data_1CVU
# 
_entry.id   1CVU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1CVU         pdb_00001cvu 10.2210/pdb1cvu/pdb 
RCSB  RCSB009571   ?            ?                   
WWPDB D_1000009571 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 6COX 'CYCLOOXYGENASE-2 COMPLEXED WITH SELECTIVE INHIBITOR SC-558' unspecified 
PDB 5COX 'CYCLOOXYGENASE-2 WITHOUT BOUND INHIBITORS'                  unspecified 
PDB 1CQE 'CYCLOOXYGENASE-1 STRUCTURE'                                 unspecified 
PDB 1LOX '15-LIPOXYGENASE STRUCTURE'                                  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CVU 
_pdbx_database_status.recvd_initial_deposition_date   1999-08-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kiefer, J.R.'    1  
'Pawlitz, J.L.'   2  
'Moreland, K.T.'  3  
'Stegeman, R.A.'  4  
'Gierse, J.K.'    5  
'Stevens, A.M.'   6  
'Goodwin, D.C.'   7  
'Rowlinson, S.W.' 8  
'Marnett, L.J.'   9  
'Stallings, W.C.' 10 
'Kurumbail, R.G.' 11 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural insights into the stereochemistry of the cyclooxygenase reaction.' Nature 405 97  101 2000 NATUAS UK 0028-0836 
0006 ? 10811226 10.1038/35011103 
1       'Structural Basis for Selective Inhibition of by Anti-Inflammatory Agents'     Nature 384 644 648 1996 NATUAS UK 0028-0836 
0006 ? ?        10.1038/384644a0 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kiefer, J.R.'    1  ? 
primary 'Pawlitz, J.L.'   2  ? 
primary 'Moreland, K.T.'  3  ? 
primary 'Stegeman, R.A.'  4  ? 
primary 'Hood, W.F.'      5  ? 
primary 'Gierse, J.K.'    6  ? 
primary 'Stevens, A.M.'   7  ? 
primary 'Goodwin, D.C.'   8  ? 
primary 'Rowlinson, S.W.' 9  ? 
primary 'Marnett, L.J.'   10 ? 
primary 'Stallings, W.C.' 11 ? 
primary 'Kurumbail, R.G.' 12 ? 
1       'Kurumbail, R.G.' 13 ? 
1       'Stevens, A.M.'   14 ? 
1       'McDonald, J.J.'  15 ? 
1       'STEGEMAN, R.A.'  16 ? 
1       'PAK, J.Y.'       17 ? 
1       'GILDEHAUS, D.'   18 ? 
1       'MIYASHIRO, J.M.' 19 ? 
1       'PENNING, T.D.'   20 ? 
1       'SEIBERT, K.'     21 ? 
1       'ISAKSON, P.C.'   22 ? 
1       'STALLINGS, W.C.' 23 ? 
# 
_cell.entry_id           1CVU 
_cell.length_a           181.036 
_cell.length_b           133.960 
_cell.length_c           124.834 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1CVU 
_symmetry.space_group_name_H-M             'I 2 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                23 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROSTAGLANDIN H2 SYNTHASE-2' 63416.359 2   1.14.99.1 'H207A (COX-1 NUMBERING)' 'PROSTAGLANDIN H2 SYNTHASE-2' ? 
2 polymer     syn 'PROTEIN (9-MER)' 907.000   1   ?         ?                         ?                             SYNTHETIC 
3 branched    syn '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2   ? ? ? ? 
4 branched    man 
;alpha-D-mannopyranose-(1-6)-alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   2   ?         ?                         ?                             ?         
5 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   2   ?         ?                         ? ?         
6 non-polymer syn 'octyl beta-D-glucopyranoside' 292.369   5   ?         ?                         ?                             ? 
7 non-polymer syn 'ARACHIDONIC ACID' 304.467   2   ?         ?                         ?                             ?         
8 water       nat water 18.015    771 ?         ?                         ?                             ?         
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        'EC 1.14.99.1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTAQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQTSKLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQ
;
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTAQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQTSKLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQ
;
A,B ? 
2 'polypeptide(L)' no no TKTATINAS TKTATINAS F   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASN n 
1 3   PRO n 
1 4   CYS n 
1 5   CYS n 
1 6   SER n 
1 7   ASN n 
1 8   PRO n 
1 9   CYS n 
1 10  GLN n 
1 11  ASN n 
1 12  ARG n 
1 13  GLY n 
1 14  GLU n 
1 15  CYS n 
1 16  MET n 
1 17  SER n 
1 18  THR n 
1 19  GLY n 
1 20  PHE n 
1 21  ASP n 
1 22  GLN n 
1 23  TYR n 
1 24  LYS n 
1 25  CYS n 
1 26  ASP n 
1 27  CYS n 
1 28  THR n 
1 29  ARG n 
1 30  THR n 
1 31  GLY n 
1 32  PHE n 
1 33  TYR n 
1 34  GLY n 
1 35  GLU n 
1 36  ASN n 
1 37  CYS n 
1 38  THR n 
1 39  THR n 
1 40  PRO n 
1 41  GLU n 
1 42  PHE n 
1 43  LEU n 
1 44  THR n 
1 45  ARG n 
1 46  ILE n 
1 47  LYS n 
1 48  LEU n 
1 49  LEU n 
1 50  LEU n 
1 51  LYS n 
1 52  PRO n 
1 53  THR n 
1 54  PRO n 
1 55  ASN n 
1 56  THR n 
1 57  VAL n 
1 58  HIS n 
1 59  TYR n 
1 60  ILE n 
1 61  LEU n 
1 62  THR n 
1 63  HIS n 
1 64  PHE n 
1 65  LYS n 
1 66  GLY n 
1 67  VAL n 
1 68  TRP n 
1 69  ASN n 
1 70  ILE n 
1 71  VAL n 
1 72  ASN n 
1 73  ASN n 
1 74  ILE n 
1 75  PRO n 
1 76  PHE n 
1 77  LEU n 
1 78  ARG n 
1 79  SER n 
1 80  LEU n 
1 81  ILE n 
1 82  MET n 
1 83  LYS n 
1 84  TYR n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  SER n 
1 89  ARG n 
1 90  SER n 
1 91  TYR n 
1 92  LEU n 
1 93  ILE n 
1 94  ASP n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  THR n 
1 99  TYR n 
1 100 ASN n 
1 101 VAL n 
1 102 HIS n 
1 103 TYR n 
1 104 GLY n 
1 105 TYR n 
1 106 LYS n 
1 107 SER n 
1 108 TRP n 
1 109 GLU n 
1 110 ALA n 
1 111 PHE n 
1 112 SER n 
1 113 ASN n 
1 114 LEU n 
1 115 SER n 
1 116 TYR n 
1 117 TYR n 
1 118 THR n 
1 119 ARG n 
1 120 ALA n 
1 121 LEU n 
1 122 PRO n 
1 123 PRO n 
1 124 VAL n 
1 125 ALA n 
1 126 ASP n 
1 127 ASP n 
1 128 CYS n 
1 129 PRO n 
1 130 THR n 
1 131 PRO n 
1 132 MET n 
1 133 GLY n 
1 134 VAL n 
1 135 LYS n 
1 136 GLY n 
1 137 ASN n 
1 138 LYS n 
1 139 GLU n 
1 140 LEU n 
1 141 PRO n 
1 142 ASP n 
1 143 SER n 
1 144 LYS n 
1 145 GLU n 
1 146 VAL n 
1 147 LEU n 
1 148 GLU n 
1 149 LYS n 
1 150 VAL n 
1 151 LEU n 
1 152 LEU n 
1 153 ARG n 
1 154 ARG n 
1 155 GLU n 
1 156 PHE n 
1 157 ILE n 
1 158 PRO n 
1 159 ASP n 
1 160 PRO n 
1 161 GLN n 
1 162 GLY n 
1 163 SER n 
1 164 ASN n 
1 165 MET n 
1 166 MET n 
1 167 PHE n 
1 168 ALA n 
1 169 PHE n 
1 170 PHE n 
1 171 ALA n 
1 172 GLN n 
1 173 HIS n 
1 174 PHE n 
1 175 THR n 
1 176 ALA n 
1 177 GLN n 
1 178 PHE n 
1 179 PHE n 
1 180 LYS n 
1 181 THR n 
1 182 ASP n 
1 183 HIS n 
1 184 LYS n 
1 185 ARG n 
1 186 GLY n 
1 187 PRO n 
1 188 GLY n 
1 189 PHE n 
1 190 THR n 
1 191 ARG n 
1 192 GLY n 
1 193 LEU n 
1 194 GLY n 
1 195 HIS n 
1 196 GLY n 
1 197 VAL n 
1 198 ASP n 
1 199 LEU n 
1 200 ASN n 
1 201 HIS n 
1 202 ILE n 
1 203 TYR n 
1 204 GLY n 
1 205 GLU n 
1 206 THR n 
1 207 LEU n 
1 208 ASP n 
1 209 ARG n 
1 210 GLN n 
1 211 HIS n 
1 212 LYS n 
1 213 LEU n 
1 214 ARG n 
1 215 LEU n 
1 216 PHE n 
1 217 LYS n 
1 218 ASP n 
1 219 GLY n 
1 220 LYS n 
1 221 LEU n 
1 222 LYS n 
1 223 TYR n 
1 224 GLN n 
1 225 VAL n 
1 226 ILE n 
1 227 GLY n 
1 228 GLY n 
1 229 GLU n 
1 230 VAL n 
1 231 TYR n 
1 232 PRO n 
1 233 PRO n 
1 234 THR n 
1 235 VAL n 
1 236 LYS n 
1 237 ASP n 
1 238 THR n 
1 239 GLN n 
1 240 VAL n 
1 241 GLU n 
1 242 MET n 
1 243 ILE n 
1 244 TYR n 
1 245 PRO n 
1 246 PRO n 
1 247 HIS n 
1 248 ILE n 
1 249 PRO n 
1 250 GLU n 
1 251 ASN n 
1 252 LEU n 
1 253 GLN n 
1 254 PHE n 
1 255 ALA n 
1 256 VAL n 
1 257 GLY n 
1 258 GLN n 
1 259 GLU n 
1 260 VAL n 
1 261 PHE n 
1 262 GLY n 
1 263 LEU n 
1 264 VAL n 
1 265 PRO n 
1 266 GLY n 
1 267 LEU n 
1 268 MET n 
1 269 MET n 
1 270 TYR n 
1 271 ALA n 
1 272 THR n 
1 273 ILE n 
1 274 TRP n 
1 275 LEU n 
1 276 ARG n 
1 277 GLU n 
1 278 HIS n 
1 279 GLN n 
1 280 ARG n 
1 281 VAL n 
1 282 CYS n 
1 283 ASP n 
1 284 ILE n 
1 285 LEU n 
1 286 LYS n 
1 287 GLN n 
1 288 GLU n 
1 289 HIS n 
1 290 PRO n 
1 291 GLU n 
1 292 TRP n 
1 293 GLY n 
1 294 ASP n 
1 295 GLU n 
1 296 GLN n 
1 297 LEU n 
1 298 PHE n 
1 299 GLN n 
1 300 THR n 
1 301 SER n 
1 302 LYS n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 ILE n 
1 307 GLY n 
1 308 GLU n 
1 309 THR n 
1 310 ILE n 
1 311 LYS n 
1 312 ILE n 
1 313 VAL n 
1 314 ILE n 
1 315 GLU n 
1 316 ASP n 
1 317 TYR n 
1 318 VAL n 
1 319 GLN n 
1 320 HIS n 
1 321 LEU n 
1 322 SER n 
1 323 GLY n 
1 324 TYR n 
1 325 HIS n 
1 326 PHE n 
1 327 LYS n 
1 328 LEU n 
1 329 LYS n 
1 330 PHE n 
1 331 ASP n 
1 332 PRO n 
1 333 GLU n 
1 334 LEU n 
1 335 LEU n 
1 336 PHE n 
1 337 ASN n 
1 338 GLN n 
1 339 GLN n 
1 340 PHE n 
1 341 GLN n 
1 342 TYR n 
1 343 GLN n 
1 344 ASN n 
1 345 ARG n 
1 346 ILE n 
1 347 ALA n 
1 348 SER n 
1 349 GLU n 
1 350 PHE n 
1 351 ASN n 
1 352 THR n 
1 353 LEU n 
1 354 TYR n 
1 355 HIS n 
1 356 TRP n 
1 357 HIS n 
1 358 PRO n 
1 359 LEU n 
1 360 LEU n 
1 361 PRO n 
1 362 ASP n 
1 363 THR n 
1 364 PHE n 
1 365 ASN n 
1 366 ILE n 
1 367 GLU n 
1 368 ASP n 
1 369 GLN n 
1 370 GLU n 
1 371 TYR n 
1 372 SER n 
1 373 PHE n 
1 374 LYS n 
1 375 GLN n 
1 376 PHE n 
1 377 LEU n 
1 378 TYR n 
1 379 ASN n 
1 380 ASN n 
1 381 SER n 
1 382 ILE n 
1 383 LEU n 
1 384 LEU n 
1 385 GLU n 
1 386 HIS n 
1 387 GLY n 
1 388 LEU n 
1 389 THR n 
1 390 GLN n 
1 391 PHE n 
1 392 VAL n 
1 393 GLU n 
1 394 SER n 
1 395 PHE n 
1 396 THR n 
1 397 ARG n 
1 398 GLN n 
1 399 ILE n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 VAL n 
1 404 ALA n 
1 405 GLY n 
1 406 GLY n 
1 407 ARG n 
1 408 ASN n 
1 409 VAL n 
1 410 PRO n 
1 411 ILE n 
1 412 ALA n 
1 413 VAL n 
1 414 GLN n 
1 415 ALA n 
1 416 VAL n 
1 417 ALA n 
1 418 LYS n 
1 419 ALA n 
1 420 SER n 
1 421 ILE n 
1 422 ASP n 
1 423 GLN n 
1 424 SER n 
1 425 ARG n 
1 426 GLU n 
1 427 MET n 
1 428 LYS n 
1 429 TYR n 
1 430 GLN n 
1 431 SER n 
1 432 LEU n 
1 433 ASN n 
1 434 GLU n 
1 435 TYR n 
1 436 ARG n 
1 437 LYS n 
1 438 ARG n 
1 439 PHE n 
1 440 SER n 
1 441 LEU n 
1 442 LYS n 
1 443 PRO n 
1 444 TYR n 
1 445 THR n 
1 446 SER n 
1 447 PHE n 
1 448 GLU n 
1 449 GLU n 
1 450 LEU n 
1 451 THR n 
1 452 GLY n 
1 453 GLU n 
1 454 LYS n 
1 455 GLU n 
1 456 MET n 
1 457 ALA n 
1 458 ALA n 
1 459 GLU n 
1 460 LEU n 
1 461 LYS n 
1 462 ALA n 
1 463 LEU n 
1 464 TYR n 
1 465 SER n 
1 466 ASP n 
1 467 ILE n 
1 468 ASP n 
1 469 VAL n 
1 470 MET n 
1 471 GLU n 
1 472 LEU n 
1 473 TYR n 
1 474 PRO n 
1 475 ALA n 
1 476 LEU n 
1 477 LEU n 
1 478 VAL n 
1 479 GLU n 
1 480 LYS n 
1 481 PRO n 
1 482 ARG n 
1 483 PRO n 
1 484 ASP n 
1 485 ALA n 
1 486 ILE n 
1 487 PHE n 
1 488 GLY n 
1 489 GLU n 
1 490 THR n 
1 491 MET n 
1 492 VAL n 
1 493 GLU n 
1 494 LEU n 
1 495 GLY n 
1 496 ALA n 
1 497 PRO n 
1 498 PHE n 
1 499 SER n 
1 500 LEU n 
1 501 LYS n 
1 502 GLY n 
1 503 LEU n 
1 504 MET n 
1 505 GLY n 
1 506 ASN n 
1 507 PRO n 
1 508 ILE n 
1 509 CYS n 
1 510 SER n 
1 511 PRO n 
1 512 GLN n 
1 513 TYR n 
1 514 TRP n 
1 515 LYS n 
1 516 PRO n 
1 517 SER n 
1 518 THR n 
1 519 PHE n 
1 520 GLY n 
1 521 GLY n 
1 522 GLU n 
1 523 VAL n 
1 524 GLY n 
1 525 PHE n 
1 526 LYS n 
1 527 ILE n 
1 528 ILE n 
1 529 ASN n 
1 530 THR n 
1 531 ALA n 
1 532 SER n 
1 533 ILE n 
1 534 GLN n 
1 535 SER n 
1 536 LEU n 
1 537 ILE n 
1 538 CYS n 
1 539 ASN n 
1 540 ASN n 
1 541 VAL n 
1 542 LYS n 
1 543 GLY n 
1 544 CYS n 
1 545 PRO n 
1 546 PHE n 
1 547 THR n 
1 548 SER n 
1 549 PHE n 
1 550 ASN n 
1 551 VAL n 
1 552 GLN n 
2 1   THR n 
2 2   LYS n 
2 3   THR n 
2 4   ALA n 
2 5   THR n 
2 6   ILE n 
2 7   ASN n 
2 8   ALA n 
2 9   SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVL1393 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP PGH2_MOUSE 1 Q05769 ? 
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTAQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQTSKLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQ
;
? 
2 PDB 1CVU       2 1CVU   ? TKTATINAS ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CVU A 1 ? 552 ? Q05769 18   ? 569  ? 33   583  
2 1 1CVU B 1 ? 552 ? Q05769 18   ? 569  ? 2033 2583 
3 2 1CVU F 1 ? 9   ? 1CVU   2595 ? 2603 ? 2595 2603 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1CVU GLN A 279 ? UNP Q05769 ASN 296 'engineered mutation' 310  1 
1 1CVU LYS A 302 ? UNP Q05769 ARG 319 'engineered mutation' 333  2 
2 1CVU GLN B 279 ? UNP Q05769 ASN 296 'engineered mutation' 2310 3 
2 1CVU LYS B 302 ? UNP Q05769 ARG 319 'engineered mutation' 2333 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACD non-polymer                   . 'ARACHIDONIC ACID'                       ? 'C20 H32 O2'     304.467 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BOG D-saccharide                  n 'octyl beta-D-glucopyranoside'           
'Beta-Octylglucoside; octyl beta-D-glucoside; octyl D-glucoside; octyl glucoside' 'C14 H28 O6'     292.369 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    'alpha-D-mannose; D-mannose; mannose' 'C6 H12 O6' 
180.156 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose 
;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE
;
'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1CVU 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.96 
_exptl_crystal.density_percent_sol   58.46 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'MONOMETHYL PEG 550, MAGNESIUM SULFATE, ARACHIDNOIC ACID, EPPS, B-OG, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           130 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   1998-10-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CVU 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             35.0 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   212739 
_reflns.number_all                   58608 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.078 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.6 
_reflns.B_iso_Wilson_estimate        26.8 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.49 
_reflns_shell.percent_possible_all   97.8 
_reflns_shell.Rmerge_I_obs           0.241 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1CVU 
_refine.ls_number_reflns_obs                     58608 
_refine.ls_number_reflns_all                     57179 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             35.0 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    96.1 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.235 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3887 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;CONJUGATE GRADIENT, MOLECULAR DYNAMICS, INDIVIDUAL ATOM ISOTROPIC B, BULK  
SOLVENT CORRECTION
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9001 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         328 
_refine_hist.number_atoms_solvent             771 
_refine_hist.number_atoms_total               10100 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        35.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               24.4  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.535 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1CVU 
_struct.title                     'CRYSTAL STRUCTURE OF ARACHIDONIC ACID BOUND TO THE CYCLOOXYGENASE ACTIVE SITE OF COX-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CVU 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE/peptide 
_struct_keywords.text            'COX-2, CYCLOOXYGENASE, PROSTAGLANDIN, ARACHIDONATE, ENDOPEROXIDE, OXIDOREDUCTASE-peptide complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
L N N 7 ? 
M N N 5 ? 
N N N 6 ? 
O N N 6 ? 
P N N 7 ? 
Q N N 8 ? 
R N N 8 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 41  ? LYS A 51  ? GLU A 73   LYS A 83   1 ? 11 
HELX_P HELX_P2  2  THR A 53  ? THR A 62  ? THR A 85   THR A 94   1 ? 10 
HELX_P HELX_P3  3  PHE A 64  ? ASN A 73  ? PHE A 96   ASN A 105  1 ? 10 
HELX_P HELX_P4  4  ILE A 74  A TYR A 91  ? ILE A 105  TYR A 122  1 ? 18 
HELX_P HELX_P5  5  SER A 107 ? ASN A 113 ? SER A 138  ASN A 144  1 ? 7  
HELX_P HELX_P6  6  ASP A 142 ? LEU A 151 ? ASP A 173  LEU A 182  1 ? 10 
HELX_P HELX_P7  7  ASN A 164 ? ALA A 176 ? ASN A 195  ALA A 207  1 ? 13 
HELX_P HELX_P8  8  LEU A 199 ? GLY A 204 ? LEU A 230  GLY A 235  1 ? 6  
HELX_P HELX_P9  9  THR A 206 ? ARG A 214 ? THR A 237  ARG A 245  1 ? 9  
HELX_P HELX_P10 10 THR A 234 ? GLN A 239 ? THR A 265  GLN A 270  1 ? 6  
HELX_P HELX_P11 11 PRO A 249 ? GLN A 253 ? PRO A 280  GLN A 284  5 ? 5  
HELX_P HELX_P12 12 VAL A 260 ? LEU A 263 ? VAL A 291  LEU A 294  5 ? 4  
HELX_P HELX_P13 13 VAL A 264 ? HIS A 289 ? VAL A 295  HIS A 320  1 ? 26 
HELX_P HELX_P14 14 GLY A 293 ? ASP A 316 ? GLY A 324  ASP A 347  1 ? 24 
HELX_P HELX_P15 15 ASP A 316 ? GLY A 323 ? ASP A 347  GLY A 354  1 ? 8  
HELX_P HELX_P16 16 ASP A 331 ? PHE A 336 ? ASP A 362  PHE A 367  5 ? 6  
HELX_P HELX_P17 17 ALA A 347 ? TYR A 354 ? ALA A 378  TYR A 385  1 ? 8  
HELX_P HELX_P18 18 TRP A 356 ? LEU A 360 ? TRP A 387  LEU A 391  5 ? 5  
HELX_P HELX_P19 19 SER A 372 ? LEU A 377 ? SER A 403  LEU A 408  1 ? 6  
HELX_P HELX_P20 20 ASN A 379 ? GLY A 387 ? ASN A 410  GLY A 418  1 ? 9  
HELX_P HELX_P21 21 HIS A 386 ? GLN A 398 ? HIS A 417  GLN A 429  1 ? 13 
HELX_P HELX_P22 22 PRO A 410 ? ALA A 412 ? PRO A 441  ALA A 443  5 ? 3  
HELX_P HELX_P23 23 VAL A 413 ? MET A 427 ? VAL A 444  MET A 458  1 ? 15 
HELX_P HELX_P24 24 SER A 431 ? PHE A 439 ? SER A 462  PHE A 470  1 ? 9  
HELX_P HELX_P25 25 SER A 446 ? GLY A 452 ? SER A 477  GLY A 483  1 ? 7  
HELX_P HELX_P26 26 LYS A 454 ? SER A 465 ? LYS A 485  SER A 496  1 ? 12 
HELX_P HELX_P27 27 ASP A 466 ? MET A 470 ? ASP A 497  MET A 501  5 ? 5  
HELX_P HELX_P28 28 GLU A 471 ? GLU A 479 ? GLU A 502  GLU A 510  1 ? 9  
HELX_P HELX_P29 29 GLY A 488 ? GLY A 505 ? GLY A 519  GLY A 536  1 ? 18 
HELX_P HELX_P30 30 ASN A 506 ? SER A 510 ? ASN A 537  SER A 541  5 ? 5  
HELX_P HELX_P31 31 LYS A 515 ? GLY A 520 ? LYS A 546  GLY A 551  5 ? 6  
HELX_P HELX_P32 32 GLY A 521 ? THR A 530 ? GLY A 552  THR A 561  1 ? 10 
HELX_P HELX_P33 33 SER A 532 ? VAL A 541 ? SER A 563  VAL A 572  1 ? 10 
HELX_P HELX_P34 34 GLU B 41  ? LYS B 51  ? GLU B 2073 LYS B 2083 1 ? 11 
HELX_P HELX_P35 35 THR B 53  ? THR B 62  ? THR B 2085 THR B 2094 1 ? 10 
HELX_P HELX_P36 36 PHE B 64  ? ASN B 73  ? PHE B 2096 ASN B 2105 1 ? 10 
HELX_P HELX_P37 37 ILE B 74  B TYR B 91  ? ILE B 105  TYR B 2122 1 ? 18 
HELX_P HELX_P38 38 SER B 107 ? ASN B 113 ? SER B 2138 ASN B 2144 1 ? 7  
HELX_P HELX_P39 39 ASP B 142 ? LEU B 151 ? ASP B 2173 LEU B 2182 1 ? 10 
HELX_P HELX_P40 40 ASN B 164 ? ALA B 176 ? ASN B 2195 ALA B 2207 1 ? 13 
HELX_P HELX_P41 41 LEU B 199 ? GLY B 204 ? LEU B 2230 GLY B 2235 1 ? 6  
HELX_P HELX_P42 42 THR B 206 ? ARG B 214 ? THR B 2237 ARG B 2245 1 ? 9  
HELX_P HELX_P43 43 THR B 234 ? GLN B 239 ? THR B 2265 GLN B 2270 1 ? 6  
HELX_P HELX_P44 44 PRO B 249 ? GLN B 253 ? PRO B 2280 GLN B 2284 5 ? 5  
HELX_P HELX_P45 45 VAL B 264 ? HIS B 289 ? VAL B 2295 HIS B 2320 1 ? 26 
HELX_P HELX_P46 46 GLY B 293 ? ASP B 316 ? GLY B 2324 ASP B 2347 1 ? 24 
HELX_P HELX_P47 47 ASP B 316 ? GLY B 323 ? ASP B 2347 GLY B 2354 1 ? 8  
HELX_P HELX_P48 48 ASP B 331 ? PHE B 336 ? ASP B 2362 PHE B 2367 5 ? 6  
HELX_P HELX_P49 49 ALA B 347 ? TYR B 354 ? ALA B 2378 TYR B 2385 1 ? 8  
HELX_P HELX_P50 50 TRP B 356 ? LEU B 360 ? TRP B 2387 LEU B 2391 5 ? 5  
HELX_P HELX_P51 51 PHE B 373 ? LEU B 377 ? PHE B 2404 LEU B 2408 5 ? 5  
HELX_P HELX_P52 52 ASN B 380 ? GLY B 387 ? ASN B 2411 GLY B 2418 1 ? 8  
HELX_P HELX_P53 53 HIS B 386 ? GLN B 398 ? HIS B 2417 GLN B 2429 1 ? 13 
HELX_P HELX_P54 54 PRO B 410 ? ALA B 412 ? PRO B 2441 ALA B 2443 5 ? 3  
HELX_P HELX_P55 55 VAL B 413 ? MET B 427 ? VAL B 2444 MET B 2458 1 ? 15 
HELX_P HELX_P56 56 SER B 431 ? PHE B 439 ? SER B 2462 PHE B 2470 1 ? 9  
HELX_P HELX_P57 57 SER B 446 ? GLY B 452 ? SER B 2477 GLY B 2483 1 ? 7  
HELX_P HELX_P58 58 LYS B 454 ? SER B 465 ? LYS B 2485 SER B 2496 1 ? 12 
HELX_P HELX_P59 59 ASP B 466 ? MET B 470 ? ASP B 2497 MET B 2501 5 ? 5  
HELX_P HELX_P60 60 GLU B 471 ? GLU B 479 ? GLU B 2502 GLU B 2510 1 ? 9  
HELX_P HELX_P61 61 GLY B 488 ? GLY B 505 ? GLY B 2519 GLY B 2536 1 ? 18 
HELX_P HELX_P62 62 ASN B 506 ? SER B 510 ? ASN B 2537 SER B 2541 5 ? 5  
HELX_P HELX_P63 63 LYS B 515 ? GLY B 520 ? LYS B 2546 GLY B 2551 5 ? 6  
HELX_P HELX_P64 64 GLY B 521 ? THR B 530 ? GLY B 2552 THR B 2561 1 ? 10 
HELX_P HELX_P65 65 SER B 532 ? VAL B 541 ? SER B 2563 VAL B 2572 1 ? 10 
HELX_P HELX_P66 66 THR C 1   ? SER C 9   ? THR F 2595 SER F 2603 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 4   SG  ? ? ? 1_555 A CYS 15  SG ? ? A CYS 36   A CYS 47   1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf2  disulf ?    ? A CYS 5   SG  ? ? ? 1_555 A CYS 128 SG ? ? A CYS 37   A CYS 159  1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3  disulf ?    ? A CYS 9   SG  ? ? ? 1_555 A CYS 25  SG ? ? A CYS 41   A CYS 57   1_555 ? ? ? ? ? ? ? 2.022 ? ? 
disulf4  disulf ?    ? A CYS 27  SG  ? ? ? 1_555 A CYS 37  SG ? ? A CYS 59   A CYS 69   1_555 ? ? ? ? ? ? ? 2.028 ? ? 
disulf5  disulf ?    ? A CYS 538 SG  ? ? ? 1_555 A CYS 544 SG ? ? A CYS 569  A CYS 575  1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf6  disulf ?    ? B CYS 4   SG  ? ? ? 1_555 B CYS 15  SG ? ? B CYS 2036 B CYS 2047 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf7  disulf ?    ? B CYS 5   SG  ? ? ? 1_555 B CYS 128 SG ? ? B CYS 2037 B CYS 2159 1_555 ? ? ? ? ? ? ? 2.026 ? ? 
disulf8  disulf ?    ? B CYS 9   SG  ? ? ? 1_555 B CYS 25  SG ? ? B CYS 2041 B CYS 2057 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf9  disulf ?    ? B CYS 27  SG  ? ? ? 1_555 B CYS 37  SG ? ? B CYS 2059 B CYS 2069 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf10 disulf ?    ? B CYS 538 SG  ? ? ? 1_555 B CYS 544 SG ? ? B CYS 2569 B CYS 2575 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
covale1  covale one  ? A ASN 36  ND2 ? ? ? 1_555 D NAG .   C1 ? ? A ASN 68   C NAG 1    1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale2  covale one  ? A ASN 113 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 144  D NAG 1    1_555 ? ? ? ? ? ? ? 1.442 ? 
N-Glycosylation 
covale3  covale one  ? A ASN 379 ND2 ? ? ? 1_555 H NAG .   C1 ? ? A ASN 410  A NAG 681  1_555 ? ? ? ? ? ? ? 1.470 ? 
N-Glycosylation 
covale4  covale one  ? B ASN 36  ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 2068 E NAG 1    1_555 ? ? ? ? ? ? ? 1.452 ? 
N-Glycosylation 
covale5  covale one  ? B ASN 113 ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 2144 G NAG 1    1_555 ? ? ? ? ? ? ? 1.444 ? 
N-Glycosylation 
covale6  covale one  ? B ASN 379 ND2 ? ? ? 1_555 M NAG .   C1 ? ? B ASN 2410 B NAG 2681 1_555 ? ? ? ? ? ? ? 1.432 ? 
N-Glycosylation 
covale7  covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? C NAG 1    C NAG 2    1_555 ? ? ? ? ? ? ? 1.397 ? ? 
covale8  covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? D NAG 1    D NAG 2    1_555 ? ? ? ? ? ? ? 1.362 ? ? 
covale9  covale both ? E NAG .   O4  ? ? ? 1_555 E MAN .   C1 ? ? D NAG 2    D MAN 3    1_555 ? ? ? ? ? ? ? 1.413 ? ? 
covale10 covale both ? E MAN .   O6  ? ? ? 1_555 E MAN .   C1 ? ? D MAN 3    D MAN 4    1_555 ? ? ? ? ? ? ? 1.500 ? ? 
covale11 covale both ? F NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.397 ? ? 
covale12 covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1    G NAG 2    1_555 ? ? ? ? ? ? ? 1.337 ? ? 
covale13 covale both ? G NAG .   O4  ? ? ? 1_555 G MAN .   C1 ? ? G NAG 2    G MAN 3    1_555 ? ? ? ? ? ? ? 1.398 ? ? 
covale14 covale both ? G MAN .   O6  ? ? ? 1_555 G MAN .   C1 ? ? G MAN 3    G MAN 4    1_555 ? ? ? ? ? ? ? 1.494 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 95 A . ? SER 126  A PRO 96 A ? PRO 127  A 1 1.27 
2 SER 95 B . ? SER 2126 B PRO 96 B ? PRO 2127 B 1 0.89 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 14  ? GLY A 19  ? GLU A 46   GLY A 51   
A 2 GLN A 22  ? ASP A 26  ? GLN A 54   ASP A 58   
B 1 PHE A 32  ? TYR A 33  ? PHE A 64   TYR A 65   
B 2 THR A 39  ? PRO A 40  ? THR A 71   PRO A 72   
C 1 GLN A 224 ? ILE A 226 ? GLN A 255  ILE A 257  
C 2 GLU A 229 ? TYR A 231 ? GLU A 260  TYR A 262  
D 1 PHE A 364 ? ILE A 366 ? PHE A 395  ILE A 397  
D 2 GLN A 369 ? TYR A 371 ? GLN A 400  TYR A 402  
E 1 GLU B 14  ? GLY B 19  ? GLU B 2046 GLY B 2051 
E 2 GLN B 22  ? ASP B 26  ? GLN B 2054 ASP B 2058 
F 1 PHE B 32  ? TYR B 33  ? PHE B 2064 TYR B 2065 
F 2 THR B 39  ? PRO B 40  ? THR B 2071 PRO B 2072 
G 1 GLN B 224 ? ILE B 226 ? GLN B 2255 ILE B 2257 
G 2 GLU B 229 ? TYR B 231 ? GLU B 2260 TYR B 2262 
H 1 PHE B 364 ? ILE B 366 ? PHE B 2395 ILE B 2397 
H 2 GLN B 369 ? TYR B 371 ? GLN B 2400 TYR B 2402 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 18  ? N THR A 50   O GLN A 22  ? O GLN A 54   
B 1 2 O TYR A 33  ? O TYR A 65   N THR A 39  ? N THR A 71   
C 1 2 N ILE A 226 ? N ILE A 257  O GLU A 229 ? O GLU A 260  
D 1 2 O ILE A 366 ? O ILE A 397  N GLN A 369 ? N GLN A 400  
E 1 2 N THR B 18  ? N THR B 2050 O GLN B 22  ? O GLN B 2054 
F 1 2 O TYR B 33  ? O TYR B 2065 N THR B 39  ? N THR B 2071 
G 1 2 N ILE B 226 ? N ILE B 2257 O GLU B 229 ? O GLU B 2260 
H 1 2 O ILE B 366 ? O ILE B 2397 N GLN B 369 ? N GLN B 2400 
# 
_database_PDB_matrix.entry_id          1CVU 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CVU 
_atom_sites.fract_transf_matrix[1][1]   0.005524 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007465 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008011 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ALA A 1 1   ? 29.202  7.093   13.968 1.00 42.76 ? 33   ALA A N     1 
ATOM   2     C CA    . ALA A 1 1   ? 29.943  5.862   13.577 1.00 41.90 ? 33   ALA A CA    1 
ATOM   3     C C     . ALA A 1 1   ? 31.002  5.542   14.629 1.00 41.52 ? 33   ALA A C     1 
ATOM   4     O O     . ALA A 1 1   ? 31.436  4.396   14.771 1.00 41.91 ? 33   ALA A O     1 
ATOM   5     C CB    . ALA A 1 1   ? 30.591  6.063   12.207 1.00 43.00 ? 33   ALA A CB    1 
ATOM   6     N N     . ASN A 1 2   ? 31.416  6.561   15.371 1.00 40.12 ? 34   ASN A N     1 
ATOM   7     C CA    . ASN A 1 2   ? 32.406  6.370   16.414 1.00 38.81 ? 34   ASN A CA    1 
ATOM   8     C C     . ASN A 1 2   ? 31.900  5.291   17.366 1.00 37.93 ? 34   ASN A C     1 
ATOM   9     O O     . ASN A 1 2   ? 30.876  5.468   18.017 1.00 37.34 ? 34   ASN A O     1 
ATOM   10    C CB    . ASN A 1 2   ? 32.622  7.677   17.170 1.00 40.46 ? 34   ASN A CB    1 
ATOM   11    C CG    . ASN A 1 2   ? 33.879  7.659   18.020 1.00 40.84 ? 34   ASN A CG    1 
ATOM   12    O OD1   . ASN A 1 2   ? 34.520  8.695   18.223 1.00 40.96 ? 34   ASN A OD1   1 
ATOM   13    N ND2   . ASN A 1 2   ? 34.243  6.477   18.524 1.00 42.29 ? 34   ASN A ND2   1 
ATOM   14    N N     . PRO A 1 3   ? 32.629  4.166   17.474 1.00 36.57 ? 35   PRO A N     1 
ATOM   15    C CA    . PRO A 1 3   ? 32.249  3.047   18.349 1.00 35.19 ? 35   PRO A CA    1 
ATOM   16    C C     . PRO A 1 3   ? 32.007  3.431   19.799 1.00 32.97 ? 35   PRO A C     1 
ATOM   17    O O     . PRO A 1 3   ? 31.507  2.632   20.589 1.00 31.53 ? 35   PRO A O     1 
ATOM   18    C CB    . PRO A 1 3   ? 33.410  2.064   18.220 1.00 35.46 ? 35   PRO A CB    1 
ATOM   19    C CG    . PRO A 1 3   ? 34.532  2.864   17.644 1.00 36.02 ? 35   PRO A CG    1 
ATOM   20    C CD    . PRO A 1 3   ? 33.902  3.905   16.780 1.00 35.90 ? 35   PRO A CD    1 
ATOM   21    N N     . CYS A 1 4   ? 32.368  4.655   20.153 1.00 31.46 ? 36   CYS A N     1 
ATOM   22    C CA    . CYS A 1 4   ? 32.183  5.097   21.519 1.00 30.05 ? 36   CYS A CA    1 
ATOM   23    C C     . CYS A 1 4   ? 30.947  5.968   21.662 1.00 29.08 ? 36   CYS A C     1 
ATOM   24    O O     . CYS A 1 4   ? 30.676  6.481   22.738 1.00 28.08 ? 36   CYS A O     1 
ATOM   25    C CB    . CYS A 1 4   ? 33.427  5.851   22.006 1.00 29.66 ? 36   CYS A CB    1 
ATOM   26    S SG    . CYS A 1 4   ? 34.869  4.783   22.324 1.00 29.14 ? 36   CYS A SG    1 
ATOM   27    N N     . CYS A 1 5   ? 30.186  6.112   20.586 1.00 28.68 ? 37   CYS A N     1 
ATOM   28    C CA    . CYS A 1 5   ? 28.984  6.932   20.615 1.00 28.46 ? 37   CYS A CA    1 
ATOM   29    C C     . CYS A 1 5   ? 27.943  6.555   21.661 1.00 28.16 ? 37   CYS A C     1 
ATOM   30    O O     . CYS A 1 5   ? 27.179  7.406   22.098 1.00 29.29 ? 37   CYS A O     1 
ATOM   31    C CB    . CYS A 1 5   ? 28.331  6.928   19.249 1.00 28.44 ? 37   CYS A CB    1 
ATOM   32    S SG    . CYS A 1 5   ? 29.164  8.053   18.094 1.00 31.40 ? 37   CYS A SG    1 
ATOM   33    N N     . SER A 1 6   ? 27.907  5.291   22.066 1.00 27.85 ? 38   SER A N     1 
ATOM   34    C CA    . SER A 1 6   ? 26.927  4.848   23.060 1.00 27.64 ? 38   SER A CA    1 
ATOM   35    C C     . SER A 1 6   ? 27.375  5.040   24.506 1.00 27.85 ? 38   SER A C     1 
ATOM   36    O O     . SER A 1 6   ? 26.652  4.675   25.433 1.00 28.62 ? 38   SER A O     1 
ATOM   37    C CB    . SER A 1 6   ? 26.556  3.369   22.839 1.00 26.56 ? 38   SER A CB    1 
ATOM   38    O OG    . SER A 1 6   ? 27.689  2.516   22.891 1.00 26.93 ? 38   SER A OG    1 
ATOM   39    N N     . ASN A 1 7   ? 28.554  5.618   24.704 1.00 27.22 ? 39   ASN A N     1 
ATOM   40    C CA    . ASN A 1 7   ? 29.076  5.821   26.050 1.00 26.66 ? 39   ASN A CA    1 
ATOM   41    C C     . ASN A 1 7   ? 29.034  4.484   26.763 1.00 25.82 ? 39   ASN A C     1 
ATOM   42    O O     . ASN A 1 7   ? 28.498  4.374   27.866 1.00 26.97 ? 39   ASN A O     1 
ATOM   43    C CB    . ASN A 1 7   ? 28.209  6.824   26.808 1.00 27.35 ? 39   ASN A CB    1 
ATOM   44    C CG    . ASN A 1 7   ? 27.805  8.016   25.954 1.00 27.45 ? 39   ASN A CG    1 
ATOM   45    O OD1   . ASN A 1 7   ? 26.640  8.424   25.945 1.00 26.82 ? 39   ASN A OD1   1 
ATOM   46    N ND2   . ASN A 1 7   ? 28.764  8.580   25.242 1.00 27.04 ? 39   ASN A ND2   1 
ATOM   47    N N     . PRO A 1 8   ? 29.622  3.450   26.149 1.00 26.99 ? 40   PRO A N     1 
ATOM   48    C CA    . PRO A 1 8   ? 29.648  2.099   26.712 1.00 25.76 ? 40   PRO A CA    1 
ATOM   49    C C     . PRO A 1 8   ? 30.349  1.917   28.050 1.00 26.54 ? 40   PRO A C     1 
ATOM   50    O O     . PRO A 1 8   ? 29.874  1.154   28.897 1.00 28.06 ? 40   PRO A O     1 
ATOM   51    C CB    . PRO A 1 8   ? 30.316  1.269   25.618 1.00 25.28 ? 40   PRO A CB    1 
ATOM   52    C CG    . PRO A 1 8   ? 31.172  2.255   24.888 1.00 25.80 ? 40   PRO A CG    1 
ATOM   53    C CD    . PRO A 1 8   ? 30.350  3.515   24.870 1.00 26.37 ? 40   PRO A CD    1 
ATOM   54    N N     . CYS A 1 9   ? 31.481  2.589   28.239 1.00 25.38 ? 41   CYS A N     1 
ATOM   55    C CA    . CYS A 1 9   ? 32.240  2.432   29.470 1.00 25.31 ? 41   CYS A CA    1 
ATOM   56    C C     . CYS A 1 9   ? 31.608  3.088   30.667 1.00 24.96 ? 41   CYS A C     1 
ATOM   57    O O     . CYS A 1 9   ? 31.331  4.277   30.655 1.00 24.11 ? 41   CYS A O     1 
ATOM   58    C CB    . CYS A 1 9   ? 33.655  2.956   29.289 1.00 26.36 ? 41   CYS A CB    1 
ATOM   59    S SG    . CYS A 1 9   ? 34.360  2.398   27.722 1.00 26.99 ? 41   CYS A SG    1 
ATOM   60    N N     . GLN A 1 10  ? 31.393  2.289   31.704 1.00 24.52 ? 42   GLN A N     1 
ATOM   61    C CA    . GLN A 1 10  ? 30.781  2.754   32.936 1.00 24.53 ? 42   GLN A CA    1 
ATOM   62    C C     . GLN A 1 10  ? 31.809  3.079   34.009 1.00 25.10 ? 42   GLN A C     1 
ATOM   63    O O     . GLN A 1 10  ? 33.011  2.901   33.840 1.00 25.48 ? 42   GLN A O     1 
ATOM   64    C CB    . GLN A 1 10  ? 29.827  1.675   33.476 1.00 24.94 ? 42   GLN A CB    1 
ATOM   65    C CG    . GLN A 1 10  ? 28.766  1.221   32.501 1.00 23.67 ? 42   GLN A CG    1 
ATOM   66    C CD    . GLN A 1 10  ? 28.081  2.396   31.848 1.00 25.52 ? 42   GLN A CD    1 
ATOM   67    O OE1   . GLN A 1 10  ? 27.433  3.204   32.515 1.00 24.23 ? 42   GLN A OE1   1 
ATOM   68    N NE2   . GLN A 1 10  ? 28.230  2.509   30.535 1.00 26.65 ? 42   GLN A NE2   1 
ATOM   69    N N     . ASN A 1 11  ? 31.309  3.578   35.124 1.00 26.28 ? 43   ASN A N     1 
ATOM   70    C CA    . ASN A 1 11  ? 32.141  3.901   36.272 1.00 28.07 ? 43   ASN A CA    1 
ATOM   71    C C     . ASN A 1 11  ? 33.399  4.699   36.001 1.00 28.05 ? 43   ASN A C     1 
ATOM   72    O O     . ASN A 1 11  ? 34.420  4.491   36.636 1.00 26.98 ? 43   ASN A O     1 
ATOM   73    C CB    . ASN A 1 11  ? 32.472  2.610   36.997 1.00 27.55 ? 43   ASN A CB    1 
ATOM   74    C CG    . ASN A 1 11  ? 31.227  1.887   37.428 1.00 29.53 ? 43   ASN A CG    1 
ATOM   75    O OD1   . ASN A 1 11  ? 30.394  2.462   38.125 1.00 28.07 ? 43   ASN A OD1   1 
