429 22.747 10.622  1.00 24.76  ? 222 DT  N "C4'" 1 
ATOM 434  O "O4'" . DT  B 2 7   ? 16.527 22.449 11.509  1.00 26.46  ? 222 DT  N "O4'" 1 
ATOM 435  C "C3'" . DT  B 2 7   ? 15.053 24.199 10.902  1.00 26.51  ? 222 DT  N "C3'" 1 
ATOM 436  O "O3'" . DT  B 2 7   ? 14.056 24.195 11.935  1.00 34.80  ? 222 DT  N "O3'" 1 
ATOM 437  C "C2'" . DT  B 2 7   ? 16.379 24.800 11.334  1.00 25.52  ? 222 DT  N "C2'" 1 
ATOM 438  C "C1'" . DT  B 2 7   ? 17.058 23.644 12.054  1.00 22.28  ? 222 DT  N "C1'" 1 
ATOM 439  N N1    . DT  B 2 7   ? 18.524 23.565 11.933  1.00 19.36  ? 222 DT  N N1    1 
ATOM 440  C C2    . DT  B 2 7   ? 19.231 23.385 13.096  1.00 21.17  ? 222 DT  N C2    1 
ATOM 441  O O2    . DT  B 2 7   ? 18.694 23.281 14.187  1.00 25.78  ? 222 DT  N O2    1 
ATOM 442  N N3    . DT  B 2 7   ? 20.592 23.331 12.941  1.00 19.92  ? 222 DT  N N3    1 
ATOM 443  C C4    . DT  B 2 7   ? 21.303 23.436 11.763  1.00 21.13  ? 222 DT  N C4    1 
ATOM 444  O O4    . DT  B 2 7   ? 22.534 23.389 11.784  1.00 22.53  ? 222 DT  N O4    1 
ATOM 445  C C5    . DT  B 2 7   ? 20.496 23.610 10.575  1.00 19.08  ? 222 DT  N C5    1 
ATOM 446  C C7    . DT  B 2 7   ? 21.180 23.726 9.250   1.00 16.63  ? 222 DT  N C7    1 
ATOM 447  C C6    . DT  B 2 7   ? 19.163 23.664 10.716  1.00 17.89  ? 222 DT  N C6    1 
ATOM 448  P P     . DT  B 2 8   ? 13.511 25.575 12.560  1.00 40.21  ? 223 DT  N P     1 
ATOM 449  O OP1   . DT  B 2 8   ? 12.032 25.456 12.602  1.00 37.91  ? 223 DT  N OP1   1 
ATOM 450  O OP2   . DT  B 2 8   ? 14.142 26.739 11.888  1.00 37.67  ? 223 DT  N OP2   1 
ATOM 451  O "O5'" . DT  B 2 8   ? 13.984 25.503 14.077  1.00 32.44  ? 223 DT  N "O5'" 1 
ATOM 452  C "C5'" . DT  B 2 8   ? 13.572 24.394 14.894  1.00 27.51  ? 223 DT  N "C5'" 1 
ATOM 453  C "C4'" . DT  B 2 8   ? 14.366 24.368 16.178  1.00 38.36  ? 223 DT  N "C4'" 1 
ATOM 454  O "O4'" . DT  B 2 8   ? 15.773 24.390 15.838  1.00 38.57  ? 223 DT  N "O4'" 1 
ATOM 455  C "C3'" . DT  B 2 8   ? 14.142 25.558 17.112  1.00 41.07  ? 223 DT  N "C3'" 1 
ATOM 456  O "O3'" . DT  B 2 8   ? 14.353 25.101 18.456  1.00 43.57  ? 223 DT  N "O3'" 1 
ATOM 457  C "C2'" . DT  B 2 8   ? 15.248 26.515 16.698  1.00 40.61  ? 223 DT  N "C2'" 1 
ATOM 458  C "C1'" . DT  B 2 8   ? 16.377 25.534 16.421  1.00 37.62  ? 223 DT  N "C1'" 1 
ATOM 459  N N1    . DT  B 2 8   ? 17.486 25.959 15.548  1.00 35.03  ? 223 DT  N N1    1 
ATOM 460  C C2    . DT  B 2 8   ? 18.756 25.783 16.051  1.00 32.24  ? 223 DT  N C2    1 
ATOM 461  O O2    . DT  B 2 8   ? 18.977 25.314 17.154  1.00 27.44  ? 223 DT  N O2    1 
ATOM 462  N N3    . DT  B 2 8   ? 19.765 26.169 15.208  1.00 32.03  ? 223 DT  N N3    1 
ATOM 463  C C4    . DT  B 2 8   ? 19.633 26.693 13.936  1.00 34.09  ? 223 DT  N C4    1 
ATOM 464  O O4    . DT  B 2 8   ? 20.637 26.983 13.289  1.00 34.14  ? 223 DT  N O4    1 
ATOM 465  C C5    . DT  B 2 8   ? 18.270 26.852 13.468  1.00 33.88  ? 223 DT  N C5    1 
ATOM 466  C C7    . DT  B 2 8   ? 18.036 27.400 12.095  1.00 34.65  ? 223 DT  N C7    1 
ATOM 467  C C6    . DT  B 2 8   ? 17.275 26.490 14.291  1.00 33.25  ? 223 DT  N C6    1 
ATOM 468  P P     . DT  B 2 9   ? 13.403 25.603 19.655  1.00 47.20  ? 224 DT  N P     1 
ATOM 469  O OP1   . DT  B 2 9   ? 14.013 25.049 20.887  1.00 31.19  ? 224 DT  N OP1   1 
ATOM 470  O OP2   . DT  B 2 9   ? 11.978 25.327 19.352  1.00 48.80  ? 224 DT  N OP2   1 
ATOM 471  O "O5'" . DT  B 2 9   ? 13.621 27.179 19.669  1.00 42.54  ? 224 DT  N "O5'" 1 
ATOM 472  C "C5'" . DT  B 2 9   ? 14.885 27.719 19.257  1.00 38.12  ? 224 DT  N "C5'" 1 
ATOM 473  C "C4'" . DT  B 2 9   ? 15.935 27.456 20.312  1.00 27.66  ? 224 DT  N "C4'" 1 
ATOM 474  O "O4'" . DT  B 2 9   ? 17.192 27.184 19.659  1.00 27.85  ? 224 DT  N "O4'" 1 
ATOM 475  C "C3'" . DT  B 2 9   ? 16.201 28.657 21.212  1.00 32.20  ? 224 DT  N "C3'" 1 
ATOM 476  O "O3'" . DT  B 2 9   ? 16.637 28.252 22.508  1.00 34.28  ? 224 DT  N "O3'" 1 
ATOM 477  C "C2'" . DT  B 2 9   ? 17.306 29.399 20.483  1.00 26.89  ? 224 DT  N "C2'" 1 
ATOM 478  C "C1'" . DT  B 2 9   ? 18.070 28.299 19.764  1.00 22.66  ? 224 DT  N "C1'" 1 
ATOM 479  N N1    . DT  B 2 9   ? 18.417 28.705 18.395  1.00 19.66  ? 224 DT  N N1    1 
ATOM 480  C C2    . DT  B 2 9   ? 19.737 28.772 18.018  1.00 14.82  ? 224 DT  N C2    1 
ATOM 481  O O2    . DT  B 2 9   ? 20.663 28.506 18.764  1.00 12.92  ? 224 DT  N O2    1 
ATOM 482  N N3    . DT  B 2 9   ? 19.937 29.171 16.723  1.00 15.31  ? 224 DT  N N3    1 
ATOM 483  C C4    . DT  B 2 9   ? 18.973 29.514 15.793  1.00 22.10  ? 224 DT  N C4    1 
ATOM 484  O O4    . DT  B 2 9   ? 19.304 29.887 14.669  1.00 24.07  ? 224 DT  N O4    1 
ATOM 485  C C5    . DT  B 2 9   ? 17.610 29.407 16.254  1.00 23.93  ? 224 DT  N C5    1 
ATOM 486  C C7    . DT  B 2 9   ? 16.497 29.737 15.310  1.00 23.23  ? 224 DT  N C7    1 
ATOM 487  C C6    . DT  B 2 9   ? 17.403 29.015 17.515  1.00 21.93  ? 224 DT  N C6    1 
ATOM 488  P P     . DG  B 2 10  ? 17.068 29.375 23.571  1.00 40.53  ? 225 DG  N P     1 
ATOM 489  O OP1   . DG  B 2 10  ? 17.086 28.753 24.923  1.00 41.52  ? 225 DG  N OP1   1 
ATOM 490  O OP2   . DG  B 2 10  ? 16.222 30.562 23.319  1.00 44.19  ? 225 DG  N OP2   1 
ATOM 491  O "O5'" . DG  B 2 10  ? 18.551 29.761 23.147  1.00 30.74  ? 225 DG  N "O5'" 1 
ATOM 492  C "C5'" . DG  B 2 10  ? 19.663 29.015 23.662  1.00 35.42  ? 225 DG  N "C5'" 1 
ATOM 493  C "C4'" . DG  B 2 10  ? 20.891 29.892 23.723  1.00 37.81  ? 225 DG  N "C4'" 1 
ATOM 494  O "O4'" . DG  B 2 10  ? 21.341 30.218 22.389  1.00 36.55  ? 225 DG  N "O4'" 1 
ATOM 495  C "C3'" . DG  B 2 10  ? 20.649 31.235 24.403  1.00 39.94  ? 225 DG  N "C3'" 1 
ATOM 496  O "O3'" . DG  B 2 10  ? 21.904 31.697 24.916  1.00 50.85  ? 225 DG  N "O3'" 1 
ATOM 497  C "C2'" . DG  B 2 10  ? 20.240 32.107 23.230  1.00 36.40  ? 225 DG  N "C2'" 1 
ATOM 498  C "C1'" . DG  B 2 10  ? 21.217 31.613 22.178  1.00 29.12  ? 225 DG  N "C1'" 1 
ATOM 499  N N9    . DG  B 2 10  ? 20.879 31.816 20.779  1.00 25.07  ? 225 DG  N N9    1 
ATOM 500  C C8    . DG  B 2 10  ? 19.640 31.856 20.182  1.00 24.70  ? 225 DG  N C8    1 
ATOM 501  N N7    . DG  B 2 10  ? 19.705 32.021 18.888  1.00 23.04  ? 225 DG  N N7    1 
ATOM 502  C C5    . DG  B 2 10  ? 21.065 32.101 18.622  1.00 21.15  ? 225 DG  N C5    1 
ATOM 503  C C6    . DG  B 2 10  ? 21.753 32.269 17.400  1.00 20.33  ? 225 DG  N C6    1 
ATOM 504  O O6    . DG  B 2 10  ? 21.280 32.373 16.264  1.00 20.81  ? 225 DG  N O6    1 
ATOM 505  N N1    . DG  B 2 10  ? 23.131 32.301 17.590  1.00 18.01  ? 225 DG  N N1    1 
ATOM 506  C C2    . DG  B 2 10  ? 23.760 32.174 18.804  1.00 19.62  ? 225 DG  N C2    1 
ATOM 507  N N2    . DG  B 2 10  ? 25.099 32.228 18.803  1.00 25.69  ? 225 DG  N N2    1 
ATOM 508  N N3    . DG  B 2 10  ? 23.129 32.008 19.946  1.00 15.64  ? 225 DG  N N3    1 
ATOM 509  C C4    . DG  B 2 10  ? 21.796 31.984 19.780  1.00 20.73  ? 225 DG  N C4    1 
ATOM 510  P P     . DC  B 2 11  ? 22.368 31.289 26.399  1.00 61.67  ? 226 DC  N P     1 
ATOM 511  O OP1   . DC  B 2 11  ? 22.007 29.858 26.621  1.00 62.16  ? 226 DC  N OP1   1 
ATOM 512  O OP2   . DC  B 2 11  ? 21.873 32.334 27.343  1.00 53.95  ? 226 DC  N OP2   1 
ATOM 513  O "O5'" . DC  B 2 11  ? 23.958 31.369 26.321  1.00 56.22  ? 226 DC  N "O5'" 1 
ATOM 514  C "C5'" . DC  B 2 11  ? 24.662 32.613 26.521  1.00 50.55  ? 226 DC  N "C5'" 1 
ATOM 515  C "C4'" . DC  B 2 11  ? 26.006 32.571 25.830  1.00 38.84  ? 226 DC  N "C4'" 1 
ATOM 516  O "O4'" . DC  B 2 11  ? 25.795 32.543 24.401  1.00 33.07  ? 226 DC  N "O4'" 1 
ATOM 517  C "C3'" . DC  B 2 11  ? 26.898 33.785 26.069  1.00 25.53  ? 226 DC  N "C3'" 1 
ATOM 518  O "O3'" . DC  B 2 11  ? 28.264 33.368 25.968  1.00 35.08  ? 226 DC  N "O3'" 1 
ATOM 519  C "C2'" . DC  B 2 11  ? 26.501 34.726 24.945  1.00 26.23  ? 226 DC  N "C2'" 1 
ATOM 520  C "C1'" . DC  B 2 11  ? 26.190 33.773 23.801  1.00 25.88  ? 226 DC  N "C1'" 1 
ATOM 521  N N1    . DC  B 2 11  ? 25.102 34.183 22.895  1.00 19.71  ? 226 DC  N N1    1 
ATOM 522  C C2    . DC  B 2 11  ? 25.390 34.511 21.550  1.00 17.18  ? 226 DC  N C2    1 
ATOM 523  O O2    . DC  B 2 11  ? 26.577 34.550 21.163  1.00 9.63   ? 226 DC  N O2    1 
ATOM 524  N N3    . DC  B 2 11  ? 24.361 34.785 20.708  1.00 13.50  ? 226 DC  N N3    1 
ATOM 525  C C4    . DC  B 2 11  ? 23.105 34.762 21.161  1.00 13.43  ? 226 DC  N C4    1 
ATOM 526  N N4    . DC  B 2 11  ? 22.119 34.993 20.295  1.00 12.68  ? 226 DC  N N4    1 
ATOM 527  C C5    . DC  B 2 11  ? 22.796 34.488 22.525  1.00 14.34  ? 226 DC  N C5    1 
ATOM 528  C C6    . DC  B 2 11  ? 23.811 34.207 23.347  1.00 15.55  ? 226 DC  N C6    1 
ATOM 529  P P     . DA  B 2 12  ? 29.442 34.392 26.346  1.00 48.61  ? 227 DA  N P     1 
ATOM 530  O OP1   . DA  B 2 12  ? 30.599 33.690 26.965  1.00 38.84  ? 227 DA  N OP1   1 
ATOM 531  O OP2   . DA  B 2 12  ? 28.770 35.498 27.074  1.00 46.79  ? 227 DA  N OP2   1 
ATOM 532  O "O5'" . DA  B 2 12  ? 29.941 34.944 24.940  1.00 46.85  ? 227 DA  N "O5'" 1 
ATOM 533  C "C5'" . DA  B 2 12  ? 28.989 35.377 23.957  1.00 48.72  ? 227 DA  N "C5'" 1 
ATOM 534  C "C4'" . DA  B 2 12  ? 29.535 36.549 23.178  1.00 40.59  ? 227 DA  N "C4'" 1 
ATOM 535  O "O4'" . DA  B 2 12  ? 28.498 37.006 22.278  1.00 33.48  ? 227 DA  N "O4'" 1 
ATOM 536  C "C3'" . DA  B 2 12  ? 29.902 37.755 24.039  1.00 31.39  ? 227 DA  N "C3'" 1 
ATOM 537  O "O3'" . DA  B 2 12  ? 31.028 38.423 23.453  1.00 34.93  ? 227 DA  N "O3'" 1 
ATOM 538  C "C2'" . DA  B 2 12  ? 28.620 38.570 24.052  1.00 26.87  ? 227 DA  N "C2'" 1 
ATOM 539  C "C1'" . DA  B 2 12  ? 27.965 38.245 22.718  1.00 23.88  ? 227 DA  N "C1'" 1 
ATOM 540  N N9    . DA  B 2 12  ? 26.515 38.092 22.803  1.00 16.13  ? 227 DA  N N9    1 
ATOM 541  C C8    . DA  B 2 12  ? 25.749 37.849 23.913  1.00 11.66  ? 227 DA  N C8    1 
ATOM 542  N N7    . DA  B 2 12  ? 24.460 37.829 23.668  1.00 8.46   ? 227 DA  N N7    1 
ATOM 543  C C5    . DA  B 2 12  ? 24.375 38.066 22.305  1.00 7.54   ? 227 DA  N C5    1 
ATOM 544  C C6    . DA  B 2 12  ? 23.283 38.193 21.435  1.00 6.27   ? 227 DA  N C6    1 
ATOM 545  N N6    . DA  B 2 12  ? 22.014 38.124 21.828  1.00 8.42   ? 227 DA  N N6    1 
ATOM 546  N N1    . DA  B 2 12  ? 23.540 38.407 20.129  1.00 11.19  ? 227 DA  N N1    1 
ATOM 547  C C2    . DA  B 2 12  ? 24.818 38.495 19.736  1.00 18.42  ? 227 DA  N C2    1 
ATOM 548  N N3    . DA  B 2 12  ? 25.935 38.412 20.463  1.00 16.23  ? 227 DA  N N3    1 
ATOM 549  C C4    . DA  B 2 12  ? 25.637 38.199 21.756  1.00 13.00  ? 227 DA  N C4    1 
ATOM 550  P P     . DT  B 2 13  ? 31.323 39.973 23.779  1.00 45.35  ? 228 DT  N P     1 
ATOM 551  O OP1   . DT  B 2 13  ? 32.767 40.165 23.480  1.00 42.81  ? 228 DT  N OP1   1 
ATOM 552  O OP2   . DT  B 2 13  ? 30.787 40.365 25.107  1.00 47.57  ? 228 DT  N OP2   1 
ATOM 553  O "O5'" . DT  B 2 13  ? 30.495 40.751 22.669  1.00 31.65  ? 228 DT  N "O5'" 1 
ATOM 554  C "C5'" . DT  B 2 13  ? 30.736 40.467 21.288  1.00 31.79  ? 228 DT  N "C5'" 1 
ATOM 555  C "C4'" . DT  B 2 13  ? 29.956 41.435 20.438  1.00 35.78  ? 228 DT  N "C4'" 1 
ATOM 556  O "O4'" . DT  B 2 13  ? 28.547 41.173 20.625  1.00 28.32  ? 228 DT  N "O4'" 1 
ATOM 557  C "C3'" . DT  B 2 13  ? 30.172 42.879 20.879  1.00 40.02  ? 228 DT  N "C3'" 1 
ATOM 558  O "O3'" . DT  B 2 13  ? 30.004 43.708 19.728  1.00 48.63  ? 228 DT  N "O3'" 1 
ATOM 559  C "C2'" . DT  B 2 13  ? 29.035 43.100 21.859  1.00 33.11  ? 228 DT  N "C2'" 1 
ATOM 560  C "C1'" . DT  B 2 13  ? 27.939 42.341 21.135  1.00 25.34  ? 228 DT  N "C1'" 1 
ATOM 561  N N1    . DT  B 2 13  ? 26.734 41.942 21.874  1.00 22.11  ? 228 DT  N N1    1 
ATOM 562  C C2    . DT  B 2 13  ? 25.583 41.788 21.131  1.00 22.50  ? 228 DT  N C2    1 
ATOM 563  O O2    . DT  B 2 13  ? 25.546 41.921 19.919  1.00 24.14  ? 228 DT  N O2    1 
ATOM 564  N N3    . DT  B 2 13  ? 24.470 41.460 21.856  1.00 19.94  ? 228 DT  N N3    1 
ATOM 565  C C4    . DT  B 2 13  ? 24.397 41.256 23.215  1.00 20.15  ? 228 DT  N C4    1 
ATOM 566  O O4    . DT  B 2 13  ? 23.318 40.978 23.722  1.00 21.24  ? 228 DT  N O4    1 
ATOM 567  C C5    . DT  B 2 13  ? 25.649 41.397 23.931  1.00 18.60  ? 228 DT  N C5    1 
ATOM 568  C C7    . DT  B 2 13  ? 25.674 41.143 25.405  1.00 16.39  ? 228 DT  N C7    1 
ATOM 569  C C6    . DT  B 2 13  ? 26.741 41.738 23.236  1.00 19.29  ? 228 DT  N C6    1 
ATOM 570  P P     . DA  B 2 14  ? 30.791 45.101 19.624  1.00 56.17  ? 229 DA  N P     1 
ATOM 571  O OP1   . DA  B 2 14  ? 32.252 44.815 19.571  1.00 45.58  ? 229 DA  N OP1   1 
ATOM 572  O OP2   . DA  B 2 14  ? 30.252 46.004 20.674  1.00 48.26  ? 229 DA  N OP2   1 
ATOM 573  O "O5'" . DA  B 2 14  ? 30.319 45.651 18.207  1.00 50.21  ? 229 DA  N "O5'" 1 
ATOM 574  C "C5'" . DA  B 2 14  ? 30.142 44.751 17.101  1.00 42.70  ? 229 DA  N "C5'" 1 
ATOM 575  C "C4'" . DA  B 2 14  ? 28.723 44.826 16.588  1.00 48.23  ? 229 DA  N "C4'" 1 
ATOM 576  O "O4'" . DA  B 2 14  ? 27.814 44.357 17.613  1.00 41.85  ? 229 DA  N "O4'" 1 
ATOM 577  C "C3'" . DA  B 2 14  ? 28.240 46.224 16.196  1.00 55.98  ? 229 DA  N "C3'" 1 
ATOM 578  O "O3'" . DA  B 2 14  ? 27.538 46.183 14.944  1.00 60.95  ? 229 DA  N "O3'" 1 
ATOM 579  C "C2'" . DA  B 2 14  ? 27.313 46.613 17.335  1.00 48.10  ? 229 DA  N "C2'" 1 
ATOM 580  C "C1'" . DA  B 2 14  ? 26.734 45.268 17.730  1.00 40.91  ? 229 DA  N "C1'" 1 
ATOM 581  N N9    . DA  B 2 14  ? 26.199 45.180 19.092  1.00 38.49  ? 229 DA  N N9    1 
ATOM 582  C C8    . DA  B 2 14  ? 26.881 45.117 20.283  1.00 34.60  ? 229 DA  N C8    1 
ATOM 583  N N7    . DA  B 2 14  ? 26.099 45.043 21.336  1.00 35.17  ? 229 DA  N N7    1 
ATOM 584  C C5    . DA  B 2 14  ? 24.814 45.060 20.806  1.00 34.04  ? 229 DA  N C5    1 
ATOM 585  C C6    . DA  B 2 14  ? 23.531 45.009 21.402  1.00 31.58  ? 229 DA  N C6    1 
ATOM 586  N N6    . DA  B 2 14  ? 23.311 44.939 22.719  1.00 25.74  ? 229 DA  N N6    1 
ATOM 587  N N1    . DA  B 2 14  ? 22.459 45.038 20.579  1.00 32.15  ? 229 DA  N N1    1 
ATOM 588  C C2    . DA  B 2 14  ? 22.666 45.121 19.257  1.00 33.35  ? 229 DA  N C2    1 
ATOM 589  N N3    . DA  B 2 14  ? 23.813 45.180 18.582  1.00 33.58  ? 229 DA  N N3    1 
ATOM 590  C C4    . DA  B 2 14  ? 24.863 45.144 19.423  1.00 35.55  ? 229 DA  N C4    1 
ATOM 591  P P     . DC  B 2 15  ? 26.965 47.545 14.305  1.00 63.53  ? 230 DC  N P     1 
ATOM 592  O OP1   . DC  B 2 15  ? 26.387 47.214 12.976  1.00 59.52  ? 230 DC  N OP1   1 
ATOM 593  O OP2   . DC  B 2 15  ? 28.033 48.577 14.406  1.00 58.96  ? 230 DC  N OP2   1 
ATOM 594  O "O5'" . DC  B 2 15  ? 25.759 47.915 15.280  1.00 58.80  ? 230 DC  N "O5'" 1 
ATOM 595  C "C5'" . DC  B 2 15  ? 25.005 49.133 15.134  1.00 57.70  ? 230 DC  N "C5'" 1 
ATOM 596  C "C4'" . DC  B 2 15  ? 23.555 48.887 15.484  1.00 58.85  ? 230 DC  N "C4'" 1 
ATOM 597  O "O4'" . DC  B 2 15  ? 23.435 48.257 16.786  1.00 54.03  ? 230 DC  N "O4'" 1 
ATOM 598  C "C3'" . DC  B 2 15  ? 22.674 50.137 15.550  1.00 62.44  ? 230 DC  N "C3'" 1 
ATOM 599  O "O3'" . DC  B 2 15  ? 21.339 49.759 15.169  1.00 61.23  ? 230 DC  N "O3'" 1 
ATOM 600  C "C2'" . DC  B 2 15  ? 22.614 50.427 17.041  1.00 52.89  ? 230 DC  N "C2'" 1 
ATOM 601  C "C1'" . DC  B 2 15  ? 22.516 49.008 17.572  1.00 45.42  ? 230 DC  N "C1'" 1 
ATOM 602  N N1    . DC  B 2 15  ? 22.817 48.789 18.997  1.00 32.15  ? 230 DC  N N1    1 
ATOM 603  C C2    . DC  B 2 15  ? 21.748 48.625 19.884  1.00 24.51  ? 230 DC  N C2    1 
ATOM 604  O O2    . DC  B 2 15  ? 20.593 48.681 19.445  1.00 22.93  ? 230 DC  N O2    1 
ATOM 605  N N3    . DC  B 2 15  ? 21.996 48.404 21.192  1.00 21.79  ? 230 DC  N N3    1 
ATOM 606  C C4    . DC  B 2 15  ? 23.255 48.331 21.624  1.00 25.50  ? 230 DC  N C4    1 
ATOM 607  N N4    . DC  B 2 15  ? 23.449 48.075 22.915  1.00 21.86  ? 230 DC  N N4    1 
ATOM 608  C C5    . DC  B 2 15  ? 24.367 48.506 20.748  1.00 27.10  ? 230 DC  N C5    1 
ATOM 609  C C6    . DC  B 2 15  ? 24.104 48.733 19.454  1.00 29.39  ? 230 DC  N C6    1 
ATOM 610  P P     . DG  C 1 2   ? 78.786 -3.512 21.515  1.00 82.82  ? 702 DG  O P     1 
ATOM 611  O OP1   . DG  C 1 2   ? 79.152 -4.737 20.759  1.00 72.96  ? 702 DG  O OP1   1 
ATOM 612  O OP2   . DG  C 1 2   ? 78.706 -3.555 22.996  1.00 86.39  ? 702 DG  O OP2   1 
ATOM 613  O "O5'" . DG  C 1 2   ? 77.395 -2.970 20.960  1.00 86.56  ? 702 DG  O "O5'" 1 
ATOM 614  C "C5'" . DG  C 1 2   ? 77.363 -1.875 20.029  1.00 92.67  ? 702 DG  O "C5'" 1 
ATOM 615  C "C4'" . DG  C 1 2   ? 77.111 -2.387 18.630  1.00 96.98  ? 702 DG  O "C4'" 1 
ATOM 616  O "O4'" . DG  C 1 2   ? 75.818 -3.032 18.586  1.00 97.70  ? 702 DG  O "O4'" 1 
ATOM 617  C "C3'" . DG  C 1 2   ? 77.054 -1.292 17.570  1.00 94.43  ? 702 DG  O "C3'" 1 
ATOM 618  O "O3'" . DG  C 1 2   ? 77.523 -1.805 16.319  1.00 88.06  ? 702 DG  O "O3'" 1 
ATOM 619  C "C2'" . DG  C 1 2   ? 75.581 -0.929 17.535  1.00 94.94  ? 702 DG  O "C2'" 1 
ATOM 620  C "C1'" . DG  C 1 2   ? 74.889 -2.244 17.856  1.00 96.11  ? 702 DG  O "C1'" 1 
ATOM 621  N N9    . DG  C 1 2   ? 73.712 -2.083 18.700  1.00 97.06  ? 702 DG  O N9    1 
ATOM 622  C C8    . DG  C 1 2   ? 73.662 -1.508 19.947  1.00 97.95  ? 702 DG  O C8    1 
ATOM 623  N N7    . DG  C 1 2   ? 72.470 -1.538 20.476  1.00 97.75  ? 702 DG  O N7    1 
ATOM 624  C C5    . DG  C 1 2   ? 71.685 -2.163 19.517  1.00 97.25  ? 702 DG  O C5    1 
ATOM 625  C C6    . DG  C 1 2   ? 70.306 -2.481 19.528  1.00 95.94  ? 702 DG  O C6    1 
ATOM 626  O O6    . DG  C 1 2   ? 69.473 -2.268 20.418  1.00 94.32  ? 702 DG  O O6    1 
ATOM 627  N N1    . DG  C 1 2   ? 69.922 -3.117 18.351  1.00 96.20  ? 702 DG  O N1    1 
ATOM 628  C C2    . DG  C 1 2   ? 70.759 -3.413 17.300  1.00 95.30  ? 702 DG  O C2    1 
ATOM 629  N N2    . DG  C 1 2   ? 70.208 -4.043 16.256  1.00 92.25  ? 702 DG  O N2    1 
ATOM 630  N N3    . DG  C 1 2   ? 72.046 -3.117 17.278  1.00 95.99  ? 702 DG  O N3    1 
ATOM 631  C C4    . DG  C 1 2   ? 72.439 -2.499 18.412  1.00 97.47  ? 702 DG  O C4    1 
ATOM 632  P P     . DT  C 1 3   ? 78.226 -0.815 15.268  1.00 85.27  ? 703 DT  O P     1 
ATOM 633  O OP1   . DT  C 1 3   ? 79.114 -1.653 14.426  1.00 83.60  ? 703 DT  O OP1   1 
ATOM 634  O OP2   . DT  C 1 3   ? 78.788 0.333  16.024  1.00 76.81  ? 703 DT  O OP2   1 
ATOM 635  O "O5'" . DT  C 1 3   ? 77.024 -0.291 14.364  1.00 86.51  ? 703 DT  O "O5'" 1 
ATOM 636  C "C5'" . DT  C 1 3   ? 75.679 -0.311 14.868  1.00 84.74  ? 703 DT  O "C5'" 1 
ATOM 637  C "C4'" . DT  C 1 3   ? 74.675 -0.205 13.745  1.00 82.86  ? 703 DT  O "C4'" 1 
ATOM 638  O "O4'" . DT  C 1 3   ? 73.379 -0.492 14.313  1.00 87.41  ? 703 DT  O "O4'" 1 
ATOM 639  C "C3'" . DT  C 1 3   ? 74.551 1.187  13.134  1.00 80.34  ? 703 DT  O "C3'" 1 
ATOM 640  O "O3'" . DT  C 1 3   ? 74.100 1.089  11.777  1.00 77.19  ? 703 DT  O "O3'" 1 
ATOM 641  C "C2'" . DT  C 1 3   ? 73.532 1.855  14.038  1.00 85.73  ? 703 DT  O "C2'" 1 
ATOM 642  C "C1'" . DT  C 1 3   ? 72.632 0.705  14.478  1.00 89.17  ? 703 DT  O "C1'" 1 
ATOM 643  N N1    . DT  C 1 3   ? 72.227 0.775  15.895  1.00 90.81  ? 703 DT  O N1    1 
ATOM 644  C C2    . DT  C 1 3   ? 70.978 0.313  16.249  1.00 92.63  ? 703 DT  O C2    1 
ATOM 645  O O2    . DT  C 1 3   ? 70.185 -0.155 15.450  1.00 93.92  ? 703 DT  O O2    1 
ATOM 646  N N3    . DT  C 1 3   ? 70.691 0.413  17.585  1.00 93.07  ? 703 DT  O N3    1 
ATOM 647  C C4    . DT  C 1 3   ? 71.506 0.912  18.580  1.00 92.52  ? 703 DT  O C4    1 
ATOM 648  O O4    . DT  C 1 3   ? 71.107 0.929  19.739  1.00 95.59  ? 703 DT  O O4    1 
ATOM 649  C C5    . DT  C 1 3   ? 72.800 1.379  18.139  1.00 91.66  ? 703 DT  O C5    1 
ATOM 650  C C7    . DT  C 1 3   ? 73.755 1.939  19.145  1.00 91.33  ? 703 DT  O C7    1 
ATOM 651  C C6    . DT  C 1 3   ? 73.091 1.289  16.837  1.00 91.08  ? 703 DT  O C6    1 
ATOM 652  P P     . DA  C 1 4   ? 73.808 2.425  10.928  1.00 74.21  ? 704 DA  O P     1 
ATOM 653  O OP1   . DA  C 1 4   ? 73.996 2.110  9.490   1.00 74.05  ? 704 DA  O OP1   1 
ATOM 654  O OP2   . DA  C 1 4   ? 74.581 3.535  11.532  1.00 67.86  ? 704 DA  O OP2   1 
ATOM 655  O "O5'" . DA  C 1 4   ? 72.258 2.692  11.184  1.00 78.54  ? 704 DA  O "O5'" 1 
ATOM 656  C "C5'" . DA  C 1 4   ? 71.264 1.763  10.701  1.00 82.11  ? 704 DA  O "C5'" 1 
ATOM 657  C "C4'" . DA  C 1 4   ? 69.870 2.323  10.881  1.00 80.04  ? 704 DA  O "C4'" 1 
ATOM 658  O "O4'" . DA  C 1 4   ? 69.526 2.327  12.285  1.00 80.10  ? 704 DA  O "O4'" 1 
ATOM 659  C "C3'" . DA  C 1 4   ? 69.655 3.754  10.390  1.00 79.92  ? 704 DA  O "C3'" 1 
ATOM 660  O "O3'" . DA  C 1 4   ? 68.332 3.886  9.848   1.00 74.24  ? 704 DA  O "O3'" 1 
ATOM 661  C "C2'" . DA  C 1 4   ? 69.824 4.579  11.655  1.00 80.34  ? 704 DA  O "C2'" 1 
ATOM 662  C "C1'" . DA  C 1 4   ? 69.278 3.652  12.731  1.00 81.61  ? 704 DA  O "C1'" 1 
ATOM 663  N N9    . DA  C 1 4   ? 69.894 3.791  14.050  1.00 84.28  ? 704 DA  O N9    1 
ATOM 664  C C8    . DA  C 1 4   ? 71.216 3.632  14.387  1.00 84.29  ? 704 DA  O C8    1 
ATOM 665  N N7    . DA  C 1 4   ? 71.457 3.781  15.667  1.00 83.15  ? 704 DA  O N7    1 
ATOM 666  C C5    . DA  C 1 4   ? 70.213 4.073  16.206  1.00 82.89  ? 704 DA  O C5    1 
ATOM 667  C C6    . DA  C 1 4   ? 69.795 4.348  17.514  1.00 82.60  ? 704 DA  O C6    1 
ATOM 668  N N6    . DA  C 1 4   ? 70.624 4.395  18.556  1.00 86.76  ? 704 DA  O N6    1 
ATOM 669  N N1    . DA  C 1 4   ? 68.483 4.587  17.719  1.00 81.07  ? 704 DA  O N1    1 
ATOM 670  C C2    . DA  C 1 4   ? 67.658 4.569  16.668  1.00 80.37  ? 704 DA  O C2    1 
ATOM 671  N N3    . DA  C 1 4   ? 67.932 4.337  15.389  1.00 83.15  ? 704 DA  O N3    1 
ATOM 672  C C4    . DA  C 1 4   ? 69.243 4.089  15.223  1.00 83.91  ? 704 DA  O C4    1 
ATOM 673  P P     . DT  C 1 5   ? 67.890 5.248  9.110   1.00 66.60  ? 705 DT  O P     1 
ATOM 674  O OP1   . DT  C 1 5   ? 67.271 4.876  7.814   1.00 70.62  ? 705 DT  O OP1   1 
ATOM 675  O OP2   . DT  C 1 5   ? 69.021 6.209  9.130   1.00 64.94  ? 705 DT  O OP2   1 
ATOM 676  O "O5'" . DT  C 1 5   ? 66.721 5.805  10.034  1.00 64.35  ? 705 DT  O "O5'" 1 
ATOM 677  C "C5'" . DT  C 1 5   ? 66.810 5.693  11.460  1.00 58.95  ? 705 DT  O "C5'" 1 
ATOM 678  C "C4'" . DT  C 1 5   ? 65.531 6.172  12.100  1.00 61.64  ? 705 DT  O "C4'" 1 
ATOM 679  O "O4'" . DT  C 1 5   ? 65.717 6.147  13.531  1.00 67.52  ? 705 DT  O "O4'" 1 
ATOM 680  C "C3'" . DT  C 1 5   ? 65.179 7.618  11.768  1.00 66.45  ? 705 DT  O "C3'" 1 
ATOM 681  O "O3'" . DT  C 1 5   ? 63.768 7.770  11.926  1.00 75.96  ? 705 DT  O "O3'" 1 
ATOM 682  C "C2'" . DT  C 1 5   ? 65.927 8.394  12.834  1.00 68.15  ? 705 DT  O "C2'" 1 
ATOM 683  C "C1'" . DT  C 1 5   ? 65.841 7.468  14.038  1.00 70.31  ? 705 DT  O "C1'" 1 
ATOM 684  N N1    . DT  C 1 5   ? 67.024 7.492  14.917  1.00 74.00  ? 705 DT  O N1    1 
ATOM 685  C C2    . DT  C 1 5   ? 66.829 7.674  16.266  1.00 75.56  ? 705 DT  O C2    1 
ATOM 686  O O2    . DT  C 1 5   ? 65.726 7.796  16.769  1.00 76.26  ? 705 DT  O O2    1 
ATOM 687  N N3    . DT  C 1 5   ? 67.981 7.695  17.013  1.00 76.37  ? 705 DT  O N3    1 
ATOM 688  C C4    . DT  C 1 5   ? 69.277 7.539  16.560  1.00 76.82  ? 705 DT  O C4    1 
ATOM 689  O O4    . DT  C 1 5   ? 70.215 7.585  17.356  1.00 76.40  ? 705 DT  O O4    1 
ATOM 690  C C5    . DT  C 1 5   ? 69.405 7.329  15.135  1.00 77.44  ? 705 DT  O C5    1 
ATOM 691  C C7    . DT  C 1 5   ? 70.766 7.116  14.551  1.00 78.28  ? 705 DT  O C7    1 
ATOM 692  C C6    . DT  C 1 5   ? 68.288 7.328  14.395  1.00 75.92  ? 705 DT  O C6    1 
ATOM 693  P P     . DG  C 1 6   ? 63.019 9.045  11.299  1.00 81.26  ? 706 DG  O P     1 
ATOM 694  O OP1   . DG  C 1 6   ? 62.374 8.575  10.050  1.00 78.22  ? 706 DG  O OP1   1 
ATOM 695  O OP2   . DG  C 1 6   ? 63.921 10.225 11.273  1.00 69.22  ? 706 DG  O OP2   1 
ATOM 696  O "O5'" . DG  C 1 6   ? 61.857 9.334  12.347  1.00 82.23  ? 706 DG  O "O5'" 1 
ATOM 697  C "C5'" . DG  C 1 6   ? 61.053 8.260  12.870  1.00 87.64  ? 706 DG  O "C5'" 1 
ATOM 698  C "C4'" . DG  C 1 6   ? 60.481 8.658  14.210  1.00 91.33  ? 706 DG  O "C4'" 1 
ATOM 699  O "O4'" . DG  C 1 6   ? 61.526 8.603  15.212  1.00 95.16  ? 706 DG  O "O4'" 1 
ATOM 700  C "C3'" . DG  C 1 6   ? 59.967 10.097 14.201  1.00 89.41  ? 706 DG  O "C3'" 1 
ATOM 701  O "O3'" . DG  C 1 6   ? 58.759 10.235 14.955  1.00 81.56  ? 706 DG  O "O3'" 1 
ATOM 702  C "C2'" . DG  C 1 6   ? 61.126 10.888 14.782  1.00 94.26  ? 706 DG  O "C2'" 1 
ATOM 703  C "C1'" . DG  C 1 6   ? 61.808 9.901  15.721  1.00 97.46  ? 706 DG  O "C1'" 1 
ATOM 704  N N9    . DG  C 1 6   ? 63.261 10.062 15.765  1.00 97.88  ? 706 DG  O N9    1 
ATOM 705  C C8    . DG  C 1 6   ? 64.115 10.087 14.689  1.00 97.89  ? 706 DG  O C8    1 
ATOM 706  N N7    . DG  C 1 6   ? 65.361 10.274 15.025  1.00 96.70  ? 706 DG  O N7    1 
ATOM 707  C C5    . DG  C 1 6   ? 65.333 10.375 16.408  1.00 97.51  ? 706 DG  O C5    1 
ATOM 708  C C6    . DG  C 1 6   ? 66.389 10.577 17.331  1.00 98.46  ? 706 DG  O C6    1 
ATOM 709  O O6    . DG  C 1 6   ? 67.595 10.719 17.100  1.00 99.63  ? 706 DG  O O6    1 
ATOM 710  N N1    . DG  C 1 6   ? 65.925 10.604 18.641  1.00 99.06  ? 706 DG  O N1    1 
ATOM 711  C C2    . DG  C 1 6   ? 64.613 10.458 19.016  1.00 98.53  ? 706 DG  O C2    1 
ATOM 712  N N2    . DG  C 1 6   ? 64.372 10.510 20.333  1.00 98.55  ? 706 DG  O N2    1 
ATOM 713  N N3    . DG  C 1 6   ? 63.615 10.272 18.165  1.00 98.70  ? 706 DG  O N3    1 
ATOM 714  C C4    . DG  C 1 6   ? 64.045 10.239 16.884  1.00 98.11  ? 706 DG  O C4    1 
ATOM 715  P P     . DC  C 1 7   ? 58.175 11.703 15.250  1.00 78.07  ? 707 DC  O P     1 
ATOM 716  O OP1   . DC  C 1 7   ? 56.774 11.550 15.712  1.00 76.47  ? 707 DC  O OP1   1 
ATOM 717  O OP2   . DC  C 1 7   ? 58.473 12.597 14.100  1.00 70.27  ? 707 DC  O OP2   1 
ATOM 718  O "O5'" . DC  C 1 7   ? 59.057 12.166 16.491  1.00 82.34  ? 707 DC  O "O5'" 1 
ATOM 719  C "C5'" . DC  C 1 7   ? 59.092 11.387 17.705  1.00 79.79  ? 707 DC  O "C5'" 1 
ATOM 720  C "C4'" . DC  C 1 7   ? 59.665 12.218 18.827  1.00 77.20  ? 707 DC  O "C4'" 1 
ATOM 721  O "O4'" . DC  C 1 7   ? 61.109 12.243 18.746  1.00 76.77  ? 707 DC  O "O4'" 1 
ATOM 722  C "C3'" . DC  C 1 7   ? 59.221 13.678 18.745  1.00 76.11  ? 707 DC  O "C3'" 1 
ATOM 723  O "O3'" . DC  C 1 7   ? 59.068 14.228 20.055  1.00 73.89  ? 707 DC  O "O3'" 1 
ATOM 724  C "C2'" . DC  C 1 7   ? 60.358 14.338 17.986  1.00 74.74  ? 707 DC  O "C2'" 1 
ATOM 725  C "C1'" . DC  C 1 7   ? 61.553 13.576 18.528  1.00 76.85  ? 707 DC  O "C1'" 1 
ATOM 726  N N1    . DC  C 1 7   ? 62.719 13.524 17.634  1.00 78.31  ? 707 DC  O N1    1 
ATOM 727  C C2    . DC  C 1 7   ? 63.951 13.978 18.115  1.00 79.22  ? 707 DC  O C2    1 
ATOM 728  O O2    . DC  C 1 7   ? 64.012 14.460 19.260  1.00 81.18  ? 707 DC  O O2    1 
ATOM 729  N N3    . DC  C 1 7   ? 65.042 13.886 17.320  1.00 77.06  ? 707 DC  O N3    1 
ATOM 730  C C4    . DC  C 1 7   ? 64.931 13.382 16.090  1.00 73.51  ? 707 DC  O C4    1 
ATOM 731  N N4    . DC  C 1 7   ? 66.034 13.300 15.351  1.00 70.92  ? 707 DC  O N4    1 
ATOM 732  C C5    . DC  C 1 7   ? 63.684 12.938 15.567  1.00 75.00  ? 707 DC  O C5    1 
ATOM 733  C C6    . DC  C 1 7   ? 62.614 13.027 16.365  1.00 77.61  ? 707 DC  O C6    1 
ATOM 734  P P     . DA  C 1 8   ? 58.983 15.821 20.242  1.00 70.32  ? 708 DA  O P     1 
ATOM 735  O OP1   . DA  C 1 8   ? 58.226 16.094 21.485  1.00 62.57  ? 708 DA  O OP1   1 
ATOM 736  O OP2   . DA  C 1 8   ? 58.546 16.436 18.964  1.00 68.80  ? 708 DA  O OP2   1 
ATOM 737  O "O5'" . DA  C 1 8   ? 60.504 16.233 20.463  1.00 76.04  ? 708 DA  O "O5'" 1 
ATOM 738  C "C5'" . DA  C 1 8   ? 61.242 15.757 21.604  1.00 74.54  ? 708 DA  O "C5'" 1 
ATOM 739  C "C4'" . DA  C 1 8   ? 62.311 16.759 21.969  1.00 67.94  ? 708 DA  O "C4'" 1 
ATOM 740  O "O4'" . DA  C 1 8   ? 63.381 16.704 21.002  1.00 67.87  ? 708 DA  O "O4'" 1 
ATOM 741  C "C3'" . DA  C 1 8   ? 61.810 18.202 21.946  1.00 72.35  ? 708 DA  O "C3'" 1 
ATOM 742  O "O3'" . DA  C 1 8   ? 62.600 18.977 22.847  1.00 77.24  ? 708 DA  O "O3'" 1 
ATOM 743  C "C2'" . DA  C 1 8   ? 62.148 18.647 20.536  1.00 72.19  ? 708 DA  O "C2'" 1 
ATOM 744  C "C1'" . DA  C 1 8   ? 63.501 17.978 20.394  1.00 72.88  ? 708 DA  O "C1'" 1 
ATOM 745  N N9    . DA  C 1 8   ? 64.025 17.783 19.046  1.00 77.30  ? 708 DA  O N9    1 
ATOM 746  C C8    . DA  C 1 8   ? 63.396 17.768 17.827  1.00 76.90  ? 708 DA  O C8    1 
ATOM 747  N N7    . DA  C 1 8   ? 64.213 17.567 16.820  1.00 79.83  ? 708 DA  O N7    1 
ATOM 748  C C5    . DA  C 1 8   ? 65.460 17.440 17.421  1.00 81.37  ? 708 DA  O C5    1 
ATOM 749  C C6    . DA  C 1 8   ? 66.749 17.216 16.905  1.00 81.82  ? 708 DA  O C6    1 
ATOM 750  N N6    . DA  C 1 8   ? 67.016 17.076 15.606  1.00 83.68  ? 708 DA  O N6    1 
ATOM 751  N N1    . DA  C 1 8   ? 67.773 17.140 17.783  1.00 80.80  ? 708 DA  O N1    1 
ATOM 752  C C2    . DA  C 1 8   ? 67.512 17.279 19.087  1.00 80.69  ? 708 DA  O C2    1 
ATOM 753  N N3    . DA  C 1 8   ? 66.351 17.497 19.693  1.00 81.67  ? 708 DA  O N3    1 
ATOM 754  C C4    . DA  C 1 8   ? 65.354 17.569 18.791  1.00 80.97  ? 708 DA  O C4    1 
ATOM 755  P P     . DA  C 1 9   ? 62.083 19.252 24.341  1.00 78.22  ? 709 DA  O P     1 
ATOM 756  O OP1   . DA  C 1 9   ? 60.911 18.405 24.689  1.00 77.62  ? 709 DA  O OP1   1 
ATOM 757  O OP2   . DA  C 1 9   ? 61.983 20.732 24.456  1.00 72.15  ? 709 DA  O OP2   1 
ATOM 758  O "O5'" . DA  C 1 9   ? 63.324 18.772 25.211  1.00 75.04  ? 709 DA  O "O5'" 1 
ATOM 759  C "C5'" . DA  C 1 9   ? 64.264 19.736 25.696  1.00 76.40  ? 709 DA  O "C5'" 1 
ATOM 760  C "C4'" . DA  C 1 9   ? 65.643 19.131 25.804  1.00 75.26  ? 709 DA  O "C4'" 1 
ATOM 761  O "O4'" . DA  C 1 9   ? 66.089 18.691 24.498  1.00 72.30  ? 709 DA  O "O4'" 1 
ATOM 762  C "C3'" . DA  C 1 9   ? 66.637 20.195 26.257  1.00 76.73  ? 709 DA  O "C3'" 1 
ATOM 763  O "O3'" . DA  C 1 9   ? 67.599 19.692 27.184  1.00 71.70  ? 709 DA  O "O3'" 1 
ATOM 764  C "C2'" . DA  C 1 9   ? 67.268 20.681 24.966  1.00 76.28  ? 709 DA  O "C2'" 1 
ATOM 765  C "C1'" . DA  C 1 9   ? 67.199 19.463 24.057  1.00 75.90  ? 709 DA  O "C1'" 1 
ATOM 766  N N9    . DA  C 1 9   ? 66.966 19.841 22.664  1.00 75.39  ? 709 DA  O N9    1 
ATOM 767  C C8    . DA  C 1 9   ? 65.881 20.511 22.150  1.00 76.58  ? 709 DA  O C8    1 
ATOM 768  N N7    . DA  C 1 9   ? 65.967 20.750 20.864  1.00 76.37  ? 709 DA  O N7    1 
ATOM 769  C C5    . DA  C 1 9   ? 67.187 20.192 20.503  1.00 76.40  ? 709 DA  O C5    1 
ATOM 770  C C6    . DA  C 1 9   ? 67.865 20.114 19.273  1.00 75.21  ? 709 DA  O C6    1 
ATOM 771  N N6    . DA  C 1 9   ? 67.380 20.602 18.129  1.00 76.38  ? 709 DA  O N6    1 
ATOM 772  N N1    . DA  C 1 9   ? 69.070 19.506 19.256  1.00 74.28  ? 709 DA  O N1    1 
ATOM 773  C C2    . DA  C 1 9   ? 69.546 19.001 20.400  1.00 73.91  ? 709 DA  O C2    1 
ATOM 774  N N3    . DA  C 1 9   ? 69.000 19.001 21.613  1.00 74.13  ? 709 DA  O N3    1 
ATOM 775  C C4    . DA  C 1 9   ? 67.809 19.622 21.599  1.00 75.11  ? 709 DA  O C4    1 
ATOM 776  P P     . DA  C 1 10  ? 68.676 20.705 27.799  1.00 69.19  ? 710 DA  O P     1 
ATOM 777  O OP1   . DA  C 1 10  ? 69.484 20.033 28.847  1.00 70.20  ? 710 DA  O OP1   1 
ATOM 778  O OP2   . DA  C 1 10  ? 67.968 21.974 28.105  1.00 63.96  ? 710 DA  O OP2   1 
ATOM 779  O "O5'" . DA  C 1 10  ? 69.612 20.998 26.550  1.00 66.37  ? 710 DA  O "O5'" 1 
ATOM 780  C "C5'" . DA  C 1 10  ? 70.505 19.990 26.052  1.00 62.43  ? 710 DA  O "C5'" 1 
ATOM 781  C "C4'" . DA  C 1 10  ? 71.560 20.644 25.196  1.00 67.58  ? 710 DA  O "C4'" 1 
ATOM 782  O "O4'" . DA  C 1 10  ? 71.004 20.963 23.900  1.00 67.60  ? 710 DA  O "O4'" 1 
ATOM 783  C "C3'" . DA  C 1 10  ? 72.028 21.976 25.782  1.00 72.07  ? 710 DA  O "C3'" 1 
ATOM 784  O "O3'" . DA  C 1 10  ? 73.401 22.186 25.442  1.00 72.40  ? 710 DA  O "O3'" 1 
ATOM 785  C "C2'" . DA  C 1 10  ? 71.132 22.988 25.090  1.00 68.73  ? 710 DA  O "C2'" 1 
ATOM 786  C "C1'" . DA  C 1 10  ? 71.034 22.369 23.706  1.00 68.83  ? 710 DA  O "C1'" 1 
ATOM 787  N N9    . DA  C 1 10  ? 69.877 22.731 22.891  1.00 67.61  ? 710 DA  O N9    1 
ATOM 788  C C8    . DA  C 1 10  ? 68.613 23.114 23.259  1.00 66.28  ? 710 DA  O C8    1 
ATOM 789  N N7    . DA  C 1 10  ? 67.816 23.343 22.244  1.00 66.40  ? 710 DA  O N7    1 
ATOM 790  C C5    . DA  C 1 10  ? 68.614 23.099 21.134  1.00 67.18  ? 710 DA  O C5    1 
ATOM 791  C C6    . DA  C 1 10  ? 68.364 23.160 19.755  1.00 68.48  ? 710 DA  O C6    1 
ATOM 792  N N6    . DA  C 1 10  ? 67.191 23.511 19.229  1.00 69.17  ? 710 DA  O N6    1 
ATOM 793  N N1    . DA  C 1 10  ? 69.378 22.848 18.919  1.00 69.35  ? 710 DA  O N1    1 
ATOM 794  C C2    . DA  C 1 10  ? 70.561 22.508 19.443  1.00 69.36  ? 710 DA  O C2    1 
ATOM 795  N N3    . DA  C 1 10  ? 70.919 22.420 20.719  1.00 68.77  ? 710 DA  O N3    1 
ATOM 796  C C4    . DA  C 1 10  ? 69.886 22.728 21.520  1.00 67.83  ? 710 DA  O C4    1 
ATOM 797  P P     . DT  C 1 11  ? 74.193 23.431 26.071  1.00 70.80  ? 711 DT  O P     1 
ATOM 798  O OP1   . DT  C 1 11  ? 75.340 22.907 26.860  1.00 72.62  ? 711 DT  O OP1   1 
ATOM 799  O OP2   . DT  C 1 11  ? 73.190 24.330 26.705  1.00 62.88  ? 711 DT  O OP2   1 
ATOM 800  O "O5'" . DT  C 1 11  ? 74.791 24.176 24.801  1.00 66.51  ? 711 DT  O "O5'" 1 
ATOM 801  C "C5'" . DT  C 1 11  ? 73.995 24.329 23.625  1.00 64.19  ? 711 DT  O "C5'" 1 
ATOM 802  C "C4'" . DT  C 1 11  ? 74.878 24.381 22.404  1.00 64.20  ? 711 DT  O "C4'" 1 
ATOM 803  O "O4'" . DT  C 1 11  ? 74.014 24.214 21.260  1.00 65.08  ? 711 DT  O "O4'" 1 
ATOM 804  C "C3'" . DT  C 1 11  ? 75.587 25.719 22.202  1.00 68.38  ? 711 DT  O "C3'" 1 
ATOM 805  O "O3'" . DT  C 1 11  ? 76.857 25.529 21.550  1.00 67.04  ? 711 DT  O "O3'" 1 
ATOM 806  C "C2'" . DT  C 1 11  ? 74.578 26.512 21.390  1.00 66.18  ? 711 DT  O "C2'" 1 
ATOM 807  C "C1'" . DT  C 1 11  ? 73.818 25.452 20.599  1.00 66.89  ? 711 DT  O "C1'" 1 
ATOM 808  N N1    . DT  C 1 11  ? 72.367 25.679 20.539  1.00 67.41  ? 711 DT  O N1    1 
ATOM 809  C C2    . DT  C 1 11  ? 71.712 25.481 19.343  1.00 69.59  ? 711 DT  O C2    1 
ATOM 810  O O2    . DT  C 1 11  ? 72.277 25.146 18.314  1.00 67.96  ? 711 DT  O O2    1 
ATOM 811  N N3    . DT  C 1 11  ? 70.357 25.693 19.397  1.00 71.14  ? 711 DT  O N3    1 
ATOM 812  C C4    . DT  C 1 11  ? 69.613 26.082 20.495  1.00 71.70  ? 711 DT  O C4    1 
ATOM 813  O O4    . DT  C 1 11  ? 68.397 26.219 20.390  1.00 72.23  ? 711 DT  O O4    1 
ATOM 814  C C5    . DT  C 1 11  ? 70.371 26.292 21.709  1.00 72.39  ? 711 DT  O C5    1 
ATOM 815  C C7    . DT  C 1 11  ? 69.659 26.744 22.945  1.00 72.28  ? 711 DT  O C7    1 
ATOM 816  C C6    . DT  C 1 11  ? 71.691 26.076 21.671  1.00 70.16  ? 711 DT  O C6    1 
ATOM 817  P P     . DA  C 1 12  ? 77.671 26.795 20.975  1.00 61.44  ? 712 DA  O P     1 
ATOM 818  O OP1   . DA  C 1 12  ? 78.986 26.333 20.453  1.00 47.06  ? 712 DA  O OP1   1 
ATOM 819  O OP2   . DA  C 1 12  ? 77.621 27.901 21.962  1.00 53.74  ? 712 DA  O OP2   1 
ATOM 820  O "O5'" . DA  C 1 12  ? 76.800 27.223 19.717  1.00 60.79  ? 712 DA  O "O5'" 1 
ATOM 821  C "C5'" . DA  C 1 12  ? 76.770 26.405 18.537  1.00 56.85  ? 712 DA  O "C5'" 1 
ATOM 822  C "C4'" . DA  C 1 12  ? 76.286 27.237 17.377  1.00 57.25  ? 712 DA  O "C4'" 1 
ATOM 823  O "O4'" . DA  C 1 12  ? 74.853 27.421 17.440  1.00 55.52  ? 712 DA  O "O4'" 1 
ATOM 824  C "C3'" . DA  C 1 12  ? 76.871 28.645 17.440  1.00 57.19  ? 712 DA  O "C3'" 1 
ATOM 825  O "O3'" . DA  C 1 12  ? 76.863 29.175 16.121  1.00 62.76  ? 712 DA  O "O3'" 1 
ATOM 826  C "C2'" . DA  C 1 12  ? 75.828 29.389 18.250  1.00 54.16  ? 712 DA  O "C2'" 1 
ATOM 827  C "C1'" . DA  C 1 12  ? 74.586 28.801 17.613  1.00 54.87  ? 712 DA  O "C1'" 1 
ATOM 828  N N9    . DA  C 1 12  ? 73.343 28.922 18.361  1.00 59.05  ? 712 DA  O N9    1 
ATOM 829  C C8    . DA  C 1 12  ? 73.116 28.793 19.705  1.00 61.24  ? 712 DA  O C8    1 
ATOM 830  N N7    . DA  C 1 12  ? 71.856 28.932 20.036  1.00 63.77  ? 712 DA  O N7    1 
ATOM 831  C C5    . DA  C 1 12  ? 71.216 29.178 18.828  1.00 65.28  ? 712 DA  O C5    1 
ATOM 832  C C6    . DA  C 1 12  ? 69.870 29.417 18.495  1.00 67.07  ? 712 DA  O C6    1 
ATOM 833  N N6    . DA  C 1 12  ? 68.880 29.438 19.390  1.00 70.20  ? 712 DA  O N6    1 
ATOM 834  N N1    . DA  C 1 12  ? 69.571 29.636 17.195  1.00 65.07  ? 712 DA  O N1    1 
ATOM 835  C C2    . DA  C 1 12  ? 70.565 29.614 16.299  1.00 64.05  ? 712 DA  O C2    1 
ATOM 836  N N3    . DA  C 1 12  ? 71.865 29.396 16.489  1.00 64.16  ? 712 DA  O N3    1 
ATOM 837  C C4    . DA  C 1 12  ? 72.125 29.182 17.790  1.00 62.51  ? 712 DA  O C4    1 
ATOM 838  P P     . DA  C 1 13  ? 78.244 29.472 15.372  1.00 64.12  ? 713 DA  O P     1 
ATOM 839  O OP1   . DA  C 1 13  ? 78.903 28.189 15.017  1.00 63.62  ? 713 DA  O OP1   1 
ATOM 840  O OP2   . DA  C 1 13  ? 78.966 30.470 16.199  1.00 68.95  ? 713 DA  O OP2   1 
ATOM 841  O "O5'" . DA  C 1 13  ? 77.745 30.156 14.027  1.00 64.10  ? 713 DA  O "O5'" 1 
ATOM 842  C "C5'" . DA  C 1 13  ? 76.751 29.515 13.206  1.00 71.37  ? 713 DA  O "C5'" 1 
ATOM 843  C "C4'" . DA  C 1 13  ? 75.766 30.540 12.697  1.00 78.25  ? 713 DA  O "C4'" 1 
ATOM 844  O "O4'" . DA  C 1 13  ? 74.653 30.691 13.612  1.00 80.82  ? 713 DA  O "O4'" 1 
ATOM 845  C "C3'" . DA  C 1 13  ? 76.389 31.926 12.556  1.00 83.83  ? 713 DA  O "C3'" 1 
ATOM 846  O "O3'" . DA  C 1 13  ? 75.889 32.554 11.371  1.00 83.88  ? 713 DA  O "O3'" 1 
ATOM 847  C "C2'" . DA  C 1 13  ? 75.978 32.614 13.849  1.00 82.82  ? 713 DA  O "C2'" 1 
ATOM 848  C "C1'" . DA  C 1 13  ? 74.594 32.030 14.085  1.00 80.99  ? 713 DA  O "C1'" 1 
ATOM 849  N N9    . DA  C 1 13  ? 74.126 31.996 15.472  1.00 79.34  ? 713 DA  O N9    1 
ATOM 850  C C8    . DA  C 1 13  ? 74.817 31.669 16.611  1.00 79.10  ? 713 DA  O C8    1 
ATOM 851  N N7    . DA  C 1 13  ? 74.084 31.694 17.699  1.00 78.52  ? 713 DA  O N7    1 
ATOM 852  C C5    . DA  C 1 13  ? 72.830 32.077 17.247  1.00 76.99  ? 713 DA  O C5    1 
ATOM 853  C C6    . DA  C 1 13  ? 71.604 32.281 17.906  1.00 75.89  ? 713 DA  O C6    1 
ATOM 854  N N6    . DA  C 1 13  ? 71.429 32.116 19.217  1.00 73.31  ? 713 DA  O N6    1 
ATOM 855  N N1    . DA  C 1 13  ? 70.545 32.660 17.161  1.00 75.63  ? 713 DA  O N1    1 
ATOM 856  C C2    . DA  C 1 13  ? 70.712 32.816 15.844  1.00 77.64  ? 713 DA  O C2    1 
ATOM 857  N N3    . DA  C 1 13  ? 71.809 32.649 15.110  1.00 80.11  ? 713 DA  O N3    1 
ATOM 858  C C4    . DA  C 1 13  ? 72.845 32.276 15.880  1.00 78.86  ? 713 DA  O C4    1 
ATOM 859  P P     . DG  C 1 14  ? 75.785 34.154 11.295  1.00 88.83  ? 714 DG  O P     1 
ATOM 860  O OP1   . DG  C 1 14  ? 75.844 34.562 9.868   1.00 91.43  ? 714 DG  O OP1   1 
ATOM 861  O OP2   . DG  C 1 14  ? 76.749 34.736 12.268  1.00 90.22  ? 714 DG  O OP2   1 
ATOM 862  O "O5'" . DG  C 1 14  ? 74.314 34.438 11.831  1.00 89.93  ? 714 DG  O "O5'" 1 
ATOM 863  C "C5'" . DG  C 1 14  ? 73.194 33.685 11.332  1.00 91.35  ? 714 DG  O "C5'" 1 
ATOM 864  C "C4'" . DG  C 1 14  ? 71.912 34.458 11.536  1.00 96.03  ? 714 DG  O "C4'" 1 
ATOM 865  O "O4'" . DG  C 1 14  ? 71.536 34.471 12.934  1.00 93.10  ? 714 DG  O "O4'" 1 
ATOM 866  C "C3'" . DG  C 1 14  ? 71.959 35.923 11.101  1.00 93.80  ? 714 DG  O "C3'" 1 
ATOM 867  O "O3'" . DG  C 1 14  ? 70.697 36.273 10.521  1.00 99.12  ? 714 DG  O "O3'" 1 
ATOM 868  C "C2'" . DG  C 1 14  ? 72.175 36.668 12.407  1.00 88.42  ? 714 DG  O "C2'" 1 
ATOM 869  C "C1'" . DG  C 1 14  ? 71.388 35.811 13.385  1.00 87.27  ? 714 DG  O "C1'" 1 
ATOM 870  N N9    . DG  C 1 14  ? 71.837 35.864 14.772  1.00 81.49  ? 714 DG  O N9    1 
ATOM 871  C C8    . DG  C 1 14  ? 73.101 35.614 15.247  1.00 79.90  ? 714 DG  O C8    1 
ATOM 872  N N7    . DG  C 1 14  ? 73.186 35.701 16.546  1.00 77.66  ? 714 DG  O N7    1 
ATOM 873  C C5    . DG  C 1 14  ? 71.903 36.035 16.948  1.00 77.11  ? 714 DG  O C5    1 
ATOM 874  C C6    . DG  C 1 14  ? 71.385 36.257 18.238  1.00 77.19  ? 714 DG  O C6    1 
ATOM 875  O O6    . DG  C 1 14  ? 71.980 36.188 19.315  1.00 78.60  ? 714 DG  O O6    1 
ATOM 876  N N1    . DG  C 1 14  ? 70.032 36.585 18.202  1.00 76.09  ? 714 DG  O N1    1 
ATOM 877  C C2    . DG  C 1 14  ? 69.273 36.678 17.061  1.00 75.18  ? 714 DG  O C2    1 
ATOM 878  N N2    . DG  C 1 14  ? 67.980 37.004 17.224  1.00 72.44  ? 714 DG  O N2    1 
ATOM 879  N N3    . DG  C 1 14  ? 69.748 36.465 15.847  1.00 77.20  ? 714 DG  O N3    1 
ATOM 880  C C4    . DG  C 1 14  ? 71.060 36.151 15.866  1.00 77.68  ? 714 DG  O C4    1 
ATOM 881  P P     . DG  C 1 15  ? 70.528 37.671 9.749   1.00 100.00 ? 715 DG  O P     1 
ATOM 882  O OP1   . DG  C 1 15  ? 69.967 37.384 8.401   1.00 98.67  ? 715 DG  O OP1   1 
ATOM 883  O OP2   . DG  C 1 15  ? 71.813 38.414 9.874   1.00 100.00 ? 715 DG  O OP2   1 
ATOM 884  O "O5'" . DG  C 1 15  ? 69.425 38.441 10.604  1.00 100.00 ? 715 DG  O "O5'" 1 
ATOM 885  C "C5'" . DG  C 1 15  ? 69.497 38.468 12.043  1.00 100.00 ? 715 DG  O "C5'" 1 