ATOM   76    N ND2   . ASN A 1 11  ? 31.070  0.633   36.997 1.00 30.22 ? 43   ASN A ND2   1 
ATOM   77    N N     . ARG A 1 12  ? 33.294  5.633   35.070 1.00 28.60 ? 44   ARG A N     1 
ATOM   78    C CA    . ARG A 1 12  ? 34.398  6.505   34.705 1.00 30.11 ? 44   ARG A CA    1 
ATOM   79    C C     . ARG A 1 12  ? 35.477  5.870   33.852 1.00 29.86 ? 44   ARG A C     1 
ATOM   80    O O     . ARG A 1 12  ? 36.488  6.509   33.572 1.00 29.48 ? 44   ARG A O     1 
ATOM   81    C CB    . ARG A 1 12  ? 35.017  7.125   35.952 1.00 30.91 ? 44   ARG A CB    1 
ATOM   82    C CG    . ARG A 1 12  ? 34.025  7.963   36.745 1.00 31.94 ? 44   ARG A CG    1 
ATOM   83    C CD    . ARG A 1 12  ? 34.176  9.435   36.445 1.00 32.71 ? 44   ARG A CD    1 
ATOM   84    N NE    . ARG A 1 12  ? 34.872  10.112  37.529 1.00 32.96 ? 44   ARG A NE    1 
ATOM   85    C CZ    . ARG A 1 12  ? 35.735  11.104  37.348 1.00 34.21 ? 44   ARG A CZ    1 
ATOM   86    N NH1   . ARG A 1 12  ? 35.999  11.526  36.117 1.00 34.47 ? 44   ARG A NH1   1 
ATOM   87    N NH2   . ARG A 1 12  ? 36.322  11.680  38.395 1.00 33.75 ? 44   ARG A NH2   1 
ATOM   88    N N     . GLY A 1 13  ? 35.269  4.623   33.437 1.00 30.63 ? 45   GLY A N     1 
ATOM   89    C CA    . GLY A 1 13  ? 36.240  3.979   32.572 1.00 31.66 ? 45   GLY A CA    1 
ATOM   90    C C     . GLY A 1 13  ? 36.216  4.783   31.279 1.00 32.66 ? 45   GLY A C     1 
ATOM   91    O O     . GLY A 1 13  ? 35.166  5.341   30.917 1.00 32.05 ? 45   GLY A O     1 
ATOM   92    N N     . GLU A 1 14  ? 37.348  4.858   30.579 1.00 32.09 ? 46   GLU A N     1 
ATOM   93    C CA    . GLU A 1 14  ? 37.409  5.633   29.339 1.00 32.26 ? 46   GLU A CA    1 
ATOM   94    C C     . GLU A 1 14  ? 37.298  4.798   28.070 1.00 31.09 ? 46   GLU A C     1 
ATOM   95    O O     . GLU A 1 14  ? 37.928  3.753   27.947 1.00 31.57 ? 46   GLU A O     1 
ATOM   96    C CB    . GLU A 1 14  ? 38.701  6.442   29.291 1.00 34.08 ? 46   GLU A CB    1 
ATOM   97    C CG    . GLU A 1 14  ? 39.078  7.068   30.611 1.00 37.19 ? 46   GLU A CG    1 
ATOM   98    C CD    . GLU A 1 14  ? 40.097  8.187   30.461 1.00 39.81 ? 46   GLU A CD    1 
ATOM   99    O OE1   . GLU A 1 14  ? 40.741  8.275   29.381 1.00 41.32 ? 46   GLU A OE1   1 
ATOM   100   O OE2   . GLU A 1 14  ? 40.251  8.974   31.426 1.00 41.24 ? 46   GLU A OE2   1 
ATOM   101   N N     . CYS A 1 15  ? 36.497  5.281   27.130 1.00 29.69 ? 47   CYS A N     1 
ATOM   102   C CA    . CYS A 1 15  ? 36.286  4.602   25.866 1.00 28.00 ? 47   CYS A CA    1 
ATOM   103   C C     . CYS A 1 15  ? 37.250  5.074   24.798 1.00 26.79 ? 47   CYS A C     1 
ATOM   104   O O     . CYS A 1 15  ? 37.422  6.268   24.597 1.00 26.24 ? 47   CYS A O     1 
ATOM   105   C CB    . CYS A 1 15  ? 34.864  4.851   25.383 1.00 27.92 ? 47   CYS A CB    1 
ATOM   106   S SG    . CYS A 1 15  ? 34.362  3.774   24.021 1.00 29.03 ? 47   CYS A SG    1 
ATOM   107   N N     . MET A 1 16  ? 37.877  4.128   24.116 1.00 26.20 ? 48   MET A N     1 
ATOM   108   C CA    . MET A 1 16  ? 38.804  4.447   23.043 1.00 26.18 ? 48   MET A CA    1 
ATOM   109   C C     . MET A 1 16  ? 38.484  3.525   21.873 1.00 25.80 ? 48   MET A C     1 
ATOM   110   O O     . MET A 1 16  ? 38.209  2.350   22.077 1.00 24.99 ? 48   MET A O     1 
ATOM   111   C CB    . MET A 1 16  ? 40.238  4.215   23.507 1.00 26.44 ? 48   MET A CB    1 
ATOM   112   C CG    . MET A 1 16  ? 41.284  4.429   22.421 1.00 27.24 ? 48   MET A CG    1 
ATOM   113   S SD    . MET A 1 16  ? 42.906  3.905   22.970 1.00 26.81 ? 48   MET A SD    1 
ATOM   114   C CE    . MET A 1 16  ? 42.651  2.088   23.067 1.00 24.74 ? 48   MET A CE    1 
ATOM   115   N N     . SER A 1 17  ? 38.488  4.055   20.655 1.00 25.71 ? 49   SER A N     1 
ATOM   116   C CA    . SER A 1 17  ? 38.200  3.220   19.505 1.00 26.39 ? 49   SER A CA    1 
ATOM   117   C C     . SER A 1 17  ? 39.435  2.386   19.235 1.00 27.44 ? 49   SER A C     1 
ATOM   118   O O     . SER A 1 17  ? 40.557  2.858   19.405 1.00 28.00 ? 49   SER A O     1 
ATOM   119   C CB    . SER A 1 17  ? 37.854  4.067   18.276 1.00 24.95 ? 49   SER A CB    1 
ATOM   120   O OG    . SER A 1 17  ? 38.673  5.214   18.198 1.00 26.05 ? 49   SER A OG    1 
ATOM   121   N N     . THR A 1 18  ? 39.229  1.142   18.826 1.00 28.31 ? 50   THR A N     1 
ATOM   122   C CA    . THR A 1 18  ? 40.340  0.258   18.540 1.00 29.52 ? 50   THR A CA    1 
ATOM   123   C C     . THR A 1 18  ? 40.285  -0.176  17.091 1.00 30.16 ? 50   THR A C     1 
ATOM   124   O O     . THR A 1 18  ? 41.079  -0.992  16.650 1.00 32.56 ? 50   THR A O     1 
ATOM   125   C CB    . THR A 1 18  ? 40.289  -0.975  19.422 1.00 29.62 ? 50   THR A CB    1 
ATOM   126   O OG1   . THR A 1 18  ? 38.970  -1.520  19.383 1.00 32.08 ? 50   THR A OG1   1 
ATOM   127   C CG2   . THR A 1 18  ? 40.620  -0.618  20.842 1.00 27.50 ? 50   THR A CG2   1 
ATOM   128   N N     . GLY A 1 19  ? 39.336  0.378   16.358 1.00 30.32 ? 51   GLY A N     1 
ATOM   129   C CA    . GLY A 1 19  ? 39.168  0.057   14.954 1.00 30.02 ? 51   GLY A CA    1 
ATOM   130   C C     . GLY A 1 19  ? 37.945  0.834   14.531 1.00 31.37 ? 51   GLY A C     1 
ATOM   131   O O     . GLY A 1 19  ? 37.330  1.503   15.360 1.00 32.56 ? 51   GLY A O     1 
ATOM   132   N N     . PHE A 1 20  ? 37.568  0.765   13.268 1.00 32.40 ? 52   PHE A N     1 
ATOM   133   C CA    . PHE A 1 20  ? 36.401  1.508   12.822 1.00 34.46 ? 52   PHE A CA    1 
ATOM   134   C C     . PHE A 1 20  ? 35.134  1.175   13.605 1.00 35.93 ? 52   PHE A C     1 
ATOM   135   O O     . PHE A 1 20  ? 34.351  2.064   13.943 1.00 36.50 ? 52   PHE A O     1 
ATOM   136   C CB    . PHE A 1 20  ? 36.166  1.264   11.334 1.00 32.73 ? 52   PHE A CB    1 
ATOM   137   C CG    . PHE A 1 20  ? 37.232  1.856   10.460 1.00 30.88 ? 52   PHE A CG    1 
ATOM   138   C CD1   . PHE A 1 20  ? 38.266  1.065   9.977  1.00 29.68 ? 52   PHE A CD1   1 
ATOM   139   C CD2   . PHE A 1 20  ? 37.219  3.213   10.150 1.00 29.07 ? 52   PHE A CD2   1 
ATOM   140   C CE1   . PHE A 1 20  ? 39.270  1.615   9.202  1.00 28.35 ? 52   PHE A CE1   1 
ATOM   141   C CE2   . PHE A 1 20  ? 38.216  3.774   9.377  1.00 28.22 ? 52   PHE A CE2   1 
ATOM   142   C CZ    . PHE A 1 20  ? 39.248  2.973   8.901  1.00 28.07 ? 52   PHE A CZ    1 
ATOM   143   N N     . ASP A 1 21  ? 34.935  -0.101  13.906 1.00 38.30 ? 53   ASP A N     1 
ATOM   144   C CA    . ASP A 1 21  ? 33.742  -0.512  14.625 1.00 40.52 ? 53   ASP A CA    1 
ATOM   145   C C     . ASP A 1 21  ? 34.052  -1.271  15.898 1.00 39.65 ? 53   ASP A C     1 
ATOM   146   O O     . ASP A 1 21  ? 33.391  -2.254  16.213 1.00 40.30 ? 53   ASP A O     1 
ATOM   147   C CB    . ASP A 1 21  ? 32.861  -1.378  13.721 1.00 43.42 ? 53   ASP A CB    1 
ATOM   148   C CG    . ASP A 1 21  ? 32.692  -0.785  12.326 1.00 45.44 ? 53   ASP A CG    1 
ATOM   149   O OD1   . ASP A 1 21  ? 32.202  0.369   12.218 1.00 48.68 ? 53   ASP A OD1   1 
ATOM   150   O OD2   . ASP A 1 21  ? 33.051  -1.472  11.339 1.00 46.73 ? 53   ASP A OD2   1 
ATOM   151   N N     . GLN A 1 22  ? 35.061  -0.829  16.631 1.00 39.14 ? 54   GLN A N     1 
ATOM   152   C CA    . GLN A 1 22  ? 35.397  -1.492  17.874 1.00 37.59 ? 54   GLN A CA    1 
ATOM   153   C C     . GLN A 1 22  ? 35.910  -0.478  18.876 1.00 35.71 ? 54   GLN A C     1 
ATOM   154   O O     . GLN A 1 22  ? 36.421  0.573   18.508 1.00 35.77 ? 54   GLN A O     1 
ATOM   155   C CB    . GLN A 1 22  ? 36.441  -2.574  17.632 1.00 41.50 ? 54   GLN A CB    1 
ATOM   156   C CG    . GLN A 1 22  ? 36.215  -3.377  16.364 1.00 44.90 ? 54   GLN A CG    1 
ATOM   157   C CD    . GLN A 1 22  ? 37.504  -3.634  15.601 1.00 47.63 ? 54   GLN A CD    1 
ATOM   158   O OE1   . GLN A 1 22  ? 37.617  -3.294  14.414 1.00 48.29 ? 54   GLN A OE1   1 
ATOM   159   N NE2   . GLN A 1 22  ? 38.489  -4.235  16.283 1.00 48.84 ? 54   GLN A NE2   1 
ATOM   160   N N     . TYR A 1 23  ? 35.761  -0.791  20.151 1.00 33.37 ? 55   TYR A N     1 
ATOM   161   C CA    . TYR A 1 23  ? 36.210  0.109   21.191 1.00 30.51 ? 55   TYR A CA    1 
ATOM   162   C C     . TYR A 1 23  ? 36.827  -0.701  22.305 1.00 30.50 ? 55   TYR A C     1 
ATOM   163   O O     . TYR A 1 23  ? 36.793  -1.924  22.285 1.00 30.54 ? 55   TYR A O     1 
ATOM   164   C CB    . TYR A 1 23  ? 35.042  0.928   21.741 1.00 29.85 ? 55   TYR A CB    1 
ATOM   165   C CG    . TYR A 1 23  ? 34.092  0.136   22.613 1.00 28.41 ? 55   TYR A CG    1 
ATOM   166   C CD1   . TYR A 1 23  ? 34.320  -0.010  23.980 1.00 28.11 ? 55   TYR A CD1   1 
ATOM   167   C CD2   . TYR A 1 23  ? 32.945  -0.449  22.073 1.00 27.17 ? 55   TYR A CD2   1 
ATOM   168   C CE1   . TYR A 1 23  ? 33.420  -0.718  24.792 1.00 27.07 ? 55   TYR A CE1   1 
ATOM   169   C CE2   . TYR A 1 23  ? 32.044  -1.153  22.874 1.00 25.88 ? 55   TYR A CE2   1 
ATOM   170   C CZ    . TYR A 1 23  ? 32.283  -1.283  24.225 1.00 26.12 ? 55   TYR A CZ    1 
ATOM   171   O OH    . TYR A 1 23  ? 31.381  -1.968  25.004 1.00 25.08 ? 55   TYR A OH    1 
ATOM   172   N N     . LYS A 1 24  ? 37.393  -0.003  23.278 1.00 30.23 ? 56   LYS A N     1 
ATOM   173   C CA    . LYS A 1 24  ? 38.020  -0.642  24.418 1.00 29.82 ? 56   LYS A CA    1 
ATOM   174   C C     . LYS A 1 24  ? 37.812  0.318   25.579 1.00 28.00 ? 56   LYS A C     1 
ATOM   175   O O     . LYS A 1 24  ? 37.835  1.528   25.382 1.00 28.16 ? 56   LYS A O     1 
ATOM   176   C CB    . LYS A 1 24  ? 39.511  -0.834  24.135 1.00 31.43 ? 56   LYS A CB    1 
ATOM   177   C CG    . LYS A 1 24  ? 40.368  -0.959  25.371 1.00 34.52 ? 56   LYS A CG    1 
ATOM   178   C CD    . LYS A 1 24  ? 41.056  -2.303  25.409 1.00 37.83 ? 56   LYS A CD    1 
ATOM   179   C CE    . LYS A 1 24  ? 41.526  -2.660  26.811 1.00 39.97 ? 56   LYS A CE    1 
ATOM   180   N NZ    . LYS A 1 24  ? 42.740  -3.549  26.744 1.00 43.98 ? 56   LYS A NZ    1 
ATOM   181   N N     . CYS A 1 25  ? 37.574  -0.208  26.775 1.00 26.38 ? 57   CYS A N     1 
ATOM   182   C CA    . CYS A 1 25  ? 37.395  0.652   27.933 1.00 25.18 ? 57   CYS A CA    1 
ATOM   183   C C     . CYS A 1 25  ? 38.640  0.559   28.786 1.00 24.94 ? 57   CYS A C     1 
ATOM   184   O O     . CYS A 1 25  ? 39.170  -0.530  29.019 1.00 23.92 ? 57   CYS A O     1 
ATOM   185   C CB    . CYS A 1 25  ? 36.197  0.220   28.767 1.00 25.39 ? 57   CYS A CB    1 
ATOM   186   S SG    . CYS A 1 25  ? 34.602  0.401   27.927 1.00 27.20 ? 57   CYS A SG    1 
ATOM   187   N N     . ASP A 1 26  ? 39.110  1.714   29.240 1.00 24.18 ? 58   ASP A N     1 
ATOM   188   C CA    . ASP A 1 26  ? 40.279  1.790   30.093 1.00 23.51 ? 58   ASP A CA    1 
ATOM   189   C C     . ASP A 1 26  ? 39.709  1.942   31.496 1.00 23.33 ? 58   ASP A C     1 
ATOM   190   O O     . ASP A 1 26  ? 39.301  3.033   31.890 1.00 23.30 ? 58   ASP A O     1 
ATOM   191   C CB    . ASP A 1 26  ? 41.108  3.014   29.709 1.00 23.25 ? 58   ASP A CB    1 
ATOM   192   C CG    . ASP A 1 26  ? 42.398  3.126   30.501 1.00 23.56 ? 58   ASP A CG    1 
ATOM   193   O OD1   . ASP A 1 26  ? 42.574  2.390   31.497 1.00 22.15 ? 58   ASP A OD1   1 
ATOM   194   O OD2   . ASP A 1 26  ? 43.243  3.957   30.122 1.00 23.81 ? 58   ASP A OD2   1 
ATOM   195   N N     . CYS A 1 27  ? 39.673  0.842   32.243 1.00 23.17 ? 59   CYS A N     1 
ATOM   196   C CA    . CYS A 1 27  ? 39.112  0.861   33.589 1.00 23.21 ? 59   CYS A CA    1 
ATOM   197   C C     . CYS A 1 27  ? 40.105  1.232   34.675 1.00 22.53 ? 59   CYS A C     1 
ATOM   198   O O     . CYS A 1 27  ? 39.834  1.060   35.865 1.00 21.94 ? 59   CYS A O     1 
ATOM   199   C CB    . CYS A 1 27  ? 38.509  -0.499  33.920 1.00 24.26 ? 59   CYS A CB    1 
ATOM   200   S SG    . CYS A 1 27  ? 37.407  -1.142  32.638 1.00 24.55 ? 59   CYS A SG    1 
ATOM   201   N N     . THR A 1 28  ? 41.253  1.751   34.269 1.00 23.54 ? 60   THR A N     1 
ATOM   202   C CA    . THR A 1 28  ? 42.293  2.126   35.217 1.00 23.64 ? 60   THR A CA    1 
ATOM   203   C C     . THR A 1 28  ? 41.760  2.940   36.393 1.00 23.38 ? 60   THR A C     1 
ATOM   204   O O     . THR A 1 28  ? 41.062  3.932   36.217 1.00 25.42 ? 60   THR A O     1 
ATOM   205   C CB    . THR A 1 28  ? 43.416  2.927   34.518 1.00 22.44 ? 60   THR A CB    1 
ATOM   206   O OG1   . THR A 1 28  ? 43.999  2.126   33.491 1.00 21.36 ? 60   THR A OG1   1 
ATOM   207   C CG2   . THR A 1 28  ? 44.504  3.303   35.500 1.00 23.16 ? 60   THR A CG2   1 
ATOM   208   N N     . ARG A 1 29  ? 42.101  2.502   37.596 1.00 25.33 ? 61   ARG A N     1 
ATOM   209   C CA    . ARG A 1 29  ? 41.694  3.178   38.815 1.00 26.73 ? 61   ARG A CA    1 
ATOM   210   C C     . ARG A 1 29  ? 40.189  3.380   38.994 1.00 26.86 ? 61   ARG A C     1 
ATOM   211   O O     . ARG A 1 29  ? 39.766  4.114   39.889 1.00 27.40 ? 61   ARG A O     1 
ATOM   212   C CB    . ARG A 1 29  ? 42.396  4.527   38.902 1.00 28.34 ? 61   ARG A CB    1 
ATOM   213   C CG    . ARG A 1 29  ? 43.665  4.523   39.742 1.00 29.13 ? 61   ARG A CG    1 
ATOM   214   C CD    . ARG A 1 29  ? 44.561  5.692   39.361 1.00 32.55 ? 61   ARG A CD    1 
ATOM   215   N NE    . ARG A 1 29  ? 45.697  5.209   38.593 1.00 34.16 ? 61   ARG A NE    1 
ATOM   216   C CZ    . ARG A 1 29  ? 46.100  5.705   37.428 1.00 34.75 ? 61   ARG A CZ    1 
ATOM   217   N NH1   . ARG A 1 29  ? 45.471  6.720   36.855 1.00 34.20 ? 61   ARG A NH1   1 
ATOM   218   N NH2   . ARG A 1 29  ? 47.131  5.146   36.821 1.00 36.24 ? 61   ARG A NH2   1 
ATOM   219   N N     . THR A 1 30  ? 39.376  2.724   38.174 1.00 27.86 ? 62   THR A N     1 
ATOM   220   C CA    . THR A 1 30  ? 37.926  2.868   38.294 1.00 28.29 ? 62   THR A CA    1 
ATOM   221   C C     . THR A 1 30  ? 37.342  2.019   39.432 1.00 27.44 ? 62   THR A C     1 
ATOM   222   O O     . THR A 1 30  ? 36.222  2.255   39.884 1.00 28.11 ? 62   THR A O     1 
ATOM   223   C CB    . THR A 1 30  ? 37.215  2.477   36.986 1.00 27.84 ? 62   THR A CB    1 
ATOM   224   O OG1   . THR A 1 30  ? 37.441  1.088   36.726 1.00 28.14 ? 62   THR A OG1   1 
ATOM   225   C CG2   . THR A 1 30  ? 37.743  3.302   35.820 1.00 28.36 ? 62   THR A CG2   1 
ATOM   226   N N     . GLY A 1 31  ? 38.100  1.034   39.896 1.00 26.85 ? 63   GLY A N     1 
ATOM   227   C CA    . GLY A 1 31  ? 37.618  0.169   40.958 1.00 25.49 ? 63   GLY A CA    1 
ATOM   228   C C     . GLY A 1 31  ? 36.770  -0.949  40.382 1.00 26.58 ? 63   GLY A C     1 
ATOM   229   O O     . GLY A 1 31  ? 36.223  -1.763  41.121 1.00 25.01 ? 63   GLY A O     1 
ATOM   230   N N     . PHE A 1 32  ? 36.674  -0.981  39.052 1.00 27.49 ? 64   PHE A N     1 
ATOM   231   C CA    . PHE A 1 32  ? 35.894  -1.983  38.323 1.00 28.38 ? 64   PHE A CA    1 
ATOM   232   C C     . PHE A 1 32  ? 36.732  -2.515  37.176 1.00 28.52 ? 64   PHE A C     1 
ATOM   233   O O     . PHE A 1 32  ? 37.814  -2.008  36.887 1.00 29.45 ? 64   PHE A O     1 
ATOM   234   C CB    . PHE A 1 32  ? 34.637  -1.362  37.694 1.00 29.51 ? 64   PHE A CB    1 
ATOM   235   C CG    . PHE A 1 32  ? 33.641  -0.843  38.683 1.00 30.25 ? 64   PHE A CG    1 
ATOM   236   C CD1   . PHE A 1 32  ? 33.798  0.413   39.247 1.00 31.47 ? 64   PHE A CD1   1 
ATOM   237   C CD2   . PHE A 1 32  ? 32.537  -1.607  39.051 1.00 31.40 ? 64   PHE A CD2   1 
ATOM   238   C CE1   . PHE A 1 32  ? 32.866  0.907   40.176 1.00 31.40 ? 64   PHE A CE1   1 
ATOM   239   C CE2   . PHE A 1 32  ? 31.606  -1.127  39.972 1.00 31.70 ? 64   PHE A CE2   1 
ATOM   240   C CZ    . PHE A 1 32  ? 31.773  0.133   40.535 1.00 31.20 ? 64   PHE A CZ    1 
ATOM   241   N N     . TYR A 1 33  ? 36.211  -3.535  36.514 1.00 29.60 ? 65   TYR A N     1 
ATOM   242   C CA    . TYR A 1 33  ? 36.871  -4.115  35.358 1.00 31.54 ? 65   TYR A CA    1 
ATOM   243   C C     . TYR A 1 33  ? 35.814  -4.756  34.462 1.00 31.06 ? 65   TYR A C     1 
ATOM   244   O O     . TYR A 1 33  ? 34.625  -4.734  34.767 1.00 30.96 ? 65   TYR A O     1 
ATOM   245   C CB    . TYR A 1 33  ? 37.936  -5.141  35.777 1.00 32.62 ? 65   TYR A CB    1 
ATOM   246   C CG    . TYR A 1 33  ? 37.428  -6.267  36.643 1.00 34.38 ? 65   TYR A CG    1 
ATOM   247   C CD1   . TYR A 1 33  ? 36.898  -7.433  36.073 1.00 33.68 ? 65   TYR A CD1   1 
ATOM   248   C CD2   . TYR A 1 33  ? 37.481  -6.174  38.032 1.00 34.21 ? 65   TYR A CD2   1 
ATOM   249   C CE1   . TYR A 1 33  ? 36.438  -8.476  36.871 1.00 33.88 ? 65   TYR A CE1   1 
ATOM   250   C CE2   . TYR A 1 33  ? 37.025  -7.210  38.835 1.00 33.90 ? 65   TYR A CE2   1 
ATOM   251   C CZ    . TYR A 1 33  ? 36.509  -8.355  38.247 1.00 33.69 ? 65   TYR A CZ    1 
ATOM   252   O OH    . TYR A 1 33  ? 36.094  -9.392  39.039 1.00 36.27 ? 65   TYR A OH    1 
ATOM   253   N N     . GLY A 1 34  ? 36.246  -5.316  33.347 1.00 31.53 ? 66   GLY A N     1 
ATOM   254   C CA    . GLY A 1 34  ? 35.304  -5.916  32.434 1.00 32.25 ? 66   GLY A CA    1 
ATOM   255   C C     . GLY A 1 34  ? 35.238  -5.032  31.210 1.00 32.46 ? 66   GLY A C     1 
ATOM   256   O O     . GLY A 1 34  ? 35.646  -3.876  31.245 1.00 33.75 ? 66   GLY A O     1 
ATOM   257   N N     . GLU A 1 35  ? 34.726  -5.573  30.122 1.00 31.70 ? 67   GLU A N     1 
ATOM   258   C CA    . GLU A 1 35  ? 34.623  -4.827  28.889 1.00 32.82 ? 67   GLU A CA    1 
ATOM   259   C C     . GLU A 1 35  ? 34.140  -3.399  29.096 1.00 33.21 ? 67   GLU A C     1 
ATOM   260   O O     . GLU A 1 35  ? 34.639  -2.475  28.455 1.00 32.54 ? 67   GLU A O     1 
ATOM   261   C CB    . GLU A 1 35  ? 33.683  -5.559  27.939 1.00 34.54 ? 67   GLU A CB    1 
ATOM   262   C CG    . GLU A 1 35  ? 33.547  -4.932  26.571 1.00 36.92 ? 67   GLU A CG    1 
ATOM   263   C CD    . GLU A 1 35  ? 32.509  -5.640  25.712 1.00 40.03 ? 67   GLU A CD    1 
ATOM   264   O OE1   . GLU A 1 35  ? 32.047  -6.729  26.122 1.00 42.22 ? 67   GLU A OE1   1 
ATOM   265   O OE2   . GLU A 1 35  ? 32.154  -5.109  24.632 1.00 41.47 ? 67   GLU A OE2   1 
ATOM   266   N N     . ASN A 1 36  ? 33.185  -3.213  30.000 1.00 32.47 ? 68   ASN A N     1 
ATOM   267   C CA    . ASN A 1 36  ? 32.629  -1.886  30.238 1.00 32.90 ? 68   ASN A CA    1 
ATOM   268   C C     . ASN A 1 36  ? 32.879  -1.356  31.640 1.00 31.64 ? 68   ASN A C     1 
ATOM   269   O O     . ASN A 1 36  ? 32.169  -0.467  32.104 1.00 31.27 ? 68   ASN A O     1 
ATOM   270   C CB    . ASN A 1 36  ? 31.129  -1.921  29.940 1.00 34.47 ? 68   ASN A CB    1 
ATOM   271   C CG    . ASN A 1 36  ? 30.840  -2.507  28.575 1.00 37.44 ? 68   ASN A CG    1 
ATOM   272   O OD1   . ASN A 1 36  ? 31.457  -2.081  27.599 1.00 36.91 ? 68   ASN A OD1   1 
ATOM   273   N ND2   . ASN A 1 36  ? 29.929  -3.480  28.480 1.00 40.74 ? 68   ASN A ND2   1 
ATOM   274   N N     . CYS A 1 37  ? 33.899  -1.897  32.302 1.00 29.76 ? 69   CYS A N     1 
ATOM   275   C CA    . CYS A 1 37  ? 34.258  -1.503  33.669 1.00 28.72 ? 69   CYS A CA    1 
ATOM   276   C C     . CYS A 1 37  ? 33.032  -1.600  34.550 1.00 28.18 ? 69   CYS A C     1 
ATOM   277   O O     . CYS A 1 37  ? 32.714  -0.684  35.295 1.00 28.40 ? 69   CYS A O     1 
ATOM   278   C CB    . CYS A 1 37  ? 34.797  -0.070  33.713 1.00 27.16 ? 69   CYS A CB    1 
ATOM   279   S SG    . CYS A 1 37  ? 36.015  0.317   32.418 1.00 25.90 ? 69   CYS A SG    1 
ATOM   280   N N     . THR A 1 38  ? 32.346  -2.724  34.465 1.00 29.20 ? 70   THR A N     1 
ATOM   281   C CA    . THR A 1 38  ? 31.141  -2.900  35.246 1.00 30.41 ? 70   THR A CA    1 
ATOM   282   C C     . THR A 1 38  ? 31.320  -3.884  36.393 1.00 30.26 ? 70   THR A C     1 
ATOM   283   O O     . THR A 1 38  ? 30.583  -3.838  37.369 1.00 30.75 ? 70   THR A O     1 
ATOM   284   C CB    . THR A 1 38  ? 29.986  -3.346  34.338 1.00 30.76 ? 70   THR A CB    1 
ATOM   285   O OG1   . THR A 1 38  ? 30.492  -4.234  33.328 1.00 33.58 ? 70   THR A OG1   1 
ATOM   286   C CG2   . THR A 1 38  ? 29.351  -2.128  33.665 1.00 29.14 ? 70   THR A CG2   1 
ATOM   287   N N     . THR A 1 39  ? 32.303  -4.766  36.292 1.00 31.21 ? 71   THR A N     1 
ATOM   288   C CA    . THR A 1 39  ? 32.537  -5.733  37.354 1.00 31.28 ? 71   THR A CA    1 
ATOM   289   C C     . THR A 1 39  ? 33.352  -5.092  38.475 1.00 32.68 ? 71   THR A C     1 
ATOM   290   O O     . THR A 1 39  ? 34.538  -4.811  38.306 1.00 33.25 ? 71   THR A O     1 
ATOM   291   C CB    . THR A 1 39  ? 33.292  -6.945  36.833 1.00 31.23 ? 71   THR A CB    1 
ATOM   292   O OG1   . THR A 1 39  ? 32.634  -7.444  35.665 1.00 31.46 ? 71   THR A OG1   1 
ATOM   293   C CG2   . THR A 1 39  ? 33.328  -8.031  37.881 1.00 30.68 ? 71   THR A CG2   1 
ATOM   294   N N     . PRO A 1 40  ? 32.732  -4.901  39.655 1.00 34.56 ? 72   PRO A N     1 
ATOM   295   C CA    . PRO A 1 40  ? 33.367  -4.287  40.819 1.00 34.63 ? 72   PRO A CA    1 
ATOM   296   C C     . PRO A 1 40  ? 34.373  -5.175  41.477 1.00 36.24 ? 72   PRO A C     1 
ATOM   297   O O     . PRO A 1 40  ? 34.189  -6.383  41.551 1.00 37.56 ? 72   PRO A O     1 
ATOM   298   C CB    . PRO A 1 40  ? 32.207  -4.022  41.756 1.00 34.82 ? 72   PRO A CB    1 
ATOM   299   C CG    . PRO A 1 40  ? 31.293  -5.141  41.476 1.00 33.30 ? 72   PRO A CG    1 
ATOM   300   C CD    . PRO A 1 40  ? 31.368  -5.347  39.980 1.00 33.32 ? 72   PRO A CD    1 
ATOM   301   N N     . GLU A 1 41  ? 35.437  -4.564  41.968 1.00 37.68 ? 73   GLU A N     1 
ATOM   302   C CA    . GLU A 1 41  ? 36.459  -5.304  42.661 1.00 38.48 ? 73   GLU A CA    1 
ATOM   303   C C     . GLU A 1 41  ? 35.927  -5.511  44.064 1.00 40.04 ? 73   GLU A C     1 
ATOM   304   O O     . GLU A 1 41  ? 34.927  -4.901  44.444 1.00 40.20 ? 73   GLU A O     1 
ATOM   305   C CB    . GLU A 1 41  ? 37.750  -4.506  42.674 1.00 38.12 ? 73   GLU A CB    1 
ATOM   306   C CG    . GLU A 1 41  ? 38.568  -4.739  41.425 1.00 38.77 ? 73   GLU A CG    1 
ATOM   307   C CD    . GLU A 1 41  ? 39.287  -3.494  40.963 1.00 40.78 ? 73   GLU A CD    1 
ATOM   308   O OE1   . GLU A 1 41  ? 39.357  -2.530  41.760 1.00 41.25 ? 73   GLU A OE1   1 
ATOM   309   O OE2   . GLU A 1 41  ? 39.780  -3.484  39.808 1.00 42.01 ? 73   GLU A OE2   1 
ATOM   310   N N     . PHE A 1 42  ? 36.582  -6.368  44.834 1.00 41.40 ? 74   PHE A N     1 
ATOM   311   C CA    . PHE A 1 42  ? 36.128  -6.639  46.189 1.00 42.27 ? 74   PHE A CA    1 
ATOM   312   C C     . PHE A 1 42  ? 35.899  -5.404  47.058 1.00 41.88 ? 74   PHE A C     1 
ATOM   313   O O     . PHE A 1 42  ? 34.787  -5.183  47.546 1.00 41.36 ? 74   PHE A O     1 
ATOM   314   C CB    . PHE A 1 42  ? 37.102  -7.572  46.913 1.00 44.58 ? 74   PHE A CB    1 
ATOM   315   C CG    . PHE A 1 42  ? 36.643  -7.955  48.296 1.00 47.00 ? 74   PHE A CG    1 
ATOM   316   C CD1   . PHE A 1 42  ? 35.556  -8.818  48.469 1.00 47.59 ? 74   PHE A CD1   1 
ATOM   317   C CD2   . PHE A 1 42  ? 37.268  -7.427  49.428 1.00 47.51 ? 74   PHE A CD2   1 
ATOM   318   C CE1   . PHE A 1 42  ? 35.095  -9.147  49.749 1.00 49.35 ? 74   PHE A CE1   1 
ATOM   319   C CE2   . PHE A 1 42  ? 36.816  -7.749  50.718 1.00 48.75 ? 74   PHE A CE2   1 
ATOM   320   C CZ    . PHE A 1 42  ? 35.728  -8.610  50.878 1.00 49.52 ? 74   PHE A CZ    1 
ATOM   321   N N     . LEU A 1 43  ? 36.946  -4.610  47.273 1.00 42.06 ? 75   LEU A N     1 
ATOM   322   C CA    . LEU A 1 43  ? 36.807  -3.433  48.123 1.00 43.24 ? 75   LEU A CA    1 
ATOM   323   C C     . LEU A 1 43  ? 35.748  -2.473  47.594 1.00 42.01 ? 75   LEU A C     1 
ATOM   324   O O     . LEU A 1 43  ? 35.095  -1.758  48.364 1.00 41.11 ? 75   LEU A O     1 
ATOM   325   C CB    . LEU A 1 43  ? 38.146  -2.708  48.273 1.00 44.96 ? 75   LEU A CB    1 
ATOM   326   C CG    . LEU A 1 43  ? 38.046  -1.238  48.729 1.00 46.60 ? 75   LEU A CG    1 
ATOM   327   C CD1   . LEU A 1 43  ? 37.240  -1.113  50.026 1.00 47.12 ? 75   LEU A CD1   1 
ATOM   328   C CD2   . LEU A 1 43  ? 39.461  -0.666  48.911 1.00 48.81 ? 75   LEU A CD2   1 
ATOM   329   N N     . THR A 1 44  ? 35.589  -2.447  46.277 1.00 40.58 ? 76   THR A N     1 
ATOM   330   C CA    . THR A 1 44  ? 34.592  -1.590  45.668 1.00 39.30 ? 76   THR A CA    1 
ATOM   331   C C     . THR A 1 44  ? 33.243  -2.080  46.163 1.00 40.67 ? 76   THR A C     1 
ATOM   332   O O     . THR A 1 44  ? 32.413  -1.302  46.628 1.00 41.11 ? 76   THR A O     1 
ATOM   333   C CB    . THR A 1 44  ? 34.640  -1.694  44.149 1.00 38.93 ? 76   THR A CB    1 
ATOM   334   O OG1   . THR A 1 44  ? 35.925  -1.264  43.696 1.00 34.98 ? 76   THR A OG1   1 
ATOM   335   C CG2   . THR A 1 44  ? 33.552  -0.834  43.519 1.00 36.65 ? 76   THR A CG2   1 
ATOM   336   N N     . ARG A 1 45  ? 33.031  -3.382  46.063 1.00 40.55 ? 77   ARG A N     1 
ATOM   337   C CA    . ARG A 1 45  ? 31.792  -3.967  46.520 1.00 41.86 ? 77   ARG A CA    1 
ATOM   338   C C     . ARG A 1 45  ? 31.520  -3.502  47.944 1.00 42.06 ? 77   ARG A C     1 
ATOM   339   O O     . ARG A 1 45  ? 30.412  -3.077  48.260 1.00 40.58 ? 77   ARG A O     1 
ATOM   340   C CB    . ARG A 1 45  ? 31.899  -5.485  46.457 1.00 44.49 ? 77   ARG A CB    1 
ATOM   341   C CG    . ARG A 1 45  ? 31.990  -6.000  45.041 1.00 47.87 ? 77   ARG A CG    1 
ATOM   342   C CD    . ARG A 1 45  ? 32.160  -7.495  45.011 1.00 51.70 ? 77   ARG A CD    1 
ATOM   343   N NE    . ARG A 1 45  ? 30.910  -8.182  45.324 1.00 54.39 ? 77   ARG A NE    1 
ATOM   344   C CZ    . ARG A 1 45  ? 30.843  -9.441  45.749 1.00 56.65 ? 77   ARG A CZ    1 
ATOM   345   N NH1   . ARG A 1 45  ? 31.966  -10.144 45.913 1.00 57.82 ? 77   ARG A NH1   1 
ATOM   346   N NH2   . ARG A 1 45  ? 29.659  -9.994  46.022 1.00 56.19 ? 77   ARG A NH2   1 
ATOM   347   N N     . ILE A 1 46  ? 32.546  -3.568  48.790 1.00 42.15 ? 78   ILE A N     1 
ATOM   348   C CA    . ILE A 1 46  ? 32.436  -3.146  50.190 1.00 42.83 ? 78   ILE A CA    1 
ATOM   349   C C     . ILE A 1 46  ? 32.036  -1.676  50.305 1.00 43.81 ? 78   ILE A C     1 
ATOM   350   O O     . ILE A 1 46  ? 31.016  -1.336  50.908 1.00 43.88 ? 78   ILE A O     1 
ATOM   351   C CB    . ILE A 1 46  ? 33.776  -3.314  50.931 1.00 42.32 ? 78   ILE A CB    1 
ATOM   352   C CG1   . ILE A 1 46  ? 34.228  -4.765  50.861 1.00 41.79 ? 78   ILE A CG1   1 
ATOM   353   C CG2   . ILE A 1 46  ? 33.634  -2.865  52.377 1.00 41.23 ? 78   ILE A CG2   1 
ATOM   354   C CD1   . ILE A 1 46  ? 33.322  -5.681  51.632 1.00 43.89 ? 78   ILE A CD1   1 
ATOM   355   N N     . LYS A 1 47  ? 32.873  -0.812  49.740 1.00 44.70 ? 79   LYS A N     1 
ATOM   356   C CA    . LYS A 1 47  ? 32.644  0.623   49.753 1.00 46.08 ? 79   LYS A CA    1 
ATOM   357   C C     . LYS A 1 47  ? 31.251  1.023   49.270 1.00 45.86 ? 79   LYS A C     1 
ATOM   358   O O     . LYS A 1 47  ? 30.627  1.926   49.839 1.00 46.41 ? 79   LYS A O     1 
ATOM   359   C CB    . LYS A 1 47  ? 33.697  1.320   48.891 1.00 47.41 ? 79   LYS A CB    1 
ATOM   360   C CG    . LYS A 1 47  ? 35.095  1.209   49.443 1.00 50.81 ? 79   LYS A CG    1 
ATOM   361   C CD    . LYS A 1 47  ? 36.071  2.010   48.613 1.00 53.43 ? 79   LYS A CD    1 
ATOM   362   C CE    . LYS A 1 47  ? 37.389  2.194   49.356 1.00 55.76 ? 79   LYS A CE    1 
ATOM   363   N NZ    . LYS A 1 47  ? 38.520  2.487   48.419 1.00 57.21 ? 79   LYS A NZ    1 
ATOM   364   N N     . LEU A 1 48  ? 30.770  0.357   48.223 1.00 46.44 ? 80   LEU A N     1 
ATOM   365   C CA    . LEU A 1 48  ? 29.455  0.667   47.661 1.00 46.45 ? 80   LEU A CA    1 
ATOM   366   C C     . LEU A 1 48  ? 28.353  0.360   48.653 1.00 46.15 ? 80   LEU A C     1 
ATOM   367   O O     . LEU A 1 48  ? 27.357  1.074   48.741 1.00 46.27 ? 80   LEU A O     1 
ATOM   368   C CB    . LEU A 1 48  ? 29.200  -0.147  46.392 1.00 47.67 ? 80   LEU A CB    1 
ATOM   369   C CG    . LEU A 1 48  ? 29.910  0.268   45.102 1.00 48.70 ? 80   LEU A CG    1 
ATOM   370   C CD1   . LEU A 1 48  ? 29.615  -0.757  44.001 1.00 49.31 ? 80   LEU A CD1   1 
ATOM   371   C CD2   . LEU A 1 48  ? 29.453  1.665   44.692 1.00 49.33 ? 80   LEU A CD2   1 
ATOM   372   N N     . LEU A 1 49  ? 28.539  -0.725  49.389 1.00 46.29 ? 81   LEU A N     1 
ATOM   373   C CA    . LEU A 1 49  ? 27.567  -1.166  50.367 1.00 46.09 ? 81   LEU A CA    1 
ATOM   374   C C     . LEU A 1 49  ? 27.544  -0.245  51.568 1.00 44.88 ? 81   LEU A C     1 
ATOM   375   O O     . LEU A 1 49  ? 26.563  -0.189  52.299 1.00 44.42 ? 81   LEU A O     1 
ATOM   376   C CB    . LEU A 1 49  ? 27.909  -2.589  50.822 1.00 48.89 ? 81   LEU A CB    1 
ATOM   377   C CG    . LEU A 1 49  ? 26.756  -3.510  51.225 1.00 49.25 ? 81   LEU A CG    1 
ATOM   378   C CD1   . LEU A 1 49  ? 25.774  -3.670  50.067 1.00 50.38 ? 81   LEU A CD1   1 
ATOM   379   C CD2   . LEU A 1 49  ? 27.324  -4.855  51.626 1.00 50.85 ? 81   LEU A CD2   1 
ATOM   380   N N     . LEU A 1 50  ? 28.624  0.494   51.759 1.00 44.48 ? 82   LEU A N     1 
ATOM   381   C CA    . LEU A 1 50  ? 28.729  1.379   52.907 1.00 44.66 ? 82   LEU A CA    1 
ATOM   382   C C     . LEU A 1 50  ? 28.536  2.857   52.607 1.00 44.13 ? 82   LEU A C     1 
ATOM   383   O O     . LEU A 1 50  ? 28.581  3.697   53.506 1.00 44.02 ? 82   LEU A O     1 
ATOM   384   C CB    . LEU A 1 50  ? 30.083  1.173   53.574 1.00 45.87 ? 82   LEU A CB    1 
ATOM   385   C CG    . LEU A 1 50  ? 30.160  -0.054  54.486 1.00 47.30 ? 82   LEU A CG    1 
ATOM   386   C CD1   . LEU A 1 50  ? 29.744  -1.313  53.725 1.00 47.38 ? 82   LEU A CD1   1 
ATOM   387   C CD2   . LEU A 1 50  ? 31.582  -0.185  55.009 1.00 47.52 ? 82   LEU A CD2   1 
ATOM   388   N N     . LYS A 1 51  ? 28.335  3.190   51.346 1.00 43.45 ? 83   LYS A N     1 
ATOM   389   C CA    . LYS A 1 51  ? 28.137  4.579   51.008 1.00 44.19 ? 83   LYS A CA    1 
ATOM   390   C C     . LYS A 1 51  ? 26.649  4.918   51.024 1.00 41.62 ? 83   LYS A C     1 
ATOM   391   O O     . LYS A 1 51  ? 25.854  4.309   50.319 1.00 42.38 ? 83   LYS A O     1 
ATOM   392   C CB    . LYS A 1 51  ? 28.732  4.866   49.635 1.00 46.19 ? 83   LYS A CB    1 
ATOM   393   C CG    . LYS A 1 51  ? 28.670  6.325   49.235 1.00 49.75 ? 83   LYS A CG    1 
ATOM   394   C CD    . LYS A 1 51  ? 28.787  6.454   47.730 1.00 52.81 ? 83   LYS A CD    1 
ATOM   395   C CE    . LYS A 1 51  ? 27.957  7.609   47.197 1.00 54.86 ? 83   LYS A CE    1 
ATOM   396   N NZ    . LYS A 1 51  ? 28.381  7.927   45.801 1.00 56.46 ? 83   LYS A NZ    1 
ATOM   397   N N     . PRO A 1 52  ? 26.251  5.882   51.860 1.00 38.80 ? 84   PRO A N     1 
ATOM   398   C CA    . PRO A 1 52  ? 24.846  6.276   51.935 1.00 37.66 ? 84   PRO A CA    1 
ATOM   399   C C     . PRO A 1 52  ? 24.543  7.183   50.752 1.00 35.37 ? 84   PRO A C     1 
ATOM   400   O O     . PRO A 1 52  ? 25.431  7.869   50.265 1.00 34.76 ? 84   PRO A O     1 
ATOM   401   C CB    . PRO A 1 52  ? 24.764  7.019   53.255 1.00 38.67 ? 84   PRO A CB    1 
ATOM   402   C CG    . PRO A 1 52  ? 26.117  7.614   53.415 1.00 38.74 ? 84   PRO A CG    1 
ATOM   403   C CD    . PRO A 1 52  ? 27.089  6.652   52.792 1.00 38.92 ? 84   PRO A CD    1 
ATOM   404   N N     . THR A 1 53  ? 23.299  7.186   50.291 1.00 32.01 ? 85   THR A N     1 
ATOM   405   C CA    . THR A 1 53  ? 22.917  8.014   49.157 1.00 29.19 ? 85   THR A CA    1 
ATOM   406   C C     . THR A 1 53  ? 22.887  9.497   49.503 1.00 28.51 ? 85   THR A C     1 
ATOM   407   O O     . THR A 1 53  ? 22.764  9.880   50.666 1.00 28.13 ? 85   THR A O     1 
ATOM   408   C CB    . THR A 1 53  ? 21.534  7.611   48.632 1.00 28.29 ? 85   THR A CB    1 
ATOM   409   O OG1   . THR A 1 53  ? 20.519  8.144   49.490 1.00 30.13 ? 85   THR A OG1   1 
ATOM   410   C CG2   . THR A 1 53  ? 21.410  6.114   48.605 1.00 26.82 ? 85   THR A CG2   1 
ATOM   411   N N     . PRO A 1 54  ? 23.041  10.355  48.495 1.00 27.97 ? 86   PRO A N     1 
ATOM   412   C CA    . PRO A 1 54  ? 23.010  11.793  48.759 1.00 28.85 ? 86   PRO A CA    1 
ATOM   413   C C     . PRO A 1 54  ? 21.749  12.229  49.499 1.00 27.87 ? 86   PRO A C     1 
ATOM   414   O O     . PRO A 1 54  ? 21.800  13.124  50.330 1.00 29.81 ? 86   PRO A O     1 
ATOM   415   C CB    . PRO A 1 54  ? 23.113  12.411  47.367 1.00 28.73 ? 86   PRO A CB    1 
ATOM   416   C CG    . PRO A 1 54  ? 23.846  11.374  46.568 1.00 27.56 ? 86   PRO A CG    1 
ATOM   417   C CD    . PRO A 1 54  ? 23.331  10.062  47.081 1.00 28.25 ? 86   PRO A CD    1 
ATOM   418   N N     . ASN A 1 55  ? 20.624  11.584  49.217 1.00 26.92 ? 87   ASN A N     1 
ATOM   419   C CA    . ASN A 1 55  ? 19.362  11.948  49.867 1.00 26.96 ? 87   ASN A CA    1 
ATOM   420   C C     . ASN A 1 55  ? 19.309  11.553  51.327 1.00 26.87 ? 87   ASN A C     1 
ATOM   421   O O     . ASN A 1 55  ? 18.688  12.231  52.135 1.00 26.58 ? 87   ASN A O     1 
ATOM   422   C CB    . ASN A 1 55  ? 18.193  11.320  49.136 1.00 26.31 ? 87   ASN A CB    1 
ATOM   423   C CG    . ASN A 1 55  ? 17.990  11.923  47.780 1.00 26.33 ? 87   ASN A CG    1 
ATOM   424   O OD1   . ASN A 1 55  ? 18.264  13.102  47.566 1.00 27.07 ? 87   ASN A OD1   1 
ATOM   425   N ND2   . ASN A 1 55  ? 17.523  11.121  46.845 1.00 27.19 ? 87   ASN A ND2   1 
ATOM   426   N N     . THR A 1 56  ? 19.959  10.445  51.657 1.00 27.49 ? 88   THR A N     1 
ATOM   427   C CA    . THR A 1 56  ? 20.019  9.981   53.029 1.00 28.36 ? 88   THR A CA    1 
ATOM   428   C C     . THR A 1 56  ? 20.867  10.992  53.799 1.00 28.87 ? 88   THR A C     1 
ATOM   429   O O     . THR A 1 56  ? 20.510  11.429  54.899 1.00 30.13 ? 88   THR A O     1 
ATOM   430   C CB    . THR A 1 56  ? 20.718  8.617   53.105 1.00 29.23 ? 88   THR A CB    1 
ATOM   431   O OG1   . THR A 1 56  ? 20.036  7.684   52.264 1.00 30.30 ? 88   THR A OG1   1 
ATOM   432   C CG2   . THR A 1 56  ? 20.741  8.105   54.524 1.00 28.56 ? 88   THR A CG2   1 
ATOM   433   N N     . VAL A 1 57  ? 21.997  11.366  53.206 1.00 27.88 ? 89   VAL A N     1 
ATOM   434   C CA    . VAL A 1 57  ? 22.906  12.306  53.843 1.00 28.32 ? 89   VAL A CA    1 
ATOM   435   C C     . VAL A 1 57  ? 22.238  13.665  53.969 1.00 26.08 ? 89   VAL A C     1 
ATOM   436   O O     . VAL A 1 57  ? 22.368  14.345  54.980 1.00 25.84 ? 89   VAL A O     1 
ATOM   437   C CB    . VAL A 1 57  ? 24.217  12.442  53.032 1.00 27.33 ? 89   VAL A CB    1 
ATOM   438   C CG1   . VAL A 1 57  ? 25.102  13.475  53.672 1.00 28.23 ? 89   VAL A CG1   1 
ATOM   439   C CG2   . VAL A 1 57  ? 24.952  11.101  52.969 1.00 26.57 ? 89   VAL A CG2   1 
ATOM   440   N N     . HIS A 1 58  ? 21.509  14.056  52.937 1.00 26.28 ? 90   HIS A N     1 
ATOM   441   C CA    . HIS A 1 58  ? 20.832  15.342  52.960 1.00 27.95 ? 90   HIS A CA    1 
ATOM   442   C C     . HIS A 1 58  ? 19.780  15.343  54.053 1.00 28.46 ? 90   HIS A C     1 
ATOM   443   O O     . HIS A 1 58  ? 19.535  16.349  54.712 1.00 29.37 ? 90   HIS A O     1 
ATOM   444   C CB    . HIS A 1 58  ? 20.161  15.612  51.622 1.00 26.31 ? 90   HIS A CB    1 
ATOM   445   C CG    . HIS A 1 58  ? 19.246  16.790  51.645 1.00 25.63 ? 90   HIS A CG    1 
ATOM   446   N ND1   . HIS A 1 58  ? 19.686  18.078  51.417 1.00 25.65 ? 90   HIS A ND1   1 
ATOM   447   C CD2   . HIS A 1 58  ? 17.920  16.888  51.884 1.00 25.85 ? 90   HIS A CD2   1 
ATOM   448   C CE1   . HIS A 1 58  ? 18.672  18.915  51.524 1.00 25.58 ? 90   HIS A CE1   1 
ATOM   449   N NE2   . HIS A 1 58  ? 17.588  18.216  51.804 1.00 25.91 ? 90   HIS A NE2   1 
ATOM   450   N N     . TYR A 1 59  ? 19.146  14.202  54.236 1.00 29.84 ? 91   TYR A N     1 
ATOM   451   C CA    . TYR A 1 59  ? 18.128  14.080  55.251 1.00 29.99 ? 91   TYR A CA    1 
ATOM   452   C C     . TYR A 1 59  ? 18.750  14.306  56.626 1.00 29.80 ? 91   TYR A C     1 
ATOM   453   O O     . TYR A 1 59  ? 18.313  15.154  57.398 1.00 28.90 ? 91   TYR A O     1 
ATOM   454   C CB    . TYR A 1 59  ? 17.512  12.688  55.177 1.00 32.29 ? 91   TYR A CB    1 
ATOM   455   C CG    . TYR A 1 59  ? 16.538  12.417  56.285 1.00 35.00 ? 91   TYR A CG    1 
ATOM   456   C CD1   . TYR A 1 59  ? 15.166  12.483  56.054 1.00 35.24 ? 91   TYR A CD1   1 
ATOM   457   C CD2   . TYR A 1 59  ? 16.982  12.143  57.579 1.00 35.65 ? 91   TYR A CD2   1 
ATOM   458   C CE1   . TYR A 1 59  ? 14.259  12.293  57.081 1.00 37.57 ? 91   TYR A CE1   1 
ATOM   459   C CE2   . TYR A 1 59  ? 16.086  11.952  58.612 1.00 37.30 ? 91   TYR A CE2   1 
ATOM   460   C CZ    . TYR A 1 59  ? 14.725  12.031  58.359 1.00 37.88 ? 91   TYR A CZ    1 
ATOM   461   O OH    . TYR A 1 59  ? 13.831  11.870  59.394 1.00 40.29 ? 91   TYR A OH    1 
ATOM   462   N N     . ILE A 1 60  ? 19.780  13.531  56.927 1.00 31.26 ? 92   ILE A N     1 
ATOM   463   C CA    . ILE A 1 60  ? 20.456  13.635  58.210 1.00 30.61 ? 92   ILE A CA    1 
ATOM   464   C C     . ILE A 1 60  ? 20.917  15.064  58.526 1.00 30.70 ? 92   ILE A C     1 
ATOM   465   O O     . ILE A 1 60  ? 20.758  15.543  59.650 1.00 31.75 ? 92   ILE A O     1 
ATOM   466   C CB    . ILE A 1 60  ? 21.657  12.680  58.239 1.00 30.78 ? 92   ILE A CB    1 
ATOM   467   C CG1   . ILE A 1 60  ? 21.156  11.249  58.044 1.00 31.15 ? 92   ILE A CG1   1 
ATOM   468   C CG2   . ILE A 1 60  ? 22.413  12.821  59.542 1.00 29.64 ? 92   ILE A CG2   1 
ATOM   469   C CD1   . ILE A 1 60  ? 22.260  10.235  57.938 1.00 34.17 ? 92   ILE A CD1   1 
ATOM   470   N N     . LEU A 1 61  ? 21.468  15.741  57.522 1.00 30.32 ? 93   LEU A N     1 
ATOM   471   C CA    . LEU A 1 61  ? 21.987  17.107  57.663 1.00 30.12 ? 93   LEU A CA    1 
ATOM   472   C C     . LEU A 1 61  ? 20.880  18.138  57.885 1.00 30.46 ? 93   LEU A C     1 
ATOM   473   O O     . LEU A 1 61  ? 21.137  19.240  58.373 1.00 28.29 ? 93   LEU A O     1 
ATOM   474   C CB    . LEU A 1 61  ? 22.765  17.490  56.400 1.00 28.73 ? 93   LEU A CB    1 
ATOM   475   C CG    . LEU A 1 61  ? 24.282  17.716  56.377 1.00 27.88 ? 93   LEU A CG    1 
ATOM   476   C CD1   . LEU A 1 61  ? 24.943  17.275  57.657 1.00 27.35 ? 93   LEU A CD1   1 
ATOM   477   C CD2   . LEU A 1 61  ? 24.853  16.955  55.198 1.00 27.20 ? 93   LEU A CD2   1 
ATOM   478   N N     . THR A 1 62  ? 19.657  17.779  57.496 1.00 31.81 ? 94   THR A N     1 
ATOM   479   C CA    . THR A 1 62  ? 18.508  18.668  57.645 1.00 32.81 ? 94   THR A CA    1 
ATOM   480   C C     . THR A 1 62  ? 17.531  18.230  58.731 1.00 33.15 ? 94   THR A C     1 
ATOM   481   O O     . THR A 1 62  ? 16.391  18.667  58.746 1.00 33.40 ? 94   THR A O     1 
ATOM   482   C CB    . THR A 1 62  ? 17.721  18.807  56.325 1.00 33.32 ? 94   THR A CB    1 
ATOM   483   O OG1   . THR A 1 62  ? 17.458  17.511  55.783 1.00 33.90 ? 94   THR A OG1   1 
ATOM   484   C CG2   . THR A 1 62  ? 18.518  19.609  55.315 1.00 34.49 ? 94   THR A CG2   1 
ATOM   485   N N     . HIS A 1 63  ? 17.975  17.364  59.631 1.00 32.74 ? 95   HIS A N     1 
ATOM   486   C CA    . HIS A 1 63  ? 17.136  16.912  60.730 1.00 33.69 ? 95   HIS A CA    1 
ATOM   487   C C     . HIS A 1 63  ? 18.000  16.817  61.971 1.00 34.16 ? 95   HIS A C     1 
ATOM   488   O O     . HIS A 1 63  ? 19.183  17.118  61.911 1.00 33.26 ? 95   HIS A O     1 
ATOM   489   C CB    . HIS A 1 63  ? 16.528  15.547  60.423 1.00 35.50 ? 95   HIS A CB    1 
ATOM   490   C CG    . HIS A 1 63  ? 15.477  15.592  59.361 1.00 37.56 ? 95   HIS A CG    1 
ATOM   491   N ND1   . HIS A 1 63  ? 15.739  15.279  58.045 1.00 38.45 ? 95   HIS A ND1   1 
ATOM   492   C CD2   . HIS A 1 63  ? 14.174  15.956  59.409 1.00 37.70 ? 95   HIS A CD2   1 
ATOM   493   C CE1   . HIS A 1 63  ? 14.643  15.453  57.325 1.00 38.14 ? 95   HIS A CE1   1 
ATOM   494   N NE2   . HIS A 1 63  ? 13.679  15.862  58.131 1.00 38.02 ? 95   HIS A NE2   1 
ATOM   495   N N     . PHE A 1 64  ? 17.420  16.385  63.086 1.00 34.19 ? 96   PHE A N     1 
ATOM   496   C CA    . PHE A 1 64  ? 18.179  16.263  64.324 1.00 35.66 ? 96   PHE A CA    1 
ATOM   497   C C     . PHE A 1 64  ? 18.831  17.600  64.631 1.00 37.45 ? 96   PHE A C     1 
ATOM   498   O O     . PHE A 1 64  ? 19.998  17.667  65.026 1.00 37.77 ? 96   PHE A O     1 
ATOM   499   C CB    . PHE A 1 64  ? 19.256  15.192  64.181 1.00 36.03 ? 96   PHE A CB    1 
ATOM   500   C CG    . PHE A 1 64  ? 18.818  14.001  63.384 1.00 37.08 ? 96   PHE A CG    1 
ATOM   501   C CD1   . PHE A 1 64  ? 19.043  13.944  62.006 1.00 37.34 ? 96   PHE A CD1   1 
ATOM   502   C CD2   . PHE A 1 64  ? 18.186  12.931  64.004 1.00 37.14 ? 96   PHE A CD2   1 
ATOM   503   C CE1   . PHE A 1 64  ? 18.645  12.832  61.257 1.00 38.03 ? 96   PHE A CE1   1 
ATOM   504   C CE2   . PHE A 1 64  ? 17.788  11.822  63.267 1.00 38.45 ? 96   PHE A CE2   1 
ATOM   505   C CZ    . PHE A 1 64  ? 18.020  11.774  61.887 1.00 38.24 ? 96   PHE A CZ    1 
ATOM   506   N N     . LYS A 1 65  ? 18.071  18.668  64.444 1.00 38.98 ? 97   LYS A N     1 
ATOM   507   C CA    . LYS A 1 65  ? 18.584  20.000  64.687 1.00 41.21 ? 97   LYS A CA    1 
ATOM   508   C C     . LYS A 1 65  ? 19.221  20.109  66.055 1.00 40.64 ? 97   LYS A C     1 
ATOM   509   O O     . LYS A 1 65  ? 20.181  20.853  66.242 1.00 40.28 ? 97   LYS A O     1 
ATOM   510   C CB    . LYS A 1 65  ? 17.463  21.021  64.576 1.00 44.86 ? 97   LYS A CB    1 
ATOM   511   C CG    . LYS A 1 65  ? 17.964  22.443  64.617 1.00 48.10 ? 97   LYS A CG    1 
ATOM   512   C CD    . LYS A 1 65  ? 16.911  23.409  64.131 1.00 51.57 ? 97   LYS A CD    1 
ATOM   513   C CE    . LYS A 1 65  ? 17.257  24.821  64.569 1.00 53.62 ? 97   LYS A CE    1 
ATOM   514   N NZ    . LYS A 1 65  ? 16.043  25.690  64.692 1.00 57.17 ? 97   LYS A NZ    1 
ATOM   515   N N     . GLY A 1 66  ? 18.683  19.351  67.003 1.00 40.40 ? 98   GLY A N     1 
ATOM   516   C CA    . GLY A 1 66  ? 19.184  19.374  68.365 1.00 39.79 ? 98   GLY A CA    1 
ATOM   517   C C     . GLY A 1 66  ? 20.628  18.941  68.511 1.00 39.68 ? 98   GLY A C     1 
ATOM   518   O O     . GLY A 1 66  ? 21.413  19.594  69.202 1.00 39.44 ? 98   GLY A O     1 
ATOM   519   N N     . VAL A 1 67  ? 20.985  17.836  67.865 1.00 40.03 ? 99   VAL A N     1 
ATOM   520   C CA    . VAL A 1 67  ? 22.353  17.335  67.939 1.00 39.08 ? 99   VAL A CA    1 
ATOM   521   C C     . VAL A 1 67  ? 23.259  18.247  67.121 1.00 38.41 ? 99   VAL A C     1 
ATOM   522   O O     . VAL A 1 67  ? 24.404  18.513  67.497 1.00 38.19 ? 99   VAL A O     1 
ATOM   523   C CB    . VAL A 1 67  ? 22.456  15.863  67.428 1.00 39.07 ? 99   VAL A CB    1 
ATOM   524   C CG1   . VAL A 1 67  ? 21.100  15.366  66.991 1.00 38.84 ? 99   VAL A CG1   1 
ATOM   525   C CG2   . VAL A 1 67  ? 23.460  15.757  66.300 1.00 38.78 ? 99   VAL A CG2   1 
ATOM   526   N N     . TRP A 1 68  ? 22.738  18.733  66.002 1.00 37.41 ? 100  TRP A N     1 
ATOM   527   C CA    . TRP A 1 68  ? 23.511  19.626  65.154 1.00 37.22 ? 100  TRP A CA    1 
ATOM   528   C C     . TRP A 1 68  ? 23.888  20.852  65.964 1.00 38.48 ? 100  TRP A C     1 
ATOM   529   O O     . TRP A 1 68  ? 24.899  21.505  65.717 1.00 39.05 ? 100  TRP A O     1 
ATOM   530   C CB    . TRP A 1 68  ? 22.695  20.026  63.927 1.00 33.07 ? 100  TRP A CB    1 
ATOM   531   C CG    . TRP A 1 68  ? 22.702  18.957  62.918 1.00 28.42 ? 100  TRP A CG    1 
ATOM   532   C CD1   . TRP A 1 68  ? 21.627  18.377  62.340 1.00 26.57 ? 100  TRP A CD1   1 
ATOM   533   C CD2   . TRP A 1 68  ? 23.855  18.290  62.390 1.00 27.47 ? 100  TRP A CD2   1 
ATOM   534   N NE1   . TRP A 1 68  ? 22.027  17.379  61.479 1.00 26.23 ? 100  TRP A NE1   1 
ATOM   535   C CE2   . TRP A 1 68  ? 23.392  17.306  61.491 1.00 26.35 ? 100  TRP A CE2   1 
ATOM   536   C CE3   . TRP A 1 68  ? 25.239  18.428  62.594 1.00 27.08 ? 100  TRP A CE3   1 
ATOM   537   C CZ2   . TRP A 1 68  ? 24.263  16.461  60.793 1.00 26.20 ? 100  TRP A CZ2   1 
ATOM   538   C CZ3   . TRP A 1 68  ? 26.105  17.586  61.898 1.00 25.69 ? 100  TRP A CZ3   1 
ATOM   539   C CH2   . TRP A 1 68  ? 25.615  16.619  61.012 1.00 25.37 ? 100  TRP A CH2   1 
ATOM   540   N N     . ASN A 1 69  ? 23.065  21.151  66.953 1.00 40.70 ? 101  ASN A N     1 
ATOM   541   C CA    . ASN A 1 69  ? 23.316  22.289  67.807 1.00 42.40 ? 101  ASN A CA    1 
ATOM   542   C C     . ASN A 1 69  ? 24.542  22.079  68.677 1.00 42.04 ? 101  ASN A C     1 
ATOM   543   O O     . ASN A 1 69  ? 25.387  22.966  68.803 1.00 41.99 ? 101  ASN A O     1 
ATOM   544   C CB    . ASN A 1 69  ? 22.108  22.534  68.688 1.00 45.51 ? 101  ASN A CB    1 
ATOM   545   C CG    . ASN A 1 69  ? 21.464  23.857  68.404 1.00 48.88 ? 101  ASN A CG    1 
ATOM   546   O OD1   . ASN A 1 69  ? 20.383  23.926  67.797 1.00 50.11 ? 101  ASN A OD1   1 
ATOM   547   N ND2   . ASN A 1 69  ? 22.127  24.933  68.834 1.00 50.54 ? 101  ASN A ND2   1 
ATOM   548   N N     . ILE A 1 70  ? 24.636  20.900  69.281 1.00 41.50 ? 102  ILE A N     1 
ATOM   549   C CA    . ILE A 1 70  ? 25.770  20.600  70.135 1.00 41.53 ? 102  ILE A CA    1 
ATOM   550   C C     . ILE A 1 70  ? 27.016  20.570  69.252 1.00 39.25 ? 102  ILE A C     1 
ATOM   551   O O     . ILE A 1 70  ? 28.045  21.158  69.590 1.00 38.79 ? 102  ILE A O     1 
ATOM   552   C CB    . ILE A 1 70  ? 25.574  19.233  70.876 1.00 42.78 ? 102  ILE A CB    1 
ATOM   553   C CG1   . ILE A 1 70  ? 26.092  18.072  70.021 1.00 43.97 ? 102  ILE A CG1   1 
ATOM   554   C CG2   . ILE A 1 70  ? 24.094  19.028  71.212 1.00 41.96 ? 102  ILE A CG2   1 
ATOM   555   C CD1   . ILE A 1 70  ? 26.166  16.735  70.754 1.00 45.32 ? 102  ILE A CD1   1 
ATOM   556   N N     . VAL A 1 71  ? 26.900  19.908  68.103 1.00 37.60 ? 103  VAL A N     1 
ATOM   557   C CA    . VAL A 1 71  ? 28.007  19.795  67.164 1.00 36.90 ? 103  VAL A CA    1 
ATOM   558   C C     . VAL A 1 71  ? 28.502  21.169  66.733 1.00 36.02 ? 103  VAL A C     1 
ATOM   559   O O     . VAL A 1 71  ? 29.696  21.461  66.793 1.00 34.98 ? 103  VAL A O     1 
ATOM   560   C CB    . VAL A 1 71  ? 27.587  19.010  65.915 1.00 35.78 ? 103  VAL A CB    1 
ATOM   561   C CG1   . VAL A 1 71  ? 28.708  19.027  64.884 1.00 35.14 ? 103  VAL A CG1   1 
ATOM   562   C CG2   . VAL A 1 71  ? 27.216  17.592  66.303 1.00 34.92 ? 103  VAL A CG2   1 
ATOM   563   N N     . ASN A 1 72  ? 27.572  22.011  66.303 1.00 35.83 ? 104  ASN A N     1 
ATOM   564   C CA    . ASN A 1 72  ? 27.914  23.353  65.852 1.00 36.54 ? 104  ASN A CA    1 
ATOM   565   C C     . ASN A 1 72  ? 28.671  24.117  66.931 1.00 37.30 ? 104  ASN A C     1 
ATOM   566   O O     . ASN A 1 72  ? 29.297  25.137  66.647 1.00 36.80 ? 104  ASN A O     1 
ATOM   567   C CB    . ASN A 1 72  ? 26.644  24.129  65.479 1.00 36.05 ? 104  ASN A CB    1 
ATOM   568   C CG    . ASN A 1 72  ? 26.102  23.754  64.111 1.00 35.05 ? 104  ASN A CG    1 
ATOM   569   O OD1   . ASN A 1 72  ? 26.740  23.026  63.356 1.00 35.99 ? 104  ASN A OD1   1 
ATOM   570   N ND2   . ASN A 1 72  ? 24.916  24.255  63.788 1.00 33.64 ? 104  ASN A ND2   1 
ATOM   571   N N     . ASN A 1 73  ? 28.616  23.628  68.166 1.00 38.46 ? 105  ASN A N     1 
ATOM   572   C CA    . ASN A 1 73  ? 29.295  24.305  69.264 1.00 38.83 ? 105  ASN A CA    1 
ATOM   573   C C     . ASN A 1 73  ? 30.494  23.555  69.825 1.00 38.78 ? 105  ASN A C     1 
ATOM   574   O O     . ASN A 1 73  ? 31.059  23.944  70.851 1.00 38.46 ? 105  ASN A O     1 
ATOM   575   C CB    . ASN A 1 73  ? 28.297  24.606  70.377 1.00 40.17 ? 105  ASN A CB    1 
ATOM   576   C CG    . ASN A 1 73  ? 27.385  25.751  70.019 1.00 41.75 ? 105  ASN A CG    1 
ATOM   577   O OD1   . ASN A 1 73  ? 27.805  26.911  69.977 1.00 44.63 ? 105  ASN A OD1   1 
ATOM   578   N ND2   . ASN A 1 73  ? 26.132  25.434  69.734 1.00 43.57 ? 105  ASN A ND2   1 
ATOM   579   N N     . ILE A 1 74  A 30.875  22.480  69.145 1.00 38.04 ? 105  ILE A N     1 
ATOM   580   C CA    . ILE A 1 74  A 32.026  21.679  69.543 1.00 36.92 ? 105  ILE A CA    1 
ATOM   581   C C     . ILE A 1 74  A 33.008  21.796  68.385 1.00 37.04 ? 105  ILE A C     1 
ATOM   582   O O     . ILE A 1 74  A 33.050  20.937  67.500 1.00 37.24 ? 105  ILE A O     1 
ATOM   583   C CB    . ILE A 1 74  A 31.627  20.210  69.751 1.00 36.59 ? 105  ILE A CB    1 
ATOM   584   C CG1   . ILE A 1 74  A 30.776  20.083  71.018 1.00 35.60 ? 105  ILE A CG1   1 
ATOM   585   C CG2   . ILE A 1 74  A 32.866  19.339  69.856 1.00 35.69 ? 105  ILE A CG2   1 
ATOM   586   C CD1   . ILE A 1 74  A 29.880  18.872  71.025 1.00 34.45 ? 105  ILE A CD1   1 
ATOM   587   N N     . PRO A 1 75  ? 33.799  22.882  68.370 1.00 36.20 ? 106  PRO A N     1 
ATOM   588   C CA    . PRO A 1 75  ? 34.802  23.192  67.349 1.00 35.33 ? 106  PRO A CA    1 
ATOM   589   C C     . PRO A 1 75  ? 35.446  21.963  66.747 1.00 35.18 ? 106  PRO A C     1 
ATOM   590   O O     . PRO A 1 75  ? 35.519  21.812  65.534 1.00 35.59 ? 106  PRO A O     1 
ATOM   591   C CB    . PRO A 1 75  ? 35.801  24.059  68.091 1.00 35.57 ? 106  PRO A CB    1 
ATOM   592   C CG    . PRO A 1 75  ? 34.953  24.798  69.075 1.00 36.35 ? 106  PRO A CG    1 
ATOM   593   C CD    . PRO A 1 75  ? 33.768  23.913  69.418 1.00 36.66 ? 106  PRO A CD    1 
ATOM   594   N N     . PHE A 1 76  ? 35.910  21.073  67.599 1.00 35.10 ? 107  PHE A N     1 
ATOM   595   C CA    . PHE A 1 76  ? 36.539  19.870  67.113 1.00 35.33 ? 107  PHE A CA    1 
ATOM   596   C C     . PHE A 1 76  ? 35.588  19.061  66.248 1.00 34.33 ? 107  PHE A C     1 
ATOM   597   O O     . PHE A 1 76  ? 35.964  18.538  65.202 1.00 34.67 ? 107  PHE A O     1 
ATOM   598   C CB    . PHE A 1 76  ? 36.986  19.013  68.285 1.00 39.48 ? 107  PHE A CB    1 
ATOM   599   C CG    . PHE A 1 76  ? 37.719  17.781  67.868 1.00 43.86 ? 107  PHE A CG    1 
ATOM   600   C CD1   . PHE A 1 76  ? 39.048  17.865  67.431 1.00 46.23 ? 107  PHE A CD1   1 
ATOM   601   C CD2   . PHE A 1 76  ? 37.082  16.541  67.875 1.00 46.10 ? 107  PHE A CD2   1 
ATOM   602   C CE1   . PHE A 1 76  ? 39.741  16.730  67.002 1.00 48.26 ? 107  PHE A CE1   1 
ATOM   603   C CE2   . PHE A 1 76  ? 37.756  15.397  67.449 1.00 47.85 ? 107  PHE A CE2   1 
ATOM   604   C CZ    . PHE A 1 76  ? 39.096  15.493  67.010 1.00 48.99 ? 107  PHE A CZ    1 
ATOM   605   N N     . LEU A 1 77  ? 34.354  18.940  66.716 1.00 34.04 ? 108  LEU A N     1 
ATOM   606   C CA    . LEU A 1 77  ? 33.334  18.185  66.015 1.00 32.66 ? 108  LEU A CA    1 
ATOM   607   C C     . LEU A 1 77  ? 32.952  18.853  64.720 1.00 31.73 ? 108  LEU A C     1 
ATOM   608   O O     . LEU A 1 77  ? 32.900  18.217  63.669 1.00 31.14 ? 108  LEU A O     1 
ATOM   609   C CB    . LEU A 1 77  ? 32.098  18.067  66.893 1.00 35.02 ? 108  LEU A CB    1 
ATOM   610   C CG    . LEU A 1 77  ? 32.005  16.773  67.691 1.00 34.64 ? 108  LEU A CG    1 
ATOM   611   C CD1   . LEU A 1 77  ? 30.659  16.723  68.375 1.00 35.14 ? 108  LEU A CD1   1 
ATOM   612   C CD2   . LEU A 1 77  ? 32.193  15.582  66.763 1.00 34.50 ? 108  LEU A CD2   1 
ATOM   613   N N     . ARG A 1 78  ? 32.663  20.145  64.812 1.00 31.35 ? 109  ARG A N     1 
ATOM   614   C CA    . ARG A 1 78  ? 32.281  20.925  63.649 1.00 30.56 ? 109  ARG A CA    1 
ATOM   615   C C     . ARG A 1 78  ? 33.335  20.785  62.557 1.00 30.18 ? 109  ARG A C     1 
ATOM   616   O O     . ARG A 1 78  ? 33.015  20.559  61.393 1.00 30.76 ? 109  ARG A O     1 
ATOM   617   C CB    . ARG A 1 78  ? 32.130  22.390  64.046 1.00 29.80 ? 109  ARG A CB    1 
ATOM   618   C CG    . ARG A 1 78  ? 31.234  23.187  63.132 1.00 29.41 ? 109  ARG A CG    1 
ATOM   619   C CD    . ARG A 1 78  ? 31.458  24.666  63.338 1.00 27.85 ? 109  ARG A CD    1 
ATOM   620   N NE    . ARG A 1 78  ? 31.068  25.443  62.169 1.00 27.48 ? 109  ARG A NE    1 
ATOM   621   C CZ    . ARG A 1 78  ? 31.438  26.701  61.958 1.00 27.22 ? 109  ARG A CZ    1 
ATOM   622   N NH1   . ARG A 1 78  ? 32.206  27.313  62.843 1.00 28.75 ? 109  ARG A NH1   1 
ATOM   623   N NH2   . ARG A 1 78  ? 31.041  27.347  60.871 1.00 25.90 ? 109  ARG A NH2   1 
ATOM   624   N N     . SER A 1 79  ? 34.596  20.906  62.945 1.00 30.01 ? 110  SER A N     1 
ATOM   625   C CA    . SER A 1 79  ? 35.686  20.800  61.997 1.00 29.89 ? 110  SER A CA    1 
ATOM   626   C C     . SER A 1 79  ? 35.672  19.407  61.410 1.00 30.05 ? 110  SER A C     1 
ATOM   627   O O     . SER A 1 79  ? 35.749  19.216  60.199 1.00 30.19 ? 110  SER A O     1 
ATOM   628   C CB    . SER A 1 79  ? 37.009  21.078  62.704 1.00 30.19 ? 110  SER A CB    1 
ATOM   629   O OG    . SER A 1 79  ? 37.006  22.376  63.285 1.00 31.40 ? 110  SER A OG    1 
ATOM   630   N N     . LEU A 1 80  ? 35.562  18.428  62.287 1.00 30.99 ? 111  LEU A N     1 
ATOM   631   C CA    . LEU A 1 80  ? 35.513  17.038  61.879 1.00 30.33 ? 111  LEU A CA    1 
ATOM   632   C C     . LEU A 1 80  ? 34.448  16.840  60.805 1.00 29.21 ? 111  LEU A C     1 
ATOM   633   O O     . LEU A 1 80  ? 34.697  16.244  59.757 1.00 28.04 ? 111  LEU A O     1 
ATOM   634   C CB    . LEU A 1 80  ? 35.179  16.185  63.093 1.00 33.41 ? 111  LEU A CB    1 
ATOM   635   C CG    . LEU A 1 80  ? 35.665  14.738  63.105 1.00 34.86 ? 111  LEU A CG    1 
ATOM   636   C CD1   . LEU A 1 80  ? 35.837  14.300  64.557 1.00 36.38 ? 111  LEU A CD1   1 
ATOM   637   C CD2   . LEU A 1 80  ? 34.665  13.833  62.381 1.00 35.04 ? 111  LEU A CD2   1 
ATOM   638   N N     . ILE A 1 81  ? 33.249  17.340  61.070 1.00 29.90 ? 112  ILE A N     1 
ATOM   639   C CA    . ILE A 1 81  ? 32.161  17.197  60.116 1.00 29.94 ? 112  ILE A CA    1 
ATOM   640   C C     . ILE A 1 81  ? 32.441  17.930  58.809 1.00 29.44 ? 112  ILE A C     1 
ATOM   641   O O     . ILE A 1 81  ? 32.264  17.368  57.732 1.00 30.33 ? 112  ILE A O     1 
ATOM   642   C CB    . ILE A 1 81  ? 30.842  17.718  60.695 1.00 29.92 ? 112  ILE A CB    1 
ATOM   643   C CG1   . ILE A 1 81  ? 30.609  17.114  62.075 1.00 29.82 ? 112  ILE A CG1   1 
ATOM   644   C CG2   . ILE A 1 81  ? 29.700  17.349  59.775 1.00 28.50 ? 112  ILE A CG2   1 
ATOM   645   C CD1   . ILE A 1 81  ? 30.341  15.642  62.042 1.00 30.35 ? 112  ILE A CD1   1 
ATOM   646   N N     . MET A 1 82  ? 32.875  19.181  58.897 1.00 29.74 ? 113  MET A N     1 
ATOM   647   C CA    . MET A 1 82  ? 33.161  19.958  57.698 1.00 30.17 ? 113  MET A CA    1 
ATOM   648   C C     . MET A 1 82  ? 34.194  19.267  56.838 1.00 29.84 ? 113  MET A C     1 
ATOM   649   O O     . MET A 1 82  ? 34.189  19.376  55.613 1.00 29.91 ? 113  MET A O     1 
ATOM   650   C CB    . MET A 1 82  ? 33.670  21.346  58.055 1.00 30.05 ? 113  MET A CB    1 
ATOM   651   C CG    . MET A 1 82  ? 33.813  22.238  56.841 1.00 31.69 ? 113  MET A CG    1 
ATOM   652   S SD    . MET A 1 82  ? 32.224  22.522  56.043 1.00 32.39 ? 113  MET A SD    1 
ATOM   653   C CE    . MET A 1 82  ? 32.705  22.989  54.351 1.00 31.57 ? 113  MET A CE    1 
ATOM   654   N N     . LYS A 1 83  ? 35.101  18.565  57.489 1.00 32.22 ? 114  LYS A N     1 
ATOM   655   C CA    . LYS A 1 83  ? 36.129  17.842  56.767 1.00 34.43 ? 114  LYS A CA    1 
ATOM   656   C C     . LYS A 1 83  ? 35.478  16.739  55.921 1.00 34.87 ? 114  LYS A C     1 
ATOM   657   O O     . LYS A 1 83  ? 35.817  16.557  54.752 1.00 33.77 ? 114  LYS A O     1 
ATOM   658   C CB    . LYS A 1 83  ? 37.123  17.237  57.756 1.00 36.50 ? 114  LYS A CB    1 
ATOM   659   C CG    . LYS A 1 83  ? 38.495  17.004  57.181 1.00 40.11 ? 114  LYS A CG    1 
ATOM   660   C CD    . LYS A 1 83  ? 39.502  16.838  58.292 1.00 43.19 ? 114  LYS A CD    1 
ATOM   661   C CE    . LYS A 1 83  ? 40.871  16.488  57.743 1.00 45.82 ? 114  LYS A CE    1 
ATOM   662   N NZ    . LYS A 1 83  ? 41.572  15.503  58.620 1.00 47.91 ? 114  LYS A NZ    1 
ATOM   663   N N     . TYR A 1 84  ? 34.534  16.015  56.514 1.00 34.64 ? 115  TYR A N     1 
ATOM   664   C CA    . TYR A 1 84  ? 33.846  14.944  55.807 1.00 34.72 ? 115  TYR A CA    1 
ATOM   665   C C     . TYR A 1 84  ? 33.147  15.480  54.574 1.00 33.92 ? 115  TYR A C     1 
ATOM   666   O O     . TYR A 1 84  ? 33.282  14.922  53.487 1.00 32.09 ? 115  TYR A O     1 
ATOM   667   C CB    . TYR A 1 84  ? 32.802  14.261  56.712 1.00 38.22 ? 115  TYR A CB    1 
ATOM   668   C CG    . TYR A 1 84  ? 31.703  13.531  55.945 1.00 40.73 ? 115  TYR A CG    1 
ATOM   669   C CD1   . TYR A 1 84  ? 31.960  12.309  55.327 1.00 41.64 ? 115  TYR A CD1   1 
ATOM   670   C CD2   . TYR A 1 84  ? 30.430  14.104  55.772 1.00 40.69 ? 115  TYR A CD2   1 
ATOM   671   C CE1   . TYR A 1 84  ? 30.992  11.678  54.545 1.00 42.52 ? 115  TYR A CE1   1 
ATOM   672   C CE2   . TYR A 1 84  ? 29.454  13.480  54.990 1.00 40.83 ? 115  TYR A CE2   1 
ATOM   673   C CZ    . TYR A 1 84  ? 29.746  12.268  54.375 1.00 41.70 ? 115  TYR A CZ    1 
ATOM   674   O OH    . TYR A 1 84  ? 28.825  11.656  53.542 1.00 42.59 ? 115  TYR A OH    1 
ATOM   675   N N     . VAL A 1 85  ? 32.398  16.565  54.747 1.00 32.94 ? 116  VAL A N     1 
ATOM   676   C CA    . VAL A 1 85  ? 31.658  17.138  53.629 1.00 32.32 ? 116  VAL A CA    1 
ATOM   677   C C     . VAL A 1 85  ? 32.595  17.613  52.541 1.00 32.13 ? 116  VAL A C     1 
ATOM   678   O O     . VAL A 1 85  ? 32.252  17.564  51.361 1.00 32.03 ? 116  VAL A O     1 
ATOM   679   C CB    . VAL A 1 85  ? 30.756  18.316  54.068 1.00 32.83 ? 116  VAL A CB    1 
ATOM   680   C CG1   . VAL A 1 85  ? 30.774  18.441  55.562 1.00 33.15 ? 116  VAL A CG1   1 
ATOM   681   C CG2   . VAL A 1 85  ? 31.195  19.612  53.387 1.00 32.23 ? 116  VAL A CG2   1 
ATOM   682   N N     . LEU A 1 86  ? 33.774  18.065  52.949 1.00 31.31 ? 117  LEU A N     1 
ATOM   683   C CA    . LEU A 1 86  ? 34.782  18.542  52.013 1.00 30.16 ? 117  LEU A CA    1 
ATOM   684   C C     . LEU A 1 86  ? 35.368  17.369  51.233 1.00 30.01 ? 117  LEU A C     1 
ATOM   685   O O     . LEU A 1 86  ? 35.307  17.318  50.009 1.00 28.67 ? 117  LEU A O     1 
ATOM   686   C CB    . LEU A 1 86  ? 35.897  19.258  52.777 1.00 28.67 ? 117  LEU A CB    1 
ATOM   687   C CG    . LEU A 1 86  ? 36.046  20.780  52.673 1.00 27.09 ? 117  LEU A CG    1 
ATOM   688   C CD1   . LEU A 1 86  ? 34.811  21.422  52.062 1.00 28.25 ? 117  LEU A CD1   1 
ATOM   689   C CD2   . LEU A 1 86  ? 36.296  21.332  54.049 1.00 27.82 ? 117  LEU A CD2   1 
ATOM   690   N N     . THR A 1 87  ? 35.924  16.409  51.949 1.00 31.70 ? 118  THR A N     1 
ATOM   691   C CA    . THR A 1 87  ? 36.529  15.272  51.290 1.00 33.14 ? 118  THR A CA    1 
ATOM   692   C C     . THR A 1 87  ? 35.527  14.376  50.588 1.00 34.65 ? 118  THR A C     1 
ATOM   693   O O     . THR A 1 87  ? 35.888  13.669  49.650 1.00 35.97 ? 118  THR A O     1 
ATOM   694   C CB    . THR A 1 87  ? 37.352  14.430  52.284 1.00 33.60 ? 118  THR A CB    1 
ATOM   695   O OG1   . THR A 1 87  ? 36.477  13.847  53.252 1.00 33.71 ? 118  THR A OG1   1 
ATOM   696   C CG2   . THR A 1 87  ? 38.397  15.307  52.998 1.00 32.87 ? 118  THR A CG2   1 
ATOM   697   N N     . SER A 1 88  ? 34.272  14.389  51.022 1.00 36.03 ? 119  SER A N     1 
ATOM   698   C CA    . SER A 1 88  ? 33.274  13.540  50.372 1.00 37.22 ? 119  SER A CA    1 
ATOM   699   C C     . SER A 1 88  ? 33.056  13.977  48.924 1.00 39.33 ? 119  SER A C     1 
ATOM   700   O O     . SER A 1 88  ? 32.698  13.164  48.070 1.00 39.28 ? 119  SER A O     1 
ATOM   701   C CB    . SER A 1 88  ? 31.942  13.561  51.137 1.00 36.24 ? 119  SER A CB    1 
ATOM   702   O OG    . SER A 1 88  ? 31.602  14.860  51.578 1.00 36.31 ? 119  SER A OG    1 
ATOM   703   N N     . ARG A 1 89  ? 33.291  15.261  48.650 1.00 41.31 ? 120  ARG A N     1 
ATOM   704   C CA    . ARG A 1 89  ? 33.123  15.806  47.307 1.00 41.58 ? 120  ARG A CA    1 
ATOM   705   C C     . ARG A 1 89  ? 34.364  15.521  46.474 1.00 43.41 ? 120  ARG A C     1 
ATOM   706   O O     . ARG A 1 89  ? 34.287  15.028  45.348 1.00 44.49 ? 120  ARG A O     1 
ATOM   707   C CB    . ARG A 1 89  ? 32.871  17.320  47.386 1.00 41.22 ? 120  ARG A CB    1 
ATOM   708   C CG    . ARG A 1 89  ? 31.397  17.691  47.619 1.00 40.67 ? 120  ARG A CG    1 
ATOM   709   C CD    . ARG A 1 89  ? 30.517  16.466  47.378 1.00 40.37 ? 120  ARG A CD    1 
ATOM   710   N NE    . ARG A 1 89  ? 29.075  16.700  47.427 1.00 39.82 ? 120  ARG A NE    1 
ATOM   711   C CZ    . ARG A 1 89  ? 28.438  17.289  48.433 1.00 39.23 ? 120  ARG A CZ    1 
ATOM   712   N NH1   . ARG A 1 89  ? 29.118  17.718  49.489 1.00 38.10 ? 120  ARG A NH1   1 
ATOM   713   N NH2   . ARG A 1 89  ? 27.113  17.404  48.402 1.00 36.83 ? 120  ARG A NH2   1 
ATOM   714   N N     . SER A 1 90  ? 35.508  15.821  47.068 1.00 45.27 ? 121  SER A N     1 
ATOM   715   C CA    . SER A 1 90  ? 36.816  15.649  46.457 1.00 44.81 ? 121  SER A CA    1 
ATOM   716   C C     . SER A 1 90  ? 36.964  14.763  45.233 1.00 44.98 ? 121  SER A C     1 
ATOM   717   O O     . SER A 1 90  ? 37.089  15.258  44.126 1.00 46.87 ? 121  SER A O     1 
ATOM   718   C CB    . SER A 1 90  ? 37.805  15.197  47.524 1.00 45.79 ? 121  SER A CB    1 
ATOM   719   O OG    . SER A 1 90  ? 37.979  16.237  48.471 1.00 46.13 ? 121  SER A OG    1 
ATOM   720   N N     . TYR A 1 91  ? 36.955  13.456  45.418 1.00 44.85 ? 122  TYR A N     1 
ATOM   721   C CA    . TYR A 1 91  ? 37.149  12.541  44.299 1.00 43.42 ? 122  TYR A CA    1 
ATOM   722   C C     . TYR A 1 91  ? 36.309  12.742  43.028 1.00 41.41 ? 122  TYR A C     1 
ATOM   723   O O     . TYR A 1 91  ? 36.419  11.944  42.100 1.00 42.20 ? 122  TYR A O     1 
ATOM   724   C CB    . TYR A 1 91  ? 36.946  11.111  44.790 1.00 45.66 ? 122  TYR A CB    1 
ATOM   725   C CG    . TYR A 1 91  ? 35.507  10.646  44.720 1.00 48.63 ? 122  TYR A CG    1 
ATOM   726   C CD1   . TYR A 1 91  ? 35.059  9.862   43.649 1.00 49.11 ? 122  TYR A CD1   1 
ATOM   727   C CD2   . TYR A 1 91  ? 34.593  10.970  45.735 1.00 50.39 ? 122  TYR A CD2   1 
ATOM   728   C CE1   . TYR A 1 91  ? 33.736  9.405   43.585 1.00 50.63 ? 122  TYR A CE1   1 
ATOM   729   C CE2   . TYR A 1 91  ? 33.262  10.518  45.683 1.00 51.48 ? 122  TYR A CE2   1 
ATOM   730   C CZ    . TYR A 1 91  ? 32.844  9.732   44.606 1.00 51.99 ? 122  TYR A CZ    1 
ATOM   731   O OH    . TYR A 1 91  ? 31.552  9.243   44.557 1.00 51.86 ? 122  TYR A OH    1 
ATOM   732   N N     . LEU A 1 92  ? 35.492  13.789  42.960 1.00 38.59 ? 123  LEU A N     1 
ATOM   733   C CA    . LEU A 1 92  ? 34.629  13.977  41.796 1.00 35.46 ? 123  LEU A CA    1 
ATOM   734   C C     . LEU A 1 92  ? 35.134  14.736  40.567 1.00 33.61 ? 123  LEU A C     1 
ATOM   735   O O     . LEU A 1 92  ? 34.846  14.337  39.440 1.00 32.68 ? 123  LEU A O     1 
ATOM   736   C CB    . LEU A 1 92  ? 33.308  14.604  42.252 1.00 35.34 ? 123  LEU A CB    1 
ATOM   737   C CG    . LEU A 1 92  ? 32.106  13.688  42.505 1.00 35.01 ? 123  LEU A CG    1 
ATOM   738   C CD1   . LEU A 1 92  ? 32.312  12.331  41.863 1.00 34.74 ? 123  LEU A CD1   1 
ATOM   739   C CD2   . LEU A 1 92  ? 31.896  13.559  43.982 1.00 33.55 ? 123  LEU A CD2   1 
ATOM   740   N N     . ILE A 1 93  ? 35.864  15.832  40.766 1.00 31.30 ? 124  ILE A N     1 
ATOM   741   C CA    . ILE A 1 93  ? 36.342  16.629  39.633 1.00 29.02 ? 124  ILE A CA    1 
ATOM   742   C C     . ILE A 1 93  ? 37.734  16.289  39.103 1.00 29.36 ? 124  ILE A C     1 
ATOM   743   O O     . ILE A 1 93  ? 38.656  16.013  39.860 1.00 28.21 ? 124  ILE A O     1 
ATOM   744   C CB    . ILE A 1 93  ? 36.308  18.149  39.965 1.00 29.10 ? 124  ILE A CB    1 
ATOM   745   C CG1   . ILE A 1 93  ? 34.905  18.562  40.421 1.00 28.30 ? 124  ILE A CG1   1 
ATOM   746   C CG2   . ILE A 1 93  ? 36.701  18.962  38.744 1.00 28.38 ? 124  ILE A CG2   1 
ATOM   747   C CD1   . ILE A 1 93  ? 33.849  18.433  39.354 1.00 27.38 ? 124  ILE A CD1   1 
ATOM   748   N N     . ASP A 1 94  ? 37.872  16.306  37.784 1.00 27.35 ? 125  ASP A N     1 
ATOM   749   C CA    . ASP A 1 94  ? 39.150  16.027  37.155 1.00 26.81 ? 125  ASP A CA    1 
ATOM   750   C C     . ASP A 1 94  ? 40.027  17.263  37.300 1.00 26.64 ? 125  ASP A C     1 
ATOM   751   O O     . ASP A 1 94  ? 39.708  18.330  36.768 1.00 26.48 ? 125  ASP A O     1 
ATOM   752   C CB    . ASP A 1 94  ? 38.966  15.713  35.667 1.00 26.99 ? 125  ASP A CB    1 
ATOM   753   C CG    . ASP A 1 94  ? 38.360  14.347  35.424 1.00 27.85 ? 125  ASP A CG    1 
ATOM   754   O OD1   . ASP A 1 94  ? 38.114  13.611  36.410 1.00 26.73 ? 125  ASP A OD1   1 
ATOM   755   O OD2   . ASP A 1 94  ? 38.132  14.015  34.236 1.00 30.20 ? 125  ASP A OD2   1 
ATOM   756   N N     . SER A 1 95  ? 41.134  17.121  38.013 1.00 24.36 ? 126  SER A N     1 
ATOM   757   C CA    . SER A 1 95  ? 42.040  18.231  38.206 1.00 24.00 ? 126  SER A CA    1 
ATOM   758   C C     . SER A 1 95  ? 43.466  17.729  38.418 1.00 23.66 ? 126  SER A C     1 
ATOM   759   O O     . SER A 1 95  ? 43.739  17.047  39.405 1.00 23.33 ? 126  SER A O     1 
ATOM   760   C CB    . SER A 1 95  ? 41.597  19.036  39.425 1.00 23.98 ? 126  SER A CB    1 
ATOM   761   O OG    . SER A 1 95  ? 42.532  20.052  39.738 1.00 25.52 ? 126  SER A OG    1 
ATOM   762   N N     . PRO A 1 96  ? 44.397  18.040  37.489 1.00 22.97 ? 127  PRO A N     1 
ATOM   763   C CA    . PRO A 1 96  ? 44.319  18.831  36.250 1.00 22.78 ? 127  PRO A CA    1 
ATOM   764   C C     . PRO A 1 96  ? 43.133  18.464  35.362 1.00 23.47 ? 127  PRO A C     1 
ATOM   765   O O     . PRO A 1 96  ? 42.745  17.296  35.271 1.00 22.94 ? 127  PRO A O     1 