ATOM 886  C "C4'" . DG  C 1 15  ? 68.829 39.713 12.578  1.00 100.00 ? 715 DG  O "C4'" 1 
ATOM 887  O "O4'" . DG  C 1 15  ? 68.911 39.683 14.022  1.00 100.00 ? 715 DG  O "O4'" 1 
ATOM 888  C "C3'" . DG  C 1 15  ? 69.507 41.018 12.160  1.00 100.00 ? 715 DG  O "C3'" 1 
ATOM 889  O "O3'" . DG  C 1 15  ? 68.603 42.125 12.273  1.00 100.00 ? 715 DG  O "O3'" 1 
ATOM 890  C "C2'" . DG  C 1 15  ? 70.523 41.226 13.267  1.00 100.00 ? 715 DG  O "C2'" 1 
ATOM 891  C "C1'" . DG  C 1 15  ? 69.742 40.741 14.478  1.00 100.00 ? 715 DG  O "C1'" 1 
ATOM 892  N N9    . DG  C 1 15  ? 70.551 40.233 15.578  1.00 99.58  ? 715 DG  O N9    1 
ATOM 893  C C8    . DG  C 1 15  ? 71.754 39.571 15.510  1.00 98.70  ? 715 DG  O C8    1 
ATOM 894  N N7    . DG  C 1 15  ? 72.232 39.257 16.683  1.00 98.90  ? 715 DG  O N7    1 
ATOM 895  C C5    . DG  C 1 15  ? 71.285 39.739 17.577  1.00 100.00 ? 715 DG  O C5    1 
ATOM 896  C C6    . DG  C 1 15  ? 71.251 39.701 18.996  1.00 100.00 ? 715 DG  O C6    1 
ATOM 897  O O6    . DG  C 1 15  ? 72.088 39.221 19.773  1.00 100.00 ? 715 DG  O O6    1 
ATOM 898  N N1    . DG  C 1 15  ? 70.099 40.305 19.497  1.00 100.00 ? 715 DG  O N1    1 
ATOM 899  C C2    . DG  C 1 15  ? 69.108 40.877 18.734  1.00 100.00 ? 715 DG  O C2    1 
ATOM 900  N N2    . DG  C 1 15  ? 68.071 41.413 19.397  1.00 99.18  ? 715 DG  O N2    1 
ATOM 901  N N3    . DG  C 1 15  ? 69.132 40.922 17.413  1.00 99.53  ? 715 DG  O N3    1 
ATOM 902  C C4    . DG  C 1 15  ? 70.239 40.339 16.908  1.00 99.35  ? 715 DG  O C4    1 
ATOM 903  P P     . DC  D 2 2   ? 70.646 38.576 31.386  1.00 100.00 ? 717 DC  P P     1 
ATOM 904  O OP1   . DC  D 2 2   ? 69.715 38.301 32.517  1.00 100.00 ? 717 DC  P OP1   1 
ATOM 905  O OP2   . DC  D 2 2   ? 71.751 37.620 31.095  1.00 100.00 ? 717 DC  P OP2   1 
ATOM 906  O "O5'" . DC  D 2 2   ? 69.811 38.880 30.056  1.00 100.00 ? 717 DC  P "O5'" 1 
ATOM 907  C "C5'" . DC  D 2 2   ? 70.453 39.380 28.856  1.00 98.12  ? 717 DC  P "C5'" 1 
ATOM 908  C "C4'" . DC  D 2 2   ? 69.447 40.019 27.922  1.00 96.92  ? 717 DC  P "C4'" 1 
ATOM 909  O "O4'" . DC  D 2 2   ? 70.168 40.702 26.867  1.00 97.40  ? 717 DC  P "O4'" 1 
ATOM 910  C "C3'" . DC  D 2 2   ? 68.479 39.064 27.216  1.00 100.00 ? 717 DC  P "C3'" 1 
ATOM 911  O "O3'" . DC  D 2 2   ? 67.195 39.686 27.031  1.00 100.00 ? 717 DC  P "O3'" 1 
ATOM 912  C "C2'" . DC  D 2 2   ? 69.130 38.862 25.859  1.00 100.00 ? 717 DC  P "C2'" 1 
ATOM 913  C "C1'" . DC  D 2 2   ? 69.712 40.242 25.600  1.00 99.17  ? 717 DC  P "C1'" 1 
ATOM 914  N N1    . DC  D 2 2   ? 70.832 40.299 24.639  1.00 100.00 ? 717 DC  P N1    1 
ATOM 915  C C2    . DC  D 2 2   ? 70.546 40.239 23.264  1.00 100.00 ? 717 DC  P C2    1 
ATOM 916  O O2    . DC  D 2 2   ? 69.364 40.143 22.897  1.00 100.00 ? 717 DC  P O2    1 
ATOM 917  N N3    . DC  D 2 2   ? 71.563 40.291 22.371  1.00 99.59  ? 717 DC  P N3    1 
ATOM 918  C C4    . DC  D 2 2   ? 72.823 40.406 22.797  1.00 99.34  ? 717 DC  P C4    1 
ATOM 919  N N4    . DC  D 2 2   ? 73.792 40.463 21.877  1.00 96.95  ? 717 DC  P N4    1 
ATOM 920  C C5    . DC  D 2 2   ? 73.145 40.470 24.186  1.00 99.76  ? 717 DC  P C5    1 
ATOM 921  C C6    . DC  D 2 2   ? 72.130 40.412 25.063  1.00 100.00 ? 717 DC  P C6    1 
ATOM 922  P P     . DC  D 2 3   ? 65.858 38.785 26.950  1.00 100.00 ? 718 DC  P P     1 
ATOM 923  O OP1   . DC  D 2 3   ? 64.818 39.487 27.754  1.00 100.00 ? 718 DC  P OP1   1 
ATOM 924  O OP2   . DC  D 2 3   ? 66.229 37.384 27.295  1.00 100.00 ? 718 DC  P OP2   1 
ATOM 925  O "O5'" . DC  D 2 3   ? 65.411 38.829 25.416  1.00 100.00 ? 718 DC  P "O5'" 1 
ATOM 926  C "C5'" . DC  D 2 3   ? 64.494 37.843 24.869  1.00 100.00 ? 718 DC  P "C5'" 1 
ATOM 927  C "C4'" . DC  D 2 3   ? 64.153 38.152 23.427  1.00 100.00 ? 718 DC  P "C4'" 1 
ATOM 928  O "O4'" . DC  D 2 3   ? 65.382 38.398 22.701  1.00 100.00 ? 718 DC  P "O4'" 1 
ATOM 929  C "C3'" . DC  D 2 3   ? 63.440 37.016 22.681  1.00 100.00 ? 718 DC  P "C3'" 1 
ATOM 930  O "O3'" . DC  D 2 3   ? 62.436 37.483 21.761  1.00 100.00 ? 718 DC  P "O3'" 1 
ATOM 931  C "C2'" . DC  D 2 3   ? 64.567 36.336 21.925  1.00 100.00 ? 718 DC  P "C2'" 1 
ATOM 932  C "C1'" . DC  D 2 3   ? 65.512 37.487 21.616  1.00 100.00 ? 718 DC  P "C1'" 1 
ATOM 933  N N1    . DC  D 2 3   ? 66.918 37.063 21.546  1.00 100.00 ? 718 DC  P N1    1 
ATOM 934  C C2    . DC  D 2 3   ? 67.912 38.012 21.280  1.00 99.45  ? 718 DC  P C2    1 
ATOM 935  O O2    . DC  D 2 3   ? 67.584 39.194 21.085  1.00 97.33  ? 718 DC  P O2    1 
ATOM 936  N N3    . DC  D 2 3   ? 69.206 37.614 21.244  1.00 100.00 ? 718 DC  P N3    1 
ATOM 937  C C4    . DC  D 2 3   ? 69.518 36.333 21.462  1.00 100.00 ? 718 DC  P C4    1 
ATOM 938  N N4    . DC  D 2 3   ? 70.804 35.985 21.449  1.00 100.00 ? 718 DC  P N4    1 
ATOM 939  C C5    . DC  D 2 3   ? 68.524 35.348 21.713  1.00 99.54  ? 718 DC  P C5    1 
ATOM 940  C C6    . DC  D 2 3   ? 67.252 35.753 21.746  1.00 98.94  ? 718 DC  P C6    1 
ATOM 941  P P     . DT  D 2 4   ? 61.730 36.445 20.742  1.00 100.00 ? 719 DT  P P     1 
ATOM 942  O OP1   . DT  D 2 4   ? 60.555 37.093 20.097  1.00 100.00 ? 719 DT  P OP1   1 
ATOM 943  O OP2   . DT  D 2 4   ? 61.551 35.137 21.432  1.00 100.00 ? 719 DT  P OP2   1 
ATOM 944  O "O5'" . DT  D 2 4   ? 62.829 36.221 19.611  1.00 100.00 ? 719 DT  P "O5'" 1 
ATOM 945  C "C5'" . DT  D 2 4   ? 63.066 37.226 18.612  1.00 99.87  ? 719 DT  P "C5'" 1 
ATOM 946  C "C4'" . DT  D 2 4   ? 63.415 36.573 17.297  1.00 100.00 ? 719 DT  P "C4'" 1 
ATOM 947  O "O4'" . DT  D 2 4   ? 64.766 36.057 17.365  1.00 100.00 ? 719 DT  P "O4'" 1 
ATOM 948  C "C3'" . DT  D 2 4   ? 62.517 35.391 16.923  1.00 98.40  ? 719 DT  P "C3'" 1 
ATOM 949  O "O3'" . DT  D 2 4   ? 62.222 35.404 15.523  1.00 100.00 ? 719 DT  P "O3'" 1 
ATOM 950  C "C2'" . DT  D 2 4   ? 63.369 34.182 17.261  1.00 99.68  ? 719 DT  P "C2'" 1 
ATOM 951  C "C1'" . DT  D 2 4   ? 64.775 34.689 16.991  1.00 100.00 ? 719 DT  P "C1'" 1 
ATOM 952  N N1    . DT  D 2 4   ? 65.800 34.005 17.796  1.00 100.00 ? 719 DT  P N1    1 
ATOM 953  C C2    . DT  D 2 4   ? 66.956 33.578 17.181  1.00 99.29  ? 719 DT  P C2    1 
ATOM 954  O O2    . DT  D 2 4   ? 67.189 33.747 15.996  1.00 97.67  ? 719 DT  P O2    1 
ATOM 955  N N3    . DT  D 2 4   ? 67.838 32.936 18.013  1.00 99.76  ? 719 DT  P N3    1 
ATOM 956  C C4    . DT  D 2 4   ? 67.681 32.684 19.362  1.00 100.00 ? 719 DT  P C4    1 
ATOM 957  O O4    . DT  D 2 4   ? 68.565 32.098 19.979  1.00 100.00 ? 719 DT  P O4    1 
ATOM 958  C C5    . DT  D 2 4   ? 66.443 33.156 19.939  1.00 100.00 ? 719 DT  P C5    1 
ATOM 959  C C7    . DT  D 2 4   ? 66.172 32.907 21.389  1.00 98.98  ? 719 DT  P C7    1 
ATOM 960  C C6    . DT  D 2 4   ? 65.581 33.793 19.139  1.00 100.00 ? 719 DT  P C6    1 
ATOM 961  P P     . DT  D 2 5   ? 61.308 34.243 14.885  1.00 100.00 ? 720 DT  P P     1 
ATOM 962  O OP1   . DT  D 2 5   ? 60.184 34.925 14.191  1.00 100.00 ? 720 DT  P OP1   1 
ATOM 963  O OP2   . DT  D 2 5   ? 61.018 33.204 15.907  1.00 100.00 ? 720 DT  P OP2   1 
ATOM 964  O "O5'" . DT  D 2 5   ? 62.256 33.588 13.785  1.00 99.65  ? 720 DT  P "O5'" 1 
ATOM 965  C "C5'" . DT  D 2 5   ? 63.002 34.417 12.874  1.00 92.52  ? 720 DT  P "C5'" 1 
ATOM 966  C "C4'" . DT  D 2 5   ? 64.228 33.688 12.379  1.00 84.64  ? 720 DT  P "C4'" 1 
ATOM 967  O "O4'" . DT  D 2 5   ? 65.100 33.381 13.494  1.00 82.89  ? 720 DT  P "O4'" 1 
ATOM 968  C "C3'" . DT  D 2 5   ? 63.953 32.355 11.681  1.00 80.30  ? 720 DT  P "C3'" 1 
ATOM 969  O "O3'" . DT  D 2 5   ? 64.851 32.215 10.576  1.00 80.04  ? 720 DT  P "O3'" 1 
ATOM 970  C "C2'" . DT  D 2 5   ? 64.268 31.331 12.755  1.00 83.16  ? 720 DT  P "C2'" 1 
ATOM 971  C "C1'" . DT  D 2 5   ? 65.432 32.002 13.455  1.00 84.36  ? 720 DT  P "C1'" 1 
ATOM 972  N N1    . DT  D 2 5   ? 65.644 31.537 14.833  1.00 86.61  ? 720 DT  P N1    1 
ATOM 973  C C2    . DT  D 2 5   ? 66.854 30.957 15.142  1.00 89.15  ? 720 DT  P C2    1 
ATOM 974  O O2    . DT  D 2 5   ? 67.764 30.831 14.340  1.00 90.52  ? 720 DT  P O2    1 
ATOM 975  N N3    . DT  D 2 5   ? 66.966 30.523 16.436  1.00 89.95  ? 720 DT  P N3    1 
ATOM 976  C C4    . DT  D 2 5   ? 66.012 30.615 17.428  1.00 90.33  ? 720 DT  P C4    1 
ATOM 977  O O4    . DT  D 2 5   ? 66.258 30.181 18.547  1.00 93.18  ? 720 DT  P O4    1 
ATOM 978  C C5    . DT  D 2 5   ? 64.769 31.239 17.037  1.00 89.49  ? 720 DT  P C5    1 
ATOM 979  C C7    . DT  D 2 5   ? 63.675 31.375 18.048  1.00 90.29  ? 720 DT  P C7    1 
ATOM 980  C C6    . DT  D 2 5   ? 64.650 31.668 15.775  1.00 87.41  ? 720 DT  P C6    1 
ATOM 981  P P     . DA  D 2 6   ? 65.174 30.758 9.980   1.00 79.38  ? 721 DA  P P     1 
ATOM 982  O OP1   . DA  D 2 6   ? 65.495 30.938 8.542   1.00 77.43  ? 721 DA  P OP1   1 
ATOM 983  O OP2   . DA  D 2 6   ? 64.085 29.835 10.375  1.00 80.92  ? 721 DA  P OP2   1 
ATOM 984  O "O5'" . DA  D 2 6   ? 66.500 30.317 10.746  1.00 79.42  ? 721 DA  P "O5'" 1 
ATOM 985  C "C5'" . DA  D 2 6   ? 67.743 31.015 10.525  1.00 78.40  ? 721 DA  P "C5'" 1 
ATOM 986  C "C4'" . DA  D 2 6   ? 68.906 30.053 10.596  1.00 73.77  ? 721 DA  P "C4'" 1 
ATOM 987  O "O4'" . DA  D 2 6   ? 69.112 29.634 11.963  1.00 75.15  ? 721 DA  P "O4'" 1 
ATOM 988  C "C3'" . DA  D 2 6   ? 68.708 28.764 9.802   1.00 68.50  ? 721 DA  P "C3'" 1 
ATOM 989  O "O3'" . DA  D 2 6   ? 69.987 28.288 9.372   1.00 68.58  ? 721 DA  P "O3'" 1 
ATOM 990  C "C2'" . DA  D 2 6   ? 68.097 27.834 10.833  1.00 70.32  ? 721 DA  P "C2'" 1 
ATOM 991  C "C1'" . DA  D 2 6   ? 68.847 28.245 12.088  1.00 73.27  ? 721 DA  P "C1'" 1 
ATOM 992  N N9    . DA  D 2 6   ? 68.132 28.053 13.346  1.00 73.42  ? 721 DA  P N9    1 
ATOM 993  C C8    . DA  D 2 6   ? 66.828 28.339 13.669  1.00 73.19  ? 721 DA  P C8    1 
ATOM 994  N N7    . DA  D 2 6   ? 66.532 28.090 14.922  1.00 73.05  ? 721 DA  P N7    1 
ATOM 995  C C5    . DA  D 2 6   ? 67.716 27.596 15.452  1.00 72.82  ? 721 DA  P C5    1 
ATOM 996  C C6    . DA  D 2 6   ? 68.066 27.149 16.735  1.00 73.39  ? 721 DA  P C6    1 
ATOM 997  N N6    . DA  D 2 6   ? 67.224 27.134 17.767  1.00 74.46  ? 721 DA  P N6    1 
ATOM 998  N N1    . DA  D 2 6   ? 69.331 26.712 16.926  1.00 72.78  ? 721 DA  P N1    1 
ATOM 999  C C2    . DA  D 2 6   ? 70.178 26.727 15.891  1.00 72.70  ? 721 DA  P C2    1 
ATOM 1000 N N3    . DA  D 2 6   ? 69.968 27.125 14.640  1.00 73.43  ? 721 DA  P N3    1 
ATOM 1001 C C4    . DA  D 2 6   ? 68.703 27.554 14.488  1.00 73.15  ? 721 DA  P C4    1 
ATOM 1002 P P     . DT  D 2 7   ? 70.099 26.906 8.558   1.00 69.39  ? 722 DT  P P     1 
ATOM 1003 O OP1   . DT  D 2 7   ? 70.792 27.181 7.276   1.00 72.29  ? 722 DT  P OP1   1 
ATOM 1004 O OP2   . DT  D 2 7   ? 68.775 26.231 8.548   1.00 69.25  ? 722 DT  P OP2   1 
ATOM 1005 O "O5'" . DT  D 2 7   ? 71.084 26.038 9.455   1.00 62.83  ? 722 DT  P "O5'" 1 
ATOM 1006 C "C5'" . DT  D 2 7   ? 70.907 26.010 10.874  1.00 52.54  ? 722 DT  P "C5'" 1 
ATOM 1007 C "C4'" . DT  D 2 7   ? 72.132 25.442 11.544  1.00 48.01  ? 722 DT  P "C4'" 1 
ATOM 1008 O "O4'" . DT  D 2 7   ? 71.855 25.479 12.961  1.00 50.17  ? 722 DT  P "O4'" 1 
ATOM 1009 C "C3'" . DT  D 2 7   ? 72.429 23.981 11.209  1.00 44.57  ? 722 DT  P "C3'" 1 
ATOM 1010 O "O3'" . DT  D 2 7   ? 73.844 23.740 11.285  1.00 53.03  ? 722 DT  P "O3'" 1 
ATOM 1011 C "C2'" . DT  D 2 7   ? 71.647 23.233 12.270  1.00 49.37  ? 722 DT  P "C2'" 1 
ATOM 1012 C "C1'" . DT  D 2 7   ? 71.674 24.168 13.470  1.00 52.49  ? 722 DT  P "C1'" 1 
ATOM 1013 N N1    . DT  D 2 7   ? 70.434 24.171 14.269  1.00 54.10  ? 722 DT  P N1    1 
ATOM 1014 C C2    . DT  D 2 7   ? 70.497 23.773 15.587  1.00 55.13  ? 722 DT  P C2    1 
ATOM 1015 O O2    . DT  D 2 7   ? 71.531 23.418 16.135  1.00 54.98  ? 722 DT  P O2    1 
ATOM 1016 N N3    . DT  D 2 7   ? 69.295 23.810 16.249  1.00 55.58  ? 722 DT  P N3    1 
ATOM 1017 C C4    . DT  D 2 7   ? 68.071 24.201 15.742  1.00 56.03  ? 722 DT  P C4    1 
ATOM 1018 O O4    . DT  D 2 7   ? 67.076 24.189 16.460  1.00 56.64  ? 722 DT  P O4    1 
ATOM 1019 C C5    . DT  D 2 7   ? 68.079 24.609 14.359  1.00 56.48  ? 722 DT  P C5    1 
ATOM 1020 C C7    . DT  D 2 7   ? 66.798 25.060 13.731  1.00 55.17  ? 722 DT  P C7    1 
ATOM 1021 C C6    . DT  D 2 7   ? 69.243 24.569 13.699  1.00 55.60  ? 722 DT  P C6    1 
ATOM 1022 P P     . DT  D 2 8   ? 74.428 22.236 11.244  1.00 53.52  ? 723 DT  P P     1 
ATOM 1023 O OP1   . DT  D 2 8   ? 75.725 22.264 10.514  1.00 50.27  ? 723 DT  P OP1   1 
ATOM 1024 O OP2   . DT  D 2 8   ? 73.367 21.295 10.815  1.00 52.05  ? 723 DT  P OP2   1 
ATOM 1025 O "O5'" . DT  D 2 8   ? 74.770 21.917 12.767  1.00 54.72  ? 723 DT  P "O5'" 1 
ATOM 1026 C "C5'" . DT  D 2 8   ? 75.662 22.766 13.508  1.00 58.84  ? 723 DT  P "C5'" 1 
ATOM 1027 C "C4'" . DT  D 2 8   ? 75.893 22.195 14.886  1.00 66.85  ? 723 DT  P "C4'" 1 
ATOM 1028 O "O4'" . DT  D 2 8   ? 74.633 22.183 15.600  1.00 68.99  ? 723 DT  P "O4'" 1 
ATOM 1029 C "C3'" . DT  D 2 8   ? 76.391 20.750 14.877  1.00 70.50  ? 723 DT  P "C3'" 1 
ATOM 1030 O "O3'" . DT  D 2 8   ? 77.327 20.567 15.945  1.00 69.38  ? 723 DT  P "O3'" 1 
ATOM 1031 C "C2'" . DT  D 2 8   ? 75.121 19.938 15.068  1.00 69.35  ? 723 DT  P "C2'" 1 
ATOM 1032 C "C1'" . DT  D 2 8   ? 74.297 20.851 15.962  1.00 72.79  ? 723 DT  P "C1'" 1 
ATOM 1033 N N1    . DT  D 2 8   ? 72.829 20.707 15.889  1.00 76.10  ? 723 DT  P N1    1 
ATOM 1034 C C2    . DT  D 2 8   ? 72.189 20.158 16.981  1.00 78.09  ? 723 DT  P C2    1 
ATOM 1035 O O2    . DT  D 2 8   ? 72.779 19.746 17.967  1.00 78.30  ? 723 DT  P O2    1 
ATOM 1036 N N3    . DT  D 2 8   ? 70.822 20.098 16.874  1.00 79.01  ? 723 DT  P N3    1 
ATOM 1037 C C4    . DT  D 2 8   ? 70.050 20.506 15.804  1.00 79.44  ? 723 DT  P C4    1 
ATOM 1038 O O4    . DT  D 2 8   ? 68.828 20.405 15.855  1.00 78.98  ? 723 DT  P O4    1 
ATOM 1039 C C5    . DT  D 2 8   ? 70.785 21.040 14.682  1.00 79.16  ? 723 DT  P C5    1 
ATOM 1040 C C7    . DT  D 2 8   ? 70.019 21.477 13.475  1.00 80.47  ? 723 DT  P C7    1 
ATOM 1041 C C6    . DT  D 2 8   ? 72.121 21.117 14.778  1.00 77.71  ? 723 DT  P C6    1 
ATOM 1042 P P     . DT  D 2 9   ? 78.093 19.163 16.110  1.00 71.40  ? 724 DT  P P     1 
ATOM 1043 O OP1   . DT  D 2 9   ? 79.535 19.443 16.313  1.00 73.46  ? 724 DT  P OP1   1 
ATOM 1044 O OP2   . DT  D 2 9   ? 77.670 18.246 15.020  1.00 73.14  ? 724 DT  P OP2   1 
ATOM 1045 O "O5'" . DT  D 2 9   ? 77.510 18.603 17.479  1.00 70.19  ? 724 DT  P "O5'" 1 
ATOM 1046 C "C5'" . DT  D 2 9   ? 76.099 18.658 17.726  1.00 69.81  ? 724 DT  P "C5'" 1 
ATOM 1047 C "C4'" . DT  D 2 9   ? 75.740 17.859 18.954  1.00 71.84  ? 724 DT  P "C4'" 1 
ATOM 1048 O "O4'" . DT  D 2 9   ? 74.299 17.882 19.034  1.00 75.25  ? 724 DT  P "O4'" 1 
ATOM 1049 C "C3'" . DT  D 2 9   ? 76.121 16.380 18.894  1.00 74.61  ? 724 DT  P "C3'" 1 
ATOM 1050 O "O3'" . DT  D 2 9   ? 76.374 15.889 20.220  1.00 71.48  ? 724 DT  P "O3'" 1 
ATOM 1051 C "C2'" . DT  D 2 9   ? 74.913 15.743 18.233  1.00 76.29  ? 724 DT  P "C2'" 1 
ATOM 1052 C "C1'" . DT  D 2 9   ? 73.754 16.619 18.682  1.00 77.80  ? 724 DT  P "C1'" 1 
ATOM 1053 N N1    . DT  D 2 9   ? 72.743 16.849 17.634  1.00 79.01  ? 724 DT  P N1    1 
ATOM 1054 C C2    . DT  D 2 9   ? 71.428 16.993 18.019  1.00 79.71  ? 724 DT  P C2    1 
ATOM 1055 O O2    . DT  D 2 9   ? 71.059 16.922 19.179  1.00 80.66  ? 724 DT  P O2    1 
ATOM 1056 N N3    . DT  D 2 9   ? 70.554 17.223 16.987  1.00 80.27  ? 724 DT  P N3    1 
ATOM 1057 C C4    . DT  D 2 9   ? 70.854 17.318 15.643  1.00 79.41  ? 724 DT  P C4    1 
ATOM 1058 O O4    . DT  D 2 9   ? 69.960 17.544 14.833  1.00 76.84  ? 724 DT  P O4    1 
ATOM 1059 C C5    . DT  D 2 9   ? 72.250 17.142 15.311  1.00 79.42  ? 724 DT  P C5    1 
ATOM 1060 C C7    . DT  D 2 9   ? 72.668 17.210 13.878  1.00 82.01  ? 724 DT  P C7    1 
ATOM 1061 C C6    . DT  D 2 9   ? 73.114 16.923 16.309  1.00 77.79  ? 724 DT  P C6    1 
ATOM 1062 P P     . DG  D 2 10  ? 76.444 14.306 20.504  1.00 68.17  ? 725 DG  P P     1 
ATOM 1063 O OP1   . DG  D 2 10  ? 77.436 14.081 21.584  1.00 66.20  ? 725 DG  P OP1   1 
ATOM 1064 O OP2   . DG  D 2 10  ? 76.558 13.540 19.236  1.00 60.84  ? 725 DG  P OP2   1 
ATOM 1065 O "O5'" . DG  D 2 10  ? 75.014 14.016 21.129  1.00 67.31  ? 725 DG  P "O5'" 1 
ATOM 1066 C "C5'" . DG  D 2 10  ? 74.512 14.835 22.196  1.00 72.30  ? 725 DG  P "C5'" 1 
ATOM 1067 C "C4'" . DG  D 2 10  ? 73.286 14.188 22.790  1.00 83.03  ? 725 DG  P "C4'" 1 
ATOM 1068 O "O4'" . DG  D 2 10  ? 72.140 14.413 21.941  1.00 84.04  ? 725 DG  P "O4'" 1 
ATOM 1069 C "C3'" . DG  D 2 10  ? 73.435 12.672 22.902  1.00 85.93  ? 725 DG  P "C3'" 1 
ATOM 1070 O "O3'" . DG  D 2 10  ? 72.661 12.215 24.010  1.00 89.33  ? 725 DG  P "O3'" 1 
ATOM 1071 C "C2'" . DG  D 2 10  ? 72.815 12.184 21.604  1.00 84.44  ? 725 DG  P "C2'" 1 
ATOM 1072 C "C1'" . DG  D 2 10  ? 71.676 13.176 21.428  1.00 86.55  ? 725 DG  P "C1'" 1 
ATOM 1073 N N9    . DG  D 2 10  ? 71.215 13.421 20.068  1.00 89.05  ? 725 DG  P N9    1 
ATOM 1074 C C8    . DG  D 2 10  ? 71.964 13.493 18.918  1.00 91.17  ? 725 DG  P C8    1 
ATOM 1075 N N7    . DG  D 2 10  ? 71.252 13.778 17.861  1.00 91.25  ? 725 DG  P N7    1 
ATOM 1076 C C5    . DG  D 2 10  ? 69.954 13.886 18.343  1.00 90.76  ? 725 DG  P C5    1 
ATOM 1077 C C6    . DG  D 2 10  ? 68.745 14.184 17.668  1.00 90.58  ? 725 DG  P C6    1 
ATOM 1078 O O6    . DG  D 2 10  ? 68.572 14.420 16.467  1.00 88.51  ? 725 DG  P O6    1 
ATOM 1079 N N1    . DG  D 2 10  ? 67.663 14.197 18.543  1.00 89.45  ? 725 DG  P N1    1 
ATOM 1080 C C2    . DG  D 2 10  ? 67.735 13.960 19.895  1.00 87.93  ? 725 DG  P C2    1 
ATOM 1081 N N2    . DG  D 2 10  ? 66.587 14.039 20.577  1.00 86.13  ? 725 DG  P N2    1 
ATOM 1082 N N3    . DG  D 2 10  ? 68.853 13.676 20.534  1.00 88.93  ? 725 DG  P N3    1 
ATOM 1083 C C4    . DG  D 2 10  ? 69.916 13.659 19.702  1.00 90.44  ? 725 DG  P C4    1 
ATOM 1084 P P     . DC  D 2 11  ? 73.074 12.631 25.506  1.00 88.99  ? 726 DC  P P     1 
ATOM 1085 O OP1   . DC  D 2 11  ? 73.368 14.088 25.585  1.00 82.23  ? 726 DC  P OP1   1 
ATOM 1086 O OP2   . DC  D 2 11  ? 74.097 11.648 25.948  1.00 84.32  ? 726 DC  P OP2   1 
ATOM 1087 O "O5'" . DC  D 2 11  ? 71.718 12.391 26.305  1.00 90.92  ? 726 DC  P "O5'" 1 
ATOM 1088 C "C5'" . DC  D 2 11  ? 71.133 11.079 26.363  1.00 96.48  ? 726 DC  P "C5'" 1 
ATOM 1089 C "C4'" . DC  D 2 11  ? 69.627 11.159 26.269  1.00 93.09  ? 726 DC  P "C4'" 1 
ATOM 1090 O "O4'" . DC  D 2 11  ? 69.220 11.440 24.906  1.00 91.00  ? 726 DC  P "O4'" 1 
ATOM 1091 C "C3'" . DC  D 2 11  ? 68.963 9.831  26.627  1.00 89.98  ? 726 DC  P "C3'" 1 
ATOM 1092 O "O3'" . DC  D 2 11  ? 67.731 10.065 27.314  1.00 86.17  ? 726 DC  P "O3'" 1 
ATOM 1093 C "C2'" . DC  D 2 11  ? 68.739 9.174  25.279  1.00 90.06  ? 726 DC  P "C2'" 1 
ATOM 1094 C "C1'" . DC  D 2 11  ? 68.433 10.369 24.395  1.00 90.05  ? 726 DC  P "C1'" 1 
ATOM 1095 N N1    . DC  D 2 11  ? 68.778 10.178 22.976  1.00 91.26  ? 726 DC  P N1    1 
ATOM 1096 C C2    . DC  D 2 11  ? 67.751 10.190 22.016  1.00 90.05  ? 726 DC  P C2    1 
ATOM 1097 O O2    . DC  D 2 11  ? 66.573 10.333 22.385  1.00 91.12  ? 726 DC  P O2    1 
ATOM 1098 N N3    . DC  D 2 11  ? 68.070 10.041 20.710  1.00 88.93  ? 726 DC  P N3    1 
ATOM 1099 C C4    . DC  D 2 11  ? 69.344 9.874  20.348  1.00 88.23  ? 726 DC  P C4    1 
ATOM 1100 N N4    . DC  D 2 11  ? 69.611 9.741  19.050  1.00 86.07  ? 726 DC  P N4    1 
ATOM 1101 C C5    . DC  D 2 11  ? 70.402 9.840  21.302  1.00 88.79  ? 726 DC  P C5    1 
ATOM 1102 C C6    . DC  D 2 11  ? 70.078 9.995  22.591  1.00 89.51  ? 726 DC  P C6    1 
ATOM 1103 P P     . DA  D 2 12  ? 67.042 8.872  28.134  1.00 79.71  ? 727 DA  P P     1 
ATOM 1104 O OP1   . DA  D 2 12  ? 66.222 9.468  29.219  1.00 75.13  ? 727 DA  P OP1   1 
ATOM 1105 O OP2   . DA  D 2 12  ? 68.082 7.862  28.454  1.00 77.18  ? 727 DA  P OP2   1 
ATOM 1106 O "O5'" . DA  D 2 12  ? 66.056 8.219  27.074  1.00 83.27  ? 727 DA  P "O5'" 1 
ATOM 1107 C "C5'" . DA  D 2 12  ? 64.865 8.905  26.654  1.00 84.79  ? 727 DA  P "C5'" 1 
ATOM 1108 C "C4'" . DA  D 2 12  ? 64.095 8.021  25.705  1.00 89.34  ? 727 DA  P "C4'" 1 
ATOM 1109 O "O4'" . DA  D 2 12  ? 64.795 7.982  24.438  1.00 90.45  ? 727 DA  P "O4'" 1 
ATOM 1110 C "C3'" . DA  D 2 12  ? 64.029 6.572  26.191  1.00 91.78  ? 727 DA  P "C3'" 1 
ATOM 1111 O "O3'" . DA  D 2 12  ? 62.791 5.968  25.794  1.00 89.72  ? 727 DA  P "O3'" 1 
ATOM 1112 C "C2'" . DA  D 2 12  ? 65.217 5.928  25.499  1.00 90.73  ? 727 DA  P "C2'" 1 
ATOM 1113 C "C1'" . DA  D 2 12  ? 65.216 6.653  24.165  1.00 90.13  ? 727 DA  P "C1'" 1 
ATOM 1114 N N9    . DA  D 2 12  ? 66.509 6.722  23.486  1.00 90.47  ? 727 DA  P N9    1 
ATOM 1115 C C8    . DA  D 2 12  ? 67.755 6.898  24.029  1.00 92.12  ? 727 DA  P C8    1 
ATOM 1116 N N7    . DA  D 2 12  ? 68.717 6.945  23.139  1.00 92.72  ? 727 DA  P N7    1 
ATOM 1117 C C5    . DA  D 2 12  ? 68.059 6.779  21.930  1.00 89.84  ? 727 DA  P C5    1 
ATOM 1118 C C6    . DA  D 2 12  ? 68.515 6.738  20.604  1.00 89.33  ? 727 DA  P C6    1 
ATOM 1119 N N6    . DA  D 2 12  ? 69.793 6.886  20.253  1.00 86.69  ? 727 DA  P N6    1 
ATOM 1120 N N1    . DA  D 2 12  ? 67.598 6.543  19.634  1.00 90.52  ? 727 DA  P N1    1 
ATOM 1121 C C2    . DA  D 2 12  ? 66.313 6.411  19.982  1.00 91.22  ? 727 DA  P C2    1 
ATOM 1122 N N3    . DA  D 2 12  ? 65.761 6.443  21.190  1.00 90.51  ? 727 DA  P N3    1 
ATOM 1123 C C4    . DA  D 2 12  ? 66.700 6.631  22.131  1.00 89.69  ? 727 DA  P C4    1 
ATOM 1124 P P     . DT  D 2 13  ? 62.478 4.440  26.189  1.00 87.11  ? 728 DT  P P     1 
ATOM 1125 O OP1   . DT  D 2 13  ? 61.004 4.353  26.325  1.00 84.45  ? 728 DT  P OP1   1 
ATOM 1126 O OP2   . DT  D 2 13  ? 63.353 3.994  27.307  1.00 87.72  ? 728 DT  P OP2   1 
ATOM 1127 O "O5'" . DT  D 2 13  ? 62.880 3.608  24.894  1.00 84.56  ? 728 DT  P "O5'" 1 
ATOM 1128 C "C5'" . DT  D 2 13  ? 63.626 4.216  23.827  1.00 87.98  ? 728 DT  P "C5'" 1 
ATOM 1129 C "C4'" . DT  D 2 13  ? 62.840 4.141  22.541  1.00 91.48  ? 728 DT  P "C4'" 1 
ATOM 1130 O "O4'" . DT  D 2 13  ? 63.726 4.444  21.439  1.00 94.18  ? 728 DT  P "O4'" 1 
ATOM 1131 C "C3'" . DT  D 2 13  ? 62.339 2.727  22.271  1.00 91.98  ? 728 DT  P "C3'" 1 
ATOM 1132 O "O3'" . DT  D 2 13  ? 61.157 2.764  21.472  1.00 89.52  ? 728 DT  P "O3'" 1 
ATOM 1133 C "C2'" . DT  D 2 13  ? 63.495 2.092  21.526  1.00 93.40  ? 728 DT  P "C2'" 1 
ATOM 1134 C "C1'" . DT  D 2 13  ? 64.089 3.255  20.746  1.00 93.59  ? 728 DT  P "C1'" 1 
ATOM 1135 N N1    . DT  D 2 13  ? 65.560 3.188  20.720  1.00 93.25  ? 728 DT  P N1    1 
ATOM 1136 C C2    . DT  D 2 13  ? 66.201 2.907  19.534  1.00 93.78  ? 728 DT  P C2    1 
ATOM 1137 O O2    . DT  D 2 13  ? 65.615 2.732  18.477  1.00 95.39  ? 728 DT  P O2    1 
ATOM 1138 N N3    . DT  D 2 13  ? 67.569 2.844  19.631  1.00 92.45  ? 728 DT  P N3    1 
ATOM 1139 C C4    . DT  D 2 13  ? 68.336 3.048  20.761  1.00 91.34  ? 728 DT  P C4    1 
ATOM 1140 O O4    . DT  D 2 13  ? 69.557 2.963  20.694  1.00 92.38  ? 728 DT  P O4    1 
ATOM 1141 C C5    . DT  D 2 13  ? 67.597 3.356  21.962  1.00 89.91  ? 728 DT  P C5    1 
ATOM 1142 C C7    . DT  D 2 13  ? 68.343 3.614  23.232  1.00 86.91  ? 728 DT  P C7    1 
ATOM 1143 C C6    . DT  D 2 13  ? 66.265 3.402  21.884  1.00 90.47  ? 728 DT  P C6    1 
ATOM 1144 P P     . DA  D 2 14  ? 60.346 1.407  21.202  1.00 86.63  ? 729 DA  P P     1 
ATOM 1145 O OP1   . DA  D 2 14  ? 58.906 1.746  21.339  1.00 87.90  ? 729 DA  P OP1   1 
ATOM 1146 O OP2   . DA  D 2 14  ? 60.940 0.329  22.039  1.00 79.50  ? 729 DA  P OP2   1 
ATOM 1147 O "O5'" . DA  D 2 14  ? 60.663 1.071  19.679  1.00 82.02  ? 729 DA  P "O5'" 1 
ATOM 1148 C "C5'" . DA  D 2 14  ? 60.297 1.977  18.625  1.00 78.38  ? 729 DA  P "C5'" 1 
ATOM 1149 C "C4'" . DA  D 2 14  ? 60.818 1.448  17.310  1.00 81.80  ? 729 DA  P "C4'" 1 
ATOM 1150 O "O4'" . DA  D 2 14  ? 62.263 1.463  17.356  1.00 83.47  ? 729 DA  P "O4'" 1 
ATOM 1151 C "C3'" . DA  D 2 14  ? 60.434 -0.010 17.078  1.00 82.82  ? 729 DA  P "C3'" 1 
ATOM 1152 O "O3'" . DA  D 2 14  ? 60.334 -0.272 15.676  1.00 87.56  ? 729 DA  P "O3'" 1 
ATOM 1153 C "C2'" . DA  D 2 14  ? 61.597 -0.767 17.691  1.00 83.25  ? 729 DA  P "C2'" 1 
ATOM 1154 C "C1'" . DA  D 2 14  ? 62.767 0.136  17.346  1.00 83.11  ? 729 DA  P "C1'" 1 
ATOM 1155 N N9    . DA  D 2 14  ? 63.872 0.074  18.298  1.00 83.97  ? 729 DA  P N9    1 
ATOM 1156 C C8    . DA  D 2 14  ? 63.822 0.087  19.669  1.00 83.76  ? 729 DA  P C8    1 
ATOM 1157 N N7    . DA  D 2 14  ? 65.000 0.034  20.241  1.00 84.19  ? 729 DA  P N7    1 
ATOM 1158 C C5    . DA  D 2 14  ? 65.885 -0.024 19.173  1.00 85.46  ? 729 DA  P C5    1 
ATOM 1159 C C6    . DA  D 2 14  ? 67.285 -0.094 19.107  1.00 84.85  ? 729 DA  P C6    1 
ATOM 1160 N N6    . DA  D 2 14  ? 68.076 -0.107 20.181  1.00 83.79  ? 729 DA  P N6    1 
ATOM 1161 N N1    . DA  D 2 14  ? 67.854 -0.146 17.882  1.00 85.35  ? 729 DA  P N1    1 
ATOM 1162 C C2    . DA  D 2 14  ? 67.060 -0.124 16.804  1.00 84.49  ? 729 DA  P C2    1 
ATOM 1163 N N3    . DA  D 2 14  ? 65.734 -0.054 16.738  1.00 83.95  ? 729 DA  P N3    1 
ATOM 1164 C C4    . DA  D 2 14  ? 65.202 -0.006 17.970  1.00 84.90  ? 729 DA  P C4    1 
ATOM 1165 P P     . DC  D 2 15  ? 60.276 -1.790 15.155  1.00 92.94  ? 730 DC  P P     1 
ATOM 1166 O OP1   . DC  D 2 15  ? 59.778 -1.741 13.755  1.00 92.11  ? 730 DC  P OP1   1 
ATOM 1167 O OP2   . DC  D 2 15  ? 59.558 -2.609 16.165  1.00 91.30  ? 730 DC  P OP2   1 
ATOM 1168 O "O5'" . DC  D 2 15  ? 61.801 -2.252 15.146  1.00 94.39  ? 730 DC  P "O5'" 1 
ATOM 1169 C "C5'" . DC  D 2 15  ? 62.726 -1.713 14.180  1.00 100.00 ? 730 DC  P "C5'" 1 
ATOM 1170 C "C4'" . DC  D 2 15  ? 64.004 -2.522 14.141  1.00 100.00 ? 730 DC  P "C4'" 1 
ATOM 1171 O "O4'" . DC  D 2 15  ? 64.832 -2.244 15.296  1.00 97.94  ? 730 DC  P "O4'" 1 
ATOM 1172 C "C3'" . DC  D 2 15  ? 63.847 -4.043 14.083  1.00 100.00 ? 730 DC  P "C3'" 1 
ATOM 1173 O "O3'" . DC  D 2 15  ? 64.880 -4.645 13.294  1.00 100.00 ? 730 DC  P "O3'" 1 
ATOM 1174 C "C2'" . DC  D 2 15  ? 64.159 -4.474 15.505  1.00 98.98  ? 730 DC  P "C2'" 1 
ATOM 1175 C "C1'" . DC  D 2 15  ? 65.238 -3.473 15.877  1.00 98.54  ? 730 DC  P "C1'" 1 
ATOM 1176 N N1    . DC  D 2 15  ? 65.405 -3.265 17.320  1.00 98.91  ? 730 DC  P N1    1 
ATOM 1177 C C2    . DC  D 2 15  ? 66.671 -3.448 17.878  1.00 99.92  ? 730 DC  P C2    1 
ATOM 1178 O O2    . DC  D 2 15  ? 67.609 -3.786 17.141  1.00 99.28  ? 730 DC  P O2    1 
ATOM 1179 N N3    . DC  D 2 15  ? 66.842 -3.259 19.207  1.00 100.00 ? 730 DC  P N3    1 
ATOM 1180 C C4    . DC  D 2 15  ? 65.804 -2.905 19.969  1.00 100.00 ? 730 DC  P C4    1 
ATOM 1181 N N4    . DC  D 2 15  ? 66.018 -2.720 21.272  1.00 100.00 ? 730 DC  P N4    1 
ATOM 1182 C C5    . DC  D 2 15  ? 64.500 -2.720 19.426  1.00 99.89  ? 730 DC  P C5    1 
ATOM 1183 C C6    . DC  D 2 15  ? 64.348 -2.904 18.108  1.00 100.00 ? 730 DC  P C6    1 
ATOM 1184 N N     . GLU E 3 5   ? -5.400 22.571 16.001  1.00 95.23  ? 2   GLU A N     1 
ATOM 1185 C CA    . GLU E 3 5   ? -4.213 22.544 15.155  1.00 98.77  ? 2   GLU A CA    1 
ATOM 1186 C C     . GLU E 3 5   ? -3.636 23.951 14.996  1.00 100.00 ? 2   GLU A C     1 
ATOM 1187 O O     . GLU E 3 5   ? -4.360 24.941 15.128  1.00 100.00 ? 2   GLU A O     1 
ATOM 1188 C CB    . GLU E 3 5   ? -4.561 21.961 13.782  1.00 100.00 ? 2   GLU A CB    1 
ATOM 1189 N N     . PRO E 3 6   ? -2.316 24.056 14.739  1.00 100.00 ? 3   PRO A N     1 
ATOM 1190 C CA    . PRO E 3 6   ? -1.608 25.331 14.557  1.00 100.00 ? 3   PRO A CA    1 
ATOM 1191 C C     . PRO E 3 6   ? -2.221 26.193 13.449  1.00 100.00 ? 3   PRO A C     1 
ATOM 1192 O O     . PRO E 3 6   ? -2.539 25.693 12.366  1.00 100.00 ? 3   PRO A O     1 
ATOM 1193 C CB    . PRO E 3 6   ? -0.194 24.878 14.190  1.00 100.00 ? 3   PRO A CB    1 
ATOM 1194 C CG    . PRO E 3 6   ? -0.044 23.607 14.966  1.00 100.00 ? 3   PRO A CG    1 
ATOM 1195 C CD    . PRO E 3 6   ? -1.367 22.927 14.705  1.00 100.00 ? 3   PRO A CD    1 
ATOM 1196 N N     . SER E 3 7   ? -2.356 27.489 13.722  1.00 99.86  ? 4   SER A N     1 
ATOM 1197 C CA    . SER E 3 7   ? -2.942 28.448 12.781  1.00 100.00 ? 4   SER A CA    1 
ATOM 1198 C C     . SER E 3 7   ? -2.243 28.522 11.417  1.00 100.00 ? 4   SER A C     1 
ATOM 1199 O O     . SER E 3 7   ? -1.255 27.823 11.167  1.00 100.00 ? 4   SER A O     1 
ATOM 1200 C CB    . SER E 3 7   ? -2.953 29.842 13.413  1.00 96.15  ? 4   SER A CB    1 
ATOM 1201 O OG    . SER E 3 7   ? -3.601 29.838 14.671  1.00 89.13  ? 4   SER A OG    1 
ATOM 1202 N N     . ASP E 3 8   ? -2.791 29.346 10.525  1.00 100.00 ? 5   ASP A N     1 
ATOM 1203 C CA    . ASP E 3 8   ? -2.210 29.540 9.200   1.00 98.46  ? 5   ASP A CA    1 
ATOM 1204 C C     . ASP E 3 8   ? -1.524 30.907 9.183   1.00 98.49  ? 5   ASP A C     1 
ATOM 1205 O O     . ASP E 3 8   ? -1.651 31.682 10.132  1.00 100.00 ? 5   ASP A O     1 
ATOM 1206 C CB    . ASP E 3 8   ? -3.285 29.464 8.103   1.00 95.32  ? 5   ASP A CB    1 
ATOM 1207 C CG    . ASP E 3 8   ? -4.084 30.753 7.963   1.00 92.82  ? 5   ASP A CG    1 
ATOM 1208 O OD1   . ASP E 3 8   ? -4.845 31.096 8.895   1.00 92.22  ? 5   ASP A OD1   1 
ATOM 1209 O OD2   . ASP E 3 8   ? -3.946 31.421 6.915   1.00 79.12  ? 5   ASP A OD2   1 
ATOM 1210 N N     . LEU E 3 9   ? -0.812 31.196 8.097   1.00 93.76  ? 6   LEU A N     1 
ATOM 1211 C CA    . LEU E 3 9   ? -0.098 32.462 7.927   1.00 89.90  ? 6   LEU A CA    1 
ATOM 1212 C C     . LEU E 3 9   ? -0.904 33.690 8.337   1.00 82.89  ? 6   LEU A C     1 
ATOM 1213 O O     . LEU E 3 9   ? -0.453 34.507 9.144   1.00 72.82  ? 6   LEU A O     1 
ATOM 1214 C CB    . LEU E 3 9   ? 0.316  32.621 6.463   1.00 94.93  ? 6   LEU A CB    1 
ATOM 1215 C CG    . LEU E 3 9   ? 0.646  34.043 5.999   1.00 97.58  ? 6   LEU A CG    1 
ATOM 1216 C CD1   . LEU E 3 9   ? 1.912  34.527 6.685   1.00 94.66  ? 6   LEU A CD1   1 
ATOM 1217 C CD2   . LEU E 3 9   ? 0.793  34.078 4.487   1.00 100.00 ? 6   LEU A CD2   1 
ATOM 1218 N N     . GLU E 3 10  ? -2.092 33.803 7.752   1.00 81.32  ? 7   GLU A N     1 
ATOM 1219 C CA    . GLU E 3 10  ? -3.006 34.913 7.986   1.00 79.85  ? 7   GLU A CA    1 
ATOM 1220 C C     . GLU E 3 10  ? -3.339 35.177 9.451   1.00 79.09  ? 7   GLU A C     1 
ATOM 1221 O O     . GLU E 3 10  ? -3.871 36.236 9.789   1.00 75.88  ? 7   GLU A O     1 
ATOM 1222 C CB    . GLU E 3 10  ? -4.292 34.695 7.186   1.00 82.86  ? 7   GLU A CB    1 
ATOM 1223 C CG    . GLU E 3 10  ? -4.924 35.977 6.692   1.00 89.83  ? 7   GLU A CG    1 
ATOM 1224 C CD    . GLU E 3 10  ? -3.931 36.837 5.935   1.00 99.74  ? 7   GLU A CD    1 
ATOM 1225 O OE1   . GLU E 3 10  ? -3.444 37.834 6.512   1.00 100.00 ? 7   GLU A OE1   1 
ATOM 1226 O OE2   . GLU E 3 10  ? -3.620 36.504 4.772   1.00 100.00 ? 7   GLU A OE2   1 
ATOM 1227 N N     . GLU E 3 11  ? -2.986 34.234 10.318  1.00 82.22  ? 8   GLU A N     1 
ATOM 1228 C CA    . GLU E 3 11  ? -3.248 34.358 11.746  1.00 85.55  ? 8   GLU A CA    1 
ATOM 1229 C C     . GLU E 3 11  ? -1.986 34.604 12.575  1.00 85.63  ? 8   GLU A C     1 
ATOM 1230 O O     . GLU E 3 11  ? -2.060 35.165 13.670  1.00 85.53  ? 8   GLU A O     1 
ATOM 1231 C CB    . GLU E 3 11  ? -3.969 33.107 12.253  1.00 87.09  ? 8   GLU A CB    1 
ATOM 1232 N N     . LEU E 3 12  ? -0.832 34.205 12.045  1.00 86.40  ? 9   LEU A N     1 
ATOM 1233 C CA    . LEU E 3 12  ? 0.436  34.370 12.753  1.00 88.66  ? 9   LEU A CA    1 
ATOM 1234 C C     . LEU E 3 12  ? 0.932  35.812 12.902  1.00 88.57  ? 9   LEU A C     1 
ATOM 1235 O O     . LEU E 3 12  ? 1.350  36.213 13.990  1.00 89.14  ? 9   LEU A O     1 
ATOM 1236 C CB    . LEU E 3 12  ? 1.516  33.481 12.131  1.00 91.38  ? 9   LEU A CB    1 
ATOM 1237 C CG    . LEU E 3 12  ? 1.573  32.022 12.610  1.00 91.96  ? 9   LEU A CG    1 
ATOM 1238 C CD1   . LEU E 3 12  ? 1.942  31.971 14.086  1.00 96.27  ? 9   LEU A CD1   1 
ATOM 1239 C CD2   . LEU E 3 12  ? 0.249  31.320 12.378  1.00 92.35  ? 9   LEU A CD2   1 
ATOM 1240 N N     . GLU E 3 13  ? 0.898  36.584 11.818  1.00 86.90  ? 10  GLU A N     1 
ATOM 1241 C CA    . GLU E 3 13  ? 1.335  37.981 11.862  1.00 88.92  ? 10  GLU A CA    1 
ATOM 1242 C C     . GLU E 3 13  ? 0.414  38.810 12.759  1.00 87.77  ? 10  GLU A C     1 
ATOM 1243 O O     . GLU E 3 13  ? 0.801  39.871 13.254  1.00 84.22  ? 10  GLU A O     1 
ATOM 1244 C CB    . GLU E 3 13  ? 1.371  38.591 10.453  1.00 94.08  ? 10  GLU A CB    1 
ATOM 1245 C CG    . GLU E 3 13  ? 0.006  38.916 9.842   1.00 98.13  ? 10  GLU A CG    1 
ATOM 1246 C CD    . GLU E 3 13  ? -0.819 37.681 9.540   1.00 100.00 ? 10  GLU A CD    1 
ATOM 1247 O OE1   . GLU E 3 13  ? -1.405 37.113 10.483  1.00 100.00 ? 10  GLU A OE1   1 
ATOM 1248 O OE2   . GLU E 3 13  ? -0.882 37.280 8.359   1.00 100.00 ? 10  GLU A OE2   1 
ATOM 1249 N N     . GLN E 3 14  ? -0.806 38.312 12.953  1.00 88.05  ? 11  GLN A N     1 
ATOM 1250 C CA    . GLN E 3 14  ? -1.807 38.972 13.787  1.00 91.59  ? 11  GLN A CA    1 
ATOM 1251 C C     . GLN E 3 14  ? -1.404 38.843 15.251  1.00 90.59  ? 11  GLN A C     1 
ATOM 1252 O O     . GLN E 3 14  ? -1.372 39.827 15.993  1.00 88.83  ? 11  GLN A O     1 
ATOM 1253 C CB    . GLN E 3 14  ? -3.179 38.327 13.567  1.00 88.81  ? 11  GLN A CB    1 
ATOM 1254 N N     . PHE E 3 15  ? -1.074 37.616 15.641  1.00 88.26  ? 12  PHE A N     1 
ATOM 1255 C CA    . PHE E 3 15  ? -0.646 37.300 16.997  1.00 87.23  ? 12  PHE A CA    1 
ATOM 1256 C C     . PHE E 3 15  ? 0.633  38.076 17.299  1.00 85.60  ? 12  PHE A C     1 
ATOM 1257 O O     . PHE E 3 15  ? 0.911  38.409 18.450  1.00 81.26  ? 12  PHE A O     1 
ATOM 1258 C CB    . PHE E 3 15  ? -0.382 35.793 17.091  1.00 92.66  ? 12  PHE A CB    1 
ATOM 1259 C CG    . PHE E 3 15  ? -0.201 35.283 18.493  1.00 99.20  ? 12  PHE A CG    1 
ATOM 1260 C CD1   . PHE E 3 15  ? -1.304 35.011 19.296  1.00 100.00 ? 12  PHE A CD1   1 
ATOM 1261 C CD2   . PHE E 3 15  ? 1.071  35.035 18.999  1.00 100.00 ? 12  PHE A CD2   1 
ATOM 1262 C CE1   . PHE E 3 15  ? -1.143 34.495 20.581  1.00 100.00 ? 12  PHE A CE1   1 
ATOM 1263 C CE2   . PHE E 3 15  ? 1.243  34.520 20.283  1.00 100.00 ? 12  PHE A CE2   1 
ATOM 1264 C CZ    . PHE E 3 15  ? 0.134  34.249 21.074  1.00 99.81  ? 12  PHE A CZ    1 
ATOM 1265 N N     . ALA E 3 16  ? 1.381  38.389 16.242  1.00 88.53  ? 13  ALA A N     1 
ATOM 1266 C CA    . ALA E 3 16  ? 2.644  39.117 16.341  1.00 91.56  ? 13  ALA A CA    1 
ATOM 1267 C C     . ALA E 3 16  ? 2.538  40.489 17.004  1.00 90.93  ? 13  ALA A C     1 
ATOM 1268 O O     . ALA E 3 16  ? 3.270  40.773 17.953  1.00 86.12  ? 13  ALA A O     1 
ATOM 1269 C CB    . ALA E 3 16  ? 3.282  39.249 14.963  1.00 93.17  ? 13  ALA A CB    1 
ATOM 1270 N N     . LYS E 3 17  ? 1.650  41.343 16.494  1.00 90.87  ? 14  LYS A N     1 
ATOM 1271 C CA    . LYS E 3 17  ? 1.478  42.681 17.058  1.00 89.51  ? 14  LYS A CA    1 
ATOM 1272 C C     . LYS E 3 17  ? 0.677  42.615 18.353  1.00 92.67  ? 14  LYS A C     1 
ATOM 1273 O O     . LYS E 3 17  ? 0.838  43.458 19.238  1.00 96.92  ? 14  LYS A O     1 
ATOM 1274 C CB    . LYS E 3 17  ? 0.787  43.615 16.061  1.00 83.25  ? 14  LYS A CB    1 
ATOM 1275 C CG    . LYS E 3 17  ? 0.956  45.094 16.395  1.00 77.98  ? 14  LYS A CG    1 
ATOM 1276 C CD    . LYS E 3 17  ? 0.263  45.984 15.373  1.00 87.56  ? 14  LYS A CD    1 
ATOM 1277 C CE    . LYS E 3 17  ? 0.630  47.458 15.542  1.00 89.96  ? 14  LYS A CE    1 
ATOM 1278 N NZ    . LYS E 3 17  ? 0.213  48.030 16.855  1.00 95.20  ? 14  LYS A NZ    1 
ATOM 1279 N N     . THR E 3 18  ? -0.185 41.605 18.454  1.00 89.16  ? 15  THR A N     1 
ATOM 1280 C CA    . THR E 3 18  ? -1.006 41.406 19.642  1.00 85.16  ? 15  THR A CA    1 
ATOM 1281 C C     . THR E 3 18  ? -0.080 41.182 20.826  1.00 86.38  ? 15  THR A C     1 
ATOM 1282 O O     . THR E 3 18  ? -0.232 41.797 21.880  1.00 83.78  ? 15  THR A O     1 
ATOM 1283 C CB    . THR E 3 18  ? -1.894 40.158 19.501  1.00 83.06  ? 15  THR A CB    1 
ATOM 1284 O OG1   . THR E 3 18  ? -2.663 40.250 18.297  1.00 84.22  ? 15  THR A OG1   1 
ATOM 1285 C CG2   . THR E 3 18  ? -2.832 40.032 20.693  1.00 79.70  ? 15  THR A CG2   1 
ATOM 1286 N N     . PHE E 3 19  ? 0.908  40.321 20.613  1.00 89.16  ? 16  PHE A N     1 
ATOM 1287 C CA    . PHE E 3 19  ? 1.877  39.978 21.639  1.00 92.79  ? 16  PHE A CA    1 
ATOM 1288 C C     . PHE E 3 19  ? 2.792  41.148 21.983  1.00 93.57  ? 16  PHE A C     1 
ATOM 1289 O O     . PHE E 3 19  ? 3.129  41.340 23.143  1.00 94.08  ? 16  PHE A O     1 
ATOM 1290 C CB    . PHE E 3 19  ? 2.710  38.774 21.186  1.00 96.52  ? 16  PHE A CB    1 
ATOM 1291 C CG    . PHE E 3 19  ? 3.090  37.842 22.305  1.00 99.26  ? 16  PHE A CG    1 
ATOM 1292 C CD1   . PHE E 3 19  ? 2.226  36.826 22.698  1.00 99.94  ? 16  PHE A CD1   1 
ATOM 1293 C CD2   . PHE E 3 19  ? 4.304  37.982 22.971  1.00 100.00 ? 16  PHE A CD2   1 
ATOM 1294 C CE1   . PHE E 3 19  ? 2.562  35.963 23.740  1.00 98.90  ? 16  PHE A CE1   1 
ATOM 1295 C CE2   . PHE E 3 19  ? 4.650  37.123 24.015  1.00 99.21  ? 16  PHE A CE2   1 
ATOM 1296 C CZ    . PHE E 3 19  ? 3.775  36.112 24.399  1.00 100.00 ? 16  PHE A CZ    1 
ATOM 1297 N N     . LYS E 3 20  ? 3.165  41.938 20.979  1.00 95.52  ? 17  LYS A N     1 
ATOM 1298 C CA    . LYS E 3 20  ? 4.056  43.082 21.178  1.00 95.74  ? 17  LYS A CA    1 
ATOM 1299 C C     . LYS E 3 20  ? 3.397  44.190 21.998  1.00 96.36  ? 17  LYS A C     1 
ATOM 1300 O O     . LYS E 3 20  ? 3.976  44.683 22.971  1.00 90.99  ? 17  LYS A O     1 
ATOM 1301 C CB    . LYS E 3 20  ? 4.511  43.636 19.823  1.00 97.07  ? 17  LYS A CB    1 
ATOM 1302 C CG    . LYS E 3 20  ? 5.893  44.282 19.835  1.00 99.36  ? 17  LYS A CG    1 
ATOM 1303 C CD    . LYS E 3 20  ? 6.309  44.740 18.435  1.00 95.54  ? 17  LYS A CD    1 
ATOM 1304 C CE    . LYS E 3 20  ? 7.824  44.924 18.310  1.00 86.00  ? 17  LYS A CE    1 
ATOM 1305 N NZ    . LYS E 3 20  ? 8.385  45.940 19.245  1.00 70.47  ? 17  LYS A NZ    1 
ATOM 1306 N N     . GLN E 3 21  ? 2.189  44.577 21.592  1.00 98.77  ? 18  GLN A N     1 
ATOM 1307 C CA    . GLN E 3 21  ? 1.431  45.620 22.277  1.00 100.00 ? 18  GLN A CA    1 
ATOM 1308 C C     . GLN E 3 21  ? 1.034  45.156 23.673  1.00 100.00 ? 18  GLN A C     1 
ATOM 1309 O O     . GLN E 3 21  ? 1.336  45.818 24.668  1.00 99.28  ? 18  GLN A O     1 
ATOM 1310 C CB    . GLN E 3 21  ? 0.177  45.979 21.475  1.00 98.77  ? 18  GLN A CB    1 
ATOM 1311 N N     . ARG E 3 22  ? 0.391  43.992 23.736  1.00 99.07  ? 19  ARG A N     1 
ATOM 1312 C CA    . ARG E 3 22  ? -0.056 43.412 25.000  1.00 100.00 ? 19  ARG A CA    1 
ATOM 1313 C C     . ARG E 3 22  ? 1.114  43.013 25.916  1.00 100.00 ? 19  ARG A C     1 
ATOM 1314 O O     . ARG E 3 22  ? 0.904  42.663 27.081  1.00 100.00 ? 19  ARG A O     1 
ATOM 1315 C CB    . ARG E 3 22  ? -0.959 42.201 24.725  1.00 98.59  ? 19  ARG A CB    1 
ATOM 1316 C CG    . ARG E 3 22  ? -2.157 42.066 25.662  1.00 98.45  ? 19  ARG A CG    1 
ATOM 1317 C CD    . ARG E 3 22  ? -3.036 40.877 25.278  1.00 94.20  ? 19  ARG A CD    1 
ATOM 1318 N NE    . ARG E 3 22  ? -4.222 40.753 26.127  1.00 89.19  ? 19  ARG A NE    1 
ATOM 1319 C CZ    . ARG E 3 22  ? -4.251 40.134 27.306  1.00 84.32  ? 19  ARG A CZ    1 
ATOM 1320 N NH1   . ARG E 3 22  ? -3.156 39.572 27.801  1.00 82.31  ? 19  ARG A NH1   1 
ATOM 1321 N NH2   . ARG E 3 22  ? -5.389 40.050 27.982  1.00 75.46  ? 19  ARG A NH2   1 
ATOM 1322 N N     . ARG E 3 23  ? 2.340  43.076 25.391  1.00 100.00 ? 20  ARG A N     1 
ATOM 1323 C CA    . ARG E 3 23  ? 3.537  42.729 26.162  1.00 99.96  ? 20  ARG A CA    1 
ATOM 1324 C C     . ARG E 3 23  ? 4.027  43.894 27.002  1.00 98.31  ? 20  ARG A C     1 
ATOM 1325 O O     . ARG E 3 23  ? 4.348  43.730 28.180  1.00 98.93  ? 20  ARG A O     1 
ATOM 1326 C CB    . ARG E 3 23  ? 4.677  42.283 25.244  1.00 100.00 ? 20  ARG A CB    1 
ATOM 1327 N N     . ILE E 3 24  ? 4.114  45.067 26.384  1.00 95.87  ? 21  ILE A N     1 
ATOM 1328 C CA    . ILE E 3 24  ? 4.574  46.250 27.092  1.00 97.18  ? 21  ILE A CA    1 
ATOM 1329 C C     . ILE E 3 24  ? 3.442  46.833 27.947  1.00 100.00 ? 21  ILE A C     1 
ATOM 1330 O O     . ILE E 3 24  ? 3.643  47.799 28.687  1.00 100.00 ? 21  ILE A O     1 
ATOM 1331 C CB    . ILE E 3 24  ? 5.157  47.300 26.107  1.00 94.40  ? 21  ILE A CB    1 
ATOM 1332 C CG1   . ILE E 3 24  ? 6.027  48.311 26.861  1.00 93.66  ? 21  ILE A CG1   1 
ATOM 1333 C CG2   . ILE E 3 24  ? 4.046  47.975 25.317  1.00 92.46  ? 21  ILE A CG2   1 
ATOM 1334 C CD1   . ILE E 3 24  ? 7.240  47.690 27.546  1.00 88.74  ? 21  ILE A CD1   1 
ATOM 1335 N N     . LYS E 3 25  ? 2.260  46.220 27.854  1.00 100.00 ? 22  LYS A N     1 
ATOM 1336 C CA    . LYS E 3 25  ? 1.093  46.643 28.626  1.00 100.00 ? 22  LYS A CA    1 
ATOM 1337 C C     . LYS E 3 25  ? 1.297  46.230 30.081  1.00 100.00 ? 22  LYS A C     1 