ATOM   766   C CB    . PRO A 1 96  ? 45.646  18.549  35.561 1.00 22.07 ? 127  PRO A CB    1 
ATOM   767   C CG    . PRO A 1 96  ? 46.570  18.251  36.676 1.00 22.79 ? 127  PRO A CG    1 
ATOM   768   C CD    . PRO A 1 96  ? 45.768  17.572  37.743 1.00 22.52 ? 127  PRO A CD    1 
ATOM   769   N N     . PRO A 1 97  ? 42.569  19.464  34.668 1.00 22.18 ? 128  PRO A N     1 
ATOM   770   C CA    . PRO A 1 97  ? 41.415  19.295  33.780 1.00 24.01 ? 128  PRO A CA    1 
ATOM   771   C C     . PRO A 1 97  ? 41.683  18.444  32.539 1.00 23.89 ? 128  PRO A C     1 
ATOM   772   O O     . PRO A 1 97  ? 42.831  18.277  32.113 1.00 24.51 ? 128  PRO A O     1 
ATOM   773   C CB    . PRO A 1 97  ? 41.028  20.725  33.426 1.00 23.57 ? 128  PRO A CB    1 
ATOM   774   C CG    . PRO A 1 97  ? 42.281  21.500  33.595 1.00 23.24 ? 128  PRO A CG    1 
ATOM   775   C CD    . PRO A 1 97  ? 43.069  20.848  34.669 1.00 22.33 ? 128  PRO A CD    1 
ATOM   776   N N     . THR A 1 98  ? 40.603  17.941  31.947 1.00 24.08 ? 129  THR A N     1 
ATOM   777   C CA    . THR A 1 98  ? 40.684  17.084  30.776 1.00 23.85 ? 129  THR A CA    1 
ATOM   778   C C     . THR A 1 98  ? 40.026  17.626  29.497 1.00 23.32 ? 129  THR A C     1 
ATOM   779   O O     . THR A 1 98  ? 40.664  18.380  28.748 1.00 25.41 ? 129  THR A O     1 
ATOM   780   C CB    . THR A 1 98  ? 40.090  15.703  31.088 1.00 23.44 ? 129  THR A CB    1 
ATOM   781   O OG1   . THR A 1 98  ? 38.854  15.867  31.799 1.00 22.74 ? 129  THR A OG1   1 
ATOM   782   C CG2   . THR A 1 98  ? 41.057  14.899  31.948 1.00 22.26 ? 129  THR A CG2   1 
ATOM   783   N N     . TYR A 1 99  ? 38.763  17.253  29.253 1.00 22.20 ? 130  TYR A N     1 
ATOM   784   C CA    . TYR A 1 99  ? 38.033  17.645  28.036 1.00 20.02 ? 130  TYR A CA    1 
ATOM   785   C C     . TYR A 1 99  ? 37.502  19.050  27.948 1.00 19.66 ? 130  TYR A C     1 
ATOM   786   O O     . TYR A 1 99  ? 37.511  19.801  28.916 1.00 20.17 ? 130  TYR A O     1 
ATOM   787   C CB    . TYR A 1 99  ? 36.859  16.686  27.808 1.00 19.34 ? 130  TYR A CB    1 
ATOM   788   C CG    . TYR A 1 99  ? 37.173  15.278  28.239 1.00 20.03 ? 130  TYR A CG    1 
ATOM   789   C CD1   . TYR A 1 99  ? 36.707  14.774  29.447 1.00 20.75 ? 130  TYR A CD1   1 
ATOM   790   C CD2   . TYR A 1 99  ? 37.989  14.467  27.458 1.00 19.51 ? 130  TYR A CD2   1 
ATOM   791   C CE1   . TYR A 1 99  ? 37.057  13.474  29.867 1.00 21.37 ? 130  TYR A CE1   1 
ATOM   792   C CE2   . TYR A 1 99  ? 38.342  13.190  27.858 1.00 20.15 ? 130  TYR A CE2   1 
ATOM   793   C CZ    . TYR A 1 99  ? 37.877  12.696  29.060 1.00 20.96 ? 130  TYR A CZ    1 
ATOM   794   O OH    . TYR A 1 99  ? 38.234  11.417  29.447 1.00 23.25 ? 130  TYR A OH    1 
ATOM   795   N N     . ASN A 1 100 ? 37.067  19.394  26.739 1.00 19.76 ? 131  ASN A N     1 
ATOM   796   C CA    . ASN A 1 100 ? 36.440  20.672  26.454 1.00 19.22 ? 131  ASN A CA    1 
ATOM   797   C C     . ASN A 1 100 ? 35.549  20.491  25.225 1.00 20.05 ? 131  ASN A C     1 
ATOM   798   O O     . ASN A 1 100 ? 35.453  19.399  24.672 1.00 20.46 ? 131  ASN A O     1 
ATOM   799   C CB    . ASN A 1 100 ? 37.470  21.799  26.303 1.00 19.34 ? 131  ASN A CB    1 
ATOM   800   C CG    . ASN A 1 100 ? 38.398  21.637  25.111 1.00 19.23 ? 131  ASN A CG    1 
ATOM   801   O OD1   . ASN A 1 100 ? 39.468  22.223  25.096 1.00 22.17 ? 131  ASN A OD1   1 
ATOM   802   N ND2   . ASN A 1 100 ? 38.000  20.875  24.115 1.00 19.47 ? 131  ASN A ND2   1 
ATOM   803   N N     . VAL A 1 101 ? 34.883  21.556  24.797 1.00 20.37 ? 132  VAL A N     1 
ATOM   804   C CA    . VAL A 1 101 ? 33.986  21.439  23.670 1.00 19.18 ? 132  VAL A CA    1 
ATOM   805   C C     . VAL A 1 101 ? 34.569  20.735  22.466 1.00 20.40 ? 132  VAL A C     1 
ATOM   806   O O     . VAL A 1 101 ? 33.911  19.937  21.829 1.00 21.37 ? 132  VAL A O     1 
ATOM   807   C CB    . VAL A 1 101 ? 33.450  22.836  23.251 1.00 19.73 ? 132  VAL A CB    1 
ATOM   808   C CG1   . VAL A 1 101 ? 34.596  23.688  22.688 1.00 20.41 ? 132  VAL A CG1   1 
ATOM   809   C CG2   . VAL A 1 101 ? 32.314  22.662  22.255 1.00 17.21 ? 132  VAL A CG2   1 
ATOM   810   N N     . HIS A 1 102 ? 35.846  21.004  22.168 1.00 20.43 ? 133  HIS A N     1 
ATOM   811   C CA    . HIS A 1 102 ? 36.482  20.415  21.010 1.00 19.74 ? 133  HIS A CA    1 
ATOM   812   C C     . HIS A 1 102 ? 37.253  19.140  21.190 1.00 19.71 ? 133  HIS A C     1 
ATOM   813   O O     . HIS A 1 102 ? 37.606  18.497  20.212 1.00 21.35 ? 133  HIS A O     1 
ATOM   814   C CB    . HIS A 1 102 ? 37.389  21.450  20.373 1.00 21.97 ? 133  HIS A CB    1 
ATOM   815   C CG    . HIS A 1 102 ? 36.638  22.617  19.841 1.00 22.85 ? 133  HIS A CG    1 
ATOM   816   N ND1   . HIS A 1 102 ? 37.229  23.841  19.626 1.00 24.46 ? 133  HIS A ND1   1 
ATOM   817   C CD2   . HIS A 1 102 ? 35.336  22.757  19.499 1.00 22.86 ? 133  HIS A CD2   1 
ATOM   818   C CE1   . HIS A 1 102 ? 36.308  24.692  19.173 1.00 24.52 ? 133  HIS A CE1   1 
ATOM   819   N NE2   . HIS A 1 102 ? 35.170  24.052  19.091 1.00 23.87 ? 133  HIS A NE2   1 
ATOM   820   N N     . TYR A 1 103 ? 37.507  18.741  22.423 1.00 18.90 ? 134  TYR A N     1 
ATOM   821   C CA    . TYR A 1 103 ? 38.259  17.522  22.628 1.00 17.85 ? 134  TYR A CA    1 
ATOM   822   C C     . TYR A 1 103 ? 37.565  16.507  23.499 1.00 17.47 ? 134  TYR A C     1 
ATOM   823   O O     . TYR A 1 103 ? 37.381  16.717  24.696 1.00 16.97 ? 134  TYR A O     1 
ATOM   824   C CB    . TYR A 1 103 ? 39.624  17.870  23.196 1.00 18.39 ? 134  TYR A CB    1 
ATOM   825   C CG    . TYR A 1 103 ? 40.479  18.602  22.188 1.00 18.76 ? 134  TYR A CG    1 
ATOM   826   C CD1   . TYR A 1 103 ? 40.410  19.990  22.060 1.00 17.81 ? 134  TYR A CD1   1 
ATOM   827   C CD2   . TYR A 1 103 ? 41.321  17.899  21.326 1.00 19.16 ? 134  TYR A CD2   1 
ATOM   828   C CE1   . TYR A 1 103 ? 41.153  20.651  21.099 1.00 17.12 ? 134  TYR A CE1   1 
ATOM   829   C CE2   . TYR A 1 103 ? 42.066  18.552  20.364 1.00 17.93 ? 134  TYR A CE2   1 
ATOM   830   C CZ    . TYR A 1 103 ? 41.977  19.927  20.257 1.00 17.64 ? 134  TYR A CZ    1 
ATOM   831   O OH    . TYR A 1 103 ? 42.727  20.573  19.305 1.00 17.90 ? 134  TYR A OH    1 
ATOM   832   N N     . GLY A 1 104 ? 37.176  15.405  22.871 1.00 16.41 ? 135  GLY A N     1 
ATOM   833   C CA    . GLY A 1 104 ? 36.516  14.329  23.571 1.00 16.56 ? 135  GLY A CA    1 
ATOM   834   C C     . GLY A 1 104 ? 37.559  13.364  24.085 1.00 17.67 ? 135  GLY A C     1 
ATOM   835   O O     . GLY A 1 104 ? 37.237  12.296  24.597 1.00 19.00 ? 135  GLY A O     1 
ATOM   836   N N     . TYR A 1 105 ? 38.824  13.722  23.922 1.00 19.16 ? 136  TYR A N     1 
ATOM   837   C CA    . TYR A 1 105 ? 39.930  12.898  24.417 1.00 19.46 ? 136  TYR A CA    1 
ATOM   838   C C     . TYR A 1 105 ? 41.001  13.854  24.962 1.00 20.05 ? 136  TYR A C     1 
ATOM   839   O O     . TYR A 1 105 ? 41.104  14.982  24.483 1.00 21.36 ? 136  TYR A O     1 
ATOM   840   C CB    . TYR A 1 105 ? 40.494  12.062  23.272 1.00 20.55 ? 136  TYR A CB    1 
ATOM   841   C CG    . TYR A 1 105 ? 40.903  12.890  22.077 1.00 22.49 ? 136  TYR A CG    1 
ATOM   842   C CD1   . TYR A 1 105 ? 42.151  13.512  22.042 1.00 22.15 ? 136  TYR A CD1   1 
ATOM   843   C CD2   . TYR A 1 105 ? 40.027  13.104  21.016 1.00 20.71 ? 136  TYR A CD2   1 
ATOM   844   C CE1   . TYR A 1 105 ? 42.514  14.329  20.995 1.00 23.41 ? 136  TYR A CE1   1 
ATOM   845   C CE2   . TYR A 1 105 ? 40.381  13.924  19.958 1.00 21.19 ? 136  TYR A CE2   1 
ATOM   846   C CZ    . TYR A 1 105 ? 41.629  14.536  19.959 1.00 22.74 ? 136  TYR A CZ    1 
ATOM   847   O OH    . TYR A 1 105 ? 42.019  15.373  18.949 1.00 23.81 ? 136  TYR A OH    1 
ATOM   848   N N     . LYS A 1 106 ? 41.786  13.431  25.951 1.00 20.66 ? 137  LYS A N     1 
ATOM   849   C CA    . LYS A 1 106 ? 42.826  14.308  26.505 1.00 21.37 ? 137  LYS A CA    1 
ATOM   850   C C     . LYS A 1 106 ? 43.825  14.716  25.438 1.00 21.34 ? 137  LYS A C     1 
ATOM   851   O O     . LYS A 1 106 ? 44.218  13.913  24.588 1.00 22.25 ? 137  LYS A O     1 
ATOM   852   C CB    . LYS A 1 106 ? 43.580  13.633  27.642 1.00 21.31 ? 137  LYS A CB    1 
ATOM   853   C CG    . LYS A 1 106 ? 42.726  12.720  28.452 1.00 23.25 ? 137  LYS A CG    1 
ATOM   854   C CD    . LYS A 1 106 ? 42.878  12.976  29.917 1.00 24.03 ? 137  LYS A CD    1 
ATOM   855   C CE    . LYS A 1 106 ? 42.379  11.773  30.714 1.00 24.99 ? 137  LYS A CE    1 
ATOM   856   N NZ    . LYS A 1 106 ? 42.615  10.467  29.997 1.00 24.64 ? 137  LYS A NZ    1 
ATOM   857   N N     . SER A 1 107 ? 44.220  15.980  25.480 1.00 21.44 ? 138  SER A N     1 
ATOM   858   C CA    . SER A 1 107 ? 45.167  16.510  24.522 1.00 21.11 ? 138  SER A CA    1 
ATOM   859   C C     . SER A 1 107 ? 45.868  17.680  25.195 1.00 20.16 ? 138  SER A C     1 
ATOM   860   O O     . SER A 1 107 ? 45.370  18.245  26.173 1.00 21.66 ? 138  SER A O     1 
ATOM   861   C CB    . SER A 1 107 ? 44.433  16.983  23.272 1.00 21.29 ? 138  SER A CB    1 
ATOM   862   O OG    . SER A 1 107 ? 43.597  18.089  23.572 1.00 22.31 ? 138  SER A OG    1 
ATOM   863   N N     . TRP A 1 108 ? 47.033  18.046  24.696 1.00 19.74 ? 139  TRP A N     1 
ATOM   864   C CA    . TRP A 1 108 ? 47.731  19.152  25.310 1.00 17.62 ? 139  TRP A CA    1 
ATOM   865   C C     . TRP A 1 108 ? 46.995  20.446  24.995 1.00 17.52 ? 139  TRP A C     1 
ATOM   866   O O     . TRP A 1 108 ? 47.098  21.414  25.741 1.00 17.90 ? 139  TRP A O     1 
ATOM   867   C CB    . TRP A 1 108 ? 49.177  19.226  24.812 1.00 16.99 ? 139  TRP A CB    1 
ATOM   868   C CG    . TRP A 1 108 ? 49.973  20.207  25.611 1.00 13.53 ? 139  TRP A CG    1 
ATOM   869   C CD1   . TRP A 1 108 ? 50.227  21.507  25.291 1.00 11.70 ? 139  TRP A CD1   1 
ATOM   870   C CD2   . TRP A 1 108 ? 50.493  20.003  26.932 1.00 13.39 ? 139  TRP A CD2   1 
ATOM   871   N NE1   . TRP A 1 108 ? 50.859  22.136  26.336 1.00 12.97 ? 139  TRP A NE1   1 
ATOM   872   C CE2   . TRP A 1 108 ? 51.037  21.237  27.357 1.00 12.21 ? 139  TRP A CE2   1 
ATOM   873   C CE3   . TRP A 1 108 ? 50.545  18.899  27.803 1.00 13.32 ? 139  TRP A CE3   1 
ATOM   874   C CZ2   . TRP A 1 108 ? 51.629  21.403  28.621 1.00 11.81 ? 139  TRP A CZ2   1 
ATOM   875   C CZ3   . TRP A 1 108 ? 51.133  19.058  29.061 1.00 12.97 ? 139  TRP A CZ3   1 
ATOM   876   C CH2   . TRP A 1 108 ? 51.670  20.309  29.457 1.00 12.52 ? 139  TRP A CH2   1 
ATOM   877   N N     . GLU A 1 109 ? 46.258  20.470  23.887 1.00 17.79 ? 140  GLU A N     1 
ATOM   878   C CA    . GLU A 1 109 ? 45.512  21.670  23.527 1.00 18.40 ? 140  GLU A CA    1 
ATOM   879   C C     . GLU A 1 109 ? 44.393  21.880  24.562 1.00 19.96 ? 140  GLU A C     1 
ATOM   880   O O     . GLU A 1 109 ? 44.229  22.982  25.103 1.00 20.79 ? 140  GLU A O     1 
ATOM   881   C CB    . GLU A 1 109 ? 44.915  21.533  22.128 1.00 17.63 ? 140  GLU A CB    1 
ATOM   882   C CG    . GLU A 1 109 ? 43.908  22.630  21.793 1.00 18.45 ? 140  GLU A CG    1 
ATOM   883   C CD    . GLU A 1 109 ? 44.566  23.989  21.611 1.00 18.82 ? 140  GLU A CD    1 
ATOM   884   O OE1   . GLU A 1 109 ? 43.867  25.025  21.631 1.00 18.42 ? 140  GLU A OE1   1 
ATOM   885   O OE2   . GLU A 1 109 ? 45.799  24.022  21.441 1.00 18.94 ? 140  GLU A OE2   1 
ATOM   886   N N     . ALA A 1 110 ? 43.638  20.817  24.848 1.00 19.32 ? 141  ALA A N     1 
ATOM   887   C CA    . ALA A 1 110 ? 42.556  20.891  25.828 1.00 19.43 ? 141  ALA A CA    1 
ATOM   888   C C     . ALA A 1 110 ? 43.119  21.292  27.180 1.00 19.44 ? 141  ALA A C     1 
ATOM   889   O O     . ALA A 1 110 ? 42.530  22.101  27.882 1.00 20.56 ? 141  ALA A O     1 
ATOM   890   C CB    . ALA A 1 110 ? 41.848  19.549  25.950 1.00 19.42 ? 141  ALA A CB    1 
ATOM   891   N N     . PHE A 1 111 ? 44.260  20.733  27.557 1.00 18.50 ? 142  PHE A N     1 
ATOM   892   C CA    . PHE A 1 111 ? 44.837  21.092  28.839 1.00 17.80 ? 142  PHE A CA    1 
ATOM   893   C C     . PHE A 1 111 ? 45.348  22.518  28.932 1.00 18.72 ? 142  PHE A C     1 
ATOM   894   O O     . PHE A 1 111 ? 45.010  23.253  29.863 1.00 20.49 ? 142  PHE A O     1 
ATOM   895   C CB    . PHE A 1 111 ? 46.011  20.191  29.189 1.00 16.21 ? 142  PHE A CB    1 
ATOM   896   C CG    . PHE A 1 111 ? 46.850  20.734  30.305 1.00 14.52 ? 142  PHE A CG    1 
ATOM   897   C CD1   . PHE A 1 111 ? 46.382  20.680  31.615 1.00 15.22 ? 142  PHE A CD1   1 
ATOM   898   C CD2   . PHE A 1 111 ? 48.072  21.366  30.050 1.00 13.99 ? 142  PHE A CD2   1 
ATOM   899   C CE1   . PHE A 1 111 ? 47.108  21.255  32.672 1.00 14.49 ? 142  PHE A CE1   1 
ATOM   900   C CE2   . PHE A 1 111 ? 48.812  21.945  31.095 1.00 14.23 ? 142  PHE A CE2   1 
ATOM   901   C CZ    . PHE A 1 111 ? 48.328  21.892  32.412 1.00 12.97 ? 142  PHE A CZ    1 
ATOM   902   N N     . SER A 1 112 ? 46.171  22.915  27.965 1.00 20.02 ? 143  SER A N     1 
ATOM   903   C CA    . SER A 1 112 ? 46.803  24.228  28.017 1.00 19.54 ? 143  SER A CA    1 
ATOM   904   C C     . SER A 1 112 ? 45.966  25.430  27.676 1.00 18.85 ? 143  SER A C     1 
ATOM   905   O O     . SER A 1 112 ? 46.194  26.504  28.201 1.00 21.11 ? 143  SER A O     1 
ATOM   906   C CB    . SER A 1 112 ? 48.049  24.242  27.129 1.00 17.10 ? 143  SER A CB    1 
ATOM   907   O OG    . SER A 1 112 ? 47.738  23.829  25.820 1.00 16.16 ? 143  SER A OG    1 
ATOM   908   N N     . ASN A 1 113 ? 45.000  25.274  26.792 1.00 19.46 ? 144  ASN A N     1 
ATOM   909   C CA    . ASN A 1 113 ? 44.227  26.425  26.396 1.00 20.10 ? 144  ASN A CA    1 
ATOM   910   C C     . ASN A 1 113 ? 43.243  26.910  27.429 1.00 18.82 ? 144  ASN A C     1 
ATOM   911   O O     . ASN A 1 113 ? 42.162  26.348  27.573 1.00 20.97 ? 144  ASN A O     1 
ATOM   912   C CB    . ASN A 1 113 ? 43.515  26.130  25.093 1.00 20.73 ? 144  ASN A CB    1 
ATOM   913   C CG    . ASN A 1 113 ? 43.155  27.373  24.363 1.00 22.63 ? 144  ASN A CG    1 
ATOM   914   O OD1   . ASN A 1 113 ? 42.780  28.375  24.975 1.00 21.48 ? 144  ASN A OD1   1 
ATOM   915   N ND2   . ASN A 1 113 ? 43.265  27.321  23.047 1.00 24.66 ? 144  ASN A ND2   1 
ATOM   916   N N     . LEU A 1 114 ? 43.609  27.971  28.135 1.00 18.17 ? 145  LEU A N     1 
ATOM   917   C CA    . LEU A 1 114 ? 42.749  28.516  29.180 1.00 18.95 ? 145  LEU A CA    1 
ATOM   918   C C     . LEU A 1 114 ? 41.518  29.270  28.687 1.00 18.31 ? 145  LEU A C     1 
ATOM   919   O O     . LEU A 1 114 ? 40.724  29.749  29.492 1.00 19.90 ? 145  LEU A O     1 
ATOM   920   C CB    . LEU A 1 114 ? 43.557  29.448  30.075 1.00 16.12 ? 145  LEU A CB    1 
ATOM   921   C CG    . LEU A 1 114 ? 44.785  28.845  30.757 1.00 16.62 ? 145  LEU A CG    1 
ATOM   922   C CD1   . LEU A 1 114 ? 45.471  29.908  31.593 1.00 14.76 ? 145  LEU A CD1   1 
ATOM   923   C CD2   . LEU A 1 114 ? 44.382  27.679  31.640 1.00 14.36 ? 145  LEU A CD2   1 
ATOM   924   N N     . SER A 1 115 ? 41.358  29.381  27.375 1.00 18.02 ? 146  SER A N     1 
ATOM   925   C CA    . SER A 1 115 ? 40.232  30.114  26.822 1.00 18.84 ? 146  SER A CA    1 
ATOM   926   C C     . SER A 1 115 ? 38.961  29.295  26.774 1.00 18.28 ? 146  SER A C     1 
ATOM   927   O O     . SER A 1 115 ? 37.887  29.822  26.496 1.00 19.02 ? 146  SER A O     1 
ATOM   928   C CB    . SER A 1 115 ? 40.576  30.582  25.416 1.00 19.85 ? 146  SER A CB    1 
ATOM   929   O OG    . SER A 1 115 ? 41.203  31.846  25.469 1.00 23.05 ? 146  SER A OG    1 
ATOM   930   N N     . TYR A 1 116 ? 39.094  28.001  27.038 1.00 17.55 ? 147  TYR A N     1 
ATOM   931   C CA    . TYR A 1 116 ? 37.980  27.069  27.008 1.00 17.95 ? 147  TYR A CA    1 
ATOM   932   C C     . TYR A 1 116 ? 37.429  26.816  28.398 1.00 17.77 ? 147  TYR A C     1 
ATOM   933   O O     . TYR A 1 116 ? 38.161  26.886  29.381 1.00 17.71 ? 147  TYR A O     1 
ATOM   934   C CB    . TYR A 1 116 ? 38.451  25.706  26.518 1.00 18.18 ? 147  TYR A CB    1 
ATOM   935   C CG    . TYR A 1 116 ? 38.655  25.510  25.045 1.00 19.28 ? 147  TYR A CG    1 
ATOM   936   C CD1   . TYR A 1 116 ? 39.940  25.568  24.488 1.00 18.90 ? 147  TYR A CD1   1 
ATOM   937   C CD2   . TYR A 1 116 ? 37.595  25.129  24.220 1.00 19.20 ? 147  TYR A CD2   1 
ATOM   938   C CE1   . TYR A 1 116 ? 40.164  25.241  23.156 1.00 18.96 ? 147  TYR A CE1   1 
ATOM   939   C CE2   . TYR A 1 116 ? 37.810  24.799  22.889 1.00 19.44 ? 147  TYR A CE2   1 
ATOM   940   C CZ    . TYR A 1 116 ? 39.093  24.853  22.369 1.00 19.76 ? 147  TYR A CZ    1 
ATOM   941   O OH    . TYR A 1 116 ? 39.299  24.477  21.070 1.00 20.72 ? 147  TYR A OH    1 
ATOM   942   N N     . TYR A 1 117 ? 36.144  26.492  28.481 1.00 16.52 ? 148  TYR A N     1 
ATOM   943   C CA    . TYR A 1 117 ? 35.589  26.101  29.761 1.00 16.80 ? 148  TYR A CA    1 
ATOM   944   C C     . TYR A 1 117 ? 35.997  24.626  29.699 1.00 16.94 ? 148  TYR A C     1 
ATOM   945   O O     . TYR A 1 117 ? 36.060  24.053  28.610 1.00 14.98 ? 148  TYR A O     1 
ATOM   946   C CB    . TYR A 1 117 ? 34.066  26.171  29.763 1.00 15.29 ? 148  TYR A CB    1 
ATOM   947   C CG    . TYR A 1 117 ? 33.488  27.515  30.109 1.00 14.60 ? 148  TYR A CG    1 
ATOM   948   C CD1   . TYR A 1 117 ? 33.639  28.058  31.384 1.00 12.77 ? 148  TYR A CD1   1 
ATOM   949   C CD2   . TYR A 1 117 ? 32.765  28.238  29.159 1.00 13.80 ? 148  TYR A CD2   1 
ATOM   950   C CE1   . TYR A 1 117 ? 33.080  29.286  31.707 1.00 13.11 ? 148  TYR A CE1   1 
ATOM   951   C CE2   . TYR A 1 117 ? 32.206  29.466  29.467 1.00 14.91 ? 148  TYR A CE2   1 
ATOM   952   C CZ    . TYR A 1 117 ? 32.367  29.986  30.747 1.00 14.31 ? 148  TYR A CZ    1 
ATOM   953   O OH    . TYR A 1 117 ? 31.807  31.209  31.041 1.00 17.32 ? 148  TYR A OH    1 
ATOM   954   N N     . THR A 1 118 ? 36.306  24.005  30.830 1.00 17.24 ? 149  THR A N     1 
ATOM   955   C CA    . THR A 1 118 ? 36.645  22.597  30.767 1.00 15.97 ? 149  THR A CA    1 
ATOM   956   C C     . THR A 1 118 ? 35.327  21.818  30.783 1.00 17.47 ? 149  THR A C     1 
ATOM   957   O O     . THR A 1 118 ? 34.264  22.410  30.951 1.00 18.79 ? 149  THR A O     1 
ATOM   958   C CB    . THR A 1 118 ? 37.547  22.183  31.924 1.00 15.87 ? 149  THR A CB    1 
ATOM   959   O OG1   . THR A 1 118 ? 38.066  20.877  31.647 1.00 15.09 ? 149  THR A OG1   1 
ATOM   960   C CG2   . THR A 1 118 ? 36.791  22.189  33.246 1.00 15.27 ? 149  THR A CG2   1 
ATOM   961   N N     . ARG A 1 119 ? 35.375  20.501  30.605 1.00 17.83 ? 150  ARG A N     1 
ATOM   962   C CA    . ARG A 1 119 ? 34.152  19.703  30.582 1.00 16.47 ? 150  ARG A CA    1 
ATOM   963   C C     . ARG A 1 119 ? 34.183  18.501  31.524 1.00 17.02 ? 150  ARG A C     1 
ATOM   964   O O     . ARG A 1 119 ? 35.130  17.718  31.518 1.00 18.21 ? 150  ARG A O     1 
ATOM   965   C CB    . ARG A 1 119 ? 33.886  19.204  29.151 1.00 16.92 ? 150  ARG A CB    1 
ATOM   966   C CG    . ARG A 1 119 ? 33.169  20.201  28.235 1.00 16.71 ? 150  ARG A CG    1 
ATOM   967   C CD    . ARG A 1 119 ? 31.656  20.209  28.506 1.00 16.98 ? 150  ARG A CD    1 
ATOM   968   N NE    . ARG A 1 119 ? 30.934  19.225  27.696 1.00 16.78 ? 150  ARG A NE    1 
ATOM   969   C CZ    . ARG A 1 119 ? 30.598  19.408  26.419 1.00 17.34 ? 150  ARG A CZ    1 
ATOM   970   N NH1   . ARG A 1 119 ? 30.915  20.539  25.804 1.00 14.32 ? 150  ARG A NH1   1 
ATOM   971   N NH2   . ARG A 1 119 ? 29.960  18.451  25.748 1.00 15.31 ? 150  ARG A NH2   1 
ATOM   972   N N     . ALA A 1 120 ? 33.139  18.351  32.334 1.00 17.67 ? 151  ALA A N     1 
ATOM   973   C CA    . ALA A 1 120 ? 33.044  17.219  33.242 1.00 16.26 ? 151  ALA A CA    1 
ATOM   974   C C     . ALA A 1 120 ? 32.847  15.933  32.435 1.00 17.52 ? 151  ALA A C     1 
ATOM   975   O O     . ALA A 1 120 ? 33.347  14.881  32.817 1.00 17.75 ? 151  ALA A O     1 
ATOM   976   C CB    . ALA A 1 120 ? 31.896  17.420  34.189 1.00 17.92 ? 151  ALA A CB    1 
ATOM   977   N N     . LEU A 1 121 ? 32.095  16.015  31.334 1.00 17.30 ? 152  LEU A N     1 
ATOM   978   C CA    . LEU A 1 121 ? 31.881  14.860  30.464 1.00 17.24 ? 152  LEU A CA    1 
ATOM   979   C C     . LEU A 1 121 ? 32.252  15.333  29.061 1.00 17.61 ? 152  LEU A C     1 
ATOM   980   O O     . LEU A 1 121 ? 31.892  16.435  28.670 1.00 17.91 ? 152  LEU A O     1 
ATOM   981   C CB    . LEU A 1 121 ? 30.417  14.411  30.486 1.00 17.94 ? 152  LEU A CB    1 
ATOM   982   C CG    . LEU A 1 121 ? 29.965  13.392  31.533 1.00 18.41 ? 152  LEU A CG    1 
ATOM   983   C CD1   . LEU A 1 121 ? 28.629  12.829  31.117 1.00 17.47 ? 152  LEU A CD1   1 
ATOM   984   C CD2   . LEU A 1 121 ? 30.990  12.273  31.668 1.00 17.87 ? 152  LEU A CD2   1 
ATOM   985   N N     . PRO A 1 122 ? 32.997  14.518  28.294 1.00 18.09 ? 153  PRO A N     1 
ATOM   986   C CA    . PRO A 1 122 ? 33.394  14.905  26.933 1.00 19.17 ? 153  PRO A CA    1 
ATOM   987   C C     . PRO A 1 122 ? 32.192  15.157  26.025 1.00 20.48 ? 153  PRO A C     1 
ATOM   988   O O     . PRO A 1 122 ? 31.091  14.668  26.288 1.00 22.57 ? 153  PRO A O     1 
ATOM   989   C CB    . PRO A 1 122 ? 34.210  13.715  26.439 1.00 17.70 ? 153  PRO A CB    1 
ATOM   990   C CG    . PRO A 1 122 ? 33.785  12.577  27.313 1.00 17.36 ? 153  PRO A CG    1 
ATOM   991   C CD    . PRO A 1 122 ? 33.497  13.179  28.648 1.00 17.96 ? 153  PRO A CD    1 
ATOM   992   N N     . PRO A 1 123 ? 32.384  15.925  24.943 1.00 19.82 ? 154  PRO A N     1 
ATOM   993   C CA    . PRO A 1 123 ? 31.243  16.172  24.059 1.00 21.13 ? 154  PRO A CA    1 
ATOM   994   C C     . PRO A 1 123 ? 30.838  14.889  23.330 1.00 22.49 ? 154  PRO A C     1 
ATOM   995   O O     . PRO A 1 123 ? 31.593  13.914  23.307 1.00 23.52 ? 154  PRO A O     1 
ATOM   996   C CB    . PRO A 1 123 ? 31.773  17.225  23.084 1.00 20.17 ? 154  PRO A CB    1 
ATOM   997   C CG    . PRO A 1 123 ? 33.246  16.983  23.058 1.00 19.04 ? 154  PRO A CG    1 
ATOM   998   C CD    . PRO A 1 123 ? 33.605  16.602  24.474 1.00 19.01 ? 154  PRO A CD    1 
ATOM   999   N N     . VAL A 1 124 ? 29.645  14.875  22.744 1.00 23.37 ? 155  VAL A N     1 
ATOM   1000  C CA    . VAL A 1 124 ? 29.212  13.713  21.983 1.00 24.51 ? 155  VAL A CA    1 
ATOM   1001  C C     . VAL A 1 124 ? 29.905  13.897  20.629 1.00 26.01 ? 155  VAL A C     1 
ATOM   1002  O O     . VAL A 1 124 ? 29.785  14.963  20.015 1.00 26.31 ? 155  VAL A O     1 
ATOM   1003  C CB    . VAL A 1 124 ? 27.658  13.698  21.829 1.00 24.74 ? 155  VAL A CB    1 
ATOM   1004  C CG1   . VAL A 1 124 ? 27.205  12.567  20.889 1.00 21.63 ? 155  VAL A CG1   1 
ATOM   1005  C CG2   . VAL A 1 124 ? 27.017  13.525  23.209 1.00 22.25 ? 155  VAL A CG2   1 
ATOM   1006  N N     . ALA A 1 125 ? 30.656  12.887  20.188 1.00 27.18 ? 156  ALA A N     1 
ATOM   1007  C CA    . ALA A 1 125 ? 31.376  12.956  18.918 1.00 29.29 ? 156  ALA A CA    1 
ATOM   1008  C C     . ALA A 1 125 ? 30.469  13.400  17.785 1.00 31.79 ? 156  ALA A C     1 
ATOM   1009  O O     . ALA A 1 125 ? 29.339  12.946  17.675 1.00 33.00 ? 156  ALA A O     1 
ATOM   1010  C CB    . ALA A 1 125 ? 31.987  11.614  18.591 1.00 27.72 ? 156  ALA A CB    1 
ATOM   1011  N N     . ASP A 1 126 ? 30.977  14.285  16.936 1.00 34.38 ? 157  ASP A N     1 
ATOM   1012  C CA    . ASP A 1 126 ? 30.204  14.811  15.825 1.00 36.05 ? 157  ASP A CA    1 
ATOM   1013  C C     . ASP A 1 126 ? 29.615  13.770  14.891 1.00 36.58 ? 157  ASP A C     1 
ATOM   1014  O O     . ASP A 1 126 ? 28.571  14.001  14.293 1.00 37.27 ? 157  ASP A O     1 
ATOM   1015  C CB    . ASP A 1 126 ? 31.051  15.781  15.012 1.00 36.80 ? 157  ASP A CB    1 
ATOM   1016  C CG    . ASP A 1 126 ? 31.331  17.063  15.758 1.00 38.76 ? 157  ASP A CG    1 
ATOM   1017  O OD1   . ASP A 1 126 ? 30.843  17.204  16.904 1.00 38.82 ? 157  ASP A OD1   1 
ATOM   1018  O OD2   . ASP A 1 126 ? 32.040  17.931  15.201 1.00 40.40 ? 157  ASP A OD2   1 
ATOM   1019  N N     . ASP A 1 127 ? 30.261  12.622  14.760 1.00 36.56 ? 158  ASP A N     1 
ATOM   1020  C CA    . ASP A 1 127 ? 29.737  11.621  13.844 1.00 36.44 ? 158  ASP A CA    1 
ATOM   1021  C C     . ASP A 1 127 ? 28.711  10.646  14.411 1.00 35.69 ? 158  ASP A C     1 
ATOM   1022  O O     . ASP A 1 127 ? 28.313  9.695   13.734 1.00 36.35 ? 158  ASP A O     1 
ATOM   1023  C CB    . ASP A 1 127 ? 30.893  10.856  13.179 1.00 36.92 ? 158  ASP A CB    1 
ATOM   1024  C CG    . ASP A 1 127 ? 31.530  9.816   14.088 1.00 38.70 ? 158  ASP A CG    1 
ATOM   1025  O OD1   . ASP A 1 127 ? 32.617  9.323   13.715 1.00 39.76 ? 158  ASP A OD1   1 
ATOM   1026  O OD2   . ASP A 1 127 ? 30.962  9.488   15.152 1.00 38.55 ? 158  ASP A OD2   1 
ATOM   1027  N N     . CYS A 1 128 ? 28.267  10.877  15.642 1.00 34.65 ? 159  CYS A N     1 
ATOM   1028  C CA    . CYS A 1 128 ? 27.283  9.992   16.245 1.00 32.23 ? 159  CYS A CA    1 
ATOM   1029  C C     . CYS A 1 128 ? 25.957  10.175  15.517 1.00 31.58 ? 159  CYS A C     1 
ATOM   1030  O O     . CYS A 1 128 ? 25.665  11.264  15.030 1.00 32.10 ? 159  CYS A O     1 
ATOM   1031  C CB    . CYS A 1 128 ? 27.136  10.306  17.732 1.00 31.73 ? 159  CYS A CB    1 
ATOM   1032  S SG    . CYS A 1 128 ? 28.628  9.916   18.702 1.00 29.28 ? 159  CYS A SG    1 
ATOM   1033  N N     . PRO A 1 129 ? 25.151  9.104   15.418 1.00 31.00 ? 160  PRO A N     1 
ATOM   1034  C CA    . PRO A 1 129 ? 23.843  9.106   14.750 1.00 31.31 ? 160  PRO A CA    1 
ATOM   1035  C C     . PRO A 1 129 ? 22.846  10.074  15.376 1.00 30.77 ? 160  PRO A C     1 
ATOM   1036  O O     . PRO A 1 129 ? 22.262  10.910  14.688 1.00 31.73 ? 160  PRO A O     1 
ATOM   1037  C CB    . PRO A 1 129 ? 23.374  7.665   14.876 1.00 30.71 ? 160  PRO A CB    1 
ATOM   1038  C CG    . PRO A 1 129 ? 24.147  7.117   16.024 1.00 31.62 ? 160  PRO A CG    1 
ATOM   1039  C CD    . PRO A 1 129 ? 25.470  7.781   15.974 1.00 31.01 ? 160  PRO A CD    1 
ATOM   1040  N N     . THR A 1 130 ? 22.653  9.952   16.685 1.00 30.49 ? 161  THR A N     1 
ATOM   1041  C CA    . THR A 1 130 ? 21.742  10.826  17.397 1.00 29.64 ? 161  THR A CA    1 
ATOM   1042  C C     . THR A 1 130 ? 22.517  11.812  18.254 1.00 30.49 ? 161  THR A C     1 
ATOM   1043  O O     . THR A 1 130 ? 23.691  11.591  18.572 1.00 30.29 ? 161  THR A O     1 
ATOM   1044  C CB    . THR A 1 130 ? 20.816  10.037  18.301 1.00 28.46 ? 161  THR A CB    1 
ATOM   1045  O OG1   . THR A 1 130 ? 21.584  9.424   19.337 1.00 28.00 ? 161  THR A OG1   1 
ATOM   1046  C CG2   . THR A 1 130 ? 20.090  8.965   17.509 1.00 27.69 ? 161  THR A CG2   1 
ATOM   1047  N N     . PRO A 1 131 ? 21.867  12.924  18.636 1.00 31.06 ? 162  PRO A N     1 
ATOM   1048  C CA    . PRO A 1 131 ? 22.467  13.976  19.464 1.00 31.94 ? 162  PRO A CA    1 
ATOM   1049  C C     . PRO A 1 131 ? 23.047  13.511  20.805 1.00 31.75 ? 162  PRO A C     1 
ATOM   1050  O O     . PRO A 1 131 ? 24.034  14.068  21.290 1.00 31.44 ? 162  PRO A O     1 
ATOM   1051  C CB    . PRO A 1 131 ? 21.324  14.983  19.643 1.00 31.39 ? 162  PRO A CB    1 
ATOM   1052  C CG    . PRO A 1 131 ? 20.444  14.756  18.441 1.00 31.77 ? 162  PRO A CG    1 
ATOM   1053  C CD    . PRO A 1 131 ? 20.483  13.266  18.257 1.00 31.71 ? 162  PRO A CD    1 
ATOM   1054  N N     . MET A 1 132 ? 22.450  12.493  21.405 1.00 30.72 ? 163  MET A N     1 
ATOM   1055  C CA    . MET A 1 132 ? 22.947  12.013  22.685 1.00 30.62 ? 163  MET A CA    1 
ATOM   1056  C C     . MET A 1 132 ? 23.885  10.830  22.495 1.00 30.73 ? 163  MET A C     1 
ATOM   1057  O O     . MET A 1 132 ? 24.347  10.224  23.464 1.00 30.80 ? 163  MET A O     1 
ATOM   1058  C CB    . MET A 1 132 ? 21.778  11.624  23.597 1.00 30.91 ? 163  MET A CB    1 
ATOM   1059  C CG    . MET A 1 132 ? 20.903  12.806  24.004 1.00 30.57 ? 163  MET A CG    1 
ATOM   1060  S SD    . MET A 1 132 ? 21.798  14.003  25.021 1.00 30.56 ? 163  MET A SD    1 
ATOM   1061  C CE    . MET A 1 132 ? 20.579  15.199  25.332 1.00 30.39 ? 163  MET A CE    1 
ATOM   1062  N N     . GLY A 1 133 ? 24.174  10.518  21.237 1.00 30.03 ? 164  GLY A N     1 
ATOM   1063  C CA    . GLY A 1 133 ? 25.050  9.402   20.927 1.00 29.67 ? 164  GLY A CA    1 
ATOM   1064  C C     . GLY A 1 133 ? 24.356  8.503   19.929 1.00 29.37 ? 164  GLY A C     1 
ATOM   1065  O O     . GLY A 1 133 ? 24.456  8.708   18.726 1.00 30.12 ? 164  GLY A O     1 
ATOM   1066  N N     . VAL A 1 134 ? 23.627  7.516   20.432 1.00 30.11 ? 165  VAL A N     1 
ATOM   1067  C CA    . VAL A 1 134 ? 22.893  6.604   19.571 1.00 31.62 ? 165  VAL A CA    1 
ATOM   1068  C C     . VAL A 1 134 ? 21.422  6.490   19.996 1.00 32.30 ? 165  VAL A C     1 
ATOM   1069  O O     . VAL A 1 134 ? 20.622  5.874   19.296 1.00 33.88 ? 165  VAL A O     1 
ATOM   1070  C CB    . VAL A 1 134 ? 23.531  5.199   19.572 1.00 30.47 ? 165  VAL A CB    1 
ATOM   1071  C CG1   . VAL A 1 134 ? 24.984  5.303   19.155 1.00 30.08 ? 165  VAL A CG1   1 
ATOM   1072  C CG2   . VAL A 1 134 ? 23.417  4.564   20.961 1.00 30.39 ? 165  VAL A CG2   1 
ATOM   1073  N N     . LYS A 1 135 ? 21.063  7.088   21.129 1.00 32.62 ? 166  LYS A N     1 
ATOM   1074  C CA    . LYS A 1 135 ? 19.683  7.039   21.625 1.00 32.27 ? 166  LYS A CA    1 
ATOM   1075  C C     . LYS A 1 135 ? 18.877  8.252   21.170 1.00 32.87 ? 166  LYS A C     1 
ATOM   1076  O O     . LYS A 1 135 ? 19.446  9.298   20.849 1.00 31.69 ? 166  LYS A O     1 
ATOM   1077  C CB    . LYS A 1 135 ? 19.669  6.968   23.153 1.00 32.44 ? 166  LYS A CB    1 
ATOM   1078  C CG    . LYS A 1 135 ? 19.750  5.569   23.674 1.00 31.57 ? 166  LYS A CG    1 
ATOM   1079  C CD    . LYS A 1 135 ? 20.071  5.548   25.136 1.00 31.46 ? 166  LYS A CD    1 
ATOM   1080  C CE    . LYS A 1 135 ? 20.341  4.118   25.564 1.00 33.04 ? 166  LYS A CE    1 
ATOM   1081  N NZ    . LYS A 1 135 ? 19.882  3.856   26.958 1.00 35.20 ? 166  LYS A NZ    1 
ATOM   1082  N N     . GLY A 1 136 ? 17.552  8.100   21.149 1.00 33.56 ? 167  GLY A N     1 
ATOM   1083  C CA    . GLY A 1 136 ? 16.679  9.183   20.729 1.00 34.73 ? 167  GLY A CA    1 
ATOM   1084  C C     . GLY A 1 136 ? 16.549  9.290   19.220 1.00 36.65 ? 167  GLY A C     1 
ATOM   1085  O O     . GLY A 1 136 ? 16.910  8.371   18.489 1.00 35.89 ? 167  GLY A O     1 
ATOM   1086  N N     . ASN A 1 137 ? 16.046  10.420  18.740 1.00 37.59 ? 168  ASN A N     1 
ATOM   1087  C CA    . ASN A 1 137 ? 15.867  10.618  17.311 1.00 39.25 ? 168  ASN A CA    1 
ATOM   1088  C C     . ASN A 1 137 ? 16.992  11.448  16.727 1.00 41.34 ? 168  ASN A C     1 
ATOM   1089  O O     . ASN A 1 137 ? 17.813  11.991  17.458 1.00 40.83 ? 168  ASN A O     1 
ATOM   1090  C CB    . ASN A 1 137 ? 14.534  11.306  17.061 1.00 41.57 ? 168  ASN A CB    1 
ATOM   1091  C CG    . ASN A 1 137 ? 13.362  10.397  17.353 1.00 42.98 ? 168  ASN A CG    1 
ATOM   1092  O OD1   . ASN A 1 137 ? 13.121  9.437   16.613 1.00 45.93 ? 168  ASN A OD1   1 
ATOM   1093  N ND2   . ASN A 1 137 ? 12.630  10.679  18.435 1.00 41.87 ? 168  ASN A ND2   1 
ATOM   1094  N N     . LYS A 1 138 ? 17.028  11.546  15.403 1.00 41.35 ? 169  LYS A N     1 
ATOM   1095  C CA    . LYS A 1 138 ? 18.059  12.322  14.739 1.00 42.34 ? 169  LYS A CA    1 
ATOM   1096  C C     . LYS A 1 138 ? 18.050  13.729  15.309 1.00 41.68 ? 169  LYS A C     1 
ATOM   1097  O O     . LYS A 1 138 ? 19.010  14.483  15.159 1.00 41.76 ? 169  LYS A O     1 
ATOM   1098  C CB    . LYS A 1 138 ? 17.797  12.376  13.231 1.00 45.20 ? 169  LYS A CB    1 
ATOM   1099  C CG    . LYS A 1 138 ? 18.270  11.147  12.473 1.00 49.23 ? 169  LYS A CG    1 
ATOM   1100  C CD    . LYS A 1 138 ? 17.960  11.255  10.978 1.00 51.42 ? 169  LYS A CD    1 
ATOM   1101  C CE    . LYS A 1 138 ? 16.997  10.151  10.524 1.00 53.02 ? 169  LYS A CE    1 
ATOM   1102  N NZ    . LYS A 1 138 ? 16.056  10.601  9.436  1.00 52.93 ? 169  LYS A NZ    1 
ATOM   1103  N N     . GLU A 1 139 ? 16.955  14.083  15.969 1.00 39.78 ? 170  GLU A N     1 
ATOM   1104  C CA    . GLU A 1 139 ? 16.832  15.405  16.552 1.00 39.04 ? 170  GLU A CA    1 
ATOM   1105  C C     . GLU A 1 139 ? 16.213  15.389  17.937 1.00 36.32 ? 170  GLU A C     1 
ATOM   1106  O O     . GLU A 1 139 ? 15.385  14.534  18.251 1.00 35.45 ? 170  GLU A O     1 
ATOM   1107  C CB    . GLU A 1 139 ? 15.988  16.291  15.650 1.00 40.93 ? 170  GLU A CB    1 
ATOM   1108  C CG    . GLU A 1 139 ? 16.723  16.855  14.478 1.00 46.15 ? 170  GLU A CG    1 
ATOM   1109  C CD    . GLU A 1 139 ? 15.755  17.359  13.370 1.00 49.47 ? 170  GLU A CD    1 
ATOM   1110  O OE1   . GLU A 1 139 ? 14.831  18.210  13.755 1.00 51.18 ? 170  GLU A OE1   1 