ATOM 1338 O O     . LYS E 3 25  ? 1.068  47.014 31.005  1.00 100.00 ? 22  LYS A O     1 
ATOM 1339 C CB    . LYS E 3 25  ? -0.167 45.999 28.068  1.00 100.00 ? 22  LYS A CB    1 
ATOM 1340 N N     . LEU E 3 26  ? 1.724  44.986 30.272  1.00 98.96  ? 23  LEU A N     1 
ATOM 1341 C CA    . LEU E 3 26  ? 1.988  44.463 31.605  1.00 98.53  ? 23  LEU A CA    1 
ATOM 1342 C C     . LEU E 3 26  ? 3.447  44.705 32.007  1.00 99.35  ? 23  LEU A C     1 
ATOM 1343 O O     . LEU E 3 26  ? 3.954  44.077 32.936  1.00 100.00 ? 23  LEU A O     1 
ATOM 1344 C CB    . LEU E 3 26  ? 1.639  42.971 31.676  1.00 97.58  ? 23  LEU A CB    1 
ATOM 1345 C CG    . LEU E 3 26  ? 0.148  42.625 31.582  1.00 100.00 ? 23  LEU A CG    1 
ATOM 1346 C CD1   . LEU E 3 26  ? -0.052 41.118 31.698  1.00 100.00 ? 23  LEU A CD1   1 
ATOM 1347 C CD2   . LEU E 3 26  ? -0.623 43.348 32.682  1.00 100.00 ? 23  LEU A CD2   1 
ATOM 1348 N N     . GLY E 3 27  ? 4.110  45.613 31.288  1.00 99.62  ? 24  GLY A N     1 
ATOM 1349 C CA    . GLY E 3 27  ? 5.496  45.963 31.565  1.00 98.16  ? 24  GLY A CA    1 
ATOM 1350 C C     . GLY E 3 27  ? 6.462  44.804 31.709  1.00 96.29  ? 24  GLY A C     1 
ATOM 1351 O O     . GLY E 3 27  ? 6.908  44.500 32.818  1.00 90.96  ? 24  GLY A O     1 
ATOM 1352 N N     . PHE E 3 28  ? 6.798  44.168 30.590  1.00 98.24  ? 25  PHE A N     1 
ATOM 1353 C CA    . PHE E 3 28  ? 7.716  43.035 30.602  1.00 98.71  ? 25  PHE A CA    1 
ATOM 1354 C C     . PHE E 3 28  ? 8.526  42.929 29.317  1.00 95.40  ? 25  PHE A C     1 
ATOM 1355 O O     . PHE E 3 28  ? 7.982  42.645 28.243  1.00 94.13  ? 25  PHE A O     1 
ATOM 1356 C CB    . PHE E 3 28  ? 6.953  41.726 30.841  1.00 99.23  ? 25  PHE A CB    1 
ATOM 1357 C CG    . PHE E 3 28  ? 7.257  41.072 32.164  1.00 100.00 ? 25  PHE A CG    1 
ATOM 1358 C CD1   . PHE E 3 28  ? 8.471  41.298 32.811  1.00 100.00 ? 25  PHE A CD1   1 
ATOM 1359 C CD2   . PHE E 3 28  ? 6.331  40.224 32.760  1.00 98.92  ? 25  PHE A CD2   1 
ATOM 1360 C CE1   . PHE E 3 28  ? 8.763  40.680 34.031  1.00 100.00 ? 25  PHE A CE1   1 
ATOM 1361 C CE2   . PHE E 3 28  ? 6.612  39.602 33.977  1.00 100.00 ? 25  PHE A CE2   1 
ATOM 1362 C CZ    . PHE E 3 28  ? 7.831  39.834 34.615  1.00 100.00 ? 25  PHE A CZ    1 
ATOM 1363 N N     . THR E 3 29  ? 9.831  43.153 29.436  1.00 89.35  ? 26  THR A N     1 
ATOM 1364 C CA    . THR E 3 29  ? 10.726 43.072 28.290  1.00 84.28  ? 26  THR A CA    1 
ATOM 1365 C C     . THR E 3 29  ? 10.712 41.641 27.766  1.00 79.87  ? 26  THR A C     1 
ATOM 1366 O O     . THR E 3 29  ? 10.317 40.717 28.482  1.00 72.80  ? 26  THR A O     1 
ATOM 1367 C CB    . THR E 3 29  ? 12.180 43.442 28.670  1.00 88.49  ? 26  THR A CB    1 
ATOM 1368 O OG1   . THR E 3 29  ? 12.757 42.396 29.462  1.00 88.92  ? 26  THR A OG1   1 
ATOM 1369 C CG2   . THR E 3 29  ? 12.211 44.741 29.463  1.00 87.90  ? 26  THR A CG2   1 
ATOM 1370 N N     . GLN E 3 30  ? 11.146 41.462 26.523  1.00 76.22  ? 27  GLN A N     1 
ATOM 1371 C CA    . GLN E 3 30  ? 11.184 40.135 25.922  1.00 67.78  ? 27  GLN A CA    1 
ATOM 1372 C C     . GLN E 3 30  ? 12.149 39.236 26.693  1.00 67.54  ? 27  GLN A C     1 
ATOM 1373 O O     . GLN E 3 30  ? 11.923 38.030 26.813  1.00 64.74  ? 27  GLN A O     1 
ATOM 1374 C CB    . GLN E 3 30  ? 11.549 40.223 24.433  1.00 64.36  ? 27  GLN A CB    1 
ATOM 1375 C CG    . GLN E 3 30  ? 12.756 41.089 24.109  1.00 67.58  ? 27  GLN A CG    1 
ATOM 1376 C CD    . GLN E 3 30  ? 12.876 41.411 22.626  1.00 65.90  ? 27  GLN A CD    1 
ATOM 1377 O OE1   . GLN E 3 30  ? 13.924 41.192 22.016  1.00 59.76  ? 27  GLN A OE1   1 
ATOM 1378 N NE2   . GLN E 3 30  ? 11.806 41.950 22.044  1.00 56.69  ? 27  GLN A NE2   1 
ATOM 1379 N N     . GLY E 3 31  ? 13.182 39.847 27.273  1.00 68.30  ? 28  GLY A N     1 
ATOM 1380 C CA    . GLY E 3 31  ? 14.155 39.100 28.052  1.00 69.96  ? 28  GLY A CA    1 
ATOM 1381 C C     . GLY E 3 31  ? 13.538 38.517 29.310  1.00 69.12  ? 28  GLY A C     1 
ATOM 1382 O O     . GLY E 3 31  ? 13.886 37.412 29.732  1.00 65.76  ? 28  GLY A O     1 
ATOM 1383 N N     . ASP E 3 32  ? 12.612 39.265 29.903  1.00 72.35  ? 29  ASP A N     1 
ATOM 1384 C CA    . ASP E 3 32  ? 11.922 38.834 31.114  1.00 69.54  ? 29  ASP A CA    1 
ATOM 1385 C C     . ASP E 3 32  ? 10.882 37.773 30.787  1.00 69.33  ? 29  ASP A C     1 
ATOM 1386 O O     . ASP E 3 32  ? 10.651 36.864 31.581  1.00 65.70  ? 29  ASP A O     1 
ATOM 1387 C CB    . ASP E 3 32  ? 11.247 40.021 31.796  1.00 68.71  ? 29  ASP A CB    1 
ATOM 1388 C CG    . ASP E 3 32  ? 12.224 41.121 32.169  1.00 68.67  ? 29  ASP A CG    1 
ATOM 1389 O OD1   . ASP E 3 32  ? 13.432 40.840 32.329  1.00 59.03  ? 29  ASP A OD1   1 
ATOM 1390 O OD2   . ASP E 3 32  ? 11.773 42.278 32.295  1.00 71.02  ? 29  ASP A OD2   1 
ATOM 1391 N N     . VAL E 3 33  ? 10.249 37.905 29.623  1.00 72.96  ? 30  VAL A N     1 
ATOM 1392 C CA    . VAL E 3 33  ? 9.246  36.940 29.175  1.00 78.28  ? 30  VAL A CA    1 
ATOM 1393 C C     . VAL E 3 33  ? 9.949  35.597 28.971  1.00 81.69  ? 30  VAL A C     1 
ATOM 1394 O O     . VAL E 3 33  ? 9.321  34.535 29.021  1.00 79.73  ? 30  VAL A O     1 
ATOM 1395 C CB    . VAL E 3 33  ? 8.591  37.381 27.840  1.00 78.77  ? 30  VAL A CB    1 
ATOM 1396 C CG1   . VAL E 3 33  ? 7.516  36.383 27.415  1.00 66.04  ? 30  VAL A CG1   1 
ATOM 1397 C CG2   . VAL E 3 33  ? 7.996  38.778 27.977  1.00 82.65  ? 30  VAL A CG2   1 
ATOM 1398 N N     . GLY E 3 34  ? 11.262 35.667 28.754  1.00 84.44  ? 31  GLY A N     1 
ATOM 1399 C CA    . GLY E 3 34  ? 12.070 34.477 28.559  1.00 87.23  ? 31  GLY A CA    1 
ATOM 1400 C C     . GLY E 3 34  ? 12.192 33.674 29.838  1.00 85.88  ? 31  GLY A C     1 
ATOM 1401 O O     . GLY E 3 34  ? 11.767 32.519 29.885  1.00 87.76  ? 31  GLY A O     1 
ATOM 1402 N N     . LEU E 3 35  ? 12.757 34.284 30.879  1.00 81.98  ? 32  LEU A N     1 
ATOM 1403 C CA    . LEU E 3 35  ? 12.903 33.610 32.165  1.00 81.02  ? 32  LEU A CA    1 
ATOM 1404 C C     . LEU E 3 35  ? 11.530 33.390 32.810  1.00 83.59  ? 32  LEU A C     1 
ATOM 1405 O O     . LEU E 3 35  ? 11.411 32.686 33.815  1.00 84.07  ? 32  LEU A O     1 
ATOM 1406 C CB    . LEU E 3 35  ? 13.811 34.411 33.104  1.00 77.91  ? 32  LEU A CB    1 
ATOM 1407 C CG    . LEU E 3 35  ? 14.066 33.788 34.485  1.00 84.81  ? 32  LEU A CG    1 
ATOM 1408 C CD1   . LEU E 3 35  ? 14.624 32.372 34.344  1.00 79.12  ? 32  LEU A CD1   1 
ATOM 1409 C CD2   . LEU E 3 35  ? 15.011 34.660 35.296  1.00 93.96  ? 32  LEU A CD2   1 
ATOM 1410 N N     . ALA E 3 36  ? 10.497 33.978 32.208  1.00 86.23  ? 33  ALA A N     1 
ATOM 1411 C CA    . ALA E 3 36  ? 9.124  33.856 32.691  1.00 90.15  ? 33  ALA A CA    1 
ATOM 1412 C C     . ALA E 3 36  ? 8.560  32.464 32.399  1.00 92.01  ? 33  ALA A C     1 
ATOM 1413 O O     . ALA E 3 36  ? 7.918  31.846 33.256  1.00 91.47  ? 33  ALA A O     1 
ATOM 1414 C CB    . ALA E 3 36  ? 8.252  34.926 32.057  1.00 89.46  ? 33  ALA A CB    1 
ATOM 1415 N N     . MET E 3 37  ? 8.783  31.986 31.177  1.00 92.68  ? 34  MET A N     1 
ATOM 1416 C CA    . MET E 3 37  ? 8.326  30.660 30.781  1.00 88.14  ? 34  MET A CA    1 
ATOM 1417 C C     . MET E 3 37  ? 9.266  29.589 31.328  1.00 85.37  ? 34  MET A C     1 
ATOM 1418 O O     . MET E 3 37  ? 9.033  28.389 31.143  1.00 82.71  ? 34  MET A O     1 
ATOM 1419 C CB    . MET E 3 37  ? 8.180  30.568 29.259  1.00 86.78  ? 34  MET A CB    1 
ATOM 1420 C CG    . MET E 3 37  ? 6.930  31.269 28.759  1.00 89.69  ? 34  MET A CG    1 
ATOM 1421 S SD    . MET E 3 37  ? 6.637  31.146 26.988  1.00 92.40  ? 34  MET A SD    1 
ATOM 1422 C CE    . MET E 3 37  ? 6.184  32.839 26.638  1.00 92.42  ? 34  MET A CE    1 
ATOM 1423 N N     . GLY E 3 38  ? 10.332 30.047 31.988  1.00 81.21  ? 35  GLY A N     1 
ATOM 1424 C CA    . GLY E 3 38  ? 11.293 29.152 32.590  1.00 78.05  ? 35  GLY A CA    1 
ATOM 1425 C C     . GLY E 3 38  ? 10.583 28.558 33.785  1.00 81.37  ? 35  GLY A C     1 
ATOM 1426 O O     . GLY E 3 38  ? 10.438 27.336 33.902  1.00 84.86  ? 35  GLY A O     1 
ATOM 1427 N N     . LYS E 3 39  ? 10.102 29.437 34.663  1.00 82.46  ? 36  LYS A N     1 
ATOM 1428 C CA    . LYS E 3 39  ? 9.360  29.043 35.867  1.00 86.66  ? 36  LYS A CA    1 
ATOM 1429 C C     . LYS E 3 39  ? 7.928  28.655 35.517  1.00 90.35  ? 36  LYS A C     1 
ATOM 1430 O O     . LYS E 3 39  ? 7.060  28.565 36.401  1.00 95.87  ? 36  LYS A O     1 
ATOM 1431 C CB    . LYS E 3 39  ? 9.348  30.188 36.861  1.00 84.71  ? 36  LYS A CB    1 
ATOM 1432 N N     . LEU E 3 40  ? 7.700  28.367 34.235  1.00 92.91  ? 37  LEU A N     1 
ATOM 1433 C CA    . LEU E 3 40  ? 6.368  27.906 33.776  1.00 88.64  ? 37  LEU A CA    1 
ATOM 1434 C C     . LEU E 3 40  ? 6.372  26.602 32.946  1.00 85.86  ? 37  LEU A C     1 
ATOM 1435 O O     . LEU E 3 40  ? 5.310  26.030 32.710  1.00 83.28  ? 37  LEU A O     1 
ATOM 1436 C CB    . LEU E 3 40  ? 5.782  29.075 32.945  1.00 87.01  ? 37  LEU A CB    1 
ATOM 1437 C CG    . LEU E 3 40  ? 4.416  28.910 32.244  1.00 85.55  ? 37  LEU A CG    1 
ATOM 1438 C CD1   . LEU E 3 40  ? 3.291  28.802 33.265  1.00 84.64  ? 37  LEU A CD1   1 
ATOM 1439 C CD2   . LEU E 3 40  ? 4.115  30.040 31.270  1.00 88.44  ? 37  LEU A CD2   1 
ATOM 1440 N N     . TYR E 3 41  ? 7.540  26.123 32.507  1.00 86.60  ? 38  TYR A N     1 
ATOM 1441 C CA    . TYR E 3 41  ? 7.569  24.923 31.628  1.00 91.35  ? 38  TYR A CA    1 
ATOM 1442 C C     . TYR E 3 41  ? 8.607  23.824 31.891  1.00 92.28  ? 38  TYR A C     1 
ATOM 1443 O O     . TYR E 3 41  ? 8.420  22.688 31.446  1.00 96.85  ? 38  TYR A O     1 
ATOM 1444 C CB    . TYR E 3 41  ? 7.674  25.335 30.152  1.00 95.92  ? 38  TYR A CB    1 
ATOM 1445 C CG    . TYR E 3 41  ? 6.458  26.018 29.586  1.00 98.92  ? 38  TYR A CG    1 
ATOM 1446 C CD1   . TYR E 3 41  ? 6.527  27.333 29.151  1.00 100.00 ? 38  TYR A CD1   1 
ATOM 1447 C CD2   . TYR E 3 41  ? 5.242  25.343 29.468  1.00 99.52  ? 38  TYR A CD2   1 
ATOM 1448 C CE1   . TYR E 3 41  ? 5.416  27.969 28.606  1.00 100.00 ? 38  TYR A CE1   1 
ATOM 1449 C CE2   . TYR E 3 41  ? 4.126  25.966 28.926  1.00 100.00 ? 38  TYR A CE2   1 
ATOM 1450 C CZ    . TYR E 3 41  ? 4.223  27.277 28.496  1.00 99.13  ? 38  TYR A CZ    1 
ATOM 1451 O OH    . TYR E 3 41  ? 3.134  27.884 27.931  1.00 100.00 ? 38  TYR A OH    1 
ATOM 1452 N N     . GLY E 3 42  ? 9.685  24.166 32.591  1.00 87.84  ? 39  GLY A N     1 
ATOM 1453 C CA    . GLY E 3 42  ? 10.716 23.188 32.863  1.00 88.85  ? 39  GLY A CA    1 
ATOM 1454 C C     . GLY E 3 42  ? 12.061 23.716 32.406  1.00 91.17  ? 39  GLY A C     1 
ATOM 1455 O O     . GLY E 3 42  ? 13.121 23.356 32.929  1.00 94.43  ? 39  GLY A O     1 
ATOM 1456 N N     . ASN E 3 43  ? 12.000 24.569 31.392  1.00 92.09  ? 40  ASN A N     1 
ATOM 1457 C CA    . ASN E 3 43  ? 13.164 25.220 30.812  1.00 96.32  ? 40  ASN A CA    1 
ATOM 1458 C C     . ASN E 3 43  ? 12.636 26.517 30.208  1.00 100.00 ? 40  ASN A C     1 
ATOM 1459 O O     . ASN E 3 43  ? 11.506 26.920 30.496  1.00 100.00 ? 40  ASN A O     1 
ATOM 1460 C CB    . ASN E 3 43  ? 13.805 24.339 29.738  1.00 91.62  ? 40  ASN A CB    1 
ATOM 1461 N N     . ASP E 3 44  ? 13.420 27.159 29.351  1.00 100.00 ? 41  ASP A N     1 
ATOM 1462 C CA    . ASP E 3 44  ? 12.967 28.414 28.771  1.00 98.15  ? 41  ASP A CA    1 
ATOM 1463 C C     . ASP E 3 44  ? 13.511 28.727 27.389  1.00 96.03  ? 41  ASP A C     1 
ATOM 1464 O O     . ASP E 3 44  ? 14.108 27.880 26.718  1.00 95.74  ? 41  ASP A O     1 
ATOM 1465 C CB    . ASP E 3 44  ? 13.305 29.575 29.719  1.00 100.00 ? 41  ASP A CB    1 
ATOM 1466 C CG    . ASP E 3 44  ? 14.797 29.701 29.983  1.00 100.00 ? 41  ASP A CG    1 
ATOM 1467 O OD1   . ASP E 3 44  ? 15.296 29.014 30.902  1.00 100.00 ? 41  ASP A OD1   1 
ATOM 1468 O OD2   . ASP E 3 44  ? 15.469 30.481 29.271  1.00 100.00 ? 41  ASP A OD2   1 
ATOM 1469 N N     . PHE E 3 45  ? 13.268 29.967 26.978  1.00 89.52  ? 42  PHE A N     1 
ATOM 1470 C CA    . PHE E 3 45  ? 13.716 30.483 25.703  1.00 81.40  ? 42  PHE A CA    1 
ATOM 1471 C C     . PHE E 3 45  ? 14.236 31.895 25.913  1.00 74.56  ? 42  PHE A C     1 
ATOM 1472 O O     . PHE E 3 45  ? 13.569 32.737 26.512  1.00 69.57  ? 42  PHE A O     1 
ATOM 1473 C CB    . PHE E 3 45  ? 12.583 30.440 24.679  1.00 83.59  ? 42  PHE A CB    1 
ATOM 1474 C CG    . PHE E 3 45  ? 12.350 29.071 24.106  1.00 91.17  ? 42  PHE A CG    1 
ATOM 1475 C CD1   . PHE E 3 45  ? 13.224 28.549 23.156  1.00 91.50  ? 42  PHE A CD1   1 
ATOM 1476 C CD2   . PHE E 3 45  ? 11.279 28.287 24.534  1.00 94.06  ? 42  PHE A CD2   1 
ATOM 1477 C CE1   . PHE E 3 45  ? 13.041 27.270 22.641  1.00 98.02  ? 42  PHE A CE1   1 
ATOM 1478 C CE2   . PHE E 3 45  ? 11.087 27.000 24.021  1.00 97.32  ? 42  PHE A CE2   1 
ATOM 1479 C CZ    . PHE E 3 45  ? 11.971 26.492 23.073  1.00 97.83  ? 42  PHE A CZ    1 
ATOM 1480 N N     . SER E 3 46  ? 15.464 32.112 25.459  1.00 71.54  ? 43  SER A N     1 
ATOM 1481 C CA    . SER E 3 46  ? 16.168 33.385 25.573  1.00 65.11  ? 43  SER A CA    1 
ATOM 1482 C C     . SER E 3 46  ? 15.437 34.602 25.023  1.00 63.42  ? 43  SER A C     1 
ATOM 1483 O O     . SER E 3 46  ? 14.368 34.498 24.415  1.00 60.72  ? 43  SER A O     1 
ATOM 1484 C CB    . SER E 3 46  ? 17.517 33.281 24.864  1.00 64.14  ? 43  SER A CB    1 
ATOM 1485 O OG    . SER E 3 46  ? 17.334 33.154 23.461  1.00 55.60  ? 43  SER A OG    1 
ATOM 1486 N N     . GLN E 3 47  ? 16.062 35.758 25.228  1.00 61.36  ? 44  GLN A N     1 
ATOM 1487 C CA    . GLN E 3 47  ? 15.551 37.040 24.762  1.00 58.51  ? 44  GLN A CA    1 
ATOM 1488 C C     . GLN E 3 47  ? 15.555 37.056 23.237  1.00 51.65  ? 44  GLN A C     1 
ATOM 1489 O O     . GLN E 3 47  ? 14.680 37.652 22.604  1.00 44.16  ? 44  GLN A O     1 
ATOM 1490 C CB    . GLN E 3 47  ? 16.441 38.167 25.298  1.00 64.45  ? 44  GLN A CB    1 
ATOM 1491 C CG    . GLN E 3 47  ? 16.216 39.537 24.662  1.00 71.57  ? 44  GLN A CG    1 
ATOM 1492 C CD    . GLN E 3 47  ? 17.425 40.029 23.881  1.00 73.91  ? 44  GLN A CD    1 
ATOM 1493 O OE1   . GLN E 3 47  ? 18.573 39.815 24.282  1.00 81.03  ? 44  GLN A OE1   1 
ATOM 1494 N NE2   . GLN E 3 47  ? 17.172 40.692 22.761  1.00 69.20  ? 44  GLN A NE2   1 
ATOM 1495 N N     . THR E 3 48  ? 16.549 36.382 22.665  1.00 40.72  ? 45  THR A N     1 
ATOM 1496 C CA    . THR E 3 48  ? 16.715 36.298 21.221  1.00 30.97  ? 45  THR A CA    1 
ATOM 1497 C C     . THR E 3 48  ? 15.545 35.575 20.593  1.00 27.82  ? 45  THR A C     1 
ATOM 1498 O O     . THR E 3 48  ? 14.904 36.088 19.680  1.00 18.41  ? 45  THR A O     1 
ATOM 1499 C CB    . THR E 3 48  ? 17.994 35.541 20.864  1.00 29.21  ? 45  THR A CB    1 
ATOM 1500 O OG1   . THR E 3 48  ? 19.060 35.996 21.705  1.00 33.83  ? 45  THR A OG1   1 
ATOM 1501 C CG2   . THR E 3 48  ? 18.360 35.779 19.413  1.00 19.08  ? 45  THR A CG2   1 
ATOM 1502 N N     . THR E 3 49  ? 15.266 34.383 21.104  1.00 38.22  ? 46  THR A N     1 
ATOM 1503 C CA    . THR E 3 49  ? 14.171 33.572 20.602  1.00 42.96  ? 46  THR A CA    1 
ATOM 1504 C C     . THR E 3 49  ? 12.876 34.369 20.640  1.00 41.78  ? 46  THR A C     1 
ATOM 1505 O O     . THR E 3 49  ? 12.182 34.477 19.630  1.00 49.62  ? 46  THR A O     1 
ATOM 1506 C CB    . THR E 3 49  ? 14.033 32.271 21.412  1.00 45.07  ? 46  THR A CB    1 
ATOM 1507 O OG1   . THR E 3 49  ? 15.212 31.478 21.230  1.00 51.70  ? 46  THR A OG1   1 
ATOM 1508 C CG2   . THR E 3 49  ? 12.823 31.470 20.953  1.00 48.57  ? 46  THR A CG2   1 
ATOM 1509 N N     . ILE E 3 50  ? 12.583 34.979 21.784  1.00 42.09  ? 47  ILE A N     1 
ATOM 1510 C CA    . ILE E 3 50  ? 11.369 35.775 21.909  1.00 45.42  ? 47  ILE A CA    1 
ATOM 1511 C C     . ILE E 3 50  ? 11.380 36.972 20.946  1.00 44.33  ? 47  ILE A C     1 
ATOM 1512 O O     . ILE E 3 50  ? 10.346 37.326 20.377  1.00 38.97  ? 47  ILE A O     1 
ATOM 1513 C CB    . ILE E 3 50  ? 11.105 36.207 23.385  1.00 46.47  ? 47  ILE A CB    1 
ATOM 1514 C CG1   . ILE E 3 50  ? 9.932  37.186 23.464  1.00 50.86  ? 47  ILE A CG1   1 
ATOM 1515 C CG2   . ILE E 3 50  ? 12.339 36.789 24.011  1.00 35.50  ? 47  ILE A CG2   1 
ATOM 1516 C CD1   . ILE E 3 50  ? 8.601  36.599 23.035  1.00 60.77  ? 47  ILE A CD1   1 
ATOM 1517 N N     . SER E 3 51  ? 12.557 37.550 20.720  1.00 41.84  ? 48  SER A N     1 
ATOM 1518 C CA    . SER E 3 51  ? 12.685 38.678 19.799  1.00 42.68  ? 48  SER A CA    1 
ATOM 1519 C C     . SER E 3 51  ? 12.213 38.230 18.422  1.00 41.50  ? 48  SER A C     1 
ATOM 1520 O O     . SER E 3 51  ? 11.287 38.802 17.847  1.00 36.39  ? 48  SER A O     1 
ATOM 1521 C CB    . SER E 3 51  ? 14.148 39.132 19.714  1.00 46.76  ? 48  SER A CB    1 
ATOM 1522 O OG    . SER E 3 51  ? 14.368 39.987 18.603  1.00 45.63  ? 48  SER A OG    1 
ATOM 1523 N N     . ARG E 3 52  ? 12.846 37.170 17.934  1.00 43.70  ? 49  ARG A N     1 
ATOM 1524 C CA    . ARG E 3 52  ? 12.556 36.582 16.635  1.00 42.49  ? 49  ARG A CA    1 
ATOM 1525 C C     . ARG E 3 52  ? 11.087 36.216 16.448  1.00 44.14  ? 49  ARG A C     1 
ATOM 1526 O O     . ARG E 3 52  ? 10.608 36.116 15.322  1.00 40.34  ? 49  ARG A O     1 
ATOM 1527 C CB    . ARG E 3 52  ? 13.438 35.351 16.433  1.00 42.76  ? 49  ARG A CB    1 
ATOM 1528 C CG    . ARG E 3 52  ? 14.922 35.667 16.491  1.00 43.89  ? 49  ARG A CG    1 
ATOM 1529 C CD    . ARG E 3 52  ? 15.783 34.416 16.496  1.00 47.50  ? 49  ARG A CD    1 
ATOM 1530 N NE    . ARG E 3 52  ? 17.198 34.759 16.383  1.00 40.91  ? 49  ARG A NE    1 
ATOM 1531 C CZ    . ARG E 3 52  ? 18.201 33.913 16.594  1.00 47.61  ? 49  ARG A CZ    1 
ATOM 1532 N NH1   . ARG E 3 52  ? 17.966 32.652 16.937  1.00 47.24  ? 49  ARG A NH1   1 
ATOM 1533 N NH2   . ARG E 3 52  ? 19.448 34.330 16.426  1.00 49.21  ? 49  ARG A NH2   1 
ATOM 1534 N N     . PHE E 3 53  ? 10.377 35.991 17.548  1.00 46.24  ? 50  PHE A N     1 
ATOM 1535 C CA    . PHE E 3 53  ? 8.963  35.658 17.453  1.00 53.40  ? 50  PHE A CA    1 
ATOM 1536 C C     . PHE E 3 53  ? 8.245  36.926 17.011  1.00 58.98  ? 50  PHE A C     1 
ATOM 1537 O O     . PHE E 3 53  ? 7.468  36.914 16.053  1.00 54.23  ? 50  PHE A O     1 
ATOM 1538 C CB    . PHE E 3 53  ? 8.421  35.195 18.811  1.00 50.21  ? 50  PHE A CB    1 
ATOM 1539 C CG    . PHE E 3 53  ? 7.109  34.457 18.726  1.00 52.08  ? 50  PHE A CG    1 
ATOM 1540 C CD1   . PHE E 3 53  ? 6.986  33.173 19.250  1.00 56.59  ? 50  PHE A CD1   1 
ATOM 1541 C CD2   . PHE E 3 53  ? 6.000  35.036 18.116  1.00 49.64  ? 50  PHE A CD2   1 
ATOM 1542 C CE1   . PHE E 3 53  ? 5.779  32.477 19.168  1.00 50.99  ? 50  PHE A CE1   1 
ATOM 1543 C CE2   . PHE E 3 53  ? 4.791  34.347 18.030  1.00 55.37  ? 50  PHE A CE2   1 
ATOM 1544 C CZ    . PHE E 3 53  ? 4.682  33.065 18.557  1.00 50.90  ? 50  PHE A CZ    1 
ATOM 1545 N N     . GLU E 3 54  ? 8.570  38.024 17.690  1.00 67.91  ? 51  GLU A N     1 
ATOM 1546 C CA    . GLU E 3 54  ? 7.976  39.332 17.427  1.00 71.74  ? 51  GLU A CA    1 
ATOM 1547 C C     . GLU E 3 54  ? 8.143  39.779 15.985  1.00 68.95  ? 51  GLU A C     1 
ATOM 1548 O O     . GLU E 3 54  ? 7.162  40.114 15.320  1.00 72.08  ? 51  GLU A O     1 
ATOM 1549 C CB    . GLU E 3 54  ? 8.560  40.389 18.372  1.00 77.58  ? 51  GLU A CB    1 
ATOM 1550 C CG    . GLU E 3 54  ? 8.321  40.102 19.856  1.00 84.29  ? 51  GLU A CG    1 
ATOM 1551 C CD    . GLU E 3 54  ? 8.760  41.239 20.771  1.00 88.06  ? 51  GLU A CD    1 
ATOM 1552 O OE1   . GLU E 3 54  ? 8.288  41.284 21.928  1.00 89.82  ? 51  GLU A OE1   1 
ATOM 1553 O OE2   . GLU E 3 54  ? 9.573  42.086 20.341  1.00 89.51  ? 51  GLU A OE2   1 
ATOM 1554 N N     . ALA E 3 55  ? 9.383  39.757 15.501  1.00 64.21  ? 52  ALA A N     1 
ATOM 1555 C CA    . ALA E 3 55  ? 9.688  40.164 14.132  1.00 60.31  ? 52  ALA A CA    1 
ATOM 1556 C C     . ALA E 3 55  ? 9.372  39.076 13.103  1.00 59.13  ? 52  ALA A C     1 
ATOM 1557 O O     . ALA E 3 55  ? 9.670  39.229 11.917  1.00 58.42  ? 52  ALA A O     1 
ATOM 1558 C CB    . ALA E 3 55  ? 11.142 40.583 14.030  1.00 59.41  ? 52  ALA A CB    1 
ATOM 1559 N N     . LEU E 3 56  ? 8.756  37.988 13.563  1.00 60.45  ? 53  LEU A N     1 
ATOM 1560 C CA    . LEU E 3 56  ? 8.383  36.864 12.704  1.00 57.88  ? 53  LEU A CA    1 
ATOM 1561 C C     . LEU E 3 56  ? 9.577  36.254 11.980  1.00 54.91  ? 53  LEU A C     1 
ATOM 1562 O O     . LEU E 3 56  ? 9.484  35.864 10.818  1.00 55.98  ? 53  LEU A O     1 
ATOM 1563 C CB    . LEU E 3 56  ? 7.293  37.279 11.708  1.00 60.36  ? 53  LEU A CB    1 
ATOM 1564 C CG    . LEU E 3 56  ? 5.937  37.665 12.315  1.00 61.15  ? 53  LEU A CG    1 
ATOM 1565 C CD1   . LEU E 3 56  ? 5.030  38.233 11.247  1.00 55.86  ? 53  LEU A CD1   1 
ATOM 1566 C CD2   . LEU E 3 56  ? 5.282  36.465 12.981  1.00 67.31  ? 53  LEU A CD2   1 
ATOM 1567 N N     . ASN E 3 57  ? 10.706 36.211 12.678  1.00 52.79  ? 54  ASN A N     1 
ATOM 1568 C CA    . ASN E 3 57  ? 11.937 35.639 12.154  1.00 54.44  ? 54  ASN A CA    1 
ATOM 1569 C C     . ASN E 3 57  ? 12.090 34.189 12.601  1.00 52.10  ? 54  ASN A C     1 
ATOM 1570 O O     . ASN E 3 57  ? 13.015 33.853 13.340  1.00 50.59  ? 54  ASN A O     1 
ATOM 1571 C CB    . ASN E 3 57  ? 13.141 36.452 12.627  1.00 62.56  ? 54  ASN A CB    1 
ATOM 1572 C CG    . ASN E 3 57  ? 13.347 37.708 11.819  1.00 67.49  ? 54  ASN A CG    1 
ATOM 1573 O OD1   . ASN E 3 57  ? 12.550 38.640 11.887  1.00 70.73  ? 54  ASN A OD1   1 
ATOM 1574 N ND2   . ASN E 3 57  ? 14.425 37.742 11.044  1.00 76.70  ? 54  ASN A ND2   1 
ATOM 1575 N N     . LEU E 3 58  ? 11.171 33.339 12.153  1.00 51.75  ? 55  LEU A N     1 
ATOM 1576 C CA    . LEU E 3 58  ? 11.182 31.917 12.488  1.00 54.06  ? 55  LEU A CA    1 
ATOM 1577 C C     . LEU E 3 58  ? 10.393 31.146 11.449  1.00 53.72  ? 55  LEU A C     1 
ATOM 1578 O O     . LEU E 3 58  ? 9.472  31.685 10.834  1.00 52.04  ? 55  LEU A O     1 
ATOM 1579 C CB    . LEU E 3 58  ? 10.585 31.666 13.879  1.00 59.01  ? 55  LEU A CB    1 
ATOM 1580 C CG    . LEU E 3 58  ? 11.472 31.997 15.084  1.00 62.73  ? 55  LEU A CG    1 
ATOM 1581 C CD1   . LEU E 3 58  ? 10.684 31.908 16.374  1.00 65.50  ? 55  LEU A CD1   1 
ATOM 1582 C CD2   . LEU E 3 58  ? 12.670 31.064 15.117  1.00 64.23  ? 55  LEU A CD2   1 
ATOM 1583 N N     . SER E 3 59  ? 10.749 29.879 11.266  1.00 54.13  ? 56  SER A N     1 
ATOM 1584 C CA    . SER E 3 59  ? 10.077 29.030 10.292  1.00 57.69  ? 56  SER A CA    1 
ATOM 1585 C C     . SER E 3 59  ? 8.617  28.856 10.667  1.00 60.33  ? 56  SER A C     1 
ATOM 1586 O O     . SER E 3 59  ? 8.155  29.366 11.690  1.00 59.02  ? 56  SER A O     1 
ATOM 1587 C CB    . SER E 3 59  ? 10.736 27.655 10.245  1.00 57.60  ? 56  SER A CB    1 
ATOM 1588 O OG    . SER E 3 59  ? 10.429 26.928 11.420  1.00 58.85  ? 56  SER A OG    1 
ATOM 1589 N N     . PHE E 3 60  ? 7.902  28.111 9.835   1.00 69.19  ? 57  PHE A N     1 
ATOM 1590 C CA    . PHE E 3 60  ? 6.494  27.833 10.066  1.00 73.34  ? 57  PHE A CA    1 
ATOM 1591 C C     . PHE E 3 60  ? 6.364  27.059 11.379  1.00 70.98  ? 57  PHE A C     1 
ATOM 1592 O O     . PHE E 3 60  ? 5.752  27.535 12.338  1.00 68.40  ? 57  PHE A O     1 
ATOM 1593 C CB    . PHE E 3 60  ? 5.942  26.998 8.907   1.00 75.85  ? 57  PHE A CB    1 
ATOM 1594 C CG    . PHE E 3 60  ? 4.441  26.968 8.838   1.00 82.72  ? 57  PHE A CG    1 
ATOM 1595 C CD1   . PHE E 3 60  ? 3.733  28.079 8.388   1.00 84.87  ? 57  PHE A CD1   1 
ATOM 1596 C CD2   . PHE E 3 60  ? 3.734  25.827 9.210   1.00 87.31  ? 57  PHE A CD2   1 
ATOM 1597 C CE1   . PHE E 3 60  ? 2.340  28.056 8.308   1.00 85.05  ? 57  PHE A CE1   1 
ATOM 1598 C CE2   . PHE E 3 60  ? 2.340  25.791 9.133   1.00 85.56  ? 57  PHE A CE2   1 
ATOM 1599 C CZ    . PHE E 3 60  ? 1.642  26.909 8.681   1.00 88.41  ? 57  PHE A CZ    1 
ATOM 1600 N N     . LYS E 3 61  ? 6.996  25.890 11.421  1.00 69.38  ? 58  LYS A N     1 
ATOM 1601 C CA    . LYS E 3 61  ? 6.972  25.022 12.592  1.00 71.17  ? 58  LYS A CA    1 
ATOM 1602 C C     . LYS E 3 61  ? 7.509  25.666 13.870  1.00 70.49  ? 58  LYS A C     1 
ATOM 1603 O O     . LYS E 3 61  ? 6.829  25.657 14.893  1.00 72.54  ? 58  LYS A O     1 
ATOM 1604 C CB    . LYS E 3 61  ? 7.728  23.729 12.298  1.00 70.00  ? 58  LYS A CB    1 
ATOM 1605 N N     . ASN E 3 62  ? 8.713  26.238 13.806  1.00 67.83  ? 59  ASN A N     1 
ATOM 1606 C CA    . ASN E 3 62  ? 9.334  26.862 14.978  1.00 65.21  ? 59  ASN A CA    1 
ATOM 1607 C C     . ASN E 3 62  ? 8.486  27.954 15.621  1.00 66.07  ? 59  ASN A C     1 
ATOM 1608 O O     . ASN E 3 62  ? 8.696  28.300 16.784  1.00 67.51  ? 59  ASN A O     1 
ATOM 1609 C CB    . ASN E 3 62  ? 10.724 27.415 14.638  1.00 60.99  ? 59  ASN A CB    1 
ATOM 1610 C CG    . ASN E 3 62  ? 11.602 27.633 15.877  1.00 57.91  ? 59  ASN A CG    1 
ATOM 1611 O OD1   . ASN E 3 62  ? 12.657 28.257 15.789  1.00 51.56  ? 59  ASN A OD1   1 
ATOM 1612 N ND2   . ASN E 3 62  ? 11.183 27.095 17.021  1.00 53.69  ? 59  ASN A ND2   1 
ATOM 1613 N N     . MET E 3 63  ? 7.537  28.503 14.871  1.00 66.50  ? 60  MET A N     1 
ATOM 1614 C CA    . MET E 3 63  ? 6.674  29.538 15.419  1.00 64.67  ? 60  MET A CA    1 
ATOM 1615 C C     . MET E 3 63  ? 5.310  28.957 15.774  1.00 61.26  ? 60  MET A C     1 
ATOM 1616 O O     . MET E 3 63  ? 4.618  29.469 16.650  1.00 60.20  ? 60  MET A O     1 
ATOM 1617 C CB    . MET E 3 63  ? 6.541  30.706 14.447  1.00 68.43  ? 60  MET A CB    1 
ATOM 1618 C CG    . MET E 3 63  ? 6.081  31.983 15.119  1.00 77.64  ? 60  MET A CG    1 
ATOM 1619 S SD    . MET E 3 63  ? 6.290  33.441 14.089  1.00 88.10  ? 60  MET A SD    1 
ATOM 1620 C CE    . MET E 3 63  ? 7.926  33.962 14.573  1.00 85.40  ? 60  MET A CE    1 
ATOM 1621 N N     . CYS E 3 64  ? 4.935  27.876 15.097  1.00 60.30  ? 61  CYS A N     1 
ATOM 1622 C CA    . CYS E 3 64  ? 3.667  27.208 15.368  1.00 66.41  ? 61  CYS A CA    1 
ATOM 1623 C C     . CYS E 3 64  ? 3.772  26.372 16.642  1.00 70.35  ? 61  CYS A C     1 
ATOM 1624 O O     . CYS E 3 64  ? 2.762  26.031 17.260  1.00 68.29  ? 61  CYS A O     1 
ATOM 1625 C CB    . CYS E 3 64  ? 3.258  26.325 14.188  1.00 67.41  ? 61  CYS A CB    1 
ATOM 1626 S SG    . CYS E 3 64  ? 2.516  27.234 12.817  1.00 68.12  ? 61  CYS A SG    1 
ATOM 1627 N N     . LYS E 3 65  ? 5.002  26.032 17.019  1.00 73.63  ? 62  LYS A N     1 
ATOM 1628 C CA    . LYS E 3 65  ? 5.256  25.255 18.227  1.00 78.66  ? 62  LYS A CA    1 
ATOM 1629 C C     . LYS E 3 65  ? 5.329  26.225 19.400  1.00 78.42  ? 62  LYS A C     1 
ATOM 1630 O O     . LYS E 3 65  ? 5.289  25.819 20.563  1.00 80.32  ? 62  LYS A O     1 
ATOM 1631 C CB    . LYS E 3 65  ? 6.589  24.495 18.108  1.00 83.92  ? 62  LYS A CB    1 
ATOM 1632 C CG    . LYS E 3 65  ? 6.981  23.693 19.360  1.00 88.93  ? 62  LYS A CG    1 
ATOM 1633 C CD    . LYS E 3 65  ? 8.458  23.291 19.358  1.00 89.82  ? 62  LYS A CD    1 
ATOM 1634 C CE    . LYS E 3 65  ? 8.860  22.611 20.671  1.00 85.39  ? 62  LYS A CE    1 
ATOM 1635 N NZ    . LYS E 3 65  ? 10.324 22.308 20.749  1.00 78.83  ? 62  LYS A NZ    1 
ATOM 1636 N N     . LEU E 3 66  ? 5.407  27.515 19.089  1.00 76.82  ? 63  LEU A N     1 
ATOM 1637 C CA    . LEU E 3 66  ? 5.517  28.523 20.127  1.00 80.71  ? 63  LEU A CA    1 
ATOM 1638 C C     . LEU E 3 66  ? 4.279  29.371 20.404  1.00 79.11  ? 63  LEU A C     1 
ATOM 1639 O O     . LEU E 3 66  ? 4.045  29.736 21.554  1.00 81.97  ? 63  LEU A O     1 
ATOM 1640 C CB    . LEU E 3 66  ? 6.739  29.410 19.869  1.00 86.33  ? 63  LEU A CB    1 
ATOM 1641 C CG    . LEU E 3 66  ? 8.106  28.711 19.918  1.00 89.43  ? 63  LEU A CG    1 
ATOM 1642 C CD1   . LEU E 3 66  ? 9.210  29.696 19.571  1.00 86.20  ? 63  LEU A CD1   1 
ATOM 1643 C CD2   . LEU E 3 66  ? 8.349  28.096 21.293  1.00 83.82  ? 63  LEU A CD2   1 
ATOM 1644 N N     . LYS E 3 67  ? 3.478  29.663 19.378  1.00 75.88  ? 64  LYS A N     1 
ATOM 1645 C CA    . LYS E 3 67  ? 2.267  30.479 19.561  1.00 75.62  ? 64  LYS A CA    1 
ATOM 1646 C C     . LYS E 3 67  ? 1.419  30.056 20.765  1.00 70.49  ? 64  LYS A C     1 
ATOM 1647 O O     . LYS E 3 67  ? 1.063  30.892 21.598  1.00 51.46  ? 64  LYS A O     1 
ATOM 1648 C CB    . LYS E 3 67  ? 1.398  30.499 18.292  1.00 79.63  ? 64  LYS A CB    1 
ATOM 1649 C CG    . LYS E 3 67  ? 0.068  31.251 18.456  1.00 76.71  ? 64  LYS A CG    1 
ATOM 1650 C CD    . LYS E 3 67  ? -0.739 31.286 17.162  1.00 74.67  ? 64  LYS A CD    1 
ATOM 1651 C CE    . LYS E 3 67  ? -2.087 30.585 17.308  1.00 71.93  ? 64  LYS A CE    1 
ATOM 1652 N NZ    . LYS E 3 67  ? -3.016 31.266 18.259  1.00 65.84  ? 64  LYS A NZ    1 
ATOM 1653 N N     . PRO E 3 68  ? 1.098  28.751 20.874  1.00 74.83  ? 65  PRO A N     1 
ATOM 1654 C CA    . PRO E 3 68  ? 0.293  28.221 21.981  1.00 76.20  ? 65  PRO A CA    1 
ATOM 1655 C C     . PRO E 3 68  ? 0.921  28.381 23.369  1.00 71.74  ? 65  PRO A C     1 
ATOM 1656 O O     . PRO E 3 68  ? 0.222  28.671 24.341  1.00 67.75  ? 65  PRO A O     1 
ATOM 1657 C CB    . PRO E 3 68  ? 0.132  26.746 21.604  1.00 79.33  ? 65  PRO A CB    1 
ATOM 1658 C CG    . PRO E 3 68  ? 1.366  26.457 20.800  1.00 77.07  ? 65  PRO A CG    1 
ATOM 1659 C CD    . PRO E 3 68  ? 1.428  27.672 19.925  1.00 75.90  ? 65  PRO A CD    1 
ATOM 1660 N N     . LEU E 3 69  ? 2.233  28.175 23.457  1.00 69.05  ? 66  LEU A N     1 
ATOM 1661 C CA    . LEU E 3 69  ? 2.954  28.296 24.722  1.00 68.83  ? 66  LEU A CA    1 
ATOM 1662 C C     . LEU E 3 69  ? 3.101  29.747 25.157  1.00 70.89  ? 66  LEU A C     1 
ATOM 1663 O O     . LEU E 3 69  ? 3.108  30.058 26.348  1.00 70.28  ? 66  LEU A O     1 
ATOM 1664 C CB    . LEU E 3 69  ? 4.333  27.646 24.606  1.00 66.02  ? 66  LEU A CB    1 
ATOM 1665 C CG    . LEU E 3 69  ? 4.426  26.168 24.990  1.00 65.75  ? 66  LEU A CG    1 
ATOM 1666 C CD1   . LEU E 3 69  ? 3.271  25.375 24.396  1.00 70.37  ? 66  LEU A CD1   1 
ATOM 1667 C CD2   . LEU E 3 69  ? 5.766  25.611 24.541  1.00 61.02  ? 66  LEU A CD2   1 
ATOM 1668 N N     . LEU E 3 70  ? 3.224  30.630 24.176  1.00 72.10  ? 67  LEU A N     1 
ATOM 1669 C CA    . LEU E 3 70  ? 3.366  32.053 24.435  1.00 75.39  ? 67  LEU A CA    1 
ATOM 1670 C C     . LEU E 3 70  ? 2.035  32.640 24.901  1.00 83.03  ? 67  LEU A C     1 
ATOM 1671 O O     . LEU E 3 70  ? 1.992  33.451 25.834  1.00 78.54  ? 67  LEU A O     1 
ATOM 1672 C CB    . LEU E 3 70  ? 3.843  32.756 23.162  1.00 67.64  ? 67  LEU A CB    1 
ATOM 1673 C CG    . LEU E 3 70  ? 5.309  32.611 22.738  1.00 61.32  ? 67  LEU A CG    1 
ATOM 1674 C CD1   . LEU E 3 70  ? 6.070  33.854 23.123  1.00 61.51  ? 67  LEU A CD1   1 
ATOM 1675 C CD2   . LEU E 3 70  ? 5.957  31.373 23.342  1.00 63.74  ? 67  LEU A CD2   1 
ATOM 1676 N N     . GLU E 3 71  ? 0.949  32.191 24.273  1.00 90.59  ? 68  GLU A N     1 
ATOM 1677 C CA    . GLU E 3 71  ? -0.386 32.675 24.607  1.00 97.03  ? 68  GLU A CA    1 
ATOM 1678 C C     . GLU E 3 71  ? -0.864 32.211 25.976  1.00 100.00 ? 68  GLU A C     1 
ATOM 1679 O O     . GLU E 3 71  ? -1.723 32.854 26.566  1.00 100.00 ? 68  GLU A O     1 
ATOM 1680 C CB    . GLU E 3 71  ? -1.409 32.288 23.527  1.00 99.86  ? 68  GLU A CB    1 
ATOM 1681 C CG    . GLU E 3 71  ? -2.025 30.896 23.667  1.00 97.54  ? 68  GLU A CG    1 
ATOM 1682 C CD    . GLU E 3 71  ? -2.961 30.546 22.520  1.00 92.96  ? 68  GLU A CD    1 
ATOM 1683 O OE1   . GLU E 3 71  ? -3.924 31.304 22.271  1.00 91.23  ? 68  GLU A OE1   1 
ATOM 1684 O OE2   . GLU E 3 71  ? -2.734 29.506 21.867  1.00 83.39  ? 68  GLU A OE2   1 
ATOM 1685 N N     . LYS E 3 72  ? -0.339 31.089 26.466  1.00 99.59  ? 69  LYS A N     1 
ATOM 1686 C CA    . LYS E 3 72  ? -0.736 30.592 27.783  1.00 99.67  ? 69  LYS A CA    1 
ATOM 1687 C C     . LYS E 3 72  ? -0.232 31.591 28.813  1.00 99.39  ? 69  LYS A C     1 
ATOM 1688 O O     . LYS E 3 72  ? -0.990 32.091 29.646  1.00 100.00 ? 69  LYS A O     1 
ATOM 1689 C CB    . LYS E 3 72  ? -0.118 29.219 28.069  1.00 99.61  ? 69  LYS A CB    1 
ATOM 1690 C CG    . LYS E 3 72  ? -0.364 28.734 29.498  1.00 100.00 ? 69  LYS A CG    1 
ATOM 1691 C CD    . LYS E 3 72  ? 0.490  27.528 29.860  1.00 100.00 ? 69  LYS A CD    1 
ATOM 1692 C CE    . LYS E 3 72  ? 0.336  27.171 31.335  1.00 100.00 ? 69  LYS A CE    1 
ATOM 1693 N NZ    . LYS E 3 72  ? 1.188  26.014 31.742  1.00 100.00 ? 69  LYS A NZ    1 
ATOM 1694 N N     . TRP E 3 73  ? 1.055  31.901 28.706  1.00 98.70  ? 70  TRP A N     1 
ATOM 1695 C CA    . TRP E 3 73  ? 1.716  32.835 29.598  1.00 98.73  ? 70  TRP A CA    1 
ATOM 1696 C C     . TRP E 3 73  ? 1.073  34.221 29.582  1.00 98.62  ? 70  TRP A C     1 
ATOM 1697 O O     . TRP E 3 73  ? 1.009  34.889 30.616  1.00 100.00 ? 70  TRP A O     1 
ATOM 1698 C CB    . TRP E 3 73  ? 3.193  32.936 29.225  1.00 98.35  ? 70  TRP A CB    1 
ATOM 1699 C CG    . TRP E 3 73  ? 3.967  33.803 30.145  1.00 96.35  ? 70  TRP A CG    1 
ATOM 1700 C CD1   . TRP E 3 73  ? 4.540  33.437 31.325  1.00 94.18  ? 70  TRP A CD1   1 
ATOM 1701 C CD2   . TRP E 3 73  ? 4.232  35.200 29.981  1.00 99.90  ? 70  TRP A CD2   1 
ATOM 1702 N NE1   . TRP E 3 73  ? 5.143  34.520 31.912  1.00 98.29  ? 70  TRP A NE1   1 
ATOM 1703 C CE2   . TRP E 3 73  ? 4.972  35.617 31.109  1.00 100.00 ? 70  TRP A CE2   1 
ATOM 1704 C CE3   . TRP E 3 73  ? 3.915  36.142 28.992  1.00 100.00 ? 70  TRP A CE3   1 
ATOM 1705 C CZ2   . TRP E 3 73  ? 5.402  36.939 31.278  1.00 100.00 ? 70  TRP A CZ2   1 
ATOM 1706 C CZ3   . TRP E 3 73  ? 4.342  37.458 29.159  1.00 100.00 ? 70  TRP A CZ3   1 
ATOM 1707 C CH2   . TRP E 3 73  ? 5.078  37.842 30.295  1.00 100.00 ? 70  TRP A CH2   1 
ATOM 1708 N N     . LEU E 3 74  ? 0.611  34.656 28.413  1.00 95.92  ? 71  LEU A N     1 
ATOM 1709 C CA    . LEU E 3 74  ? -0.020 35.967 28.291  1.00 98.19  ? 71  LEU A CA    1 
ATOM 1710 C C     . LEU E 3 74  ? -1.498 35.952 28.685  1.00 100.00 ? 71  LEU A C     1 
ATOM 1711 O O     . LEU E 3 74  ? -1.990 36.893 29.317  1.00 100.00 ? 71  LEU A O     1 
ATOM 1712 C CB    . LEU E 3 74  ? 0.137  36.508 26.871  1.00 98.06  ? 71  LEU A CB    1 
ATOM 1713 C CG    . LEU E 3 74  ? -0.381 37.935 26.671  1.00 100.00 ? 71  LEU A CG    1 
ATOM 1714 C CD1   . LEU E 3 74  ? 0.342  38.895 27.607  1.00 100.00 ? 71  LEU A CD1   1 
ATOM 1715 C CD2   . LEU E 3 74  ? -0.196 38.357 25.226  1.00 100.00 ? 71  LEU A CD2   1 
ATOM 1716 N N     . ASN E 3 75  ? -2.197 34.890 28.290  1.00 99.29  ? 72  ASN A N     1 
ATOM 1717 C CA    . ASN E 3 75  ? -3.617 34.713 28.597  1.00 100.00 ? 72  ASN A CA    1 
ATOM 1718 C C     . ASN E 3 75  ? -3.724 34.788 30.117  1.00 100.00 ? 72  ASN A C     1 
ATOM 1719 O O     . ASN E 3 75  ? -4.100 35.821 30.681  1.00 100.00 ? 72  ASN A O     1 
ATOM 1720 C CB    . ASN E 3 75  ? -4.081 33.332 28.103  1.00 100.00 ? 72  ASN A CB    1 
ATOM 1721 C CG    . ASN E 3 75  ? -5.593 33.197 28.037  1.00 100.00 ? 72  ASN A CG    1 
ATOM 1722 O OD1   . ASN E 3 75  ? -6.173 33.172 26.952  1.00 100.00 ? 72  ASN A OD1   1 
ATOM 1723 N ND2   . ASN E 3 75  ? -6.234 33.073 29.193  1.00 100.00 ? 72  ASN A ND2   1 
ATOM 1724 N N     . ASP E 3 76  ? -3.332 33.700 30.770  1.00 98.27  ? 73  ASP A N     1 
ATOM 1725 C CA    . ASP E 3 76  ? -3.348 33.624 32.219  1.00 96.03  ? 73  ASP A CA    1 
ATOM 1726 C C     . ASP E 3 76  ? -1.945 33.931 32.721  1.00 93.14  ? 73  ASP A C     1 
ATOM 1727 O O     . ASP E 3 76  ? -0.995 33.961 31.942  1.00 86.89  ? 73  ASP A O     1 
ATOM 1728 C CB    . ASP E 3 76  ? -3.799 32.232 32.682  1.00 98.59  ? 73  ASP A CB    1 
ATOM 1729 C CG    . ASP E 3 76  ? -3.065 31.104 31.970  1.00 100.00 ? 73  ASP A CG    1 
ATOM 1730 O OD1   . ASP E 3 76  ? -2.094 30.568 32.546  1.00 100.00 ? 73  ASP A OD1   1 
ATOM 1731 O OD2   . ASP E 3 76  ? -3.466 30.748 30.839  1.00 99.42  ? 73  ASP A OD2   1 
ATOM 1732 N N     . ALA E 3 77  ? -1.825 34.180 34.019  1.00 97.64  ? 74  ALA A N     1 
ATOM 1733 C CA    . ALA E 3 77  ? -0.536 34.481 34.626  1.00 98.88  ? 74  ALA A CA    1 
ATOM 1734 C C     . ALA E 3 77  ? 0.235  33.180 34.885  1.00 100.00 ? 74  ALA A C     1 
ATOM 1735 O O     . ALA E 3 77  ? 0.210  32.262 34.059  1.00 100.00 ? 74  ALA A O     1 
ATOM 1736 C CB    . ALA E 3 77  ? -0.742 35.266 35.925  1.00 95.56  ? 74  ALA A CB    1 
ATOM 1737 N N     . GLU E 3 78  ? 0.924  33.110 36.022  1.00 100.00 ? 75  GLU A N     1 
ATOM 1738 C CA    . GLU E 3 78  ? 1.698  31.930 36.394  1.00 100.00 ? 75  GLU A CA    1 
ATOM 1739 C C     . GLU E 3 78  ? 1.993  31.963 37.891  1.00 100.00 ? 75  GLU A C     1 
ATOM 1740 O O     . GLU E 3 78  ? 2.521  30.950 38.396  1.00 100.00 ? 75  GLU A O     1 
ATOM 1741 C CB    . GLU E 3 78  ? 3.012  31.882 35.605  1.00 100.00 ? 75  GLU A CB    1 
ATOM 1742 N N     . ARG E 3 104 ? 17.448 21.298 27.204  1.00 24.01  ? 102 ARG A N     1 
ATOM 1743 C CA    . ARG E 3 104 ? 18.539 21.825 26.330  1.00 22.60  ? 102 ARG A CA    1 
ATOM 1744 C C     . ARG E 3 104 ? 19.769 22.242 27.130  1.00 22.78  ? 102 ARG A C     1 
ATOM 1745 O O     . ARG E 3 104 ? 19.666 22.949 28.134  1.00 24.76  ? 102 ARG A O     1 
ATOM 1746 C CB    . ARG E 3 104 ? 18.041 23.007 25.490  1.00 29.16  ? 102 ARG A CB    1 
ATOM 1747 C CG    . ARG E 3 104 ? 19.154 23.748 24.750  1.00 44.05  ? 102 ARG A CG    1 
ATOM 1748 C CD    . ARG E 3 104 ? 18.630 24.879 23.869  1.00 57.60  ? 102 ARG A CD    1 
ATOM 1749 N NE    . ARG E 3 104 ? 18.523 24.491 22.461  1.00 68.26  ? 102 ARG A NE    1 
ATOM 1750 C CZ    . ARG E 3 104 ? 19.562 24.331 21.642  1.00 73.41  ? 102 ARG A CZ    1 
ATOM 1751 N NH1   . ARG E 3 104 ? 20.803 24.523 22.081  1.00 78.01  ? 102 ARG A NH1   1 
ATOM 1752 N NH2   . ARG E 3 104 ? 19.360 23.987 20.375  1.00 59.95  ? 102 ARG A NH2   1 
ATOM 1753 N N     . LYS E 3 105 ? 20.935 21.819 26.650  1.00 24.45  ? 103 LYS A N     1 
ATOM 1754 C CA    . LYS E 3 105 ? 22.207 22.126 27.292  1.00 23.23  ? 103 LYS A CA    1 
ATOM 1755 C C     . LYS E 3 105 ? 22.583 23.585 27.050  1.00 23.25  ? 103 LYS A C     1 
ATOM 1756 O O     . LYS E 3 105 ? 22.504 24.079 25.924  1.00 20.47  ? 103 LYS A O     1 
ATOM 1757 C CB    . LYS E 3 105 ? 23.310 21.202 26.749  1.00 14.42  ? 103 LYS A CB    1 
ATOM 1758 C CG    . LYS E 3 105 ? 24.504 21.034 27.689  1.00 28.98  ? 103 LYS A CG    1 
ATOM 1759 C CD    . LYS E 3 105 ? 25.773 21.725 27.197  1.00 23.25  ? 103 LYS A CD    1 
ATOM 1760 C CE    . LYS E 3 105 ? 26.885 21.612 28.237  1.00 21.84  ? 103 LYS A CE    1 
ATOM 1761 N NZ    . LYS E 3 105 ? 28.241 21.756 27.638  1.00 24.50  ? 103 LYS A NZ    1 
ATOM 1762 N N     . LYS E 3 106 ? 22.959 24.281 28.117  1.00 29.53  ? 104 LYS A N     1 
ATOM 1763 C CA    . LYS E 3 106 ? 23.366 25.677 28.005  1.00 31.47  ? 104 LYS A CA    1 
ATOM 1764 C C     . LYS E 3 106 ? 24.539 25.737 27.027  1.00 27.24  ? 104 LYS A C     1 
ATOM 1765 O O     . LYS E 3 106 ? 25.544 25.042 27.204  1.00 34.05  ? 104 LYS A O     1 
ATOM 1766 C CB    . LYS E 3 106 ? 23.801 26.226 29.370  1.00 35.95  ? 104 LYS A CB    1 
ATOM 1767 C CG    . LYS E 3 106 ? 22.768 26.080 30.488  1.00 43.25  ? 104 LYS A CG    1 
ATOM 1768 C CD    . LYS E 3 106 ? 21.452 26.782 30.160  1.00 53.80  ? 104 LYS A CD    1 
ATOM 1769 C CE    . LYS E 3 106 ? 20.512 26.809 31.363  1.00 51.90  ? 104 LYS A CE    1 
ATOM 1770 N NZ    . LYS E 3 106 ? 20.967 27.762 32.423  1.00 52.82  ? 104 LYS A NZ    1 
ATOM 1771 N N     . ARG E 3 107 ? 24.373 26.536 25.979  1.00 18.86  ? 105 ARG A N     1 
ATOM 1772 C CA    . ARG E 3 107 ? 25.376 26.722 24.925  1.00 14.59  ? 105 ARG A CA    1 
ATOM 1773 C C     . ARG E 3 107 ? 26.835 26.861 25.399  1.00 14.75  ? 105 ARG A C     1 
ATOM 1774 O O     . ARG E 3 107 ? 27.143 27.682 26.267  1.00 16.96  ? 105 ARG A O     1 
ATOM 1775 C CB    . ARG E 3 107 ? 24.987 27.951 24.101  1.00 13.02  ? 105 ARG A CB    1 
ATOM 1776 C CG    . ARG E 3 107 ? 25.914 28.282 22.962  1.00 17.19  ? 105 ARG A CG    1 
ATOM 1777 C CD    . ARG E 3 107 ? 25.556 29.626 22.348  1.00 23.24  ? 105 ARG A CD    1 
ATOM 1778 N NE    . ARG E 3 107 ? 26.252 29.824 21.082  1.00 19.64  ? 105 ARG A NE    1 
ATOM 1779 C CZ    . ARG E 3 107 ? 25.761 29.463 19.901  1.00 23.94  ? 105 ARG A CZ    1 
ATOM 1780 N NH1   . ARG E 3 107 ? 24.557 28.897 19.816  1.00 22.72  ? 105 ARG A NH1   1 
ATOM 1781 N NH2   . ARG E 3 107 ? 26.505 29.608 18.814  1.00 20.02  ? 105 ARG A NH2   1 
ATOM 1782 N N     . THR E 3 108 ? 27.727 26.064 24.812  1.00 19.05  ? 106 THR A N     1 
ATOM 1783 C CA    . THR E 3 108 ? 29.148 26.111 25.158  1.00 27.94  ? 106 THR A CA    1 
ATOM 1784 C C     . THR E 3 108 ? 29.848 27.165 24.319  1.00 26.02  ? 106 THR A C     1 
ATOM 1785 O O     . THR E 3 108 ? 29.829 27.088 23.092  1.00 35.79  ? 106 THR A O     1 
ATOM 1786 C CB    . THR E 3 108 ? 29.858 24.761 24.886  1.00 36.63  ? 106 THR A CB    1 
ATOM 1787 O OG1   . THR E 3 108 ? 29.312 23.745 25.736  1.00 57.48  ? 106 THR A OG1   1 
ATOM 1788 C CG2   . THR E 3 108 ? 31.359 24.877 25.155  1.00 38.94  ? 106 THR A CG2   1 
ATOM 1789 N N     . SER E 3 109 ? 30.469 28.141 24.976  1.00 28.26  ? 107 SER A N     1 
ATOM 1790 C CA    . SER E 3 109 ? 31.187 29.194 24.262  1.00 32.23  ? 107 SER A CA    1 
ATOM 1791 C C     . SER E 3 109 ? 32.684 28.912 24.356  1.00 35.36  ? 107 SER A C     1 
ATOM 1792 O O     . SER E 3 109 ? 33.292 29.031 25.422  1.00 31.75  ? 107 SER A O     1 
ATOM 1793 C CB    . SER E 3 109 ? 30.848 30.581 24.824  1.00 34.63  ? 107 SER A CB    1 
ATOM 1794 O OG    . SER E 3 109 ? 31.446 30.806 26.087  1.00 32.15  ? 107 SER A OG    1 
ATOM 1795 N N     . ILE E 3 110 ? 33.265 28.513 23.230  1.00 38.12  ? 108 ILE A N     1 
ATOM 1796 C CA    . ILE E 3 110 ? 34.680 28.176 23.175  1.00 37.01  ? 108 ILE A CA    1 
ATOM 1797 C C     . ILE E 3 110 ? 35.586 29.395 23.218  1.00 34.17  ? 108 ILE A C     1 
ATOM 1798 O O     . ILE E 3 110 ? 35.395 30.351 22.469  1.00 39.14  ? 108 ILE A O     1 
ATOM 1799 C CB    . ILE E 3 110 ? 35.009 27.342 21.911  1.00 36.54  ? 108 ILE A CB    1 
ATOM 1800 C CG1   . ILE E 3 110 ? 34.257 26.010 21.942  1.00 18.88  ? 108 ILE A CG1   1 
ATOM 1801 C CG2   . ILE E 3 110 ? 36.506 27.096 21.800  1.00 38.27  ? 108 ILE A CG2   1 
ATOM 1802 C CD1   . ILE E 3 110 ? 33.059 25.981 21.028  1.00 20.72  ? 108 ILE A CD1   1 
ATOM 1803 N N     . GLU E 3 111 ? 36.570 29.354 24.109  1.00 35.11  ? 109 GLU A N     1 
ATOM 1804 C CA    . GLU E 3 111 ? 37.526 30.442 24.233  1.00 45.69  ? 109 GLU A CA    1 
ATOM 1805 C C     . GLU E 3 111 ? 38.287 30.520 22.916  1.00 43.28  ? 109 GLU A C     1 
ATOM 1806 O O     . GLU E 3 111 ? 38.624 29.494 22.330  1.00 39.90  ? 109 GLU A O     1 
ATOM 1807 C CB    . GLU E 3 111 ? 38.492 30.155 25.375  1.00 47.05  ? 109 GLU A CB    1 
ATOM 1808 C CG    . GLU E 3 111 ? 37.808 29.920 26.704  1.00 52.23  ? 109 GLU A CG    1 
ATOM 1809 C CD    . GLU E 3 111 ? 38.701 29.203 27.691  1.00 62.38  ? 109 GLU A CD    1 
ATOM 1810 O OE1   . GLU E 3 111 ? 39.285 28.163 27.312  1.00 66.64  ? 109 GLU A OE1   1 
ATOM 1811 O OE2   . GLU E 3 111 ? 38.816 29.673 28.844  1.00 64.73  ? 109 GLU A OE2   1 
ATOM 1812 N N     . THR E 3 112 ? 38.538 31.736 22.447  1.00 43.43  ? 110 THR A N     1 
ATOM 1813 C CA    . THR E 3 112 ? 39.248 31.945 21.189  1.00 49.30  ? 110 THR A CA    1 
ATOM 1814 C C     . THR E 3 112 ? 40.557 31.166 21.022  1.00 46.70  ? 110 THR A C     1 
ATOM 1815 O O     . THR E 3 112 ? 41.002 30.944 19.896  1.00 47.00  ? 110 THR A O     1 
ATOM 1816 C CB    . THR E 3 112 ? 39.510 33.447 20.939  1.00 53.23  ? 110 THR A CB    1 
ATOM 1817 O OG1   . THR E 3 112 ? 39.896 34.081 22.164  1.00 62.10  ? 110 THR A OG1   1 
ATOM 1818 C CG2   . THR E 3 112 ? 38.264 34.124 20.393  1.00 52.87  ? 110 THR A CG2   1 
ATOM 1819 N N     . ASN E 3 113 ? 41.161 30.731 22.125  1.00 40.95  ? 111 ASN A N     1 
ATOM 1820 C CA    . ASN E 3 113 ? 42.414 29.986 22.038  1.00 41.55  ? 111 ASN A CA    1 
ATOM 1821 C C     . ASN E 3 113 ? 42.192 28.514 21.693  1.00 39.01  ? 111 ASN A C     1 
ATOM 1822 O O     . ASN E 3 113 ? 43.114 27.824 21.263  1.00 38.86  ? 111 ASN A O     1 
ATOM 1823 C CB    . ASN E 3 113 ? 43.237 30.130 23.323  1.00 44.14  ? 111 ASN A CB    1 
ATOM 1824 C CG    . ASN E 3 113 ? 42.691 29.305 24.467  1.00 54.73  ? 111 ASN A CG    1 
ATOM 1825 O OD1   . ASN E 3 113 ? 43.313 28.328 24.891  1.00 53.04  ? 111 ASN A OD1   1 
ATOM 1826 N ND2   . ASN E 3 113 ? 41.525 29.688 24.972  1.00 55.99  ? 111 ASN A ND2   1 
ATOM 1827 N N     . ILE E 3 114 ? 40.978 28.026 21.923  1.00 35.51  ? 112 ILE A N     1 
ATOM 1828 C CA    . ILE E 3 114 ? 40.644 26.646 21.601  1.00 37.53  ? 112 ILE A CA    1 
ATOM 1829 C C     . ILE E 3 114 ? 39.953 26.635 20.238  1.00 45.04  ? 112 ILE A C     1 
ATOM 1830 O O     . ILE E 3 114 ? 39.915 25.607 19.565  1.00 39.67  ? 112 ILE A O     1 
ATOM 1831 C CB    . ILE E 3 114 ? 39.768 25.993 22.703  1.00 37.12  ? 112 ILE A CB    1 
ATOM 1832 C CG1   . ILE E 3 114 ? 40.608 25.787 23.965  1.00 38.59  ? 112 ILE A CG1   1 
ATOM 1833 C CG2   . ILE E 3 114 ? 39.204 24.654 22.236  1.00 33.26  ? 112 ILE A CG2   1 
ATOM 1834 C CD1   . ILE E 3 114 ? 39.901 25.033 25.068  1.00 49.52  ? 112 ILE A CD1   1 
ATOM 1835 N N     . ARG E 3 115 ? 39.446 27.796 19.822  1.00 51.29  ? 113 ARG A N     1 
ATOM 1836 C CA    . ARG E 3 115 ? 38.795 27.928 18.521  1.00 56.29  ? 113 ARG A CA    1 
ATOM 1837 C C     . ARG E 3 115 ? 39.866 27.968 17.432  1.00 61.67  ? 113 ARG A C     1 
ATOM 1838 O O     . ARG E 3 115 ? 39.652 27.489 16.320  1.00 68.10  ? 113 ARG A O     1 
ATOM 1839 C CB    . ARG E 3 115 ? 37.935 29.194 18.448  1.00 57.10  ? 113 ARG A CB    1 
ATOM 1840 C CG    . ARG E 3 115 ? 36.452 28.951 18.652  1.00 57.87  ? 113 ARG A CG    1 
ATOM 1841 C CD    . ARG E 3 115 ? 35.617 29.998 17.925  1.00 69.04  ? 113 ARG A CD    1 
ATOM 1842 N NE    . ARG E 3 115 ? 35.833 31.353 18.435  1.00 81.62  ? 113 ARG A NE    1 
ATOM 1843 C CZ    . ARG E 3 115 ? 35.023 31.972 19.291  1.00 87.24  ? 113 ARG A CZ    1 
ATOM 1844 N NH1   . ARG E 3 115 ? 33.934 31.362 19.744  1.00 97.51  ? 113 ARG A NH1   1 
ATOM 1845 N NH2   . ARG E 3 115 ? 35.290 33.210 19.686  1.00 84.93  ? 113 ARG A NH2   1 
ATOM 1846 N N     . VAL E 3 116 ? 41.013 28.556 17.761  1.00 61.47  ? 114 VAL A N     1 
ATOM 1847 C CA    . VAL E 3 116 ? 42.129 28.642 16.827  1.00 61.77  ? 114 VAL A CA    1 
ATOM 1848 C C     . VAL E 3 116 ? 42.871 27.311 16.811  1.00 58.24  ? 114 VAL A C     1 
ATOM 1849 O O     . VAL E 3 116 ? 43.248 26.813 15.747  1.00 62.08  ? 114 VAL A O     1 
ATOM 1850 C CB    . VAL E 3 116 ? 43.085 29.800 17.205  1.00 66.89  ? 114 VAL A CB    1 
ATOM 1851 C CG1   . VAL E 3 116 ? 44.486 29.566 16.637  1.00 71.81  ? 114 VAL A CG1   1 
ATOM 1852 C CG2   . VAL E 3 116 ? 42.526 31.111 16.671  1.00 68.93  ? 114 VAL A CG2   1 
ATOM 1853 N N     . ALA E 3 117 ? 43.055 26.732 17.995  1.00 52.00  ? 115 ALA A N     1 
ATOM 1854 C CA    . ALA E 3 117 ? 43.734 25.447 18.137  1.00 52.00  ? 115 ALA A CA    1 
ATOM 1855 C C     . ALA E 3 117 ? 43.022 24.379 17.310  1.00 50.41  ? 115 ALA A C     1 
ATOM 1856 O O     . ALA E 3 117 ? 43.659 23.611 16.581  1.00 46.24  ? 115 ALA A O     1 
ATOM 1857 C CB    . ALA E 3 117 ? 43.773 25.037 19.605  1.00 50.43  ? 115 ALA A CB    1 
ATOM 1858 N N     . LEU E 3 118 ? 41.693 24.367 17.413  1.00 48.41  ? 116 LEU A N     1 
ATOM 1859 C CA    . LEU E 3 118 ? 40.852 23.414 16.695  1.00 45.28  ? 116 LEU A CA    1 
ATOM 1860 C C     . LEU E 3 118 ? 40.860 23.643 15.196  1.00 43.57  ? 116 LEU A C     1 
ATOM 1861 O O     . LEU E 3 118 ? 40.844 22.687 14.420  1.00 46.73  ? 116 LEU A O     1 
ATOM 1862 C CB    . LEU E 3 118 ? 39.418 23.482 17.209  1.00 51.71  ? 116 LEU A CB    1 
ATOM 1863 C CG    . LEU E 3 118 ? 39.177 22.833 18.570  1.00 63.85  ? 116 LEU A CG    1 
ATOM 1864 C CD1   . LEU E 3 118 ? 37.777 23.152 19.062  1.00 71.25  ? 116 LEU A CD1   1 
ATOM 1865 C CD2   . LEU E 3 118 ? 39.385 21.331 18.461  1.00 72.20  ? 116 LEU A CD2   1 
ATOM 1866 N N     . GLU E 3 119 ? 40.859 24.912 14.797  1.00 37.29  ? 117 GLU A N     1 
ATOM 1867 C CA    . GLU E 3 119 ? 40.882 25.273 13.386  1.00 35.26  ? 117 GLU A CA    1 
ATOM 1868 C C     . GLU E 3 119 ? 42.066 24.601 12.706  1.00 39.61  ? 117 GLU A C     1 
ATOM 1869 O O     . GLU E 3 119 ? 41.971 24.170 11.559  1.00 38.98  ? 117 GLU A O     1 
ATOM 1870 C CB    . GLU E 3 119 ? 40.994 26.789 13.227  1.00 34.75  ? 117 GLU A CB    1 
ATOM 1871 C CG    . GLU E 3 119 ? 39.672 27.531 13.297  1.00 35.86  ? 117 GLU A CG    1 
ATOM 1872 C CD    . GLU E 3 119 ? 38.739 27.210 12.138  1.00 42.05  ? 117 GLU A CD    1 
ATOM 1873 O OE1   . GLU E 3 119 ? 39.220 26.803 11.052  1.00 37.04  ? 117 GLU A OE1   1 
ATOM 1874 O OE2   . GLU E 3 119 ? 37.515 27.380 12.318  1.00 43.17  ? 117 GLU A OE2   1 
ATOM 1875 N N     . LYS E 3 120 ? 43.166 24.487 13.447  1.00 44.05  ? 118 LYS A N     1 
ATOM 1876 C CA    . LYS E 3 120 ? 44.396 23.874 12.959  1.00 49.18  ? 118 LYS A CA    1 
ATOM 1877 C C     . LYS E 3 120 ? 44.248 22.374 12.692  1.00 52.42  ? 118 LYS A C     1 
ATOM 1878 O O     . LYS E 3 120 ? 44.650 21.883 11.634  1.00 51.58  ? 118 LYS A O     1 
ATOM 1879 C CB    . LYS E 3 120 ? 45.529 24.127 13.952  1.00 45.37  ? 118 LYS A CB    1 
ATOM 1880 N N     . SER E 3 121 ? 43.686 21.648 13.657  1.00 53.59  ? 119 SER A N     1 
ATOM 1881 C CA    . SER E 3 121 ? 43.487 20.206 13.515  1.00 54.02  ? 119 SER A CA    1 
ATOM 1882 C C     . SER E 3 121 ? 42.500 19.896 12.395  1.00 52.34  ? 119 SER A C     1 
ATOM 1883 O O     . SER E 3 121 ? 42.512 18.804 11.825  1.00 59.91  ? 119 SER A O     1 
ATOM 1884 C CB    . SER E 3 121 ? 43.012 19.600 14.832  1.00 57.60  ? 119 SER A CB    1 
ATOM 1885 O OG    . SER E 3 121 ? 43.972 19.831 15.849  1.00 68.80  ? 119 SER A OG    1 
ATOM 1886 N N     . PHE E 3 122 ? 41.626 20.857 12.113  1.00 43.06  ? 120 PHE A N     1 
ATOM 1887 C CA    . PHE E 3 122 ? 40.654 20.736 11.036  1.00 38.40  ? 120 PHE A CA    1 
ATOM 1888 C C     . PHE E 3 122 ? 41.482 20.863 9.764   1.00 40.16  ? 120 PHE A C     1 
ATOM 1889 O O     . PHE E 3 122 ? 41.338 20.084 8.826   1.00 42.05  ? 120 PHE A O     1 
ATOM 1890 C CB    . PHE E 3 122 ? 39.654 21.885 11.116  1.00 32.51  ? 120 PHE A CB    1 
ATOM 1891 C CG    . PHE E 3 122 ? 38.557 21.808 10.101  1.00 28.35  ? 120 PHE A CG    1 
ATOM 1892 C CD1   . PHE E 3 122 ? 38.182 22.936 9.384   1.00 30.39  ? 120 PHE A CD1   1 
ATOM 1893 C CD2   . PHE E 3 122 ? 37.868 20.621 9.890   1.00 24.81  ? 120 PHE A CD2   1 
ATOM 1894 C CE1   . PHE E 3 122 ? 37.135 22.880 8.476   1.00 25.49  ? 120 PHE A CE1   1 
ATOM 1895 C CE2   . PHE E 3 122 ? 36.819 20.559 8.983   1.00 23.21  ? 120 PHE A CE2   1 
ATOM 1896 C CZ    . PHE E 3 122 ? 36.452 21.687 8.277   1.00 19.67  ? 120 PHE A CZ    1 
ATOM 1897 N N     . LEU E 3 123 ? 42.392 21.834 9.790   1.00 49.80  ? 121 LEU A N     1 
ATOM 1898 C CA    . LEU E 3 123 ? 43.310 22.123 8.693   1.00 54.27  ? 121 LEU A CA    1 
ATOM 1899 C C     . LEU E 3 123 ? 44.264 20.961 8.425   1.00 56.31  ? 121 LEU A C     1 
ATOM 1900 O O     . LEU E 3 123 ? 45.003 20.966 7.440   1.00 60.85  ? 121 LEU A O     1 
ATOM 1901 C CB    . LEU E 3 123 ? 44.118 23.385 9.015   1.00 53.60  ? 121 LEU A CB    1 
ATOM 1902 C CG    . LEU E 3 123 ? 43.658 24.712 8.407   1.00 57.42  ? 121 LEU A CG    1 
ATOM 1903 C CD1   . LEU E 3 123 ? 44.090 24.771 6.949   1.00 54.57  ? 121 LEU A CD1   1 
ATOM 1904 C CD2   . LEU E 3 123 ? 42.145 24.894 8.552   1.00 57.45  ? 121 LEU A CD2   1 
ATOM 1905 N N     . GLU E 3 124 ? 44.273 19.985 9.325   1.00 57.53  ? 122 GLU A N     1 
ATOM 1906 C CA    . GLU E 3 124 ? 45.125 18.820 9.170   1.00 65.60  ? 122 GLU A CA    1 
ATOM 1907 C C     . GLU E 3 124 ? 44.257 17.677 8.658   1.00 66.86  ? 122 GLU A C     1 
ATOM 1908 O O     . GLU E 3 124 ? 44.657 16.929 7.764   1.00 73.34  ? 122 GLU A O     1 
ATOM 1909 C CB    . GLU E 3 124 ? 45.747 18.436 10.513  1.00 72.26  ? 122 GLU A CB    1 
ATOM 1910 C CG    . GLU E 3 124 ? 46.808 17.355 10.411  1.00 84.05  ? 122 GLU A CG    1 
ATOM 1911 C CD    . GLU E 3 124 ? 47.109 16.706 11.747  1.00 95.59  ? 122 GLU A CD    1 
ATOM 1912 O OE1   . GLU E 3 124 ? 46.393 15.747 12.110  1.00 100.00 ? 122 GLU A OE1   1 
ATOM 1913 O OE2   . GLU E 3 124 ? 48.060 17.149 12.431  1.00 100.00 ? 122 GLU A OE2   1 
ATOM 1914 N N     . ASN E 3 125 ? 43.047 17.585 9.204   1.00 63.44  ? 123 ASN A N     1 
ATOM 1915 C CA    . ASN E 3 125 ? 42.095 16.542 8.840   1.00 60.65  ? 123 ASN A CA    1 
ATOM 1916 C C     . ASN E 3 125 ? 40.685 17.010 9.210   1.00 51.52  ? 123 ASN A C     1 
ATOM 1917 O O     . ASN E 3 125 ? 40.387 17.254 10.377  1.00 41.33  ? 123 ASN A O     1 
ATOM 1918 C CB    . ASN E 3 125 ? 42.450 15.241 9.572   1.00 68.67  ? 123 ASN A CB    1 
ATOM 1919 C CG    . ASN E 3 125 ? 41.604 14.061 9.128   1.00 74.42  ? 123 ASN A CG    1 
ATOM 1920 O OD1   . ASN E 3 125 ? 41.275 13.914 7.947   1.00 77.04  ? 123 ASN A OD1   1 
ATOM 1921 N ND2   . ASN E 3 125 ? 41.254 13.204 10.080  1.00 82.35  ? 123 ASN A ND2   1 
ATOM 1922 N N     . GLN E 3 126 ? 39.833 17.149 8.198   1.00 47.02  ? 124 GLN A N     1 
ATOM 1923 C CA    . GLN E 3 126 ? 38.458 17.605 8.383   1.00 46.03  ? 124 GLN A CA    1 
ATOM 1924 C C     . GLN E 3 126 ? 37.495 16.602 9.019   1.00 47.70  ? 124 GLN A C     1 
ATOM 1925 O O     . GLN E 3 126 ? 36.395 16.977 9.428   1.00 49.67  ? 124 GLN A O     1 
ATOM 1926 C CB    . GLN E 3 126 ? 37.869 18.057 7.044   1.00 45.13  ? 124 GLN A CB    1 
ATOM 1927 C CG    . GLN E 3 126 ? 38.530 19.272 6.420   1.00 40.56  ? 124 GLN A CG    1 
ATOM 1928 C CD    . GLN E 3 126 ? 37.779 19.758 5.192   1.00 48.60  ? 124 GLN A CD    1 
ATOM 1929 O OE1   . GLN E 3 126 ? 37.306 18.959 4.382   1.00 53.13  ? 124 GLN A OE1   1 
ATOM 1930 N NE2   . GLN E 3 126 ? 37.656 21.071 5.054   1.00 50.95  ? 124 GLN A NE2   1 
ATOM 1931 N N     . LYS E 3 127 ? 37.897 15.338 9.110   1.00 46.73  ? 125 LYS A N     1 
ATOM 1932 C CA    . LYS E 3 127 ? 37.024 14.313 9.670   1.00 39.60  ? 125 LYS A CA    1 
ATOM 1933 C C     . LYS E 3 127 ? 37.809 13.244 10.412  1.00 37.65  ? 125 LYS A C     1 
ATOM 1934 O O     . LYS E 3 127 ? 38.165 12.211 9.847   1.00 38.28  ? 125 LYS A O     1 
ATOM 1935 C CB    . LYS E 3 127 ? 36.187 13.689 8.545   1.00 46.35  ? 125 LYS A CB    1 
ATOM 1936 C CG    . LYS E 3 127 ? 35.154 12.665 8.986   1.00 49.73  ? 125 LYS A CG    1 
ATOM 1937 C CD    . LYS E 3 127 ? 34.245 12.280 7.823   1.00 44.00  ? 125 LYS A CD    1 
ATOM 1938 C CE    . LYS E 3 127 ? 33.309 11.152 8.213   1.00 54.03  ? 125 LYS A CE    1 
ATOM 1939 N NZ    . LYS E 3 127 ? 32.334 10.833 7.136   1.00 55.95  ? 125 LYS A NZ    1 
ATOM 1940 N N     . PRO E 3 128 ? 38.141 13.512 11.683  1.00 41.45  ? 126 PRO A N     1 
ATOM 1941 C CA    . PRO E 3 128 ? 38.891 12.591 12.539  1.00 42.41  ? 126 PRO A CA    1 
ATOM 1942 C C     . PRO E 3 128 ? 37.976 11.494 13.056  1.00 43.84  ? 126 PRO A C     1 
ATOM 1943 O O     . PRO E 3 128 ? 36.780 11.716 13.255  1.00 41.05  ? 126 PRO A O     1 
ATOM 1944 C CB    . PRO E 3 128 ? 39.348 13.489 13.691  1.00 45.49  ? 126 PRO A CB    1 
ATOM 1945 C CG    . PRO E 3 128 ? 39.296 14.878 13.113  1.00 45.61  ? 126 PRO A CG    1 
ATOM 1946 C CD    . PRO E 3 128 ? 38.025 14.827 12.328  1.00 46.38  ? 126 PRO A CD    1 
ATOM 1947 N N     . THR E 3 129 ? 38.547 10.317 13.283  1.00 49.12  ? 127 THR A N     1 
ATOM 1948 C CA    . THR E 3 129 ? 37.792 9.177  13.788  1.00 58.07  ? 127 THR A CA    1 
ATOM 1949 C C     . THR E 3 129 ? 37.389 9.432  15.237  1.00 56.00  ? 127 THR A C     1 
ATOM 1950 O O     . THR E 3 129 ? 38.033 10.223 15.923  1.00 55.38  ? 127 THR A O     1 
ATOM 1951 C CB    . THR E 3 129 ? 38.629 7.880  13.702  1.00 63.57  ? 127 THR A CB    1 
ATOM 1952 O OG1   . THR E 3 129 ? 39.878 8.055  14.389  1.00 66.76  ? 127 THR A OG1   1 
ATOM 1953 C CG2   . THR E 3 129 ? 38.905 7.533  12.250  1.00 67.27  ? 127 THR A CG2   1 
ATOM 1954 N N     . SER E 3 130 ? 36.333 8.759  15.699  1.00 55.72  ? 128 SER A N     1 
ATOM 1955 C CA    . SER E 3 130 ? 35.852 8.913  17.075  1.00 54.52  ? 128 SER A CA    1 
ATOM 1956 C C     . SER E 3 130 ? 36.965 8.632  18.081  1.00 57.34  ? 128 SER A C     1 
ATOM 1957 O O     . SER E 3 130 ? 36.828 8.922  19.269  1.00 52.90  ? 128 SER A O     1 
ATOM 1958 C CB    . SER E 3 130 ? 34.663 7.985  17.339  1.00 49.06  ? 128 SER A CB    1 
ATOM 1959 N N     . GLU E 3 131 ? 38.053 8.043  17.586  1.00 65.78  ? 129 GLU A N     1 
ATOM 1960 C CA    . GLU E 3 131 ? 39.223 7.726  18.392  1.00 67.83  ? 129 GLU A CA    1 
ATOM 1961 C C     . GLU E 3 131 ? 40.070 8.987  18.460  1.00 60.56  ? 129 GLU A C     1 
ATOM 1962 O O     . GLU E 3 131 ? 40.322 9.501  19.547  1.00 59.16  ? 129 GLU A O     1 
ATOM 1963 C CB    . GLU E 3 131 ? 40.028 6.594  17.743  1.00 76.83  ? 129 GLU A CB    1 
ATOM 1964 C CG    . GLU E 3 131 ? 40.892 5.777  18.710  1.00 88.57  ? 129 GLU A CG    1 
ATOM 1965 C CD    . GLU E 3 131 ? 42.007 6.579  19.365  1.00 92.14  ? 129 GLU A CD    1 
ATOM 1966 O OE1   . GLU E 3 131 ? 41.756 7.203  20.419  1.00 90.26  ? 129 GLU A OE1   1 
ATOM 1967 O OE2   . GLU E 3 131 ? 43.140 6.570  18.834  1.00 97.69  ? 129 GLU A OE2   1 
ATOM 1968 N N     . GLU E 3 132 ? 40.510 9.468  17.295  1.00 53.83  ? 130 GLU A N     1 
ATOM 1969 C CA    . GLU E 3 132 ? 41.318 10.685 17.200  1.00 52.35  ? 130 GLU A CA    1 
ATOM 1970 C C     . GLU E 3 132 ? 40.618 11.777 17.995  1.00 53.14  ? 130 GLU A C     1 
ATOM 1971 O O     . GLU E 3 132 ? 41.225 12.427 18.848  1.00 58.73  ? 130 GLU A O     1 
ATOM 1972 C CB    . GLU E 3 132 ? 41.441 11.145 15.747  1.00 49.75  ? 130 GLU A CB    1 
ATOM 1973 C CG    . GLU E 3 132 ? 42.181 10.200 14.821  1.00 52.45  ? 130 GLU A CG    1 
ATOM 1974 C CD    . GLU E 3 132 ? 42.314 10.770 13.416  1.00 56.86  ? 130 GLU A CD    1 
ATOM 1975 O OE1   . GLU E 3 132 ? 41.404 10.552 12.588  1.00 53.58  ? 130 GLU A OE1   1 
ATOM 1976 O OE2   . GLU E 3 132 ? 43.328 11.448 13.142  1.00 55.61  ? 130 GLU A OE2   1 
ATOM 1977 N N     . ILE E 3 133 ? 39.330 11.951 17.707  1.00 45.66  ? 131 ILE A N     1 
ATOM 1978 C CA    . ILE E 3 133 ? 38.493 12.931 18.384  1.00 40.96  ? 131 ILE A CA    1 
ATOM 1979 C C     . ILE E 3 133 ? 38.635 12.813 19.903  1.00 39.27  ? 131 ILE A C     1 
ATOM 1980 O O     . ILE E 3 133 ? 38.821 13.819 20.587  1.00 37.28  ? 131 ILE A O     1 
ATOM 1981 C CB    . ILE E 3 133 ? 37.007 12.798 17.935  1.00 40.63  ? 131 ILE A CB    1 
ATOM 1982 C CG1   . ILE E 3 133 ? 36.796 13.573 16.627  1.00 38.24  ? 131 ILE A CG1   1 
ATOM 1983 C CG2   . ILE E 3 133 ? 36.046 13.251 19.036  1.00 35.99  ? 131 ILE A CG2   1 
ATOM 1984 C CD1   . ILE E 3 133 ? 35.345 13.654 16.158  1.00 34.28  ? 131 ILE A CD1   1 
ATOM 1985 N N     . THR E 3 134 ? 38.582 11.593 20.430  1.00 39.91  ? 132 THR A N     1 
ATOM 1986 C CA    . THR E 3 134 ? 38.744 11.418 21.871  1.00 44.09  ? 132 THR A CA    1 
ATOM 1987 C C     . THR E 3 134 ? 40.135 11.926 22.243  1.00 48.14  ? 132 THR A C     1 
ATOM 1988 O O     . THR E 3 134 ? 40.283 12.760 23.136  1.00 51.33  ? 132 THR A O     1 
ATOM 1989 C CB    . THR E 3 134 ? 38.651 9.936  22.311  1.00 40.38  ? 132 THR A CB    1 
ATOM 1990 O OG1   . THR E 3 134 ? 37.449 9.343  21.807  1.00 37.24  ? 132 THR A OG1   1 
ATOM 1991 C CG2   . THR E 3 134 ? 38.655 9.843  23.830  1.00 32.75  ? 132 THR A CG2   1 
ATOM 1992 N N     . MET E 3 135 ? 41.135 11.473 21.487  1.00 49.91  ? 133 MET A N     1 
ATOM 1993 C CA    . MET E 3 135 ? 42.530 11.838 21.716  1.00 55.65  ? 133 MET A CA    1 
ATOM 1994 C C     . MET E 3 135 ? 42.825 13.322 21.531  1.00 53.69  ? 133 MET A C     1 
ATOM 1995 O O     . MET E 3 135 ? 43.922 13.777 21.846  1.00 59.98  ? 133 MET A O     1 
ATOM 1996 C CB    . MET E 3 135 ? 43.462 11.000 20.828  1.00 62.63  ? 133 MET A CB    1 
ATOM 1997 C CG    . MET E 3 135 ? 44.950 11.165 21.151  1.00 72.53  ? 133 MET A CG    1 
ATOM 1998 S SD    . MET E 3 135 ? 46.050 10.102 20.192  1.00 92.28  ? 133 MET A SD    1 
ATOM 1999 C CE    . MET E 3 135 ? 46.911 11.311 19.191  1.00 76.56  ? 133 MET A CE    1 
ATOM 2000 N N     . ILE E 3 136 ? 41.862 14.073 21.008  1.00 49.96  ? 134 ILE A N     1 
ATOM 2001 C CA    . ILE E 3 136 ? 42.056 15.506 20.816  1.00 52.21  ? 134 ILE A CA    1 
ATOM 2002 C C     . ILE E 3 136 ? 41.436 16.249 21.989  1.00 48.01  ? 134 ILE A C     1 
ATOM 2003 O O     . ILE E 3 136 ? 42.057 17.133 22.575  1.00 39.39  ? 134 ILE A O     1 
ATOM 2004 C CB    . ILE E 3 136 ? 41.421 15.998 19.504  1.00 55.40  ? 134 ILE A CB    1 
ATOM 2005 C CG1   . ILE E 3 136 ? 42.093 15.320 18.308  1.00 56.23  ? 134 ILE A CG1   1 
ATOM 2006 C CG2   . ILE E 3 136 ? 41.559 17.510 19.393  1.00 59.17  ? 134 ILE A CG2   1 
ATOM 2007 C CD1   . ILE E 3 136 ? 41.410 15.594 16.984  1.00 58.30  ? 134 ILE A CD1   1 
ATOM 2008 N N     . ALA E 3 137 ? 40.206 15.869 22.325  1.00 54.63  ? 135 ALA A N     1 
ATOM 2009 C CA    . ALA E 3 137 ? 39.471 16.466 23.435  1.00 60.21  ? 135 ALA A CA    1 
ATOM 2010 C C     . ALA E 3 137 ? 40.305 16.329 24.698  1.00 59.94  ? 135 ALA A C     1 
ATOM 2011 O O     . ALA E 3 137 ? 40.538 17.304 25.408  1.00 60.41  ? 135 ALA A O     1 
ATOM 2012 C CB    . ALA E 3 137 ? 38.128 15.762 23.611  1.00 65.60  ? 135 ALA A CB    1 
ATOM 2013 N N     . ASP E 3 138 ? 40.759 15.108 24.959  1.00 60.92  ? 136 ASP A N     1 
ATOM 2014 C CA    . ASP E 3 138 ? 41.593 14.817 26.117  1.00 66.40  ? 136 ASP A CA    1 
ATOM 2015 C C     . ASP E 3 138 ? 42.898 15.609 26.018  1.00 64.95  ? 136 ASP A C     1 
ATOM 2016 O O     . ASP E 3 138 ? 43.310 16.268 26.974  1.00 65.93  ? 136 ASP A O     1 
ATOM 2017 C CB    . ASP E 3 138 ? 41.889 13.313 26.182  1.00 74.01  ? 136 ASP A CB    1 
ATOM 2018 C CG    . ASP E 3 138 ? 42.865 12.949 27.293  1.00 80.41  ? 136 ASP A CG    1 
ATOM 2019 O OD1   . ASP E 3 138 ? 43.805 12.169 27.026  1.00 85.24  ? 136 ASP A OD1   1 
ATOM 2020 O OD2   . ASP E 3 138 ? 42.693 13.437 28.431  1.00 84.33  ? 136 ASP A OD2   1 
ATOM 2021 N N     . GLN E 3 139 ? 43.519 15.568 24.842  1.00 57.30  ? 137 GLN A N     1 
ATOM 2022 C CA    . GLN E 3 139 ? 44.770 16.276 24.590  1.00 56.41  ? 137 GLN A CA    1 
ATOM 2023 C C     . GLN E 3 139 ? 44.632 17.785 24.808  1.00 57.17  ? 137 GLN A C     1 
ATOM 2024 O O     . GLN E 3 139 ? 45.631 18.502 24.912  1.00 60.78  ? 137 GLN A O     1 
ATOM 2025 C CB    . GLN E 3 139 ? 45.235 15.985 23.158  1.00 57.97  ? 137 GLN A CB    1 
ATOM 2026 C CG    . GLN E 3 139 ? 46.444 16.773 22.677  1.00 71.00  ? 137 GLN A CG    1 
ATOM 2027 C CD    . GLN E 3 139 ? 46.084 17.804 21.621  1.00 81.95  ? 137 GLN A CD    1 
ATOM 2028 O OE1   . GLN E 3 139 ? 46.146 17.525 20.422  1.00 90.59  ? 137 GLN A OE1   1 
ATOM 2029 N NE2   . GLN E 3 139 ? 45.706 19.002 22.061  1.00 89.57  ? 137 GLN A NE2   1 
ATOM 2030 N N     . LEU E 3 140 ? 43.394 18.251 24.939  1.00 54.86  ? 138 LEU A N     1 
ATOM 2031 C CA    . LEU E 3 140 ? 43.129 19.671 25.118  1.00 51.32  ? 138 LEU A CA    1 
ATOM 2032 C C     . LEU E 3 140 ? 42.227 19.988 26.316  1.00 49.75  ? 138 LEU A C     1 
ATOM 2033 O O     . LEU E 3 140 ? 41.862 21.147 26.530  1.00 47.76  ? 138 LEU A O     1 
ATOM 2034 C CB    . LEU E 3 140 ? 42.512 20.212 23.828  1.00 54.59  ? 138 LEU A CB    1 
ATOM 2035 C CG    . LEU E 3 140 ? 42.538 21.708 23.532  1.00 57.74  ? 138 LEU A CG    1 
ATOM 2036 C CD1   . LEU E 3 140 ? 43.938 22.271 23.759  1.00 62.87  ? 138 LEU A CD1   1 
ATOM 2037 C CD2   . LEU E 3 140 ? 42.090 21.923 22.095  1.00 54.10  ? 138 LEU A CD2   1 
ATOM 2038 N N     . ASN E 3 141 ? 41.872 18.962 27.089  1.00 48.10  ? 139 ASN A N     1 
ATOM 2039 C CA    . ASN E 3 141 ? 41.018 19.130 28.264  1.00 51.07  ? 139 ASN A CA    1 
ATOM 2040 C C     . ASN E 3 141 ? 39.692 19.757 27.831  1.00 51.79  ? 139 ASN A C     1 
ATOM 2041 O O     . ASN E 3 141 ? 39.379 20.896 28.172  1.00 52.34  ? 139 ASN A O     1 
ATOM 2042 C CB    . ASN E 3 141 ? 41.730 20.002 29.311  1.00 57.52  ? 139 ASN A CB    1 
ATOM 2043 C CG    . ASN E 3 141 ? 41.007 20.035 30.646  1.00 59.49  ? 139 ASN A CG    1 
ATOM 2044 O OD1   . ASN E 3 141 ? 40.217 19.148 30.965  1.00 67.04  ? 139 ASN A OD1   1 
ATOM 2045 N ND2   . ASN E 3 141 ? 41.287 21.062 31.440  1.00 60.89  ? 139 ASN A ND2   1 
ATOM 2046 N N     . MET E 3 142 ? 38.941 19.003 27.037  1.00 59.12  ? 140 MET A N     1 
ATOM 2047 C CA    . MET E 3 142 ? 37.649 19.440 26.517  1.00 60.14  ? 140 MET A CA    1 
ATOM 2048 C C     . MET E 3 142 ? 36.686 18.259 26.524  1.00 61.51  ? 140 MET A C     1 
ATOM 2049 O O     . MET E 3 142 ? 37.084 17.131 26.227  1.00 72.30  ? 140 MET A O     1 
ATOM 2050 C CB    . MET E 3 142 ? 37.807 19.953 25.082  1.00 56.94  ? 140 MET A CB    1 
ATOM 2051 C CG    . MET E 3 142 ? 38.588 21.246 24.956  1.00 47.77  ? 140 MET A CG    1 
ATOM 2052 S SD    . MET E 3 142 ? 37.759 22.568 25.831  1.00 58.20  ? 140 MET A SD    1 
ATOM 2053 C CE    . MET E 3 142 ? 36.716 23.215 24.552  1.00 49.14  ? 140 MET A CE    1 
ATOM 2054 N N     . GLU E 3 143 ? 35.424 18.515 26.863  1.00 55.58  ? 141 GLU A N     1 
ATOM 2055 C CA    . GLU E 3 143 ? 34.417 17.459 26.898  1.00 56.66  ? 141 GLU A CA    1 
ATOM 2056 C C     . GLU E 3 143 ? 34.409 16.784 25.530  1.00 56.99  ? 141 GLU A C     1 
ATOM 2057 O O     . GLU E 3 143 ? 34.278 17.454 24.505  1.00 57.49  ? 141 GLU A O     1 
ATOM 2058 C CB    . GLU E 3 143 ? 33.040 18.046 27.215  1.00 58.48  ? 141 GLU A CB    1 
ATOM 2059 C CG    . GLU E 3 143 ? 31.948 17.006 27.429  1.00 63.14  ? 141 GLU A CG    1 
ATOM 2060 C CD    . GLU E 3 143 ? 30.623 17.624 27.842  1.00 65.04  ? 141 GLU A CD    1 
ATOM 2061 O OE1   . GLU E 3 143 ? 29.708 17.695 26.993  1.00 64.79  ? 141 GLU A OE1   1 
ATOM 2062 O OE2   . GLU E 3 143 ? 30.493 18.032 29.018  1.00 70.67  ? 141 GLU A OE2   1 
ATOM 2063 N N     . LYS E 3 144 ? 34.593 15.467 25.517  1.00 53.92  ? 142 LYS A N     1 
ATOM 2064 C CA    . LYS E 3 144 ? 34.634 14.718 24.267  1.00 48.07  ? 142 LYS A CA    1 
ATOM 2065 C C     . LYS E 3 144 ? 33.501 15.084 23.317  1.00 37.53  ? 142 LYS A C     1 
ATOM 2066 O O     . LYS E 3 144 ? 33.745 15.363 22.142  1.00 39.81  ? 142 LYS A O     1 
ATOM 2067 C CB    . LYS E 3 144 ? 34.656 13.203 24.526  1.00 56.72  ? 142 LYS A CB    1 
ATOM 2068 C CG    . LYS E 3 144 ? 34.492 12.355 23.256  1.00 72.72  ? 142 LYS A CG    1 
ATOM 2069 C CD    . LYS E 3 144 ? 34.750 10.868 23.492  1.00 83.74  ? 142 LYS A CD    1 
ATOM 2070 C CE    . LYS E 3 144 ? 34.270 10.002 22.313  1.00 93.33  ? 142 LYS A CE    1 
ATOM 2071 N NZ    . LYS E 3 144 ? 34.887 10.332 20.987  1.00 97.61  ? 142 LYS A NZ    1 
ATOM 2072 N N     . GLU E 3 145 ? 32.280 15.146 23.837  1.00 22.67  ? 143 GLU A N     1 
ATOM 2073 C CA    . GLU E 3 145 ? 31.125 15.469 23.012  1.00 27.82  ? 143 GLU A CA    1 
ATOM 2074 C C     . GLU E 3 145 ? 31.263 16.771 22.240  1.00 34.76  ? 143 GLU A C     1 
ATOM 2075 O O     . GLU E 3 145 ? 31.256 16.759 21.010  1.00 42.24  ? 143 GLU A O     1 
ATOM 2076 C CB    . GLU E 3 145 ? 29.847 15.497 23.849  1.00 32.47  ? 143 GLU A CB    1 
ATOM 2077 C CG    . GLU E 3 145 ? 28.582 15.844 23.058  1.00 38.84  ? 143 GLU A CG    1 
ATOM 2078 C CD    . GLU E 3 145 ? 28.166 14.774 22.045  1.00 46.28  ? 143 GLU A CD    1 
ATOM 2079 O OE1   . GLU E 3 145 ? 28.950 13.836 21.771  1.00 48.79  ? 143 GLU A OE1   1 
ATOM 2080 O OE2   . GLU E 3 145 ? 27.036 14.875 21.518  1.00 49.77  ? 143 GLU A OE2   1 
ATOM 2081 N N     . VAL E 3 146 ? 31.411 17.880 22.965  1.00 35.01  ? 144 VAL A N     1 
ATOM 2082 C CA    . VAL E 3 146 ? 31.548 19.219 22.376  1.00 34.03  ? 144 VAL A CA    1 
ATOM 2083 C C     . VAL E 3 146 ? 32.478 19.252 21.156  1.00 30.69  ? 144 VAL A C     1 
ATOM 2084 O O     . VAL E 3 146 ? 32.264 20.011 20.209  1.00 28.18  ? 144 VAL A O     1 
ATOM 2085 C CB    . VAL E 3 146 ? 32.045 20.236 23.437  1.00 29.72  ? 144 VAL A CB    1 
ATOM 2086 C CG1   . VAL E 3 146 ? 32.213 21.606 22.821  1.00 35.57  ? 144 VAL A CG1   1 
ATOM 2087 C CG2   . VAL E 3 146 ? 31.060 20.313 24.593  1.00 27.82  ? 144 VAL A CG2   1 
ATOM 2088 N N     . ILE E 3 147 ? 33.507 18.417 21.194  1.00 33.11  ? 145 ILE A N     1 
ATOM 2089 C CA    . ILE E 3 147 ? 34.462 18.319 20.105  1.00 35.70  ? 145 ILE A CA    1 
ATOM 2090 C C     . ILE E 3 147 ? 33.867 17.538 18.935  1.00 35.49  ? 145 ILE A C     1 
ATOM 2091 O O     . ILE E 3 147 ? 33.959 17.980 17.785  1.00 34.58  ? 145 ILE A O     1 
ATOM 2092 C CB    . ILE E 3 147 ? 35.750 17.628 20.570  1.00 44.52  ? 145 ILE A CB    1 
ATOM 2093 C CG1   . ILE E 3 147 ? 36.284 18.321 21.825  1.00 44.69  ? 145 ILE A CG1   1 
ATOM 2094 C CG2   . ILE E 3 147 ? 36.786 17.644 19.456  1.00 55.10  ? 145 ILE A CG2   1 
ATOM 2095 C CD1   . ILE E 3 147 ? 36.391 19.826 21.686  1.00 51.32  ? 145 ILE A CD1   1 
ATOM 2096 N N     . ARG E 3 148 ? 33.268 16.381 19.226  1.00 29.22  ? 146 ARG A N     1 
ATOM 2097 C CA    . ARG E 3 148 ? 32.652 15.562 18.182  1.00 26.65  ? 146 ARG A CA    1 
ATOM 2098 C C     . ARG E 3 148 ? 31.688 16.452 17.426  1.00 28.37  ? 146 ARG A C     1 
ATOM 2099 O O     . ARG E 3 148 ? 31.576 16.375 16.202  1.00 36.51  ? 146 ARG A O     1 
ATOM 2100 C CB    . ARG E 3 148 ? 31.873 14.383 18.767  1.00 27.21  ? 146 ARG A CB    1 
ATOM 2101 C CG    . ARG E 3 148 ? 31.335 13.426 17.694  1.00 29.58  ? 146 ARG A CG    1 
ATOM 2102 C CD    . ARG E 3 148 ? 30.331 12.412 18.250  1.00 39.05  ? 146 ARG A CD    1 
ATOM 2103 N NE    . ARG E 3 148 ? 29.089 13.039 18.709  1.00 40.57  ? 146 ARG A NE    1 
ATOM 2104 C CZ    . ARG E 3 148 ? 28.210 13.654 17.919  1.00 34.35  ? 146 ARG A CZ    1 
ATOM 2105 N NH1   . ARG E 3 148 ? 28.413 13.733 16.609  1.00 37.55  ? 146 ARG A NH1   1 
ATOM 2106 N NH2   . ARG E 3 148 ? 27.145 14.241 18.447  1.00 24.29  ? 146 ARG A NH2   1 
ATOM 2107 N N     . VAL E 3 149 ? 31.042 17.343 18.168  1.00 20.08  ? 147 VAL A N     1 
ATOM 2108 C CA    . VAL E 3 149 ? 30.093 18.264 17.584  1.00 19.54  ? 147 VAL A CA    1 
ATOM 2109 C C     . VAL E 3 149 ? 30.801 19.406 16.863  1.00 25.82  ? 147 VAL A C     1 
ATOM 2110 O O     . VAL E 3 149 ? 30.418 19.749 15.744  1.00 25.86  ? 147 VAL A O     1 
ATOM 2111 C CB    . VAL E 3 149 ? 29.138 18.861 18.642  1.00 10.69  ? 147 VAL A CB    1 
ATOM 2112 C CG1   . VAL E 3 149 ? 27.828 19.262 17.990  1.00 7.24   ? 147 VAL A CG1   1 
ATOM 2113 C CG2   . VAL E 3 149 ? 28.882 17.877 19.744  1.00 10.97  ? 147 VAL A CG2   1 
ATOM 2114 N N     . TRP E 3 150 ? 31.858 19.955 17.469  1.00 31.05  ? 148 TRP A N     1 
ATOM 2115 C CA    . TRP E 3 150 ? 32.568 21.082 16.858  1.00 33.87  ? 148 TRP A CA    1 
ATOM 2116 C C     . TRP E 3 150 ? 32.969 20.815 15.423  1.00 36.06  ? 148 TRP A C     1 
ATOM 2117 O O     . TRP E 3 150 ? 32.865 21.700 14.571  1.00 37.54  ? 148 TRP A O     1 
ATOM 2118 C CB    . TRP E 3 150 ? 33.813 21.501 17.644  1.00 34.04  ? 148 TRP A CB    1 
ATOM 2119 C CG    . TRP E 3 150 ? 34.362 22.809 17.120  1.00 39.83  ? 148 TRP A CG    1 
ATOM 2120 C CD1   . TRP E 3 150 ? 33.931 24.065 17.450  1.00 47.43  ? 148 TRP A CD1   1 
ATOM 2121 C CD2   . TRP E 3 150 ? 35.362 22.987 16.103  1.00 37.23  ? 148 TRP A CD2   1 
ATOM 2122 N NE1   . TRP E 3 150 ? 34.587 25.007 16.696  1.00 41.45  ? 148 TRP A NE1   1 
ATOM 2123 C CE2   . TRP E 3 150 ? 35.472 24.375 15.863  1.00 39.28  ? 148 TRP A CE2   1 
ATOM 2124 C CE3   . TRP E 3 150 ? 36.171 22.110 15.369  1.00 40.07  ? 148 TRP A CE3   1 
ATOM 2125 C CZ2   . TRP E 3 150 ? 36.357 24.907 14.917  1.00 38.78  ? 148 TRP A CZ2   1 
ATOM 2126 C CZ3   . TRP E 3 150 ? 37.052 22.640 14.427  1.00 42.89  ? 148 TRP A CZ3   1 
ATOM 2127 C CH2   . TRP E 3 150 ? 37.136 24.026 14.212  1.00 40.69  ? 148 TRP A CH2   1 
ATOM 2128 N N     . PHE E 3 151 ? 33.440 19.599 15.163  1.00 33.42  ? 149 PHE A N     1 
ATOM 2129 C CA    . PHE E 3 151 ? 33.846 19.233 13.817  1.00 31.21  ? 149 PHE A CA    1 
ATOM 2130 C C     . PHE E 3 151 ? 32.650 19.103 12.903  1.00 23.83  ? 149 PHE A C     1 
ATOM 2131 O O     . PHE E 3 151 ? 32.724 19.454 11.733  1.00 20.19  ? 149 PHE A O     1 
ATOM 2132 C CB    . PHE E 3 151 ? 34.660 17.941 13.819  1.00 39.91  ? 149 PHE A CB    1 
ATOM 2133 C CG    . PHE E 3 151 ? 36.129 18.162 14.027  1.00 42.65  ? 149 PHE A CG    1 
ATOM 2134 C CD1   . PHE E 3 151 ? 36.957 18.471 12.950  1.00 38.31  ? 149 PHE A CD1   1 
ATOM 2135 C CD2   . PHE E 3 151 ? 36.681 18.099 15.302  1.00 38.38  ? 149 PHE A CD2   1 
ATOM 2136 C CE1   . PHE E 3 151 ? 38.317 18.718 13.142  1.00 39.79  ? 149 PHE A CE1   1 
ATOM 2137 C CE2   . PHE E 3 151 ? 38.038 18.345 15.504  1.00 38.21  ? 149 PHE A CE2   1 
ATOM 2138 C CZ    . PHE E 3 151 ? 38.858 18.656 14.422  1.00 37.89  ? 149 PHE A CZ    1 
ATOM 2139 N N     . CYS E 3 152 ? 31.543 18.610 13.444  1.00 17.87  ? 150 CYS A N     1 
ATOM 2140 C CA    . CYS E 3 152 ? 30.336 18.449 12.655  1.00 17.73  ? 150 CYS A CA    1 
ATOM 2141 C C     . CYS E 3 152 ? 29.870 19.785 12.110  1.00 22.07  ? 150 CYS A C     1 
ATOM 2142 O O     . CYS E 3 152 ? 29.881 19.995 10.897  1.00 32.10  ? 150 CYS A O     1 
ATOM 2143 C CB    . CYS E 3 152 ? 29.241 17.789 13.482  1.00 17.43  ? 150 CYS A CB    1 
ATOM 2144 S SG    . CYS E 3 152 ? 29.552 16.039 13.789  1.00 27.58  ? 150 CYS A SG    1 
ATOM 2145 N N     . ASN E 3 153 ? 29.525 20.704 13.010  1.00 23.72  ? 151 ASN A N     1 
ATOM 2146 C CA    . ASN E 3 153 ? 29.058 22.037 12.630  1.00 21.57  ? 151 ASN A CA    1 
ATOM 2147 C C     . ASN E 3 153 ? 30.057 22.711 11.698  1.00 20.52  ? 151 ASN A C     1 
ATOM 2148 O O     . ASN E 3 153 ? 29.676 23.407 10.752  1.00 13.73  ? 151 ASN A O     1 
ATOM 2149 C CB    . ASN E 3 153 ? 28.869 22.909 13.876  1.00 24.74  ? 151 ASN A CB    1 
ATOM 2150 C CG    . ASN E 3 153 ? 27.752 22.418 14.773  1.00 18.06  ? 151 ASN A CG    1 
ATOM 2151 O OD1   . ASN E 3 153 ? 26.659 22.113 14.306  1.00 14.52  ? 151 ASN A OD1   1 
ATOM 2152 N ND2   . ASN E 3 153 ? 28.022 22.344 16.073  1.00 15.62  ? 151 ASN A ND2   1 
ATOM 2153 N N     . ARG E 3 154 ? 31.337 22.473 11.973  1.00 20.30  ? 152 ARG A N     1 
ATOM 2154 C CA    . ARG E 3 154 ? 32.429 23.040 11.193  1.00 26.75  ? 152 ARG A CA    1 
ATOM 2155 C C     . ARG E 3 154 ? 32.453 22.506 9.760   1.00 28.63  ? 152 ARG A C     1 
ATOM 2156 O O     . ARG E 3 154 ? 32.578 23.282 8.812   1.00 30.87  ? 152 ARG A O     1 
ATOM 2157 C CB    . ARG E 3 154 ? 33.767 22.769 11.886  1.00 23.59  ? 152 ARG A CB    1 
ATOM 2158 C CG    . ARG E 3 154 ? 34.939 23.487 11.261  1.00 21.91  ? 152 ARG A CG    1 
ATOM 2159 C CD    . ARG E 3 154 ? 34.708 24.989 11.247  1.00 35.09  ? 152 ARG A CD    1 
ATOM 2160 N NE    . ARG E 3 154 ? 35.778 25.715 10.569  1.00 38.05  ? 152 ARG A NE    1 
ATOM 2161 C CZ    . ARG E 3 154 ? 35.818 25.954 9.262   1.00 33.15  ? 152 ARG A CZ    1 
ATOM 2162 N NH1   . ARG E 3 154 ? 34.850 25.518 8.464   1.00 26.60  ? 152 ARG A NH1   1 
ATOM 2163 N NH2   . ARG E 3 154 ? 36.821 26.657 8.755   1.00 38.95  ? 152 ARG A NH2   1 
ATOM 2164 N N     . ARG E 3 155 ? 32.344 21.185 9.610   1.00 29.64  ? 153 ARG A N     1 
ATOM 2165 C CA    . ARG E 3 155 ? 32.334 20.555 8.289   1.00 22.69  ? 153 ARG A CA    1 
ATOM 2166 C C     . ARG E 3 155 ? 31.179 21.157 7.506   1.00 27.01  ? 153 ARG A C     1 
ATOM 2167 O O     . ARG E 3 155 ? 31.337 21.527 6.341   1.00 23.91  ? 153 ARG A O     1 
ATOM 2168 C CB    . ARG E 3 155 ? 32.142 19.040 8.399   1.00 14.31  ? 153 ARG A CB    1 
ATOM 2169 C CG    . ARG E 3 155 ? 33.368 18.276 8.855   1.00 10.71  ? 153 ARG A CG    1 
ATOM 2170 C CD    . ARG E 3 155 ? 33.067 16.784 9.001   1.00 9.59   ? 153 ARG A CD    1 
ATOM 2171 N NE    . ARG E 3 155 ? 33.750 16.223 10.163  1.00 16.45  ? 153 ARG A NE    1 
ATOM 2172 C CZ    . ARG E 3 155 ? 33.149 15.533 11.129  1.00 22.18  ? 153 ARG A CZ    1 
ATOM 2173 N NH1   . ARG E 3 155 ? 31.848 15.295 11.068  1.00 21.92  ? 153 ARG A NH1   1 
ATOM 2174 N NH2   . ARG E 3 155 ? 33.827 15.168 12.211  1.00 27.82  ? 153 ARG A NH2   1 
ATOM 2175 N N     . GLN E 3 156 ? 30.027 21.273 8.167   1.00 29.22  ? 154 GLN A N     1 
ATOM 2176 C CA    . GLN E 3 156 ? 28.844 21.860 7.550   1.00 27.80  ? 154 GLN A CA    1 
ATOM 2177 C C     . GLN E 3 156 ? 29.152 23.305 7.177   1.00 27.04  ? 154 GLN A C     1 
ATOM 2178 O O     . GLN E 3 156 ? 28.740 23.782 6.117   1.00 16.19  ? 154 GLN A O     1 
ATOM 2179 C CB    . GLN E 3 156 ? 27.638 21.811 8.498   1.00 33.41  ? 154 GLN A CB    1 
ATOM 2180 C CG    . GLN E 3 156 ? 26.942 20.452 8.569   1.00 31.00  ? 154 GLN A CG    1 
ATOM 2181 C CD    . GLN E 3 156 ? 25.654 20.485 9.386   1.00 33.29  ? 154 GLN A CD    1 
ATOM 2182 O OE1   . GLN E 3 156 ? 25.668 20.247 10.595  1.00 27.07  ? 154 GLN A OE1   1 
ATOM 2183 N NE2   . GLN E 3 156 ? 24.535 20.767 8.724   1.00 23.87  ? 154 GLN A NE2   1 
ATOM 2184 N N     . LYS E 3 157 ? 29.909 23.985 8.039   1.00 29.18  ? 155 LYS A N     1 
ATOM 2185 C CA    . LYS E 3 157 ? 30.280 25.370 7.788   1.00 31.73  ? 155 LYS A CA    1 
ATOM 2186 C C     . LYS E 3 157 ? 31.034 25.443 6.474   1.00 34.04  ? 155 LYS A C     1 
ATOM 2187 O O     . LYS E 3 157 ? 30.659 26.212 5.598   1.00 42.81  ? 155 LYS A O     1 
ATOM 2188 C CB    . LYS E 3 157 ? 31.129 25.937 8.925   1.00 32.71  ? 155 LYS A CB    1 
ATOM 2189 C CG    . LYS E 3 157 ? 31.453 27.410 8.757   1.00 34.77  ? 155 LYS A CG    1 
ATOM 2190 C CD    . LYS E 3 157 ? 32.309 27.920 9.896   1.00 46.68  ? 155 LYS A CD    1 
ATOM 2191 C CE    . LYS E 3 157 ? 32.878 29.287 9.576   1.00 45.24  ? 155 LYS A CE    1 
ATOM 2192 N NZ    . LYS E 3 157 ? 33.755 29.794 10.664  1.00 47.94  ? 155 LYS A NZ    1 
ATOM 2193 N N     . GLU E 3 158 ? 32.067 24.616 6.327   1.00 31.35  ? 156 GLU A N     1 
ATOM 2194 C CA    . GLU E 3 158 ? 32.852 24.568 5.097   1.00 31.01  ? 156 GLU A CA    1 
ATOM 2195 C C     . GLU E 3 158 ? 31.929 24.529 3.889   1.00 33.78  ? 156 GLU A C     1 
ATOM 2196 O O     . GLU E 3 158 ? 31.958 25.420 3.037   1.00 33.29  ? 156 GLU A O     1 
ATOM 2197 C CB    . GLU E 3 158 ? 33.724 23.317 5.078   1.00 29.97  ? 156 GLU A CB    1 
ATOM 2198 C CG    . GLU E 3 158 ? 34.991 23.432 5.875   1.00 39.94  ? 156 GLU A CG    1 
ATOM 2199 C CD    . GLU E 3 158 ? 35.942 24.462 5.304   1.00 47.05  ? 156 GLU A CD    1 
ATOM 2200 O OE1   . GLU E 3 158 ? 36.753 24.105 4.419   1.00 53.35  ? 156 GLU A OE1   1 
ATOM 2201 O OE2   . GLU E 3 158 ? 35.881 25.628 5.743   1.00 47.51  ? 156 GLU A OE2   1 
ATOM 2202 N N     . LYS E 3 159 ? 31.088 23.500 3.857   1.00 31.82  ? 157 LYS A N     1 
ATOM 2203 C CA    . LYS E 3 159 ? 30.127 23.289 2.785   1.00 29.40  ? 157 LYS A CA    1 
ATOM 2204 C C     . LYS E 3 159 ? 29.330 24.543 2.442   1.00 30.21  ? 157 LYS A C     1 
ATOM 2205 O O     . LYS E 3 159 ? 28.952 24.742 1.284   1.00 31.22  ? 157 LYS A O     1 
ATOM 2206 C CB    . LYS E 3 159 ? 29.192 22.143 3.161   1.00 31.87  ? 157 LYS A CB    1 
ATOM 2207 C CG    . LYS E 3 159 ? 29.897 20.797 3.271   1.00 32.24  ? 157 LYS A CG    1 
ATOM 2208 C CD    . LYS E 3 159 ? 29.004 19.742 3.915   1.00 39.98  ? 157 LYS A CD    1 
ATOM 2209 C CE    . LYS E 3 159 ? 29.484 18.333 3.597   1.00 30.88  ? 157 LYS A CE    1 
ATOM 2210 N NZ    . LYS E 3 159 ? 29.412 18.081 2.126   1.00 36.50  ? 157 LYS A NZ    1 
ATOM 2211 N N     . ARG E 3 160 ? 29.081 25.383 3.444   1.00 29.33  ? 158 ARG A N     1 
ATOM 2212 C CA    . ARG E 3 160 ? 28.343 26.629 3.235   1.00 40.59  ? 158 ARG A CA    1 
ATOM 2213 C C     . ARG E 3 160 ? 29.276 27.719 2.718   1.00 40.54  ? 158 ARG A C     1 
ATOM 2214 O O     . ARG E 3 160 ? 28.991 28.371 1.710   1.00 40.32  ? 158 ARG A O     1 
ATOM 2215 C CB    . ARG E 3 160 ? 27.698 27.120 4.537   1.00 44.62  ? 158 ARG A CB    1 
ATOM 2216 C CG    . ARG E 3 160 ? 26.563 26.268 5.078   1.00 50.06  ? 158 ARG A CG    1 
ATOM 2217 C CD    . ARG E 3 160 ? 25.843 26.995 6.215   1.00 51.64  ? 158 ARG A CD    1 
ATOM 2218 N NE    . ARG E 3 160 ? 26.740 27.357 7.313   1.00 44.49  ? 158 ARG A NE    1 
ATOM 2219 C CZ    . ARG E 3 160 ? 27.127 26.522 8.272   1.00 46.78  ? 158 ARG A CZ    1 
ATOM 2220 N NH1   . ARG E 3 160 ? 26.702 25.263 8.282   1.00 47.31  ? 158 ARG A NH1   1 
ATOM 2221 N NH2   . ARG E 3 160 ? 27.947 26.947 9.224   1.00 46.20  ? 158 ARG A NH2   1 
ATOM 2222 N N     . ILE E 3 161 ? 30.395 27.889 3.420   1.00 40.97  ? 159 ILE A N     1 
ATOM 2223 C CA    . ILE E 3 161 ? 31.404 28.894 3.102   1.00 47.63  ? 159 ILE A CA    1 
ATOM 2224 C C     . ILE E 3 161 ? 32.089 28.640 1.765   1.00 51.70  ? 159 ILE A C     1 
ATOM 2225 O O     . ILE E 3 161 ? 31.794 29.327 0.788   1.00 56.71  ? 159 ILE A O     1 
ATOM 2226 C CB    . ILE E 3 161 ? 32.447 29.013 4.242   1.00 44.19  ? 159 ILE A CB    1 
ATOM 2227 C CG1   . ILE E 3 161 ? 31.733 29.349 5.553   1.00 42.70  ? 159 ILE A CG1   1 
ATOM 2228 C CG2   . ILE E 3 161 ? 33.490 30.074 3.915   1.00 44.85  ? 159 ILE A CG2   1 
ATOM 2229 C CD1   . ILE E 3 161 ? 30.595 30.353 5.392   1.00 48.26  ? 159 ILE A CD1   1 
ATOM 2230 N N     . ASN E 3 162 ? 33.021 27.692 1.715   1.00 50.61  ? 160 ASN A N     1 
ATOM 2231 C CA    . ASN E 3 162 ? 33.673 27.399 0.448   1.00 57.40  ? 160 ASN A CA    1 
ATOM 2232 C C     . ASN E 3 162 ? 33.295 26.027 -0.091  1.00 56.42  ? 160 ASN A C     1 
ATOM 2233 O O     . ASN E 3 162 ? 33.648 24.994 0.481   1.00 51.48  ? 160 ASN A O     1 
ATOM 2234 C CB    . ASN E 3 162 ? 35.197 27.613 0.490   1.00 61.21  ? 160 ASN A CB    1 
ATOM 2235 C CG    . ASN E 3 162 ? 35.834 27.108 1.764   1.00 68.46  ? 160 ASN A CG    1 
ATOM 2236 O OD1   . ASN E 3 162 ? 36.291 25.967 1.835   1.00 75.90  ? 160 ASN A OD1   1 
ATOM 2237 N ND2   . ASN E 3 162 ? 35.905 27.973 2.768   1.00 75.83  ? 160 ASN A ND2   1 
ATOM 2238 N N     . PRO E 3 163 ? 32.465 26.017 -1.148  1.00 57.42  ? 161 PRO A N     1 
ATOM 2239 C CA    . PRO E 3 163 ? 31.949 24.844 -1.859  1.00 62.53  ? 161 PRO A CA    1 
ATOM 2240 C C     . PRO E 3 163 ? 33.004 24.192 -2.754  1.00 64.57  ? 161 PRO A C     1 
ATOM 2241 O O     . PRO E 3 163 ? 33.001 22.945 -2.822  1.00 65.43  ? 161 PRO A O     1 
ATOM 2242 C CB    . PRO E 3 163 ? 30.809 25.436 -2.688  1.00 64.05  ? 161 PRO A CB    1 