ATOM   1111  O OE2   . GLU A 1 139 ? 15.967  16.870  12.172 1.00 53.11 ? 170  GLU A OE2   1 
ATOM   1112  N N     . LEU A 1 140 ? 16.635  16.347  18.757 1.00 33.13 ? 171  LEU A N     1 
ATOM   1113  C CA    . LEU A 1 140 ? 16.129  16.506  20.111 1.00 30.34 ? 171  LEU A CA    1 
ATOM   1114  C C     . LEU A 1 140 ? 14.862  17.342  19.923 1.00 28.75 ? 171  LEU A C     1 
ATOM   1115  O O     . LEU A 1 140 ? 14.731  18.043  18.922 1.00 27.18 ? 171  LEU A O     1 
ATOM   1116  C CB    . LEU A 1 140 ? 17.156  17.267  20.962 1.00 28.70 ? 171  LEU A CB    1 
ATOM   1117  C CG    . LEU A 1 140 ? 17.996  16.596  22.066 1.00 28.34 ? 171  LEU A CG    1 
ATOM   1118  C CD1   . LEU A 1 140 ? 17.722  15.117  22.177 1.00 26.84 ? 171  LEU A CD1   1 
ATOM   1119  C CD2   . LEU A 1 140 ? 19.456  16.834  21.777 1.00 26.07 ? 171  LEU A CD2   1 
ATOM   1120  N N     . PRO A 1 141 ? 13.916  17.282  20.874 1.00 28.62 ? 172  PRO A N     1 
ATOM   1121  C CA    . PRO A 1 141 ? 12.674  18.057  20.756 1.00 29.12 ? 172  PRO A CA    1 
ATOM   1122  C C     . PRO A 1 141 ? 12.846  19.569  20.732 1.00 30.63 ? 172  PRO A C     1 
ATOM   1123  O O     . PRO A 1 141 ? 13.709  20.118  21.407 1.00 32.76 ? 172  PRO A O     1 
ATOM   1124  C CB    . PRO A 1 141 ? 11.842  17.602  21.953 1.00 28.75 ? 172  PRO A CB    1 
ATOM   1125  C CG    . PRO A 1 141 ? 12.804  17.010  22.898 1.00 28.07 ? 172  PRO A CG    1 
ATOM   1126  C CD    . PRO A 1 141 ? 13.950  16.474  22.103 1.00 28.49 ? 172  PRO A CD    1 
ATOM   1127  N N     . ASP A 1 142 ? 12.007  20.234  19.950 1.00 31.06 ? 173  ASP A N     1 
ATOM   1128  C CA    . ASP A 1 142 ? 12.022  21.686  19.821 1.00 32.07 ? 173  ASP A CA    1 
ATOM   1129  C C     . ASP A 1 142 ? 12.209  22.338  21.194 1.00 31.82 ? 173  ASP A C     1 
ATOM   1130  O O     . ASP A 1 142 ? 11.479  22.043  22.133 1.00 31.99 ? 173  ASP A O     1 
ATOM   1131  C CB    . ASP A 1 142 ? 10.704  22.130  19.172 1.00 34.22 ? 173  ASP A CB    1 
ATOM   1132  C CG    . ASP A 1 142 ? 10.635  23.626  18.914 1.00 36.43 ? 173  ASP A CG    1 
ATOM   1133  O OD1   . ASP A 1 142 ? 9.897   24.026  17.982 1.00 37.38 ? 173  ASP A OD1   1 
ATOM   1134  O OD2   . ASP A 1 142 ? 11.302  24.398  19.639 1.00 38.29 ? 173  ASP A OD2   1 
ATOM   1135  N N     . SER A 1 143 ? 13.193  23.224  21.307 1.00 32.12 ? 174  SER A N     1 
ATOM   1136  C CA    . SER A 1 143 ? 13.487  23.882  22.582 1.00 30.80 ? 174  SER A CA    1 
ATOM   1137  C C     . SER A 1 143 ? 12.417  24.863  23.014 1.00 30.88 ? 174  SER A C     1 
ATOM   1138  O O     . SER A 1 143 ? 12.255  25.115  24.207 1.00 30.36 ? 174  SER A O     1 
ATOM   1139  C CB    . SER A 1 143 ? 14.851  24.584  22.527 1.00 28.48 ? 174  SER A CB    1 
ATOM   1140  O OG    . SER A 1 143 ? 15.014  25.308  21.323 1.00 27.70 ? 174  SER A OG    1 
ATOM   1141  N N     . LYS A 1 144 ? 11.699  25.428  22.047 1.00 32.64 ? 175  LYS A N     1 
ATOM   1142  C CA    . LYS A 1 144 ? 10.620  26.363  22.349 1.00 32.62 ? 175  LYS A CA    1 
ATOM   1143  C C     . LYS A 1 144 ? 9.508   25.576  23.029 1.00 31.74 ? 175  LYS A C     1 
ATOM   1144  O O     . LYS A 1 144 ? 8.890   26.042  23.983 1.00 32.57 ? 175  LYS A O     1 
ATOM   1145  C CB    . LYS A 1 144 ? 10.080  26.994  21.068 1.00 34.06 ? 175  LYS A CB    1 
ATOM   1146  C CG    . LYS A 1 144 ? 9.192   28.215  21.300 1.00 36.07 ? 175  LYS A CG    1 
ATOM   1147  C CD    . LYS A 1 144 ? 8.539   28.683  20.001 1.00 35.80 ? 175  LYS A CD    1 
ATOM   1148  C CE    . LYS A 1 144 ? 7.127   29.192  20.250 1.00 37.99 ? 175  LYS A CE    1 
ATOM   1149  N NZ    . LYS A 1 144 ? 6.636   30.055  19.142 1.00 39.14 ? 175  LYS A NZ    1 
ATOM   1150  N N     . GLU A 1 145 ? 9.267   24.373  22.521 1.00 32.29 ? 176  GLU A N     1 
ATOM   1151  C CA    . GLU A 1 145 ? 8.247   23.476  23.061 1.00 32.44 ? 176  GLU A CA    1 
ATOM   1152  C C     . GLU A 1 145 ? 8.554   23.106  24.507 1.00 30.82 ? 176  GLU A C     1 
ATOM   1153  O O     . GLU A 1 145 ? 7.679   23.178  25.373 1.00 31.13 ? 176  GLU A O     1 
ATOM   1154  C CB    . GLU A 1 145 ? 8.191   22.194  22.236 1.00 34.58 ? 176  GLU A CB    1 
ATOM   1155  C CG    . GLU A 1 145 ? 7.356   22.305  20.999 1.00 35.97 ? 176  GLU A CG    1 
ATOM   1156  C CD    . GLU A 1 145 ? 5.933   22.591  21.341 1.00 39.11 ? 176  GLU A CD    1 
ATOM   1157  O OE1   . GLU A 1 145 ? 5.191   21.616  21.585 1.00 43.07 ? 176  GLU A OE1   1 
ATOM   1158  O OE2   . GLU A 1 145 ? 5.563   23.785  21.381 1.00 40.31 ? 176  GLU A OE2   1 
ATOM   1159  N N     . VAL A 1 146 ? 9.794   22.677  24.749 1.00 29.11 ? 177  VAL A N     1 
ATOM   1160  C CA    . VAL A 1 146 ? 10.233  22.301  26.088 1.00 26.82 ? 177  VAL A CA    1 
ATOM   1161  C C     . VAL A 1 146 ? 10.126  23.535  26.983 1.00 24.82 ? 177  VAL A C     1 
ATOM   1162  O O     . VAL A 1 146 ? 9.585   23.484  28.077 1.00 23.59 ? 177  VAL A O     1 
ATOM   1163  C CB    . VAL A 1 146 ? 11.703  21.809  26.077 1.00 28.35 ? 177  VAL A CB    1 
ATOM   1164  C CG1   . VAL A 1 146 ? 12.077  21.278  27.449 1.00 26.80 ? 177  VAL A CG1   1 
ATOM   1165  C CG2   . VAL A 1 146 ? 11.897  20.721  25.016 1.00 27.99 ? 177  VAL A CG2   1 
ATOM   1166  N N     . LEU A 1 147 ? 10.643  24.647  26.487 1.00 23.77 ? 178  LEU A N     1 
ATOM   1167  C CA    . LEU A 1 147 ? 10.609  25.908  27.205 1.00 24.40 ? 178  LEU A CA    1 
ATOM   1168  C C     . LEU A 1 147 ? 9.208   26.221  27.722 1.00 24.66 ? 178  LEU A C     1 
ATOM   1169  O O     . LEU A 1 147 ? 8.983   26.315  28.928 1.00 26.26 ? 178  LEU A O     1 
ATOM   1170  C CB    . LEU A 1 147 ? 11.064  27.019  26.264 1.00 23.90 ? 178  LEU A CB    1 
ATOM   1171  C CG    . LEU A 1 147 ? 11.746  28.301  26.739 1.00 22.51 ? 178  LEU A CG    1 
ATOM   1172  C CD1   . LEU A 1 147 ? 11.175  29.446  25.920 1.00 21.70 ? 178  LEU A CD1   1 
ATOM   1173  C CD2   . LEU A 1 147 ? 11.541  28.539  28.208 1.00 22.94 ? 178  LEU A CD2   1 
ATOM   1174  N N     . GLU A 1 148 ? 8.265   26.370  26.802 1.00 24.86 ? 179  GLU A N     1 
ATOM   1175  C CA    . GLU A 1 148 ? 6.881   26.696  27.151 1.00 25.67 ? 179  GLU A CA    1 
ATOM   1176  C C     . GLU A 1 148 ? 6.128   25.665  27.976 1.00 25.53 ? 179  GLU A C     1 
ATOM   1177  O O     . GLU A 1 148 ? 5.534   25.990  29.001 1.00 26.34 ? 179  GLU A O     1 
ATOM   1178  C CB    . GLU A 1 148 ? 6.093   26.961  25.878 1.00 25.38 ? 179  GLU A CB    1 
ATOM   1179  C CG    . GLU A 1 148 ? 6.767   27.927  24.955 1.00 26.28 ? 179  GLU A CG    1 
ATOM   1180  C CD    . GLU A 1 148 ? 5.956   28.197  23.718 1.00 28.05 ? 179  GLU A CD    1 
ATOM   1181  O OE1   . GLU A 1 148 ? 5.456   27.223  23.098 1.00 31.09 ? 179  GLU A OE1   1 
ATOM   1182  O OE2   . GLU A 1 148 ? 5.825   29.388  23.372 1.00 27.89 ? 179  GLU A OE2   1 
ATOM   1183  N N     . LYS A 1 149 ? 6.142   24.419  27.521 1.00 26.70 ? 180  LYS A N     1 
ATOM   1184  C CA    . LYS A 1 149 ? 5.430   23.363  28.215 1.00 27.42 ? 180  LYS A CA    1 
ATOM   1185  C C     . LYS A 1 149 ? 5.837   23.154  29.657 1.00 27.25 ? 180  LYS A C     1 
ATOM   1186  O O     . LYS A 1 149 ? 4.975   22.977  30.514 1.00 28.25 ? 180  LYS A O     1 
ATOM   1187  C CB    . LYS A 1 149 ? 5.587   22.038  27.469 1.00 28.53 ? 180  LYS A CB    1 
ATOM   1188  C CG    . LYS A 1 149 ? 5.069   22.070  26.058 1.00 29.50 ? 180  LYS A CG    1 
ATOM   1189  C CD    . LYS A 1 149 ? 4.207   20.867  25.756 1.00 32.57 ? 180  LYS A CD    1 
ATOM   1190  C CE    . LYS A 1 149 ? 2.991   21.279  24.947 1.00 34.29 ? 180  LYS A CE    1 
ATOM   1191  N NZ    . LYS A 1 149 ? 3.172   20.930  23.517 1.00 35.39 ? 180  LYS A NZ    1 
ATOM   1192  N N     . VAL A 1 150 ? 7.135   23.178  29.945 1.00 25.73 ? 181  VAL A N     1 
ATOM   1193  C CA    . VAL A 1 150 ? 7.557   22.901  31.303 1.00 23.09 ? 181  VAL A CA    1 
ATOM   1194  C C     . VAL A 1 150 ? 8.512   23.873  31.979 1.00 22.21 ? 181  VAL A C     1 
ATOM   1195  O O     . VAL A 1 150 ? 8.791   23.724  33.165 1.00 22.21 ? 181  VAL A O     1 
ATOM   1196  C CB    . VAL A 1 150 ? 8.159   21.475  31.388 1.00 23.14 ? 181  VAL A CB    1 
ATOM   1197  C CG1   . VAL A 1 150 ? 7.070   20.445  31.261 1.00 22.68 ? 181  VAL A CG1   1 
ATOM   1198  C CG2   . VAL A 1 150 ? 9.157   21.259  30.279 1.00 22.96 ? 181  VAL A CG2   1 
ATOM   1199  N N     . LEU A 1 151 ? 8.998   24.877  31.264 1.00 20.09 ? 182  LEU A N     1 
ATOM   1200  C CA    . LEU A 1 151 ? 9.928   25.800  31.887 1.00 19.11 ? 182  LEU A CA    1 
ATOM   1201  C C     . LEU A 1 151 ? 9.333   27.151  32.221 1.00 19.55 ? 182  LEU A C     1 
ATOM   1202  O O     . LEU A 1 151 ? 9.594   27.697  33.292 1.00 20.62 ? 182  LEU A O     1 
ATOM   1203  C CB    . LEU A 1 151 ? 11.163  25.996  30.998 1.00 17.43 ? 182  LEU A CB    1 
ATOM   1204  C CG    . LEU A 1 151 ? 12.073  24.779  30.709 1.00 16.73 ? 182  LEU A CG    1 
ATOM   1205  C CD1   . LEU A 1 151 ? 13.425  25.276  30.180 1.00 15.40 ? 182  LEU A CD1   1 
ATOM   1206  C CD2   . LEU A 1 151 ? 12.278  23.926  31.973 1.00 12.94 ? 182  LEU A CD2   1 
ATOM   1207  N N     . LEU A 1 152 ? 8.534   27.701  31.317 1.00 19.36 ? 183  LEU A N     1 
ATOM   1208  C CA    . LEU A 1 152 ? 7.963   29.019  31.548 1.00 20.62 ? 183  LEU A CA    1 
ATOM   1209  C C     . LEU A 1 152 ? 7.078   29.115  32.778 1.00 21.88 ? 183  LEU A C     1 
ATOM   1210  O O     . LEU A 1 152 ? 6.387   28.168  33.153 1.00 22.11 ? 183  LEU A O     1 
ATOM   1211  C CB    . LEU A 1 152 ? 7.204   29.481  30.318 1.00 19.29 ? 183  LEU A CB    1 
ATOM   1212  C CG    . LEU A 1 152 ? 8.166   29.889  29.211 1.00 19.16 ? 183  LEU A CG    1 
ATOM   1213  C CD1   . LEU A 1 152 ? 7.391   30.384  27.999 1.00 19.18 ? 183  LEU A CD1   1 
ATOM   1214  C CD2   . LEU A 1 152 ? 9.101   30.980  29.745 1.00 19.93 ? 183  LEU A CD2   1 
ATOM   1215  N N     . ARG A 1 153 ? 7.118   30.284  33.400 1.00 23.39 ? 184  ARG A N     1 
ATOM   1216  C CA    . ARG A 1 153 ? 6.363   30.559  34.608 1.00 24.72 ? 184  ARG A CA    1 
ATOM   1217  C C     . ARG A 1 153 ? 4.953   31.009  34.302 1.00 26.92 ? 184  ARG A C     1 
ATOM   1218  O O     . ARG A 1 153 ? 4.744   31.845  33.432 1.00 27.01 ? 184  ARG A O     1 
ATOM   1219  C CB    . ARG A 1 153 ? 7.063   31.663  35.401 1.00 22.12 ? 184  ARG A CB    1 
ATOM   1220  C CG    . ARG A 1 153 ? 6.215   32.301  36.474 1.00 21.93 ? 184  ARG A CG    1 
ATOM   1221  C CD    . ARG A 1 153 ? 6.969   33.418  37.187 1.00 22.02 ? 184  ARG A CD    1 
ATOM   1222  N NE    . ARG A 1 153 ? 8.212   32.960  37.813 1.00 23.14 ? 184  ARG A NE    1 
ATOM   1223  C CZ    . ARG A 1 153 ? 9.166   33.769  38.280 1.00 24.03 ? 184  ARG A CZ    1 
ATOM   1224  N NH1   . ARG A 1 153 ? 9.037   35.088  38.202 1.00 22.33 ? 184  ARG A NH1   1 
ATOM   1225  N NH2   . ARG A 1 153 ? 10.266  33.259  38.816 1.00 23.13 ? 184  ARG A NH2   1 
ATOM   1226  N N     . ARG A 1 154 ? 3.981   30.435  35.001 1.00 28.86 ? 185  ARG A N     1 
ATOM   1227  C CA    . ARG A 1 154 ? 2.596   30.867  34.844 1.00 31.55 ? 185  ARG A CA    1 
ATOM   1228  C C     . ARG A 1 154 ? 2.396   31.772  36.058 1.00 31.93 ? 185  ARG A C     1 
ATOM   1229  O O     . ARG A 1 154 ? 2.332   32.976  35.927 1.00 33.05 ? 185  ARG A O     1 
ATOM   1230  C CB    . ARG A 1 154 ? 1.622   29.686  34.883 1.00 32.41 ? 185  ARG A CB    1 
ATOM   1231  C CG    . ARG A 1 154 ? 2.207   28.365  34.426 1.00 35.08 ? 185  ARG A CG    1 
ATOM   1232  C CD    . ARG A 1 154 ? 2.418   28.309  32.921 1.00 35.54 ? 185  ARG A CD    1 
ATOM   1233  N NE    . ARG A 1 154 ? 3.255   27.166  32.551 1.00 37.81 ? 185  ARG A NE    1 
ATOM   1234  C CZ    . ARG A 1 154 ? 3.376   26.689  31.314 1.00 38.54 ? 185  ARG A CZ    1 
ATOM   1235  N NH1   . ARG A 1 154 ? 2.715   27.249  30.316 1.00 39.08 ? 185  ARG A NH1   1 
ATOM   1236  N NH2   . ARG A 1 154 ? 4.160   25.649  31.073 1.00 40.15 ? 185  ARG A NH2   1 
ATOM   1237  N N     . GLU A 1 155 ? 2.326   31.185  37.245 1.00 33.54 ? 186  GLU A N     1 
ATOM   1238  C CA    . GLU A 1 155 ? 2.188   31.959  38.473 1.00 33.90 ? 186  GLU A CA    1 
ATOM   1239  C C     . GLU A 1 155 ? 3.527   31.874  39.202 1.00 31.38 ? 186  GLU A C     1 
ATOM   1240  O O     . GLU A 1 155 ? 4.147   30.812  39.250 1.00 30.74 ? 186  GLU A O     1 
ATOM   1241  C CB    . GLU A 1 155 ? 1.100   31.371  39.369 1.00 38.27 ? 186  GLU A CB    1 
ATOM   1242  C CG    . GLU A 1 155 ? -0.314  31.662  38.918 1.00 47.42 ? 186  GLU A CG    1 
ATOM   1243  C CD    . GLU A 1 155 ? -1.360  30.905  39.735 1.00 52.41 ? 186  GLU A CD    1 
ATOM   1244  O OE1   . GLU A 1 155 ? -1.006  30.377  40.817 1.00 56.24 ? 186  GLU A OE1   1 
ATOM   1245  O OE2   . GLU A 1 155 ? -2.537  30.840  39.295 1.00 55.22 ? 186  GLU A OE2   1 
ATOM   1246  N N     . PHE A 1 156 ? 3.975   32.988  39.761 1.00 28.41 ? 187  PHE A N     1 
ATOM   1247  C CA    . PHE A 1 156 ? 5.232   33.010  40.489 1.00 26.31 ? 187  PHE A CA    1 
ATOM   1248  C C     . PHE A 1 156 ? 5.225   31.927  41.569 1.00 26.23 ? 187  PHE A C     1 
ATOM   1249  O O     . PHE A 1 156 ? 4.287   31.846  42.364 1.00 25.96 ? 187  PHE A O     1 
ATOM   1250  C CB    . PHE A 1 156 ? 5.430   34.386  41.137 1.00 24.89 ? 187  PHE A CB    1 
ATOM   1251  C CG    . PHE A 1 156 ? 6.695   34.511  41.957 1.00 23.99 ? 187  PHE A CG    1 
ATOM   1252  C CD1   . PHE A 1 156 ? 6.621   34.707  43.334 1.00 23.48 ? 187  PHE A CD1   1 
ATOM   1253  C CD2   . PHE A 1 156 ? 7.957   34.448  41.356 1.00 23.13 ? 187  PHE A CD2   1 
ATOM   1254  C CE1   . PHE A 1 156 ? 7.771   34.842  44.099 1.00 21.60 ? 187  PHE A CE1   1 
ATOM   1255  C CE2   . PHE A 1 156 ? 9.120   34.582  42.120 1.00 22.40 ? 187  PHE A CE2   1 
ATOM   1256  C CZ    . PHE A 1 156 ? 9.025   34.779  43.489 1.00 22.49 ? 187  PHE A CZ    1 
ATOM   1257  N N     . ILE A 1 157 ? 6.259   31.086  41.588 1.00 25.11 ? 188  ILE A N     1 
ATOM   1258  C CA    . ILE A 1 157 ? 6.366   30.048  42.603 1.00 23.57 ? 188  ILE A CA    1 
ATOM   1259  C C     . ILE A 1 157 ? 7.502   30.510  43.495 1.00 24.85 ? 188  ILE A C     1 
ATOM   1260  O O     . ILE A 1 157 ? 8.666   30.476  43.097 1.00 26.28 ? 188  ILE A O     1 
ATOM   1261  C CB    . ILE A 1 157 ? 6.756   28.682  42.015 1.00 23.03 ? 188  ILE A CB    1 
ATOM   1262  C CG1   . ILE A 1 157 ? 5.689   28.183  41.051 1.00 20.69 ? 188  ILE A CG1   1 
ATOM   1263  C CG2   . ILE A 1 157 ? 6.952   27.684  43.137 1.00 22.83 ? 188  ILE A CG2   1 
ATOM   1264  C CD1   . ILE A 1 157 ? 6.081   26.893  40.374 1.00 18.71 ? 188  ILE A CD1   1 
ATOM   1265  N N     . PRO A 1 158 ? 7.186   30.957  44.715 1.00 24.65 ? 189  PRO A N     1 
ATOM   1266  C CA    . PRO A 1 158 ? 8.222   31.432  45.643 1.00 23.79 ? 189  PRO A CA    1 
ATOM   1267  C C     . PRO A 1 158 ? 9.101   30.312  46.148 1.00 24.36 ? 189  PRO A C     1 
ATOM   1268  O O     . PRO A 1 158 ? 8.640   29.194  46.296 1.00 24.09 ? 189  PRO A O     1 
ATOM   1269  C CB    . PRO A 1 158 ? 7.424   32.078  46.765 1.00 23.18 ? 189  PRO A CB    1 
ATOM   1270  C CG    . PRO A 1 158 ? 6.138   31.337  46.753 1.00 22.52 ? 189  PRO A CG    1 
ATOM   1271  C CD    . PRO A 1 158 ? 5.842   31.041  45.307 1.00 23.51 ? 189  PRO A CD    1 
ATOM   1272  N N     . ASP A 1 159 ? 10.369  30.625  46.408 1.00 25.53 ? 190  ASP A N     1 
ATOM   1273  C CA    . ASP A 1 159 ? 11.321  29.642  46.906 1.00 25.37 ? 190  ASP A CA    1 
ATOM   1274  C C     . ASP A 1 159 ? 10.983  29.293  48.352 1.00 26.16 ? 190  ASP A C     1 
ATOM   1275  O O     . ASP A 1 159 ? 10.959  30.161  49.229 1.00 26.67 ? 190  ASP A O     1 
ATOM   1276  C CB    . ASP A 1 159 ? 12.750  30.192  46.817 1.00 25.22 ? 190  ASP A CB    1 
ATOM   1277  C CG    . ASP A 1 159 ? 13.721  29.439  47.706 1.00 24.88 ? 190  ASP A CG    1 
ATOM   1278  O OD1   . ASP A 1 159 ? 13.563  28.208  47.857 1.00 23.22 ? 190  ASP A OD1   1 
ATOM   1279  O OD2   . ASP A 1 159 ? 14.639  30.084  48.256 1.00 26.00 ? 190  ASP A OD2   1 
ATOM   1280  N N     . PRO A 1 160 ? 10.715  28.009  48.623 1.00 25.95 ? 191  PRO A N     1 
ATOM   1281  C CA    . PRO A 1 160 ? 10.381  27.590  49.985 1.00 26.03 ? 191  PRO A CA    1 
ATOM   1282  C C     . PRO A 1 160 ? 11.476  27.880  50.999 1.00 25.09 ? 191  PRO A C     1 
ATOM   1283  O O     . PRO A 1 160 ? 11.189  28.045  52.173 1.00 26.90 ? 191  PRO A O     1 
ATOM   1284  C CB    . PRO A 1 160 ? 10.111  26.092  49.849 1.00 26.40 ? 191  PRO A CB    1 
ATOM   1285  C CG    . PRO A 1 160 ? 10.813  25.686  48.596 1.00 25.82 ? 191  PRO A CG    1 
ATOM   1286  C CD    . PRO A 1 160 ? 10.705  26.872  47.687 1.00 26.95 ? 191  PRO A CD    1 
ATOM   1287  N N     . GLN A 1 161 ? 12.727  27.942  50.555 1.00 24.54 ? 192  GLN A N     1 
ATOM   1288  C CA    . GLN A 1 161 ? 13.836  28.202  51.472 1.00 24.01 ? 192  GLN A CA    1 
ATOM   1289  C C     . GLN A 1 161 ? 14.015  29.668  51.839 1.00 23.27 ? 192  GLN A C     1 
ATOM   1290  O O     . GLN A 1 161 ? 14.901  30.014  52.622 1.00 22.30 ? 192  GLN A O     1 
ATOM   1291  C CB    . GLN A 1 161 ? 15.131  27.657  50.886 1.00 23.19 ? 192  GLN A CB    1 
ATOM   1292  C CG    . GLN A 1 161 ? 15.123  26.154  50.751 1.00 22.95 ? 192  GLN A CG    1 
ATOM   1293  C CD    . GLN A 1 161 ? 16.506  25.594  50.525 1.00 22.86 ? 192  GLN A CD    1 
ATOM   1294  O OE1   . GLN A 1 161 ? 16.678  24.660  49.750 1.00 25.42 ? 192  GLN A OE1   1 
ATOM   1295  N NE2   . GLN A 1 161 ? 17.500  26.160  51.198 1.00 20.08 ? 192  GLN A NE2   1 
ATOM   1296  N N     . GLY A 1 162 ? 13.187  30.527  51.255 1.00 23.23 ? 193  GLY A N     1 
ATOM   1297  C CA    . GLY A 1 162 ? 13.251  31.942  51.570 1.00 23.81 ? 193  GLY A CA    1 
ATOM   1298  C C     . GLY A 1 162 ? 14.288  32.814  50.896 1.00 24.22 ? 193  GLY A C     1 
ATOM   1299  O O     . GLY A 1 162 ? 14.505  33.945  51.332 1.00 24.80 ? 193  GLY A O     1 
ATOM   1300  N N     . SER A 1 163 ? 14.928  32.321  49.841 1.00 24.32 ? 194  SER A N     1 
ATOM   1301  C CA    . SER A 1 163 ? 15.932  33.124  49.144 1.00 24.28 ? 194  SER A CA    1 
ATOM   1302  C C     . SER A 1 163 ? 15.335  34.488  48.793 1.00 24.31 ? 194  SER A C     1 
ATOM   1303  O O     . SER A 1 163 ? 14.166  34.572  48.439 1.00 24.79 ? 194  SER A O     1 
ATOM   1304  C CB    . SER A 1 163 ? 16.383  32.401  47.869 1.00 24.18 ? 194  SER A CB    1 
ATOM   1305  O OG    . SER A 1 163 ? 16.947  31.131  48.184 1.00 22.79 ? 194  SER A OG    1 
ATOM   1306  N N     . ASN A 1 164 ? 16.127  35.553  48.909 1.00 24.09 ? 195  ASN A N     1 
ATOM   1307  C CA    . ASN A 1 164 ? 15.638  36.890  48.578 1.00 24.19 ? 195  ASN A CA    1 
ATOM   1308  C C     . ASN A 1 164 ? 16.414  37.524  47.424 1.00 23.42 ? 195  ASN A C     1 
ATOM   1309  O O     . ASN A 1 164 ? 17.175  36.856  46.734 1.00 23.06 ? 195  ASN A O     1 
ATOM   1310  C CB    . ASN A 1 164 ? 15.689  37.805  49.801 1.00 24.20 ? 195  ASN A CB    1 
ATOM   1311  C CG    . ASN A 1 164 ? 17.071  37.891  50.407 1.00 23.90 ? 195  ASN A CG    1 
ATOM   1312  O OD1   . ASN A 1 164 ? 18.072  37.626  49.734 1.00 23.48 ? 195  ASN A OD1   1 
ATOM   1313  N ND2   . ASN A 1 164 ? 17.136  38.265  51.690 1.00 22.55 ? 195  ASN A ND2   1 
ATOM   1314  N N     . MET A 1 165 ? 16.211  38.816  47.211 1.00 23.39 ? 196  MET A N     1 
ATOM   1315  C CA    . MET A 1 165 ? 16.882  39.496  46.123 1.00 23.24 ? 196  MET A CA    1 
ATOM   1316  C C     . MET A 1 165 ? 18.349  39.787  46.441 1.00 23.09 ? 196  MET A C     1 
ATOM   1317  O O     . MET A 1 165 ? 19.154  40.012  45.540 1.00 21.63 ? 196  MET A O     1 
ATOM   1318  C CB    . MET A 1 165 ? 16.124  40.776  45.782 1.00 24.16 ? 196  MET A CB    1 
ATOM   1319  C CG    . MET A 1 165 ? 14.828  40.516  45.022 1.00 23.03 ? 196  MET A CG    1 
ATOM   1320  S SD    . MET A 1 165 ? 15.045  39.458  43.570 1.00 24.70 ? 196  MET A SD    1 
ATOM   1321  C CE    . MET A 1 165 ? 14.649  37.880  44.238 1.00 22.46 ? 196  MET A CE    1 
ATOM   1322  N N     . MET A 1 166 ? 18.697  39.776  47.722 1.00 22.00 ? 197  MET A N     1 
ATOM   1323  C CA    . MET A 1 166 ? 20.082  40.003  48.110 1.00 21.95 ? 197  MET A CA    1 
ATOM   1324  C C     . MET A 1 166 ? 20.844  38.785  47.608 1.00 22.40 ? 197  MET A C     1 
ATOM   1325  O O     . MET A 1 166 ? 21.949  38.905  47.064 1.00 23.76 ? 197  MET A O     1 
ATOM   1326  C CB    . MET A 1 166 ? 20.226  40.085  49.632 1.00 20.95 ? 197  MET A CB    1 
ATOM   1327  C CG    . MET A 1 166 ? 19.917  41.438  50.246 1.00 20.54 ? 197  MET A CG    1 
ATOM   1328  S SD    . MET A 1 166 ? 20.777  42.817  49.502 1.00 22.52 ? 197  MET A SD    1 
ATOM   1329  C CE    . MET A 1 166 ? 22.229  42.901  50.473 1.00 21.31 ? 197  MET A CE    1 
ATOM   1330  N N     . PHE A 1 167 ? 20.241  37.612  47.789 1.00 21.21 ? 198  PHE A N     1 
ATOM   1331  C CA    . PHE A 1 167 ? 20.849  36.359  47.359 1.00 20.13 ? 198  PHE A CA    1 
ATOM   1332  C C     . PHE A 1 167 ? 20.891  36.250  45.836 1.00 20.08 ? 198  PHE A C     1 
ATOM   1333  O O     . PHE A 1 167 ? 21.904  35.884  45.252 1.00 21.75 ? 198  PHE A O     1 
ATOM   1334  C CB    . PHE A 1 167 ? 20.072  35.160  47.920 1.00 18.31 ? 198  PHE A CB    1 
ATOM   1335  C CG    . PHE A 1 167 ? 20.534  33.843  47.369 1.00 16.87 ? 198  PHE A CG    1 
ATOM   1336  C CD1   . PHE A 1 167 ? 21.543  33.128  48.008 1.00 15.93 ? 198  PHE A CD1   1 
ATOM   1337  C CD2   . PHE A 1 167 ? 20.021  33.349  46.170 1.00 16.14 ? 198  PHE A CD2   1 
ATOM   1338  C CE1   . PHE A 1 167 ? 22.044  31.947  47.462 1.00 14.78 ? 198  PHE A CE1   1 
ATOM   1339  C CE2   . PHE A 1 167 ? 20.519  32.161  45.608 1.00 14.47 ? 198  PHE A CE2   1 
ATOM   1340  C CZ    . PHE A 1 167 ? 21.531  31.464  46.257 1.00 14.95 ? 198  PHE A CZ    1 
ATOM   1341  N N     . ALA A 1 168 ? 19.778  36.550  45.189 1.00 21.84 ? 199  ALA A N     1 
ATOM   1342  C CA    . ALA A 1 168 ? 19.717  36.456  43.736 1.00 22.14 ? 199  ALA A CA    1 
ATOM   1343  C C     . ALA A 1 168 ? 20.776  37.326  43.045 1.00 21.02 ? 199  ALA A C     1 
ATOM   1344  O O     . ALA A 1 168 ? 21.437  36.880  42.102 1.00 22.19 ? 199  ALA A O     1 
ATOM   1345  C CB    . ALA A 1 168 ? 18.310  36.830  43.253 1.00 21.31 ? 199  ALA A CB    1 
ATOM   1346  N N     . PHE A 1 169 ? 20.945  38.557  43.508 1.00 20.50 ? 200  PHE A N     1 
ATOM   1347  C CA    . PHE A 1 169 ? 21.921  39.438  42.899 1.00 20.75 ? 200  PHE A CA    1 
ATOM   1348  C C     . PHE A 1 169 ? 23.345  39.102  43.305 1.00 20.53 ? 200  PHE A C     1 
ATOM   1349  O O     . PHE A 1 169 ? 24.280  39.362  42.553 1.00 21.44 ? 200  PHE A O     1 
ATOM   1350  C CB    . PHE A 1 169 ? 21.586  40.889  43.220 1.00 19.72 ? 200  PHE A CB    1 
ATOM   1351  C CG    . PHE A 1 169 ? 20.536  41.460  42.319 1.00 20.74 ? 200  PHE A CG    1 
ATOM   1352  C CD1   . PHE A 1 169 ? 20.852  41.833  41.015 1.00 21.23 ? 200  PHE A CD1   1 
ATOM   1353  C CD2   . PHE A 1 169 ? 19.207  41.571  42.754 1.00 21.20 ? 200  PHE A CD2   1 
ATOM   1354  C CE1   . PHE A 1 169 ? 19.853  42.314  40.137 1.00 22.09 ? 200  PHE A CE1   1 
ATOM   1355  C CE2   . PHE A 1 169 ? 18.191  42.047  41.899 1.00 20.98 ? 200  PHE A CE2   1 
ATOM   1356  C CZ    . PHE A 1 169 ? 18.514  42.418  40.583 1.00 22.22 ? 200  PHE A CZ    1 
ATOM   1357  N N     . PHE A 1 170 ? 23.521  38.522  44.487 1.00 20.29 ? 201  PHE A N     1 
ATOM   1358  C CA    . PHE A 1 170 ? 24.863  38.131  44.911 1.00 20.36 ? 201  PHE A CA    1 
ATOM   1359  C C     . PHE A 1 170 ? 25.321  36.979  44.014 1.00 21.08 ? 201  PHE A C     1 
ATOM   1360  O O     . PHE A 1 170 ? 26.484  36.908  43.617 1.00 21.90 ? 201  PHE A O     1 
ATOM   1361  C CB    . PHE A 1 170 ? 24.858  37.669  46.368 1.00 19.26 ? 201  PHE A CB    1 
ATOM   1362  C CG    . PHE A 1 170 ? 26.220  37.354  46.911 1.00 18.89 ? 201  PHE A CG    1 
ATOM   1363  C CD1   . PHE A 1 170 ? 26.872  38.251  47.762 1.00 18.38 ? 201  PHE A CD1   1 
ATOM   1364  C CD2   . PHE A 1 170 ? 26.860  36.156  46.571 1.00 19.85 ? 201  PHE A CD2   1 
ATOM   1365  C CE1   . PHE A 1 170 ? 28.148  37.962  48.277 1.00 17.90 ? 201  PHE A CE1   1 
ATOM   1366  C CE2   . PHE A 1 170 ? 28.136  35.844  47.075 1.00 19.03 ? 201  PHE A CE2   1 
ATOM   1367  C CZ    . PHE A 1 170 ? 28.782  36.756  47.933 1.00 19.14 ? 201  PHE A CZ    1 
ATOM   1368  N N     . ALA A 1 171 ? 24.394  36.076  43.706 1.00 21.73 ? 202  ALA A N     1 
ATOM   1369  C CA    . ALA A 1 171 ? 24.687  34.920  42.861 1.00 22.45 ? 202  ALA A CA    1 
ATOM   1370  C C     . ALA A 1 171 ? 25.136  35.409  41.503 1.00 23.89 ? 202  ALA A C     1 
ATOM   1371  O O     . ALA A 1 171 ? 26.092  34.897  40.914 1.00 25.60 ? 202  ALA A O     1 
ATOM   1372  C CB    . ALA A 1 171 ? 23.448  34.045  42.713 1.00 19.27 ? 202  ALA A CB    1 
ATOM   1373  N N     . GLN A 1 172 ? 24.445  36.421  41.012 1.00 24.96 ? 203  GLN A N     1 
ATOM   1374  C CA    . GLN A 1 172 ? 24.772  36.965  39.726 1.00 25.13 ? 203  GLN A CA    1 
ATOM   1375  C C     . GLN A 1 172 ? 26.088  37.739  39.711 1.00 23.18 ? 203  GLN A C     1 
ATOM   1376  O O     . GLN A 1 172 ? 26.898  37.600  38.799 1.00 23.35 ? 203  GLN A O     1 
ATOM   1377  C CB    . GLN A 1 172 ? 23.702  37.892  39.285 1.00 27.55 ? 203  GLN A CB    1 
ATOM   1378  C CG    . GLN A 1 172 ? 24.109  38.380  38.004 1.00 36.10 ? 203  GLN A CG    1 
ATOM   1379  C CD    . GLN A 1 172 ? 23.072  37.980  37.054 1.00 40.30 ? 203  GLN A CD    1 
ATOM   1380  O OE1   . GLN A 1 172 ? 22.995  36.746  36.479 1.00 47.58 ? 203  GLN A OE1   1 
ATOM   1381  N NE2   . GLN A 1 172 ? 22.116  38.997  36.946 1.00 39.92 ? 203  GLN A NE2   1 
ATOM   1382  N N     . HIS A 1 173 ? 26.291  38.567  40.724 1.00 21.52 ? 204  HIS A N     1 
ATOM   1383  C CA    . HIS A 1 173 ? 27.502  39.368  40.832 1.00 20.15 ? 204  HIS A CA    1 
ATOM   1384  C C     . HIS A 1 173 ? 28.719  38.452  41.050 1.00 20.77 ? 204  HIS A C     1 
ATOM   1385  O O     . HIS A 1 173 ? 29.717  38.506  40.319 1.00 21.84 ? 204  HIS A O     1 
ATOM   1386  C CB    . HIS A 1 173 ? 27.330  40.339  41.997 1.00 19.26 ? 204  HIS A CB    1 
ATOM   1387  C CG    . HIS A 1 173 ? 28.513  41.217  42.255 1.00 18.54 ? 204  HIS A CG    1 
ATOM   1388  N ND1   . HIS A 1 173 ? 29.437  40.942  43.230 1.00 19.80 ? 204  HIS A ND1   1 
ATOM   1389  C CD2   . HIS A 1 173 ? 28.913  42.368  41.665 1.00 18.54 ? 204  HIS A CD2   1 
ATOM   1390  C CE1   . HIS A 1 173 ? 30.363  41.882  43.242 1.00 18.53 ? 204  HIS A CE1   1 
ATOM   1391  N NE2   . HIS A 1 173 ? 30.071  42.759  42.299 1.00 19.77 ? 204  HIS A NE2   1 
ATOM   1392  N N     . PHE A 1 174 ? 28.625  37.593  42.051 1.00 18.55 ? 205  PHE A N     1 
ATOM   1393  C CA    . PHE A 1 174 ? 29.701  36.679  42.356 1.00 19.16 ? 205  PHE A CA    1 
ATOM   1394  C C     . PHE A 1 174 ? 30.153  35.826  41.169 1.00 19.49 ? 205  PHE A C     1 
ATOM   1395  O O     . PHE A 1 174 ? 31.318  35.865  40.772 1.00 20.77 ? 205  PHE A O     1 
ATOM   1396  C CB    . PHE A 1 174 ? 29.265  35.766  43.486 1.00 19.02 ? 205  PHE A CB    1 
ATOM   1397  C CG    . PHE A 1 174 ? 30.237  34.676  43.785 1.00 20.02 ? 205  PHE A CG    1 
ATOM   1398  C CD1   . PHE A 1 174 ? 31.509  34.980  44.258 1.00 18.96 ? 205  PHE A CD1   1 
ATOM   1399  C CD2   . PHE A 1 174 ? 29.879  33.333  43.611 1.00 20.21 ? 205  PHE A CD2   1 
ATOM   1400  C CE1   . PHE A 1 174 ? 32.414  33.962  44.557 1.00 19.64 ? 205  PHE A CE1   1 
ATOM   1401  C CE2   . PHE A 1 174 ? 30.784  32.297  43.908 1.00 20.20 ? 205  PHE A CE2   1 
ATOM   1402  C CZ    . PHE A 1 174 ? 32.051  32.613  44.382 1.00 19.03 ? 205  PHE A CZ    1 
ATOM   1403  N N     . THR A 1 175 ? 29.233  35.049  40.605 1.00 18.63 ? 206  THR A N     1 
ATOM   1404  C CA    . THR A 1 175 ? 29.566  34.164  39.486 1.00 19.29 ? 206  THR A CA    1 
ATOM   1405  C C     . THR A 1 175 ? 29.972  34.874  38.200 1.00 18.86 ? 206  THR A C     1 
ATOM   1406  O O     . THR A 1 175 ? 30.496  34.251  37.274 1.00 18.10 ? 206  THR A O     1 
ATOM   1407  C CB    . THR A 1 175 ? 28.395  33.201  39.158 1.00 19.55 ? 206  THR A CB    1 
ATOM   1408  O OG1   . THR A 1 175 ? 27.273  33.956  38.689 1.00 20.30 ? 206  THR A OG1   1 
ATOM   1409  C CG2   . THR A 1 175 ? 27.986  32.413  40.389 1.00 17.34 ? 206  THR A CG2   1 
ATOM   1410  N N     . ALA A 1 176 ? 29.732  36.178  38.141 1.00 18.70 ? 207  ALA A N     1 
ATOM   1411  C CA    . ALA A 1 176 ? 30.082  36.958  36.965 1.00 18.89 ? 207  ALA A CA    1 
ATOM   1412  C C     . ALA A 1 176 ? 31.605  37.076  36.781 1.00 20.10 ? 207  ALA A C     1 
ATOM   1413  O O     . ALA A 1 176 ? 32.081  37.423  35.687 1.00 20.79 ? 207  ALA A O     1 
ATOM   1414  C CB    . ALA A 1 176 ? 29.465  38.325  37.072 1.00 18.03 ? 207  ALA A CB    1 
ATOM   1415  N N     . GLN A 1 177 ? 32.373  36.792  37.833 1.00 19.33 ? 208  GLN A N     1 
ATOM   1416  C CA    . GLN A 1 177 ? 33.825  36.879  37.718 1.00 19.41 ? 208  GLN A CA    1 
ATOM   1417  C C     . GLN A 1 177 ? 34.398  35.645  37.043 1.00 19.76 ? 208  GLN A C     1 
ATOM   1418  O O     . GLN A 1 177 ? 35.474  35.715  36.448 1.00 21.14 ? 208  GLN A O     1 
ATOM   1419  C CB    . GLN A 1 177 ? 34.487  37.071  39.082 1.00 20.18 ? 208  GLN A CB    1 
ATOM   1420  C CG    . GLN A 1 177 ? 34.463  35.848  39.962 1.00 21.60 ? 208  GLN A CG    1 
ATOM   1421  C CD    . GLN A 1 177 ? 34.666  36.208  41.404 1.00 23.56 ? 208  GLN A CD    1 
ATOM   1422  O OE1   . GLN A 1 177 ? 35.774  36.552  41.814 1.00 26.78 ? 208  GLN A OE1   1 
ATOM   1423  N NE2   . GLN A 1 177 ? 33.596  36.144  42.191 1.00 24.93 ? 208  GLN A NE2   1 
ATOM   1424  N N     . PHE A 1 178 ? 33.697  34.513  37.115 1.00 17.28 ? 209  PHE A N     1 
ATOM   1425  C CA    . PHE A 1 178 ? 34.224  33.329  36.463 1.00 16.79 ? 209  PHE A CA    1 
ATOM   1426  C C     . PHE A 1 178 ? 33.372  32.745  35.339 1.00 18.15 ? 209  PHE A C     1 
ATOM   1427  O O     . PHE A 1 178 ? 33.830  31.865  34.618 1.00 16.89 ? 209  PHE A O     1 
ATOM   1428  C CB    . PHE A 1 178 ? 34.604  32.245  37.479 1.00 14.06 ? 209  PHE A CB    1 
ATOM   1429  C CG    . PHE A 1 178 ? 33.546  31.914  38.486 1.00 13.76 ? 209  PHE A CG    1 
ATOM   1430  C CD1   . PHE A 1 178 ? 33.620  32.431  39.772 1.00 12.93 ? 209  PHE A CD1   1 
ATOM   1431  C CD2   . PHE A 1 178 ? 32.536  31.007  38.186 1.00 13.46 ? 209  PHE A CD2   1 
ATOM   1432  C CE1   . PHE A 1 178 ? 32.711  32.047  40.750 1.00 12.96 ? 209  PHE A CE1   1 
ATOM   1433  C CE2   . PHE A 1 178 ? 31.627  30.615  39.155 1.00 12.96 ? 209  PHE A CE2   1 
ATOM   1434  C CZ    . PHE A 1 178 ? 31.718  31.141  40.446 1.00 12.65 ? 209  PHE A CZ    1 
ATOM   1435  N N     . PHE A 1 179 ? 32.141  33.225  35.174 1.00 17.75 ? 210  PHE A N     1 
ATOM   1436  C CA    . PHE A 1 179 ? 31.308  32.752  34.070 1.00 18.09 ? 210  PHE A CA    1 
ATOM   1437  C C     . PHE A 1 179 ? 31.288  33.957  33.148 1.00 19.81 ? 210  PHE A C     1 
ATOM   1438  O O     . PHE A 1 179 ? 30.402  34.803  33.247 1.00 21.38 ? 210  PHE A O     1 
ATOM   1439  C CB    . PHE A 1 179 ? 29.862  32.445  34.508 1.00 17.14 ? 210  PHE A CB    1 
ATOM   1440  C CG    . PHE A 1 179 ? 29.706  31.187  35.332 1.00 15.22 ? 210  PHE A CG    1 
ATOM   1441  C CD1   . PHE A 1 179 ? 30.561  30.113  35.169 1.00 15.23 ? 210  PHE A CD1   1 
ATOM   1442  C CD2   . PHE A 1 179 ? 28.721  31.108  36.310 1.00 13.09 ? 210  PHE A CD2   1 
ATOM   1443  C CE1   . PHE A 1 179 ? 30.448  28.986  35.971 1.00 15.11 ? 210  PHE A CE1   1 
ATOM   1444  C CE2   . PHE A 1 179 ? 28.597  29.987  37.119 1.00 12.53 ? 210  PHE A CE2   1 
ATOM   1445  C CZ    . PHE A 1 179 ? 29.462  28.924  36.952 1.00 14.52 ? 210  PHE A CZ    1 
ATOM   1446  N N     . LYS A 1 180 ? 32.282  34.068  32.282 1.00 21.19 ? 211  LYS A N     1 
ATOM   1447  C CA    . LYS A 1 180 ? 32.340  35.195  31.363 1.00 22.90 ? 211  LYS A CA    1 
ATOM   1448  C C     . LYS A 1 180 ? 32.519  34.652  29.972 1.00 24.72 ? 211  LYS A C     1 
ATOM   1449  O O     . LYS A 1 180 ? 33.590  34.725  29.374 1.00 24.29 ? 211  LYS A O     1 
ATOM   1450  C CB    . LYS A 1 180 ? 33.501  36.100  31.721 1.00 22.93 ? 211  LYS A CB    1 
ATOM   1451  C CG    . LYS A 1 180 ? 33.485  36.574  33.151 1.00 21.60 ? 211  LYS A CG    1 
ATOM   1452  C CD    . LYS A 1 180 ? 34.875  36.967  33.570 1.00 21.98 ? 211  LYS A CD    1 
ATOM   1453  C CE    . LYS A 1 180 ? 35.362  38.092  32.723 1.00 21.69 ? 211  LYS A CE    1 
ATOM   1454  N NZ    . LYS A 1 180 ? 36.644  38.595  33.232 1.00 21.60 ? 211  LYS A NZ    1 
ATOM   1455  N N     . THR A 1 181 ? 31.442  34.089  29.462 1.00 28.15 ? 212  THR A N     1 
ATOM   1456  C CA    . THR A 1 181 ? 31.457  33.484  28.153 1.00 30.72 ? 212  THR A CA    1 
ATOM   1457  C C     . THR A 1 181 ? 31.955  34.423  27.063 1.00 32.22 ? 212  THR A C     1 
ATOM   1458  O O     . THR A 1 181 ? 31.538  35.582  26.982 1.00 32.77 ? 212  THR A O     1 
ATOM   1459  C CB    . THR A 1 181 ? 30.066  32.944  27.848 1.00 31.48 ? 212  THR A CB    1 
ATOM   1460  O OG1   . THR A 1 181 ? 29.655  32.110  28.950 1.00 30.80 ? 212  THR A OG1   1 
ATOM   1461  C CG2   . THR A 1 181 ? 30.073  32.141  26.558 1.00 30.66 ? 212  THR A CG2   1 
ATOM   1462  N N     . ASP A 1 182 ? 32.884  33.910  26.254 1.00 34.61 ? 213  ASP A N     1 
ATOM   1463  C CA    . ASP A 1 182 ? 33.480  34.659  25.145 1.00 36.63 ? 213  ASP A CA    1 
ATOM   1464  C C     . ASP A 1 182 ? 32.624  34.459  23.900 1.00 37.78 ? 213  ASP A C     1 
ATOM   1465  O O     . ASP A 1 182 ? 32.956  33.666  23.025 1.00 38.21 ? 213  ASP A O     1 
ATOM   1466  C CB    . ASP A 1 182 ? 34.901  34.161  24.876 1.00 36.08 ? 213  ASP A CB    1 
ATOM   1467  C CG    . ASP A 1 182 ? 35.677  35.075  23.941 1.00 36.08 ? 213  ASP A CG    1 
ATOM   1468  O OD1   . ASP A 1 182 ? 35.084  36.032  23.399 1.00 37.13 ? 213  ASP A OD1   1 
ATOM   1469  O OD2   . ASP A 1 182 ? 36.887  34.835  23.744 1.00 37.10 ? 213  ASP A OD2   1 
ATOM   1470  N N     . HIS A 1 183 ? 31.520  35.193  23.837 1.00 40.29 ? 214  HIS A N     1 
ATOM   1471  C CA    . HIS A 1 183 ? 30.563  35.099  22.741 1.00 42.09 ? 214  HIS A CA    1 
ATOM   1472  C C     . HIS A 1 183 ? 31.144  35.109  21.320 1.00 43.09 ? 214  HIS A C     1 
ATOM   1473  O O     . HIS A 1 183 ? 30.628  34.417  20.433 1.00 43.28 ? 214  HIS A O     1 
ATOM   1474  C CB    . HIS A 1 183 ? 29.516  36.207  22.892 1.00 43.67 ? 214  HIS A CB    1 
ATOM   1475  C CG    . HIS A 1 183 ? 28.829  36.209  24.228 1.00 46.25 ? 214  HIS A CG    1 
ATOM   1476  N ND1   . HIS A 1 183 ? 28.002  35.190  24.648 1.00 46.23 ? 214  HIS A ND1   1 
ATOM   1477  C CD2   . HIS A 1 183 ? 28.858  37.116  25.240 1.00 46.38 ? 214  HIS A CD2   1 
ATOM   1478  C CE1   . HIS A 1 183 ? 27.553  35.457  25.859 1.00 47.67 ? 214  HIS A CE1   1 
ATOM   1479  N NE2   . HIS A 1 183 ? 28.054  36.622  26.244 1.00 47.62 ? 214  HIS A NE2   1 
ATOM   1480  N N     . LYS A 1 184 ? 32.206  35.884  21.097 1.00 43.73 ? 215  LYS A N     1 
ATOM   1481  C CA    . LYS A 1 184 ? 32.825  35.947  19.775 1.00 41.29 ? 215  LYS A CA    1 
ATOM   1482  C C     . LYS A 1 184 ? 33.441  34.605  19.399 1.00 40.19 ? 215  LYS A C     1 
ATOM   1483  O O     . LYS A 1 184 ? 33.646  34.324  18.225 1.00 39.00 ? 215  LYS A O     1 
ATOM   1484  C CB    . LYS A 1 184 ? 33.904  37.033  19.733 1.00 44.71 ? 215  LYS A CB    1 
ATOM   1485  C CG    . LYS A 1 184 ? 33.363  38.428  19.999 1.00 47.45 ? 215  LYS A CG    1 
ATOM   1486  C CD    . LYS A 1 184 ? 33.710  39.408  18.888 1.00 50.40 ? 215  LYS A CD    1 
ATOM   1487  C CE    . LYS A 1 184 ? 33.671  40.845  19.404 1.00 52.44 ? 215  LYS A CE    1 
ATOM   1488  N NZ    . LYS A 1 184 ? 34.252  41.835  18.434 1.00 55.06 ? 215  LYS A NZ    1 
ATOM   1489  N N     . ARG A 1 185 ? 33.725  33.784  20.392 1.00 37.28 ? 216  ARG A N     1 
ATOM   1490  C CA    . ARG A 1 185 ? 34.308  32.475  20.151 1.00 35.24 ? 216  ARG A CA    1 
ATOM   1491  C C     . ARG A 1 185 ? 33.301  31.322  20.273 1.00 33.58 ? 216  ARG A C     1 
ATOM   1492  O O     . ARG A 1 185 ? 33.363  30.340  19.532 1.00 32.49 ? 216  ARG A O     1 
ATOM   1493  C CB    . ARG A 1 185 ? 35.483  32.282  21.108 1.00 37.98 ? 216  ARG A CB    1 
ATOM   1494  C CG    . ARG A 1 185 ? 36.628  33.239  20.840 1.00 41.02 ? 216  ARG A CG    1 
ATOM   1495  C CD    . ARG A 1 185 ? 37.938  32.766  21.412 1.00 45.20 ? 216  ARG A CD    1 
ATOM   1496  N NE    . ARG A 1 185 ? 38.990  33.744  21.148 1.00 47.30 ? 216  ARG A NE    1 
ATOM   1497  C CZ    . ARG A 1 185 ? 40.274  33.486  21.306 1.00 48.88 ? 216  ARG A CZ    1 
ATOM   1498  N NH1   . ARG A 1 185 ? 40.621  32.287  21.713 1.00 50.37 ? 216  ARG A NH1   1 
ATOM   1499  N NH2   . ARG A 1 185 ? 41.204  34.418  21.107 1.00 50.05 ? 216  ARG A NH2   1 
ATOM   1500  N N     . GLY A 1 186 ? 32.351  31.439  21.211 1.00 32.13 ? 217  GLY A N     1 
ATOM   1501  C CA    . GLY A 1 186 ? 31.376  30.402  21.388 1.00 28.52 ? 217  GLY A CA    1 
ATOM   1502  C C     . GLY A 1 186 ? 31.014  30.105  22.830 1.00 27.42 ? 217  GLY A C     1 
ATOM   1503  O O     . GLY A 1 186 ? 31.701  30.511  23.764 1.00 26.47 ? 217  GLY A O     1 
ATOM   1504  N N     . PRO A 1 187 ? 29.917  29.369  23.033 1.00 26.73 ? 218  PRO A N     1 
ATOM   1505  C CA    . PRO A 1 187 ? 29.464  29.035  24.384 1.00 25.72 ? 218  PRO A CA    1 
ATOM   1506  C C     . PRO A 1 187 ? 30.483  28.252  25.227 1.00 24.80 ? 218  PRO A C     1 
ATOM   1507  O O     . PRO A 1 187 ? 30.478  28.349  26.458 1.00 25.11 ? 218  PRO A O     1 
ATOM   1508  C CB    . PRO A 1 187 ? 28.178  28.237  24.136 1.00 25.04 ? 218  PRO A CB    1 
ATOM   1509  C CG    . PRO A 1 187 ? 28.286  27.758  22.743 1.00 23.50 ? 218  PRO A CG    1 
ATOM   1510  C CD    . PRO A 1 187 ? 29.027  28.806  22.002 1.00 24.60 ? 218  PRO A CD    1 
ATOM   1511  N N     . GLY A 1 188 ? 31.357  27.487  24.570 1.00 23.86 ? 219  GLY A N     1 
ATOM   1512  C CA    . GLY A 1 188 ? 32.344  26.706  25.296 1.00 21.98 ? 219  GLY A CA    1 
ATOM   1513  C C     . GLY A 1 188 ? 33.635  27.433  25.608 1.00 21.66 ? 219  GLY A C     1 
ATOM   1514  O O     . GLY A 1 188 ? 34.600  26.803  26.033 1.00 22.65 ? 219  GLY A O     1 
ATOM   1515  N N     . PHE A 1 189 ? 33.656  28.751  25.407 1.00 21.57 ? 220  PHE A N     1 
ATOM   1516  C CA    . PHE A 1 189 ? 34.845  29.575  25.656 1.00 19.59 ? 220  PHE A CA    1 
ATOM   1517  C C     . PHE A 1 189 ? 34.582  30.614  26.721 1.00 20.36 ? 220  PHE A C     1 
ATOM   1518  O O     . PHE A 1 189 ? 33.447  31.080  26.867 1.00 21.96 ? 220  PHE A O     1 
ATOM   1519  C CB    . PHE A 1 189 ? 35.255  30.310  24.383 1.00 20.15 ? 220  PHE A CB    1 
ATOM   1520  C CG    . PHE A 1 189 ? 35.764  29.412  23.309 1.00 20.13 ? 220  PHE A CG    1 
ATOM   1521  C CD1   . PHE A 1 189 ? 34.887  28.841  22.390 1.00 19.40 ? 220  PHE A CD1   1 
ATOM   1522  C CD2   . PHE A 1 189 ? 37.123  29.129  23.219 1.00 20.37 ? 220  PHE A CD2   1 
ATOM   1523  C CE1   . PHE A 1 189 ? 35.343  27.999  21.390 1.00 19.42 ? 220  PHE A CE1   1 
ATOM   1524  C CE2   . PHE A 1 189 ? 37.607  28.286  22.225 1.00 21.58 ? 220  PHE A CE2   1 
ATOM   1525  C CZ    . PHE A 1 189 ? 36.709  27.716  21.303 1.00 21.92 ? 220  PHE A CZ    1 
ATOM   1526  N N     . THR A 1 190 ? 35.628  31.001  27.450 1.00 20.24 ? 221  THR A N     1 
ATOM   1527  C CA    . THR A 1 190 ? 35.489  32.002  28.510 1.00 19.28 ? 221  THR A CA    1 
ATOM   1528  C C     . THR A 1 190 ? 36.537  33.086  28.451 1.00 20.84 ? 221  THR A C     1 
ATOM   1529  O O     . THR A 1 190 ? 37.600  32.898  27.889 1.00 22.31 ? 221  THR A O     1 
ATOM   1530  C CB    . THR A 1 190 ? 35.603  31.376  29.907 1.00 19.02 ? 221  THR A CB    1 
ATOM   1531  O OG1   . THR A 1 190 ? 35.603  32.424  30.883 1.00 17.88 ? 221  THR A OG1   1 
ATOM   1532  C CG2   . THR A 1 190 ? 36.892  30.558  30.033 1.00 14.17 ? 221  THR A CG2   1 
ATOM   1533  N N     . ARG A 1 191 ? 36.253  34.219  29.063 1.00 20.64 ? 222  ARG A N     1 
ATOM   1534  C CA    . ARG A 1 191 ? 37.219  35.296  29.076 1.00 21.71 ? 222  ARG A CA    1 
ATOM   1535  C C     . ARG A 1 191 ? 37.845  35.403  30.457 1.00 21.68 ? 222  ARG A C     1 
ATOM   1536  O O     . ARG A 1 191 ? 38.736  36.212  30.686 1.00 22.51 ? 222  ARG A O     1 
ATOM   1537  C CB    . ARG A 1 191 ? 36.544  36.601  28.702 1.00 24.72 ? 222  ARG A CB    1 
ATOM   1538  C CG    . ARG A 1 191 ? 36.403  36.772  27.210 1.00 28.54 ? 222  ARG A CG    1 
ATOM   1539  C CD    . ARG A 1 191 ? 35.778  38.107  26.887 1.00 34.64 ? 222  ARG A CD    1 
ATOM   1540  N NE    . ARG A 1 191 ? 34.329  38.014  26.970 1.00 40.22 ? 222  ARG A NE    1 
ATOM   1541  C CZ    . ARG A 1 191 ? 33.617  38.379  28.030 1.00 41.82 ? 222  ARG A CZ    1 
ATOM   1542  N NH1   . ARG A 1 191 ? 34.223  38.873  29.107 1.00 42.43 ? 222  ARG A NH1   1 
ATOM   1543  N NH2   . ARG A 1 191 ? 32.296  38.232  28.020 1.00 41.91 ? 222  ARG A NH2   1 
ATOM   1544  N N     . GLY A 1 192 ? 37.355  34.583  31.379 1.00 21.65 ? 223  GLY A N     1 
ATOM   1545  C CA    . GLY A 1 192 ? 37.874  34.580  32.734 1.00 20.83 ? 223  GLY A CA    1 
ATOM   1546  C C     . GLY A 1 192 ? 39.012  33.582  32.824 1.00 21.49 ? 223  GLY A C     1 
ATOM   1547  O O     . GLY A 1 192 ? 38.847  32.445  33.298 1.00 19.94 ? 223  GLY A O     1 
ATOM   1548  N N     . LEU A 1 193 ? 40.180  34.008  32.356 1.00 19.66 ? 224  LEU A N     1 
ATOM   1549  C CA    . LEU A 1 193 ? 41.345  33.147  32.363 1.00 18.40 ? 224  LEU A CA    1 
ATOM   1550  C C     . LEU A 1 193 ? 41.826  32.807  33.758 1.00 18.19 ? 224  LEU A C     1 
ATOM   1551  O O     . LEU A 1 193 ? 42.687  31.950  33.925 1.00 18.34 ? 224  LEU A O     1 
ATOM   1552  C CB    . LEU A 1 193 ? 42.458  33.792  31.552 1.00 17.48 ? 224  LEU A CB    1 
ATOM   1553  C CG    . LEU A 1 193 ? 42.008  34.187  30.138 1.00 17.94 ? 224  LEU A CG    1 
ATOM   1554  C CD1   . LEU A 1 193 ? 43.241  34.495  29.303 1.00 16.39 ? 224  LEU A CD1   1 
ATOM   1555  C CD2   . LEU A 1 193 ? 41.197  33.080  29.500 1.00 15.07 ? 224  LEU A CD2   1 
ATOM   1556  N N     . GLY A 1 194 ? 41.257  33.463  34.762 1.00 17.55 ? 225  GLY A N     1 
ATOM   1557  C CA    . GLY A 1 194 ? 41.647  33.168  36.127 1.00 17.55 ? 225  GLY A CA    1 
ATOM   1558  C C     . GLY A 1 194 ? 40.973  31.898  36.605 1.00 18.57 ? 225  GLY A C     1 
ATOM   1559  O O     . GLY A 1 194 ? 41.431  31.260  37.550 1.00 18.96 ? 225  GLY A O     1 
ATOM   1560  N N     . HIS A 1 195 ? 39.867  31.540  35.948 1.00 19.39 ? 226  HIS A N     1 
ATOM   1561  C CA    . HIS A 1 195 ? 39.094  30.345  36.274 1.00 16.83 ? 226  HIS A CA    1 
ATOM   1562  C C     . HIS A 1 195 ? 38.747  30.194  37.751 1.00 16.78 ? 226  HIS A C     1 
ATOM   1563  O O     . HIS A 1 195 ? 38.865  29.101  38.315 1.00 17.30 ? 226  HIS A O     1 
ATOM   1564  C CB    . HIS A 1 195 ? 39.843  29.108  35.788 1.00 16.65 ? 226  HIS A CB    1 
ATOM   1565  C CG    . HIS A 1 195 ? 39.799  28.934  34.300 1.00 17.02 ? 226  HIS A CG    1 
ATOM   1566  N ND1   . HIS A 1 195 ? 38.898  28.105  33.670 1.00 17.56 ? 226  HIS A ND1   1 
ATOM   1567  C CD2   . HIS A 1 195 ? 40.532  29.510  33.320 1.00 16.83 ? 226  HIS A CD2   1 
ATOM   1568  C CE1   . HIS A 1 195 ? 39.076  28.170  32.363 1.00 17.92 ? 226  HIS A CE1   1 
ATOM   1569  N NE2   . HIS A 1 195 ? 40.064  29.018  32.122 1.00 16.90 ? 226  HIS A NE2   1 
ATOM   1570  N N     . GLY A 1 196 ? 38.291  31.279  38.372 1.00 15.54 ? 227  GLY A N     1 
ATOM   1571  C CA    . GLY A 1 196 ? 37.938  31.207  39.779 1.00 15.47 ? 227  GLY A CA    1 
ATOM   1572  C C     . GLY A 1 196 ? 37.663  32.545  40.448 1.00 15.74 ? 227  GLY A C     1 
ATOM   1573  O O     . GLY A 1 196 ? 37.461  33.582  39.796 1.00 15.95 ? 227  GLY A O     1 
ATOM   1574  N N     . VAL A 1 197 ? 37.659  32.513  41.774 1.00 14.90 ? 228  VAL A N     1 
ATOM   1575  C CA    . VAL A 1 197 ? 37.400  33.690  42.575 1.00 14.09 ? 228  VAL A CA    1 
ATOM   1576  C C     . VAL A 1 197 ? 38.651  34.568  42.664 1.00 15.78 ? 228  VAL A C     1 
ATOM   1577  O O     . VAL A 1 197 ? 39.397  34.497  43.643 1.00 14.77 ? 228  VAL A O     1 
ATOM   1578  C CB    . VAL A 1 197 ? 36.963  33.266  43.995 1.00 13.57 ? 228  VAL A CB    1 
ATOM   1579  C CG1   . VAL A 1 197 ? 36.529  34.483  44.806 1.00 12.89 ? 228  VAL A CG1   1 
ATOM   1580  C CG2   . VAL A 1 197 ? 35.830  32.230  43.902 1.00 10.17 ? 228  VAL A CG2   1 
ATOM   1581  N N     . ASP A 1 198 ? 38.888  35.385  41.637 1.00 15.48 ? 229  ASP A N     1 
ATOM   1582  C CA    . ASP A 1 198 ? 40.041  36.277  41.656 1.00 16.78 ? 229  ASP A CA    1 
ATOM   1583  C C     . ASP A 1 198 ? 39.590  37.718  41.813 1.00 16.94 ? 229  ASP A C     1 
ATOM   1584  O O     . ASP A 1 198 ? 40.410  38.623  41.920 1.00 17.35 ? 229  ASP A O     1 
ATOM   1585  C CB    . ASP A 1 198 ? 40.869  36.137  40.378 1.00 18.27 ? 229  ASP A CB    1 
ATOM   1586  C CG    . ASP A 1 198 ? 40.064  36.397  39.121 1.00 20.12 ? 229  ASP A CG    1 
ATOM   1587  O OD1   . ASP A 1 198 ? 38.918  36.885  39.239 1.00 22.37 ? 229  ASP A OD1   1 
ATOM   1588  O OD2   . ASP A 1 198 ? 40.593  36.112  38.019 1.00 18.08 ? 229  ASP A OD2   1 
ATOM   1589  N N     . LEU A 1 199 ? 38.275  37.909  41.840 1.00 16.99 ? 230  LEU A N     1 
ATOM   1590  C CA    . LEU A 1 199 ? 37.671  39.219  42.001 1.00 16.00 ? 230  LEU A CA    1 
ATOM   1591  C C     . LEU A 1 199 ? 37.981  40.174  40.864 1.00 16.54 ? 230  LEU A C     1 
ATOM   1592  O O     . LEU A 1 199 ? 38.107  41.375  41.075 1.00 17.25 ? 230  LEU A O     1 
ATOM   1593  C CB    . LEU A 1 199 ? 38.109  39.840  43.323 1.00 16.06 ? 230  LEU A CB    1 
ATOM   1594  C CG    . LEU A 1 199 ? 37.665  39.191  44.645 1.00 16.08 ? 230  LEU A CG    1 
ATOM   1595  C CD1   . LEU A 1 199 ? 37.111  40.295  45.514 1.00 17.32 ? 230  LEU A CD1   1 
ATOM   1596  C CD2   . LEU A 1 199 ? 36.625  38.100  44.461 1.00 13.40 ? 230  LEU A CD2   1 
ATOM   1597  N N     . ASN A 1 200 ? 38.083  39.640  39.652 1.00 17.34 ? 231  ASN A N     1 
ATOM   1598  C CA    . ASN A 1 200 ? 38.359  40.457  38.479 1.00 17.15 ? 231  ASN A CA    1 
ATOM   1599  C C     . ASN A 1 200 ? 37.142  41.325  38.141 1.00 18.28 ? 231  ASN A C     1 
ATOM   1600  O O     . ASN A 1 200 ? 37.239  42.288  37.366 1.00 17.06 ? 231  ASN A O     1 
ATOM   1601  C CB    . ASN A 1 200 ? 38.696  39.558  37.286 1.00 17.88 ? 231  ASN A CB    1 
ATOM   1602  C CG    . ASN A 1 200 ? 37.480  38.813  36.748 1.00 18.88 ? 231  ASN A CG    1 
ATOM   1603  O OD1   . ASN A 1 200 ? 36.679  39.370  35.995 1.00 20.59 ? 231  ASN A OD1   1 
ATOM   1604  N ND2   . ASN A 1 200 ? 37.340  37.548  37.130 1.00 17.13 ? 231  ASN A ND2   1 
ATOM   1605  N N     . HIS A 1 201 ? 35.996  40.988  38.730 1.00 17.88 ? 232  HIS A N     1 
ATOM   1606  C CA    . HIS A 1 201 ? 34.784  41.742  38.455 1.00 16.74 ? 232  HIS A CA    1 
ATOM   1607  C C     . HIS A 1 201 ? 34.807  43.029  39.257 1.00 17.22 ? 232  HIS A C     1 
ATOM   1608  O O     . HIS A 1 201 ? 33.947  43.895  39.089 1.00 17.70 ? 232  HIS A O     1 
ATOM   1609  C CB    . HIS A 1 201 ? 33.522  40.889  38.733 1.00 17.88 ? 232  HIS A CB    1 
ATOM   1610  C CG    . HIS A 1 201 ? 33.412  40.366  40.139 1.00 17.21 ? 232  HIS A CG    1 
ATOM   1611  N ND1   . HIS A 1 201 ? 34.487  39.887  40.850 1.00 17.53 ? 232  HIS A ND1   1 
ATOM   1612  C CD2   . HIS A 1 201 ? 32.339  40.254  40.960 1.00 15.94 ? 232  HIS A CD2   1 
ATOM   1613  C CE1   . HIS A 1 201 ? 34.088  39.503  42.051 1.00 17.90 ? 232  HIS A CE1   1 
ATOM   1614  N NE2   . HIS A 1 201 ? 32.789  39.716  42.143 1.00 16.83 ? 232  HIS A NE2   1 
ATOM   1615  N N     . ILE A 1 202 ? 35.815  43.156  40.121 1.00 16.33 ? 233  ILE A N     1 
ATOM   1616  C CA    . ILE A 1 202 ? 35.995  44.358  40.928 1.00 15.86 ? 233  ILE A CA    1 
ATOM   1617  C C     . ILE A 1 202 ? 37.230  45.094  40.417 1.00 17.63 ? 233  ILE A C     1 
ATOM   1618  O O     . ILE A 1 202 ? 37.192  46.296  40.132 1.00 17.56 ? 233  ILE A O     1 
ATOM   1619  C CB    . ILE A 1 202 ? 36.235  44.039  42.429 1.00 16.49 ? 233  ILE A CB    1 
ATOM   1620  C CG1   . ILE A 1 202 ? 34.956  43.551  43.083 1.00 16.24 ? 233  ILE A CG1   1 
ATOM   1621  C CG2   . ILE A 1 202 ? 36.657  45.298  43.180 1.00 16.14 ? 233  ILE A CG2   1 
ATOM   1622  C CD1   . ILE A 1 202 ? 35.180  43.071  44.475 1.00 17.30 ? 233  ILE A CD1   1 
ATOM   1623  N N     . TYR A 1 203 ? 38.315  44.340  40.274 1.00 18.17 ? 234  TYR A N     1 
ATOM   1624  C CA    . TYR A 1 203 ? 39.604  44.868  39.835 1.00 18.50 ? 234  TYR A CA    1 
ATOM   1625  C C     . TYR A 1 203 ? 39.925  44.847  38.329 1.00 20.15 ? 234  TYR A C     1 
ATOM   1626  O O     . TYR A 1 203 ? 40.872  45.500  37.894 1.00 19.48 ? 234  TYR A O     1 
ATOM   1627  C CB    . TYR A 1 203 ? 40.710  44.123  40.589 1.00 17.56 ? 234  TYR A CB    1 
ATOM   1628  C CG    . TYR A 1 203 ? 40.518  44.131  42.087 1.00 16.14 ? 234  TYR A CG    1 
ATOM   1629  C CD1   . TYR A 1 203 ? 40.706  45.297  42.825 1.00 16.23 ? 234  TYR A CD1   1 
ATOM   1630  C CD2   . TYR A 1 203 ? 40.140  42.976  42.767 1.00 15.47 ? 234  TYR A CD2   1 
ATOM   1631  C CE1   . TYR A 1 203 ? 40.521  45.312  44.215 1.00 16.60 ? 234  TYR A CE1   1 
ATOM   1632  C CE2   . TYR A 1 203 ? 39.952  42.978  44.158 1.00 15.58 ? 234  TYR A CE2   1 
ATOM   1633  C CZ    . TYR A 1 203 ? 40.147  44.147  44.872 1.00 15.38 ? 234  TYR A CZ    1 
ATOM   1634  O OH    . TYR A 1 203 ? 40.007  44.150  46.239 1.00 16.84 ? 234  TYR A OH    1 
ATOM   1635  N N     . GLY A 1 204 ? 39.173  44.091  37.536 1.00 20.66 ? 235  GLY A N     1 
ATOM   1636  C CA    . GLY A 1 204 ? 39.449  44.039  36.108 1.00 21.47 ? 235  GLY A CA    1 
ATOM   1637  C C     . GLY A 1 204 ? 40.265  42.812  35.762 1.00 22.49 ? 235  GLY A C     1 
ATOM   1638  O O     . GLY A 1 204 ? 41.066  42.370  36.583 1.00 22.61 ? 235  GLY A O     1 
ATOM   1639  N N     . GLU A 1 205 ? 40.058  42.271  34.558 1.00 22.35 ? 236  GLU A N     1 
ATOM   1640  C CA    . GLU A 1 205 ? 40.764  41.079  34.077 1.00 25.10 ? 236  GLU A CA    1 
ATOM   1641  C C     . GLU A 1 205 ? 42.216  41.359  33.756 1.00 25.21 ? 236  GLU A C     1 
ATOM   1642  O O     . GLU A 1 205 ? 43.057  40.489  33.893 1.00 26.74 ? 236  GLU A O     1 
ATOM   1643  C CB    . GLU A 1 205 ? 40.140  40.562  32.778 1.00 24.18 ? 236  GLU A CB    1 
ATOM   1644  C CG    . GLU A 1 205 ? 39.214  39.366  32.894 1.00 26.40 ? 236  GLU A CG    1 
ATOM   1645  C CD    . GLU A 1 205 ? 39.912  38.056  33.214 1.00 25.79 ? 236  GLU A CD    1 
ATOM   1646  O OE1   . GLU A 1 205 ? 41.025  37.805  32.729 1.00 27.45 ? 236  GLU A OE1   1 
ATOM   1647  O OE2   . GLU A 1 205 ? 39.331  37.258  33.963 1.00 28.28 ? 236  GLU A OE2   1 
ATOM   1648  N N     . THR A 1 206 ? 42.493  42.573  33.289 1.00 25.61 ? 237  THR A N     1 
ATOM   1649  C CA    . THR A 1 206 ? 43.833  42.959  32.888 1.00 25.80 ? 237  THR A CA    1 
ATOM   1650  C C     . THR A 1 206 ? 44.428  44.050  33.749 1.00 26.79 ? 237  THR A C     1 
ATOM   1651  O O     . THR A 1 206 ? 43.709  44.869  34.325 1.00 28.24 ? 237  THR A O     1 
ATOM   1652  C CB    . THR A 1 206 ? 43.832  43.464  31.448 1.00 24.40 ? 237  THR A CB    1 
ATOM   1653  O OG1   . THR A 1 206 ? 43.125  44.710  31.377 1.00 23.43 ? 237  THR A OG1   1 
ATOM   1654  C CG2   . THR A 1 206 ? 43.164  42.466  30.550 1.00 23.60 ? 237  THR A CG2   1 
ATOM   1655  N N     . LEU A 1 207 ? 45.756  44.053  33.814 1.00 28.13 ? 238  LEU A N     1 
ATOM   1656  C CA    . LEU A 1 207 ? 46.503  45.029  34.589 1.00 28.46 ? 238  LEU A CA    1 
ATOM   1657  C C     . LEU A 1 207 ? 46.128  46.407  34.073 1.00 29.30 ? 238  LEU A C     1 
ATOM   1658  O O     . LEU A 1 207 ? 46.049  47.373  34.825 1.00 30.30 ? 238  LEU A O     1 
ATOM   1659  C CB    . LEU A 1 207 ? 48.001  44.788  34.396 1.00 26.79 ? 238  LEU A CB    1 
ATOM   1660  C CG    . LEU A 1 207 ? 48.929  44.914  35.595 1.00 27.22 ? 238  LEU A CG    1 
ATOM   1661  C CD1   . LEU A 1 207 ? 50.173  45.682  35.200 1.00 25.98 ? 238  LEU A CD1   1 
ATOM   1662  C CD2   . LEU A 1 207 ? 48.208  45.605  36.721 1.00 27.34 ? 238  LEU A CD2   1 
ATOM   1663  N N     . ASP A 1 208 ? 45.888  46.482  32.774 1.00 30.54 ? 239  ASP A N     1 
ATOM   1664  C CA    . ASP A 1 208 ? 45.536  47.738  32.147 1.00 32.76 ? 239  ASP A CA    1 
ATOM   1665  C C     . ASP A 1 208 ? 44.263  48.322  32.689 1.00 32.09 ? 239  ASP A C     1 
ATOM   1666  O O     . ASP A 1 208 ? 44.188  49.525  32.930 1.00 32.10 ? 239  ASP A O     1 
ATOM   1667  C CB    . ASP A 1 208 ? 45.408  47.560  30.641 1.00 38.37 ? 239  ASP A CB    1 
ATOM   1668  C CG    . ASP A 1 208 ? 46.708  47.864  29.920 1.00 44.03 ? 239  ASP A CG    1 
ATOM   1669  O OD1   . ASP A 1 208 ? 47.655  47.041  29.969 1.00 47.48 ? 239  ASP A OD1   1 
ATOM   1670  O OD2   . ASP A 1 208 ? 46.790  48.945  29.304 1.00 47.56 ? 239  ASP A OD2   1 
ATOM   1671  N N     . ARG A 1 209 ? 43.260  47.470  32.868 1.00 31.66 ? 240  ARG A N     1 
ATOM   1672  C CA    . ARG A 1 209 ? 41.963  47.899  33.390 1.00 30.72 ? 240  ARG A CA    1 
ATOM   1673  C C     . ARG A 1 209 ? 42.100  48.272  34.846 1.00 30.07 ? 240  ARG A C     1 
ATOM   1674  O O     . ARG A 1 209 ? 41.591  49.306  35.281 1.00 28.79 ? 240  ARG A O     1 
ATOM   1675  C CB    . ARG A 1 209 ? 40.943  46.771  33.268 1.00 30.60 ? 240  ARG A CB    1 
ATOM   1676  C CG    . ARG A 1 209 ? 39.512  47.230  33.149 1.00 27.30 ? 240  ARG A CG    1 
ATOM   1677  C CD    . ARG A 1 209 ? 38.620  46.055  32.806 1.00 26.16 ? 240  ARG A CD    1 
ATOM   1678  N NE    . ARG A 1 209 ? 37.246  46.329  33.181 1.00 26.25 ? 240  ARG A NE    1 
ATOM   1679  C CZ    . ARG A 1 209 ? 36.420  47.062  32.452 1.00 26.78 ? 240  ARG A CZ    1 
ATOM   1680  N NH1   . ARG A 1 209 ? 36.842  47.585  31.308 1.00 27.68 ? 240  ARG A NH1   1 
ATOM   1681  N NH2   . ARG A 1 209 ? 35.183  47.283  32.870 1.00 26.76 ? 240  ARG A NH2   1 
ATOM   1682  N N     . GLN A 1 210 ? 42.789  47.404  35.584 1.00 29.51 ? 241  GLN A N     1 
ATOM   1683  C CA    . GLN A 1 210 ? 43.025  47.586  37.008 1.00 28.39 ? 241  GLN A CA    1 
ATOM   1684  C C     . GLN A 1 210 ? 43.658  48.931  37.274 1.00 27.76 ? 241  GLN A C     1 
ATOM   1685  O O     . GLN A 1 210 ? 43.241  49.674  38.156 1.00 29.64 ? 241  GLN A O     1 
ATOM   1686  C CB    . GLN A 1 210 ? 43.958  46.501  37.527 1.00 28.15 ? 241  GLN A CB    1 
ATOM   1687  C CG    . GLN A 1 210 ? 44.328  46.685  38.989 1.00 29.22 ? 241  GLN A CG    1 
ATOM   1688  C CD    . GLN A 1 210 ? 45.626  45.996  39.357 1.00 30.48 ? 241  GLN A CD    1 
ATOM   1689  O OE1   . GLN A 1 210 ? 46.628  46.650  39.665 1.00 32.87 ? 241  GLN A OE1   1 
ATOM   1690  N NE2   . GLN A 1 210 ? 45.618  44.669  39.323 1.00 29.49 ? 241  GLN A NE2   1 
ATOM   1691  N N     . HIS A 1 211 ? 44.678  49.247  36.500 1.00 27.82 ? 242  HIS A N     1 
ATOM   1692  C CA    . HIS A 1 211 ? 45.372  50.498  36.687 1.00 26.93 ? 242  HIS A CA    1 
ATOM   1693  C C     . HIS A 1 211 ? 44.461  51.700  36.500 1.00 25.17 ? 242  HIS A C     1 
ATOM   1694  O O     . HIS A 1 211 ? 44.572  52.676  37.236 1.00 25.89 ? 242  HIS A O     1 
ATOM   1695  C CB    . HIS A 1 211 ? 46.591  50.543  35.759 1.00 27.81 ? 242  HIS A CB    1 
ATOM   1696  C CG    . HIS A 1 211 ? 47.798  49.859  36.328 1.00 28.51 ? 242  HIS A CG    1 
ATOM   1697  N ND1   . HIS A 1 211 ? 47.776  49.201  37.547 1.00 28.45 ? 242  HIS A ND1   1 
ATOM   1698  C CD2   . HIS A 1 211 ? 49.071  49.753  35.875 1.00 28.16 ? 242  HIS A CD2   1 
ATOM   1699  C CE1   . HIS A 1 211 ? 48.982  48.727  37.816 1.00 28.71 ? 242  HIS A CE1   1 
ATOM   1700  N NE2   . HIS A 1 211 ? 49.781  49.049  36.819 1.00 29.32 ? 242  HIS A NE2   1 
ATOM   1701  N N     . LYS A 1 212 ? 43.543  51.618  35.544 1.00 25.53 ? 243  LYS A N     1 
ATOM   1702  C CA    . LYS A 1 212 ? 42.600  52.709  35.289 1.00 24.54 ? 243  LYS A CA    1 
ATOM   1703  C C     . LYS A 1 212 ? 41.577  52.881  36.409 1.00 23.24 ? 243  LYS A C     1 
ATOM   1704  O O     . LYS A 1 212 ? 40.998  53.956  36.563 1.00 23.59 ? 243  LYS A O     1 
ATOM   1705  C CB    . LYS A 1 212 ? 41.838  52.468  33.991 1.00 24.85 ? 243  LYS A CB    1 
ATOM   1706  C CG    . LYS A 1 212 ? 42.610  52.791  32.749 1.00 25.55 ? 243  LYS A CG    1 
ATOM   1707  C CD    . LYS A 1 212 ? 42.125  51.914  31.621 1.00 28.04 ? 243  LYS A CD    1 
ATOM   1708  C CE    . LYS A 1 212 ? 42.159  52.627  30.284 1.00 30.11 ? 243  LYS A CE    1 
ATOM   1709  N NZ    . LYS A 1 212 ? 41.617  51.727  29.219 1.00 31.23 ? 243  LYS A NZ    1 
ATOM   1710  N N     . LEU A 1 213 ? 41.347  51.819  37.175 1.00 22.76 ? 244  LEU A N     1 
ATOM   1711  C CA    . LEU A 1 213 ? 40.382  51.860  38.269 1.00 21.64 ? 244  LEU A CA    1 
ATOM   1712  C C     . LEU A 1 213 ? 41.013  52.215  39.599 1.00 20.83 ? 244  LEU A C     1 
ATOM   1713  O O     . LEU A 1 213 ? 40.305  52.544  40.539 1.00 21.27 ? 244  LEU A O     1 
ATOM   1714  C CB    . LEU A 1 213 ? 39.673  50.508  38.392 1.00 21.42 ? 244  LEU A CB    1 
ATOM   1715  C CG    . LEU A 1 213 ? 38.820  50.078  37.187 1.00 20.84 ? 244  LEU A CG    1 
ATOM   1716  C CD1   . LEU A 1 213 ? 38.428  48.621  37.303 1.00 20.19 ? 244  LEU A CD1   1 
ATOM   1717  C CD2   . LEU A 1 213 ? 37.584  50.931  37.124 1.00 18.96 ? 244  LEU A CD2   1 
ATOM   1718  N N     . ARG A 1 214 ? 42.341  52.173  39.671 1.00 20.84 ? 245  ARG A N     1 
ATOM   1719  C CA    . ARG A 1 214 ? 43.055  52.478  40.911 1.00 21.03 ? 245  ARG A CA    1 
ATOM   1720  C C     . ARG A 1 214 ? 43.360  53.952  41.129 1.00 22.01 ? 245  ARG A C     1 
ATOM   1721  O O     . ARG A 1 214 ? 43.568  54.712  40.182 1.00 21.95 ? 245  ARG A O     1 
ATOM   1722  C CB    . ARG A 1 214 ? 44.363  51.700  40.975 1.00 19.55 ? 245  ARG A CB    1 
ATOM   1723  C CG    . ARG A 1 214 ? 44.176  50.255  41.308 1.00 19.70 ? 245  ARG A CG    1 
ATOM   1724  C CD    . ARG A 1 214 ? 45.479  49.504  41.148 1.00 19.34 ? 245  ARG A CD    1 
ATOM   1725  N NE    . ARG A 1 214 ? 46.514  50.041  42.028 1.00 19.13 ? 245  ARG A NE    1 
ATOM   1726  C CZ    . ARG A 1 214 ? 47.733  49.529  42.141 1.00 18.83 ? 245  ARG A CZ    1 
ATOM   1727  N NH1   . ARG A 1 214 ? 48.063  48.467  41.426 1.00 17.36 ? 245  ARG A NH1   1 
ATOM   1728  N NH2   . ARG A 1 214 ? 48.606  50.063  42.979 1.00 18.08 ? 245  ARG A NH2   1 
ATOM   1729  N N     . LEU A 1 215 ? 43.405  54.334  42.398 1.00 21.73 ? 246  LEU A N     1 
ATOM   1730  C CA    . LEU A 1 215 ? 43.676  55.702  42.784 1.00 22.38 ? 246  LEU A CA    1 
ATOM   1731  C C     . LEU A 1 215 ? 45.177  55.954  42.862 1.00 24.28 ? 246  LEU A C     1 
ATOM   1732  O O     . LEU A 1 215 ? 45.640  57.081  42.667 1.00 25.92 ? 246  LEU A O     1 
ATOM   1733  C CB    . LEU A 1 215 ? 43.043  55.966  44.148 1.00 20.82 ? 246  LEU A CB    1 
ATOM   1734  C CG    . LEU A 1 215 ? 43.140  57.378  44.683 1.00 18.07 ? 246  LEU A CG    1 
ATOM   1735  C CD1   . LEU A 1 215 ? 42.480  58.292  43.708 1.00 17.42 ? 246  LEU A CD1   1 
ATOM   1736  C CD2   . LEU A 1 215 ? 42.472  57.459  46.043 1.00 17.70 ? 246  LEU A CD2   1 
ATOM   1737  N N     . PHE A 1 216 ? 45.928  54.892  43.152 1.00 25.17 ? 247  PHE A N     1 
ATOM   1738  C CA    . PHE A 1 216 ? 47.381  54.956  43.318 1.00 26.45 ? 247  PHE A CA    1 
ATOM   1739  C C     . PHE A 1 216 ? 47.772  55.810  44.514 1.00 28.06 ? 247  PHE A C     1 
ATOM   1740  O O     . PHE A 1 216 ? 48.766  56.526  44.491 1.00 28.13 ? 247  PHE A O     1 
ATOM   1741  C CB    . PHE A 1 216 ? 48.056  55.440  42.043 1.00 22.46 ? 247  PHE A CB    1 
ATOM   1742  C CG    . PHE A 1 216 ? 48.116  54.386  40.994 1.00 21.40 ? 247  PHE A CG    1 
ATOM   1743  C CD1   . PHE A 1 216 ? 47.295  54.449  39.881 1.00 21.60 ? 247  PHE A CD1   1 
ATOM   1744  C CD2   . PHE A 1 216 ? 48.933  53.277  41.156 1.00 20.37 ? 247  PHE A CD2   1 
ATOM   1745  C CE1   . PHE A 1 216 ? 47.282  53.418  38.942 1.00 20.62 ? 247  PHE A CE1   1 
ATOM   1746  C CE2   . PHE A 1 216 ? 48.927  52.240  40.222 1.00 21.00 ? 247  PHE A CE2   1 
ATOM   1747  C CZ    . PHE A 1 216 ? 48.101  52.310  39.117 1.00 20.43 ? 247  PHE A CZ    1 
ATOM   1748  N N     . LYS A 1 217 ? 46.955  55.714  45.556 1.00 30.68 ? 248  LYS A N     1 
ATOM   1749  C CA    . LYS A 1 217 ? 47.160  56.412  46.815 1.00 34.36 ? 248  LYS A CA    1 
ATOM   1750  C C     . LYS A 1 217 ? 46.475  55.546  47.864 1.00 33.79 ? 248  LYS A C     1 
ATOM   1751  O O     . LYS A 1 217 ? 45.287  55.254  47.751 1.00 34.09 ? 248  LYS A O     1 
ATOM   1752  C CB    . LYS A 1 217 ? 46.527  57.807  46.777 1.00 39.17 ? 248  LYS A CB    1 
ATOM   1753  C CG    . LYS A 1 217 ? 46.442  58.404  45.374 1.00 44.94 ? 248  LYS A CG    1 
ATOM   1754  C CD    . LYS A 1 217 ? 46.401  59.930  45.396 1.00 49.48 ? 248  LYS A CD    1 
ATOM   1755  C CE    . LYS A 1 217 ? 46.755  60.541  44.036 1.00 50.66 ? 248  LYS A CE    1 
ATOM   1756  N NZ    . LYS A 1 217 ? 46.919  62.035  44.142 1.00 52.48 ? 248  LYS A NZ    1 
ATOM   1757  N N     . ASP A 1 218 ? 47.237  55.112  48.860 1.00 32.97 ? 249  ASP A N     1 
ATOM   1758  C CA    . ASP A 1 218 ? 46.716  54.282  49.936 1.00 32.21 ? 249  ASP A CA    1 
ATOM   1759  C C     . ASP A 1 218 ? 46.198  52.927  49.475 1.00 30.77 ? 249  ASP A C     1 
ATOM   1760  O O     . ASP A 1 218 ? 45.468  52.260  50.200 1.00 29.62 ? 249  ASP A O     1 
ATOM   1761  C CB    . ASP A 1 218 ? 45.619  55.034  50.682 1.00 33.73 ? 249  ASP A CB    1 
ATOM   1762  C CG    . ASP A 1 218 ? 46.134  56.307  51.334 1.00 33.81 ? 249  ASP A CG    1 
ATOM   1763  O OD1   . ASP A 1 218 ? 45.363  57.280  51.473 1.00 35.67 ? 249  ASP A OD1   1 
ATOM   1764  O OD2   . ASP A 1 218 ? 47.324  56.331  51.711 1.00 34.53 ? 249  ASP A OD2   1 
ATOM   1765  N N     . GLY A 1 219 ? 46.593  52.535  48.269 1.00 29.06 ? 250  GLY A N     1 
ATOM   1766  C CA    . GLY A 1 219 ? 46.200  51.254  47.709 1.00 27.29 ? 250  GLY A CA    1 
ATOM   1767  C C     . GLY A 1 219 ? 44.750  51.166  47.291 1.00 26.16 ? 250  GLY A C     1 
ATOM   1768  O O     . GLY A 1 219 ? 44.262  50.096  46.920 1.00 25.62 ? 250  GLY A O     1 
ATOM   1769  N N     . LYS A 1 220 ? 44.071  52.306  47.320 1.00 25.63 ? 251  LYS A N     1 
ATOM   1770  C CA    . LYS A 1 220 ? 42.648  52.374  47.007 1.00 24.30 ? 251  LYS A CA    1 
ATOM   1771  C C     . LYS A 1 220 ? 42.222  52.356  45.545 1.00 24.87 ? 251  LYS A C     1 
ATOM   1772  O O     . LYS A 1 220 ? 43.041  52.461  44.622 1.00 25.06 ? 251  LYS A O     1 
ATOM   1773  C CB    . LYS A 1 220 ? 42.049  53.619  47.666 1.00 22.12 ? 251  LYS A CB    1 
ATOM   1774  C CG    . LYS A 1 220 ? 42.084  53.547  49.165 1.00 24.16 ? 251  LYS A CG    1 
ATOM   1775  C CD    . LYS A 1 220 ? 41.433  54.753  49.821 1.00 22.01 ? 251  LYS A CD    1 
ATOM   1776  C CE    . LYS A 1 220 ? 41.789  54.757  51.301 1.00 23.24 ? 251  LYS A CE    1 
ATOM   1777  N NZ    . LYS A 1 220 ? 40.875  55.622  52.072 1.00 23.89 ? 251  LYS A NZ    1 
ATOM   1778  N N     . LEU A 1 221 ? 40.908  52.230  45.370 1.00 23.81 ? 252  LEU A N     1 
ATOM   1779  C CA    . LEU A 1 221 ? 40.254  52.242  44.072 1.00 22.34 ? 252  LEU A CA    1 
ATOM   1780  C C     . LEU A 1 221 ? 39.673  53.649  43.901 1.00 22.98 ? 252  LEU A C     1 
ATOM   1781  O O     . LEU A 1 221 ? 39.244  54.265  44.879 1.00 22.64 ? 252  LEU A O     1 
ATOM   1782  C CB    . LEU A 1 221 ? 39.099  51.247  44.075 1.00 22.15 ? 252  LEU A CB    1 
ATOM   1783  C CG    . LEU A 1 221 ? 39.175  49.922  43.326 1.00 21.36 ? 252  LEU A CG    1 
ATOM   1784  C CD1   . LEU A 1 221 ? 40.613  49.530  43.117 1.00 21.71 ? 252  LEU A CD1   1 
ATOM   1785  C CD2   . LEU A 1 221 ? 38.431  48.856  44.113 1.00 22.15 ? 252  LEU A CD2   1 
ATOM   1786  N N     . LYS A 1 222 ? 39.655  54.163  42.677 1.00 23.29 ? 253  LYS A N     1 
ATOM   1787  C CA    . LYS A 1 222 ? 39.074  55.479  42.440 1.00 24.40 ? 253  LYS A CA    1 
ATOM   1788  C C     . LYS A 1 222 ? 37.601  55.402  42.779 1.00 24.58 ? 253  LYS A C     1 
ATOM   1789  O O     . LYS A 1 222 ? 37.016  54.322  42.768 1.00 24.28 ? 253  LYS A O     1 
ATOM   1790  C CB    . LYS A 1 222 ? 39.203  55.876  40.976 1.00 24.71 ? 253  LYS A CB    1 
ATOM   1791  C CG    . LYS A 1 222 ? 40.591  56.300  40.586 1.00 28.57 ? 253  LYS A CG    1 
ATOM   1792  C CD    . LYS A 1 222 ? 40.541  57.347  39.512 1.00 30.56 ? 253  LYS A CD    1 
ATOM   1793  C CE    . LYS A 1 222 ? 41.467  57.012  38.368 1.00 31.18 ? 253  LYS A CE    1 
ATOM   1794  N NZ    . LYS A 1 222 ? 41.252  57.971  37.245 1.00 34.55 ? 253  LYS A NZ    1 
ATOM   1795  N N     . TYR A 1 223 ? 36.999  56.550  43.066 1.00 26.30 ? 254  TYR A N     1 
ATOM   1796  C CA    . TYR A 1 223 ? 35.580  56.607  43.392 1.00 27.27 ? 254  TYR A CA    1 
ATOM   1797  C C     . TYR A 1 223 ? 35.132  58.051  43.363 1.00 28.05 ? 254  TYR A C     1 
ATOM   1798  O O     . TYR A 1 223 ? 35.946  58.960  43.448 1.00 29.33 ? 254  TYR A O     1 
ATOM   1799  C CB    . TYR A 1 223 ? 35.336  56.046  44.784 1.00 27.23 ? 254  TYR A CB    1 
ATOM   1800  C CG    . TYR A 1 223 ? 36.009  56.864  45.853 1.00 27.10 ? 254  TYR A CG    1 