ATOM 2243 C CG    . PRO E 3 163 ? 31.309 26.810 -2.995  1.00 56.21  ? 161 PRO A CG    1 
ATOM 2244 C CD    . PRO E 3 163 ? 31.828 27.246 -1.656  1.00 53.33  ? 161 PRO A CD    1 
ATOM 2245 N N     . ASP F 3 8   ? 87.753 18.379 0.672   1.00 90.73  ? 505 ASP B N     1 
ATOM 2246 C CA    . ASP F 3 8   ? 86.582 19.262 0.954   1.00 94.54  ? 505 ASP B CA    1 
ATOM 2247 C C     . ASP F 3 8   ? 85.465 19.332 -0.108  1.00 93.37  ? 505 ASP B C     1 
ATOM 2248 O O     . ASP F 3 8   ? 84.577 20.166 0.008   1.00 96.01  ? 505 ASP B O     1 
ATOM 2249 C CB    . ASP F 3 8   ? 87.087 20.683 1.234   1.00 96.51  ? 505 ASP B CB    1 
ATOM 2250 C CG    . ASP F 3 8   ? 87.687 20.813 2.605   1.00 100.00 ? 505 ASP B CG    1 
ATOM 2251 O OD1   . ASP F 3 8   ? 88.435 19.882 2.976   1.00 100.00 ? 505 ASP B OD1   1 
ATOM 2252 O OD2   . ASP F 3 8   ? 87.357 21.794 3.322   1.00 100.00 ? 505 ASP B OD2   1 
ATOM 2253 N N     . LEU F 3 9   ? 85.485 18.484 -1.140  1.00 85.52  ? 506 LEU B N     1 
ATOM 2254 C CA    . LEU F 3 9   ? 84.430 18.536 -2.187  1.00 75.83  ? 506 LEU B CA    1 
ATOM 2255 C C     . LEU F 3 9   ? 83.374 17.443 -2.055  1.00 71.32  ? 506 LEU B C     1 
ATOM 2256 O O     . LEU F 3 9   ? 82.200 17.712 -1.782  1.00 68.58  ? 506 LEU B O     1 
ATOM 2257 C CB    . LEU F 3 9   ? 85.055 18.460 -3.575  1.00 77.00  ? 506 LEU B CB    1 
ATOM 2258 C CG    . LEU F 3 9   ? 86.132 19.475 -3.952  1.00 81.82  ? 506 LEU B CG    1 
ATOM 2259 C CD1   . LEU F 3 9   ? 86.691 19.033 -5.269  1.00 79.82  ? 506 LEU B CD1   1 
ATOM 2260 C CD2   . LEU F 3 9   ? 85.609 20.904 -4.060  1.00 78.96  ? 506 LEU B CD2   1 
ATOM 2261 N N     . GLU F 3 10  ? 83.792 16.220 -2.352  1.00 72.50  ? 507 GLU B N     1 
ATOM 2262 C CA    . GLU F 3 10  ? 82.931 15.053 -2.256  1.00 76.07  ? 507 GLU B CA    1 
ATOM 2263 C C     . GLU F 3 10  ? 83.777 13.847 -1.907  1.00 79.28  ? 507 GLU B C     1 
ATOM 2264 O O     . GLU F 3 10  ? 83.334 12.697 -1.994  1.00 74.87  ? 507 GLU B O     1 
ATOM 2265 C CB    . GLU F 3 10  ? 82.160 14.834 -3.553  1.00 75.32  ? 507 GLU B CB    1 
ATOM 2266 C CG    . GLU F 3 10  ? 82.975 14.295 -4.707  1.00 72.37  ? 507 GLU B CG    1 
ATOM 2267 C CD    . GLU F 3 10  ? 82.154 14.241 -5.970  1.00 68.38  ? 507 GLU B CD    1 
ATOM 2268 O OE1   . GLU F 3 10  ? 82.156 15.239 -6.723  1.00 57.48  ? 507 GLU B OE1   1 
ATOM 2269 O OE2   . GLU F 3 10  ? 81.472 13.218 -6.199  1.00 71.47  ? 507 GLU B OE2   1 
ATOM 2270 N N     . GLU F 3 11  ? 85.031 14.129 -1.573  1.00 84.88  ? 508 GLU B N     1 
ATOM 2271 C CA    . GLU F 3 11  ? 85.940 13.096 -1.118  1.00 85.52  ? 508 GLU B CA    1 
ATOM 2272 C C     . GLU F 3 11  ? 85.488 12.888 0.319   1.00 79.24  ? 508 GLU B C     1 
ATOM 2273 O O     . GLU F 3 11  ? 85.992 12.022 1.032   1.00 75.60  ? 508 GLU B O     1 
ATOM 2274 C CB    . GLU F 3 11  ? 87.387 13.576 -1.225  1.00 95.95  ? 508 GLU B CB    1 
ATOM 2275 C CG    . GLU F 3 11  ? 87.826 13.708 -2.689  1.00 100.00 ? 508 GLU B CG    1 
ATOM 2276 C CD    . GLU F 3 11  ? 89.294 14.104 -2.887  1.00 100.00 ? 508 GLU B CD    1 
ATOM 2277 O OE1   . GLU F 3 11  ? 90.042 14.294 -1.884  1.00 100.00 ? 508 GLU B OE1   1 
ATOM 2278 O OE2   . GLU F 3 11  ? 89.703 14.225 -4.076  1.00 100.00 ? 508 GLU B OE2   1 
ATOM 2279 N N     . LEU F 3 12  ? 84.536 13.741 0.706   1.00 70.76  ? 509 LEU B N     1 
ATOM 2280 C CA    . LEU F 3 12  ? 83.855 13.737 1.988   1.00 62.55  ? 509 LEU B CA    1 
ATOM 2281 C C     . LEU F 3 12  ? 83.033 12.441 2.037   1.00 62.61  ? 509 LEU B C     1 
ATOM 2282 O O     . LEU F 3 12  ? 82.677 11.956 3.111   1.00 67.00  ? 509 LEU B O     1 
ATOM 2283 C CB    . LEU F 3 12  ? 82.909 14.943 2.015   1.00 52.80  ? 509 LEU B CB    1 
ATOM 2284 C CG    . LEU F 3 12  ? 82.694 15.698 3.325   1.00 47.19  ? 509 LEU B CG    1 
ATOM 2285 C CD1   . LEU F 3 12  ? 84.012 16.177 3.915   1.00 40.73  ? 509 LEU B CD1   1 
ATOM 2286 C CD2   . LEU F 3 12  ? 81.783 16.878 3.076   1.00 50.66  ? 509 LEU B CD2   1 
ATOM 2287 N N     . GLU F 3 13  ? 82.686 11.923 0.858   1.00 60.82  ? 510 GLU B N     1 
ATOM 2288 C CA    . GLU F 3 13  ? 81.915 10.684 0.744   1.00 58.37  ? 510 GLU B CA    1 
ATOM 2289 C C     . GLU F 3 13  ? 82.866 9.503  0.838   1.00 58.86  ? 510 GLU B C     1 
ATOM 2290 O O     . GLU F 3 13  ? 82.597 8.520  1.533   1.00 55.65  ? 510 GLU B O     1 
ATOM 2291 C CB    . GLU F 3 13  ? 81.170 10.618 -0.593  1.00 56.64  ? 510 GLU B CB    1 
ATOM 2292 C CG    . GLU F 3 13  ? 80.473 9.279  -0.826  1.00 59.58  ? 510 GLU B CG    1 
ATOM 2293 C CD    . GLU F 3 13  ? 79.825 9.166  -2.189  1.00 62.74  ? 510 GLU B CD    1 
ATOM 2294 O OE1   . GLU F 3 13  ? 78.662 8.712  -2.260  1.00 70.82  ? 510 GLU B OE1   1 
ATOM 2295 O OE2   . GLU F 3 13  ? 80.472 9.515  -3.202  1.00 71.53  ? 510 GLU B OE2   1 
ATOM 2296 N N     . GLN F 3 14  ? 83.981 9.619  0.122   1.00 61.71  ? 511 GLN B N     1 
ATOM 2297 C CA    . GLN F 3 14  ? 85.001 8.581  0.094   1.00 64.80  ? 511 GLN B CA    1 
ATOM 2298 C C     . GLN F 3 14  ? 85.561 8.319  1.489   1.00 63.44  ? 511 GLN B C     1 
ATOM 2299 O O     . GLN F 3 14  ? 85.731 7.171  1.901   1.00 58.46  ? 511 GLN B O     1 
ATOM 2300 C CB    . GLN F 3 14  ? 86.128 8.986  -0.859  1.00 65.88  ? 511 GLN B CB    1 
ATOM 2301 C CG    . GLN F 3 14  ? 87.127 7.876  -1.108  1.00 68.90  ? 511 GLN B CG    1 
ATOM 2302 C CD    . GLN F 3 14  ? 86.439 6.541  -1.364  1.00 68.12  ? 511 GLN B CD    1 
ATOM 2303 O OE1   . GLN F 3 14  ? 85.687 6.390  -2.323  1.00 70.94  ? 511 GLN B OE1   1 
ATOM 2304 N NE2   . GLN F 3 14  ? 86.667 5.582  -0.485  1.00 69.19  ? 511 GLN B NE2   1 
ATOM 2305 N N     . PHE F 3 15  ? 85.828 9.400  2.212   1.00 63.57  ? 512 PHE B N     1 
ATOM 2306 C CA    . PHE F 3 15  ? 86.361 9.329  3.563   1.00 68.09  ? 512 PHE B CA    1 
ATOM 2307 C C     . PHE F 3 15  ? 85.354 8.698  4.535   1.00 66.85  ? 512 PHE B C     1 
ATOM 2308 O O     . PHE F 3 15  ? 85.729 7.871  5.364   1.00 67.56  ? 512 PHE B O     1 
ATOM 2309 C CB    . PHE F 3 15  ? 86.775 10.735 4.016   1.00 73.14  ? 512 PHE B CB    1 
ATOM 2310 C CG    . PHE F 3 15  ? 87.213 10.819 5.453   1.00 85.36  ? 512 PHE B CG    1 
ATOM 2311 C CD1   . PHE F 3 15  ? 86.952 11.966 6.195   1.00 89.51  ? 512 PHE B CD1   1 
ATOM 2312 C CD2   . PHE F 3 15  ? 87.867 9.754  6.072   1.00 87.80  ? 512 PHE B CD2   1 
ATOM 2313 C CE1   . PHE F 3 15  ? 87.326 12.051 7.532   1.00 93.55  ? 512 PHE B CE1   1 
ATOM 2314 C CE2   . PHE F 3 15  ? 88.245 9.828  7.409   1.00 91.11  ? 512 PHE B CE2   1 
ATOM 2315 C CZ    . PHE F 3 15  ? 87.974 10.979 8.140   1.00 95.76  ? 512 PHE B CZ    1 
ATOM 2316 N N     . ALA F 3 16  ? 84.082 9.073  4.424   1.00 62.80  ? 513 ALA B N     1 
ATOM 2317 C CA    . ALA F 3 16  ? 83.041 8.523  5.295   1.00 57.97  ? 513 ALA B CA    1 
ATOM 2318 C C     . ALA F 3 16  ? 82.759 7.058  4.957   1.00 54.55  ? 513 ALA B C     1 
ATOM 2319 O O     . ALA F 3 16  ? 82.016 6.374  5.662   1.00 52.86  ? 513 ALA B O     1 
ATOM 2320 C CB    . ALA F 3 16  ? 81.772 9.347  5.179   1.00 57.83  ? 513 ALA B CB    1 
ATOM 2321 N N     . LYS F 3 17  ? 83.344 6.602  3.854   1.00 52.88  ? 514 LYS B N     1 
ATOM 2322 C CA    . LYS F 3 17  ? 83.206 5.231  3.382   1.00 52.62  ? 514 LYS B CA    1 
ATOM 2323 C C     . LYS F 3 17  ? 84.323 4.425  4.019   1.00 51.92  ? 514 LYS B C     1 
ATOM 2324 O O     . LYS F 3 17  ? 84.084 3.378  4.622   1.00 50.92  ? 514 LYS B O     1 
ATOM 2325 C CB    . LYS F 3 17  ? 83.344 5.199  1.854   1.00 53.76  ? 514 LYS B CB    1 
ATOM 2326 C CG    . LYS F 3 17  ? 83.597 3.823  1.235   1.00 57.22  ? 514 LYS B CG    1 
ATOM 2327 C CD    . LYS F 3 17  ? 82.354 2.947  1.232   1.00 65.88  ? 514 LYS B CD    1 
ATOM 2328 C CE    . LYS F 3 17  ? 82.592 1.640  0.479   1.00 62.99  ? 514 LYS B CE    1 
ATOM 2329 N NZ    . LYS F 3 17  ? 82.867 1.839  -0.975  1.00 58.54  ? 514 LYS B NZ    1 
ATOM 2330 N N     . THR F 3 18  ? 85.539 4.953  3.904   1.00 55.14  ? 515 THR B N     1 
ATOM 2331 C CA    . THR F 3 18  ? 86.731 4.314  4.445   1.00 53.10  ? 515 THR B CA    1 
ATOM 2332 C C     . THR F 3 18  ? 86.798 4.420  5.957   1.00 53.18  ? 515 THR B C     1 
ATOM 2333 O O     . THR F 3 18  ? 87.332 3.533  6.608   1.00 52.86  ? 515 THR B O     1 
ATOM 2334 C CB    . THR F 3 18  ? 88.020 4.931  3.868   1.00 53.14  ? 515 THR B CB    1 
ATOM 2335 O OG1   . THR F 3 18  ? 88.102 6.311  4.245   1.00 60.44  ? 515 THR B OG1   1 
ATOM 2336 C CG2   . THR F 3 18  ? 88.038 4.819  2.352   1.00 44.93  ? 515 THR B CG2   1 
ATOM 2337 N N     . PHE F 3 19  ? 86.265 5.510  6.507   1.00 51.47  ? 516 PHE B N     1 
ATOM 2338 C CA    . PHE F 3 19  ? 86.274 5.733  7.952   1.00 52.12  ? 516 PHE B CA    1 
ATOM 2339 C C     . PHE F 3 19  ? 85.545 4.600  8.652   1.00 53.83  ? 516 PHE B C     1 
ATOM 2340 O O     . PHE F 3 19  ? 86.064 4.005  9.595   1.00 52.82  ? 516 PHE B O     1 
ATOM 2341 C CB    . PHE F 3 19  ? 85.615 7.064  8.307   1.00 52.87  ? 516 PHE B CB    1 
ATOM 2342 C CG    . PHE F 3 19  ? 85.659 7.381  9.772   1.00 56.22  ? 516 PHE B CG    1 
ATOM 2343 C CD1   . PHE F 3 19  ? 86.761 8.020  10.324  1.00 64.42  ? 516 PHE B CD1   1 
ATOM 2344 C CD2   . PHE F 3 19  ? 84.605 7.028  10.606  1.00 58.72  ? 516 PHE B CD2   1 
ATOM 2345 C CE1   . PHE F 3 19  ? 86.816 8.300  11.687  1.00 65.65  ? 516 PHE B CE1   1 
ATOM 2346 C CE2   . PHE F 3 19  ? 84.652 7.304  11.971  1.00 61.30  ? 516 PHE B CE2   1 
ATOM 2347 C CZ    . PHE F 3 19  ? 85.760 7.942  12.511  1.00 59.86  ? 516 PHE B CZ    1 
ATOM 2348 N N     . LYS F 3 20  ? 84.326 4.329  8.200   1.00 57.00  ? 517 LYS B N     1 
ATOM 2349 C CA    . LYS F 3 20  ? 83.531 3.247  8.757   1.00 65.88  ? 517 LYS B CA    1 
ATOM 2350 C C     . LYS F 3 20  ? 84.305 1.972  8.441   1.00 69.77  ? 517 LYS B C     1 
ATOM 2351 O O     . LYS F 3 20  ? 84.747 1.256  9.337   1.00 70.84  ? 517 LYS B O     1 
ATOM 2352 C CB    . LYS F 3 20  ? 82.154 3.205  8.083   1.00 67.47  ? 517 LYS B CB    1 
ATOM 2353 C CG    . LYS F 3 20  ? 81.173 2.212  8.702   1.00 71.96  ? 517 LYS B CG    1 
ATOM 2354 C CD    . LYS F 3 20  ? 79.827 2.250  7.988   1.00 76.54  ? 517 LYS B CD    1 
ATOM 2355 C CE    . LYS F 3 20  ? 78.699 1.667  8.841   1.00 75.16  ? 517 LYS B CE    1 
ATOM 2356 N NZ    . LYS F 3 20  ? 78.811 0.200  9.081   1.00 75.25  ? 517 LYS B NZ    1 
ATOM 2357 N N     . GLN F 3 21  ? 84.539 1.769  7.148   1.00 72.42  ? 518 GLN B N     1 
ATOM 2358 C CA    . GLN F 3 21  ? 85.254 0.616  6.612   1.00 78.88  ? 518 GLN B CA    1 
ATOM 2359 C C     . GLN F 3 21  ? 86.495 0.217  7.411   1.00 81.16  ? 518 GLN B C     1 
ATOM 2360 O O     . GLN F 3 21  ? 86.705 -0.962 7.698   1.00 78.76  ? 518 GLN B O     1 
ATOM 2361 C CB    . GLN F 3 21  ? 85.636 0.922  5.162   1.00 82.31  ? 518 GLN B CB    1 
ATOM 2362 C CG    . GLN F 3 21  ? 86.159 -0.243 4.348   1.00 89.35  ? 518 GLN B CG    1 
ATOM 2363 C CD    . GLN F 3 21  ? 86.125 0.044  2.853   1.00 93.03  ? 518 GLN B CD    1 
ATOM 2364 O OE1   . GLN F 3 21  ? 85.715 -0.804 2.059   1.00 91.10  ? 518 GLN B OE1   1 
ATOM 2365 N NE2   . GLN F 3 21  ? 86.540 1.248  2.464   1.00 96.15  ? 518 GLN B NE2   1 
ATOM 2366 N N     . ARG F 3 22  ? 87.280 1.213  7.810   1.00 84.43  ? 519 ARG B N     1 
ATOM 2367 C CA    . ARG F 3 22  ? 88.509 0.985  8.562   1.00 88.98  ? 519 ARG B CA    1 
ATOM 2368 C C     . ARG F 3 22  ? 88.274 0.719  10.045  1.00 87.35  ? 519 ARG B C     1 
ATOM 2369 O O     . ARG F 3 22  ? 88.883 -0.189 10.611  1.00 90.96  ? 519 ARG B O     1 
ATOM 2370 C CB    . ARG F 3 22  ? 89.474 2.163  8.383   1.00 90.36  ? 519 ARG B CB    1 
ATOM 2371 C CG    . ARG F 3 22  ? 90.060 2.286  6.980   1.00 92.41  ? 519 ARG B CG    1 
ATOM 2372 C CD    . ARG F 3 22  ? 90.728 3.640  6.760   1.00 93.02  ? 519 ARG B CD    1 
ATOM 2373 N NE    . ARG F 3 22  ? 91.869 3.864  7.646   1.00 97.85  ? 519 ARG B NE    1 
ATOM 2374 C CZ    . ARG F 3 22  ? 92.910 4.636  7.345   1.00 97.69  ? 519 ARG B CZ    1 
ATOM 2375 N NH1   . ARG F 3 22  ? 92.962 5.265  6.178   1.00 100.00 ? 519 ARG B NH1   1 
ATOM 2376 N NH2   . ARG F 3 22  ? 93.898 4.788  8.217   1.00 94.14  ? 519 ARG B NH2   1 
ATOM 2377 N N     . ARG F 3 23  ? 87.383 1.490  10.669  1.00 81.34  ? 520 ARG B N     1 
ATOM 2378 C CA    . ARG F 3 23  ? 87.098 1.308  12.091  1.00 74.30  ? 520 ARG B CA    1 
ATOM 2379 C C     . ARG F 3 23  ? 86.462 -0.052 12.372  1.00 72.41  ? 520 ARG B C     1 
ATOM 2380 O O     . ARG F 3 23  ? 86.406 -0.496 13.516  1.00 68.69  ? 520 ARG B O     1 
ATOM 2381 C CB    . ARG F 3 23  ? 86.208 2.430  12.632  1.00 74.35  ? 520 ARG B CB    1 
ATOM 2382 C CG    . ARG F 3 23  ? 84.769 2.366  12.177  1.00 73.07  ? 520 ARG B CG    1 
ATOM 2383 C CD    . ARG F 3 23  ? 83.834 2.875  13.262  1.00 76.89  ? 520 ARG B CD    1 
ATOM 2384 N NE    . ARG F 3 23  ? 82.433 2.614  12.943  1.00 78.78  ? 520 ARG B NE    1 
ATOM 2385 C CZ    . ARG F 3 23  ? 81.915 1.403  12.757  1.00 85.85  ? 520 ARG B CZ    1 
ATOM 2386 N NH1   . ARG F 3 23  ? 82.675 0.320  12.862  1.00 89.09  ? 520 ARG B NH1   1 
ATOM 2387 N NH2   . ARG F 3 23  ? 80.637 1.275  12.429  1.00 90.93  ? 520 ARG B NH2   1 
ATOM 2388 N N     . ILE F 3 24  ? 85.964 -0.696 11.321  1.00 73.85  ? 521 ILE B N     1 
ATOM 2389 C CA    . ILE F 3 24  ? 85.360 -2.017 11.440  1.00 79.55  ? 521 ILE B CA    1 
ATOM 2390 C C     . ILE F 3 24  ? 86.495 -3.036 11.462  1.00 83.44  ? 521 ILE B C     1 
ATOM 2391 O O     . ILE F 3 24  ? 86.471 -3.996 12.236  1.00 86.17  ? 521 ILE B O     1 
ATOM 2392 C CB    . ILE F 3 24  ? 84.427 -2.317 10.248  1.00 83.71  ? 521 ILE B CB    1 
ATOM 2393 C CG1   . ILE F 3 24  ? 83.271 -1.315 10.224  1.00 89.28  ? 521 ILE B CG1   1 
ATOM 2394 C CG2   . ILE F 3 24  ? 83.891 -3.744 10.336  1.00 84.99  ? 521 ILE B CG2   1 
ATOM 2395 C CD1   . ILE F 3 24  ? 82.363 -1.445 9.017   1.00 93.46  ? 521 ILE B CD1   1 
ATOM 2396 N N     . LYS F 3 25  ? 87.497 -2.805 10.616  1.00 84.20  ? 522 LYS B N     1 
ATOM 2397 C CA    . LYS F 3 25  ? 88.662 -3.680 10.531  1.00 82.64  ? 522 LYS B CA    1 
ATOM 2398 C C     . LYS F 3 25  ? 89.449 -3.603 11.832  1.00 83.45  ? 522 LYS B C     1 
ATOM 2399 O O     . LYS F 3 25  ? 90.260 -4.478 12.128  1.00 84.20  ? 522 LYS B O     1 
ATOM 2400 C CB    . LYS F 3 25  ? 89.543 -3.273 9.359   1.00 82.81  ? 522 LYS B CB    1 
ATOM 2401 N N     . LEU F 3 26  ? 89.211 -2.539 12.596  1.00 87.46  ? 523 LEU B N     1 
ATOM 2402 C CA    . LEU F 3 26  ? 89.878 -2.333 13.875  1.00 92.63  ? 523 LEU B CA    1 
ATOM 2403 C C     . LEU F 3 26  ? 89.055 -2.859 15.055  1.00 92.11  ? 523 LEU B C     1 
ATOM 2404 O O     . LEU F 3 26  ? 89.582 -3.038 16.155  1.00 90.59  ? 523 LEU B O     1 
ATOM 2405 C CB    . LEU F 3 26  ? 90.221 -0.853 14.063  1.00 95.26  ? 523 LEU B CB    1 
ATOM 2406 C CG    . LEU F 3 26  ? 91.564 -0.367 13.503  1.00 99.88  ? 523 LEU B CG    1 
ATOM 2407 C CD1   . LEU F 3 26  ? 91.684 -0.647 12.011  1.00 99.58  ? 523 LEU B CD1   1 
ATOM 2408 C CD2   . LEU F 3 26  ? 91.717 1.113  13.777  1.00 100.00 ? 523 LEU B CD2   1 
ATOM 2409 N N     . GLY F 3 27  ? 87.763 -3.087 14.820  1.00 91.25  ? 524 GLY B N     1 
ATOM 2410 C CA    . GLY F 3 27  ? 86.886 -3.620 15.851  1.00 89.14  ? 524 GLY B CA    1 
ATOM 2411 C C     . GLY F 3 27  ? 86.256 -2.633 16.815  1.00 88.08  ? 524 GLY B C     1 
ATOM 2412 O O     . GLY F 3 27  ? 85.973 -2.985 17.960  1.00 85.73  ? 524 GLY B O     1 
ATOM 2413 N N     . PHE F 3 28  ? 86.020 -1.406 16.358  1.00 92.97  ? 525 PHE B N     1 
ATOM 2414 C CA    . PHE F 3 28  ? 85.411 -0.379 17.202  1.00 98.36  ? 525 PHE B CA    1 
ATOM 2415 C C     . PHE F 3 28  ? 83.959 -0.125 16.815  1.00 100.00 ? 525 PHE B C     1 
ATOM 2416 O O     . PHE F 3 28  ? 83.635 -0.027 15.630  1.00 100.00 ? 525 PHE B O     1 
ATOM 2417 C CB    . PHE F 3 28  ? 86.199 0.931  17.109  1.00 97.45  ? 525 PHE B CB    1 
ATOM 2418 C CG    . PHE F 3 28  ? 87.615 0.821  17.594  1.00 100.00 ? 525 PHE B CG    1 
ATOM 2419 C CD1   . PHE F 3 28  ? 88.629 0.419  16.730  1.00 100.00 ? 525 PHE B CD1   1 
ATOM 2420 C CD2   . PHE F 3 28  ? 87.938 1.117  18.915  1.00 100.00 ? 525 PHE B CD2   1 
ATOM 2421 C CE1   . PHE F 3 28  ? 89.947 0.311  17.173  1.00 96.64  ? 525 PHE B CE1   1 
ATOM 2422 C CE2   . PHE F 3 28  ? 89.254 1.012  19.368  1.00 100.00 ? 525 PHE B CE2   1 
ATOM 2423 C CZ    . PHE F 3 28  ? 90.260 0.608  18.493  1.00 100.00 ? 525 PHE B CZ    1 
ATOM 2424 N N     . THR F 3 29  ? 83.089 -0.017 17.816  1.00 98.85  ? 526 THR B N     1 
ATOM 2425 C CA    . THR F 3 29  ? 81.674 0.243  17.571  1.00 95.95  ? 526 THR B CA    1 
ATOM 2426 C C     . THR F 3 29  ? 81.529 1.698  17.124  1.00 90.28  ? 526 THR B C     1 
ATOM 2427 O O     . THR F 3 29  ? 82.432 2.267  16.509  1.00 85.83  ? 526 THR B O     1 
ATOM 2428 C CB    . THR F 3 29  ? 80.812 0.020  18.854  1.00 100.00 ? 526 THR B CB    1 
ATOM 2429 O OG1   . THR F 3 29  ? 81.110 1.031  19.828  1.00 100.00 ? 526 THR B OG1   1 
ATOM 2430 C CG2   . THR F 3 29  ? 81.080 -1.355 19.459  1.00 100.00 ? 526 THR B CG2   1 
ATOM 2431 N N     . GLN F 3 30  ? 80.377 2.286  17.409  1.00 87.02  ? 527 GLN B N     1 
ATOM 2432 C CA    . GLN F 3 30  ? 80.130 3.675  17.070  1.00 87.96  ? 527 GLN B CA    1 
ATOM 2433 C C     . GLN F 3 30  ? 79.975 4.436  18.379  1.00 89.12  ? 527 GLN B C     1 
ATOM 2434 O O     . GLN F 3 30  ? 80.117 5.657  18.424  1.00 90.26  ? 527 GLN B O     1 
ATOM 2435 C CB    . GLN F 3 30  ? 78.866 3.795  16.224  1.00 87.04  ? 527 GLN B CB    1 
ATOM 2436 C CG    . GLN F 3 30  ? 78.966 3.084  14.892  1.00 82.63  ? 527 GLN B CG    1 
ATOM 2437 C CD    . GLN F 3 30  ? 77.766 3.332  14.015  1.00 86.25  ? 527 GLN B CD    1 
ATOM 2438 O OE1   . GLN F 3 30  ? 77.263 4.451  13.938  1.00 81.01  ? 527 GLN B OE1   1 
ATOM 2439 N NE2   . GLN F 3 30  ? 77.306 2.293  13.332  1.00 89.64  ? 527 GLN B NE2   1 
ATOM 2440 N N     . GLY F 3 31  ? 79.698 3.686  19.444  1.00 91.27  ? 528 GLY B N     1 
ATOM 2441 C CA    . GLY F 3 31  ? 79.524 4.268  20.761  1.00 89.90  ? 528 GLY B CA    1 
ATOM 2442 C C     . GLY F 3 31  ? 80.841 4.588  21.439  1.00 88.19  ? 528 GLY B C     1 
ATOM 2443 O O     . GLY F 3 31  ? 81.004 5.677  21.994  1.00 88.64  ? 528 GLY B O     1 
ATOM 2444 N N     . ASP F 3 32  ? 81.780 3.645  21.399  1.00 84.52  ? 529 ASP B N     1 
ATOM 2445 C CA    . ASP F 3 32  ? 83.085 3.855  22.018  1.00 78.48  ? 529 ASP B CA    1 
ATOM 2446 C C     . ASP F 3 32  ? 83.875 4.975  21.348  1.00 71.75  ? 529 ASP B C     1 
ATOM 2447 O O     . ASP F 3 32  ? 84.566 5.740  22.022  1.00 70.28  ? 529 ASP B O     1 
ATOM 2448 C CB    . ASP F 3 32  ? 83.904 2.553  22.077  1.00 80.30  ? 529 ASP B CB    1 
ATOM 2449 C CG    . ASP F 3 32  ? 83.828 1.734  20.795  1.00 84.15  ? 529 ASP B CG    1 
ATOM 2450 O OD1   . ASP F 3 32  ? 83.930 2.307  19.687  1.00 84.55  ? 529 ASP B OD1   1 
ATOM 2451 O OD2   . ASP F 3 32  ? 83.676 0.497  20.906  1.00 83.45  ? 529 ASP B OD2   1 
ATOM 2452 N N     . VAL F 3 33  ? 83.734 5.095  20.029  1.00 65.08  ? 530 VAL B N     1 
ATOM 2453 C CA    . VAL F 3 33  ? 84.431 6.136  19.276  1.00 63.06  ? 530 VAL B CA    1 
ATOM 2454 C C     . VAL F 3 33  ? 84.001 7.511  19.787  1.00 61.52  ? 530 VAL B C     1 
ATOM 2455 O O     . VAL F 3 33  ? 84.773 8.467  19.753  1.00 61.02  ? 530 VAL B O     1 
ATOM 2456 C CB    . VAL F 3 33  ? 84.144 6.032  17.754  1.00 62.17  ? 530 VAL B CB    1 
ATOM 2457 C CG1   . VAL F 3 33  ? 84.915 7.105  16.992  1.00 60.25  ? 530 VAL B CG1   1 
ATOM 2458 C CG2   . VAL F 3 33  ? 84.524 4.652  17.236  1.00 59.24  ? 530 VAL B CG2   1 
ATOM 2459 N N     . GLY F 3 34  ? 82.772 7.589  20.286  1.00 61.97  ? 531 GLY B N     1 
ATOM 2460 C CA    . GLY F 3 34  ? 82.256 8.838  20.810  1.00 64.40  ? 531 GLY B CA    1 
ATOM 2461 C C     . GLY F 3 34  ? 82.983 9.267  22.065  1.00 65.43  ? 531 GLY B C     1 
ATOM 2462 O O     . GLY F 3 34  ? 83.162 10.459 22.314  1.00 62.09  ? 531 GLY B O     1 
ATOM 2463 N N     . LEU F 3 35  ? 83.382 8.286  22.869  1.00 69.86  ? 532 LEU B N     1 
ATOM 2464 C CA    . LEU F 3 35  ? 84.114 8.548  24.103  1.00 75.81  ? 532 LEU B CA    1 
ATOM 2465 C C     . LEU F 3 35  ? 85.548 8.931  23.760  1.00 72.63  ? 532 LEU B C     1 
ATOM 2466 O O     . LEU F 3 35  ? 86.186 9.698  24.486  1.00 71.28  ? 532 LEU B O     1 
ATOM 2467 C CB    . LEU F 3 35  ? 84.107 7.310  25.008  1.00 81.45  ? 532 LEU B CB    1 
ATOM 2468 C CG    . LEU F 3 35  ? 82.810 6.964  25.745  1.00 83.99  ? 532 LEU B CG    1 
ATOM 2469 C CD1   . LEU F 3 35  ? 82.934 5.586  26.378  1.00 84.21  ? 532 LEU B CD1   1 
ATOM 2470 C CD2   . LEU F 3 35  ? 82.505 8.021  26.802  1.00 78.93  ? 532 LEU B CD2   1 
ATOM 2471 N N     . ALA F 3 36  ? 86.042 8.387  22.649  1.00 65.64  ? 533 ALA B N     1 
ATOM 2472 C CA    . ALA F 3 36  ? 87.396 8.658  22.180  1.00 61.77  ? 533 ALA B CA    1 
ATOM 2473 C C     . ALA F 3 36  ? 87.554 10.112 21.738  1.00 66.52  ? 533 ALA B C     1 
ATOM 2474 O O     . ALA F 3 36  ? 88.632 10.686 21.860  1.00 70.38  ? 533 ALA B O     1 
ATOM 2475 C CB    . ALA F 3 36  ? 87.751 7.721  21.046  1.00 51.00  ? 533 ALA B CB    1 
ATOM 2476 N N     . MET F 3 37  ? 86.474 10.699 21.227  1.00 73.18  ? 534 MET B N     1 
ATOM 2477 C CA    . MET F 3 37  ? 86.476 12.092 20.777  1.00 76.47  ? 534 MET B CA    1 
ATOM 2478 C C     . MET F 3 37  ? 86.506 13.057 21.962  1.00 74.36  ? 534 MET B C     1 
ATOM 2479 O O     . MET F 3 37  ? 86.799 14.244 21.803  1.00 70.81  ? 534 MET B O     1 
ATOM 2480 C CB    . MET F 3 37  ? 85.224 12.385 19.935  1.00 85.39  ? 534 MET B CB    1 
ATOM 2481 C CG    . MET F 3 37  ? 85.089 11.581 18.649  1.00 89.96  ? 534 MET B CG    1 
ATOM 2482 S SD    . MET F 3 37  ? 86.301 12.011 17.392  1.00 85.62  ? 534 MET B SD    1 
ATOM 2483 C CE    . MET F 3 37  ? 87.466 10.693 17.612  1.00 84.25  ? 534 MET B CE    1 
ATOM 2484 N N     . GLY F 3 38  ? 86.166 12.548 23.142  1.00 79.41  ? 535 GLY B N     1 
ATOM 2485 C CA    . GLY F 3 38  ? 86.152 13.376 24.336  1.00 84.75  ? 535 GLY B CA    1 
ATOM 2486 C C     . GLY F 3 38  ? 87.286 13.082 25.303  1.00 88.90  ? 535 GLY B C     1 
ATOM 2487 O O     . GLY F 3 38  ? 87.352 13.672 26.379  1.00 89.12  ? 535 GLY B O     1 
ATOM 2488 N N     . LYS F 3 39  ? 88.193 12.190 24.909  1.00 92.90  ? 536 LYS B N     1 
ATOM 2489 C CA    . LYS F 3 39  ? 89.330 11.811 25.741  1.00 92.05  ? 536 LYS B CA    1 
ATOM 2490 C C     . LYS F 3 39  ? 90.599 11.661 24.907  1.00 90.34  ? 536 LYS B C     1 
ATOM 2491 O O     . LYS F 3 39  ? 91.600 11.117 25.366  1.00 92.55  ? 536 LYS B O     1 
ATOM 2492 C CB    . LYS F 3 39  ? 89.030 10.517 26.503  1.00 91.34  ? 536 LYS B CB    1 
ATOM 2493 N N     . LEU F 3 40  ? 90.532 12.123 23.664  1.00 89.34  ? 537 LEU B N     1 
ATOM 2494 C CA    . LEU F 3 40  ? 91.661 12.089 22.733  1.00 90.66  ? 537 LEU B CA    1 
ATOM 2495 C C     . LEU F 3 40  ? 91.530 13.302 21.815  1.00 92.76  ? 537 LEU B C     1 
ATOM 2496 O O     . LEU F 3 40  ? 92.167 13.376 20.763  1.00 86.65  ? 537 LEU B O     1 
ATOM 2497 C CB    . LEU F 3 40  ? 91.662 10.792 21.920  1.00 92.89  ? 537 LEU B CB    1 
ATOM 2498 C CG    . LEU F 3 40  ? 92.923 9.917  21.984  1.00 96.33  ? 537 LEU B CG    1 
ATOM 2499 C CD1   . LEU F 3 40  ? 93.500 9.879  23.397  1.00 93.76  ? 537 LEU B CD1   1 
ATOM 2500 C CD2   . LEU F 3 40  ? 92.590 8.510  21.501  1.00 96.12  ? 537 LEU B CD2   1 
ATOM 2501 N N     . TYR F 3 41  ? 90.677 14.236 22.254  1.00 96.52  ? 538 TYR B N     1 
ATOM 2502 C CA    . TYR F 3 41  ? 90.384 15.487 21.542  1.00 98.08  ? 538 TYR B CA    1 
ATOM 2503 C C     . TYR F 3 41  ? 89.684 16.485 22.451  1.00 94.04  ? 538 TYR B C     1 
ATOM 2504 O O     . TYR F 3 41  ? 89.999 16.579 23.636  1.00 87.38  ? 538 TYR B O     1 
ATOM 2505 C CB    . TYR F 3 41  ? 89.517 15.206 20.319  1.00 100.00 ? 538 TYR B CB    1 
ATOM 2506 C CG    . TYR F 3 41  ? 90.292 15.263 19.034  1.00 100.00 ? 538 TYR B CG    1 
ATOM 2507 C CD1   . TYR F 3 41  ? 89.941 14.469 17.951  1.00 100.00 ? 538 TYR B CD1   1 
ATOM 2508 C CD2   . TYR F 3 41  ? 91.356 16.152 18.892  1.00 100.00 ? 538 TYR B CD2   1 
ATOM 2509 C CE1   . TYR F 3 41  ? 90.631 14.564 16.752  1.00 100.00 ? 538 TYR B CE1   1 
ATOM 2510 C CE2   . TYR F 3 41  ? 92.051 16.255 17.695  1.00 100.00 ? 538 TYR B CE2   1 
ATOM 2511 C CZ    . TYR F 3 41  ? 91.680 15.462 16.626  1.00 100.00 ? 538 TYR B CZ    1 
ATOM 2512 O OH    . TYR F 3 41  ? 92.331 15.578 15.424  1.00 100.00 ? 538 TYR B OH    1 
ATOM 2513 N N     . ASN F 3 43  ? 85.268 17.725 22.631  1.00 91.53  ? 540 ASN B N     1 
ATOM 2514 C CA    . ASN F 3 43  ? 84.081 17.290 23.361  1.00 95.83  ? 540 ASN B CA    1 
ATOM 2515 C C     . ASN F 3 43  ? 83.679 15.884 22.904  1.00 98.00  ? 540 ASN B C     1 
ATOM 2516 O O     . ASN F 3 43  ? 84.276 15.332 21.980  1.00 97.50  ? 540 ASN B O     1 
ATOM 2517 C CB    . ASN F 3 43  ? 82.931 18.280 23.129  1.00 90.56  ? 540 ASN B CB    1 
ATOM 2518 C CG    . ASN F 3 43  ? 81.949 18.325 24.290  1.00 88.71  ? 540 ASN B CG    1 
ATOM 2519 O OD1   . ASN F 3 43  ? 81.186 17.385 24.517  1.00 87.89  ? 540 ASN B OD1   1 
ATOM 2520 N ND2   . ASN F 3 43  ? 81.958 19.430 25.025  1.00 82.33  ? 540 ASN B ND2   1 
ATOM 2521 N N     . ASP F 3 44  ? 82.685 15.303 23.572  1.00 99.51  ? 541 ASP B N     1 
ATOM 2522 C CA    . ASP F 3 44  ? 82.199 13.963 23.244  1.00 99.40  ? 541 ASP B CA    1 
ATOM 2523 C C     . ASP F 3 44  ? 81.088 13.971 22.198  1.00 98.41  ? 541 ASP B C     1 
ATOM 2524 O O     . ASP F 3 44  ? 80.250 14.874 22.178  1.00 95.58  ? 541 ASP B O     1 
ATOM 2525 C CB    . ASP F 3 44  ? 81.694 13.265 24.506  1.00 100.00 ? 541 ASP B CB    1 
ATOM 2526 C CG    . ASP F 3 44  ? 82.787 13.049 25.527  1.00 100.00 ? 541 ASP B CG    1 
ATOM 2527 O OD1   . ASP F 3 44  ? 83.233 11.891 25.681  1.00 100.00 ? 541 ASP B OD1   1 
ATOM 2528 O OD2   . ASP F 3 44  ? 83.203 14.037 26.172  1.00 100.00 ? 541 ASP B OD2   1 
ATOM 2529 N N     . PHE F 3 45  ? 81.074 12.944 21.352  1.00 94.89  ? 542 PHE B N     1 
ATOM 2530 C CA    . PHE F 3 45  ? 80.066 12.819 20.305  1.00 91.33  ? 542 PHE B CA    1 
ATOM 2531 C C     . PHE F 3 45  ? 79.438 11.430 20.303  1.00 85.92  ? 542 PHE B C     1 
ATOM 2532 O O     . PHE F 3 45  ? 80.102 10.436 20.016  1.00 81.91  ? 542 PHE B O     1 
ATOM 2533 C CB    . PHE F 3 45  ? 80.669 13.158 18.937  1.00 97.54  ? 542 PHE B CB    1 
ATOM 2534 C CG    . PHE F 3 45  ? 80.901 14.634 18.728  1.00 100.00 ? 542 PHE B CG    1 
ATOM 2535 C CD1   . PHE F 3 45  ? 80.023 15.573 19.273  1.00 100.00 ? 542 PHE B CD1   1 
ATOM 2536 C CD2   . PHE F 3 45  ? 81.992 15.088 17.995  1.00 100.00 ? 542 PHE B CD2   1 
ATOM 2537 C CE1   . PHE F 3 45  ? 80.228 16.940 19.093  1.00 100.00 ? 542 PHE B CE1   1 
ATOM 2538 C CE2   . PHE F 3 45  ? 82.206 16.458 17.808  1.00 100.00 ? 542 PHE B CE2   1 
ATOM 2539 C CZ    . PHE F 3 45  ? 81.321 17.384 18.359  1.00 100.00 ? 542 PHE B CZ    1 
ATOM 2540 N N     . SER F 3 46  ? 78.138 11.385 20.580  1.00 80.56  ? 543 SER B N     1 
ATOM 2541 C CA    . SER F 3 46  ? 77.390 10.133 20.664  1.00 74.81  ? 543 SER B CA    1 
ATOM 2542 C C     . SER F 3 46  ? 77.347 9.295  19.395  1.00 68.96  ? 543 SER B C     1 
ATOM 2543 O O     . SER F 3 46  ? 77.735 9.742  18.317  1.00 67.64  ? 543 SER B O     1 
ATOM 2544 C CB    . SER F 3 46  ? 75.956 10.405 21.125  1.00 71.45  ? 543 SER B CB    1 
ATOM 2545 O OG    . SER F 3 46  ? 75.237 11.126 20.142  1.00 64.54  ? 543 SER B OG    1 
ATOM 2546 N N     . GLN F 3 47  ? 76.848 8.073  19.548  1.00 66.35  ? 544 GLN B N     1 
ATOM 2547 C CA    . GLN F 3 47  ? 76.706 7.138  18.443  1.00 67.42  ? 544 GLN B CA    1 
ATOM 2548 C C     . GLN F 3 47  ? 75.877 7.807  17.350  1.00 68.72  ? 544 GLN B C     1 
ATOM 2549 O O     . GLN F 3 47  ? 76.044 7.510  16.169  1.00 71.86  ? 544 GLN B O     1 
ATOM 2550 C CB    . GLN F 3 47  ? 76.034 5.848  18.944  1.00 65.31  ? 544 GLN B CB    1 
ATOM 2551 C CG    . GLN F 3 47  ? 75.526 4.879  17.871  1.00 60.77  ? 544 GLN B CG    1 
ATOM 2552 C CD    . GLN F 3 47  ? 74.158 5.265  17.329  1.00 67.22  ? 544 GLN B CD    1 
ATOM 2553 O OE1   . GLN F 3 47  ? 73.333 5.846  18.038  1.00 72.24  ? 544 GLN B OE1   1 
ATOM 2554 N NE2   . GLN F 3 47  ? 73.919 4.959  16.062  1.00 66.59  ? 544 GLN B NE2   1 
ATOM 2555 N N     . THR F 3 48  ? 74.997 8.722  17.761  1.00 67.22  ? 545 THR B N     1 
ATOM 2556 C CA    . THR F 3 48  ? 74.140 9.457  16.838  1.00 63.08  ? 545 THR B CA    1 
ATOM 2557 C C     . THR F 3 48  ? 74.989 10.033 15.713  1.00 65.58  ? 545 THR B C     1 
ATOM 2558 O O     . THR F 3 48  ? 74.983 9.511  14.597  1.00 70.50  ? 545 THR B O     1 
ATOM 2559 C CB    . THR F 3 48  ? 73.413 10.629 17.539  1.00 60.24  ? 545 THR B CB    1 
ATOM 2560 O OG1   . THR F 3 48  ? 72.777 10.166 18.736  1.00 71.24  ? 545 THR B OG1   1 
ATOM 2561 C CG2   . THR F 3 48  ? 72.364 11.221 16.621  1.00 49.23  ? 545 THR B CG2   1 
ATOM 2562 N N     . THR F 3 49  ? 75.763 11.069 16.033  1.00 64.63  ? 546 THR B N     1 
ATOM 2563 C CA    . THR F 3 49  ? 76.621 11.728 15.052  1.00 57.01  ? 546 THR B CA    1 
ATOM 2564 C C     . THR F 3 49  ? 77.629 10.797 14.385  1.00 57.91  ? 546 THR B C     1 
ATOM 2565 O O     . THR F 3 49  ? 78.017 11.026 13.241  1.00 59.34  ? 546 THR B O     1 
ATOM 2566 C CB    . THR F 3 49  ? 77.362 12.936 15.657  1.00 49.00  ? 546 THR B CB    1 
ATOM 2567 O OG1   . THR F 3 49  ? 78.039 12.539 16.853  1.00 35.28  ? 546 THR B OG1   1 
ATOM 2568 C CG2   . THR F 3 49  ? 76.384 14.051 15.979  1.00 51.11  ? 546 THR B CG2   1 
ATOM 2569 N N     . ILE F 3 50  ? 78.041 9.743  15.082  1.00 59.00  ? 547 ILE B N     1 
ATOM 2570 C CA    . ILE F 3 50  ? 78.992 8.804  14.501  1.00 64.78  ? 547 ILE B CA    1 
ATOM 2571 C C     . ILE F 3 50  ? 78.324 8.030  13.363  1.00 59.30  ? 547 ILE B C     1 
ATOM 2572 O O     . ILE F 3 50  ? 78.919 7.829  12.306  1.00 62.46  ? 547 ILE B O     1 
ATOM 2573 C CB    . ILE F 3 50  ? 79.571 7.834  15.564  1.00 68.40  ? 547 ILE B CB    1 
ATOM 2574 C CG1   . ILE F 3 50  ? 80.291 8.624  16.665  1.00 70.16  ? 547 ILE B CG1   1 
ATOM 2575 C CG2   . ILE F 3 50  ? 80.549 6.855  14.914  1.00 72.66  ? 547 ILE B CG2   1 
ATOM 2576 C CD1   . ILE F 3 50  ? 81.423 9.517  16.168  1.00 63.67  ? 547 ILE B CD1   1 
ATOM 2577 N N     . SER F 3 51  ? 77.069 7.645  13.568  1.00 50.51  ? 548 SER B N     1 
ATOM 2578 C CA    . SER F 3 51  ? 76.317 6.915  12.556  1.00 50.84  ? 548 SER B CA    1 
ATOM 2579 C C     . SER F 3 51  ? 75.993 7.814  11.373  1.00 53.98  ? 548 SER B C     1 
ATOM 2580 O O     . SER F 3 51  ? 76.087 7.391  10.218  1.00 54.85  ? 548 SER B O     1 
ATOM 2581 C CB    . SER F 3 51  ? 75.016 6.376  13.143  1.00 51.49  ? 548 SER B CB    1 
ATOM 2582 O OG    . SER F 3 51  ? 74.160 5.910  12.115  1.00 51.69  ? 548 SER B OG    1 
ATOM 2583 N N     . ARG F 3 52  ? 75.585 9.045  11.676  1.00 45.76  ? 549 ARG B N     1 
ATOM 2584 C CA    . ARG F 3 52  ? 75.231 10.020 10.654  1.00 42.66  ? 549 ARG B CA    1 
ATOM 2585 C C     . ARG F 3 52  ? 76.394 10.320 9.730   1.00 44.22  ? 549 ARG B C     1 
ATOM 2586 O O     . ARG F 3 52  ? 76.223 10.400 8.520   1.00 49.68  ? 549 ARG B O     1 
ATOM 2587 C CB    . ARG F 3 52  ? 74.733 11.317 11.292  1.00 38.61  ? 549 ARG B CB    1 
ATOM 2588 C CG    . ARG F 3 52  ? 73.329 11.227 11.840  1.00 36.76  ? 549 ARG B CG    1 
ATOM 2589 C CD    . ARG F 3 52  ? 72.910 12.519 12.510  1.00 49.23  ? 549 ARG B CD    1 
ATOM 2590 N NE    . ARG F 3 52  ? 71.500 12.481 12.888  1.00 75.82  ? 549 ARG B NE    1 
ATOM 2591 C CZ    . ARG F 3 52  ? 70.952 13.215 13.854  1.00 85.53  ? 549 ARG B CZ    1 
ATOM 2592 N NH1   . ARG F 3 52  ? 71.689 14.062 14.565  1.00 88.91  ? 549 ARG B NH1   1 
ATOM 2593 N NH2   . ARG F 3 52  ? 69.654 13.102 14.107  1.00 92.04  ? 549 ARG B NH2   1 
ATOM 2594 N N     . PHE F 3 53  ? 77.580 10.466 10.304  1.00 49.45  ? 550 PHE B N     1 
ATOM 2595 C CA    . PHE F 3 53  ? 78.770 10.757 9.516   1.00 60.46  ? 550 PHE B CA    1 
ATOM 2596 C C     . PHE F 3 53  ? 79.058 9.627  8.529   1.00 62.33  ? 550 PHE B C     1 
ATOM 2597 O O     . PHE F 3 53  ? 79.511 9.869  7.411   1.00 67.16  ? 550 PHE B O     1 
ATOM 2598 C CB    . PHE F 3 53  ? 79.970 10.972 10.438  1.00 65.58  ? 550 PHE B CB    1 
ATOM 2599 C CG    . PHE F 3 53  ? 81.204 11.451 9.728   1.00 69.68  ? 550 PHE B CG    1 
ATOM 2600 C CD1   . PHE F 3 53  ? 81.511 12.808 9.684   1.00 67.16  ? 550 PHE B CD1   1 
ATOM 2601 C CD2   . PHE F 3 53  ? 82.073 10.546 9.119   1.00 72.53  ? 550 PHE B CD2   1 
ATOM 2602 C CE1   . PHE F 3 53  ? 82.668 13.258 9.045   1.00 73.91  ? 550 PHE B CE1   1 
ATOM 2603 C CE2   . PHE F 3 53  ? 83.232 10.983 8.478   1.00 77.11  ? 550 PHE B CE2   1 
ATOM 2604 C CZ    . PHE F 3 53  ? 83.531 12.344 8.442   1.00 78.38  ? 550 PHE B CZ    1 
ATOM 2605 N N     . GLU F 3 54  ? 78.790 8.396  8.946   1.00 58.79  ? 551 GLU B N     1 
ATOM 2606 C CA    . GLU F 3 54  ? 79.018 7.240  8.093   1.00 66.26  ? 551 GLU B CA    1 
ATOM 2607 C C     . GLU F 3 54  ? 77.876 7.082  7.096   1.00 70.45  ? 551 GLU B C     1 
ATOM 2608 O O     . GLU F 3 54  ? 78.040 6.478  6.033   1.00 75.07  ? 551 GLU B O     1 
ATOM 2609 C CB    . GLU F 3 54  ? 79.141 5.990  8.953   1.00 71.89  ? 551 GLU B CB    1 
ATOM 2610 C CG    . GLU F 3 54  ? 80.188 6.129  10.037  1.00 76.15  ? 551 GLU B CG    1 
ATOM 2611 C CD    . GLU F 3 54  ? 80.249 4.929  10.950  1.00 83.54  ? 551 GLU B CD    1 
ATOM 2612 O OE1   . GLU F 3 54  ? 81.372 4.446  11.194  1.00 90.56  ? 551 GLU B OE1   1 
ATOM 2613 O OE2   . GLU F 3 54  ? 79.184 4.475  11.425  1.00 80.38  ? 551 GLU B OE2   1 
ATOM 2614 N N     . ALA F 3 55  ? 76.722 7.642  7.450   1.00 68.73  ? 552 ALA B N     1 
ATOM 2615 C CA    . ALA F 3 55  ? 75.534 7.583  6.605   1.00 66.36  ? 552 ALA B CA    1 
ATOM 2616 C C     . ALA F 3 55  ? 75.362 8.822  5.713   1.00 60.49  ? 552 ALA B C     1 
ATOM 2617 O O     . ALA F 3 55  ? 74.520 8.827  4.817   1.00 65.29  ? 552 ALA B O     1 
ATOM 2618 C CB    . ALA F 3 55  ? 74.291 7.366  7.466   1.00 66.06  ? 552 ALA B CB    1 
ATOM 2619 N N     . LEU F 3 56  ? 76.181 9.848  5.945   1.00 53.71  ? 553 LEU B N     1 
ATOM 2620 C CA    . LEU F 3 56  ? 76.155 11.102 5.181   1.00 47.31  ? 553 LEU B CA    1 
ATOM 2621 C C     . LEU F 3 56  ? 74.967 12.043 5.458   1.00 48.05  ? 553 LEU B C     1 
ATOM 2622 O O     . LEU F 3 56  ? 74.697 12.963 4.679   1.00 40.52  ? 553 LEU B O     1 
ATOM 2623 C CB    . LEU F 3 56  ? 76.277 10.824 3.676   1.00 49.01  ? 553 LEU B CB    1 
ATOM 2624 C CG    . LEU F 3 56  ? 77.555 10.165 3.136   1.00 51.39  ? 553 LEU B CG    1 
ATOM 2625 C CD1   . LEU F 3 56  ? 77.544 8.654  3.350   1.00 48.09  ? 553 LEU B CD1   1 
ATOM 2626 C CD2   . LEU F 3 56  ? 77.659 10.460 1.653   1.00 58.18  ? 553 LEU B CD2   1 
ATOM 2627 N N     . ASN F 3 57  ? 74.325 11.862 6.611   1.00 50.24  ? 554 ASN B N     1 
ATOM 2628 C CA    . ASN F 3 57  ? 73.162 12.660 7.020   1.00 51.05  ? 554 ASN B CA    1 
ATOM 2629 C C     . ASN F 3 57  ? 73.487 14.009 7.655   1.00 52.60  ? 554 ASN B C     1 
ATOM 2630 O O     . ASN F 3 57  ? 72.608 14.648 8.240   1.00 55.91  ? 554 ASN B O     1 
ATOM 2631 C CB    . ASN F 3 57  ? 72.299 11.868 8.012   1.00 52.97  ? 554 ASN B CB    1 
ATOM 2632 C CG    . ASN F 3 57  ? 71.644 10.646 7.392   1.00 52.78  ? 554 ASN B CG    1 
ATOM 2633 O OD1   . ASN F 3 57  ? 70.541 10.263 7.783   1.00 57.87  ? 554 ASN B OD1   1 
ATOM 2634 N ND2   . ASN F 3 57  ? 72.320 10.021 6.435   1.00 58.75  ? 554 ASN B ND2   1 
ATOM 2635 N N     . LEU F 3 58  ? 74.735 14.447 7.550   1.00 57.56  ? 555 LEU B N     1 
ATOM 2636 C CA    . LEU F 3 58  ? 75.127 15.715 8.149   1.00 60.43  ? 555 LEU B CA    1 
ATOM 2637 C C     . LEU F 3 58  ? 75.326 16.820 7.132   1.00 54.52  ? 555 LEU B C     1 
ATOM 2638 O O     . LEU F 3 58  ? 75.778 16.571 6.016   1.00 58.56  ? 555 LEU B O     1 
ATOM 2639 C CB    . LEU F 3 58  ? 76.380 15.525 9.001   1.00 66.97  ? 555 LEU B CB    1 
ATOM 2640 C CG    . LEU F 3 58  ? 76.087 14.689 10.248  1.00 69.84  ? 555 LEU B CG    1 
ATOM 2641 C CD1   . LEU F 3 58  ? 77.369 14.256 10.935  1.00 76.21  ? 555 LEU B CD1   1 
ATOM 2642 C CD2   . LEU F 3 58  ? 75.207 15.499 11.182  1.00 72.57  ? 555 LEU B CD2   1 
ATOM 2643 N N     . SER F 3 59  ? 74.980 18.042 7.530   1.00 44.95  ? 556 SER B N     1 
ATOM 2644 C CA    . SER F 3 59  ? 75.106 19.210 6.666   1.00 44.02  ? 556 SER B CA    1 
ATOM 2645 C C     . SER F 3 59  ? 76.511 19.288 6.106   1.00 50.37  ? 556 SER B C     1 
ATOM 2646 O O     . SER F 3 59  ? 77.409 18.583 6.566   1.00 55.08  ? 556 SER B O     1 
ATOM 2647 C CB    . SER F 3 59  ? 74.822 20.482 7.456   1.00 45.78  ? 556 SER B CB    1 
ATOM 2648 O OG    . SER F 3 59  ? 75.816 20.677 8.441   1.00 39.66  ? 556 SER B OG    1 
ATOM 2649 N N     . PHE F 3 60  ? 76.712 20.155 5.123   1.00 54.35  ? 557 PHE B N     1 
ATOM 2650 C CA    . PHE F 3 60  ? 78.033 20.285 4.536   1.00 58.74  ? 557 PHE B CA    1 
ATOM 2651 C C     . PHE F 3 60  ? 79.013 20.743 5.605   1.00 56.64  ? 557 PHE B C     1 
ATOM 2652 O O     . PHE F 3 60  ? 79.993 20.053 5.897   1.00 47.76  ? 557 PHE B O     1 
ATOM 2653 C CB    . PHE F 3 60  ? 78.029 21.270 3.372   1.00 61.49  ? 557 PHE B CB    1 
ATOM 2654 C CG    . PHE F 3 60  ? 79.326 21.308 2.619   1.00 59.57  ? 557 PHE B CG    1 
ATOM 2655 C CD1   . PHE F 3 60  ? 79.964 20.124 2.254   1.00 51.09  ? 557 PHE B CD1   1 
ATOM 2656 C CD2   . PHE F 3 60  ? 79.924 22.520 2.293   1.00 57.84  ? 557 PHE B CD2   1 
ATOM 2657 C CE1   . PHE F 3 60  ? 81.177 20.147 1.578   1.00 41.23  ? 557 PHE B CE1   1 
ATOM 2658 C CE2   . PHE F 3 60  ? 81.138 22.553 1.617   1.00 49.46  ? 557 PHE B CE2   1 
ATOM 2659 C CZ    . PHE F 3 60  ? 81.765 21.364 1.259   1.00 44.82  ? 557 PHE B CZ    1 
ATOM 2660 N N     . LYS F 3 61  ? 78.722 21.895 6.204   1.00 58.34  ? 558 LYS B N     1 
ATOM 2661 C CA    . LYS F 3 61  ? 79.563 22.449 7.256   1.00 63.04  ? 558 LYS B CA    1 
ATOM 2662 C C     . LYS F 3 61  ? 79.829 21.395 8.330   1.00 61.99  ? 558 LYS B C     1 
ATOM 2663 O O     . LYS F 3 61  ? 80.977 21.021 8.558   1.00 63.02  ? 558 LYS B O     1 
ATOM 2664 C CB    . LYS F 3 61  ? 78.901 23.682 7.872   1.00 57.42  ? 558 LYS B CB    1 
ATOM 2665 N N     . ASN F 3 62  ? 78.759 20.868 8.921   1.00 57.47  ? 559 ASN B N     1 
ATOM 2666 C CA    . ASN F 3 62  ? 78.871 19.862 9.974   1.00 58.07  ? 559 ASN B CA    1 
ATOM 2667 C C     . ASN F 3 62  ? 79.793 18.700 9.604   1.00 60.00  ? 559 ASN B C     1 
ATOM 2668 O O     . ASN F 3 62  ? 80.683 18.350 10.376  1.00 59.75  ? 559 ASN B O     1 
ATOM 2669 C CB    . ASN F 3 62  ? 77.486 19.320 10.346  1.00 57.10  ? 559 ASN B CB    1 
ATOM 2670 C CG    . ASN F 3 62  ? 77.422 18.763 11.764  1.00 55.98  ? 559 ASN B CG    1 
ATOM 2671 O OD1   . ASN F 3 62  ? 76.402 18.893 12.439  1.00 61.59  ? 559 ASN B OD1   1 
ATOM 2672 N ND2   . ASN F 3 62  ? 78.501 18.133 12.217  1.00 47.13  ? 559 ASN B ND2   1 
ATOM 2673 N N     . MET F 3 63  ? 79.616 18.127 8.418   1.00 64.29  ? 560 MET B N     1 
ATOM 2674 C CA    . MET F 3 63  ? 80.446 16.993 8.026   1.00 70.53  ? 560 MET B CA    1 
ATOM 2675 C C     . MET F 3 63  ? 81.923 17.345 7.848   1.00 72.66  ? 560 MET B C     1 
ATOM 2676 O O     . MET F 3 63  ? 82.795 16.544 8.187   1.00 71.54  ? 560 MET B O     1 
ATOM 2677 C CB    . MET F 3 63  ? 79.885 16.299 6.778   1.00 77.97  ? 560 MET B CB    1 
ATOM 2678 C CG    . MET F 3 63  ? 80.515 14.925 6.512   1.00 86.39  ? 560 MET B CG    1 
ATOM 2679 S SD    . MET F 3 63  ? 79.582 13.819 5.414   1.00 87.84  ? 560 MET B SD    1 
ATOM 2680 C CE    . MET F 3 63  ? 78.568 12.971 6.599   1.00 80.04  ? 560 MET B CE    1 
ATOM 2681 N N     . CYS F 3 64  ? 82.202 18.545 7.343   1.00 76.74  ? 561 CYS B N     1 
ATOM 2682 C CA    . CYS F 3 64  ? 83.583 18.992 7.140   1.00 74.65  ? 561 CYS B CA    1 
ATOM 2683 C C     . CYS F 3 64  ? 84.291 19.272 8.459   1.00 72.90  ? 561 CYS B C     1 
ATOM 2684 O O     . CYS F 3 64  ? 85.504 19.101 8.569   1.00 71.53  ? 561 CYS B O     1 
ATOM 2685 C CB    . CYS F 3 64  ? 83.626 20.252 6.273   1.00 72.48  ? 561 CYS B CB    1 
ATOM 2686 S SG    . CYS F 3 64  ? 83.526 19.943 4.509   1.00 71.24  ? 561 CYS B SG    1 
ATOM 2687 N N     . LYS F 3 65  ? 83.521 19.710 9.450   1.00 71.33  ? 562 LYS B N     1 
ATOM 2688 C CA    . LYS F 3 65  ? 84.050 20.032 10.769  1.00 63.81  ? 562 LYS B CA    1 
ATOM 2689 C C     . LYS F 3 65  ? 84.617 18.798 11.460  1.00 53.92  ? 562 LYS B C     1 
ATOM 2690 O O     . LYS F 3 65  ? 85.714 18.830 12.010  1.00 52.89  ? 562 LYS B O     1 
ATOM 2691 C CB    . LYS F 3 65  ? 82.950 20.675 11.624  1.00 65.92  ? 562 LYS B CB    1 
ATOM 2692 C CG    . LYS F 3 65  ? 83.363 21.025 13.047  1.00 76.09  ? 562 LYS B CG    1 
ATOM 2693 C CD    . LYS F 3 65  ? 82.642 22.275 13.561  1.00 81.41  ? 562 LYS B CD    1 
ATOM 2694 C CE    . LYS F 3 65  ? 81.122 22.131 13.551  1.00 85.77  ? 562 LYS B CE    1 
ATOM 2695 N NZ    . LYS F 3 65  ? 80.651 21.025 14.425  1.00 85.33  ? 562 LYS B NZ    1 