ATOM   1801  C CD1   . TYR A 1 223 ? 35.322  57.882  46.520 1.00 27.42 ? 254  TYR A CD1   1 
ATOM   1802  C CD2   . TYR A 1 223 ? 37.354  56.655  46.165 1.00 28.44 ? 254  TYR A CD2   1 
ATOM   1803  C CE1   . TYR A 1 223 ? 35.960  58.672  47.470 1.00 26.88 ? 254  TYR A CE1   1 
ATOM   1804  C CE2   . TYR A 1 223 ? 38.005  57.433  47.109 1.00 26.78 ? 254  TYR A CE2   1 
ATOM   1805  C CZ    . TYR A 1 223 ? 37.305  58.439  47.755 1.00 28.11 ? 254  TYR A CZ    1 
ATOM   1806  O OH    . TYR A 1 223 ? 37.966  59.208  48.683 1.00 27.63 ? 254  TYR A OH    1 
ATOM   1807  N N     . GLN A 1 224 ? 33.834  58.270  43.227 1.00 29.08 ? 255  GLN A N     1 
ATOM   1808  C CA    . GLN A 1 224 ? 33.309  59.620  43.235 1.00 28.83 ? 255  GLN A CA    1 
ATOM   1809  C C     . GLN A 1 224 ? 32.382  59.686  44.423 1.00 29.56 ? 255  GLN A C     1 
ATOM   1810  O O     . GLN A 1 224 ? 31.957  58.660  44.950 1.00 29.67 ? 255  GLN A O     1 
ATOM   1811  C CB    . GLN A 1 224 ? 32.548  59.930  41.945 1.00 28.12 ? 255  GLN A CB    1 
ATOM   1812  C CG    . GLN A 1 224 ? 31.373  59.026  41.662 1.00 30.19 ? 255  GLN A CG    1 
ATOM   1813  C CD    . GLN A 1 224 ? 30.816  59.258  40.291 1.00 31.55 ? 255  GLN A CD    1 
ATOM   1814  O OE1   . GLN A 1 224 ? 30.965  60.345  39.748 1.00 34.53 ? 255  GLN A OE1   1 
ATOM   1815  N NE2   . GLN A 1 224 ? 30.171  58.242  39.714 1.00 32.81 ? 255  GLN A NE2   1 
ATOM   1816  N N     . VAL A 1 225 ? 32.090  60.901  44.869 1.00 30.91 ? 256  VAL A N     1 
ATOM   1817  C CA    . VAL A 1 225 ? 31.201  61.088  45.994 1.00 31.42 ? 256  VAL A CA    1 
ATOM   1818  C C     . VAL A 1 225 ? 30.012  61.899  45.524 1.00 31.55 ? 256  VAL A C     1 
ATOM   1819  O O     . VAL A 1 225 ? 30.134  63.088  45.252 1.00 32.34 ? 256  VAL A O     1 
ATOM   1820  C CB    . VAL A 1 225 ? 31.919  61.807  47.140 1.00 30.48 ? 256  VAL A CB    1 
ATOM   1821  C CG1   . VAL A 1 225 ? 31.010  61.892  48.354 1.00 30.03 ? 256  VAL A CG1   1 
ATOM   1822  C CG2   . VAL A 1 225 ? 33.196  61.055  47.499 1.00 30.33 ? 256  VAL A CG2   1 
ATOM   1823  N N     . ILE A 1 226 ? 28.865  61.240  45.404 1.00 31.50 ? 257  ILE A N     1 
ATOM   1824  C CA    . ILE A 1 226 ? 27.656  61.910  44.970 1.00 32.54 ? 257  ILE A CA    1 
ATOM   1825  C C     . ILE A 1 226 ? 26.727  62.026  46.158 1.00 33.34 ? 257  ILE A C     1 
ATOM   1826  O O     . ILE A 1 226 ? 26.391  61.037  46.809 1.00 32.84 ? 257  ILE A O     1 
ATOM   1827  C CB    . ILE A 1 226 ? 26.936  61.131  43.844 1.00 32.56 ? 257  ILE A CB    1 
ATOM   1828  C CG1   . ILE A 1 226 ? 27.890  60.924  42.676 1.00 32.25 ? 257  ILE A CG1   1 
ATOM   1829  C CG2   . ILE A 1 226 ? 25.705  61.901  43.358 1.00 31.24 ? 257  ILE A CG2   1 
ATOM   1830  C CD1   . ILE A 1 226 ? 27.499  59.778  41.787 1.00 32.99 ? 257  ILE A CD1   1 
ATOM   1831  N N     . GLY A 1 227 ? 26.323  63.247  46.461 1.00 34.79 ? 258  GLY A N     1 
ATOM   1832  C CA    . GLY A 1 227 ? 25.423  63.403  47.567 1.00 35.00 ? 258  GLY A CA    1 
ATOM   1833  C C     . GLY A 1 227 ? 25.973  62.846  48.861 1.00 35.19 ? 258  GLY A C     1 
ATOM   1834  O O     . GLY A 1 227 ? 25.220  62.305  49.681 1.00 35.71 ? 258  GLY A O     1 
ATOM   1835  N N     . GLY A 1 228 ? 27.285  62.977  49.050 1.00 34.97 ? 259  GLY A N     1 
ATOM   1836  C CA    . GLY A 1 228 ? 27.911  62.488  50.264 1.00 34.56 ? 259  GLY A CA    1 
ATOM   1837  C C     . GLY A 1 228 ? 28.121  60.989  50.288 1.00 34.70 ? 259  GLY A C     1 
ATOM   1838  O O     . GLY A 1 228 ? 28.685  60.464  51.241 1.00 34.41 ? 259  GLY A O     1 
ATOM   1839  N N     . GLU A 1 229 ? 27.676  60.288  49.253 1.00 34.91 ? 260  GLU A N     1 
ATOM   1840  C CA    . GLU A 1 229 ? 27.848  58.847  49.231 1.00 32.98 ? 260  GLU A CA    1 
ATOM   1841  C C     . GLU A 1 229 ? 28.907  58.454  48.229 1.00 31.16 ? 260  GLU A C     1 
ATOM   1842  O O     . GLU A 1 229 ? 29.028  59.066  47.172 1.00 31.49 ? 260  GLU A O     1 
ATOM   1843  C CB    . GLU A 1 229 ? 26.532  58.180  48.900 1.00 34.91 ? 260  GLU A CB    1 
ATOM   1844  C CG    . GLU A 1 229 ? 25.599  58.137  50.076 1.00 37.81 ? 260  GLU A CG    1 
ATOM   1845  C CD    . GLU A 1 229 ? 24.233  57.630  49.683 1.00 41.60 ? 260  GLU A CD    1 
ATOM   1846  O OE1   . GLU A 1 229 ? 24.136  56.836  48.708 1.00 41.52 ? 260  GLU A OE1   1 
ATOM   1847  O OE2   . GLU A 1 229 ? 23.253  58.028  50.352 1.00 43.63 ? 260  GLU A OE2   1 
ATOM   1848  N N     . VAL A 1 230 ? 29.671  57.422  48.571 1.00 28.83 ? 261  VAL A N     1 
ATOM   1849  C CA    . VAL A 1 230 ? 30.745  56.948  47.722 1.00 26.27 ? 261  VAL A CA    1 
ATOM   1850  C C     . VAL A 1 230 ? 30.256  56.003  46.647 1.00 24.78 ? 261  VAL A C     1 
ATOM   1851  O O     . VAL A 1 230 ? 29.641  54.990  46.949 1.00 24.81 ? 261  VAL A O     1 
ATOM   1852  C CB    . VAL A 1 230 ? 31.812  56.245  48.566 1.00 24.94 ? 261  VAL A CB    1 
ATOM   1853  C CG1   . VAL A 1 230 ? 32.750  55.431  47.685 1.00 23.45 ? 261  VAL A CG1   1 
ATOM   1854  C CG2   . VAL A 1 230 ? 32.586  57.282  49.326 1.00 24.31 ? 261  VAL A CG2   1 
ATOM   1855  N N     . TYR A 1 231 ? 30.532  56.346  45.391 1.00 23.68 ? 262  TYR A N     1 
ATOM   1856  C CA    . TYR A 1 231 ? 30.138  55.526  44.257 1.00 22.59 ? 262  TYR A CA    1 
ATOM   1857  C C     . TYR A 1 231 ? 31.347  55.322  43.366 1.00 21.96 ? 262  TYR A C     1 
ATOM   1858  O O     . TYR A 1 231 ? 32.377  55.975  43.538 1.00 20.62 ? 262  TYR A O     1 
ATOM   1859  C CB    . TYR A 1 231 ? 29.024  56.214  43.470 1.00 24.25 ? 262  TYR A CB    1 
ATOM   1860  C CG    . TYR A 1 231 ? 27.680  56.096  44.144 1.00 25.15 ? 262  TYR A CG    1 
ATOM   1861  C CD1   . TYR A 1 231 ? 27.227  57.086  45.004 1.00 26.05 ? 262  TYR A CD1   1 
ATOM   1862  C CD2   . TYR A 1 231 ? 26.893  54.962  43.977 1.00 24.32 ? 262  TYR A CD2   1 
ATOM   1863  C CE1   . TYR A 1 231 ? 26.030  56.944  45.692 1.00 25.50 ? 262  TYR A CE1   1 
ATOM   1864  C CE2   . TYR A 1 231 ? 25.693  54.813  44.658 1.00 25.22 ? 262  TYR A CE2   1 
ATOM   1865  C CZ    . TYR A 1 231 ? 25.273  55.804  45.517 1.00 25.63 ? 262  TYR A CZ    1 
ATOM   1866  O OH    . TYR A 1 231 ? 24.109  55.651  46.228 1.00 27.93 ? 262  TYR A OH    1 
ATOM   1867  N N     . PRO A 1 232 ? 31.246  54.395  42.409 1.00 21.42 ? 263  PRO A N     1 
ATOM   1868  C CA    . PRO A 1 232 ? 32.376  54.153  41.514 1.00 22.16 ? 263  PRO A CA    1 
ATOM   1869  C C     . PRO A 1 232 ? 32.604  55.351  40.622 1.00 21.97 ? 263  PRO A C     1 
ATOM   1870  O O     . PRO A 1 232 ? 31.711  56.189  40.472 1.00 23.37 ? 263  PRO A O     1 
ATOM   1871  C CB    . PRO A 1 232 ? 31.946  52.927  40.704 1.00 22.63 ? 263  PRO A CB    1 
ATOM   1872  C CG    . PRO A 1 232 ? 30.791  52.349  41.455 1.00 21.78 ? 263  PRO A CG    1 
ATOM   1873  C CD    . PRO A 1 232 ? 30.117  53.506  42.108 1.00 21.71 ? 263  PRO A CD    1 
ATOM   1874  N N     . PRO A 1 233 ? 33.801  55.449  40.008 1.00 21.76 ? 264  PRO A N     1 
ATOM   1875  C CA    . PRO A 1 233 ? 34.094  56.576  39.120 1.00 21.33 ? 264  PRO A CA    1 
ATOM   1876  C C     . PRO A 1 233 ? 33.350  56.334  37.805 1.00 21.86 ? 264  PRO A C     1 
ATOM   1877  O O     . PRO A 1 233 ? 32.766  55.272  37.609 1.00 22.60 ? 264  PRO A O     1 
ATOM   1878  C CB    . PRO A 1 233 ? 35.609  56.509  38.951 1.00 21.21 ? 264  PRO A CB    1 
ATOM   1879  C CG    . PRO A 1 233 ? 35.902  55.067  39.037 1.00 19.91 ? 264  PRO A CG    1 
ATOM   1880  C CD    . PRO A 1 233 ? 34.934  54.509  40.065 1.00 21.29 ? 264  PRO A CD    1 
ATOM   1881  N N     . THR A 1 234 ? 33.372  57.296  36.894 1.00 22.39 ? 265  THR A N     1 
ATOM   1882  C CA    . THR A 1 234 ? 32.650  57.109  35.641 1.00 21.78 ? 265  THR A CA    1 
ATOM   1883  C C     . THR A 1 234 ? 33.553  56.682  34.504 1.00 23.84 ? 265  THR A C     1 
ATOM   1884  O O     . THR A 1 234 ? 34.775  56.707  34.612 1.00 23.12 ? 265  THR A O     1 
ATOM   1885  C CB    . THR A 1 234 ? 31.916  58.390  35.233 1.00 23.69 ? 265  THR A CB    1 
ATOM   1886  O OG1   . THR A 1 234 ? 32.869  59.442  35.027 1.00 23.40 ? 265  THR A OG1   1 
ATOM   1887  C CG2   . THR A 1 234 ? 30.927  58.797  36.325 1.00 21.83 ? 265  THR A CG2   1 
ATOM   1888  N N     . VAL A 1 235 ? 32.942  56.289  33.403 1.00 24.21 ? 266  VAL A N     1 
ATOM   1889  C CA    . VAL A 1 235 ? 33.707  55.867  32.254 1.00 25.34 ? 266  VAL A CA    1 
ATOM   1890  C C     . VAL A 1 235 ? 34.494  57.039  31.712 1.00 27.48 ? 266  VAL A C     1 
ATOM   1891  O O     . VAL A 1 235 ? 35.548  56.868  31.136 1.00 29.39 ? 266  VAL A O     1 
ATOM   1892  C CB    . VAL A 1 235 ? 32.795  55.347  31.147 1.00 24.41 ? 266  VAL A CB    1 
ATOM   1893  C CG1   . VAL A 1 235 ? 33.508  55.451  29.818 1.00 22.52 ? 266  VAL A CG1   1 
ATOM   1894  C CG2   . VAL A 1 235 ? 32.389  53.906  31.439 1.00 23.04 ? 266  VAL A CG2   1 
ATOM   1895  N N     . LYS A 1 236 ? 33.977  58.240  31.897 1.00 30.44 ? 267  LYS A N     1 
ATOM   1896  C CA    . LYS A 1 236 ? 34.647  59.422  31.395 1.00 31.52 ? 267  LYS A CA    1 
ATOM   1897  C C     . LYS A 1 236 ? 35.872  59.715  32.225 1.00 31.49 ? 267  LYS A C     1 
ATOM   1898  O O     . LYS A 1 236 ? 36.935  60.015  31.694 1.00 32.03 ? 267  LYS A O     1 
ATOM   1899  C CB    . LYS A 1 236 ? 33.699  60.618  31.432 1.00 35.10 ? 267  LYS A CB    1 
ATOM   1900  C CG    . LYS A 1 236 ? 34.371  61.929  31.106 1.00 39.61 ? 267  LYS A CG    1 
ATOM   1901  C CD    . LYS A 1 236 ? 33.568  62.708  30.095 1.00 43.62 ? 267  LYS A CD    1 
ATOM   1902  C CE    . LYS A 1 236 ? 34.209  64.059  29.809 1.00 45.40 ? 267  LYS A CE    1 
ATOM   1903  N NZ    . LYS A 1 236 ? 33.202  65.179  29.861 1.00 49.88 ? 267  LYS A NZ    1 
ATOM   1904  N N     . ASP A 1 237 ? 35.718  59.623  33.537 1.00 31.43 ? 268  ASP A N     1 
ATOM   1905  C CA    . ASP A 1 237 ? 36.815  59.889  34.455 1.00 31.40 ? 268  ASP A CA    1 
ATOM   1906  C C     . ASP A 1 237 ? 37.952  58.876  34.344 1.00 31.05 ? 268  ASP A C     1 
ATOM   1907  O O     . ASP A 1 237 ? 39.118  59.224  34.466 1.00 31.53 ? 268  ASP A O     1 
ATOM   1908  C CB    . ASP A 1 237 ? 36.327  59.864  35.914 1.00 33.23 ? 268  ASP A CB    1 
ATOM   1909  C CG    . ASP A 1 237 ? 35.224  60.875  36.202 1.00 34.39 ? 268  ASP A CG    1 
ATOM   1910  O OD1   . ASP A 1 237 ? 35.206  61.956  35.570 1.00 35.46 ? 268  ASP A OD1   1 
ATOM   1911  O OD2   . ASP A 1 237 ? 34.379  60.574  37.078 1.00 34.20 ? 268  ASP A OD2   1 
ATOM   1912  N N     . THR A 1 238 ? 37.613  57.614  34.133 1.00 30.75 ? 269  THR A N     1 
ATOM   1913  C CA    . THR A 1 238 ? 38.623  56.569  34.089 1.00 30.77 ? 269  THR A CA    1 
ATOM   1914  C C     . THR A 1 238 ? 38.963  56.061  32.705 1.00 31.48 ? 269  THR A C     1 
ATOM   1915  O O     . THR A 1 238 ? 40.104  55.711  32.424 1.00 31.11 ? 269  THR A O     1 
ATOM   1916  C CB    . THR A 1 238 ? 38.161  55.365  34.896 1.00 29.32 ? 269  THR A CB    1 
ATOM   1917  O OG1   . THR A 1 238 ? 37.010  54.794  34.259 1.00 29.41 ? 269  THR A OG1   1 
ATOM   1918  C CG2   . THR A 1 238 ? 37.813  55.772  36.315 1.00 27.46 ? 269  THR A CG2   1 
ATOM   1919  N N     . GLN A 1 239 ? 37.949  55.996  31.859 1.00 32.50 ? 270  GLN A N     1 
ATOM   1920  C CA    . GLN A 1 239 ? 38.094  55.499  30.509 1.00 34.27 ? 270  GLN A CA    1 
ATOM   1921  C C     . GLN A 1 239 ? 38.115  53.985  30.469 1.00 33.45 ? 270  GLN A C     1 
ATOM   1922  O O     . GLN A 1 239 ? 38.659  53.393  29.546 1.00 32.97 ? 270  GLN A O     1 
ATOM   1923  C CB    . GLN A 1 239 ? 39.357  56.035  29.869 1.00 36.90 ? 270  GLN A CB    1 
ATOM   1924  C CG    . GLN A 1 239 ? 39.442  57.524  29.911 1.00 42.49 ? 270  GLN A CG    1 
ATOM   1925  C CD    . GLN A 1 239 ? 40.755  58.003  29.368 1.00 47.27 ? 270  GLN A CD    1 
ATOM   1926  O OE1   . GLN A 1 239 ? 41.647  57.201  29.081 1.00 49.81 ? 270  GLN A OE1   1 
ATOM   1927  N NE2   . GLN A 1 239 ? 40.892  59.313  29.218 1.00 49.12 ? 270  GLN A NE2   1 
ATOM   1928  N N     . VAL A 1 240 ? 37.558  53.340  31.481 1.00 32.61 ? 271  VAL A N     1 
ATOM   1929  C CA    . VAL A 1 240 ? 37.514  51.900  31.415 1.00 32.92 ? 271  VAL A CA    1 
ATOM   1930  C C     . VAL A 1 240 ? 36.228  51.631  30.639 1.00 33.33 ? 271  VAL A C     1 
ATOM   1931  O O     . VAL A 1 240 ? 35.199  52.263  30.887 1.00 34.21 ? 271  VAL A O     1 
ATOM   1932  C CB    . VAL A 1 240 ? 37.486  51.228  32.825 1.00 31.43 ? 271  VAL A CB    1 
ATOM   1933  C CG1   . VAL A 1 240 ? 38.298  52.019  33.780 1.00 28.81 ? 271  VAL A CG1   1 
ATOM   1934  C CG2   . VAL A 1 240 ? 36.083  51.076  33.327 1.00 30.91 ? 271  VAL A CG2   1 
ATOM   1935  N N     . GLU A 1 241 ? 36.301  50.726  29.671 1.00 35.06 ? 272  GLU A N     1 
ATOM   1936  C CA    . GLU A 1 241 ? 35.147  50.377  28.854 1.00 36.75 ? 272  GLU A CA    1 
ATOM   1937  C C     . GLU A 1 241 ? 34.058  49.679  29.652 1.00 35.21 ? 272  GLU A C     1 
ATOM   1938  O O     . GLU A 1 241 ? 34.328  48.741  30.400 1.00 36.49 ? 272  GLU A O     1 
ATOM   1939  C CB    . GLU A 1 241 ? 35.578  49.461  27.712 1.00 40.29 ? 272  GLU A CB    1 
ATOM   1940  C CG    . GLU A 1 241 ? 36.676  50.031  26.826 1.00 47.08 ? 272  GLU A CG    1 
ATOM   1941  C CD    . GLU A 1 241 ? 36.570  49.550  25.386 1.00 51.80 ? 272  GLU A CD    1 
ATOM   1942  O OE1   . GLU A 1 241 ? 37.260  48.558  25.029 1.00 54.78 ? 272  GLU A OE1   1 
ATOM   1943  O OE2   . GLU A 1 241 ? 35.793  50.166  24.615 1.00 55.64 ? 272  GLU A OE2   1 
ATOM   1944  N N     . MET A 1 242 ? 32.824  50.139  29.490 1.00 34.71 ? 273  MET A N     1 
ATOM   1945  C CA    . MET A 1 242 ? 31.677  49.547  30.173 1.00 32.60 ? 273  MET A CA    1 
ATOM   1946  C C     . MET A 1 242 ? 30.625  49.333  29.097 1.00 31.41 ? 273  MET A C     1 
ATOM   1947  O O     . MET A 1 242 ? 30.691  49.959  28.042 1.00 31.26 ? 273  MET A O     1 
ATOM   1948  C CB    . MET A 1 242 ? 31.123  50.498  31.236 1.00 30.93 ? 273  MET A CB    1 
ATOM   1949  C CG    . MET A 1 242 ? 31.966  50.630  32.488 1.00 29.41 ? 273  MET A CG    1 
ATOM   1950  S SD    . MET A 1 242 ? 32.197  49.082  33.359 1.00 29.53 ? 273  MET A SD    1 
ATOM   1951  C CE    . MET A 1 242 ? 30.559  48.759  33.938 1.00 28.77 ? 273  MET A CE    1 
ATOM   1952  N N     . ILE A 1 243 ? 29.665  48.451  29.361 1.00 31.83 ? 274  ILE A N     1 
ATOM   1953  C CA    . ILE A 1 243 ? 28.574  48.165  28.419 1.00 31.78 ? 274  ILE A CA    1 
ATOM   1954  C C     . ILE A 1 243 ? 27.351  49.026  28.772 1.00 31.23 ? 274  ILE A C     1 
ATOM   1955  O O     . ILE A 1 243 ? 26.604  48.699  29.686 1.00 30.49 ? 274  ILE A O     1 
ATOM   1956  C CB    . ILE A 1 243 ? 28.160  46.673  28.480 1.00 32.61 ? 274  ILE A CB    1 
ATOM   1957  C CG1   . ILE A 1 243 ? 29.331  45.791  28.057 1.00 32.62 ? 274  ILE A CG1   1 
ATOM   1958  C CG2   . ILE A 1 243 ? 26.948  46.423  27.588 1.00 31.70 ? 274  ILE A CG2   1 
ATOM   1959  C CD1   . ILE A 1 243 ? 29.502  45.682  26.554 1.00 33.34 ? 274  ILE A CD1   1 
ATOM   1960  N N     . TYR A 1 244 ? 27.139  50.116  28.040 1.00 31.53 ? 275  TYR A N     1 
ATOM   1961  C CA    . TYR A 1 244 ? 26.020  51.017  28.322 1.00 32.14 ? 275  TYR A CA    1 
ATOM   1962  C C     . TYR A 1 244 ? 25.270  51.509  27.083 1.00 33.38 ? 275  TYR A C     1 
ATOM   1963  O O     . TYR A 1 244 ? 25.893  51.970  26.124 1.00 32.89 ? 275  TYR A O     1 
ATOM   1964  C CB    . TYR A 1 244 ? 26.525  52.268  29.055 1.00 30.52 ? 275  TYR A CB    1 
ATOM   1965  C CG    . TYR A 1 244 ? 26.764  52.100  30.531 1.00 29.07 ? 275  TYR A CG    1 
ATOM   1966  C CD1   . TYR A 1 244 ? 28.053  52.148  31.056 1.00 28.97 ? 275  TYR A CD1   1 
ATOM   1967  C CD2   . TYR A 1 244 ? 25.704  51.897  31.408 1.00 28.61 ? 275  TYR A CD2   1 
ATOM   1968  C CE1   . TYR A 1 244 ? 28.282  51.997  32.425 1.00 28.15 ? 275  TYR A CE1   1 
ATOM   1969  C CE2   . TYR A 1 244 ? 25.923  51.745  32.775 1.00 28.69 ? 275  TYR A CE2   1 
ATOM   1970  C CZ    . TYR A 1 244 ? 27.208  51.794  33.270 1.00 28.26 ? 275  TYR A CZ    1 
ATOM   1971  O OH    . TYR A 1 244 ? 27.400  51.636  34.618 1.00 29.62 ? 275  TYR A OH    1 
ATOM   1972  N N     . PRO A 1 245 ? 23.924  51.410  27.082 1.00 34.21 ? 276  PRO A N     1 
ATOM   1973  C CA    . PRO A 1 245 ? 23.153  51.890  25.928 1.00 35.14 ? 276  PRO A CA    1 
ATOM   1974  C C     . PRO A 1 245 ? 23.460  53.376  25.656 1.00 36.06 ? 276  PRO A C     1 
ATOM   1975  O O     . PRO A 1 245 ? 23.753  54.152  26.572 1.00 35.06 ? 276  PRO A O     1 
ATOM   1976  C CB    . PRO A 1 245 ? 21.699  51.684  26.346 1.00 35.13 ? 276  PRO A CB    1 
ATOM   1977  C CG    . PRO A 1 245 ? 21.736  51.429  27.815 1.00 33.84 ? 276  PRO A CG    1 
ATOM   1978  C CD    . PRO A 1 245 ? 23.054  50.802  28.101 1.00 34.05 ? 276  PRO A CD    1 
ATOM   1979  N N     . PRO A 1 246 ? 23.361  53.792  24.387 1.00 36.82 ? 277  PRO A N     1 
ATOM   1980  C CA    . PRO A 1 246 ? 23.621  55.154  23.908 1.00 38.01 ? 277  PRO A CA    1 
ATOM   1981  C C     . PRO A 1 246 ? 23.020  56.328  24.684 1.00 38.19 ? 277  PRO A C     1 
ATOM   1982  O O     . PRO A 1 246 ? 23.652  57.381  24.836 1.00 39.31 ? 277  PRO A O     1 
ATOM   1983  C CB    . PRO A 1 246 ? 23.118  55.119  22.471 1.00 37.62 ? 277  PRO A CB    1 
ATOM   1984  C CG    . PRO A 1 246 ? 23.248  53.703  22.072 1.00 38.34 ? 277  PRO A CG    1 
ATOM   1985  C CD    . PRO A 1 246 ? 22.928  52.907  23.293 1.00 37.53 ? 277  PRO A CD    1 
ATOM   1986  N N     . HIS A 1 247 ? 21.803  56.149  25.178 1.00 38.63 ? 278  HIS A N     1 
ATOM   1987  C CA    . HIS A 1 247 ? 21.110  57.215  25.897 1.00 37.78 ? 278  HIS A CA    1 
ATOM   1988  C C     . HIS A 1 247 ? 21.498  57.403  27.355 1.00 37.30 ? 278  HIS A C     1 
ATOM   1989  O O     . HIS A 1 247 ? 20.963  58.290  28.005 1.00 36.81 ? 278  HIS A O     1 
ATOM   1990  C CB    . HIS A 1 247 ? 19.606  56.978  25.827 1.00 38.49 ? 278  HIS A CB    1 
ATOM   1991  C CG    . HIS A 1 247 ? 19.165  55.716  26.507 1.00 39.86 ? 278  HIS A CG    1 
ATOM   1992  N ND1   . HIS A 1 247 ? 19.282  54.474  25.921 1.00 40.07 ? 278  HIS A ND1   1 
ATOM   1993  C CD2   . HIS A 1 247 ? 18.618  55.508  27.728 1.00 39.55 ? 278  HIS A CD2   1 
ATOM   1994  C CE1   . HIS A 1 247 ? 18.826  53.552  26.753 1.00 40.79 ? 278  HIS A CE1   1 
ATOM   1995  N NE2   . HIS A 1 247 ? 18.418  54.154  27.855 1.00 40.58 ? 278  HIS A NE2   1 
ATOM   1996  N N     . ILE A 1 248 ? 22.402  56.579  27.883 1.00 37.97 ? 279  ILE A N     1 
ATOM   1997  C CA    . ILE A 1 248 ? 22.796  56.721  29.284 1.00 38.24 ? 279  ILE A CA    1 
ATOM   1998  C C     . ILE A 1 248 ? 23.759  57.880  29.456 1.00 39.25 ? 279  ILE A C     1 
ATOM   1999  O O     . ILE A 1 248 ? 24.801  57.922  28.812 1.00 40.90 ? 279  ILE A O     1 
ATOM   2000  C CB    . ILE A 1 248 ? 23.426  55.425  29.811 1.00 36.81 ? 279  ILE A CB    1 
ATOM   2001  C CG1   . ILE A 1 248 ? 22.400  54.309  29.663 1.00 35.37 ? 279  ILE A CG1   1 
ATOM   2002  C CG2   . ILE A 1 248 ? 23.860  55.587  31.276 1.00 36.23 ? 279  ILE A CG2   1 
ATOM   2003  C CD1   . ILE A 1 248 ? 22.759  53.060  30.373 1.00 37.25 ? 279  ILE A CD1   1 
ATOM   2004  N N     . PRO A 1 249 ? 23.418  58.839  30.331 1.00 39.07 ? 280  PRO A N     1 
ATOM   2005  C CA    . PRO A 1 249 ? 24.262  60.007  30.579 1.00 40.49 ? 280  PRO A CA    1 
ATOM   2006  C C     . PRO A 1 249 ? 25.629  59.575  31.065 1.00 40.89 ? 280  PRO A C     1 
ATOM   2007  O O     . PRO A 1 249 ? 25.789  58.459  31.562 1.00 41.32 ? 280  PRO A O     1 
ATOM   2008  C CB    . PRO A 1 249 ? 23.499  60.787  31.652 1.00 40.14 ? 280  PRO A CB    1 
ATOM   2009  C CG    . PRO A 1 249 ? 22.648  59.771  32.319 1.00 41.05 ? 280  PRO A CG    1 
ATOM   2010  C CD    . PRO A 1 249 ? 22.223  58.859  31.186 1.00 40.03 ? 280  PRO A CD    1 
ATOM   2011  N N     . GLU A 1 250 ? 26.605  60.468  30.932 1.00 40.39 ? 281  GLU A N     1 
ATOM   2012  C CA    . GLU A 1 250 ? 27.972  60.186  31.345 1.00 39.93 ? 281  GLU A CA    1 
ATOM   2013  C C     . GLU A 1 250 ? 28.077  60.000  32.844 1.00 38.88 ? 281  GLU A C     1 
ATOM   2014  O O     . GLU A 1 250 ? 28.728  59.072  33.319 1.00 39.87 ? 281  GLU A O     1 
ATOM   2015  C CB    . GLU A 1 250 ? 28.893  61.318  30.910 1.00 41.29 ? 281  GLU A CB    1 
ATOM   2016  C CG    . GLU A 1 250 ? 29.304  61.240  29.454 1.00 43.64 ? 281  GLU A CG    1 
ATOM   2017  C CD    . GLU A 1 250 ? 30.250  62.359  29.074 1.00 46.32 ? 281  GLU A CD    1 
ATOM   2018  O OE1   . GLU A 1 250 ? 30.620  63.139  29.979 1.00 48.04 ? 281  GLU A OE1   1 
ATOM   2019  O OE2   . GLU A 1 250 ? 30.622  62.463  27.880 1.00 48.60 ? 281  GLU A OE2   1 
ATOM   2020  N N     . ASN A 1 251 ? 27.420  60.879  33.587 1.00 36.87 ? 282  ASN A N     1 
ATOM   2021  C CA    . ASN A 1 251 ? 27.452  60.813  35.040 1.00 35.05 ? 282  ASN A CA    1 
ATOM   2022  C C     . ASN A 1 251 ? 26.859  59.515  35.578 1.00 33.07 ? 282  ASN A C     1 
ATOM   2023  O O     . ASN A 1 251 ? 26.979  59.213  36.762 1.00 32.34 ? 282  ASN A O     1 
ATOM   2024  C CB    . ASN A 1 251 ? 26.711  62.011  35.635 1.00 37.24 ? 282  ASN A CB    1 
ATOM   2025  C CG    . ASN A 1 251 ? 25.336  62.199  35.031 1.00 38.60 ? 282  ASN A CG    1 
ATOM   2026  O OD1   . ASN A 1 251 ? 25.171  62.183  33.822 1.00 40.94 ? 282  ASN A OD1   1 
ATOM   2027  N ND2   . ASN A 1 251 ? 24.344  62.365  35.874 1.00 41.22 ? 282  ASN A ND2   1 
ATOM   2028  N N     . LEU A 1 252 ? 26.223  58.736  34.717 1.00 30.98 ? 283  LEU A N     1 
ATOM   2029  C CA    . LEU A 1 252 ? 25.653  57.489  35.189 1.00 29.84 ? 283  LEU A CA    1 
ATOM   2030  C C     . LEU A 1 252 ? 26.333  56.251  34.610 1.00 28.81 ? 283  LEU A C     1 
ATOM   2031  O O     . LEU A 1 252 ? 25.879  55.122  34.804 1.00 28.13 ? 283  LEU A O     1 
ATOM   2032  C CB    . LEU A 1 252 ? 24.148  57.481  34.933 1.00 28.77 ? 283  LEU A CB    1 
ATOM   2033  C CG    . LEU A 1 252 ? 23.422  58.422  35.912 1.00 28.35 ? 283  LEU A CG    1 
ATOM   2034  C CD1   . LEU A 1 252 ? 21.989  58.604  35.471 1.00 27.97 ? 283  LEU A CD1   1 
ATOM   2035  C CD2   . LEU A 1 252 ? 23.472  57.859  37.341 1.00 28.05 ? 283  LEU A CD2   1 
ATOM   2036  N N     . GLN A 1 253 ? 27.436  56.474  33.907 1.00 27.78 ? 284  GLN A N     1 
ATOM   2037  C CA    . GLN A 1 253 ? 28.205  55.378  33.345 1.00 28.70 ? 284  GLN A CA    1 
ATOM   2038  C C     . GLN A 1 253 ? 29.351  55.063  34.297 1.00 27.65 ? 284  GLN A C     1 
ATOM   2039  O O     . GLN A 1 253 ? 30.474  55.530  34.127 1.00 27.27 ? 284  GLN A O     1 
ATOM   2040  C CB    . GLN A 1 253 ? 28.750  55.772  31.987 1.00 29.85 ? 284  GLN A CB    1 
ATOM   2041  C CG    . GLN A 1 253 ? 27.700  56.375  31.107 1.00 32.05 ? 284  GLN A CG    1 
ATOM   2042  C CD    . GLN A 1 253 ? 28.206  56.622  29.704 1.00 34.15 ? 284  GLN A CD    1 
ATOM   2043  O OE1   . GLN A 1 253 ? 29.062  55.888  29.204 1.00 34.11 ? 284  GLN A OE1   1 
ATOM   2044  N NE2   . GLN A 1 253 ? 27.677  57.658  29.056 1.00 34.28 ? 284  GLN A NE2   1 
ATOM   2045  N N     . PHE A 1 254 ? 29.054  54.268  35.310 1.00 26.63 ? 285  PHE A N     1 
ATOM   2046  C CA    . PHE A 1 254 ? 30.054  53.905  36.288 1.00 26.50 ? 285  PHE A CA    1 
ATOM   2047  C C     . PHE A 1 254 ? 31.080  52.923  35.734 1.00 26.82 ? 285  PHE A C     1 
ATOM   2048  O O     . PHE A 1 254 ? 30.745  52.057  34.910 1.00 27.05 ? 285  PHE A O     1 
ATOM   2049  C CB    . PHE A 1 254 ? 29.368  53.327  37.520 1.00 27.52 ? 285  PHE A CB    1 
ATOM   2050  C CG    . PHE A 1 254 ? 28.375  54.260  38.145 1.00 28.77 ? 285  PHE A CG    1 
ATOM   2051  C CD1   . PHE A 1 254 ? 27.015  54.091  37.923 1.00 29.93 ? 285  PHE A CD1   1 
ATOM   2052  C CD2   . PHE A 1 254 ? 28.796  55.294  38.975 1.00 30.22 ? 285  PHE A CD2   1 
ATOM   2053  C CE1   . PHE A 1 254 ? 26.084  54.932  38.517 1.00 30.73 ? 285  PHE A CE1   1 
ATOM   2054  C CE2   . PHE A 1 254 ? 27.875  56.145  39.579 1.00 31.88 ? 285  PHE A CE2   1 
ATOM   2055  C CZ    . PHE A 1 254 ? 26.515  55.960  39.349 1.00 31.94 ? 285  PHE A CZ    1 
ATOM   2056  N N     . ALA A 1 255 ? 32.329  53.062  36.189 1.00 24.94 ? 286  ALA A N     1 
ATOM   2057  C CA    . ALA A 1 255 ? 33.412  52.202  35.737 1.00 22.86 ? 286  ALA A CA    1 
ATOM   2058  C C     . ALA A 1 255 ? 33.700  51.206  36.843 1.00 22.43 ? 286  ALA A C     1 
ATOM   2059  O O     . ALA A 1 255 ? 34.057  51.592  37.962 1.00 22.53 ? 286  ALA A O     1 
ATOM   2060  C CB    . ALA A 1 255 ? 34.660  53.037  35.444 1.00 23.73 ? 286  ALA A CB    1 
ATOM   2061  N N     . VAL A 1 256 ? 33.528  49.927  36.539 1.00 20.76 ? 287  VAL A N     1 
ATOM   2062  C CA    . VAL A 1 256 ? 33.812  48.893  37.508 1.00 21.13 ? 287  VAL A CA    1 
ATOM   2063  C C     . VAL A 1 256 ? 34.576  47.756  36.843 1.00 21.41 ? 287  VAL A C     1 
ATOM   2064  O O     . VAL A 1 256 ? 34.742  47.740  35.620 1.00 20.00 ? 287  VAL A O     1 
ATOM   2065  C CB    . VAL A 1 256 ? 32.525  48.362  38.148 1.00 20.81 ? 287  VAL A CB    1 
ATOM   2066  C CG1   . VAL A 1 256 ? 31.890  49.454  38.990 1.00 19.29 ? 287  VAL A CG1   1 
ATOM   2067  C CG2   . VAL A 1 256 ? 31.559  47.883  37.070 1.00 23.34 ? 287  VAL A CG2   1 
ATOM   2068  N N     . GLY A 1 257 ? 35.044  46.812  37.653 1.00 22.68 ? 288  GLY A N     1 
ATOM   2069  C CA    . GLY A 1 257 ? 35.814  45.698  37.124 1.00 25.87 ? 288  GLY A CA    1 
ATOM   2070  C C     . GLY A 1 257 ? 35.149  44.977  35.970 1.00 26.55 ? 288  GLY A C     1 
ATOM   2071  O O     . GLY A 1 257 ? 35.762  44.735  34.928 1.00 27.39 ? 288  GLY A O     1 
ATOM   2072  N N     . GLN A 1 258 ? 33.885  44.623  36.159 1.00 29.35 ? 289  GLN A N     1 
ATOM   2073  C CA    . GLN A 1 258 ? 33.132  43.923  35.128 1.00 30.71 ? 289  GLN A CA    1 
ATOM   2074  C C     . GLN A 1 258 ? 32.296  44.907  34.327 1.00 31.22 ? 289  GLN A C     1 
ATOM   2075  O O     . GLN A 1 258 ? 31.382  45.543  34.846 1.00 30.90 ? 289  GLN A O     1 
ATOM   2076  C CB    . GLN A 1 258 ? 32.252  42.858  35.771 1.00 29.85 ? 289  GLN A CB    1 
ATOM   2077  C CG    . GLN A 1 258 ? 32.584  41.463  35.318 1.00 28.49 ? 289  GLN A CG    1 
ATOM   2078  C CD    . GLN A 1 258 ? 31.827  41.111  34.078 1.00 27.80 ? 289  GLN A CD    1 
ATOM   2079  O OE1   . GLN A 1 258 ? 31.682  41.934  33.181 1.00 29.04 ? 289  GLN A OE1   1 
ATOM   2080  N NE2   . GLN A 1 258 ? 31.323  39.887  34.018 1.00 26.60 ? 289  GLN A NE2   1 
ATOM   2081  N N     . GLU A 1 259 ? 32.628  45.023  33.049 1.00 34.53 ? 290  GLU A N     1 
ATOM   2082  C CA    . GLU A 1 259 ? 31.961  45.955  32.157 1.00 36.35 ? 290  GLU A CA    1 
ATOM   2083  C C     . GLU A 1 259 ? 30.494  45.692  31.890 1.00 34.68 ? 290  GLU A C     1 
ATOM   2084  O O     . GLU A 1 259 ? 29.872  46.425  31.133 1.00 36.24 ? 290  GLU A O     1 
ATOM   2085  C CB    . GLU A 1 259 ? 32.702  46.019  30.822 1.00 40.99 ? 290  GLU A CB    1 
ATOM   2086  C CG    . GLU A 1 259 ? 33.662  44.878  30.580 1.00 46.22 ? 290  GLU A CG    1 
ATOM   2087  C CD    . GLU A 1 259 ? 33.122  43.895  29.568 1.00 50.95 ? 290  GLU A CD    1 
ATOM   2088  O OE1   . GLU A 1 259 ? 33.365  44.092  28.356 1.00 53.68 ? 290  GLU A OE1   1 
ATOM   2089  O OE2   . GLU A 1 259 ? 32.447  42.925  29.981 1.00 53.62 ? 290  GLU A OE2   1 
ATOM   2090  N N     . VAL A 1 260 ? 29.930  44.669  32.513 1.00 33.19 ? 291  VAL A N     1 
ATOM   2091  C CA    . VAL A 1 260 ? 28.524  44.347  32.295 1.00 30.48 ? 291  VAL A CA    1 
ATOM   2092  C C     . VAL A 1 260 ? 27.599  44.717  33.470 1.00 29.32 ? 291  VAL A C     1 
ATOM   2093  O O     . VAL A 1 260 ? 26.368  44.732  33.345 1.00 28.68 ? 291  VAL A O     1 
ATOM   2094  C CB    . VAL A 1 260 ? 28.397  42.843  31.964 1.00 30.55 ? 291  VAL A CB    1 
ATOM   2095  C CG1   . VAL A 1 260 ? 27.984  42.044  33.185 1.00 28.62 ? 291  VAL A CG1   1 
ATOM   2096  C CG2   . VAL A 1 260 ? 27.437  42.668  30.826 1.00 32.29 ? 291  VAL A CG2   1 
ATOM   2097  N N     . PHE A 1 261 ? 28.213  45.049  34.598 1.00 26.73 ? 292  PHE A N     1 
ATOM   2098  C CA    . PHE A 1 261 ? 27.486  45.390  35.803 1.00 25.23 ? 292  PHE A CA    1 
ATOM   2099  C C     . PHE A 1 261 ? 26.617  46.631  35.763 1.00 24.37 ? 292  PHE A C     1 
ATOM   2100  O O     . PHE A 1 261 ? 25.882  46.892  36.700 1.00 24.35 ? 292  PHE A O     1 
ATOM   2101  C CB    . PHE A 1 261 ? 28.461  45.451  36.976 1.00 22.90 ? 292  PHE A CB    1 
ATOM   2102  C CG    . PHE A 1 261 ? 28.928  44.093  37.426 1.00 20.21 ? 292  PHE A CG    1 
ATOM   2103  C CD1   . PHE A 1 261 ? 28.358  42.942  36.891 1.00 19.25 ? 292  PHE A CD1   1 
ATOM   2104  C CD2   . PHE A 1 261 ? 29.919  43.958  38.387 1.00 19.81 ? 292  PHE A CD2   1 
ATOM   2105  C CE1   . PHE A 1 261 ? 28.765  41.680  37.303 1.00 18.69 ? 292  PHE A CE1   1 
ATOM   2106  C CE2   . PHE A 1 261 ? 30.333  42.693  38.807 1.00 19.19 ? 292  PHE A CE2   1 
ATOM   2107  C CZ    . PHE A 1 261 ? 29.753  41.557  38.263 1.00 19.22 ? 292  PHE A CZ    1 
ATOM   2108  N N     . GLY A 1 262 ? 26.680  47.394  34.685 1.00 24.45 ? 293  GLY A N     1 
ATOM   2109  C CA    . GLY A 1 262 ? 25.824  48.561  34.598 1.00 26.22 ? 293  GLY A CA    1 
ATOM   2110  C C     . GLY A 1 262 ? 24.462  48.126  34.061 1.00 28.16 ? 293  GLY A C     1 
ATOM   2111  O O     . GLY A 1 262 ? 23.504  48.888  34.032 1.00 28.94 ? 293  GLY A O     1 
ATOM   2112  N N     . LEU A 1 263 ? 24.369  46.880  33.624 1.00 28.56 ? 294  LEU A N     1 
ATOM   2113  C CA    . LEU A 1 263 ? 23.124  46.352  33.078 1.00 30.24 ? 294  LEU A CA    1 
ATOM   2114  C C     . LEU A 1 263 ? 21.996  46.221  34.105 1.00 29.32 ? 294  LEU A C     1 
ATOM   2115  O O     . LEU A 1 263 ? 20.822  46.216  33.744 1.00 29.23 ? 294  LEU A O     1 
ATOM   2116  C CB    . LEU A 1 263 ? 23.400  44.989  32.426 1.00 31.17 ? 294  LEU A CB    1 
ATOM   2117  C CG    . LEU A 1 263 ? 22.328  43.889  32.442 1.00 32.25 ? 294  LEU A CG    1 
ATOM   2118  C CD1   . LEU A 1 263 ? 21.873  43.610  31.001 1.00 31.79 ? 294  LEU A CD1   1 
ATOM   2119  C CD2   . LEU A 1 263 ? 22.889  42.609  33.074 1.00 33.33 ? 294  LEU A CD2   1 
ATOM   2120  N N     . VAL A 1 264 ? 22.346  46.117  35.380 1.00 28.55 ? 295  VAL A N     1 
ATOM   2121  C CA    . VAL A 1 264 ? 21.338  45.971  36.416 1.00 28.03 ? 295  VAL A CA    1 
ATOM   2122  C C     . VAL A 1 264 ? 21.694  46.766  37.659 1.00 27.59 ? 295  VAL A C     1 
ATOM   2123  O O     . VAL A 1 264 ? 22.812  46.681  38.178 1.00 28.36 ? 295  VAL A O     1 
ATOM   2124  C CB    . VAL A 1 264 ? 21.160  44.506  36.845 1.00 28.59 ? 295  VAL A CB    1 
ATOM   2125  C CG1   . VAL A 1 264 ? 19.706  44.241  37.148 1.00 30.57 ? 295  VAL A CG1   1 
ATOM   2126  C CG2   . VAL A 1 264 ? 21.641  43.585  35.773 1.00 29.82 ? 295  VAL A CG2   1 
ATOM   2127  N N     . PRO A 1 265 ? 20.740  47.546  38.172 1.00 25.45 ? 296  PRO A N     1 
ATOM   2128  C CA    . PRO A 1 265 ? 21.092  48.310  39.363 1.00 23.92 ? 296  PRO A CA    1 
ATOM   2129  C C     . PRO A 1 265 ? 21.414  47.382  40.516 1.00 22.81 ? 296  PRO A C     1 
ATOM   2130  O O     . PRO A 1 265 ? 22.098  47.771  41.460 1.00 22.35 ? 296  PRO A O     1 
ATOM   2131  C CB    . PRO A 1 265 ? 19.854  49.164  39.623 1.00 23.83 ? 296  PRO A CB    1 
ATOM   2132  C CG    . PRO A 1 265 ? 19.107  49.158  38.312 1.00 24.28 ? 296  PRO A CG    1 
ATOM   2133  C CD    . PRO A 1 265 ? 19.360  47.806  37.739 1.00 24.66 ? 296  PRO A CD    1 
ATOM   2134  N N     . GLY A 1 266 ? 20.922  46.155  40.431 1.00 20.97 ? 297  GLY A N     1 
ATOM   2135  C CA    . GLY A 1 266 ? 21.184  45.211  41.496 1.00 21.23 ? 297  GLY A CA    1 
ATOM   2136  C C     . GLY A 1 266 ? 22.649  44.822  41.530 1.00 22.23 ? 297  GLY A C     1 
ATOM   2137  O O     . GLY A 1 266 ? 23.185  44.483  42.584 1.00 22.64 ? 297  GLY A O     1 
ATOM   2138  N N     . LEU A 1 267 ? 23.302  44.878  40.370 1.00 23.10 ? 298  LEU A N     1 
ATOM   2139  C CA    . LEU A 1 267 ? 24.712  44.519  40.244 1.00 22.38 ? 298  LEU A CA    1 
ATOM   2140  C C     . LEU A 1 267 ? 25.610  45.683  40.656 1.00 22.42 ? 298  LEU A C     1 
ATOM   2141  O O     . LEU A 1 267 ? 26.617  45.508  41.350 1.00 23.59 ? 298  LEU A O     1 
ATOM   2142  C CB    . LEU A 1 267 ? 25.005  44.114  38.800 1.00 21.92 ? 298  LEU A CB    1 
ATOM   2143  C CG    . LEU A 1 267 ? 25.058  42.618  38.442 1.00 22.28 ? 298  LEU A CG    1 
ATOM   2144  C CD1   . LEU A 1 267 ? 24.367  41.761  39.499 1.00 22.05 ? 298  LEU A CD1   1 
ATOM   2145  C CD2   . LEU A 1 267 ? 24.421  42.415  37.077 1.00 21.16 ? 298  LEU A CD2   1 