ATOM 2696 N N     . LEU F 3 66  ? 83.871 17.705 11.393  1.00 45.99  ? 563 LEU B N     1 
ATOM 2697 C CA    . LEU F 3 66  ? 84.270 16.449 12.009  1.00 43.96  ? 563 LEU B CA    1 
ATOM 2698 C C     . LEU F 3 66  ? 85.343 15.724 11.213  1.00 42.95  ? 563 LEU B C     1 
ATOM 2699 O O     . LEU F 3 66  ? 86.051 14.883 11.756  1.00 45.35  ? 563 LEU B O     1 
ATOM 2700 C CB    . LEU F 3 66  ? 83.053 15.533 12.150  1.00 49.29  ? 563 LEU B CB    1 
ATOM 2701 C CG    . LEU F 3 66  ? 81.938 15.831 13.161  1.00 48.26  ? 563 LEU B CG    1 
ATOM 2702 C CD1   . LEU F 3 66  ? 81.513 17.297 13.155  1.00 49.07  ? 563 LEU B CD1   1 
ATOM 2703 C CD2   . LEU F 3 66  ? 80.759 14.926 12.848  1.00 49.19  ? 563 LEU B CD2   1 
ATOM 2704 N N     . LYS F 3 67  ? 85.461 16.053 9.930   1.00 47.48  ? 564 LYS B N     1 
ATOM 2705 C CA    . LYS F 3 67  ? 86.437 15.415 9.051   1.00 56.77  ? 564 LYS B CA    1 
ATOM 2706 C C     . LYS F 3 67  ? 87.844 15.317 9.643   1.00 60.27  ? 564 LYS B C     1 
ATOM 2707 O O     . LYS F 3 67  ? 88.401 14.224 9.723   1.00 64.41  ? 564 LYS B O     1 
ATOM 2708 C CB    . LYS F 3 67  ? 86.492 16.128 7.697   1.00 62.32  ? 564 LYS B CB    1 
ATOM 2709 C CG    . LYS F 3 67  ? 87.359 15.437 6.658   1.00 61.99  ? 564 LYS B CG    1 
ATOM 2710 C CD    . LYS F 3 67  ? 87.821 16.413 5.587   1.00 63.33  ? 564 LYS B CD    1 
ATOM 2711 C CE    . LYS F 3 67  ? 88.258 15.681 4.329   1.00 67.91  ? 564 LYS B CE    1 
ATOM 2712 N NZ    . LYS F 3 67  ? 89.148 14.515 4.612   1.00 59.31  ? 564 LYS B NZ    1 
ATOM 2713 N N     . PRO F 3 68  ? 88.428 16.450 10.087  1.00 59.43  ? 565 PRO B N     1 
ATOM 2714 C CA    . PRO F 3 68  ? 89.778 16.421 10.662  1.00 60.78  ? 565 PRO B CA    1 
ATOM 2715 C C     . PRO F 3 68  ? 89.874 15.643 11.973  1.00 60.07  ? 565 PRO B C     1 
ATOM 2716 O O     . PRO F 3 68  ? 90.807 14.860 12.167  1.00 63.68  ? 565 PRO B O     1 
ATOM 2717 C CB    . PRO F 3 68  ? 90.092 17.904 10.861  1.00 59.79  ? 565 PRO B CB    1 
ATOM 2718 C CG    . PRO F 3 68  ? 88.760 18.491 11.143  1.00 61.83  ? 565 PRO B CG    1 
ATOM 2719 C CD    . PRO F 3 68  ? 87.895 17.823 10.106  1.00 60.50  ? 565 PRO B CD    1 
ATOM 2720 N N     . LEU F 3 69  ? 88.906 15.860 12.861  1.00 49.38  ? 566 LEU B N     1 
ATOM 2721 C CA    . LEU F 3 69  ? 88.863 15.191 14.156  1.00 47.27  ? 566 LEU B CA    1 
ATOM 2722 C C     . LEU F 3 69  ? 88.778 13.680 14.010  1.00 48.11  ? 566 LEU B C     1 
ATOM 2723 O O     . LEU F 3 69  ? 89.537 12.937 14.634  1.00 48.93  ? 566 LEU B O     1 
ATOM 2724 C CB    . LEU F 3 69  ? 87.673 15.702 14.964  1.00 41.66  ? 566 LEU B CB    1 
ATOM 2725 C CG    . LEU F 3 69  ? 87.855 16.996 15.760  1.00 45.02  ? 566 LEU B CG    1 
ATOM 2726 C CD1   . LEU F 3 69  ? 88.833 17.959 15.086  1.00 41.32  ? 566 LEU B CD1   1 
ATOM 2727 C CD2   . LEU F 3 69  ? 86.492 17.633 15.962  1.00 46.23  ? 566 LEU B CD2   1 
ATOM 2728 N N     . LEU F 3 70  ? 87.857 13.240 13.164  1.00 53.99  ? 567 LEU B N     1 
ATOM 2729 C CA    . LEU F 3 70  ? 87.652 11.823 12.910  1.00 62.55  ? 567 LEU B CA    1 
ATOM 2730 C C     . LEU F 3 70  ? 88.864 11.243 12.207  1.00 68.35  ? 567 LEU B C     1 
ATOM 2731 O O     . LEU F 3 70  ? 89.243 10.097 12.457  1.00 69.73  ? 567 LEU B O     1 
ATOM 2732 C CB    . LEU F 3 70  ? 86.391 11.620 12.078  1.00 67.52  ? 567 LEU B CB    1 
ATOM 2733 C CG    . LEU F 3 70  ? 85.154 12.084 12.844  1.00 73.07  ? 567 LEU B CG    1 
ATOM 2734 C CD1   . LEU F 3 70  ? 83.932 11.957 11.982  1.00 76.37  ? 567 LEU B CD1   1 
ATOM 2735 C CD2   . LEU F 3 70  ? 85.000 11.271 14.119  1.00 79.76  ? 567 LEU B CD2   1 
ATOM 2736 N N     . GLU F 3 71  ? 89.480 12.049 11.344  1.00 69.43  ? 568 GLU B N     1 
ATOM 2737 C CA    . GLU F 3 71  ? 90.675 11.632 10.623  1.00 71.90  ? 568 GLU B CA    1 
ATOM 2738 C C     . GLU F 3 71  ? 91.769 11.269 11.614  1.00 75.87  ? 568 GLU B C     1 
ATOM 2739 O O     . GLU F 3 71  ? 92.407 10.227 11.485  1.00 82.96  ? 568 GLU B O     1 
ATOM 2740 C CB    . GLU F 3 71  ? 91.188 12.752 9.715   1.00 72.71  ? 568 GLU B CB    1 
ATOM 2741 C CG    . GLU F 3 71  ? 90.692 12.685 8.285   1.00 81.04  ? 568 GLU B CG    1 
ATOM 2742 C CD    . GLU F 3 71  ? 91.305 13.750 7.397   1.00 85.26  ? 568 GLU B CD    1 
ATOM 2743 O OE1   . GLU F 3 71  ? 91.062 14.953 7.642   1.00 84.05  ? 568 GLU B OE1   1 
ATOM 2744 O OE2   . GLU F 3 71  ? 92.027 13.380 6.446   1.00 88.52  ? 568 GLU B OE2   1 
ATOM 2745 N N     . LYS F 3 72  ? 91.953 12.117 12.625  1.00 75.62  ? 569 LYS B N     1 
ATOM 2746 C CA    . LYS F 3 72  ? 92.989 11.895 13.625  1.00 72.02  ? 569 LYS B CA    1 
ATOM 2747 C C     . LYS F 3 72  ? 92.807 10.645 14.455  1.00 68.41  ? 569 LYS B C     1 
ATOM 2748 O O     . LYS F 3 72  ? 93.781 9.960  14.741  1.00 75.76  ? 569 LYS B O     1 
ATOM 2749 C CB    . LYS F 3 72  ? 93.137 13.095 14.549  1.00 73.19  ? 569 LYS B CB    1 
ATOM 2750 C CG    . LYS F 3 72  ? 94.416 13.058 15.366  1.00 74.97  ? 569 LYS B CG    1 
ATOM 2751 C CD    . LYS F 3 72  ? 95.619 12.972 14.439  1.00 75.35  ? 569 LYS B CD    1 
ATOM 2752 C CE    . LYS F 3 72  ? 96.926 12.859 15.198  1.00 71.21  ? 569 LYS B CE    1 
ATOM 2753 N NZ    . LYS F 3 72  ? 98.042 12.644 14.241  1.00 65.20  ? 569 LYS B NZ    1 
ATOM 2754 N N     . TRP F 3 73  ? 91.578 10.353 14.867  1.00 66.09  ? 570 TRP B N     1 
ATOM 2755 C CA    . TRP F 3 73  ? 91.340 9.152  15.654  1.00 68.27  ? 570 TRP B CA    1 
ATOM 2756 C C     . TRP F 3 73  ? 91.694 7.910  14.835  1.00 66.05  ? 570 TRP B C     1 
ATOM 2757 O O     . TRP F 3 73  ? 92.363 6.997  15.323  1.00 57.06  ? 570 TRP B O     1 
ATOM 2758 C CB    . TRP F 3 73  ? 89.882 9.065  16.104  1.00 69.68  ? 570 TRP B CB    1 
ATOM 2759 C CG    . TRP F 3 73  ? 89.603 7.800  16.844  1.00 68.13  ? 570 TRP B CG    1 
ATOM 2760 C CD1   . TRP F 3 73  ? 89.660 7.610  18.194  1.00 70.49  ? 570 TRP B CD1   1 
ATOM 2761 C CD2   . TRP F 3 73  ? 89.328 6.520  16.268  1.00 68.02  ? 570 TRP B CD2   1 
ATOM 2762 N NE1   . TRP F 3 73  ? 89.453 6.284  18.491  1.00 74.12  ? 570 TRP B NE1   1 
ATOM 2763 C CE2   . TRP F 3 73  ? 89.247 5.593  17.327  1.00 71.88  ? 570 TRP B CE2   1 
ATOM 2764 C CE3   . TRP F 3 73  ? 89.151 6.062  14.955  1.00 70.60  ? 570 TRP B CE3   1 
ATOM 2765 C CZ2   . TRP F 3 73  ? 88.999 4.235  17.112  1.00 78.03  ? 570 TRP B CZ2   1 
ATOM 2766 C CZ3   . TRP F 3 73  ? 88.908 4.716  14.742  1.00 74.72  ? 570 TRP B CZ3   1 
ATOM 2767 C CH2   . TRP F 3 73  ? 88.833 3.817  15.815  1.00 78.31  ? 570 TRP B CH2   1 
ATOM 2768 N N     . LEU F 3 74  ? 91.208 7.880  13.597  1.00 68.51  ? 571 LEU B N     1 
ATOM 2769 C CA    . LEU F 3 74  ? 91.444 6.766  12.685  1.00 73.38  ? 571 LEU B CA    1 
ATOM 2770 C C     . LEU F 3 74  ? 92.931 6.551  12.417  1.00 79.49  ? 571 LEU B C     1 
ATOM 2771 O O     . LEU F 3 74  ? 93.435 5.428  12.514  1.00 85.72  ? 571 LEU B O     1 
ATOM 2772 C CB    . LEU F 3 74  ? 90.710 7.017  11.367  1.00 72.76  ? 571 LEU B CB    1 
ATOM 2773 C CG    . LEU F 3 74  ? 90.901 5.997  10.243  1.00 71.69  ? 571 LEU B CG    1 
ATOM 2774 C CD1   . LEU F 3 74  ? 90.329 4.651  10.655  1.00 70.35  ? 571 LEU B CD1   1 
ATOM 2775 C CD2   . LEU F 3 74  ? 90.232 6.503  8.980   1.00 71.11  ? 571 LEU B CD2   1 
ATOM 2776 N N     . ASN F 3 75  ? 93.624 7.638  12.089  1.00 81.98  ? 572 ASN B N     1 
ATOM 2777 C CA    . ASN F 3 75  ? 95.051 7.591  11.795  1.00 83.70  ? 572 ASN B CA    1 
ATOM 2778 C C     . ASN F 3 75  ? 95.906 7.475  13.058  1.00 82.06  ? 572 ASN B C     1 
ATOM 2779 O O     . ASN F 3 75  ? 97.122 7.284  12.977  1.00 75.44  ? 572 ASN B O     1 
ATOM 2780 C CB    . ASN F 3 75  ? 95.459 8.809  10.957  1.00 86.37  ? 572 ASN B CB    1 
ATOM 2781 C CG    . ASN F 3 75  ? 94.801 8.818  9.576   1.00 89.02  ? 572 ASN B CG    1 
ATOM 2782 O OD1   . ASN F 3 75  ? 94.702 7.783  8.914   1.00 90.97  ? 572 ASN B OD1   1 
ATOM 2783 N ND2   . ASN F 3 75  ? 94.352 9.991  9.140   1.00 91.08  ? 572 ASN B ND2   1 
ATOM 2784 N N     . ASP F 3 76  ? 95.258 7.591  14.218  1.00 86.90  ? 573 ASP B N     1 
ATOM 2785 C CA    . ASP F 3 76  ? 95.931 7.472  15.512  1.00 88.39  ? 573 ASP B CA    1 
ATOM 2786 C C     . ASP F 3 76  ? 96.065 5.993  15.856  1.00 88.42  ? 573 ASP B C     1 
ATOM 2787 O O     . ASP F 3 76  ? 97.108 5.557  16.345  1.00 89.59  ? 573 ASP B O     1 
ATOM 2788 C CB    . ASP F 3 76  ? 95.129 8.175  16.617  1.00 89.87  ? 573 ASP B CB    1 
ATOM 2789 C CG    . ASP F 3 76  ? 95.860 9.375  17.214  1.00 95.33  ? 573 ASP B CG    1 
ATOM 2790 O OD1   . ASP F 3 76  ? 96.982 9.697  16.763  1.00 98.55  ? 573 ASP B OD1   1 
ATOM 2791 O OD2   . ASP F 3 76  ? 95.302 10.000 18.144  1.00 92.24  ? 573 ASP B OD2   1 
ATOM 2792 N N     . ALA F 3 77  ? 94.996 5.237  15.608  1.00 87.85  ? 574 ALA B N     1 
ATOM 2793 C CA    . ALA F 3 77  ? 94.972 3.803  15.874  1.00 85.01  ? 574 ALA B CA    1 
ATOM 2794 C C     . ALA F 3 77  ? 96.079 3.112  15.081  1.00 88.57  ? 574 ALA B C     1 
ATOM 2795 O O     . ALA F 3 77  ? 95.885 2.680  13.941  1.00 84.10  ? 574 ALA B O     1 
ATOM 2796 C CB    . ALA F 3 77  ? 93.617 3.228  15.517  1.00 79.56  ? 574 ALA B CB    1 
ATOM 2797 N N     . GLU F 3 78  ? 97.251 3.049  15.707  1.00 94.29  ? 575 GLU B N     1 
ATOM 2798 C CA    . GLU F 3 78  ? 98.447 2.445  15.127  1.00 93.17  ? 575 GLU B CA    1 
ATOM 2799 C C     . GLU F 3 78  ? 98.502 0.933  15.346  1.00 95.92  ? 575 GLU B C     1 
ATOM 2800 O O     . GLU F 3 78  ? 99.442 0.307  14.809  1.00 98.46  ? 575 GLU B O     1 
ATOM 2801 C CB    . GLU F 3 78  ? 99.710 3.121  15.692  1.00 85.58  ? 575 GLU B CB    1 
ATOM 2802 C CG    . GLU F 3 78  ? 99.572 3.711  17.106  1.00 77.87  ? 575 GLU B CG    1 
ATOM 2803 C CD    . GLU F 3 78  ? 99.075 2.710  18.140  1.00 79.77  ? 575 GLU B CD    1 
ATOM 2804 O OE1   . GLU F 3 78  ? 98.151 3.053  18.906  1.00 66.06  ? 575 GLU B OE1   1 
ATOM 2805 O OE2   . GLU F 3 78  ? 99.607 1.580  18.188  1.00 90.73  ? 575 GLU B OE2   1 
ATOM 2806 N N     . ARG F 3 104 ? 78.978 18.543 26.783  1.00 90.08  ? 602 ARG B N     1 
ATOM 2807 C CA    . ARG F 3 104 ? 78.423 19.781 27.412  1.00 89.65  ? 602 ARG B CA    1 
ATOM 2808 C C     . ARG F 3 104 ? 77.148 19.485 28.198  1.00 87.26  ? 602 ARG B C     1 
ATOM 2809 O O     . ARG F 3 104 ? 76.830 18.322 28.446  1.00 86.97  ? 602 ARG B O     1 
ATOM 2810 C CB    . ARG F 3 104 ? 78.167 20.854 26.343  1.00 86.98  ? 602 ARG B CB    1 
ATOM 2811 C CG    . ARG F 3 104 ? 77.588 20.330 25.028  1.00 88.30  ? 602 ARG B CG    1 
ATOM 2812 C CD    . ARG F 3 104 ? 76.133 19.893 25.149  1.00 90.32  ? 602 ARG B CD    1 
ATOM 2813 N NE    . ARG F 3 104 ? 75.753 18.957 24.090  1.00 95.71  ? 602 ARG B NE    1 
ATOM 2814 C CZ    . ARG F 3 104 ? 75.436 19.302 22.843  1.00 91.98  ? 602 ARG B CZ    1 
ATOM 2815 N NH1   . ARG F 3 104 ? 75.442 20.577 22.475  1.00 89.63  ? 602 ARG B NH1   1 
ATOM 2816 N NH2   . ARG F 3 104 ? 75.129 18.362 21.956  1.00 81.68  ? 602 ARG B NH2   1 
ATOM 2817 N N     . LYS F 3 105 ? 76.436 20.540 28.596  1.00 82.45  ? 603 LYS B N     1 
ATOM 2818 C CA    . LYS F 3 105 ? 75.186 20.413 29.347  1.00 80.41  ? 603 LYS B CA    1 
ATOM 2819 C C     . LYS F 3 105 ? 74.284 19.361 28.706  1.00 77.66  ? 603 LYS B C     1 
ATOM 2820 O O     . LYS F 3 105 ? 73.651 19.608 27.679  1.00 78.08  ? 603 LYS B O     1 
ATOM 2821 C CB    . LYS F 3 105 ? 74.479 21.775 29.423  1.00 79.22  ? 603 LYS B CB    1 
ATOM 2822 C CG    . LYS F 3 105 ? 72.999 21.740 29.790  1.00 72.42  ? 603 LYS B CG    1 
ATOM 2823 C CD    . LYS F 3 105 ? 72.425 23.150 29.865  1.00 62.03  ? 603 LYS B CD    1 
ATOM 2824 C CE    . LYS F 3 105 ? 70.909 23.139 29.799  1.00 60.04  ? 603 LYS B CE    1 
ATOM 2825 N NZ    . LYS F 3 105 ? 70.307 22.255 30.831  1.00 61.25  ? 603 LYS B NZ    1 
ATOM 2826 N N     . LYS F 3 106 ? 74.270 18.177 29.313  1.00 77.74  ? 604 LYS B N     1 
ATOM 2827 C CA    . LYS F 3 106 ? 73.485 17.044 28.832  1.00 77.55  ? 604 LYS B CA    1 
ATOM 2828 C C     . LYS F 3 106 ? 72.047 17.371 28.478  1.00 79.92  ? 604 LYS B C     1 
ATOM 2829 O O     . LYS F 3 106 ? 71.403 18.209 29.117  1.00 77.98  ? 604 LYS B O     1 
ATOM 2830 C CB    . LYS F 3 106 ? 73.493 15.908 29.859  1.00 74.97  ? 604 LYS B CB    1 
ATOM 2831 C CG    . LYS F 3 106 ? 74.354 14.716 29.477  1.00 73.06  ? 604 LYS B CG    1 
ATOM 2832 C CD    . LYS F 3 106 ? 75.826 15.091 29.398  1.00 75.78  ? 604 LYS B CD    1 
ATOM 2833 C CE    . LYS F 3 106 ? 76.684 13.901 29.004  1.00 64.66  ? 604 LYS B CE    1 
ATOM 2834 N NZ    . LYS F 3 106 ? 76.273 13.354 27.683  1.00 62.35  ? 604 LYS B NZ    1 
ATOM 2835 N N     . ARG F 3 107 ? 71.559 16.705 27.437  1.00 80.32  ? 605 ARG B N     1 
ATOM 2836 C CA    . ARG F 3 107 ? 70.190 16.890 26.997  1.00 79.40  ? 605 ARG B CA    1 
ATOM 2837 C C     . ARG F 3 107 ? 69.321 16.354 28.123  1.00 77.01  ? 605 ARG B C     1 
ATOM 2838 O O     . ARG F 3 107 ? 69.254 15.142 28.347  1.00 72.74  ? 605 ARG B O     1 
ATOM 2839 C CB    . ARG F 3 107 ? 69.930 16.115 25.702  1.00 84.55  ? 605 ARG B CB    1 
ATOM 2840 C CG    . ARG F 3 107 ? 68.535 16.332 25.153  1.00 89.72  ? 605 ARG B CG    1 
ATOM 2841 C CD    . ARG F 3 107 ? 68.337 15.744 23.765  1.00 90.39  ? 605 ARG B CD    1 
ATOM 2842 N NE    . ARG F 3 107 ? 67.011 16.106 23.272  1.00 90.90  ? 605 ARG B NE    1 
ATOM 2843 C CZ    . ARG F 3 107 ? 65.934 15.335 23.383  1.00 93.89  ? 605 ARG B CZ    1 
ATOM 2844 N NH1   . ARG F 3 107 ? 66.019 14.137 23.947  1.00 94.29  ? 605 ARG B NH1   1 
ATOM 2845 N NH2   . ARG F 3 107 ? 64.750 15.810 23.030  1.00 92.59  ? 605 ARG B NH2   1 
ATOM 2846 N N     . THR F 3 108 ? 68.717 17.272 28.872  1.00 78.07  ? 606 THR B N     1 
ATOM 2847 C CA    . THR F 3 108 ? 67.865 16.905 29.996  1.00 79.08  ? 606 THR B CA    1 
ATOM 2848 C C     . THR F 3 108 ? 66.516 16.376 29.526  1.00 75.36  ? 606 THR B C     1 
ATOM 2849 O O     . THR F 3 108 ? 65.685 17.125 29.003  1.00 70.27  ? 606 THR B O     1 
ATOM 2850 C CB    . THR F 3 108 ? 67.656 18.090 30.966  1.00 80.46  ? 606 THR B CB    1 
ATOM 2851 O OG1   . THR F 3 108 ? 67.050 19.186 30.269  1.00 91.61  ? 606 THR B OG1   1 
ATOM 2852 C CG2   . THR F 3 108 ? 68.989 18.539 31.555  1.00 74.18  ? 606 THR B CG2   1 
ATOM 2853 N N     . SER F 3 109 ? 66.324 15.070 29.695  1.00 72.51  ? 607 SER B N     1 
ATOM 2854 C CA    . SER F 3 109 ? 65.089 14.406 29.297  1.00 70.80  ? 607 SER B CA    1 
ATOM 2855 C C     . SER F 3 109 ? 63.887 14.874 30.109  1.00 71.34  ? 607 SER B C     1 
ATOM 2856 O O     . SER F 3 109 ? 63.879 14.782 31.338  1.00 76.74  ? 607 SER B O     1 
ATOM 2857 C CB    . SER F 3 109 ? 65.227 12.887 29.445  1.00 67.48  ? 607 SER B CB    1 
ATOM 2858 O OG    . SER F 3 109 ? 66.171 12.359 28.534  1.00 64.70  ? 607 SER B OG    1 
ATOM 2859 N N     . ILE F 3 110 ? 62.890 15.416 29.418  1.00 66.05  ? 608 ILE B N     1 
ATOM 2860 C CA    . ILE F 3 110 ? 61.668 15.860 30.074  1.00 70.82  ? 608 ILE B CA    1 
ATOM 2861 C C     . ILE F 3 110 ? 60.905 14.578 30.401  1.00 78.85  ? 608 ILE B C     1 
ATOM 2862 O O     . ILE F 3 110 ? 61.059 13.572 29.705  1.00 80.93  ? 608 ILE B O     1 
ATOM 2863 C CB    . ILE F 3 110 ? 60.810 16.744 29.129  1.00 64.95  ? 608 ILE B CB    1 
ATOM 2864 C CG1   . ILE F 3 110 ? 61.569 18.020 28.762  1.00 67.77  ? 608 ILE B CG1   1 
ATOM 2865 C CG2   . ILE F 3 110 ? 59.479 17.099 29.775  1.00 56.39  ? 608 ILE B CG2   1 
ATOM 2866 C CD1   . ILE F 3 110 ? 61.913 18.904 29.946  1.00 73.83  ? 608 ILE B CD1   1 
ATOM 2867 N N     . GLU F 3 111 ? 60.124 14.588 31.476  1.00 89.17  ? 609 GLU B N     1 
ATOM 2868 C CA    . GLU F 3 111 ? 59.358 13.400 31.845  1.00 95.41  ? 609 GLU B CA    1 
ATOM 2869 C C     . GLU F 3 111 ? 57.917 13.505 31.349  1.00 94.40  ? 609 GLU B C     1 
ATOM 2870 O O     . GLU F 3 111 ? 57.388 14.608 31.190  1.00 92.21  ? 609 GLU B O     1 
ATOM 2871 C CB    . GLU F 3 111 ? 59.396 13.168 33.362  1.00 95.74  ? 609 GLU B CB    1 
ATOM 2872 C CG    . GLU F 3 111 ? 60.784 12.822 33.918  1.00 91.53  ? 609 GLU B CG    1 
ATOM 2873 C CD    . GLU F 3 111 ? 61.365 11.529 33.350  1.00 81.91  ? 609 GLU B CD    1 
ATOM 2874 O OE1   . GLU F 3 111 ? 62.597 11.474 33.141  1.00 71.82  ? 609 GLU B OE1   1 
ATOM 2875 O OE2   . GLU F 3 111 ? 60.600 10.565 33.125  1.00 77.00  ? 609 GLU B OE2   1 
ATOM 2876 N N     . THR F 3 112 ? 57.308 12.351 31.074  1.00 87.67  ? 610 THR B N     1 
ATOM 2877 C CA    . THR F 3 112 ? 55.928 12.278 30.590  1.00 77.60  ? 610 THR B CA    1 
ATOM 2878 C C     . THR F 3 112 ? 54.961 13.198 31.341  1.00 75.59  ? 610 THR B C     1 
ATOM 2879 O O     . THR F 3 112 ? 54.181 13.926 30.727  1.00 72.28  ? 610 THR B O     1 
ATOM 2880 C CB    . THR F 3 112 ? 55.406 10.826 30.633  1.00 71.60  ? 610 THR B CB    1 
ATOM 2881 O OG1   . THR F 3 112 ? 56.122 10.087 31.632  1.00 70.73  ? 610 THR B OG1   1 
ATOM 2882 C CG2   . THR F 3 112 ? 55.592 10.156 29.283  1.00 62.74  ? 610 THR B CG2   1 
ATOM 2883 N N     . ASN F 3 113 ? 55.046 13.186 32.667  1.00 77.17  ? 611 ASN B N     1 
ATOM 2884 C CA    . ASN F 3 113 ? 54.197 14.022 33.517  1.00 72.55  ? 611 ASN B CA    1 
ATOM 2885 C C     . ASN F 3 113 ? 54.561 15.505 33.412  1.00 72.03  ? 611 ASN B C     1 
ATOM 2886 O O     . ASN F 3 113 ? 53.729 16.381 33.664  1.00 68.43  ? 611 ASN B O     1 
ATOM 2887 C CB    . ASN F 3 113 ? 54.304 13.560 34.977  1.00 71.39  ? 611 ASN B CB    1 
ATOM 2888 C CG    . ASN F 3 113 ? 55.746 13.388 35.434  1.00 70.98  ? 611 ASN B CG    1 
ATOM 2889 O OD1   . ASN F 3 113 ? 56.315 12.299 35.338  1.00 63.36  ? 611 ASN B OD1   1 
ATOM 2890 N ND2   . ASN F 3 113 ? 56.347 14.468 35.921  1.00 71.88  ? 611 ASN B ND2   1 
ATOM 2891 N N     . ILE F 3 114 ? 55.810 15.773 33.037  1.00 72.22  ? 612 ILE B N     1 
ATOM 2892 C CA    . ILE F 3 114 ? 56.312 17.135 32.901  1.00 73.61  ? 612 ILE B CA    1 
ATOM 2893 C C     . ILE F 3 114 ? 55.886 17.796 31.595  1.00 74.88  ? 612 ILE B C     1 
ATOM 2894 O O     . ILE F 3 114 ? 55.428 18.940 31.592  1.00 75.94  ? 612 ILE B O     1 
ATOM 2895 C CB    . ILE F 3 114 ? 57.849 17.171 32.995  1.00 69.98  ? 612 ILE B CB    1 
ATOM 2896 N N     . ARG F 3 115 ? 56.032 17.067 30.491  1.00 74.38  ? 613 ARG B N     1 
ATOM 2897 C CA    . ARG F 3 115 ? 55.676 17.580 29.173  1.00 70.93  ? 613 ARG B CA    1 
ATOM 2898 C C     . ARG F 3 115 ? 54.200 17.914 29.048  1.00 67.70  ? 613 ARG B C     1 
ATOM 2899 O O     . ARG F 3 115 ? 53.848 18.930 28.457  1.00 63.82  ? 613 ARG B O     1 
ATOM 2900 C CB    . ARG F 3 115 ? 56.078 16.591 28.080  1.00 75.62  ? 613 ARG B CB    1 
ATOM 2901 C CG    . ARG F 3 115 ? 55.204 15.349 27.977  1.00 79.58  ? 613 ARG B CG    1 
ATOM 2902 C CD    . ARG F 3 115 ? 55.608 14.514 26.780  1.00 89.32  ? 613 ARG B CD    1 
ATOM 2903 N NE    . ARG F 3 115 ? 55.854 15.362 25.617  1.00 99.78  ? 613 ARG B NE    1 
ATOM 2904 C CZ    . ARG F 3 115 ? 56.985 15.366 24.916  1.00 100.00 ? 613 ARG B CZ    1 
ATOM 2905 N NH1   . ARG F 3 115 ? 57.984 14.557 25.247  1.00 100.00 ? 613 ARG B NH1   1 
ATOM 2906 N NH2   . ARG F 3 115 ? 57.138 16.221 23.916  1.00 100.00 ? 613 ARG B NH2   1 
ATOM 2907 N N     . VAL F 3 116 ? 53.345 17.042 29.583  1.00 66.48  ? 614 VAL B N     1 
ATOM 2908 C CA    . VAL F 3 116 ? 51.899 17.249 29.546  1.00 65.49  ? 614 VAL B CA    1 
ATOM 2909 C C     . VAL F 3 116 ? 51.567 18.526 30.301  1.00 65.47  ? 614 VAL B C     1 
ATOM 2910 O O     . VAL F 3 116 ? 50.742 19.331 29.858  1.00 60.74  ? 614 VAL B O     1 
ATOM 2911 C CB    . VAL F 3 116 ? 51.133 16.063 30.181  1.00 64.23  ? 614 VAL B CB    1 
ATOM 2912 C CG1   . VAL F 3 116 ? 51.410 14.792 29.407  1.00 71.55  ? 614 VAL B CG1   1 
ATOM 2913 C CG2   . VAL F 3 116 ? 51.517 15.885 31.641  1.00 59.89  ? 614 VAL B CG2   1 
ATOM 2914 N N     . ALA F 3 117 ? 52.250 18.711 31.429  1.00 60.31  ? 615 ALA B N     1 
ATOM 2915 C CA    . ALA F 3 117 ? 52.074 19.887 32.260  1.00 55.76  ? 615 ALA B CA    1 
ATOM 2916 C C     . ALA F 3 117 ? 52.439 21.097 31.405  1.00 60.90  ? 615 ALA B C     1 
ATOM 2917 O O     . ALA F 3 117 ? 51.735 22.110 31.406  1.00 60.14  ? 615 ALA B O     1 
ATOM 2918 C CB    . ALA F 3 117 ? 52.981 19.798 33.469  1.00 47.09  ? 615 ALA B CB    1 
ATOM 2919 N N     . LEU F 3 118 ? 53.503 20.941 30.619  1.00 65.30  ? 616 LEU B N     1 
ATOM 2920 C CA    . LEU F 3 118 ? 53.990 21.992 29.732  1.00 68.32  ? 616 LEU B CA    1 
ATOM 2921 C C     . LEU F 3 118 ? 53.039 22.302 28.580  1.00 68.71  ? 616 LEU B C     1 
ATOM 2922 O O     . LEU F 3 118 ? 52.792 23.471 28.276  1.00 69.36  ? 616 LEU B O     1 
ATOM 2923 C CB    . LEU F 3 118 ? 55.374 21.628 29.194  1.00 67.55  ? 616 LEU B CB    1 
ATOM 2924 C CG    . LEU F 3 118 ? 56.506 21.811 30.207  1.00 67.22  ? 616 LEU B CG    1 
ATOM 2925 C CD1   . LEU F 3 118 ? 57.826 21.313 29.637  1.00 67.22  ? 616 LEU B CD1   1 
ATOM 2926 C CD2   . LEU F 3 118 ? 56.601 23.284 30.591  1.00 64.41  ? 616 LEU B CD2   1 
ATOM 2927 N N     . GLU F 3 119 ? 52.525 21.258 27.934  1.00 60.72  ? 617 GLU B N     1 
ATOM 2928 C CA    . GLU F 3 119 ? 51.588 21.423 26.831  1.00 54.87  ? 617 GLU B CA    1 
ATOM 2929 C C     . GLU F 3 119 ? 50.408 22.259 27.302  1.00 54.86  ? 617 GLU B C     1 
ATOM 2930 O O     . GLU F 3 119 ? 49.969 23.174 26.606  1.00 56.79  ? 617 GLU B O     1 
ATOM 2931 C CB    . GLU F 3 119 ? 51.090 20.066 26.340  1.00 57.51  ? 617 GLU B CB    1 
ATOM 2932 C CG    . GLU F 3 119 ? 51.469 19.744 24.902  1.00 65.84  ? 617 GLU B CG    1 
ATOM 2933 C CD    . GLU F 3 119 ? 52.957 19.510 24.728  1.00 73.73  ? 617 GLU B CD    1 
ATOM 2934 O OE1   . GLU F 3 119 ? 53.679 20.486 24.444  1.00 73.40  ? 617 GLU B OE1   1 
ATOM 2935 O OE2   . GLU F 3 119 ? 53.404 18.351 24.870  1.00 81.16  ? 617 GLU B OE2   1 
ATOM 2936 N N     . LYS F 3 120 ? 49.936 21.968 28.512  1.00 52.87  ? 618 LYS B N     1 
ATOM 2937 C CA    . LYS F 3 120 ? 48.814 22.690 29.105  1.00 53.19  ? 618 LYS B CA    1 
ATOM 2938 C C     . LYS F 3 120 ? 49.066 24.196 29.030  1.00 51.50  ? 618 LYS B C     1 
ATOM 2939 O O     . LYS F 3 120 ? 48.263 24.945 28.468  1.00 36.84  ? 618 LYS B O     1 
ATOM 2940 C CB    . LYS F 3 120 ? 48.621 22.253 30.556  1.00 45.31  ? 618 LYS B CB    1 
ATOM 2941 N N     . SER F 3 121 ? 50.222 24.608 29.544  1.00 55.02  ? 619 SER B N     1 
ATOM 2942 C CA    . SER F 3 121 ? 50.630 26.009 29.559  1.00 57.99  ? 619 SER B CA    1 
ATOM 2943 C C     . SER F 3 121 ? 50.928 26.565 28.164  1.00 60.36  ? 619 SER B C     1 
ATOM 2944 O O     . SER F 3 121 ? 50.679 27.742 27.887  1.00 50.60  ? 619 SER B O     1 
ATOM 2945 C CB    . SER F 3 121 ? 51.854 26.180 30.466  1.00 56.02  ? 619 SER B CB    1 
ATOM 2946 O OG    . SER F 3 121 ? 52.914 25.320 30.078  1.00 43.00  ? 619 SER B OG    1 
ATOM 2947 N N     . PHE F 3 122 ? 51.452 25.710 27.291  1.00 67.16  ? 620 PHE B N     1 
ATOM 2948 C CA    . PHE F 3 122 ? 51.796 26.099 25.929  1.00 71.95  ? 620 PHE B CA    1 
ATOM 2949 C C     . PHE F 3 122 ? 50.553 26.476 25.134  1.00 70.38  ? 620 PHE B C     1 
ATOM 2950 O O     . PHE F 3 122 ? 50.458 27.582 24.604  1.00 69.58  ? 620 PHE B O     1 
ATOM 2951 C CB    . PHE F 3 122 ? 52.549 24.964 25.233  1.00 79.58  ? 620 PHE B CB    1 
ATOM 2952 C CG    . PHE F 3 122 ? 52.916 25.264 23.808  1.00 93.74  ? 620 PHE B CG    1 
ATOM 2953 C CD1   . PHE F 3 122 ? 52.137 24.780 22.759  1.00 98.95  ? 620 PHE B CD1   1 
ATOM 2954 C CD2   . PHE F 3 122 ? 54.035 26.036 23.513  1.00 97.74  ? 620 PHE B CD2   1 
ATOM 2955 C CE1   . PHE F 3 122 ? 52.466 25.060 21.438  1.00 99.61  ? 620 PHE B CE1   1 
ATOM 2956 C CE2   . PHE F 3 122 ? 54.373 26.323 22.193  1.00 100.00 ? 620 PHE B CE2   1 
ATOM 2957 C CZ    . PHE F 3 122 ? 53.586 25.834 21.154  1.00 100.00 ? 620 PHE B CZ    1 
ATOM 2958 N N     . LEU F 3 123 ? 49.604 25.549 25.052  1.00 68.26  ? 621 LEU B N     1 
ATOM 2959 C CA    . LEU F 3 123 ? 48.364 25.793 24.331  1.00 70.68  ? 621 LEU B CA    1 
ATOM 2960 C C     . LEU F 3 123 ? 47.487 26.770 25.109  1.00 71.61  ? 621 LEU B C     1 
ATOM 2961 O O     . LEU F 3 123 ? 46.422 27.177 24.640  1.00 70.35  ? 621 LEU B O     1 
ATOM 2962 C CB    . LEU F 3 123 ? 47.642 24.473 24.035  1.00 72.49  ? 621 LEU B CB    1 
ATOM 2963 C CG    . LEU F 3 123 ? 48.358 23.594 22.991  1.00 69.95  ? 621 LEU B CG    1 
ATOM 2964 C CD1   . LEU F 3 123 ? 47.793 22.186 22.983  1.00 63.08  ? 621 LEU B CD1   1 
ATOM 2965 C CD2   . LEU F 3 123 ? 48.260 24.222 21.602  1.00 68.20  ? 621 LEU B CD2   1 
ATOM 2966 N N     . GLU F 3 124 ? 47.952 27.132 26.305  1.00 75.30  ? 622 GLU B N     1 
ATOM 2967 C CA    . GLU F 3 124 ? 47.279 28.102 27.166  1.00 79.45  ? 622 GLU B CA    1 
ATOM 2968 C C     . GLU F 3 124 ? 47.621 29.463 26.561  1.00 76.26  ? 622 GLU B C     1 
ATOM 2969 O O     . GLU F 3 124 ? 46.781 30.357 26.479  1.00 71.22  ? 622 GLU B O     1 
ATOM 2970 C CB    . GLU F 3 124 ? 47.841 28.002 28.588  1.00 84.68  ? 622 GLU B CB    1 
ATOM 2971 C CG    . GLU F 3 124 ? 47.330 29.036 29.587  1.00 94.97  ? 622 GLU B CG    1 
ATOM 2972 C CD    . GLU F 3 124 ? 47.957 28.877 30.971  1.00 100.00 ? 622 GLU B CD    1 
ATOM 2973 O OE1   . GLU F 3 124 ? 48.159 27.724 31.414  1.00 100.00 ? 622 GLU B OE1   1 
ATOM 2974 O OE2   . GLU F 3 124 ? 48.249 29.906 31.619  1.00 100.00 ? 622 GLU B OE2   1 
ATOM 2975 N N     . ASN F 3 125 ? 48.868 29.572 26.112  1.00 74.10  ? 623 ASN B N     1 
ATOM 2976 C CA    . ASN F 3 125 ? 49.420 30.764 25.480  1.00 74.82  ? 623 ASN B CA    1 
ATOM 2977 C C     . ASN F 3 125 ? 50.866 30.420 25.159  1.00 77.36  ? 623 ASN B C     1 
ATOM 2978 O O     . ASN F 3 125 ? 51.557 29.818 25.983  1.00 77.59  ? 623 ASN B O     1 
ATOM 2979 C CB    . ASN F 3 125 ? 49.367 31.967 26.422  1.00 75.33  ? 623 ASN B CB    1 
ATOM 2980 C CG    . ASN F 3 125 ? 50.065 33.187 25.847  1.00 73.37  ? 623 ASN B CG    1 
ATOM 2981 O OD1   . ASN F 3 125 ? 50.120 33.373 24.631  1.00 75.50  ? 623 ASN B OD1   1 
ATOM 2982 N ND2   . ASN F 3 125 ? 50.616 34.015 26.722  1.00 66.09  ? 623 ASN B ND2   1 
ATOM 2983 N N     . GLN F 3 126 ? 51.322 30.773 23.963  1.00 79.58  ? 624 GLN B N     1 
ATOM 2984 C CA    . GLN F 3 126 ? 52.693 30.460 23.573  1.00 83.86  ? 624 GLN B CA    1 
ATOM 2985 C C     . GLN F 3 126 ? 53.670 31.635 23.519  1.00 86.39  ? 624 GLN B C     1 
ATOM 2986 O O     . GLN F 3 126 ? 54.823 31.474 23.118  1.00 88.48  ? 624 GLN B O     1 
ATOM 2987 C CB    . GLN F 3 126 ? 52.706 29.667 22.262  1.00 84.14  ? 624 GLN B CB    1 
ATOM 2988 C CG    . GLN F 3 126 ? 51.721 30.160 21.216  1.00 87.17  ? 624 GLN B CG    1 
ATOM 2989 C CD    . GLN F 3 126 ? 51.433 29.107 20.158  1.00 82.09  ? 624 GLN B CD    1 
ATOM 2990 O OE1   . GLN F 3 126 ? 50.948 28.024 20.472  1.00 76.27  ? 624 GLN B OE1   1 
ATOM 2991 N NE2   . GLN F 3 126 ? 51.725 29.419 18.901  1.00 81.50  ? 624 GLN B NE2   1 
ATOM 2992 N N     . LYS F 3 127 ? 53.229 32.810 23.953  1.00 86.98  ? 625 LYS B N     1 
ATOM 2993 C CA    . LYS F 3 127 ? 54.111 33.971 23.955  1.00 85.92  ? 625 LYS B CA    1 
ATOM 2994 C C     . LYS F 3 127 ? 54.147 34.632 25.341  1.00 83.29  ? 625 LYS B C     1 
ATOM 2995 O O     . LYS F 3 127 ? 53.913 35.831 25.467  1.00 85.14  ? 625 LYS B O     1 
ATOM 2996 C CB    . LYS F 3 127 ? 53.677 34.984 22.881  1.00 83.15  ? 625 LYS B CB    1 
ATOM 2997 N N     . THR F 3 129 ? 56.241 35.961 29.150  1.00 98.44  ? 627 THR B N     1 
ATOM 2998 C CA    . THR F 3 129 ? 57.285 36.907 29.476  1.00 99.08  ? 627 THR B CA    1 
ATOM 2999 C C     . THR F 3 129 ? 58.153 36.312 30.594  1.00 97.91  ? 627 THR B C     1 
ATOM 3000 O O     . THR F 3 129 ? 57.787 35.281 31.173  1.00 92.09  ? 627 THR B O     1 
ATOM 3001 C CB    . THR F 3 129 ? 56.654 38.255 29.913  1.00 98.57  ? 627 THR B CB    1 
ATOM 3002 O OG1   . THR F 3 129 ? 55.711 38.681 28.925  1.00 95.71  ? 627 THR B OG1   1 
ATOM 3003 C CG2   . THR F 3 129 ? 57.714 39.349 30.080  1.00 100.00 ? 627 THR B CG2   1 
ATOM 3004 N N     . SER F 3 130 ? 59.295 36.935 30.902  1.00 96.95  ? 628 SER B N     1 
ATOM 3005 C CA    . SER F 3 130 ? 60.205 36.382 31.915  1.00 97.21  ? 628 SER B CA    1 
ATOM 3006 C C     . SER F 3 130 ? 59.524 36.326 33.276  1.00 100.00 ? 628 SER B C     1 
ATOM 3007 O O     . SER F 3 130 ? 59.983 35.625 34.179  1.00 98.06  ? 628 SER B O     1 
ATOM 3008 C CB    . SER F 3 130 ? 61.484 37.211 32.016  1.00 95.31  ? 628 SER B CB    1 
ATOM 3009 O OG    . SER F 3 130 ? 62.428 36.578 32.878  1.00 96.57  ? 628 SER B OG    1 
ATOM 3010 N N     . GLU F 3 131 ? 58.439 37.090 33.420  1.00 100.00 ? 629 GLU B N     1 
ATOM 3011 C CA    . GLU F 3 131 ? 57.657 37.114 34.657  1.00 100.00 ? 629 GLU B CA    1 
ATOM 3012 C C     . GLU F 3 131 ? 57.037 35.725 34.749  1.00 100.00 ? 629 GLU B C     1 
ATOM 3013 O O     . GLU F 3 131 ? 56.849 35.192 35.841  1.00 100.00 ? 629 GLU B O     1 
ATOM 3014 C CB    . GLU F 3 131 ? 56.559 38.180 34.583  1.00 98.06  ? 629 GLU B CB    1 
ATOM 3015 N N     . GLU F 3 132 ? 56.695 35.175 33.581  1.00 96.77  ? 630 GLU B N     1 
ATOM 3016 C CA    . GLU F 3 132 ? 56.154 33.824 33.460  1.00 90.37  ? 630 GLU B CA    1 
ATOM 3017 C C     . GLU F 3 132 ? 57.366 32.920 33.221  1.00 90.47  ? 630 GLU B C     1 
ATOM 3018 O O     . GLU F 3 132 ? 58.499 33.402 33.180  1.00 91.14  ? 630 GLU B O     1 
ATOM 3019 C CB    . GLU F 3 132 ? 55.200 33.724 32.264  1.00 83.97  ? 630 GLU B CB    1 
ATOM 3020 C CG    . GLU F 3 132 ? 53.917 34.538 32.372  1.00 74.19  ? 630 GLU B CG    1 
ATOM 3021 C CD    . GLU F 3 132 ? 54.068 35.958 31.863  1.00 76.15  ? 630 GLU B CD    1 
ATOM 3022 O OE1   . GLU F 3 132 ? 54.716 36.776 32.542  1.00 72.40  ? 630 GLU B OE1   1 
ATOM 3023 O OE2   . GLU F 3 132 ? 53.526 36.262 30.781  1.00 80.91  ? 630 GLU B OE2   1 
ATOM 3024 N N     . ILE F 3 133 ? 57.127 31.622 33.043  1.00 95.46  ? 631 ILE B N     1 
ATOM 3025 C CA    . ILE F 3 133 ? 58.199 30.641 32.815  1.00 100.00 ? 631 ILE B CA    1 
ATOM 3026 C C     . ILE F 3 133 ? 59.061 30.463 34.068  1.00 100.00 ? 631 ILE B C     1 
ATOM 3027 O O     . ILE F 3 133 ? 60.046 29.720 34.073  1.00 100.00 ? 631 ILE B O     1 
ATOM 3028 C CB    . ILE F 3 133 ? 59.111 31.035 31.621  1.00 100.00 ? 631 ILE B CB    1 
ATOM 3029 N N     . THR F 3 134 ? 58.659 31.149 35.129  1.00 100.00 ? 632 THR B N     1 
ATOM 3030 C CA    . THR F 3 134 ? 59.347 31.113 36.407  1.00 97.74  ? 632 THR B CA    1 
ATOM 3031 C C     . THR F 3 134 ? 58.375 30.478 37.388  1.00 94.77  ? 632 THR B C     1 
ATOM 3032 O O     . THR F 3 134 ? 58.723 29.556 38.129  1.00 87.94  ? 632 THR B O     1 
ATOM 3033 C CB    . THR F 3 134 ? 59.708 32.539 36.864  1.00 100.00 ? 632 THR B CB    1 
ATOM 3034 O OG1   . THR F 3 134 ? 58.566 33.397 36.732  1.00 100.00 ? 632 THR B OG1   1 
ATOM 3035 C CG2   . THR F 3 134 ? 60.839 33.097 36.022  1.00 100.00 ? 632 THR B CG2   1 
ATOM 3036 N N     . MET F 3 135 ? 57.138 30.968 37.354  1.00 97.69  ? 633 MET B N     1 
ATOM 3037 C CA    . MET F 3 135 ? 56.070 30.441 38.193  1.00 98.53  ? 633 MET B CA    1 
ATOM 3038 C C     . MET F 3 135 ? 55.974 28.995 37.725  1.00 96.19  ? 633 MET B C     1 
ATOM 3039 O O     . MET F 3 135 ? 55.715 28.087 38.508  1.00 99.07  ? 633 MET B O     1 
ATOM 3040 C CB    . MET F 3 135 ? 54.747 31.170 37.895  1.00 100.00 ? 633 MET B CB    1 
ATOM 3041 C CG    . MET F 3 135 ? 54.903 32.657 37.556  1.00 100.00 ? 633 MET B CG    1 
ATOM 3042 S SD    . MET F 3 135 ? 53.358 33.591 37.417  1.00 100.00 ? 633 MET B SD    1 
ATOM 3043 C CE    . MET F 3 135 ? 53.626 34.861 38.657  1.00 96.33  ? 633 MET B CE    1 
ATOM 3044 N N     . ILE F 3 136 ? 56.313 28.813 36.450  1.00 89.84  ? 634 ILE B N     1 
ATOM 3045 C CA    . ILE F 3 136 ? 56.298 27.534 35.759  1.00 86.73  ? 634 ILE B CA    1 
ATOM 3046 C C     . ILE F 3 136 ? 57.574 26.705 35.963  1.00 88.06  ? 634 ILE B C     1 
ATOM 3047 O O     . ILE F 3 136 ? 57.504 25.481 36.063  1.00 92.70  ? 634 ILE B O     1 
ATOM 3048 C CB    . ILE F 3 136 ? 56.076 27.765 34.250  1.00 82.09  ? 634 ILE B CB    1 
ATOM 3049 C CG1   . ILE F 3 136 ? 54.911 28.743 34.047  1.00 75.35  ? 634 ILE B CG1   1 
ATOM 3050 C CG2   . ILE F 3 136 ? 55.803 26.443 33.543  1.00 75.37  ? 634 ILE B CG2   1 
ATOM 3051 C CD1   . ILE F 3 136 ? 54.738 29.228 32.624  1.00 73.16  ? 634 ILE B CD1   1 
ATOM 3052 N N     . ALA F 3 137 ? 58.734 27.358 36.009  1.00 85.28  ? 635 ALA B N     1 
ATOM 3053 C CA    . ALA F 3 137 ? 60.008 26.655 36.196  1.00 85.31  ? 635 ALA B CA    1 
ATOM 3054 C C     . ALA F 3 137 ? 60.073 25.973 37.561  1.00 84.56  ? 635 ALA B C     1 
ATOM 3055 O O     . ALA F 3 137 ? 60.264 24.758 37.663  1.00 74.62  ? 635 ALA B O     1 
ATOM 3056 C CB    . ALA F 3 137 ? 61.167 27.628 36.042  1.00 85.70  ? 635 ALA B CB    1 
ATOM 3057 N N     . ASP F 3 138 ? 59.916 26.784 38.602  1.00 90.51  ? 636 ASP B N     1 
ATOM 3058 C CA    . ASP F 3 138 ? 59.929 26.322 39.985  1.00 95.52  ? 636 ASP B CA    1 
ATOM 3059 C C     . ASP F 3 138 ? 58.747 25.380 40.194  1.00 95.11  ? 636 ASP B C     1 
ATOM 3060 O O     . ASP F 3 138 ? 58.767 24.517 41.076  1.00 100.00 ? 636 ASP B O     1 
ATOM 3061 C CB    . ASP F 3 138 ? 59.809 27.532 40.923  1.00 98.03  ? 636 ASP B CB    1 
ATOM 3062 C CG    . ASP F 3 138 ? 59.874 27.153 42.394  1.00 100.00 ? 636 ASP B CG    1 
ATOM 3063 O OD1   . ASP F 3 138 ? 60.990 27.129 42.957  1.00 100.00 ? 636 ASP B OD1   1 
ATOM 3064 O OD2   . ASP F 3 138 ? 58.806 26.893 42.992  1.00 98.30  ? 636 ASP B OD2   1 
ATOM 3065 N N     . GLN F 3 139 ? 57.733 25.546 39.351  1.00 88.85  ? 637 GLN B N     1 
ATOM 3066 C CA    . GLN F 3 139 ? 56.518 24.747 39.401  1.00 88.30  ? 637 GLN B CA    1 
ATOM 3067 C C     . GLN F 3 139 ? 56.813 23.253 39.307  1.00 93.92  ? 637 GLN B C     1 
ATOM 3068 O O     . GLN F 3 139 ? 56.194 22.447 40.004  1.00 98.38  ? 637 GLN B O     1 
ATOM 3069 C CB    . GLN F 3 139 ? 55.603 25.150 38.241  1.00 83.67  ? 637 GLN B CB    1 
ATOM 3070 C CG    . GLN F 3 139 ? 54.132 24.909 38.465  1.00 78.04  ? 637 GLN B CG    1 
ATOM 3071 C CD    . GLN F 3 139 ? 53.595 25.739 39.601  1.00 73.71  ? 637 GLN B CD    1 
ATOM 3072 O OE1   . GLN F 3 139 ? 53.270 25.211 40.661  1.00 82.80  ? 637 GLN B OE1   1 
ATOM 3073 N NE2   . GLN F 3 139 ? 53.513 27.050 39.397  1.00 68.15  ? 637 GLN B NE2   1 
ATOM 3074 N N     . LEU F 3 140 ? 57.767 22.896 38.450  1.00 95.01  ? 638 LEU B N     1 
ATOM 3075 C CA    . LEU F 3 140 ? 58.132 21.498 38.239  1.00 96.83  ? 638 LEU B CA    1 
ATOM 3076 C C     . LEU F 3 140 ? 59.397 21.066 38.970  1.00 98.49  ? 638 LEU B C     1 
ATOM 3077 O O     . LEU F 3 140 ? 59.683 19.865 39.055  1.00 97.46  ? 638 LEU B O     1 
ATOM 3078 C CB    . LEU F 3 140 ? 58.301 21.210 36.743  1.00 97.00  ? 638 LEU B CB    1 
ATOM 3079 C CG    . LEU F 3 140 ? 57.076 21.100 35.832  1.00 97.06  ? 638 LEU B CG    1 
ATOM 3080 C CD1   . LEU F 3 140 ? 56.329 22.421 35.742  1.00 99.09  ? 638 LEU B CD1   1 
ATOM 3081 C CD2   . LEU F 3 140 ? 57.524 20.658 34.448  1.00 94.84  ? 638 LEU B CD2   1 
ATOM 3082 N N     . ASN F 3 141 ? 60.151 22.038 39.479  1.00 99.97  ? 639 ASN B N     1 
ATOM 3083 C CA    . ASN F 3 141 ? 61.400 21.764 40.183  1.00 99.34  ? 639 ASN B CA    1 
ATOM 3084 C C     . ASN F 3 141 ? 62.394 21.222 39.167  1.00 100.00 ? 639 ASN B C     1 
ATOM 3085 O O     . ASN F 3 141 ? 63.300 20.441 39.493  1.00 100.00 ? 639 ASN B O     1 
ATOM 3086 C CB    . ASN F 3 141 ? 61.194 20.756 41.324  1.00 100.00 ? 639 ASN B CB    1 
ATOM 3087 C CG    . ASN F 3 141 ? 60.590 21.400 42.567  1.00 100.00 ? 639 ASN B CG    1 
ATOM 3088 O OD1   . ASN F 3 141 ? 59.587 20.928 43.100  1.00 100.00 ? 639 ASN B OD1   1 
ATOM 3089 N ND2   . ASN F 3 141 ? 61.221 22.458 43.054  1.00 97.13  ? 639 ASN B ND2   1 
ATOM 3090 N N     . MET F 3 142 ? 62.130 21.616 37.929  1.00 100.00 ? 640 MET B N     1 
ATOM 3091 C CA    . MET F 3 142 ? 63.010 21.201 36.852  1.00 100.00 ? 640 MET B CA    1 
ATOM 3092 C C     . MET F 3 142 ? 64.181 22.162 36.840  1.00 98.15  ? 640 MET B C     1 
ATOM 3093 O O     . MET F 3 142 ? 65.229 21.874 37.397  1.00 100.00 ? 640 MET B O     1 
ATOM 3094 C CB    . MET F 3 142 ? 62.280 21.249 35.510  1.00 99.80  ? 640 MET B CB    1 
ATOM 3095 C CG    . MET F 3 142 ? 61.336 20.085 35.288  1.00 100.00 ? 640 MET B CG    1 
ATOM 3096 S SD    . MET F 3 142 ? 62.201 18.526 35.506  1.00 100.00 ? 640 MET B SD    1 
ATOM 3097 C CE    . MET F 3 142 ? 62.691 18.162 33.819  1.00 92.53  ? 640 MET B CE    1 
ATOM 3098 N N     . GLU F 3 143 ? 64.050 23.311 36.194  1.00 96.55  ? 641 GLU B N     1 
ATOM 3099 C CA    . GLU F 3 143 ? 65.119 24.308 36.149  1.00 96.65  ? 641 GLU B CA    1 
ATOM 3100 C C     . GLU F 3 143 ? 64.516 25.598 35.598  1.00 93.06  ? 641 GLU B C     1 
ATOM 3101 O O     . GLU F 3 143 ? 63.307 25.644 35.351  1.00 93.63  ? 641 GLU B O     1 
ATOM 3102 C CB    . GLU F 3 143 ? 66.263 23.772 35.262  1.00 99.44  ? 641 GLU B CB    1 
ATOM 3103 C CG    . GLU F 3 143 ? 67.578 24.555 35.283  1.00 100.00 ? 641 GLU B CG    1 
ATOM 3104 C CD    . GLU F 3 143 ? 68.649 23.884 34.437  1.00 100.00 ? 641 GLU B CD    1 
ATOM 3105 O OE1   . GLU F 3 143 ? 69.371 24.601 33.705  1.00 100.00 ? 641 GLU B OE1   1 
ATOM 3106 O OE2   . GLU F 3 143 ? 68.769 22.633 34.499  1.00 100.00 ? 641 GLU B OE2   1 
ATOM 3107 N N     . LYS F 3 144 ? 65.302 26.661 35.488  1.00 89.06  ? 642 LYS B N     1 
ATOM 3108 C CA    . LYS F 3 144 ? 64.801 27.896 34.892  1.00 92.44  ? 642 LYS B CA    1 
ATOM 3109 C C     . LYS F 3 144 ? 65.049 28.020 33.381  1.00 94.96  ? 642 LYS B C     1 
ATOM 3110 O O     . LYS F 3 144 ? 64.147 28.418 32.613  1.00 90.46  ? 642 LYS B O     1 
ATOM 3111 C CB    . LYS F 3 144 ? 65.476 29.039 35.672  1.00 92.38  ? 642 LYS B CB    1 
ATOM 3112 C CG    . LYS F 3 144 ? 65.076 30.454 35.162  1.00 99.00  ? 642 LYS B CG    1 
ATOM 3113 C CD    . LYS F 3 144 ? 63.538 30.664 35.107  1.00 100.00 ? 642 LYS B CD    1 
ATOM 3114 C CE    . LYS F 3 144 ? 63.196 31.805 34.141  1.00 98.37  ? 642 LYS B CE    1 
ATOM 3115 N NZ    . LYS F 3 144 ? 63.795 31.487 32.824  1.00 88.19  ? 642 LYS B NZ    1 
ATOM 3116 N N     . GLU F 3 145 ? 66.272 27.715 32.944  1.00 97.62  ? 643 GLU B N     1 
ATOM 3117 C CA    . GLU F 3 145 ? 66.615 27.856 31.511  1.00 95.52  ? 643 GLU B CA    1 
ATOM 3118 C C     . GLU F 3 145 ? 66.104 26.766 30.564  1.00 94.83  ? 643 GLU B C     1 
ATOM 3119 O O     . GLU F 3 145 ? 65.625 27.059 29.466  1.00 98.19  ? 643 GLU B O     1 
ATOM 3120 C CB    . GLU F 3 145 ? 68.127 28.045 31.300  1.00 96.35  ? 643 GLU B CB    1 
ATOM 3121 C CG    . GLU F 3 145 ? 68.933 26.750 31.143  1.00 100.00 ? 643 GLU B CG    1 
ATOM 3122 C CD    . GLU F 3 145 ? 69.584 26.603 29.774  1.00 98.55  ? 643 GLU B CD    1 
ATOM 3123 O OE1   . GLU F 3 145 ? 68.893 26.182 28.823  1.00 93.91  ? 643 GLU B OE1   1 
ATOM 3124 O OE2   . GLU F 3 145 ? 70.789 26.911 29.649  1.00 93.99  ? 643 GLU B OE2   1 
ATOM 3125 N N     . VAL F 3 146 ? 66.220 25.515 30.997  1.00 91.19  ? 644 VAL B N     1 
ATOM 3126 C CA    . VAL F 3 146 ? 65.768 24.385 30.197  1.00 87.65  ? 644 VAL B CA    1 
ATOM 3127 C C     . VAL F 3 146 ? 64.291 24.568 29.810  1.00 83.48  ? 644 VAL B C     1 
ATOM 3128 O O     . VAL F 3 146 ? 63.803 23.972 28.846  1.00 86.18  ? 644 VAL B O     1 
ATOM 3129 C CB    . VAL F 3 146 ? 65.962 23.041 30.958  1.00 85.89  ? 644 VAL B CB    1 
ATOM 3130 C CG1   . VAL F 3 146 ? 65.129 23.022 32.220  1.00 84.08  ? 644 VAL B CG1   1 
ATOM 3131 C CG2   . VAL F 3 146 ? 65.621 21.846 30.069  1.00 85.35  ? 644 VAL B CG2   1 
ATOM 3132 N N     . ILE F 3 147 ? 63.613 25.445 30.547  1.00 75.80  ? 645 ILE B N     1 
ATOM 3133 C CA    . ILE F 3 147 ? 62.211 25.747 30.320  1.00 71.59  ? 645 ILE B CA    1 
ATOM 3134 C C     . ILE F 3 147 ? 61.985 26.822 29.259  1.00 69.58  ? 645 ILE B C     1 
ATOM 3135 O O     . ILE F 3 147 ? 61.106 26.671 28.413  1.00 75.13  ? 645 ILE B O     1 
ATOM 3136 C CB    . ILE F 3 147 ? 61.499 26.102 31.651  1.00 71.44  ? 645 ILE B CB    1 
ATOM 3137 C CG1   . ILE F 3 147 ? 60.649 24.914 32.112  1.00 66.56  ? 645 ILE B CG1   1 
ATOM 3138 C CG2   . ILE F 3 147 ? 60.627 27.351 31.510  1.00 69.78  ? 645 ILE B CG2   1 
ATOM 3139 C CD1   . ILE F 3 147 ? 61.414 23.612 32.266  1.00 53.90  ? 645 ILE B CD1   1 
ATOM 3140 N N     . ARG F 3 148 ? 62.758 27.907 29.303  1.00 67.10  ? 646 ARG B N     1 
ATOM 3141 C CA    . ARG F 3 148 ? 62.604 28.972 28.311  1.00 66.76  ? 646 ARG B CA    1 
ATOM 3142 C C     . ARG F 3 148 ? 62.949 28.416 26.927  1.00 67.06  ? 646 ARG B C     1 
ATOM 3143 O O     . ARG F 3 148 ? 62.453 28.898 25.906  1.00 64.47  ? 646 ARG B O     1 
ATOM 3144 C CB    . ARG F 3 148 ? 63.517 30.159 28.632  1.00 66.10  ? 646 ARG B CB    1 
ATOM 3145 C CG    . ARG F 3 148 ? 64.998 29.841 28.542  1.00 64.66  ? 646 ARG B CG    1 
ATOM 3146 C CD    . ARG F 3 148 ? 65.773 30.929 27.812  1.00 63.32  ? 646 ARG B CD    1 
ATOM 3147 N NE    . ARG F 3 148 ? 67.190 30.591 27.688  1.00 52.77  ? 646 ARG B NE    1 
ATOM 3148 C CZ    . ARG F 3 148 ? 68.035 30.522 28.714  1.00 51.21  ? 646 ARG B CZ    1 
ATOM 3149 N NH1   . ARG F 3 148 ? 67.614 30.775 29.947  1.00 39.90  ? 646 ARG B NH1   1 
ATOM 3150 N NH2   . ARG F 3 148 ? 69.299 30.171 28.511  1.00 54.53  ? 646 ARG B NH2   1 
ATOM 3151 N N     . VAL F 3 149 ? 63.807 27.395 26.922  1.00 64.34  ? 647 VAL B N     1 
ATOM 3152 C CA    . VAL F 3 149 ? 64.257 26.721 25.708  1.00 61.05  ? 647 VAL B CA    1 
ATOM 3153 C C     . VAL F 3 149 ? 63.130 25.922 25.062  1.00 62.72  ? 647 VAL B C     1 
ATOM 3154 O O     . VAL F 3 149 ? 62.808 26.133 23.896  1.00 68.71  ? 647 VAL B O     1 
ATOM 3155 C CB    . VAL F 3 149 ? 65.438 25.774 26.019  1.00 56.39  ? 647 VAL B CB    1 
ATOM 3156 C CG1   . VAL F 3 149 ? 65.742 24.878 24.827  1.00 54.17  ? 647 VAL B CG1   1 
ATOM 3157 C CG2   . VAL F 3 149 ? 66.660 26.585 26.395  1.00 50.33  ? 647 VAL B CG2   1 
ATOM 3158 N N     . TRP F 3 150 ? 62.558 24.990 25.822  1.00 62.26  ? 648 TRP B N     1 
ATOM 3159 C CA    . TRP F 3 150 ? 61.457 24.151 25.350  1.00 63.35  ? 648 TRP B CA    1 
ATOM 3160 C C     . TRP F 3 150 ? 60.386 25.023 24.702  1.00 59.47  ? 648 TRP B C     1 
ATOM 3161 O O     . TRP F 3 150 ? 59.891 24.719 23.618  1.00 61.42  ? 648 TRP B O     1 
ATOM 3162 C CB    . TRP F 3 150 ? 60.859 23.376 26.534  1.00 69.23  ? 648 TRP B CB    1 
ATOM 3163 C CG    . TRP F 3 150 ? 59.626 22.556 26.225  1.00 72.09  ? 648 TRP B CG    1 
ATOM 3164 C CD1   . TRP F 3 150 ? 59.571 21.208 25.999  1.00 71.82  ? 648 TRP B CD1   1 
ATOM 3165 C CD2   . TRP F 3 150 ? 58.270 23.026 26.163  1.00 71.33  ? 648 TRP B CD2   1 
ATOM 3166 N NE1   . TRP F 3 150 ? 58.270 20.811 25.807  1.00 67.41  ? 648 TRP B NE1   1 
ATOM 3167 C CE2   . TRP F 3 150 ? 57.450 21.906 25.902  1.00 68.74  ? 648 TRP B CE2   1 
ATOM 3168 C CE3   . TRP F 3 150 ? 57.668 24.286 26.305  1.00 72.29  ? 648 TRP B CE3   1 
ATOM 3169 C CZ2   . TRP F 3 150 ? 56.059 22.006 25.781  1.00 71.35  ? 648 TRP B CZ2   1 
ATOM 3170 C CZ3   . TRP F 3 150 ? 56.283 24.387 26.182  1.00 74.32  ? 648 TRP B CZ3   1 
ATOM 3171 C CH2   . TRP F 3 150 ? 55.496 23.252 25.923  1.00 74.18  ? 648 TRP B CH2   1 
ATOM 3172 N N     . PHE F 3 151 ? 60.049 26.115 25.379  1.00 50.55  ? 649 PHE B N     1 
ATOM 3173 C CA    . PHE F 3 151 ? 59.053 27.052 24.896  1.00 54.82  ? 649 PHE B CA    1 
ATOM 3174 C C     . PHE F 3 151 ? 59.482 27.574 23.527  1.00 57.64  ? 649 PHE B C     1 
ATOM 3175 O O     . PHE F 3 151 ? 58.706 27.544 22.575  1.00 57.86  ? 649 PHE B O     1 
ATOM 3176 C CB    . PHE F 3 151 ? 58.912 28.210 25.889  1.00 67.16  ? 649 PHE B CB    1 
ATOM 3177 C CG    . PHE F 3 151 ? 57.496 28.688 26.075  1.00 77.62  ? 649 PHE B CG    1 
ATOM 3178 C CD1   . PHE F 3 151 ? 56.746 29.133 24.992  1.00 84.07  ? 649 PHE B CD1   1 
ATOM 3179 C CD2   . PHE F 3 151 ? 56.910 28.694 27.337  1.00 81.36  ? 649 PHE B CD2   1 
ATOM 3180 C CE1   . PHE F 3 151 ? 55.437 29.574 25.162  1.00 85.05  ? 649 PHE B CE1   1 
ATOM 3181 C CE2   . PHE F 3 151 ? 55.595 29.136 27.515  1.00 83.29  ? 649 PHE B CE2   1 
ATOM 3182 C CZ    . PHE F 3 151 ? 54.859 29.577 26.424  1.00 85.44  ? 649 PHE B CZ    1 
ATOM 3183 N N     . CYS F 3 152 ? 60.733 28.020 23.431  1.00 64.24  ? 650 CYS B N     1 
ATOM 3184 C CA    . CYS F 3 152 ? 61.277 28.542 22.178  1.00 67.69  ? 650 CYS B CA    1 
ATOM 3185 C C     . CYS F 3 152 ? 61.273 27.526 21.047  1.00 66.70  ? 650 CYS B C     1 
ATOM 3186 O O     . CYS F 3 152 ? 60.981 27.872 19.906  1.00 66.43  ? 650 CYS B O     1 
ATOM 3187 C CB    . CYS F 3 152 ? 62.700 29.071 22.379  1.00 71.02  ? 650 CYS B CB    1 
ATOM 3188 S SG    . CYS F 3 152 ? 62.794 30.805 22.876  1.00 78.74  ? 650 CYS B SG    1 
ATOM 3189 N N     . ASN F 3 153 ? 61.594 26.277 21.374  1.00 67.85  ? 651 ASN B N     1 
ATOM 3190 C CA    . ASN F 3 153 ? 61.637 25.204 20.388  1.00 72.66  ? 651 ASN B CA    1 
ATOM 3191 C C     . ASN F 3 153 ? 60.281 24.557 20.135  1.00 77.02  ? 651 ASN B C     1 
ATOM 3192 O O     . ASN F 3 153 ? 60.153 23.696 19.262  1.00 83.93  ? 651 ASN B O     1 
ATOM 3193 C CB    . ASN F 3 153 ? 62.655 24.141 20.798  1.00 71.21  ? 651 ASN B CB    1 
ATOM 3194 C CG    . ASN F 3 153 ? 64.083 24.623 20.660  1.00 73.29  ? 651 ASN B CG    1 
ATOM 3195 O OD1   . ASN F 3 153 ? 64.365 25.569 19.921  1.00 68.47  ? 651 ASN B OD1   1 
ATOM 3196 N ND2   . ASN F 3 153 ? 64.996 23.967 21.364  1.00 79.09  ? 651 ASN B ND2   1 
ATOM 3197 N N     . ARG F 3 154 ? 59.283 24.949 20.921  1.00 71.80  ? 652 ARG B N     1 
ATOM 3198 C CA    . ARG F 3 154 ? 57.936 24.422 20.761  1.00 69.37  ? 652 ARG B CA    1 
ATOM 3199 C C     . ARG F 3 154 ? 57.162 25.437 19.941  1.00 64.75  ? 652 ARG B C     1 
ATOM 3200 O O     . ARG F 3 154 ? 56.250 25.092 19.194  1.00 65.49  ? 652 ARG B O     1 
ATOM 3201 C CB    . ARG F 3 154 ? 57.271 24.226 22.120  1.00 78.61  ? 652 ARG B CB    1 
ATOM 3202 C CG    . ARG F 3 154 ? 56.497 22.932 22.227  1.00 86.82  ? 652 ARG B CG    1 
ATOM 3203 C CD    . ARG F 3 154 ? 57.410 21.756 21.924  1.00 94.68  ? 652 ARG B CD    1 
ATOM 3204 N NE    . ARG F 3 154 ? 56.768 20.472 22.189  1.00 100.00 ? 652 ARG B NE    1 
ATOM 3205 C CZ    . ARG F 3 154 ? 57.274 19.293 21.837  1.00 100.00 ? 652 ARG B CZ    1 
ATOM 3206 N NH1   . ARG F 3 154 ? 58.435 19.223 21.194  1.00 99.06  ? 652 ARG B NH1   1 
ATOM 3207 N NH2   . ARG F 3 154 ? 56.621 18.181 22.144  1.00 97.58  ? 652 ARG B NH2   1 
ATOM 3208 N N     . ARG F 3 155 ? 57.556 26.696 20.095  1.00 62.16  ? 653 ARG B N     1 
ATOM 3209 C CA    . ARG F 3 155 ? 56.962 27.818 19.382  1.00 65.48  ? 653 ARG B CA    1 
ATOM 3210 C C     . ARG F 3 155 ? 57.541 27.737 17.973  1.00 63.76  ? 653 ARG B C     1 
ATOM 3211 O O     . ARG F 3 155 ? 56.840 27.902 16.971  1.00 58.43  ? 653 ARG B O     1 
ATOM 3212 C CB    . ARG F 3 155 ? 57.415 29.113 20.051  1.00 67.64  ? 653 ARG B CB    1 
ATOM 3213 C CG    . ARG F 3 155 ? 56.562 30.338 19.787  1.00 72.29  ? 653 ARG B CG    1 
ATOM 3214 C CD    . ARG F 3 155 ? 57.137 31.546 20.528  1.00 74.69  ? 653 ARG B CD    1 
ATOM 3215 N NE    . ARG F 3 155 ? 57.458 31.228 21.922  1.00 72.76  ? 653 ARG B NE    1 
ATOM 3216 C CZ    . ARG F 3 155 ? 58.692 31.056 22.389  1.00 66.30  ? 653 ARG B CZ    1 
ATOM 3217 N NH1   . ARG F 3 155 ? 59.737 31.173 21.581  1.00 70.89  ? 653 ARG B NH1   1 
ATOM 3218 N NH2   . ARG F 3 155 ? 58.883 30.738 23.661  1.00 54.19  ? 653 ARG B NH2   1 
ATOM 3219 N N     . GLN F 3 156 ? 58.840 27.455 17.932  1.00 59.18  ? 654 GLN B N     1 
ATOM 3220 C CA    . GLN F 3 156 ? 59.596 27.309 16.700  1.00 58.55  ? 654 GLN B CA    1 
ATOM 3221 C C     . GLN F 3 156 ? 59.087 26.067 15.966  1.00 59.52  ? 654 GLN B C     1 
ATOM 3222 O O     . GLN F 3 156 ? 59.122 26.004 14.738  1.00 63.45  ? 654 GLN B O     1 
ATOM 3223 C CB    . GLN F 3 156 ? 61.075 27.159 17.062  1.00 59.82  ? 654 GLN B CB    1 
ATOM 3224 C CG    . GLN F 3 156 ? 62.052 27.069 15.914  1.00 66.99  ? 654 GLN B CG    1 
ATOM 3225 C CD    . GLN F 3 156 ? 63.493 27.069 16.400  1.00 67.04  ? 654 GLN B CD    1 
ATOM 3226 O OE1   . GLN F 3 156 ? 64.061 28.126 16.680  1.00 68.07  ? 654 GLN B OE1   1 
ATOM 3227 N NE2   . GLN F 3 156 ? 64.087 25.882 16.519  1.00 59.68  ? 654 GLN B NE2   1 
ATOM 3228 N N     . LYS F 3 157 ? 58.576 25.103 16.732  1.00 57.63  ? 655 LYS B N     1 
ATOM 3229 C CA    . LYS F 3 157 ? 58.050 23.855 16.183  1.00 55.10  ? 655 LYS B CA    1 
ATOM 3230 C C     . LYS F 3 157 ? 56.637 23.978 15.621  1.00 56.12  ? 655 LYS B C     1 
ATOM 3231 O O     . LYS F 3 157 ? 56.297 23.299 14.657  1.00 57.97  ? 655 LYS B O     1 
ATOM 3232 C CB    . LYS F 3 157 ? 58.080 22.754 17.241  1.00 57.56  ? 655 LYS B CB    1 
ATOM 3233 C CG    . LYS F 3 157 ? 57.418 21.454 16.810  1.00 57.46  ? 655 LYS B CG    1 
ATOM 3234 C CD    . LYS F 3 157 ? 57.433 20.423 17.930  1.00 67.43  ? 655 LYS B CD    1 
ATOM 3235 C CE    . LYS F 3 157 ? 56.582 19.214 17.578  1.00 60.98  ? 655 LYS B CE    1 
ATOM 3236 N NZ    . LYS F 3 157 ? 56.529 18.206 18.676  1.00 60.84  ? 655 LYS B NZ    1 
ATOM 3237 N N     . GLU F 3 158 ? 55.808 24.812 16.242  1.00 58.47  ? 656 GLU B N     1 
ATOM 3238 C CA    . GLU F 3 158 ? 54.435 25.006 15.781  1.00 60.47  ? 656 GLU B CA    1 
ATOM 3239 C C     . GLU F 3 158 ? 54.438 25.472 14.326  1.00 59.46  ? 656 GLU B C     1 
ATOM 3240 O O     . GLU F 3 158 ? 53.515 25.181 13.567  1.00 57.97  ? 656 GLU B O     1 
ATOM 3241 C CB    . GLU F 3 158 ? 53.719 26.042 16.658  1.00 63.83  ? 656 GLU B CB    1 
ATOM 3242 C CG    . GLU F 3 158 ? 52.203 26.152 16.428  1.00 63.91  ? 656 GLU B CG    1 
ATOM 3243 C CD    . GLU F 3 158 ? 51.394 25.063 17.132  1.00 62.68  ? 656 GLU B CD    1 
ATOM 3244 O OE1   . GLU F 3 158 ? 50.206 25.316 17.433  1.00 55.61  ? 656 GLU B OE1   1 
ATOM 3245 O OE2   . GLU F 3 158 ? 51.936 23.962 17.386  1.00 58.30  ? 656 GLU B OE2   1 
ATOM 3246 N N     . LYS F 3 159 ? 55.501 26.177 13.947  1.00 63.36  ? 657 LYS B N     1 
ATOM 3247 C CA    . LYS F 3 159 ? 55.663 26.693 12.591  1.00 66.27  ? 657 LYS B CA    1 
ATOM 3248 C C     . LYS F 3 159 ? 56.018 25.599 11.588  1.00 66.13  ? 657 LYS B C     1 
ATOM 3249 O O     . LYS F 3 159 ? 56.035 25.843 10.382  1.00 68.26  ? 657 LYS B O     1 
ATOM 3250 C CB    . LYS F 3 159 ? 56.756 27.769 12.557  1.00 67.86  ? 657 LYS B CB    1 
ATOM 3251 C CG    . LYS F 3 159 ? 56.443 29.031 13.348  1.00 75.48  ? 657 LYS B CG    1 
ATOM 3252 C CD    . LYS F 3 159 ? 57.584 30.034 13.234  1.00 81.19  ? 657 LYS B CD    1 
ATOM 3253 C CE    . LYS F 3 159 ? 57.270 31.345 13.947  1.00 83.11  ? 657 LYS B CE    1 
ATOM 3254 N NZ    . LYS F 3 159 ? 58.360 32.351 13.760  1.00 84.36  ? 657 LYS B NZ    1 
ATOM 3255 N N     . ARG F 3 160 ? 56.288 24.395 12.085  1.00 64.76  ? 658 ARG B N     1 
ATOM 3256 C CA    . ARG F 3 160 ? 56.662 23.278 11.223  1.00 74.19  ? 658 ARG B CA    1 
ATOM 3257 C C     . ARG F 3 160 ? 55.551 22.259 10.969  1.00 78.24  ? 658 ARG B C     1 
ATOM 3258 O O     . ARG F 3 160 ? 55.458 21.699 9.874   1.00 81.01  ? 658 ARG B O     1 
ATOM 3259 C CB    . ARG F 3 160 ? 57.906 22.584 11.775  1.00 76.41  ? 658 ARG B CB    1 
ATOM 3260 C CG    . ARG F 3 160 ? 59.090 23.519 11.938  1.00 79.58  ? 658 ARG B CG    1 
ATOM 3261 C CD    . ARG F 3 160 ? 60.370 22.749 12.176  1.00 84.96  ? 658 ARG B CD    1 
ATOM 3262 N NE    . ARG F 3 160 ? 60.281 21.877 13.343  1.00 91.62  ? 658 ARG B NE    1 
ATOM 3263 C CZ    . ARG F 3 160 ? 60.654 22.221 14.573  1.00 94.30  ? 658 ARG B CZ    1 
ATOM 3264 N NH1   . ARG F 3 160 ? 61.143 23.429 14.816  1.00 96.83  ? 658 ARG B NH1   1 
ATOM 3265 N NH2   . ARG F 3 160 ? 60.566 21.338 15.555  1.00 94.31  ? 658 ARG B NH2   1 
ATOM 3266 N N     . ILE F 3 161 ? 54.744 21.980 11.990  1.00 79.30  ? 659 ILE B N     1 
ATOM 3267 C CA    . ILE F 3 161 ? 53.635 21.041 11.841  1.00 81.26  ? 659 ILE B CA    1 
ATOM 3268 C C     . ILE F 3 161 ? 52.497 21.776 11.143  1.00 85.85  ? 659 ILE B C     1 
ATOM 3269 O O     . ILE F 3 161 ? 51.846 21.234 10.248  1.00 88.82  ? 659 ILE B O     1 
ATOM 3270 C CB    . ILE F 3 161 ? 53.158 20.487 13.216  1.00 78.61  ? 659 ILE B CB    1 
ATOM 3271 C CG1   . ILE F 3 161 ? 53.950 19.229 13.580  1.00 76.14  ? 659 ILE B CG1   1 
ATOM 3272 C CG2   . ILE F 3 161 ? 51.663 20.155 13.191  1.00 78.36  ? 659 ILE B CG2   1 
ATOM 3273 C CD1   . ILE F 3 161 ? 55.443 19.424 13.625  1.00 72.98  ? 659 ILE B CD1   1 
ATOM 3274 N N     . ASN F 3 162 ? 52.291 23.026 11.546  1.00 87.48  ? 660 ASN B N     1 
ATOM 3275 C CA    . ASN F 3 162 ? 51.247 23.863 10.977  1.00 88.59  ? 660 ASN B CA    1 
ATOM 3276 C C     . ASN F 3 162 ? 51.859 25.087 10.298  1.00 86.10  ? 660 ASN B C     1 
ATOM 3277 O O     . ASN F 3 162 ? 52.892 25.599 10.732  1.00 87.99  ? 660 ASN B O     1 
ATOM 3278 C CB    . ASN F 3 162 ? 50.273 24.298 12.074  1.00 93.58  ? 660 ASN B CB    1 
ATOM 3279 C CG    . ASN F 3 162 ? 49.113 25.107 11.534  1.00 99.56  ? 660 ASN B CG    1 
ATOM 3280 O OD1   . ASN F 3 162 ? 48.124 24.552 11.057  1.00 100.00 ? 660 ASN B OD1   1 
ATOM 3281 N ND2   . ASN F 3 162 ? 49.234 26.428 11.594  1.00 100.00 ? 660 ASN B ND2   1 
ATOM 3282 N N     . PRO F 3 163 ? 51.220 25.570 9.220   1.00 85.47  ? 661 PRO B N     1 
ATOM 3283 C CA    . PRO F 3 163 ? 51.572 26.720 8.378   1.00 88.50  ? 661 PRO B CA    1 
ATOM 3284 C C     . PRO F 3 163 ? 53.041 26.723 7.960   1.00 93.32  ? 661 PRO B C     1 
ATOM 3285 O O     . PRO F 3 163 ? 53.503 25.663 7.485   1.00 96.69  ? 661 PRO B O     1 
ATOM 3286 C CB    . PRO F 3 163 ? 51.237 27.926 9.260   1.00 85.79  ? 661 PRO B CB    1 
ATOM 3287 N N     . ALA G 4 16  ? 33.549 41.390 1.584   1.00 84.90  ? 300 ALA I N     1 
ATOM 3288 C CA    . ALA G 4 16  ? 33.510 40.037 0.937   1.00 93.61  ? 300 ALA I CA    1 
ATOM 3289 C C     . ALA G 4 16  ? 33.148 38.935 1.927   1.00 92.60  ? 300 ALA I C     1 
ATOM 3290 O O     . ALA G 4 16  ? 33.042 37.764 1.548   1.00 95.99  ? 300 ALA I O     1 
ATOM 3291 C CB    . ALA G 4 16  ? 34.833 39.724 0.256   1.00 93.87  ? 300 ALA I CB    1 
ATOM 3292 N N     . ARG G 4 17  ? 32.966 39.311 3.197   1.00 87.63  ? 301 ARG I N     1 
ATOM 3293 C CA    . ARG G 4 17  ? 32.582 38.361 4.244   1.00 80.72  ? 301 ARG I CA    1 
ATOM 3294 C C     . ARG G 4 17  ? 31.421 37.500 3.726   1.00 75.48  ? 301 ARG I C     1 
ATOM 3295 O O     . ARG G 4 17  ? 30.293 37.977 3.515   1.00 76.75  ? 301 ARG I O     1 
ATOM 3296 C CB    . ARG G 4 17  ? 32.172 39.139 5.500   1.00 79.88  ? 301 ARG I CB    1 
ATOM 3297 N N     . PRO G 4 18  ? 31.694 36.197 3.591   1.00 66.53  ? 302 PRO I N     1 
ATOM 3298 C CA    . PRO G 4 18  ? 30.824 35.126 3.077   1.00 60.26  ? 302 PRO I CA    1 
ATOM 3299 C C     . PRO G 4 18  ? 29.563 34.775 3.878   1.00 60.41  ? 302 PRO I C     1 
ATOM 3300 O O     . PRO G 4 18  ? 28.508 34.449 3.318   1.00 64.99  ? 302 PRO I O     1 
ATOM 3301 C CB    . PRO G 4 18  ? 31.799 33.952 2.899   1.00 60.98  ? 302 PRO I CB    1 
ATOM 3302 C CG    . PRO G 4 18  ? 32.731 34.147 4.160   1.00 63.47  ? 302 PRO I CG    1 
ATOM 3303 C CD    . PRO G 4 18  ? 32.925 35.672 4.203   1.00 67.92  ? 302 PRO I CD    1 
ATOM 3304 N N     . TYR G 4 19  ? 29.625 35.226 5.115   1.00 56.57  ? 303 TYR I N     1 
ATOM 3305 C CA    . TYR G 4 19  ? 28.643 34.996 6.145   1.00 53.77  ? 303 TYR I CA    1 
ATOM 3306 C C     . TYR G 4 19  ? 28.744 33.654 6.830   1.00 52.48  ? 303 TYR I C     1 
ATOM 3307 O O     . TYR G 4 19  ? 27.795 32.852 6.737   1.00 48.05  ? 303 TYR I O     1 
ATOM 3308 C CB    . TYR G 4 19  ? 27.204 35.247 5.713   1.00 51.31  ? 303 TYR I CB    1 
ATOM 3309 C CG    . TYR G 4 19  ? 26.185 35.235 6.874   1.00 55.77  ? 303 TYR I CG    1 
ATOM 3310 C CD1   . TYR G 4 19  ? 26.485 34.656 8.116   1.00 56.74  ? 303 TYR I CD1   1 
ATOM 3311 C CD2   . TYR G 4 19  ? 24.933 35.793 6.721   1.00 57.05  ? 303 TYR I CD2   1 
ATOM 3312 C CE1   . TYR G 4 19  ? 25.560 34.627 9.163   1.00 56.52  ? 303 TYR I CE1   1 
ATOM 3313 C CE2   . TYR G 4 19  ? 24.007 35.774 7.757   1.00 55.96  ? 303 TYR I CE2   1 
ATOM 3314 C CZ    . TYR G 4 19  ? 24.331 35.180 8.972   1.00 57.40  ? 303 TYR I CZ    1 
ATOM 3315 O OH    . TYR G 4 19  ? 23.411 35.075 9.970   1.00 59.72  ? 303 TYR I OH    1 
ATOM 3316 N N     . GLN G 4 20  ? 29.895 33.393 7.484   1.00 51.90  ? 304 GLN I N     1 
ATOM 3317 C CA    . GLN G 4 20  ? 30.128 32.257 8.400   1.00 54.14  ? 304 GLN I CA    1 
ATOM 3318 C C     . GLN G 4 20  ? 28.914 32.358 9.371   1.00 47.88  ? 304 GLN I C     1 
ATOM 3319 O O     . GLN G 4 20  ? 28.592 33.454 9.808   1.00 46.63  ? 304 GLN I O     1 
ATOM 3320 C CB    . GLN G 4 20  ? 31.501 32.425 9.064   1.00 54.84  ? 304 GLN I CB    1 
ATOM 3321 C CG    . GLN G 4 20  ? 32.635 32.622 8.006   1.00 55.00  ? 304 GLN I CG    1 
ATOM 3322 C CD    . GLN G 4 20  ? 33.979 32.920 8.657   1.00 63.36  ? 304 GLN I CD    1 
ATOM 3323 O OE1   . GLN G 4 20  ? 34.010 33.371 9.787   1.00 81.27  ? 304 GLN I OE1   1 
ATOM 3324 N NE2   . GLN G 4 20  ? 35.091 32.678 7.953   1.00 58.90  ? 304 GLN I NE2   1 
ATOM 3325 N N     . GLY G 4 21  ? 28.209 31.227 9.612   1.00 43.23  ? 305 GLY I N     1 
ATOM 3326 C CA    . GLY G 4 21  ? 26.923 31.216 10.342  1.00 41.56  ? 305 GLY I CA    1 
ATOM 3327 C C     . GLY G 4 21  ? 25.678 30.733 9.620   1.00 35.23  ? 305 GLY I C     1 
ATOM 3328 O O     . GLY G 4 21  ? 25.527 30.943 8.422   1.00 29.26  ? 305 GLY I O     1 
ATOM 3329 N N     . VAL G 4 22  ? 24.771 30.105 10.357  1.00 27.43  ? 306 VAL I N     1 
ATOM 3330 C CA    . VAL G 4 22  ? 23.546 29.526 9.814   1.00 27.61  ? 306 VAL I CA    1 
ATOM 3331 C C     . VAL G 4 22  ? 22.264 30.395 9.863   1.00 30.86  ? 306 VAL I C     1 
ATOM 3332 O O     . VAL G 4 22  ? 22.034 31.102 10.845  1.00 39.84  ? 306 VAL I O     1 
ATOM 3333 C CB    . VAL G 4 22  ? 23.234 28.198 10.565  1.00 25.30  ? 306 VAL I CB    1 
ATOM 3334 C CG1   . VAL G 4 22  ? 21.942 27.578 10.043  1.00 26.19  ? 306 VAL I CG1   1 
ATOM 3335 C CG2   . VAL G 4 22  ? 24.359 27.205 10.444  1.00 24.71  ? 306 VAL I CG2   1 
ATOM 3336 N N     . ARG G 4 23  ? 21.367 30.203 8.884   1.00 28.25  ? 307 ARG I N     1 
ATOM 3337 C CA    . ARG G 4 23  ? 20.115 30.967 8.808   1.00 31.25  ? 307 ARG I CA    1 
ATOM 3338 C C     . ARG G 4 23  ? 18.807 30.147 8.874   1.00 31.51  ? 307 ARG I C     1 
ATOM 3339 O O     . ARG G 4 23  ? 18.765 28.955 8.533   1.00 30.90  ? 307 ARG I O     1 
ATOM 3340 C CB    . ARG G 4 23  ? 20.063 31.791 7.510   1.00 37.62  ? 307 ARG I CB    1 
ATOM 3341 C CG    . ARG G 4 23  ? 21.204 32.778 7.325   1.00 37.72  ? 307 ARG I CG    1 
ATOM 3342 C CD    . ARG G 4 23  ? 20.886 33.738 6.189   1.00 39.14  ? 307 ARG I CD    1 
ATOM 3343 N NE    . ARG G 4 23  ? 22.081 34.412 5.693   1.00 59.22  ? 307 ARG I NE    1 
ATOM 3344 C CZ    . ARG G 4 23  ? 22.092 35.611 5.113   1.00 68.05  ? 307 ARG I CZ    1 
ATOM 3345 N NH1   . ARG G 4 23  ? 20.969 36.299 4.949   1.00 70.31  ? 307 ARG I NH1   1 
ATOM 3346 N NH2   . ARG G 4 23  ? 23.236 36.119 4.677   1.00 78.65  ? 307 ARG I NH2   1 
ATOM 3347 N N     . VAL G 4 24  ? 17.730 30.813 9.283   1.00 28.60  ? 308 VAL I N     1 
ATOM 3348 C CA    . VAL G 4 24  ? 16.428 30.176 9.353   1.00 29.23  ? 308 VAL I CA    1 
ATOM 3349 C C     . VAL G 4 24  ? 15.892 30.216 7.929   1.00 32.98  ? 308 VAL I C     1 
ATOM 3350 O O     . VAL G 4 24  ? 15.929 31.258 7.272   1.00 21.59  ? 308 VAL I O     1 
ATOM 3351 C CB    . VAL G 4 24  ? 15.446 30.957 10.281  1.00 25.23  ? 308 VAL I CB    1 
ATOM 3352 C CG1   . VAL G 4 24  ? 14.085 30.254 10.339  1.00 26.39  ? 308 VAL I CG1   1 
ATOM 3353 C CG2   . VAL G 4 24  ? 16.022 31.086 11.673  1.00 13.73  ? 308 VAL I CG2   1 
ATOM 3354 N N     . LYS G 4 25  ? 15.456 29.067 7.427   1.00 46.92  ? 309 LYS I N     1 
ATOM 3355 C CA    . LYS G 4 25  ? 14.912 29.011 6.077   1.00 55.44  ? 309 LYS I CA    1 
ATOM 3356 C C     . LYS G 4 25  ? 13.439 29.384 6.061   1.00 57.02  ? 309 LYS I C     1 
ATOM 3357 O O     . LYS G 4 25  ? 12.639 28.871 6.852   1.00 59.66  ? 309 LYS I O     1 
ATOM 3358 C CB    . LYS G 4 25  ? 15.130 27.632 5.440   1.00 54.68  ? 309 LYS I CB    1 
ATOM 3359 C CG    . LYS G 4 25  ? 16.589 27.332 5.130   1.00 51.39  ? 309 LYS I CG    1 
ATOM 3360 C CD    . LYS G 4 25  ? 17.206 28.445 4.291   1.00 46.97  ? 309 LYS I CD    1 
ATOM 3361 C CE    . LYS G 4 25  ? 18.715 28.282 4.162   1.00 43.70  ? 309 LYS I CE    1 
ATOM 3362 N NZ    . LYS G 4 25  ? 19.431 28.380 5.471   1.00 44.88  ? 309 LYS I NZ    1 
ATOM 3363 N N     . GLU G 4 26  ? 13.105 30.316 5.173   1.00 56.66  ? 310 GLU I N     1 
ATOM 3364 C CA    . GLU G 4 26  ? 11.741 30.797 5.011   1.00 56.94  ? 310 GLU I CA    1 
ATOM 3365 C C     . GLU G 4 26  ? 11.129 31.328 6.303   1.00 57.43  ? 310 GLU I C     1 
ATOM 3366 O O     . GLU G 4 26  ? 10.148 30.774 6.816   1.00 50.64  ? 310 GLU I O     1 
ATOM 3367 C CB    . GLU G 4 26  ? 10.863 29.699 4.413   1.00 53.69  ? 310 GLU I CB    1 
ATOM 3368 C CG    . GLU G 4 26  ? 11.425 29.132 3.129   1.00 53.70  ? 310 GLU I CG    1 
ATOM 3369 C CD    . GLU G 4 26  ? 10.457 28.222 2.415   1.00 61.47  ? 310 GLU I CD    1 
ATOM 3370 O OE1   . GLU G 4 26  ? 9.918  27.294 3.056   1.00 65.66  ? 310 GLU I OE1   1 
ATOM 3371 O OE2   . GLU G 4 26  ? 10.239 28.439 1.204   1.00 64.00  ? 310 GLU I OE2   1 
ATOM 3372 N N     . PRO G 4 27  ? 11.746 32.374 6.884   1.00 56.54  ? 311 PRO I N     1 
ATOM 3373 C CA    . PRO G 4 27  ? 11.203 32.936 8.119   1.00 57.10  ? 311 PRO I CA    1 
ATOM 3374 C C     . PRO G 4 27  ? 9.891  33.592 7.735   1.00 60.70  ? 311 PRO I C     1 
ATOM 3375 O O     . PRO G 4 27  ? 9.775  34.142 6.641   1.00 61.60  ? 311 PRO I O     1 
ATOM 3376 C CB    . PRO G 4 27  ? 12.264 33.964 8.520   1.00 52.95  ? 311 PRO I CB    1 
ATOM 3377 C CG    . PRO G 4 27  ? 12.822 34.405 7.212   1.00 49.78  ? 311 PRO I CG    1 
ATOM 3378 C CD    . PRO G 4 27  ? 12.949 33.109 6.454   1.00 55.41  ? 311 PRO I CD    1 
ATOM 3379 N N     . VAL G 4 28  ? 8.894  33.495 8.608   1.00 68.29  ? 312 VAL I N     1 
ATOM 3380 C CA    . VAL G 4 28  ? 7.578  34.072 8.332   1.00 72.63  ? 312 VAL I CA    1 
ATOM 3381 C C     . VAL G 4 28  ? 7.662  35.535 7.885   1.00 69.45  ? 312 VAL I C     1 
ATOM 3382 O O     . VAL G 4 28  ? 6.796  36.020 7.159   1.00 68.77  ? 312 VAL I O     1 
ATOM 3383 C CB    . VAL G 4 28  ? 6.632  33.931 9.545   1.00 77.18  ? 312 VAL I CB    1 
ATOM 3384 C CG1   . VAL G 4 28  ? 5.217  34.319 9.149   1.00 84.18  ? 312 VAL I CG1   1 
ATOM 3385 C CG2   . VAL G 4 28  ? 6.657  32.495 10.074  1.00 77.94  ? 312 VAL I CG2   1 
ATOM 3386 N N     . LYS G 4 29  ? 8.727  36.216 8.299   1.00 65.09  ? 313 LYS I N     1 
ATOM 3387 C CA    . LYS G 4 29  ? 8.956  37.601 7.924   1.00 63.85  ? 313 LYS I CA    1 
ATOM 3388 C C     . LYS G 4 29  ? 9.043  37.667 6.402   1.00 68.72  ? 313 LYS I C     1 
ATOM 3389 O O     . LYS G 4 29  ? 8.242  38.336 5.748   1.00 75.07  ? 313 LYS I O     1 
ATOM 3390 C CB    . LYS G 4 29  ? 10.270 38.095 8.536   1.00 64.95  ? 313 LYS I CB    1 
ATOM 3391 C CG    . LYS G 4 29  ? 10.666 39.509 8.128   1.00 73.04  ? 313 LYS I CG    1 
ATOM 3392 C CD    . LYS G 4 29  ? 12.036 39.887 8.679   1.00 77.72  ? 313 LYS I CD    1 
ATOM 3393 C CE    . LYS G 4 29  ? 12.435 41.298 8.263   1.00 84.32  ? 313 LYS I CE    1 
ATOM 3394 N NZ    . LYS G 4 29  ? 13.780 41.697 8.782   1.00 87.13  ? 313 LYS I NZ    1 
ATOM 3395 N N     . GLU G 4 30  ? 9.991  36.923 5.843   1.00 72.38  ? 314 GLU I N     1 
ATOM 3396 C CA    . GLU G 4 30  ? 10.193 36.894 4.402   1.00 80.17  ? 314 GLU I CA    1 
ATOM 3397 C C     . GLU G 4 30  ? 9.059  36.167 3.683   1.00 82.05  ? 314 GLU I C     1 
ATOM 3398 O O     . GLU G 4 30  ? 8.755  36.477 2.531   1.00 85.41  ? 314 GLU I O     1 
ATOM 3399 C CB    . GLU G 4 30  ? 11.543 36.258 4.070   1.00 82.61  ? 314 GLU I CB    1 
ATOM 3400 C CG    . GLU G 4 30  ? 12.043 36.551 2.662   1.00 88.76  ? 314 GLU I CG    1 
ATOM 3401 C CD    . GLU G 4 30  ? 13.527 36.266 2.499   1.00 98.04  ? 314 GLU I CD    1 
ATOM 3402 O OE1   . GLU G 4 30  ? 13.978 35.176 2.918   1.00 100.00 ? 314 GLU I OE1   1 
ATOM 3403 O OE2   . GLU G 4 30  ? 14.244 37.135 1.955   1.00 95.93  ? 314 GLU I OE2   1 
ATOM 3404 N N     . LEU G 4 31  ? 8.429  35.212 4.365   1.00 81.32  ? 315 LEU I N     1 
ATOM 3405 C CA    . LEU G 4 31  ? 7.319  34.464 3.781   1.00 88.40  ? 315 LEU I CA    1 
ATOM 3406 C C     . LEU G 4 31  ? 6.142  35.394 3.494   1.00 90.30  ? 315 LEU I C     1 
ATOM 3407 O O     . LEU G 4 31  ? 5.357  35.157 2.573   1.00 93.93  ? 315 LEU I O     1 
ATOM 3408 C CB    . LEU G 4 31  ? 6.877  33.323 4.707   1.00 92.04  ? 315 LEU I CB    1 
ATOM 3409 C CG    . LEU G 4 31  ? 7.664  32.007 4.659   1.00 95.42  ? 315 LEU I CG    1 
ATOM 3410 C CD1   . LEU G 4 31  ? 7.106  31.016 5.678   1.00 95.25  ? 315 LEU I CD1   1 
ATOM 3411 C CD2   . LEU G 4 31  ? 7.594  31.415 3.260   1.00 90.43  ? 315 LEU I CD2   1 
ATOM 3412 N N     . LEU G 4 32  ? 6.028  36.455 4.288   1.00 89.25  ? 316 LEU I N     1 
ATOM 3413 C CA    . LEU G 4 32  ? 4.963  37.430 4.112   1.00 87.36  ? 316 LEU I CA    1 
ATOM 3414 C C     . LEU G 4 32  ? 5.248  38.372 2.953   1.00 88.65  ? 316 LEU I C     1 
ATOM 3415 O O     . LEU G 4 32  ? 4.461  38.446 2.009   1.00 86.47  ? 316 LEU I O     1 
ATOM 3416 C CB    . LEU G 4 32  ? 4.746  38.228 5.396   1.00 85.26  ? 316 LEU I CB    1 
ATOM 3417 C CG    . LEU G 4 32  ? 3.731  37.623 6.365   1.00 85.45  ? 316 LEU I CG    1 
ATOM 3418 C CD1   . LEU G 4 32  ? 3.785  38.345 7.693   1.00 90.63  ? 316 LEU I CD1   1 
ATOM 3419 C CD2   . LEU G 4 32  ? 2.337  37.711 5.765   1.00 85.95  ? 316 LEU I CD2   1 
ATOM 3420 N N     . ARG G 4 33  ? 6.397  39.048 2.999   1.00 89.59  ? 317 ARG I N     1 
ATOM 3421 C CA    . ARG G 4 33  ? 6.784  39.992 1.948   1.00 92.14  ? 317 ARG I CA    1 
ATOM 3422 C C     . ARG G 4 33  ? 6.808  39.342 0.564   1.00 93.44  ? 317 ARG I C     1 
ATOM 3423 O O     . ARG G 4 33  ? 6.882  40.031 -0.458  1.00 92.27  ? 317 ARG I O     1 
ATOM 3424 C CB    . ARG G 4 33  ? 8.146  40.630 2.255   1.00 88.85  ? 317 ARG I CB    1 
ATOM 3425 C CG    . ARG G 4 33  ? 9.356  39.871 1.723   1.00 91.89  ? 317 ARG I CG    1 
ATOM 3426 C CD    . ARG G 4 33  ? 10.619 40.706 1.872   1.00 97.81  ? 317 ARG I CD    1 
ATOM 3427 N NE    . ARG G 4 33  ? 11.767 40.146 1.157   1.00 100.00 ? 317 ARG I NE    1 
ATOM 3428 C CZ    . ARG G 4 33  ? 12.058 40.396 -0.118  1.00 100.00 ? 317 ARG I CZ    1 
ATOM 3429 N NH1   . ARG G 4 33  ? 11.284 41.197 -0.843  1.00 100.00 ? 317 ARG I NH1   1 
ATOM 3430 N NH2   . ARG G 4 33  ? 13.151 39.875 -0.661  1.00 100.00 ? 317 ARG I NH2   1 
ATOM 3431 N N     . ARG G 4 34  ? 6.754  38.013 0.548   1.00 96.12  ? 318 ARG I N     1 
ATOM 3432 C CA    . ARG G 4 34  ? 6.754  37.239 -0.685  1.00 100.00 ? 318 ARG I CA    1 
ATOM 3433 C C     . ARG G 4 34  ? 5.333  37.104 -1.238  1.00 100.00 ? 318 ARG I C     1 
ATOM 3434 O O     . ARG G 4 34  ? 5.087  37.408 -2.410  1.00 100.00 ? 318 ARG I O     1 
ATOM 3435 C CB    . ARG G 4 34  ? 7.362  35.856 -0.429  1.00 100.00 ? 318 ARG I CB    1 
ATOM 3436 C CG    . ARG G 4 34  ? 7.552  34.995 -1.672  1.00 100.00 ? 318 ARG I CG    1 
ATOM 3437 C CD    . ARG G 4 34  ? 8.278  33.702 -1.333  1.00 100.00 ? 318 ARG I CD    1 
ATOM 3438 N NE    . ARG G 4 34  ? 9.597  33.959 -0.756  1.00 100.00 ? 318 ARG I NE    1 
ATOM 3439 C CZ    . ARG G 4 34  ? 10.381 33.027 -0.220  1.00 100.00 ? 318 ARG I CZ    1 
ATOM 3440 N NH1   . ARG G 4 34  ? 9.989  31.758 -0.179  1.00 100.00 ? 318 ARG I NH1   1 
ATOM 3441 N NH2   . ARG G 4 34  ? 11.566 33.367 0.272   1.00 99.02  ? 318 ARG I NH2   1 
ATOM 3442 N N     . LYS G 4 35  ? 4.400  36.672 -0.386  1.00 100.00 ? 319 LYS I N     1 
ATOM 3443 C CA    . LYS G 4 35  ? 3.000  36.497 -0.783  1.00 100.00 ? 319 LYS I CA    1 
ATOM 3444 C C     . LYS G 4 35  ? 2.234  37.830 -0.749  1.00 100.00 ? 319 LYS I C     1 
ATOM 3445 O O     . LYS G 4 35  ? 1.053  37.880 -0.390  1.00 98.53  ? 319 LYS I O     1 
ATOM 3446 C CB    . LYS G 4 35  ? 2.322  35.454 0.119   1.00 100.00 ? 319 LYS I CB    1 
ATOM 3447 C CG    . LYS G 4 35  ? 0.991  34.915 -0.416  1.00 100.00 ? 319 LYS I CG    1 
ATOM 3448 C CD    . LYS G 4 35  ? 0.352  33.920 0.549   1.00 100.00 ? 319 LYS I CD    1 
ATOM 3449 C CE    . LYS G 4 35  ? -1.036 33.486 0.082   1.00 96.94  ? 319 LYS I CE    1 
ATOM 3450 N NZ    . LYS G 4 35  ? -2.009 34.620 0.033   1.00 93.23  ? 319 LYS I NZ    1 
ATOM 3451 N N     . ARG G 4 36  ? 2.922  38.904 -1.136  1.00 100.00 ? 320 ARG I N     1 
ATOM 3452 C CA    . ARG G 4 36  ? 2.354  40.251 -1.172  1.00 100.00 ? 320 ARG I CA    1 
ATOM 3453 C C     . ARG G 4 36  ? 2.791  41.007 -2.428  1.00 100.00 ? 320 ARG I C     1 
ATOM 3454 O O     . ARG G 4 36  ? 2.093  41.910 -2.894  1.00 100.00 ? 320 ARG I O     1 
ATOM 3455 C CB    . ARG G 4 36  ? 2.767  41.044 0.077   1.00 100.00 ? 320 ARG I CB    1 
ATOM 3456 C CG    . ARG G 4 36  ? 2.085  40.577 1.352   1.00 100.00 ? 320 ARG I CG    1 
ATOM 3457 C CD    . ARG G 4 36  ? 2.454  41.423 2.562   1.00 100.00 ? 320 ARG I CD    1 
ATOM 3458 N NE    . ARG G 4 36  ? 1.616  41.075 3.709   1.00 100.00 ? 320 ARG I NE    1 
ATOM 3459 C CZ    . ARG G 4 36  ? 1.702  41.634 4.914   1.00 100.00 ? 320 ARG I CZ    1 
ATOM 3460 N NH1   . ARG G 4 36  ? 2.599  42.583 5.155   1.00 100.00 ? 320 ARG I NH1   1 
ATOM 3461 N NH2   . ARG G 4 36  ? 0.868  41.255 5.875   1.00 100.00 ? 320 ARG I NH2   1 
ATOM 3462 N N     . GLY G 4 37  ? 3.947  40.631 -2.972  1.00 100.00 ? 321 GLY I N     1 
ATOM 3463 C CA    . GLY G 4 37  ? 4.460  41.283 -4.165  1.00 99.00  ? 321 GLY I CA    1 
ATOM 3464 C C     . GLY G 4 37  ? 5.973  41.228 -4.259  1.00 93.62  ? 321 GLY I C     1 
ATOM 3465 O O     . GLY G 4 37  ? 6.643  41.399 -3.218  1.00 90.42  ? 321 GLY I O     1 
ATOM 3466 N N     . ALA H 4 16  ? 51.394 8.383  7.656   1.00 99.97  ? 800 ALA J N     1 
ATOM 3467 C CA    . ALA H 4 16  ? 52.602 9.215  7.948   1.00 100.00 ? 800 ALA J CA    1 
ATOM 3468 C C     . ALA H 4 16  ? 52.231 10.541 8.614   1.00 100.00 ? 800 ALA J C     1 
ATOM 3469 O O     . ALA H 4 16  ? 51.212 11.156 8.277   1.00 100.00 ? 800 ALA J O     1 
ATOM 3470 C CB    . ALA H 4 16  ? 53.390 9.465  6.661   1.00 98.48  ? 800 ALA J CB    1 
ATOM 3471 N N     . ARG H 4 17  ? 53.071 10.975 9.557   1.00 100.00 ? 801 ARG J N     1 
ATOM 3472 C CA    . ARG H 4 17  ? 52.864 12.221 10.300  1.00 100.00 ? 801 ARG J CA    1 
ATOM 3473 C C     . ARG H 4 17  ? 53.525 13.424 9.620   1.00 100.00 ? 801 ARG J C     1 
ATOM 3474 O O     . ARG H 4 17  ? 54.450 13.256 8.821   1.00 100.00 ? 801 ARG J O     1 
ATOM 3475 C CB    . ARG H 4 17  ? 53.415 12.069 11.727  1.00 94.75  ? 801 ARG J CB    1 
ATOM 3476 N N     . PRO H 4 18  ? 53.085 14.655 9.953   1.00 100.00 ? 802 PRO J N     1 
ATOM 3477 C CA    . PRO H 4 18  ? 53.649 15.882 9.360   1.00 99.03  ? 802 PRO J CA    1 
ATOM 3478 C C     . PRO H 4 18  ? 55.118 16.117 9.713   1.00 100.00 ? 802 PRO J C     1 
ATOM 3479 O O     . PRO H 4 18  ? 55.716 17.134 9.330   1.00 100.00 ? 802 PRO J O     1 
ATOM 3480 C CB    . PRO H 4 18  ? 52.770 17.012 9.890   1.00 96.65  ? 802 PRO J CB    1 
ATOM 3481 C CG    . PRO H 4 18  ? 51.753 16.391 10.793  1.00 97.48  ? 802 PRO J CG    1 
ATOM 3482 C CD    . PRO H 4 18  ? 51.973 14.925 10.890  1.00 99.24  ? 802 PRO J CD    1 
ATOM 3483 N N     . TYR H 4 19  ? 55.667 15.178 10.477  1.00 100.00 ? 803 TYR J N     1 
ATOM 3484 C CA    . TYR H 4 19  ? 57.057 15.171 10.910  1.00 100.00 ? 803 TYR J CA    1 
ATOM 3485 C C     . TYR H 4 19  ? 57.486 16.264 11.894  1.00 100.00 ? 803 TYR J C     1 
ATOM 3486 O O     . TYR H 4 19  ? 58.081 17.286 11.519  1.00 99.37  ? 803 TYR J O     1 
ATOM 3487 C CB    . TYR H 4 19  ? 58.010 15.104 9.704   1.00 100.00 ? 803 TYR J CB    1 
ATOM 3488 C CG    . TYR H 4 19  ? 59.459 14.788 10.040  1.00 100.00 ? 803 TYR J CG    1 
ATOM 3489 C CD1   . TYR H 4 19  ? 59.826 14.334 11.308  1.00 98.01  ? 803 TYR J CD1   1 
ATOM 3490 C CD2   . TYR H 4 19  ? 60.467 14.970 9.089   1.00 100.00 ? 803 TYR J CD2   1 
ATOM 3491 C CE1   . TYR H 4 19  ? 61.153 14.078 11.619  1.00 99.41  ? 803 TYR J CE1   1 
ATOM 3492 C CE2   . TYR H 4 19  ? 61.794 14.719 9.387   1.00 100.00 ? 803 TYR J CE2   1 
ATOM 3493 C CZ    . TYR H 4 19  ? 62.128 14.275 10.653  1.00 100.00 ? 803 TYR J CZ    1 
ATOM 3494 O OH    . TYR H 4 19  ? 63.440 14.034 10.959  1.00 100.00 ? 803 TYR J OH    1 
ATOM 3495 N N     . GLN H 4 20  ? 57.214 15.972 13.167  1.00 100.00 ? 804 GLN J N     1 
ATOM 3496 C CA    . GLN H 4 20  ? 57.599 16.790 14.327  1.00 94.39  ? 804 GLN J CA    1 
ATOM 3497 C C     . GLN H 4 20  ? 59.111 16.733 14.552  1.00 88.21  ? 804 GLN J C     1 
ATOM 3498 O O     . GLN H 4 20  ? 59.708 15.654 14.590  1.00 88.41  ? 804 GLN J O     1 
ATOM 3499 C CB    . GLN H 4 20  ? 56.907 16.264 15.591  1.00 98.91  ? 804 GLN J CB    1 
ATOM 3500 C CG    . GLN H 4 20  ? 55.370 16.131 15.497  1.00 100.00 ? 804 GLN J CG    1 
ATOM 3501 C CD    . GLN H 4 20  ? 54.903 15.013 14.572  1.00 100.00 ? 804 GLN J CD    1 
ATOM 3502 O OE1   . GLN H 4 20  ? 53.929 15.180 13.851  1.00 100.00 ? 804 GLN J OE1   1 
ATOM 3503 N NE2   . GLN H 4 20  ? 55.581 13.863 14.608  1.00 100.00 ? 804 GLN J NE2   1 
ATOM 3504 N N     . GLY H 4 21  ? 59.735 17.897 14.680  1.00 77.45  ? 805 GLY J N     1 
ATOM 3505 C CA    . GLY H 4 21  ? 61.167 17.916 14.904  1.00 74.67  ? 805 GLY J CA    1 
ATOM 3506 C C     . GLY H 4 21  ? 61.966 18.855 14.024  1.00 71.48  ? 805 GLY J C     1 
ATOM 3507 O O     . GLY H 4 21  ? 61.415 19.639 13.260  1.00 71.25  ? 805 GLY J O     1 
ATOM 3508 N N     . VAL H 4 22  ? 63.285 18.738 14.122  1.00 71.21  ? 806 VAL J N     1 
ATOM 3509 C CA    . VAL H 4 22  ? 64.206 19.591 13.388  1.00 66.74  ? 806 VAL J CA    1 
ATOM 3510 C C     . VAL H 4 22  ? 64.813 18.737 12.283  1.00 63.00  ? 806 VAL J C     1 
ATOM 3511 O O     . VAL H 4 22  ? 65.168 17.572 12.503  1.00 55.48  ? 806 VAL J O     1 
ATOM 3512 C CB    . VAL H 4 22  ? 65.321 20.168 14.308  1.00 69.25  ? 806 VAL J CB    1 
ATOM 3513 C CG1   . VAL H 4 22  ? 66.325 20.965 13.493  1.00 75.38  ? 806 VAL J CG1   1 
ATOM 3514 C CG2   . VAL H 4 22  ? 64.709 21.060 15.377  1.00 68.77  ? 806 VAL J CG2   1 
ATOM 3515 N N     . ARG H 4 23  ? 64.910 19.311 11.089  1.00 62.03  ? 807 ARG J N     1 
ATOM 3516 C CA    . ARG H 4 23  ? 65.458 18.592 9.947   1.00 67.16  ? 807 ARG J CA    1 
ATOM 3517 C C     . ARG H 4 23  ? 66.821 19.141 9.526   1.00 63.02  ? 807 ARG J C     1 
ATOM 3518 O O     . ARG H 4 23  ? 67.069 20.351 9.598   1.00 63.05  ? 807 ARG J O     1 
ATOM 3519 C CB    . ARG H 4 23  ? 64.497 18.674 8.763   1.00 74.06  ? 807 ARG J CB    1 
ATOM 3520 C CG    . ARG H 4 23  ? 63.101 18.137 9.030   1.00 82.07  ? 807 ARG J CG    1 
ATOM 3521 C CD    . ARG H 4 23  ? 62.275 18.168 7.749   1.00 96.12  ? 807 ARG J CD    1 
ATOM 3522 N NE    . ARG H 4 23  ? 60.925 17.647 7.947   1.00 100.00 ? 807 ARG J NE    1 
ATOM 3523 C CZ    . ARG H 4 23  ? 60.015 17.523 6.983   1.00 100.00 ? 807 ARG J CZ    1 
ATOM 3524 N NH1   . ARG H 4 23  ? 60.298 17.883 5.738   1.00 100.00 ? 807 ARG J NH1   1 
ATOM 3525 N NH2   . ARG H 4 23  ? 58.818 17.025 7.264   1.00 100.00 ? 807 ARG J NH2   1 
ATOM 3526 N N     . VAL H 4 24  ? 67.705 18.255 9.078   1.00 56.06  ? 808 VAL J N     1 
ATOM 3527 C CA    . VAL H 4 24  ? 69.026 18.674 8.622   1.00 55.96  ? 808 VAL J CA    1 
ATOM 3528 C C     . VAL H 4 24  ? 68.845 19.353 7.269   1.00 57.36  ? 808 VAL J C     1 
ATOM 3529 O O     . VAL H 4 24  ? 68.694 18.686 6.243   1.00 55.56  ? 808 VAL J O     1 
ATOM 3530 C CB    . VAL H 4 24  ? 69.988 17.475 8.448   1.00 56.14  ? 808 VAL J CB    1 
ATOM 3531 C CG1   . VAL H 4 24  ? 71.390 17.973 8.126   1.00 58.35  ? 808 VAL J CG1   1 
ATOM 3532 C CG2   . VAL H 4 24  ? 70.014 16.627 9.700   1.00 65.23  ? 808 VAL J CG2   1 
ATOM 3533 N N     . LYS H 4 25  ? 68.820 20.681 7.276   1.00 54.44  ? 809 LYS J N     1 
ATOM 3534 C CA    . LYS H 4 25  ? 68.650 21.438 6.046   1.00 51.13  ? 809 LYS J CA    1 
ATOM 3535 C C     . LYS H 4 25  ? 69.803 21.165 5.091   1.00 53.10  ? 809 LYS J C     1 
ATOM 3536 O O     . LYS H 4 25  ? 70.914 21.655 5.288   1.00 58.01  ? 809 LYS J O     1 
ATOM 3537 C CB    . LYS H 4 25  ? 68.553 22.936 6.349   1.00 52.65  ? 809 LYS J CB    1 
ATOM 3538 C CG    . LYS H 4 25  ? 68.433 23.823 5.117   1.00 51.83  ? 809 LYS J CG    1 
ATOM 3539 C CD    . LYS H 4 25  ? 68.112 25.259 5.505   1.00 62.93  ? 809 LYS J CD    1 
ATOM 3540 C CE    . LYS H 4 25  ? 68.011 26.177 4.290   1.00 75.91  ? 809 LYS J CE    1 
ATOM 3541 N NZ    . LYS H 4 25  ? 69.331 26.429 3.642   1.00 79.53  ? 809 LYS J NZ    1 
ATOM 3542 N N     . GLU H 4 26  ? 69.533 20.331 4.091   1.00 52.05  ? 810 GLU J N     1 
ATOM 3543 C CA    . GLU H 4 26  ? 70.508 19.963 3.063   1.00 55.43  ? 810 GLU J CA    1 
ATOM 3544 C C     . GLU H 4 26  ? 71.696 19.107 3.529   1.00 53.56  ? 810 GLU J C     1 
ATOM 3545 O O     . GLU H 4 26  ? 72.832 19.587 3.601   1.00 57.35  ? 810 GLU J O     1 
ATOM 3546 C CB    . GLU H 4 26  ? 71.033 21.212 2.337   1.00 57.82  ? 810 GLU J CB    1 
ATOM 3547 C CG    . GLU H 4 26  ? 69.969 22.092 1.693   1.00 61.63  ? 810 GLU J CG    1 
ATOM 3548 C CD    . GLU H 4 26  ? 70.557 23.312 0.999   1.00 69.48  ? 810 GLU J CD    1 
ATOM 3549 O OE1   . GLU H 4 26  ? 71.547 23.889 1.506   1.00 73.03  ? 810 GLU J OE1   1 
ATOM 3550 O OE2   . GLU H 4 26  ? 70.024 23.699 -0.061  1.00 74.06  ? 810 GLU J OE2   1 
ATOM 3551 N N     . PRO H 4 27  ? 71.450 17.828 3.857   1.00 47.43  ? 811 PRO J N     1 
ATOM 3552 C CA    . PRO H 4 27  ? 72.539 16.948 4.299   1.00 50.33  ? 811 PRO J CA    1 
ATOM 3553 C C     . PRO H 4 27  ? 73.468 16.609 3.129   1.00 57.47  ? 811 PRO J C     1 
ATOM 3554 O O     . PRO H 4 27  ? 73.102 16.797 1.965   1.00 57.63  ? 811 PRO J O     1 
ATOM 3555 C CB    . PRO H 4 27  ? 71.793 15.715 4.804   1.00 47.84  ? 811 PRO J CB    1 
ATOM 3556 C CG    . PRO H 4 27  ? 70.560 15.698 3.966   1.00 40.04  ? 811 PRO J CG    1 
ATOM 3557 C CD    . PRO H 4 27  ? 70.151 17.143 3.960   1.00 39.66  ? 811 PRO J CD    1 
ATOM 3558 N N     . VAL H 4 28  ? 74.656 16.090 3.433   1.00 61.48  ? 812 VAL J N     1 
ATOM 3559 C CA    . VAL H 4 28  ? 75.626 15.747 2.394   1.00 57.43  ? 812 VAL J CA    1 
ATOM 3560 C C     . VAL H 4 28  ? 75.087 14.693 1.429   1.00 52.13  ? 812 VAL J C     1 
ATOM 3561 O O     . VAL H 4 28  ? 75.444 14.677 0.251   1.00 45.09  ? 812 VAL J O     1 
ATOM 3562 C CB    . VAL H 4 28  ? 76.976 15.305 3.011   1.00 61.10  ? 812 VAL J CB    1 
ATOM 3563 C CG1   . VAL H 4 28  ? 77.900 14.732 1.940   1.00 66.57  ? 812 VAL J CG1   1 
ATOM 3564 C CG2   . VAL H 4 28  ? 77.651 16.503 3.683   1.00 62.55  ? 812 VAL J CG2   1 
ATOM 3565 N N     . LYS H 4 29  ? 74.190 13.847 1.926   1.00 52.20  ? 813 LYS J N     1 
ATOM 3566 C CA    . LYS H 4 29  ? 73.577 12.804 1.112   1.00 48.99  ? 813 LYS J CA    1 
ATOM 3567 C C     . LYS H 4 29  ? 72.633 13.455 0.098   1.00 41.74  ? 813 LYS J C     1 
ATOM 3568 O O     . LYS H 4 29  ? 72.486 12.978 -1.025  1.00 38.76  ? 813 LYS J O     1 
ATOM 3569 C CB    . LYS H 4 29  ? 72.798 11.834 2.010   1.00 54.48  ? 813 LYS J CB    1 
ATOM 3570 C CG    . LYS H 4 29  ? 72.426 10.508 1.356   1.00 61.72  ? 813 LYS J CG    1 
ATOM 3571 C CD    . LYS H 4 29  ? 71.696 9.599  2.341   1.00 71.04  ? 813 LYS J CD    1 
ATOM 3572 C CE    . LYS H 4 29  ? 71.545 8.181  1.799   1.00 80.65  ? 813 LYS J CE    1 
ATOM 3573 N NZ    . LYS H 4 29  ? 70.807 7.298  2.752   1.00 88.98  ? 813 LYS J NZ    1 
ATOM 3574 N N     . GLU H 4 30  ? 72.027 14.569 0.499   1.00 34.27  ? 814 GLU J N     1 
ATOM 3575 C CA    . GLU H 4 30  ? 71.096 15.294 -0.350  1.00 33.22  ? 814 GLU J CA    1 
ATOM 3576 C C     . GLU H 4 30  ? 71.784 15.987 -1.509  1.00 35.44  ? 814 GLU J C     1 
ATOM 3577 O O     . GLU H 4 30  ? 71.251 16.017 -2.615  1.00 40.92  ? 814 GLU J O     1 
ATOM 3578 C CB    . GLU H 4 30  ? 70.308 16.313 0.471   1.00 43.20  ? 814 GLU J CB    1 
ATOM 3579 C CG    . GLU H 4 30  ? 69.220 17.059 -0.300  1.00 56.35  ? 814 GLU J CG    1 
ATOM 3580 C CD    . GLU H 4 30  ? 68.103 16.156 -0.812  1.00 70.14  ? 814 GLU J CD    1 
ATOM 3581 O OE1   . GLU H 4 30  ? 68.045 14.964 -0.426  1.00 71.42  ? 814 GLU J OE1   1 
ATOM 3582 O OE2   . GLU H 4 30  ? 67.272 16.649 -1.606  1.00 79.10  ? 814 GLU J OE2   1 
ATOM 3583 N N     . LEU H 4 31  ? 72.947 16.580 -1.260  1.00 35.17  ? 815 LEU J N     1 
ATOM 3584 C CA    . LEU H 4 31  ? 73.663 17.245 -2.340  1.00 36.61  ? 815 LEU J CA    1 
ATOM 3585 C C     . LEU H 4 31  ? 74.159 16.173 -3.298  1.00 39.88  ? 815 LEU J C     1 
ATOM 3586 O O     . LEU H 4 31  ? 74.053 16.320 -4.514  1.00 38.45  ? 815 LEU J O     1 
ATOM 3587 C CB    . LEU H 4 31  ? 74.829 18.084 -1.812  1.00 41.57  ? 815 LEU J CB    1 
ATOM 3588 C CG    . LEU H 4 31  ? 74.515 19.311 -0.944  1.00 47.27  ? 815 LEU J CG    1 
ATOM 3589 C CD1   . LEU H 4 31  ? 73.174 19.924 -1.340  1.00 47.26  ? 815 LEU J CD1   1 
ATOM 3590 C CD2   . LEU H 4 31  ? 74.504 18.924 0.521   1.00 53.47  ? 815 LEU J CD2   1 
ATOM 3591 N N     . LEU H 4 32  ? 74.631 15.062 -2.736  1.00 47.20  ? 816 LEU J N     1 
ATOM 3592 C CA    . LEU H 4 32  ? 75.117 13.938 -3.532  1.00 51.40  ? 816 LEU J CA    1 
ATOM 3593 C C     . LEU H 4 32  ? 73.958 13.127 -4.117  1.00 53.68  ? 816 LEU J C     1 
ATOM 3594 O O     . LEU H 4 32  ? 74.136 11.987 -4.550  1.00 59.05  ? 816 LEU J O     1 
ATOM 3595 C CB    . LEU H 4 32  ? 76.055 13.042 -2.710  1.00 50.89  ? 816 LEU J CB    1 
ATOM 3596 C CG    . LEU H 4 32  ? 77.558 13.311 -2.869  1.00 54.56  ? 816 LEU J CG    1 
ATOM 3597 C CD1   . LEU H 4 32  ? 77.910 14.743 -2.482  1.00 67.39  ? 816 LEU J CD1   1 
ATOM 3598 C CD2   . LEU H 4 32  ? 78.343 12.336 -2.025  1.00 62.82  ? 816 LEU J CD2   1 
ATOM 3599 N N     . ARG H 4 33  ? 72.764 13.717 -4.077  1.00 55.97  ? 817 ARG J N     1 
ATOM 3600 C CA    . ARG H 4 33  ? 71.555 13.113 -4.629  1.00 56.27  ? 817 ARG J CA    1 
ATOM 3601 C C     . ARG H 4 33  ? 71.090 13.992 -5.783  1.00 53.80  ? 817 ARG J C     1 
ATOM 3602 O O     . ARG H 4 33  ? 70.821 13.501 -6.872  1.00 54.85  ? 817 ARG J O     1 
ATOM 3603 C CB    . ARG H 4 33  ? 70.433 13.042 -3.587  1.00 56.36  ? 817 ARG J CB    1 
ATOM 3604 C CG    . ARG H 4 33  ? 69.043 12.859 -4.208  1.00 52.05  ? 817 ARG J CG    1 
ATOM 3605 C CD    . ARG H 4 33  ? 67.942 13.411 -3.325  1.00 45.02  ? 817 ARG J CD    1 
ATOM 3606 N NE    . ARG H 4 33  ? 66.826 13.935 -4.110  1.00 43.42  ? 817 ARG J NE    1 
ATOM 3607 C CZ    . ARG H 4 33  ? 65.619 14.199 -3.616  1.00 62.83  ? 817 ARG J CZ    1 
ATOM 3608 N NH1   . ARG H 4 33  ? 65.356 13.990 -2.331  1.00 78.35  ? 817 ARG J NH1   1 
ATOM 3609 N NH2   . ARG H 4 33  ? 64.671 14.679 -4.407  1.00 71.00  ? 817 ARG J NH2   1 
ATOM 3610 N N     . ARG H 4 34  ? 70.990 15.294 -5.524  1.00 46.75  ? 818 ARG J N     1 
ATOM 3611 C CA    . ARG H 4 34  ? 70.547 16.251 -6.529  1.00 48.33  ? 818 ARG J CA    1 
ATOM 3612 C C     . ARG H 4 34  ? 71.546 16.318 -7.667  1.00 50.96  ? 818 ARG J C     1 
ATOM 3613 O O     . ARG H 4 34  ? 71.179 16.589 -8.811  1.00 55.15  ? 818 ARG J O     1 
ATOM 3614 C CB    . ARG H 4 34  ? 70.388 17.639 -5.915  1.00 59.43  ? 818 ARG J CB    1 
ATOM 3615 C CG    . ARG H 4 34  ? 69.488 17.691 -4.692  1.00 65.43  ? 818 ARG J CG    1 
ATOM 3616 C CD    . ARG H 4 34  ? 69.351 19.120 -4.196  1.00 63.40  ? 818 ARG J CD    1 
ATOM 3617 N NE    . ARG H 4 34  ? 68.713 19.193 -2.886  1.00 61.85  ? 818 ARG J NE    1 
ATOM 3618 C CZ    . ARG H 4 34  ? 68.602 20.308 -2.171  1.00 68.10  ? 818 ARG J CZ    1 
ATOM 3619 N NH1   . ARG H 4 34  ? 69.083 21.453 -2.639  1.00 67.69  ? 818 ARG J NH1   1 
ATOM 3620 N NH2   . ARG H 4 34  ? 68.021 20.277 -0.979  1.00 69.06  ? 818 ARG J NH2   1 
ATOM 3621 N N     . LYS H 4 35  ? 72.812 16.085 -7.332  1.00 53.09  ? 819 LYS J N     1 
ATOM 3622 C CA    . LYS H 4 35  ? 73.903 16.092 -8.301  1.00 57.23  ? 819 LYS J CA    1 
ATOM 3623 C C     . LYS H 4 35  ? 73.708 14.989 -9.337  1.00 56.11  ? 819 LYS J C     1 
ATOM 3624 O O     . LYS H 4 35  ? 73.908 15.196 -10.532 1.00 51.54  ? 819 LYS J O     1 
ATOM 3625 C CB    . LYS H 4 35  ? 75.234 15.847 -7.580  1.00 58.63  ? 819 LYS J CB    1 
ATOM 3626 C CG    . LYS H 4 35  ? 76.023 17.095 -7.208  1.00 63.09  ? 819 LYS J CG    1 
ATOM 3627 C CD    . LYS H 4 35  ? 76.837 17.612 -8.388  1.00 64.34  ? 819 LYS J CD    1 
ATOM 3628 C CE    . LYS H 4 35  ? 77.755 18.757 -7.982  1.00 64.41  ? 819 LYS J CE    1 
ATOM 3629 N NZ    . LYS H 4 35  ? 77.003 19.966 -7.532  1.00 71.08  ? 819 LYS J NZ    1 
ATOM 3630 N N     . ARG H 4 36  ? 73.275 13.829 -8.859  1.00 59.56  ? 820 ARG J N     1 
ATOM 3631 C CA    . ARG H 4 36  ? 73.085 12.651 -9.698  1.00 64.45  ? 820 ARG J CA    1 
ATOM 3632 C C     . ARG H 4 36  ? 71.666 12.410 -10.236 1.00 66.95  ? 820 ARG J C     1 
ATOM 3633 O O     . ARG H 4 36  ? 71.496 11.876 -11.334 1.00 67.59  ? 820 ARG J O     1 
ATOM 3634 C CB    . ARG H 4 36  ? 73.567 11.425 -8.913  1.00 63.02  ? 820 ARG J CB    1 
ATOM 3635 C CG    . ARG H 4 36  ? 74.922 11.644 -8.238  1.00 53.95  ? 820 ARG J CG    1 
ATOM 3636 C CD    . ARG H 4 36  ? 75.358 10.462 -7.392  1.00 61.58  ? 820 ARG J CD    1 
ATOM 3637 N NE    . ARG H 4 36  ? 76.699 10.659 -6.838  1.00 64.60  ? 820 ARG J NE    1 
ATOM 3638 C CZ    . ARG H 4 36  ? 77.089 10.236 -5.638  1.00 62.59  ? 820 ARG J CZ    1 
ATOM 3639 N NH1   . ARG H 4 36  ? 76.243 9.585  -4.850  1.00 69.45  ? 820 ARG J NH1   1 
ATOM 3640 N NH2   . ARG H 4 36  ? 78.326 10.470 -5.220  1.00 39.91  ? 820 ARG J NH2   1 
ATOM 3641 N N     . GLY H 4 37  ? 70.660 12.829 -9.472  1.00 66.14  ? 821 GLY J N     1 
ATOM 3642 C CA    . GLY H 4 37  ? 69.270 12.624 -9.848  1.00 57.21  ? 821 GLY J CA    1 
ATOM 3643 C C     . GLY H 4 37  ? 68.572 11.771 -8.795  1.00 52.91  ? 821 GLY J C     1 
ATOM 3644 O O     . GLY H 4 37  ? 69.126 11.540 -7.719  1.00 50.98  ? 821 GLY J O     1 
ATOM 3645 N N     . HIS H 4 38  ? 67.356 11.318 -9.097  1.00 50.35  ? 822 HIS J N     1 
ATOM 3646 C CA    . HIS H 4 38  ? 66.563 10.474 -8.191  1.00 44.35  ? 822 HIS J CA    1 
ATOM 3647 C C     . HIS H 4 38  ? 65.910 11.223 -7.032  1.00 41.41  ? 822 HIS J C     1 
ATOM 3648 O O     . HIS H 4 38  ? 65.079 10.584 -6.346  1.00 28.77  ? 822 HIS J O     1 
ATOM 3649 C CB    . HIS H 4 38  ? 67.410 9.322  -7.645  1.00 39.45  ? 822 HIS J CB    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   201 201 DT  T   M . n 
A 1 2   DG  2   202 202 DG  G   M . n 
A 1 3   DT  3   203 203 DT  T   M . n 
A 1 4   DA  4   204 204 DA  A   M . n 
A 1 5   DT  5   205 205 DT  T   M . n 
A 1 6   DG  6   206 206 DG  G   M . n 
A 1 7   DC  7   207 207 DC  C   M . n 
A 1 8   DA  8   208 208 DA  A   M . n 
A 1 9   DA  9   209 209 DA  A   M . n 
A 1 10  DA  10  210 210 DA  A   M . n 
A 1 11  DT  11  211 211 DT  T   M . n 
A 1 12  DA  12  212 212 DA  A   M . n 
A 1 13  DA  13  213 213 DA  A   M . n 
A 1 14  DG  14  214 214 DG  G   M . n 
A 1 15  DG  15  215 215 DG  G   M . n 
B 2 1   DA  1   216 216 DA  A   N . n 
B 2 2   DC  2   217 217 DC  C   N . n 
B 2 3   DC  3   218 218 DC  C   N . n 
B 2 4   DT  4   219 219 DT  T   N . n 
B 2 5   DT  5   220 220 DT  T   N . n 
B 2 6   DA  6   221 221 DA  A   N . n 
B 2 7   DT  7   222 222 DT  T   N . n 
B 2 8   DT  8   223 223 DT  T   N . n 
B 2 9   DT  9   224 224 DT  T   N . n 
B 2 10  DG  10  225 225 DG  G   N . n 
B 2 11  DC  11  226 226 DC  C   N . n 
B 2 12  DA  12  227 227 DA  A   N . n 
B 2 13  DT  13  228 228 DT  T   N . n 
B 2 14  DA  14  229 229 DA  A   N . n 
B 2 15  DC  15  230 230 DC  C   N . n 
C 1 1   DT  1   701 ?   ?   ?   O . n 
C 1 2   DG  2   702 702 DG  G   O . n 
C 1 3   DT  3   703 703 DT  T   O . n 
C 1 4   DA  4   704 704 DA  A   O . n 
C 1 5   DT  5   705 705 DT  T   O . n 
C 1 6   DG  6   706 706 DG  G   O . n 
C 1 7   DC  7   707 707 DC  C   O . n 
C 1 8   DA  8   708 708 DA  A   O . n 
C 1 9   DA  9   709 709 DA  A   O . n 
C 1 10  DA  10  710 710 DA  A   O . n 
C 1 11  DT  11  711 711 DT  T   O . n 
C 1 12  DA  12  712 712 DA  A   O . n 
C 1 13  DA  13  713 713 DA  A   O . n 
C 1 14  DG  14  714 714 DG  G   O . n 
C 1 15  DG  15  715 715 DG  G   O . n 
D 2 1   DA  1   716 ?   ?   ?   P . n 
D 2 2   DC  2   717 717 DC  C   P . n 
D 2 3   DC  3   718 718 DC  C   P . n 
D 2 4   DT  4   719 719 DT  T   P . n 
D 2 5   DT  5   720 720 DT  T   P . n 
D 2 6   DA  6   721 721 DA  A   P . n 
D 2 7   DT  7   722 722 DT  T   P . n 
D 2 8   DT  8   723 723 DT  T   P . n 
D 2 9   DT  9   724 724 DT  T   P . n 
D 2 10  DG  10  725 725 DG  G   P . n 
D 2 11  DC  11  726 726 DC  C   P . n 
D 2 12  DA  12  727 727 DA  A   P . n 
D 2 13  DT  13  728 728 DT  T   P . n 
D 2 14  DA  14  729 729 DA  A   P . n 
D 2 15  DC  15  730 730 DC  C   P . n 
E 3 1   GLY 1   -2  ?   ?   ?   A . n 
E 3 2   SER 2   -1  ?   ?   ?   A . n 
E 3 3   ARG 3   0   ?   ?   ?   A . n 
E 3 4   GLU 4   1   ?   ?   ?   A . n 
E 3 5   GLU 5   2   2   GLU GLU A . n 
E 3 6   PRO 6   3   3   PRO PRO A . n 
E 3 7   SER 7   4   4   SER SER A . n 
E 3 8   ASP 8   5   5   ASP ASP A . n 
E 3 9   LEU 9   6   6   LEU LEU A . n 
E 3 10  GLU 10  7   7   GLU GLU A . n 
E 3 11  GLU 11  8   8   GLU GLU A . n 
E 3 12  LEU 12  9   9   LEU LEU A . n 
E 3 13  GLU 13  10  10  GLU GLU A . n 
E 3 14  GLN 14  11  11  GLN GLN A . n 
E 3 15  PHE 15  12  12  PHE PHE A . n 
E 3 16  ALA 16  13  13  ALA ALA A . n 
E 3 17  LYS 17  14  14  LYS LYS A . n 
E 3 18  THR 18  15  15  THR THR A . n 
E 3 19  PHE 19  16  16  PHE PHE A . n 
E 3 20  LYS 20  17  17  LYS LYS A . n 
E 3 21  GLN 21  18  18  GLN GLN A . n 
E 3 22  ARG 22  19  19  ARG ARG A . n 
E 3 23  ARG 23  20  20  ARG ARG A . n 
E 3 24  ILE 24  21  21  ILE ILE A . n 
E 3 25  LYS 25  22  22  LYS LYS A . n 
E 3 26  LEU 26  23  23  LEU LEU A . n 
E 3 27  GLY 27  24  24  GLY GLY A . n 
E 3 28  PHE 28  25  25  PHE PHE A . n 
E 3 29  THR 29  26  26  THR THR A . n 
E 3 30  GLN 30  27  27  GLN GLN A . n 
E 3 31  GLY 31  28  28  GLY GLY A . n 
E 3 32  ASP 32  29  29  ASP ASP A . n 
E 3 33  VAL 33  30  30  VAL VAL A . n 
E 3 34  GLY 34  31  31  GLY GLY A . n 
E 3 35  LEU 35  32  32  LEU LEU A . n 
E 3 36  ALA 36  33  33  ALA ALA A . n 
E 3 37  MET 37  34  34  MET MET A . n 
E 3 38  GLY 38  35  35  GLY GLY A . n 
E 3 39  LYS 39  36  36  LYS LYS A . n 
E 3 40  LEU 40  37  37  LEU LEU A . n 
E 3 41  TYR 41  38  38  TYR TYR A . n 
E 3 42  GLY 42  39  39  GLY GLY A . n 
E 3 43  ASN 43  40  40  ASN ASN A . n 
E 3 44  ASP 44  41  41  ASP ASP A . n 
E 3 45  PHE 45  42  42  PHE PHE A . n 
E 3 46  SER 46  43  43  SER SER A . n 
E 3 47  GLN 47  44  44  GLN GLN A . n 
E 3 48  THR 48  45  45  THR THR A . n 
E 3 49  THR 49  46  46  THR THR A . n 
E 3 50  ILE 50  47  47  ILE ILE A . n 
E 3 51  SER 51  48  48  SER SER A . n 
E 3 52  ARG 52  49  49  ARG ARG A . n 
E 3 53  PHE 53  50  50  PHE PHE A . n 
E 3 54  GLU 54  51  51  GLU GLU A . n 
E 3 55  ALA 55  52  52  ALA ALA A . n 
E 3 56  LEU 56  53  53  LEU LEU A . n 
E 3 57  ASN 57  54  54  ASN ASN A . n 
E 3 58  LEU 58  55  55  LEU LEU A . n 
E 3 59  SER 59  56  56  SER SER A . n 
E 3 60  PHE 60  57  57  PHE PHE A . n 
E 3 61  LYS 61  58  58  LYS LYS A . n 
E 3 62  ASN 62  59  59  ASN ASN A . n 
E 3 63  MET 63  60  60  MET MET A . n 
E 3 64  CYS 64  61  61  CYS CYS A . n 
E 3 65  LYS 65  62  62  LYS LYS A . n 
E 3 66  LEU 66  63  63  LEU LEU A . n 
E 3 67  LYS 67  64  64  LYS LYS A . n 
E 3 68  PRO 68  65  65  PRO PRO A . n 
E 3 69  LEU 69  66  66  LEU LEU A . n 
E 3 70  LEU 70  67  67  LEU LEU A . n 
E 3 71  GLU 71  68  68  GLU GLU A . n 
E 3 72  LYS 72  69  69  LYS LYS A . n 
E 3 73  TRP 73  70  70  TRP TRP A . n 
E 3 74  LEU 74  71  71  LEU LEU A . n 
E 3 75  ASN 75  72  72  ASN ASN A . n 
E 3 76  ASP 76  73  73  ASP ASP A . n 
E 3 77  ALA 77  74  74  ALA ALA A . n 
E 3 78  GLU 78  75  75  GLU GLU A . n 
E 3 79  ASN 79  77  ?   ?   ?   A . n 
E 3 80  LEU 80  78  ?   ?   ?   A . n 
E 3 81  SER 81  79  ?   ?   ?   A . n 
E 3 82  SER 82  80  ?   ?   ?   A . n 
E 3 83  ASP 83  81  ?   ?   ?   A . n 
E 3 84  SER 84  82  ?   ?   ?   A . n 
E 3 85  SER 85  83  ?   ?   ?   A . n 
E 3 86  LEU 86  84  ?   ?   ?   A . n 
E 3 87  SER 87  85  ?   ?   ?   A . n 
E 3 88  SER 88  86  ?   ?   ?   A . n 
E 3 89  PRO 89  87  ?   ?   ?   A . n 
E 3 90  SER 90  88  ?   ?   ?   A . n 
E 3 91  ALA 91  89  ?   ?   ?   A . n 
E 3 92  LEU 92  90  ?   ?   ?   A . n 
E 3 93  ASN 93  91  ?   ?   ?   A . n 
E 3 94  SER 94  92  ?   ?   ?   A . n 
E 3 95  PRO 95  93  ?   ?   ?   A . n 
E 3 96  GLY 96  94  ?   ?   ?   A . n 
E 3 97  ILE 97  95  ?   ?   ?   A . n 
E 3 98  GLU 98  96  ?   ?   ?   A . n 
E 3 99  GLY 99  97  ?   ?   ?   A . n 
E 3 100 LEU 100 98  ?   ?   ?   A . n 
E 3 101 SER 101 99  ?   ?   ?   A . n 
E 3 102 ARG 102 100 ?   ?   ?   A . n 
E 3 103 ARG 103 101 ?   ?   ?   A . n 
E 3 104 ARG 104 102 102 ARG ARG A . n 
E 3 105 LYS 105 103 103 LYS LYS A . n 
E 3 106 LYS 106 104 104 LYS LYS A . n 
E 3 107 ARG 107 105 105 ARG ARG A . n 
E 3 108 THR 108 106 106 THR THR A . n 
E 3 109 SER 109 107 107 SER SER A . n 
E 3 110 ILE 110 108 108 ILE ILE A . n 
E 3 111 GLU 111 109 109 GLU GLU A . n 
E 3 112 THR 112 110 110 THR THR A . n 
E 3 113 ASN 113 111 111 ASN ASN A . n 
E 3 114 ILE 114 112 112 ILE ILE A . n 
E 3 115 ARG 115 113 113 ARG ARG A . n 
E 3 116 VAL 116 114 114 VAL VAL A . n 
E 3 117 ALA 117 115 115 ALA ALA A . n 
E 3 118 LEU 118 116 116 LEU LEU A . n 
E 3 119 GLU 119 117 117 GLU GLU A . n 
E 3 120 LYS 120 118 118 LYS LYS A . n 
E 3 121 SER 121 119 119 SER SER A . n 
E 3 122 PHE 122 120 120 PHE PHE A . n 
E 3 123 LEU 123 121 121 LEU LEU A . n 
E 3 124 GLU 124 122 122 GLU GLU A . n 
E 3 125 ASN 125 123 123 ASN ASN A . n 
E 3 126 GLN 126 124 124 GLN GLN A . n 
E 3 127 LYS 127 125 125 LYS LYS A . n 
E 3 128 PRO 128 126 126 PRO PRO A . n 
E 3 129 THR 129 127 127 THR THR A . n 
E 3 130 SER 130 128 128 SER SER A . n 
E 3 131 GLU 131 129 129 GLU GLU A . n 
E 3 132 GLU 132 130 130 GLU GLU A . n 
E 3 133 ILE 133 131 131 ILE ILE A . n 
E 3 134 THR 134 132 132 THR THR A . n 
E 3 135 MET 135 133 133 MET MET A . n 
E 3 136 ILE 136 134 134 ILE ILE A . n 
E 3 137 ALA 137 135 135 ALA ALA A . n 
E 3 138 ASP 138 136 136 ASP ASP A . n 
E 3 139 GLN 139 137 137 GLN GLN A . n 
E 3 140 LEU 140 138 138 LEU LEU A . n 
E 3 141 ASN 141 139 139 ASN ASN A . n 
E 3 142 MET 142 140 140 MET MET A . n 
E 3 143 GLU 143 141 141 GLU GLU A . n 
E 3 144 LYS 144 142 142 LYS LYS A . n 
E 3 145 GLU 145 143 143 GLU GLU A . n 
E 3 146 VAL 146 144 144 VAL VAL A . n 
E 3 147 ILE 147 145 145 ILE ILE A . n 
E 3 148 ARG 148 146 146 ARG ARG A . n 
E 3 149 VAL 149 147 147 VAL VAL A . n 
E 3 150 TRP 150 148 148 TRP TRP A . n 
E 3 151 PHE 151 149 149 PHE PHE A . n 
E 3 152 CYS 152 150 150 CYS CYS A . n 
E 3 153 ASN 153 151 151 ASN ASN A . n 
E 3 154 ARG 154 152 152 ARG ARG A . n 
E 3 155 ARG 155 153 153 ARG ARG A . n 
E 3 156 GLN 156 154 154 GLN GLN A . n 
E 3 157 LYS 157 155 155 LYS LYS A . n 
E 3 158 GLU 158 156 156 GLU GLU A . n 
E 3 159 LYS 159 157 157 LYS LYS A . n 
E 3 160 ARG 160 158 158 ARG ARG A . n 
E 3 161 ILE 161 159 159 ILE ILE A . n 
E 3 162 ASN 162 160 160 ASN ASN A . n 
E 3 163 PRO 163 161 161 PRO PRO A . n 
F 3 1   GLY 1   498 ?   ?   ?   B . n 
F 3 2   SER 2   499 ?   ?   ?   B . n 
F 3 3   ARG 3   500 ?   ?   ?   B . n 
F 3 4   GLU 4   501 ?   ?   ?   B . n 
F 3 5   GLU 5   502 ?   ?   ?   B . n 
F 3 6   PRO 6   503 ?   ?   ?   B . n 
F 3 7   SER 7   504 ?   ?   ?   B . n 
F 3 8   ASP 8   505 505 ASP ASP B . n 
F 3 9   LEU 9   506 506 LEU LEU B . n 
F 3 10  GLU 10  507 507 GLU GLU B . n 
F 3 11  GLU 11  508 508 GLU GLU B . n 
F 3 12  LEU 12  509 509 LEU LEU B . n 
F 3 13  GLU 13  510 510 GLU GLU B . n 
F 3 14  GLN 14  511 511 GLN GLN B . n 
F 3 15  PHE 15  512 512 PHE PHE B . n 
F 3 16  ALA 16  513 513 ALA ALA B . n 
F 3 17  LYS 17  514 514 LYS LYS B . n 
F 3 18  THR 18  515 515 THR THR B . n 
F 3 19  PHE 19  516 516 PHE PHE B . n 
F 3 20  LYS 20  517 517 LYS LYS B . n 
F 3 21  GLN 21  518 518 GLN GLN B . n 
F 3 22  ARG 22  519 519 ARG ARG B . n 
F 3 23  ARG 23  520 520 ARG ARG B . n 
F 3 24  ILE 24  521 521 ILE ILE B . n 
F 3 25  LYS 25  522 522 LYS LYS B . n 
F 3 26  LEU 26  523 523 LEU LEU B . n 
F 3 27  GLY 27  524 524 GLY GLY B . n 
F 3 28  PHE 28  525 525 PHE PHE B . n 
F 3 29  THR 29  526 526 THR THR B . n 
F 3 30  GLN 30  527 527 GLN GLN B . n 
F 3 31  GLY 31  528 528 GLY GLY B . n 
F 3 32  ASP 32  529 529 ASP ASP B . n 
F 3 33  VAL 33  530 530 VAL VAL B . n 
F 3 34  GLY 34  531 531 GLY GLY B . n 
F 3 35  LEU 35  532 532 LEU LEU B . n 
F 3 36  ALA 36  533 533 ALA ALA B . n 
F 3 37  MET 37  534 534 MET MET B . n 
F 3 38  GLY 38  535 535 GLY GLY B . n 
F 3 39  LYS 39  536 536 LYS LYS B . n 
F 3 40  LEU 40  537 537 LEU LEU B . n 
F 3 41  TYR 41  538 538 TYR TYR B . n 
F 3 42  GLY 42  539 ?   ?   ?   B . n 
F 3 43  ASN 43  540 540 ASN ASN B . n 
F 3 44  ASP 44  541 541 ASP ASP B . n 
F 3 45  PHE 45  542 542 PHE PHE B . n 
F 3 46  SER 46  543 543 SER SER B . n 
F 3 47  GLN 47  544 544 GLN GLN B . n 
F 3 48  THR 48  545 545 THR THR B . n 
F 3 49  THR 49  546 546 THR THR B . n 
F 3 50  ILE 50  547 547 ILE ILE B . n 
F 3 51  SER 51  548 548 SER SER B . n 
F 3 52  ARG 52  549 549 ARG ARG B . n 
F 3 53  PHE 53  550 550 PHE PHE B . n 
F 3 54  GLU 54  551 551 GLU GLU B . n 
F 3 55  ALA 55  552 552 ALA ALA B . n 
F 3 56  LEU 56  553 553 LEU LEU B . n 
F 3 57  ASN 57  554 554 ASN ASN B . n 
F 3 58  LEU 58  555 555 LEU LEU B . n 
F 3 59  SER 59  556 556 SER SER B . n 
F 3 60  PHE 60  557 557 PHE PHE B . n 
F 3 61  LYS 61  558 558 LYS LYS B . n 
F 3 62  ASN 62  559 559 ASN ASN B . n 
F 3 63  MET 63  560 560 MET MET B . n 
F 3 64  CYS 64  561 561 CYS CYS B . n 
F 3 65  LYS 65  562 562 LYS LYS B . n 
F 3 66  LEU 66  563 563 LEU LEU B . n 
F 3 67  LYS 67  564 564 LYS LYS B . n 
F 3 68  PRO 68  565 565 PRO PRO B . n 
F 3 69  LEU 69  566 566 LEU LEU B . n 
F 3 70  LEU 70  567 567 LEU LEU B . n 
F 3 71  GLU 71  568 568 GLU GLU B . n 
F 3 72  LYS 72  569 569 LYS LYS B . n 
F 3 73  TRP 73  570 570 TRP TRP B . n 
F 3 74  LEU 74  571 571 LEU LEU B . n 
F 3 75  ASN 75  572 572 ASN ASN B . n 
F 3 76  ASP 76  573 573 ASP ASP B . n 
F 3 77  ALA 77  574 574 ALA ALA B . n 
F 3 78  GLU 78  575 575 GLU GLU B . n 
F 3 79  ASN 79  577 ?   ?   ?   B . n 
F 3 80  LEU 80  578 ?   ?   ?   B . n 
F 3 81  SER 81  579 ?   ?   ?   B . n 
F 3 82  SER 82  580 ?   ?   ?   B . n 
F 3 83  ASP 83  581 ?   ?   ?   B . n 
F 3 84  SER 84  582 ?   ?   ?   B . n 
F 3 85  SER 85  583 ?   ?   ?   B . n 
F 3 86  LEU 86  584 ?   ?   ?   B . n 
F 3 87  SER 87  585 ?   ?   ?   B . n 
F 3 88  SER 88  586 ?   ?   ?   B . n 
F 3 89  PRO 89  587 ?   ?   ?   B . n 
F 3 90  SER 90  588 ?   ?   ?   B . n 
F 3 91  ALA 91  589 ?   ?   ?   B . n 
F 3 92  LEU 92  590 ?   ?   ?   B . n 
F 3 93  ASN 93  591 ?   ?   ?   B . n 
F 3 94  SER 94  592 ?   ?   ?   B . n 
F 3 95  PRO 95  593 ?   ?   ?   B . n 
F 3 96  GLY 96  594 ?   ?   ?   B . n 
F 3 97  ILE 97  595 ?   ?   ?   B . n 
F 3 98  GLU 98  596 ?   ?   ?   B . n 
F 3 99  GLY 99  597 ?   ?   ?   B . n 
F 3 100 LEU 100 598 ?   ?   ?   B . n 
F 3 101 SER 101 599 ?   ?   ?   B . n 
F 3 102 ARG 102 600 ?   ?   ?   B . n 
F 3 103 ARG 103 601 ?   ?   ?   B . n 
F 3 104 ARG 104 602 602 ARG ARG B . n 
F 3 105 LYS 105 603 603 LYS LYS B . n 
F 3 106 LYS 106 604 604 LYS LYS B . n 
F 3 107 ARG 107 605 605 ARG ARG B . n 
F 3 108 THR 108 606 606 THR THR B . n 
F 3 109 SER 109 607 607 SER SER B . n 
F 3 110 ILE 110 608 608 ILE ILE B . n 
F 3 111 GLU 111 609 609 GLU GLU B . n 
F 3 112 THR 112 610 610 THR THR B . n 
F 3 113 ASN 113 611 611 ASN ASN B . n 
F 3 114 ILE 114 612 612 ILE ILE B . n 
F 3 115 ARG 115 613 613 ARG ARG B . n 
F 3 116 VAL 116 614 614 VAL VAL B . n 
F 3 117 ALA 117 615 615 ALA ALA B . n 
F 3 118 LEU 118 616 616 LEU LEU B . n 
F 3 119 GLU 119 617 617 GLU GLU B . n 
F 3 120 LYS 120 618 618 LYS LYS B . n 
F 3 121 SER 121 619 619 SER SER B . n 
F 3 122 PHE 122 620 620 PHE PHE B . n 
F 3 123 LEU 123 621 621 LEU LEU B . n 
F 3 124 GLU 124 622 622 GLU GLU B . n 
F 3 125 ASN 125 623 623 ASN ASN B . n 
F 3 126 GLN 126 624 624 GLN GLN B . n 
F 3 127 LYS 127 625 625 LYS LYS B . n 
F 3 128 PRO 128 626 ?   ?   ?   B . n 
F 3 129 THR 129 627 627 THR THR B . n 
F 3 130 SER 130 628 628 SER SER B . n 
F 3 131 GLU 131 629 629 GLU GLU B . n 
F 3 132 GLU 132 630 630 GLU GLU B . n 
F 3 133 ILE 133 631 631 ILE ILE B . n 
F 3 134 THR 134 632 632 THR THR B . n 
F 3 135 MET 135 633 633 MET MET B . n 
F 3 136 ILE 136 634 634 ILE ILE B . n 
F 3 137 ALA 137 635 635 ALA ALA B . n 
F 3 138 ASP 138 636 636 ASP ASP B . n 
F 3 139 GLN 139 637 637 GLN GLN B . n 
F 3 140 LEU 140 638 638 LEU LEU B . n 
F 3 141 ASN 141 639 639 ASN ASN B . n 
F 3 142 MET 142 640 640 MET MET B . n 
F 3 143 GLU 143 641 641 GLU GLU B . n 
F 3 144 LYS 144 642 642 LYS LYS B . n 
F 3 145 GLU 145 643 643 GLU GLU B . n 
F 3 146 VAL 146 644 644 VAL VAL B . n 
F 3 147 ILE 147 645 645 ILE ILE B . n 
F 3 148 ARG 148 646 646 ARG ARG B . n 
F 3 149 VAL 149 647 647 VAL VAL B . n 
F 3 150 TRP 150 648 648 TRP TRP B . n 
F 3 151 PHE 151 649 649 PHE PHE B . n 
F 3 152 CYS 152 650 650 CYS CYS B . n 
F 3 153 ASN 153 651 651 ASN ASN B . n 
F 3 154 ARG 154 652 652 ARG ARG B . n 
F 3 155 ARG 155 653 653 ARG ARG B . n 
F 3 156 GLN 156 654 654 GLN GLN B . n 
F 3 157 LYS 157 655 655 LYS LYS B . n 
F 3 158 GLU 158 656 656 GLU GLU B . n 
F 3 159 LYS 159 657 657 LYS LYS B . n 
F 3 160 ARG 160 658 658 ARG ARG B . n 
F 3 161 ILE 161 659 659 ILE ILE B . n 
F 3 162 ASN 162 660 660 ASN ASN B . n 
F 3 163 PRO 163 661 661 PRO PRO B . n 
G 4 1   MET 1   285 ?   ?   ?   I . n 
G 4 2   LEU 2   286 ?   ?   ?   I . n 
G 4 3   TRP 3   287 ?   ?   ?   I . n 
G 4 4   GLN 4   288 ?   ?   ?   I . n 
G 4 5   LYS 5   289 ?   ?   ?   I . n 
G 4 6   PRO 6   290 ?   ?   ?   I . n 
G 4 7   THR 7   291 ?   ?   ?   I . n 
G 4 8   ALA 8   292 ?   ?   ?   I . n 
G 4 9   PRO 9   293 ?   ?   ?   I . n 
G 4 10  GLU 10  294 ?   ?   ?   I . n 
G 4 11  GLN 11  295 ?   ?   ?   I . n 
G 4 12  ALA 12  296 ?   ?   ?   I . n 
G 4 13  PRO 13  297 ?   ?   ?   I . n 
G 4 14  ALA 14  298 ?   ?   ?   I . n 
G 4 15  PRO 15  299 ?   ?   ?   I . n 
G 4 16  ALA 16  300 300 ALA ALA I . n 
G 4 17  ARG 17  301 301 ARG ARG I . n 
G 4 18  PRO 18  302 302 PRO PRO I . n 
G 4 19  TYR 19  303 303 TYR TYR I . n 
G 4 20  GLN 20  304 304 GLN GLN I . n 
G 4 21  GLY 21  305 305 GLY GLY I . n 
G 4 22  VAL 22  306 306 VAL VAL I . n 
G 4 23  ARG 23  307 307 ARG ARG I . n 
G 4 24  VAL 24  308 308 VAL VAL I . n 
G 4 25  LYS 25  309 309 LYS LYS I . n 
G 4 26  GLU 26  310 310 GLU GLU I . n 
G 4 27  PRO 27  311 311 PRO PRO I . n 
G 4 28  VAL 28  312 312 VAL VAL I . n 
G 4 29  LYS 29  313 313 LYS LYS I . n 
G 4 30  GLU 30  314 314 GLU GLU I . n 
G 4 31  LEU 31  315 315 LEU LEU I . n 
G 4 32  LEU 32  316 316 LEU LEU I . n 
G 4 33  ARG 33  317 317 ARG ARG I . n 
G 4 34  ARG 34  318 318 ARG ARG I . n 
G 4 35  LYS 35  319 319 LYS LYS I . n 
G 4 36  ARG 36  320 320 ARG ARG I . n 
G 4 37  GLY 37  321 321 GLY GLY I . n 
G 4 38  HIS 38  322 ?   ?   ?   I . n 
G 4 39  ALA 39  323 ?   ?   ?   I . n 
G 4 40  SER 40  324 ?   ?   ?   I . n 
G 4 41  SER 41  325 ?   ?   ?   I . n 
G 4 42  GLY 42  326 ?   ?   ?   I . n 
G 4 43  ALA 43  327 ?   ?   ?   I . n 
G 4 44  ALA 44  328 ?   ?   ?   I . n 
H 4 1   MET 1   785 ?   ?   ?   J . n 
H 4 2   LEU 2   786 ?   ?   ?   J . n 
H 4 3   TRP 3   787 ?   ?   ?   J . n 
H 4 4   GLN 4   788 ?   ?   ?   J . n 
H 4 5   LYS 5   789 ?   ?   ?   J . n 
H 4 6   PRO 6   790 ?   ?   ?   J . n 
H 4 7   THR 7   791 ?   ?   ?   J . n 
H 4 8   ALA 8   792 ?   ?   ?   J . n 
H 4 9   PRO 9   793 ?   ?   ?   J . n 
H 4 10  GLU 10  794 ?   ?   ?   J . n 
H 4 11  GLN 11  795 ?   ?   ?   J . n 
H 4 12  ALA 12  796 ?   ?   ?   J . n 
H 4 13  PRO 13  797 ?   ?   ?   J . n 
H 4 14  ALA 14  798 ?   ?   ?   J . n 
H 4 15  PRO 15  799 ?   ?   ?   J . n 
H 4 16  ALA 16  800 800 ALA ALA J . n 
H 4 17  ARG 17  801 801 ARG ARG J . n 
H 4 18  PRO 18  802 802 PRO PRO J . n 
H 4 19  TYR 19  803 803 TYR TYR J . n 
H 4 20  GLN 20  804 804 GLN GLN J . n 
H 4 21  GLY 21  805 805 GLY GLY J . n 
H 4 22  VAL 22  806 806 VAL VAL J . n 
H 4 23  ARG 23  807 807 ARG ARG J . n 
H 4 24  VAL 24  808 808 VAL VAL J . n 
H 4 25  LYS 25  809 809 LYS LYS J . n 
H 4 26  GLU 26  810 810 GLU GLU J . n 
H 4 27  PRO 27  811 811 PRO PRO J . n 
H 4 28  VAL 28  812 812 VAL VAL J . n 
H 4 29  LYS 29  813 813 LYS LYS J . n 
H 4 30  GLU 30  814 814 GLU GLU J . n 
H 4 31  LEU 31  815 815 LEU LEU J . n 
H 4 32  LEU 32  816 816 LEU LEU J . n 
H 4 33  ARG 33  817 817 ARG ARG J . n 
H 4 34  ARG 34  818 818 ARG ARG J . n 
H 4 35  LYS 35  819 819 LYS LYS J . n 
H 4 36  ARG 36  820 820 ARG ARG J . n 
H 4 37  GLY 37  821 821 GLY GLY J . n 
H 4 38  HIS 38  822 822 HIS HIS J . n 
H 4 39  ALA 39  823 ?   ?   ?   J . n 
H 4 40  SER 40  824 ?   ?   ?   J . n 
H 4 41  SER 41  825 ?   ?   ?   J . n 
H 4 42  GLY 42  826 ?   ?   ?   J . n 
H 4 43  ALA 43  827 ?   ?   ?   J . n 
H 4 44  ALA 44  828 ?   ?   ?   J . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? tetrameric 4 
2 author_defined_assembly ? tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,E,G 
2 1 C,D,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-11-15 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          .     ? 1 
SHARP     phasing          .     ? 2 
O         'model building' .     ? 3 
X-PLOR    refinement       3.851 ? 4 
DENZO     'data reduction' .     ? 5 
SCALEPACK 'data scaling'   .     ? 6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C B ASN 660 ? ? N B PRO 661 ? ? CA B PRO 661 ? ? 128.90 119.30 9.60 1.50 Y 
2 1 C I ARG 301 ? ? N I PRO 302 ? ? CA I PRO 302 ? ? 128.53 119.30 9.23 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 SER A 4   ? ? -57.30  177.31  
2  1 SER A 43  ? ? -54.10  175.42  
3  1 ASN A 72  ? ? -56.54  -76.67  
4  1 ALA A 74  ? ? -80.82  -140.74 
5  1 ILE A 159 ? ? -65.31  -77.32  
6  1 LEU B 506 ? ? -102.54 -71.01  
7  1 THR B 526 ? ? -72.57  -151.46 
8  1 LEU B 537 ? ? -148.45 15.40   
9  1 THR B 545 ? ? -49.76  -73.03  
10 1 ALA B 574 ? ? -58.92  88.48   
11 1 LYS B 603 ? ? -46.43  101.65  
12 1 ASN B 623 ? ? 179.25  135.94  
13 1 MET B 640 ? ? -83.06  -84.11  
14 1 TYR I 303 ? ? 80.57   61.04   
15 1 LYS I 319 ? ? -81.70  36.91   
16 1 PRO J 802 ? ? -64.62  1.00    
17 1 TYR J 803 ? ? 67.71   83.55   
18 1 GLU J 810 ? ? 68.13   71.01   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 2   ? CG  ? E GLU 5   CG  
2  1 Y 1 A GLU 2   ? CD  ? E GLU 5   CD  
3  1 Y 1 A GLU 2   ? OE1 ? E GLU 5   OE1 
4  1 Y 1 A GLU 2   ? OE2 ? E GLU 5   OE2 
5  1 Y 1 A GLU 8   ? CG  ? E GLU 11  CG  
6  1 Y 1 A GLU 8   ? CD  ? E GLU 11  CD  
7  1 Y 1 A GLU 8   ? OE1 ? E GLU 11  OE1 
8  1 Y 1 A GLU 8   ? OE2 ? E GLU 11  OE2 
9  1 Y 1 A GLN 11  ? CG  ? E GLN 14  CG  
10 1 Y 1 A GLN 11  ? CD  ? E GLN 14  CD  
11 1 Y 1 A GLN 11  ? OE1 ? E GLN 14  OE1 
12 1 Y 1 A GLN 11  ? NE2 ? E GLN 14  NE2 
13 1 Y 1 A GLN 18  ? CG  ? E GLN 21  CG  
14 1 Y 1 A GLN 18  ? CD  ? E GLN 21  CD  
15 1 Y 1 A GLN 18  ? OE1 ? E GLN 21  OE1 
16 1 Y 1 A GLN 18  ? NE2 ? E GLN 21  NE2 
17 1 Y 1 A ARG 20  ? CG  ? E ARG 23  CG  
18 1 Y 1 A ARG 20  ? CD  ? E ARG 23  CD  
19 1 Y 1 A ARG 20  ? NE  ? E ARG 23  NE  
20 1 Y 1 A ARG 20  ? CZ  ? E ARG 23  CZ  
21 1 Y 1 A ARG 20  ? NH1 ? E ARG 23  NH1 
22 1 Y 1 A ARG 20  ? NH2 ? E ARG 23  NH2 
23 1 Y 1 A LYS 22  ? CG  ? E LYS 25  CG  
24 1 Y 1 A LYS 22  ? CD  ? E LYS 25  CD  
25 1 Y 1 A LYS 22  ? CE  ? E LYS 25  CE  
26 1 Y 1 A LYS 22  ? NZ  ? E LYS 25  NZ  
27 1 Y 1 A LYS 36  ? CG  ? E LYS 39  CG  
28 1 Y 1 A LYS 36  ? CD  ? E LYS 39  CD  
29 1 Y 1 A LYS 36  ? CE  ? E LYS 39  CE  
30 1 Y 1 A LYS 36  ? NZ  ? E LYS 39  NZ  
31 1 Y 1 A ASN 40  ? CG  ? E ASN 43  CG  
32 1 Y 1 A ASN 40  ? OD1 ? E ASN 43  OD1 
33 1 Y 1 A ASN 40  ? ND2 ? E ASN 43  ND2 
34 1 Y 1 A LYS 58  ? CG  ? E LYS 61  CG  
35 1 Y 1 A LYS 58  ? CD  ? E LYS 61  CD  
36 1 Y 1 A LYS 58  ? CE  ? E LYS 61  CE  
37 1 Y 1 A LYS 58  ? NZ  ? E LYS 61  NZ  
38 1 Y 1 A GLU 75  ? CG  ? E GLU 78  CG  
39 1 Y 1 A GLU 75  ? CD  ? E GLU 78  CD  
40 1 Y 1 A GLU 75  ? OE1 ? E GLU 78  OE1 
41 1 Y 1 A GLU 75  ? OE2 ? E GLU 78  OE2 
42 1 Y 1 A LYS 118 ? CG  ? E LYS 120 CG  
43 1 Y 1 A LYS 118 ? CD  ? E LYS 120 CD  
44 1 Y 1 A LYS 118 ? CE  ? E LYS 120 CE  
45 1 Y 1 A LYS 118 ? NZ  ? E LYS 120 NZ  
46 1 Y 1 A SER 128 ? OG  ? E SER 130 OG  
47 1 Y 1 B LYS 522 ? CG  ? F LYS 25  CG  
48 1 Y 1 B LYS 522 ? CD  ? F LYS 25  CD  
49 1 Y 1 B LYS 522 ? CE  ? F LYS 25  CE  
50 1 Y 1 B LYS 522 ? NZ  ? F LYS 25  NZ  
51 1 Y 1 B LYS 536 ? CG  ? F LYS 39  CG  
52 1 Y 1 B LYS 536 ? CD  ? F LYS 39  CD  
53 1 Y 1 B LYS 536 ? CE  ? F LYS 39  CE  
54 1 Y 1 B LYS 536 ? NZ  ? F LYS 39  NZ  
55 1 Y 1 B LYS 558 ? CG  ? F LYS 61  CG  
56 1 Y 1 B LYS 558 ? CD  ? F LYS 61  CD  
57 1 Y 1 B LYS 558 ? CE  ? F LYS 61  CE  
58 1 Y 1 B LYS 558 ? NZ  ? F LYS 61  NZ  
59 1 Y 1 B ILE 612 ? CG1 ? F ILE 114 CG1 
60 1 Y 1 B ILE 612 ? CG2 ? F ILE 114 CG2 
61 1 Y 1 B ILE 612 ? CD1 ? F ILE 114 CD1 
62 1 Y 1 B LYS 618 ? CG  ? F LYS 120 CG  
63 1 Y 1 B LYS 618 ? CD  ? F LYS 120 CD  
64 1 Y 1 B LYS 618 ? CE  ? F LYS 120 CE  
65 1 Y 1 B LYS 618 ? NZ  ? F LYS 120 NZ  
66 1 Y 1 B LYS 625 ? CG  ? F LYS 127 CG  
67 1 Y 1 B LYS 625 ? CD  ? F LYS 127 CD  
68 1 Y 1 B LYS 625 ? CE  ? F LYS 127 CE  
69 1 Y 1 B LYS 625 ? NZ  ? F LYS 127 NZ  
70 1 Y 1 B GLU 629 ? CG  ? F GLU 131 CG  
71 1 Y 1 B GLU 629 ? CD  ? F GLU 131 CD  
72 1 Y 1 B GLU 629 ? OE1 ? F GLU 131 OE1 
73 1 Y 1 B GLU 629 ? OE2 ? F GLU 131 OE2 
74 1 Y 1 B ILE 631 ? CG1 ? F ILE 133 CG1 
75 1 Y 1 B ILE 631 ? CG2 ? F ILE 133 CG2 
76 1 Y 1 B ILE 631 ? CD1 ? F ILE 133 CD1 
77 1 Y 1 B PRO 661 ? CG  ? F PRO 163 CG  
78 1 Y 1 B PRO 661 ? CD  ? F PRO 163 CD  
79 1 Y 1 I ARG 301 ? CG  ? G ARG 17  CG  
80 1 Y 1 I ARG 301 ? CD  ? G ARG 17  CD  
81 1 Y 1 I ARG 301 ? NE  ? G ARG 17  NE  
82 1 Y 1 I ARG 301 ? CZ  ? G ARG 17  CZ  
83 1 Y 1 I ARG 301 ? NH1 ? G ARG 17  NH1 
84 1 Y 1 I ARG 301 ? NH2 ? G ARG 17  NH2 
85 1 Y 1 J ARG 801 ? CG  ? H ARG 17  CG  
86 1 Y 1 J ARG 801 ? CD  ? H ARG 17  CD  
87 1 Y 1 J ARG 801 ? NE  ? H ARG 17  NE  
88 1 Y 1 J ARG 801 ? CZ  ? H ARG 17  CZ  
89 1 Y 1 J ARG 801 ? NH1 ? H ARG 17  NH1 
90 1 Y 1 J ARG 801 ? NH2 ? H ARG 17  NH2 
91 1 Y 1 J HIS 822 ? CG  ? H HIS 38  CG  
92 1 Y 1 J HIS 822 ? ND1 ? H HIS 38  ND1 
93 1 Y 1 J HIS 822 ? CD2 ? H HIS 38  CD2 
94 1 Y 1 J HIS 822 ? CE1 ? H HIS 38  CE1 
95 1 Y 1 J HIS 822 ? NE2 ? H HIS 38  NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 O DT  701 ? C DT  1   
2   1 Y 1 P DA  716 ? D DA  1   
3   1 Y 1 A GLY -2  ? E GLY 1   
4   1 Y 1 A SER -1  ? E SER 2   
5   1 Y 1 A ARG 0   ? E ARG 3   
6   1 Y 1 A GLU 1   ? E GLU 4   
7   1 Y 1 A ASN 77  ? E ASN 79  
8   1 Y 1 A LEU 78  ? E LEU 80  
9   1 Y 1 A SER 79  ? E SER 81  
10  1 Y 1 A SER 80  ? E SER 82  
11  1 Y 1 A ASP 81  ? E ASP 83  
12  1 Y 1 A SER 82  ? E SER 84  
13  1 Y 1 A SER 83  ? E SER 85  
14  1 Y 1 A LEU 84  ? E LEU 86  
15  1 Y 1 A SER 85  ? E SER 87  
16  1 Y 1 A SER 86  ? E SER 88  
17  1 Y 1 A PRO 87  ? E PRO 89  
18  1 Y 1 A SER 88  ? E SER 90  
19  1 Y 1 A ALA 89  ? E ALA 91  
20  1 Y 1 A LEU 90  ? E LEU 92  
21  1 Y 1 A ASN 91  ? E ASN 93  
22  1 Y 1 A SER 92  ? E SER 94  
23  1 Y 1 A PRO 93  ? E PRO 95  
24  1 Y 1 A GLY 94  ? E GLY 96  
25  1 Y 1 A ILE 95  ? E ILE 97  
26  1 Y 1 A GLU 96  ? E GLU 98  
27  1 Y 1 A GLY 97  ? E GLY 99  
28  1 Y 1 A LEU 98  ? E LEU 100 
29  1 Y 1 A SER 99  ? E SER 101 
30  1 Y 1 A ARG 100 ? E ARG 102 
31  1 Y 1 A ARG 101 ? E ARG 103 
32  1 Y 1 B GLY 498 ? F GLY 1   
33  1 Y 1 B SER 499 ? F SER 2   
34  1 Y 1 B ARG 500 ? F ARG 3   
35  1 Y 1 B GLU 501 ? F GLU 4   
36  1 Y 1 B GLU 502 ? F GLU 5   
37  1 Y 1 B PRO 503 ? F PRO 6   
38  1 Y 1 B SER 504 ? F SER 7   
39  1 Y 1 B GLY 539 ? F GLY 42  
40  1 Y 1 B ASN 577 ? F ASN 79  
41  1 Y 1 B LEU 578 ? F LEU 80  
42  1 Y 1 B SER 579 ? F SER 81  
43  1 Y 1 B SER 580 ? F SER 82  
44  1 Y 1 B ASP 581 ? F ASP 83  
45  1 Y 1 B SER 582 ? F SER 84  
46  1 Y 1 B SER 583 ? F SER 85  
47  1 Y 1 B LEU 584 ? F LEU 86  
48  1 Y 1 B SER 585 ? F SER 87  
49  1 Y 1 B SER 586 ? F SER 88  
50  1 Y 1 B PRO 587 ? F PRO 89  
51  1 Y 1 B SER 588 ? F SER 90  
52  1 Y 1 B ALA 589 ? F ALA 91  
53  1 Y 1 B LEU 590 ? F LEU 92  
54  1 Y 1 B ASN 591 ? F ASN 93  
55  1 Y 1 B SER 592 ? F SER 94  
56  1 Y 1 B PRO 593 ? F PRO 95  
57  1 Y 1 B GLY 594 ? F GLY 96  
58  1 Y 1 B ILE 595 ? F ILE 97  
59  1 Y 1 B GLU 596 ? F GLU 98  
60  1 Y 1 B GLY 597 ? F GLY 99  
61  1 Y 1 B LEU 598 ? F LEU 100 
62  1 Y 1 B SER 599 ? F SER 101 
63  1 Y 1 B ARG 600 ? F ARG 102 
64  1 Y 1 B ARG 601 ? F ARG 103 
65  1 Y 1 B PRO 626 ? F PRO 128 
66  1 Y 1 I MET 285 ? G MET 1   
67  1 Y 1 I LEU 286 ? G LEU 2   
68  1 Y 1 I TRP 287 ? G TRP 3   
69  1 Y 1 I GLN 288 ? G GLN 4   
70  1 Y 1 I LYS 289 ? G LYS 5   
71  1 Y 1 I PRO 290 ? G PRO 6   
72  1 Y 1 I THR 291 ? G THR 7   
73  1 Y 1 I ALA 292 ? G ALA 8   
74  1 Y 1 I PRO 293 ? G PRO 9   
75  1 Y 1 I GLU 294 ? G GLU 10  
76  1 Y 1 I GLN 295 ? G GLN 11  
77  1 Y 1 I ALA 296 ? G ALA 12  
78  1 Y 1 I PRO 297 ? G PRO 13  
79  1 Y 1 I ALA 298 ? G ALA 14  
80  1 Y 1 I PRO 299 ? G PRO 15  
81  1 Y 1 I HIS 322 ? G HIS 38  
82  1 Y 1 I ALA 323 ? G ALA 39  
83  1 Y 1 I SER 324 ? G SER 40  
84  1 Y 1 I SER 325 ? G SER 41  
85  1 Y 1 I GLY 326 ? G GLY 42  
86  1 Y 1 I ALA 327 ? G ALA 43  
87  1 Y 1 I ALA 328 ? G ALA 44  
88  1 Y 1 J MET 785 ? H MET 1   
89  1 Y 1 J LEU 786 ? H LEU 2   
90  1 Y 1 J TRP 787 ? H TRP 3   
91  1 Y 1 J GLN 788 ? H GLN 4   
92  1 Y 1 J LYS 789 ? H LYS 5   
93  1 Y 1 J PRO 790 ? H PRO 6   
94  1 Y 1 J THR 791 ? H THR 7   
95  1 Y 1 J ALA 792 ? H ALA 8   
96  1 Y 1 J PRO 793 ? H PRO 9   
97  1 Y 1 J GLU 794 ? H GLU 10  
98  1 Y 1 J GLN 795 ? H GLN 11  
99  1 Y 1 J ALA 796 ? H ALA 12  
100 1 Y 1 J PRO 797 ? H PRO 13  
101 1 Y 1 J ALA 798 ? H ALA 14  
102 1 Y 1 J PRO 799 ? H PRO 15  
103 1 Y 1 J ALA 823 ? H ALA 39  
104 1 Y 1 J SER 824 ? H SER 40  
105 1 Y 1 J SER 825 ? H SER 41  
106 1 Y 1 J GLY 826 ? H GLY 42  
107 1 Y 1 J ALA 827 ? H ALA 43  
108 1 Y 1 J ALA 828 ? H ALA 44  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1CQT 'double helix'         
1CQT 'b-form double helix'  
1CQT 'mismatched base pair' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DG 2  1_555 B DC 15 1_555 0.488  -0.185 0.209  2.521   -0.487  -4.081  1  M_DG202:DC230_N M 202 ? N 230 ? 19 1 
1 A DT 3  1_555 B DA 14 1_555 0.502  -0.066 0.061  4.547   -18.129 -4.157  2  M_DT203:DA229_N M 203 ? N 229 ? 20 1 
1 A DA 4  1_555 B DT 13 1_555 -0.147 -0.128 -0.217 -17.574 -8.432  0.979   3  M_DA204:DT228_N M 204 ? N 228 ? 20 1 
1 A DT 5  1_555 B DA 12 1_555 0.076  -0.285 -0.068 -5.901  -6.293  5.059   4  M_DT205:DA227_N M 205 ? N 227 ? 20 1 
1 A DG 6  1_555 B DC 11 1_555 0.120  -0.091 0.001  -8.557  -13.190 -5.137  5  M_DG206:DC226_N M 206 ? N 226 ? 19 1 
1 A DC 7  1_555 B DG 10 1_555 -0.278 -0.115 -0.317 -3.270  6.762   -5.745  6  M_DC207:DG225_N M 207 ? N 225 ? 19 1 
1 A DA 8  1_555 B DT 9  1_555 0.169  -0.183 -0.221 5.704   1.450   2.817   7  M_DA208:DT224_N M 208 ? N 224 ? 20 1 
1 A DA 9  1_555 B DT 8  1_555 0.037  -0.058 0.290  -6.492  -11.341 3.584   8  M_DA209:DT223_N M 209 ? N 223 ? 20 1 
1 A DA 10 1_555 B DT 7  1_555 -0.041 -0.195 0.436  -1.200  5.096   8.154   9  M_DA210:DT222_N M 210 ? N 222 ? 20 1 
1 A DT 11 1_555 B DA 6  1_555 0.261  -0.025 0.117  5.758   1.719   6.601   10 M_DT211:DA221_N M 211 ? N 221 ? 20 1 
1 A DA 12 1_555 B DT 5  1_555 0.009  -0.112 -0.236 2.792   -10.613 6.202   11 M_DA212:DT220_N M 212 ? N 220 ? 20 1 
1 A DA 13 1_555 B DT 4  1_555 0.229  -0.219 0.226  3.984   -12.209 6.064   12 M_DA213:DT219_N M 213 ? N 219 ? 20 1 
1 A DG 14 1_555 B DC 3  1_555 -0.016 -0.026 0.001  -1.958  2.136   -2.914  13 M_DG214:DC218_N M 214 ? N 218 ? 19 1 
1 A DG 15 1_555 B DC 2  1_555 0.372  -0.204 -0.667 -18.304 -5.054  -4.666  14 M_DG215:DC217_N M 215 ? N 217 ? 19 1 
1 C DG 2  1_555 D DC 15 1_555 -1.780 -0.294 0.861  28.026  -4.210  9.977   15 O_DG702:DC730_P O 702 ? P 730 ? ?  1 
1 C DT 3  1_555 D DA 14 1_555 0.386  -0.001 -0.113 21.738  -15.340 5.425   16 O_DT703:DA729_P O 703 ? P 729 ? 20 1 
1 C DA 4  1_555 D DT 13 1_555 0.010  -1.202 2.071  -0.463  7.269   5.890   17 O_DA704:DT728_P O 704 ? P 728 ? 20 1 
1 C DT 5  1_555 D DA 12 1_555 -0.019 -0.377 1.362  -3.814  10.880  6.226   18 O_DT705:DA727_P O 705 ? P 727 ? 20 1 
1 C DG 6  1_555 D DC 11 1_555 -0.129 -0.131 0.744  -7.133  -11.551 -5.359  19 O_DG706:DC726_P O 706 ? P 726 ? 19 1 
1 C DC 7  1_555 D DG 10 1_555 0.233  -0.052 0.045  -26.812 23.989  -1.639  20 O_DC707:DG725_P O 707 ? P 725 ? 19 1 
1 C DA 8  1_555 D DT 9  1_555 0.010  -0.100 -0.533 1.621   10.091  0.670   21 O_DA708:DT724_P O 708 ? P 724 ? 20 1 
1 C DA 9  1_555 D DT 8  1_555 0.344  0.062  0.375  28.392  -16.920 -11.976 22 O_DA709:DT723_P O 709 ? P 723 ? 20 1 
1 C DA 10 1_555 D DT 7  1_555 0.012  -0.159 -0.228 16.666  -4.821  -0.613  23 O_DA710:DT722_P O 710 ? P 722 ? 20 1 
1 C DT 11 1_555 D DA 6  1_555 -0.012 -0.078 -1.149 28.649  -8.515  2.775   24 O_DT711:DA721_P O 711 ? P 721 ? 20 1 
1 C DA 12 1_555 D DT 5  1_555 0.025  -0.099 0.251  15.647  -1.945  -2.297  25 O_DA712:DT720_P O 712 ? P 720 ? 20 1 
1 C DA 13 1_555 D DT 4  1_555 0.292  -0.137 0.754  10.327  -7.783  -1.247  26 O_DA713:DT719_P O 713 ? P 719 ? 20 1 
1 C DG 15 1_555 D DC 2  1_555 -1.135 -0.403 -0.465 0.633   33.381  -19.400 27 O_DG715:DC717_P O 715 ? P 717 ? ?  1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DG 2  1_555 B DC 15 1_555 A DT 3  1_555 B DA 14 1_555 -0.206 -1.530 3.312 0.329   -1.790  34.727 -2.281 0.396  3.382 -2.996  
-0.551  34.773 1  MM_DG202DT203:DA229DC230_NN M 202 ? N 230 ? M 203 ? N 229 ? 
1 A DT 3  1_555 B DA 14 1_555 A DA 4  1_555 B DT 13 1_555 0.448  0.080  3.698 4.560   -3.271  38.437 0.574  -0.041 3.707 -4.936  
-6.882  38.829 2  MM_DT203DA204:DT228DA229_NN M 203 ? N 229 ? M 204 ? N 228 ? 
1 A DA 4  1_555 B DT 13 1_555 A DT 5  1_555 B DA 12 1_555 -0.215 -0.156 2.982 -0.783  3.363   30.013 -0.920 0.268  2.952 6.468   
1.506   30.207 3  MM_DA204DT205:DA227DT228_NN M 204 ? N 228 ? M 205 ? N 227 ? 
1 A DT 5  1_555 B DA 12 1_555 A DG 6  1_555 B DC 11 1_555 -1.408 0.530  3.471 -3.913  -0.645  38.130 0.895  1.616  3.583 -0.984  
5.969   38.328 4  MM_DT205DG206:DC226DA227_NN M 205 ? N 227 ? M 206 ? N 226 ? 
1 A DG 6  1_555 B DC 11 1_555 A DC 7  1_555 B DG 10 1_555 1.272  0.507  3.076 7.055   -0.966  39.090 0.855  -1.074 3.235 -1.430  
-10.438 39.709 5  MM_DG206DC207:DG225DC226_NN M 206 ? N 226 ? M 207 ? N 225 ? 
1 A DC 7  1_555 B DG 10 1_555 A DA 8  1_555 B DT 9  1_555 1.082  -0.567 3.206 0.491   8.573   26.975 -3.066 -2.106 2.911 17.813  
-1.020  28.284 6  MM_DC207DA208:DT224DG225_NN M 207 ? N 225 ? M 208 ? N 224 ? 
1 A DA 8  1_555 B DT 9  1_555 A DA 9  1_555 B DT 8  1_555 -1.034 0.249  3.506 -7.668  -1.170  39.513 0.509  0.546  3.628 -1.711  
11.211  40.237 7  MM_DA208DA209:DT223DT224_NN M 208 ? N 224 ? M 209 ? N 223 ? 
1 A DA 9  1_555 B DT 8  1_555 A DA 10 1_555 B DT 7  1_555 0.251  -0.147 3.243 -2.547  -9.109  38.262 0.856  -0.674 3.173 -13.643 
3.815   39.371 8  MM_DA209DA210:DT222DT223_NN M 209 ? N 223 ? M 210 ? N 222 ? 
1 A DA 10 1_555 B DT 7  1_555 A DT 11 1_555 B DA 6  1_555 -0.137 -1.110 3.246 1.630   -6.272  28.844 -0.808 0.624  3.393 -12.394 
-3.221  29.547 9  MM_DA210DT211:DA221DT222_NN M 210 ? N 222 ? M 211 ? N 221 ? 
1 A DT 11 1_555 B DA 6  1_555 A DA 12 1_555 B DT 5  1_555 -0.153 -0.418 3.282 5.782   3.416   35.013 -1.177 1.085  3.164 5.615   
-9.502  35.632 10 MM_DT211DA212:DT220DA221_NN M 211 ? N 221 ? M 212 ? N 220 ? 
1 A DA 12 1_555 B DT 5  1_555 A DA 13 1_555 B DT 4  1_555 0.529  0.091  3.245 -0.837  12.382  32.426 -1.747 -1.017 3.061 21.228  
1.435   34.660 11 MM_DA212DA213:DT219DT220_NN M 212 ? N 220 ? M 213 ? N 219 ? 
1 A DA 13 1_555 B DT 4  1_555 A DG 14 1_555 B DC 3  1_555 -0.645 -0.507 3.310 0.309   8.074   35.799 -1.907 1.068  3.121 12.931  
-0.496  36.671 12 MM_DA213DG214:DC218DT219_NN M 213 ? N 219 ? M 214 ? N 218 ? 
1 A DG 14 1_555 B DC 3  1_555 A DG 15 1_555 B DC 2  1_555 0.188  -1.055 3.856 5.682   6.309   34.965 -2.750 0.633  3.603 10.313  
-9.287  35.950 13 MM_DG214DG215:DC217DC218_NN M 214 ? N 218 ? M 215 ? N 217 ? 
1 C DG 2  1_555 D DC 15 1_555 C DT 3  1_555 D DA 14 1_555 -0.600 -0.030 3.220 9.037   12.840  40.135 -1.274 1.686  2.886 17.903  
-12.601 42.979 14 OO_DG702DT703:DA729DC730_PP O 702 ? P 730 ? O 703 ? P 729 ? 
1 C DT 3  1_555 D DA 14 1_555 C DA 4  1_555 D DT 13 1_555 0.407  0.325  3.731 -16.001 5.236   40.245 -0.134 -2.299 3.359 7.238   
22.121  43.490 15 OO_DT703DA704:DT728DA729_PP O 703 ? P 729 ? O 704 ? P 728 ? 
1 C DA 4  1_555 D DT 13 1_555 C DT 5  1_555 D DA 12 1_555 -0.318 -1.805 3.540 6.575   -5.705  28.802 -2.162 2.131  3.662 -11.152 
-12.852 30.063 16 OO_DA704DT705:DA727DT728_PP O 704 ? P 728 ? O 705 ? P 727 ? 
1 C DT 5  1_555 D DA 12 1_555 C DG 6  1_555 D DC 11 1_555 -1.221 0.668  3.129 1.467   0.243   40.696 0.934  1.908  3.089 0.349   
-2.108  40.722 17 OO_DT705DG706:DC726DA727_PP O 705 ? P 727 ? O 706 ? P 726 ? 
1 C DG 6  1_555 D DC 11 1_555 C DC 7  1_555 D DG 10 1_555 0.884  0.011  4.129 -1.128  0.509   37.463 -0.066 -1.561 4.102 0.792   
1.756   37.483 18 OO_DG706DC707:DG725DC726_PP O 706 ? P 726 ? O 707 ? P 725 ? 
1 C DC 7  1_555 D DG 10 1_555 C DA 8  1_555 D DT 9  1_555 0.462  -0.668 2.949 9.764   -5.627  25.298 -0.098 1.286  2.996 -12.110 
-21.014 27.657 19 OO_DC707DA708:DT724DG725_PP O 707 ? P 725 ? O 708 ? P 724 ? 
1 C DA 8  1_555 D DT 9  1_555 C DA 9  1_555 D DT 8  1_555 -1.141 0.066  2.528 -5.893  -16.836 43.079 1.215  1.051  2.468 -21.844 
7.646   46.463 20 OO_DA708DA709:DT723DT724_PP O 708 ? P 724 ? O 709 ? P 723 ? 
1 C DA 9  1_555 D DT 8  1_555 C DA 10 1_555 D DT 7  1_555 1.303  -0.362 3.389 10.187  1.523   35.222 -0.803 -0.549 3.597 2.454   
-16.406 36.651 21 OO_DA709DA710:DT722DT723_PP O 709 ? P 723 ? O 710 ? P 722 ? 
1 C DA 10 1_555 D DT 7  1_555 C DT 11 1_555 D DA 6  1_555 0.314  -1.112 2.789 7.741   -0.990  33.811 -1.733 0.505  2.821 -1.675  
-13.094 34.674 22 OO_DA710DT711:DA721DT722_PP O 710 ? P 722 ? O 711 ? P 721 ? 
1 C DT 11 1_555 D DA 6  1_555 C DA 12 1_555 D DT 5  1_555 0.219  -0.968 3.382 -9.295  7.062   33.817 -2.598 -1.699 2.967 11.715  
15.419  35.719 23 OO_DT711DA712:DT720DA721_PP O 711 ? P 721 ? O 712 ? P 720 ? 
1 C DA 12 1_555 D DT 5  1_555 C DA 13 1_555 D DT 4  1_555 -0.417 0.369  2.978 -5.000  -1.483  40.476 0.679  0.093  2.992 -2.133  
7.190   40.797 24 OO_DA712DA713:DT719DT720_PP O 712 ? P 720 ? O 713 ? P 719 ? 
#