ATOM   2146  N N     . MET A 1 268 ? 25.244  46.876  40.218 1.00 22.57 ? 299  MET A N     1 
ATOM   2147  C CA    . MET A 1 268 ? 26.006  48.066  40.560 1.00 23.08 ? 299  MET A CA    1 
ATOM   2148  C C     . MET A 1 268 ? 26.001  48.308  42.074 1.00 22.31 ? 299  MET A C     1 
ATOM   2149  O O     . MET A 1 268 ? 26.880  48.977  42.612 1.00 22.72 ? 299  MET A O     1 
ATOM   2150  C CB    . MET A 1 268 ? 25.417  49.275  39.833 1.00 24.06 ? 299  MET A CB    1 
ATOM   2151  C CG    . MET A 1 268 ? 26.329  50.492  39.822 1.00 24.60 ? 299  MET A CG    1 
ATOM   2152  S SD    . MET A 1 268 ? 27.944  50.155  39.081 1.00 27.41 ? 299  MET A SD    1 
ATOM   2153  C CE    . MET A 1 268 ? 27.494  49.018  37.774 1.00 25.83 ? 299  MET A CE    1 
ATOM   2154  N N     . MET A 1 269 ? 24.998  47.769  42.754 1.00 21.42 ? 300  MET A N     1 
ATOM   2155  C CA    . MET A 1 269 ? 24.877  47.910  44.200 1.00 21.48 ? 300  MET A CA    1 
ATOM   2156  C C     . MET A 1 269 ? 25.989  47.115  44.889 1.00 21.49 ? 300  MET A C     1 
ATOM   2157  O O     . MET A 1 269 ? 26.632  47.583  45.827 1.00 21.05 ? 300  MET A O     1 
ATOM   2158  C CB    . MET A 1 269 ? 23.509  47.386  44.654 1.00 21.70 ? 300  MET A CB    1 
ATOM   2159  C CG    . MET A 1 269 ? 23.301  47.343  46.161 1.00 22.77 ? 300  MET A CG    1 
ATOM   2160  S SD    . MET A 1 269 ? 22.368  45.893  46.714 1.00 24.38 ? 300  MET A SD    1 
ATOM   2161  C CE    . MET A 1 269 ? 21.324  46.646  47.837 1.00 27.36 ? 300  MET A CE    1 
ATOM   2162  N N     . TYR A 1 270 ? 26.200  45.891  44.431 1.00 20.82 ? 301  TYR A N     1 
ATOM   2163  C CA    . TYR A 1 270 ? 27.240  45.075  45.012 1.00 20.70 ? 301  TYR A CA    1 
ATOM   2164  C C     . TYR A 1 270 ? 28.582  45.645  44.576 1.00 21.77 ? 301  TYR A C     1 
ATOM   2165  O O     . TYR A 1 270 ? 29.529  45.668  45.355 1.00 23.46 ? 301  TYR A O     1 
ATOM   2166  C CB    . TYR A 1 270 ? 27.083  43.624  44.563 1.00 18.96 ? 301  TYR A CB    1 
ATOM   2167  C CG    . TYR A 1 270 ? 26.199  42.814  45.487 1.00 17.13 ? 301  TYR A CG    1 
ATOM   2168  C CD1   . TYR A 1 270 ? 26.526  42.657  46.838 1.00 17.03 ? 301  TYR A CD1   1 
ATOM   2169  C CD2   . TYR A 1 270 ? 25.026  42.223  45.023 1.00 17.31 ? 301  TYR A CD2   1 
ATOM   2170  C CE1   . TYR A 1 270 ? 25.705  41.932  47.710 1.00 16.25 ? 301  TYR A CE1   1 
ATOM   2171  C CE2   . TYR A 1 270 ? 24.192  41.491  45.886 1.00 16.07 ? 301  TYR A CE2   1 
ATOM   2172  C CZ    . TYR A 1 270 ? 24.539  41.348  47.227 1.00 16.93 ? 301  TYR A CZ    1 
ATOM   2173  O OH    . TYR A 1 270 ? 23.725  40.610  48.076 1.00 15.97 ? 301  TYR A OH    1 
ATOM   2174  N N     . ALA A 1 271 ? 28.667  46.122  43.339 1.00 21.69 ? 302  ALA A N     1 
ATOM   2175  C CA    . ALA A 1 271 ? 29.920  46.696  42.864 1.00 22.20 ? 302  ALA A CA    1 
ATOM   2176  C C     . ALA A 1 271 ? 30.353  47.830  43.791 1.00 22.56 ? 302  ALA A C     1 
ATOM   2177  O O     . ALA A 1 271 ? 31.533  47.949  44.124 1.00 25.14 ? 302  ALA A O     1 
ATOM   2178  C CB    . ALA A 1 271 ? 29.769  47.212  41.425 1.00 19.62 ? 302  ALA A CB    1 
ATOM   2179  N N     . THR A 1 272 ? 29.391  48.658  44.197 1.00 22.10 ? 303  THR A N     1 
ATOM   2180  C CA    . THR A 1 272 ? 29.632  49.798  45.085 1.00 20.83 ? 303  THR A CA    1 
ATOM   2181  C C     . THR A 1 272 ? 30.004  49.339  46.491 1.00 21.90 ? 303  THR A C     1 
ATOM   2182  O O     . THR A 1 272 ? 30.849  49.943  47.148 1.00 22.60 ? 303  THR A O     1 
ATOM   2183  C CB    . THR A 1 272 ? 28.372  50.693  45.181 1.00 19.60 ? 303  THR A CB    1 
ATOM   2184  O OG1   . THR A 1 272 ? 28.070  51.224  43.889 1.00 16.36 ? 303  THR A OG1   1 
ATOM   2185  C CG2   . THR A 1 272 ? 28.592  51.842  46.137 1.00 18.77 ? 303  THR A CG2   1 
ATOM   2186  N N     . ILE A 1 273 ? 29.372  48.264  46.950 1.00 21.39 ? 304  ILE A N     1 
ATOM   2187  C CA    . ILE A 1 273 ? 29.637  47.741  48.284 1.00 19.89 ? 304  ILE A CA    1 
ATOM   2188  C C     . ILE A 1 273 ? 31.050  47.189  48.409 1.00 19.87 ? 304  ILE A C     1 
ATOM   2189  O O     . ILE A 1 273 ? 31.743  47.479  49.379 1.00 19.85 ? 304  ILE A O     1 
ATOM   2190  C CB    . ILE A 1 273 ? 28.601  46.654  48.663 1.00 20.32 ? 304  ILE A CB    1 
ATOM   2191  C CG1   . ILE A 1 273 ? 27.259  47.318  48.978 1.00 19.90 ? 304  ILE A CG1   1 
ATOM   2192  C CG2   . ILE A 1 273 ? 29.079  45.860  49.866 1.00 19.96 ? 304  ILE A CG2   1 
ATOM   2193  C CD1   . ILE A 1 273 ? 26.105  46.330  49.141 1.00 19.40 ? 304  ILE A CD1   1 
ATOM   2194  N N     . TRP A 1 274 ? 31.482  46.404  47.427 1.00 19.37 ? 305  TRP A N     1 
ATOM   2195  C CA    . TRP A 1 274 ? 32.826  45.839  47.454 1.00 18.79 ? 305  TRP A CA    1 
ATOM   2196  C C     . TRP A 1 274 ? 33.882  46.921  47.199 1.00 18.86 ? 305  TRP A C     1 
ATOM   2197  O O     . TRP A 1 274 ? 34.967  46.873  47.770 1.00 20.58 ? 305  TRP A O     1 
ATOM   2198  C CB    . TRP A 1 274 ? 32.951  44.703  46.429 1.00 16.96 ? 305  TRP A CB    1 
ATOM   2199  C CG    . TRP A 1 274 ? 32.300  43.408  46.874 1.00 16.61 ? 305  TRP A CG    1 
ATOM   2200  C CD1   . TRP A 1 274 ? 31.151  42.854  46.373 1.00 16.94 ? 305  TRP A CD1   1 
ATOM   2201  C CD2   . TRP A 1 274 ? 32.787  42.481  47.862 1.00 16.14 ? 305  TRP A CD2   1 
ATOM   2202  N NE1   . TRP A 1 274 ? 30.897  41.645  46.981 1.00 16.23 ? 305  TRP A NE1   1 
ATOM   2203  C CE2   . TRP A 1 274 ? 31.882  41.390  47.895 1.00 15.88 ? 305  TRP A CE2   1 
ATOM   2204  C CE3   . TRP A 1 274 ? 33.901  42.465  48.720 1.00 16.25 ? 305  TRP A CE3   1 
ATOM   2205  C CZ2   . TRP A 1 274 ? 32.060  40.292  48.754 1.00 15.62 ? 305  TRP A CZ2   1 
ATOM   2206  C CZ3   . TRP A 1 274 ? 34.078  41.369  49.574 1.00 14.71 ? 305  TRP A CZ3   1 
ATOM   2207  C CH2   . TRP A 1 274 ? 33.160  40.300  49.580 1.00 16.06 ? 305  TRP A CH2   1 
ATOM   2208  N N     . LEU A 1 275 ? 33.585  47.897  46.347 1.00 19.14 ? 306  LEU A N     1 
ATOM   2209  C CA    . LEU A 1 275 ? 34.542  48.980  46.109 1.00 21.01 ? 306  LEU A CA    1 
ATOM   2210  C C     . LEU A 1 275 ? 34.780  49.647  47.465 1.00 21.98 ? 306  LEU A C     1 
ATOM   2211  O O     . LEU A 1 275 ? 35.922  49.928  47.865 1.00 22.47 ? 306  LEU A O     1 
ATOM   2212  C CB    . LEU A 1 275 ? 33.969  50.020  45.140 1.00 22.18 ? 306  LEU A CB    1 
ATOM   2213  C CG    . LEU A 1 275 ? 34.893  51.172  44.712 1.00 22.31 ? 306  LEU A CG    1 
ATOM   2214  C CD1   . LEU A 1 275 ? 34.332  51.838  43.473 1.00 21.90 ? 306  LEU A CD1   1 
ATOM   2215  C CD2   . LEU A 1 275 ? 35.025  52.191  45.818 1.00 23.99 ? 306  LEU A CD2   1 
ATOM   2216  N N     . ARG A 1 276 ? 33.675  49.896  48.164 1.00 22.40 ? 307  ARG A N     1 
ATOM   2217  C CA    . ARG A 1 276 ? 33.711  50.515  49.476 1.00 21.21 ? 307  ARG A CA    1 
ATOM   2218  C C     . ARG A 1 276 ? 34.537  49.651  50.434 1.00 20.96 ? 307  ARG A C     1 
ATOM   2219  O O     . ARG A 1 276 ? 35.423  50.147  51.134 1.00 20.97 ? 307  ARG A O     1 
ATOM   2220  C CB    . ARG A 1 276 ? 32.272  50.704  49.990 1.00 20.39 ? 307  ARG A CB    1 
ATOM   2221  C CG    . ARG A 1 276 ? 31.770  52.114  49.794 1.00 19.68 ? 307  ARG A CG    1 
ATOM   2222  C CD    . ARG A 1 276 ? 30.427  52.195  49.104 1.00 21.74 ? 307  ARG A CD    1 
ATOM   2223  N NE    . ARG A 1 276 ? 29.374  52.496  50.065 1.00 22.97 ? 307  ARG A NE    1 
ATOM   2224  C CZ    . ARG A 1 276 ? 28.401  53.389  49.895 1.00 23.99 ? 307  ARG A CZ    1 
ATOM   2225  N NH1   . ARG A 1 276 ? 28.301  54.108  48.784 1.00 22.05 ? 307  ARG A NH1   1 
ATOM   2226  N NH2   . ARG A 1 276 ? 27.502  53.542  50.852 1.00 26.66 ? 307  ARG A NH2   1 
ATOM   2227  N N     . GLU A 1 277 ? 34.274  48.348  50.431 1.00 21.44 ? 308  GLU A N     1 
ATOM   2228  C CA    . GLU A 1 277 ? 34.982  47.417  51.308 1.00 21.25 ? 308  GLU A CA    1 
ATOM   2229  C C     . GLU A 1 277 ? 36.492  47.388  51.031 1.00 21.31 ? 308  GLU A C     1 
ATOM   2230  O O     . GLU A 1 277 ? 37.281  47.202  51.946 1.00 22.47 ? 308  GLU A O     1 
ATOM   2231  C CB    . GLU A 1 277 ? 34.388  46.015  51.162 1.00 19.88 ? 308  GLU A CB    1 
ATOM   2232  C CG    . GLU A 1 277 ? 35.163  44.917  51.869 1.00 19.50 ? 308  GLU A CG    1 
ATOM   2233  C CD    . GLU A 1 277 ? 35.141  45.053  53.383 1.00 21.93 ? 308  GLU A CD    1 
ATOM   2234  O OE1   . GLU A 1 277 ? 35.784  44.218  54.065 1.00 22.81 ? 308  GLU A OE1   1 
ATOM   2235  O OE2   . GLU A 1 277 ? 34.481  45.989  53.901 1.00 22.78 ? 308  GLU A OE2   1 
ATOM   2236  N N     . HIS A 1 278 ? 36.892  47.576  49.780 1.00 21.78 ? 309  HIS A N     1 
ATOM   2237  C CA    . HIS A 1 278 ? 38.312  47.577  49.435 1.00 22.41 ? 309  HIS A CA    1 
ATOM   2238  C C     . HIS A 1 278 ? 39.010  48.736  50.143 1.00 22.82 ? 309  HIS A C     1 
ATOM   2239  O O     . HIS A 1 278 ? 40.038  48.545  50.798 1.00 22.90 ? 309  HIS A O     1 
ATOM   2240  C CB    . HIS A 1 278 ? 38.491  47.726  47.923 1.00 21.23 ? 309  HIS A CB    1 
ATOM   2241  C CG    . HIS A 1 278 ? 39.921  47.791  47.488 1.00 20.26 ? 309  HIS A CG    1 
ATOM   2242  N ND1   . HIS A 1 278 ? 40.677  46.659  47.250 1.00 20.25 ? 309  HIS A ND1   1 
ATOM   2243  C CD2   . HIS A 1 278 ? 40.744  48.844  47.265 1.00 19.03 ? 309  HIS A CD2   1 
ATOM   2244  C CE1   . HIS A 1 278 ? 41.901  47.017  46.899 1.00 19.57 ? 309  HIS A CE1   1 
ATOM   2245  N NE2   . HIS A 1 278 ? 41.966  48.333  46.903 1.00 19.21 ? 309  HIS A NE2   1 
ATOM   2246  N N     . GLN A 1 279 ? 38.446  49.935  49.984 1.00 22.79 ? 310  GLN A N     1 
ATOM   2247  C CA    . GLN A 1 279 ? 38.953  51.159  50.599 1.00 22.33 ? 310  GLN A CA    1 
ATOM   2248  C C     . GLN A 1 279 ? 39.001  51.035  52.109 1.00 22.84 ? 310  GLN A C     1 
ATOM   2249  O O     . GLN A 1 279 ? 39.931  51.500  52.767 1.00 23.84 ? 310  GLN A O     1 
ATOM   2250  C CB    . GLN A 1 279 ? 38.031  52.304  50.252 1.00 22.68 ? 310  GLN A CB    1 
ATOM   2251  C CG    . GLN A 1 279 ? 38.615  53.264  49.300 1.00 23.96 ? 310  GLN A CG    1 
ATOM   2252  C CD    . GLN A 1 279 ? 38.871  52.639  47.989 1.00 24.24 ? 310  GLN A CD    1 
ATOM   2253  O OE1   . GLN A 1 279 ? 39.575  51.638  47.896 1.00 25.12 ? 310  GLN A OE1   1 
ATOM   2254  N NE2   . GLN A 1 279 ? 38.309  53.224  46.942 1.00 25.98 ? 310  GLN A NE2   1 
ATOM   2255  N N     . ARG A 1 280 ? 37.955  50.435  52.650 1.00 23.47 ? 311  ARG A N     1 
ATOM   2256  C CA    . ARG A 1 280 ? 37.838  50.220  54.075 1.00 23.27 ? 311  ARG A CA    1 
ATOM   2257  C C     . ARG A 1 280 ? 39.055  49.441  54.536 1.00 23.20 ? 311  ARG A C     1 
ATOM   2258  O O     . ARG A 1 280 ? 39.780  49.851  55.438 1.00 24.67 ? 311  ARG A O     1 
ATOM   2259  C CB    . ARG A 1 280 ? 36.577  49.412  54.342 1.00 23.91 ? 311  ARG A CB    1 
ATOM   2260  C CG    . ARG A 1 280 ? 36.022  49.539  55.725 1.00 22.74 ? 311  ARG A CG    1 
ATOM   2261  C CD    . ARG A 1 280 ? 35.122  48.373  56.012 1.00 22.76 ? 311  ARG A CD    1 
ATOM   2262  N NE    . ARG A 1 280 ? 35.627  47.665  57.175 1.00 25.56 ? 311  ARG A NE    1 
ATOM   2263  C CZ    . ARG A 1 280 ? 35.973  46.385  57.181 1.00 27.07 ? 311  ARG A CZ    1 
ATOM   2264  N NH1   . ARG A 1 280 ? 35.869  45.659  56.080 1.00 27.23 ? 311  ARG A NH1   1 
ATOM   2265  N NH2   . ARG A 1 280 ? 36.436  45.837  58.293 1.00 28.67 ? 311  ARG A NH2   1 
ATOM   2266  N N     . VAL A 1 281 ? 39.272  48.304  53.900 1.00 22.81 ? 312  VAL A N     1 
ATOM   2267  C CA    . VAL A 1 281 ? 40.388  47.457  54.246 1.00 22.54 ? 312  VAL A CA    1 
ATOM   2268  C C     . VAL A 1 281 ? 41.695  48.203  54.036 1.00 21.89 ? 312  VAL A C     1 
ATOM   2269  O O     . VAL A 1 281 ? 42.637  48.022  54.799 1.00 22.35 ? 312  VAL A O     1 
ATOM   2270  C CB    . VAL A 1 281 ? 40.366  46.168  53.411 1.00 23.33 ? 312  VAL A CB    1 
ATOM   2271  C CG1   . VAL A 1 281 ? 41.680  45.423  53.564 1.00 22.79 ? 312  VAL A CG1   1 
ATOM   2272  C CG2   . VAL A 1 281 ? 39.196  45.292  53.859 1.00 21.90 ? 312  VAL A CG2   1 
ATOM   2273  N N     . CYS A 1 282 ? 41.753  49.050  53.012 1.00 21.99 ? 313  CYS A N     1 
ATOM   2274  C CA    . CYS A 1 282 ? 42.963  49.832  52.737 1.00 22.27 ? 313  CYS A CA    1 
ATOM   2275  C C     . CYS A 1 282 ? 43.298  50.738  53.924 1.00 23.18 ? 313  CYS A C     1 
ATOM   2276  O O     . CYS A 1 282 ? 44.464  50.875  54.324 1.00 22.17 ? 313  CYS A O     1 
ATOM   2277  C CB    . CYS A 1 282 ? 42.764  50.701  51.499 1.00 22.96 ? 313  CYS A CB    1 
ATOM   2278  S SG    . CYS A 1 282 ? 43.049  49.856  49.945 1.00 25.40 ? 313  CYS A SG    1 
ATOM   2279  N N     . ASP A 1 283 ? 42.261  51.374  54.459 1.00 23.25 ? 314  ASP A N     1 
ATOM   2280  C CA    . ASP A 1 283 ? 42.398  52.259  55.601 1.00 22.74 ? 314  ASP A CA    1 
ATOM   2281  C C     . ASP A 1 283 ? 42.868  51.481  56.820 1.00 22.44 ? 314  ASP A C     1 
ATOM   2282  O O     . ASP A 1 283 ? 43.713  51.948  57.582 1.00 23.32 ? 314  ASP A O     1 
ATOM   2283  C CB    . ASP A 1 283 ? 41.054  52.914  55.904 1.00 24.83 ? 314  ASP A CB    1 
ATOM   2284  C CG    . ASP A 1 283 ? 40.735  54.043  54.957 1.00 24.98 ? 314  ASP A CG    1 
ATOM   2285  O OD1   . ASP A 1 283 ? 41.659  54.505  54.269 1.00 28.04 ? 314  ASP A OD1   1 
ATOM   2286  O OD2   . ASP A 1 283 ? 39.566  54.472  54.895 1.00 27.19 ? 314  ASP A OD2   1 
ATOM   2287  N N     . ILE A 1 284 ? 42.314  50.289  57.006 1.00 22.15 ? 315  ILE A N     1 
ATOM   2288  C CA    . ILE A 1 284 ? 42.689  49.457  58.140 1.00 23.42 ? 315  ILE A CA    1 
ATOM   2289  C C     . ILE A 1 284 ? 44.152  49.028  58.068 1.00 24.05 ? 315  ILE A C     1 
ATOM   2290  O O     . ILE A 1 284 ? 44.868  49.053  59.064 1.00 24.63 ? 315  ILE A O     1 
ATOM   2291  C CB    . ILE A 1 284 ? 41.833  48.195  58.197 1.00 22.03 ? 315  ILE A CB    1 
ATOM   2292  C CG1   . ILE A 1 284 ? 40.412  48.560  58.633 1.00 21.18 ? 315  ILE A CG1   1 
ATOM   2293  C CG2   . ILE A 1 284 ? 42.453  47.183  59.160 1.00 19.60 ? 315  ILE A CG2   1 
ATOM   2294  C CD1   . ILE A 1 284 ? 39.393  47.486  58.309 1.00 20.39 ? 315  ILE A CD1   1 
ATOM   2295  N N     . LEU A 1 285 ? 44.585  48.608  56.888 1.00 24.43 ? 316  LEU A N     1 
ATOM   2296  C CA    . LEU A 1 285 ? 45.957  48.168  56.694 1.00 25.16 ? 316  LEU A CA    1 
ATOM   2297  C C     . LEU A 1 285 ? 46.936  49.337  56.792 1.00 25.99 ? 316  LEU A C     1 
ATOM   2298  O O     . LEU A 1 285 ? 48.045  49.184  57.302 1.00 24.97 ? 316  LEU A O     1 
ATOM   2299  C CB    . LEU A 1 285 ? 46.093  47.509  55.327 1.00 23.14 ? 316  LEU A CB    1 
ATOM   2300  C CG    . LEU A 1 285 ? 45.516  46.110  55.208 1.00 20.66 ? 316  LEU A CG    1 
ATOM   2301  C CD1   . LEU A 1 285 ? 45.690  45.618  53.782 1.00 21.28 ? 316  LEU A CD1   1 
ATOM   2302  C CD2   . LEU A 1 285 ? 46.223  45.187  56.166 1.00 21.50 ? 316  LEU A CD2   1 
ATOM   2303  N N     . LYS A 1 286 ? 46.529  50.496  56.289 1.00 26.79 ? 317  LYS A N     1 
ATOM   2304  C CA    . LYS A 1 286 ? 47.384  51.661  56.339 1.00 29.65 ? 317  LYS A CA    1 
ATOM   2305  C C     . LYS A 1 286 ? 47.672  51.984  57.789 1.00 31.40 ? 317  LYS A C     1 
ATOM   2306  O O     . LYS A 1 286 ? 48.781  52.374  58.156 1.00 31.99 ? 317  LYS A O     1 
ATOM   2307  C CB    . LYS A 1 286 ? 46.704  52.851  55.682 1.00 30.11 ? 317  LYS A CB    1 
ATOM   2308  C CG    . LYS A 1 286 ? 47.502  54.132  55.796 1.00 30.36 ? 317  LYS A CG    1 
ATOM   2309  C CD    . LYS A 1 286 ? 47.169  55.080  54.664 1.00 30.62 ? 317  LYS A CD    1 
ATOM   2310  C CE    . LYS A 1 286 ? 48.260  56.109  54.480 1.00 30.65 ? 317  LYS A CE    1 
ATOM   2311  N NZ    . LYS A 1 286 ? 49.574  55.452  54.217 1.00 33.14 ? 317  LYS A NZ    1 
ATOM   2312  N N     . GLN A 1 287 ? 46.659  51.812  58.619 1.00 33.03 ? 318  GLN A N     1 
ATOM   2313  C CA    . GLN A 1 287 ? 46.800  52.083  60.031 1.00 33.46 ? 318  GLN A CA    1 
ATOM   2314  C C     . GLN A 1 287 ? 47.811  51.142  60.668 1.00 33.66 ? 318  GLN A C     1 
ATOM   2315  O O     . GLN A 1 287 ? 48.604  51.549  61.517 1.00 34.65 ? 318  GLN A O     1 
ATOM   2316  C CB    . GLN A 1 287 ? 45.458  51.917  60.708 1.00 35.60 ? 318  GLN A CB    1 
ATOM   2317  C CG    . GLN A 1 287 ? 45.409  52.507  62.081 1.00 38.67 ? 318  GLN A CG    1 
ATOM   2318  C CD    . GLN A 1 287 ? 43.997  52.621  62.573 1.00 40.80 ? 318  GLN A CD    1 
ATOM   2319  O OE1   . GLN A 1 287 ? 43.114  51.902  62.108 1.00 42.24 ? 318  GLN A OE1   1 
ATOM   2320  N NE2   . GLN A 1 287 ? 43.765  53.527  63.514 1.00 43.47 ? 318  GLN A NE2   1 
ATOM   2321  N N     . GLU A 1 288 ? 47.779  49.883  60.252 1.00 32.61 ? 319  GLU A N     1 
ATOM   2322  C CA    . GLU A 1 288 ? 48.686  48.877  60.784 1.00 31.59 ? 319  GLU A CA    1 
ATOM   2323  C C     . GLU A 1 288 ? 50.076  48.981  60.161 1.00 30.70 ? 319  GLU A C     1 
ATOM   2324  O O     . GLU A 1 288 ? 51.083  48.617  60.777 1.00 30.67 ? 319  GLU A O     1 
ATOM   2325  C CB    . GLU A 1 288 ? 48.139  47.482  60.488 1.00 31.76 ? 319  GLU A CB    1 
ATOM   2326  C CG    . GLU A 1 288 ? 46.843  47.169  61.175 1.00 34.08 ? 319  GLU A CG    1 
ATOM   2327  C CD    . GLU A 1 288 ? 46.971  47.258  62.679 1.00 35.42 ? 319  GLU A CD    1 
ATOM   2328  O OE1   . GLU A 1 288 ? 47.711  46.428  63.266 1.00 37.75 ? 319  GLU A OE1   1 
ATOM   2329  O OE2   . GLU A 1 288 ? 46.337  48.166  63.265 1.00 35.42 ? 319  GLU A OE2   1 
ATOM   2330  N N     . HIS A 1 289 ? 50.118  49.462  58.924 1.00 29.46 ? 320  HIS A N     1 
ATOM   2331  C CA    . HIS A 1 289 ? 51.362  49.562  58.187 1.00 26.90 ? 320  HIS A CA    1 
ATOM   2332  C C     . HIS A 1 289 ? 51.574  50.931  57.586 1.00 26.51 ? 320  HIS A C     1 
ATOM   2333  O O     . HIS A 1 289 ? 51.524  51.098  56.370 1.00 26.16 ? 320  HIS A O     1 
ATOM   2334  C CB    . HIS A 1 289 ? 51.384  48.509  57.079 1.00 25.54 ? 320  HIS A CB    1 
ATOM   2335  C CG    . HIS A 1 289 ? 51.326  47.101  57.585 1.00 25.16 ? 320  HIS A CG    1 
ATOM   2336  N ND1   . HIS A 1 289 ? 52.344  46.533  58.320 1.00 26.18 ? 320  HIS A ND1   1 
ATOM   2337  C CD2   . HIS A 1 289 ? 50.367  46.156  57.480 1.00 25.10 ? 320  HIS A CD2   1 
ATOM   2338  C CE1   . HIS A 1 289 ? 52.013  45.294  58.648 1.00 26.12 ? 320  HIS A CE1   1 
ATOM   2339  N NE2   . HIS A 1 289 ? 50.817  45.044  58.149 1.00 26.15 ? 320  HIS A NE2   1 
ATOM   2340  N N     . PRO A 1 290 ? 51.846  51.928  58.437 1.00 27.54 ? 321  PRO A N     1 
ATOM   2341  C CA    . PRO A 1 290 ? 52.077  53.307  58.001 1.00 26.39 ? 321  PRO A CA    1 
ATOM   2342  C C     . PRO A 1 290 ? 53.302  53.331  57.097 1.00 26.79 ? 321  PRO A C     1 
ATOM   2343  O O     . PRO A 1 290 ? 53.553  54.287  56.369 1.00 27.09 ? 321  PRO A O     1 
ATOM   2344  C CB    . PRO A 1 290 ? 52.319  54.056  59.307 1.00 27.10 ? 321  PRO A CB    1 
ATOM   2345  C CG    . PRO A 1 290 ? 52.749  53.004  60.273 1.00 26.31 ? 321  PRO A CG    1 
ATOM   2346  C CD    . PRO A 1 290 ? 51.989  51.781  59.896 1.00 26.78 ? 321  PRO A CD    1 
ATOM   2347  N N     . GLU A 1 291 ? 54.040  52.237  57.139 1.00 26.94 ? 322  GLU A N     1 
ATOM   2348  C CA    . GLU A 1 291 ? 55.258  52.089  56.375 1.00 27.95 ? 322  GLU A CA    1 
ATOM   2349  C C     . GLU A 1 291 ? 55.044  51.486  55.013 1.00 27.25 ? 322  GLU A C     1 
ATOM   2350  O O     . GLU A 1 291 ? 55.985  51.416  54.224 1.00 28.44 ? 322  GLU A O     1 
ATOM   2351  C CB    . GLU A 1 291 ? 56.222  51.199  57.150 1.00 28.99 ? 322  GLU A CB    1 
ATOM   2352  C CG    . GLU A 1 291 ? 55.579  50.595  58.380 1.00 33.58 ? 322  GLU A CG    1 
ATOM   2353  C CD    . GLU A 1 291 ? 55.134  49.174  58.172 1.00 37.05 ? 322  GLU A CD    1 
ATOM   2354  O OE1   . GLU A 1 291 ? 55.493  48.581  57.141 1.00 40.75 ? 322  GLU A OE1   1 
ATOM   2355  O OE2   . GLU A 1 291 ? 54.429  48.640  59.048 1.00 39.38 ? 322  GLU A OE2   1 
ATOM   2356  N N     . TRP A 1 292 ? 53.831  51.026  54.729 1.00 26.70 ? 323  TRP A N     1 
ATOM   2357  C CA    . TRP A 1 292 ? 53.562  50.406  53.432 1.00 24.90 ? 323  TRP A CA    1 
ATOM   2358  C C     . TRP A 1 292 ? 53.258  51.429  52.363 1.00 25.24 ? 323  TRP A C     1 
ATOM   2359  O O     . TRP A 1 292 ? 52.915  52.572  52.660 1.00 25.95 ? 323  TRP A O     1 
ATOM   2360  C CB    . TRP A 1 292 ? 52.382  49.450  53.521 1.00 22.98 ? 323  TRP A CB    1 
ATOM   2361  C CG    . TRP A 1 292 ? 52.753  48.114  54.044 1.00 21.79 ? 323  TRP A CG    1 
ATOM   2362  C CD1   . TRP A 1 292 ? 53.965  47.733  54.541 1.00 19.99 ? 323  TRP A CD1   1 
ATOM   2363  C CD2   . TRP A 1 292 ? 51.900  46.973  54.143 1.00 20.50 ? 323  TRP A CD2   1 
ATOM   2364  N NE1   . TRP A 1 292 ? 53.917  46.425  54.947 1.00 19.73 ? 323  TRP A NE1   1 
ATOM   2365  C CE2   . TRP A 1 292 ? 52.660  45.933  54.715 1.00 20.80 ? 323  TRP A CE2   1 
ATOM   2366  C CE3   . TRP A 1 292 ? 50.564  46.728  53.805 1.00 18.43 ? 323  TRP A CE3   1 
ATOM   2367  C CZ2   . TRP A 1 292 ? 52.130  44.665  54.958 1.00 19.89 ? 323  TRP A CZ2   1 
ATOM   2368  C CZ3   . TRP A 1 292 ? 50.038  45.476  54.040 1.00 18.09 ? 323  TRP A CZ3   1 
ATOM   2369  C CH2   . TRP A 1 292 ? 50.820  44.457  54.612 1.00 20.09 ? 323  TRP A CH2   1 
ATOM   2370  N N     . GLY A 1 293 ? 53.365  51.005  51.113 1.00 25.40 ? 324  GLY A N     1 
ATOM   2371  C CA    . GLY A 1 293 ? 53.081  51.897  50.009 1.00 25.22 ? 324  GLY A CA    1 
ATOM   2372  C C     . GLY A 1 293 ? 51.775  51.500  49.359 1.00 25.79 ? 324  GLY A C     1 
ATOM   2373  O O     . GLY A 1 293 ? 51.112  50.559  49.796 1.00 26.31 ? 324  GLY A O     1 
ATOM   2374  N N     . ASP A 1 294 ? 51.420  52.218  48.302 1.00 26.29 ? 325  ASP A N     1 
ATOM   2375  C CA    . ASP A 1 294 ? 50.194  51.984  47.547 1.00 25.85 ? 325  ASP A CA    1 
ATOM   2376  C C     . ASP A 1 294 ? 50.049  50.547  47.001 1.00 25.86 ? 325  ASP A C     1 
ATOM   2377  O O     . ASP A 1 294 ? 49.033  49.886  47.248 1.00 26.45 ? 325  ASP A O     1 
ATOM   2378  C CB    . ASP A 1 294 ? 50.130  53.009  46.413 1.00 26.39 ? 325  ASP A CB    1 
ATOM   2379  C CG    . ASP A 1 294 ? 48.918  52.832  45.521 1.00 26.90 ? 325  ASP A CG    1 
ATOM   2380  O OD1   . ASP A 1 294 ? 47.790  53.045  46.003 1.00 27.36 ? 325  ASP A OD1   1 
ATOM   2381  O OD2   . ASP A 1 294 ? 49.092  52.485  44.331 1.00 28.20 ? 325  ASP A OD2   1 
ATOM   2382  N N     . GLU A 1 295 ? 51.053  50.063  46.271 1.00 25.04 ? 326  GLU A N     1 
ATOM   2383  C CA    . GLU A 1 295 ? 51.020  48.708  45.718 1.00 24.00 ? 326  GLU A CA    1 
ATOM   2384  C C     . GLU A 1 295 ? 50.683  47.643  46.750 1.00 23.43 ? 326  GLU A C     1 
ATOM   2385  O O     . GLU A 1 295 ? 49.762  46.873  46.553 1.00 23.91 ? 326  GLU A O     1 
ATOM   2386  C CB    . GLU A 1 295 ? 52.368  48.323  45.121 1.00 24.43 ? 326  GLU A CB    1 
ATOM   2387  C CG    . GLU A 1 295 ? 52.465  48.297  43.616 1.00 23.83 ? 326  GLU A CG    1 
ATOM   2388  C CD    . GLU A 1 295 ? 51.374  47.524  42.910 1.00 22.51 ? 326  GLU A CD    1 
ATOM   2389  O OE1   . GLU A 1 295 ? 50.479  48.188  42.385 1.00 25.16 ? 326  GLU A OE1   1 
ATOM   2390  O OE2   . GLU A 1 295 ? 51.403  46.280  42.841 1.00 22.89 ? 326  GLU A OE2   1 
ATOM   2391  N N     . GLN A 1 296 ? 51.453  47.574  47.831 1.00 22.16 ? 327  GLN A N     1 
ATOM   2392  C CA    . GLN A 1 296 ? 51.217  46.556  48.849 1.00 22.07 ? 327  GLN A CA    1 
ATOM   2393  C C     . GLN A 1 296 ? 49.874  46.718  49.538 1.00 20.51 ? 327  GLN A C     1 
ATOM   2394  O O     . GLN A 1 296 ? 49.232  45.734  49.903 1.00 19.97 ? 327  GLN A O     1 
ATOM   2395  C CB    . GLN A 1 296 ? 52.332  46.567  49.904 1.00 22.22 ? 327  GLN A CB    1 
ATOM   2396  C CG    . GLN A 1 296 ? 52.328  45.326  50.795 1.00 23.58 ? 327  GLN A CG    1 
ATOM   2397  C CD    . GLN A 1 296 ? 53.644  45.126  51.507 1.00 23.74 ? 327  GLN A CD    1 
ATOM   2398  O OE1   . GLN A 1 296 ? 54.486  46.027  51.528 1.00 23.29 ? 327  GLN A OE1   1 
ATOM   2399  N NE2   . GLN A 1 296 ? 53.835  43.945  52.094 1.00 22.51 ? 327  GLN A NE2   1 
ATOM   2400  N N     . LEU A 1 297 ? 49.464  47.966  49.728 1.00 19.68 ? 328  LEU A N     1 
ATOM   2401  C CA    . LEU A 1 297 ? 48.189  48.241  50.359 1.00 18.98 ? 328  LEU A CA    1 
ATOM   2402  C C     . LEU A 1 297 ? 47.131  47.677  49.421 1.00 20.47 ? 328  LEU A C     1 
ATOM   2403  O O     . LEU A 1 297 ? 46.252  46.909  49.834 1.00 21.94 ? 328  LEU A O     1 
ATOM   2404  C CB    . LEU A 1 297 ? 47.996  49.740  50.524 1.00 17.40 ? 328  LEU A CB    1 
ATOM   2405  C CG    . LEU A 1 297 ? 48.813  50.361  51.657 1.00 17.21 ? 328  LEU A CG    1 
ATOM   2406  C CD1   . LEU A 1 297 ? 48.689  51.885  51.616 1.00 15.52 ? 328  LEU A CD1   1 
ATOM   2407  C CD2   . LEU A 1 297 ? 48.338  49.803  52.991 1.00 16.11 ? 328  LEU A CD2   1 
ATOM   2408  N N     . PHE A 1 298 ? 47.234  48.027  48.144 1.00 20.06 ? 329  PHE A N     1 
ATOM   2409  C CA    . PHE A 1 298 ? 46.278  47.526  47.163 1.00 20.08 ? 329  PHE A CA    1 
ATOM   2410  C C     . PHE A 1 298 ? 46.256  45.995  47.099 1.00 21.07 ? 329  PHE A C     1 
ATOM   2411  O O     . PHE A 1 298 ? 45.212  45.369  47.295 1.00 21.94 ? 329  PHE A O     1 
ATOM   2412  C CB    . PHE A 1 298 ? 46.592  48.045  45.765 1.00 19.47 ? 329  PHE A CB    1 
ATOM   2413  C CG    . PHE A 1 298 ? 45.805  47.349  44.694 1.00 20.82 ? 329  PHE A CG    1 
ATOM   2414  C CD1   . PHE A 1 298 ? 44.513  47.767  44.387 1.00 21.94 ? 329  PHE A CD1   1 
ATOM   2415  C CD2   . PHE A 1 298 ? 46.316  46.229  44.046 1.00 20.47 ? 329  PHE A CD2   1 
ATOM   2416  C CE1   . PHE A 1 298 ? 43.735  47.073  43.453 1.00 20.99 ? 329  PHE A CE1   1 
ATOM   2417  C CE2   . PHE A 1 298 ? 45.543  45.526  43.107 1.00 20.69 ? 329  PHE A CE2   1 
ATOM   2418  C CZ    . PHE A 1 298 ? 44.252  45.949  42.814 1.00 19.42 ? 329  PHE A CZ    1 
ATOM   2419  N N     . GLN A 1 299 ? 47.413  45.403  46.806 1.00 21.78 ? 330  GLN A N     1 
ATOM   2420  C CA    . GLN A 1 299 ? 47.550  43.953  46.676 1.00 21.06 ? 330  GLN A CA    1 
ATOM   2421  C C     . GLN A 1 299 ? 47.100  43.177  47.896 1.00 21.14 ? 330  GLN A C     1 
ATOM   2422  O O     . GLN A 1 299 ? 46.457  42.130  47.773 1.00 23.52 ? 330  GLN A O     1 
ATOM   2423  C CB    . GLN A 1 299 ? 49.005  43.578  46.361 1.00 19.44 ? 330  GLN A CB    1 
ATOM   2424  C CG    . GLN A 1 299 ? 49.560  44.206  45.103 1.00 19.65 ? 330  GLN A CG    1 
ATOM   2425  C CD    . GLN A 1 299 ? 48.943  43.642  43.840 1.00 21.16 ? 330  GLN A CD    1 
ATOM   2426  O OE1   . GLN A 1 299 ? 48.317  42.588  43.858 1.00 23.23 ? 330  GLN A OE1   1 
ATOM   2427  N NE2   . GLN A 1 299 ? 49.121  44.342  42.733 1.00 19.95 ? 330  GLN A NE2   1 
ATOM   2428  N N     . THR A 1 300 ? 47.441  43.671  49.077 1.00 21.82 ? 331  THR A N     1 
ATOM   2429  C CA    . THR A 1 300 ? 47.071  42.965  50.290 1.00 20.21 ? 331  THR A CA    1 
ATOM   2430  C C     . THR A 1 300 ? 45.584  43.059  50.512 1.00 21.40 ? 331  THR A C     1 
ATOM   2431  O O     . THR A 1 300 ? 44.961  42.115  51.000 1.00 22.58 ? 331  THR A O     1 
ATOM   2432  C CB    . THR A 1 300 ? 47.804  43.526  51.502 1.00 21.02 ? 331  THR A CB    1 
ATOM   2433  O OG1   . THR A 1 300 ? 49.198  43.655  51.190 1.00 20.51 ? 331  THR A OG1   1 
ATOM   2434  C CG2   . THR A 1 300 ? 47.643  42.598  52.693 1.00 19.96 ? 331  THR A CG2   1 
ATOM   2435  N N     . SER A 1 301 ? 45.007  44.200  50.141 1.00 21.21 ? 332  SER A N     1 
ATOM   2436  C CA    . SER A 1 301 ? 43.570  44.391  50.306 1.00 19.73 ? 332  SER A CA    1 
ATOM   2437  C C     . SER A 1 301 ? 42.829  43.431  49.371 1.00 19.75 ? 332  SER A C     1 
ATOM   2438  O O     . SER A 1 301 ? 41.813  42.829  49.760 1.00 22.49 ? 332  SER A O     1 
ATOM   2439  C CB    . SER A 1 301 ? 43.175  45.843  49.993 1.00 19.50 ? 332  SER A CB    1 
ATOM   2440  O OG    . SER A 1 301 ? 43.743  46.754  50.921 1.00 18.16 ? 332  SER A OG    1 
ATOM   2441  N N     . LYS A 1 302 ? 43.333  43.281  48.147 1.00 17.31 ? 333  LYS A N     1 
ATOM   2442  C CA    . LYS A 1 302 ? 42.703  42.393  47.179 1.00 17.42 ? 333  LYS A CA    1 
ATOM   2443  C C     . LYS A 1 302 ? 42.724  40.964  47.694 1.00 18.31 ? 333  LYS A C     1 
ATOM   2444  O O     . LYS A 1 302 ? 41.756  40.218  47.518 1.00 17.94 ? 333  LYS A O     1 
ATOM   2445  C CB    . LYS A 1 302 ? 43.417  42.447  45.823 1.00 15.83 ? 333  LYS A CB    1 
ATOM   2446  C CG    . LYS A 1 302 ? 43.038  41.295  44.889 1.00 15.87 ? 333  LYS A CG    1 
ATOM   2447  C CD    . LYS A 1 302 ? 43.455  41.581  43.442 1.00 14.54 ? 333  LYS A CD    1 
ATOM   2448  C CE    . LYS A 1 302 ? 42.696  40.733  42.424 1.00 14.78 ? 333  LYS A CE    1 
ATOM   2449  N NZ    . LYS A 1 302 ? 43.001  41.169  41.022 1.00 13.66 ? 333  LYS A NZ    1 
ATOM   2450  N N     . LEU A 1 303 ? 43.824  40.586  48.344 1.00 19.42 ? 334  LEU A N     1 
ATOM   2451  C CA    . LEU A 1 303 ? 43.958  39.225  48.868 1.00 19.60 ? 334  LEU A CA    1 
ATOM   2452  C C     . LEU A 1 303 ? 42.940  38.982  49.965 1.00 19.38 ? 334  LEU A C     1 
ATOM   2453  O O     . LEU A 1 303 ? 42.386  37.888  50.085 1.00 20.54 ? 334  LEU A O     1 
ATOM   2454  C CB    . LEU A 1 303 ? 45.362  38.997  49.434 1.00 19.02 ? 334  LEU A CB    1 
ATOM   2455  C CG    . LEU A 1 303 ? 46.451  38.688  48.411 1.00 20.58 ? 334  LEU A CG    1 
ATOM   2456  C CD1   . LEU A 1 303 ? 47.680  38.108  49.124 1.00 20.47 ? 334  LEU A CD1   1 
ATOM   2457  C CD2   . LEU A 1 303 ? 45.913  37.697  47.372 1.00 20.27 ? 334  LEU A CD2   1 
ATOM   2458  N N     . ILE A 1 304 ? 42.704  40.014  50.769 1.00 19.56 ? 335  ILE A N     1 
ATOM   2459  C CA    . ILE A 1 304 ? 41.763  39.931  51.881 1.00 19.03 ? 335  ILE A CA    1 
ATOM   2460  C C     . ILE A 1 304 ? 40.326  39.843  51.377 1.00 18.13 ? 335  ILE A C     1 
ATOM   2461  O O     . ILE A 1 304 ? 39.525  39.062  51.898 1.00 18.43 ? 335  ILE A O     1 
ATOM   2462  C CB    . ILE A 1 304 ? 41.929  41.153  52.824 1.00 18.65 ? 335  ILE A CB    1 
ATOM   2463  C CG1   . ILE A 1 304 ? 43.259  41.022  53.581 1.00 17.92 ? 335  ILE A CG1   1 
ATOM   2464  C CG2   . ILE A 1 304 ? 40.755  41.243  53.796 1.00 17.19 ? 335  ILE A CG2   1 
ATOM   2465  C CD1   . ILE A 1 304 ? 43.560  42.145  54.525 1.00 16.28 ? 335  ILE A CD1   1 
ATOM   2466  N N     . LEU A 1 305 ? 39.995  40.625  50.354 1.00 17.86 ? 336  LEU A N     1 
ATOM   2467  C CA    . LEU A 1 305 ? 38.637  40.581  49.827 1.00 18.00 ? 336  LEU A CA    1 
ATOM   2468  C C     . LEU A 1 305 ? 38.373  39.234  49.172 1.00 17.47 ? 336  LEU A C     1 
ATOM   2469  O O     . LEU A 1 305 ? 37.249  38.731  49.207 1.00 18.05 ? 336  LEU A O     1 
ATOM   2470  C CB    . LEU A 1 305 ? 38.408  41.716  48.838 1.00 16.36 ? 336  LEU A CB    1 
ATOM   2471  C CG    . LEU A 1 305 ? 37.728  42.937  49.461 1.00 14.86 ? 336  LEU A CG    1 
ATOM   2472  C CD1   . LEU A 1 305 ? 38.668  43.581  50.489 1.00 14.81 ? 336  LEU A CD1   1 
ATOM   2473  C CD2   . LEU A 1 305 ? 37.386  43.933  48.369 1.00 13.39 ? 336  LEU A CD2   1 
ATOM   2474  N N     . ILE A 1 306 ? 39.407  38.644  48.580 1.00 18.64 ? 337  ILE A N     1 
ATOM   2475  C CA    . ILE A 1 306 ? 39.249  37.336  47.961 1.00 20.17 ? 337  ILE A CA    1 
ATOM   2476  C C     . ILE A 1 306 ? 38.851  36.390  49.088 1.00 19.83 ? 337  ILE A C     1 
ATOM   2477  O O     . ILE A 1 306 ? 37.910  35.602  48.951 1.00 20.98 ? 337  ILE A O     1 
ATOM   2478  C CB    . ILE A 1 306 ? 40.569  36.841  47.290 1.00 19.27 ? 337  ILE A CB    1 
ATOM   2479  C CG1   . ILE A 1 306 ? 40.862  37.672  46.036 1.00 18.73 ? 337  ILE A CG1   1 
ATOM   2480  C CG2   . ILE A 1 306 ? 40.427  35.385  46.854 1.00 19.20 ? 337  ILE A CG2   1 
ATOM   2481  C CD1   . ILE A 1 306 ? 42.183  37.331  45.346 1.00 16.44 ? 337  ILE A CD1   1 
ATOM   2482  N N     . GLY A 1 307 ? 39.552  36.500  50.215 1.00 20.24 ? 338  GLY A N     1 
ATOM   2483  C CA    . GLY A 1 307 ? 39.260  35.659  51.369 1.00 20.93 ? 338  GLY A CA    1 
ATOM   2484  C C     . GLY A 1 307 ? 37.882  35.913  51.971 1.00 20.96 ? 338  GLY A C     1 
ATOM   2485  O O     . GLY A 1 307 ? 37.190  34.980  52.387 1.00 22.03 ? 338  GLY A O     1 
ATOM   2486  N N     . GLU A 1 308 ? 37.484  37.182  52.027 1.00 21.07 ? 339  GLU A N     1 
ATOM   2487  C CA    . GLU A 1 308 ? 36.176  37.556  52.551 1.00 19.64 ? 339  GLU A CA    1 
ATOM   2488  C C     . GLU A 1 308 ? 35.105  36.954  51.660 1.00 19.07 ? 339  GLU A C     1 
ATOM   2489  O O     . GLU A 1 308 ? 34.106  36.433  52.149 1.00 20.00 ? 339  GLU A O     1 
ATOM   2490  C CB    . GLU A 1 308 ? 36.013  39.071  52.554 1.00 19.77 ? 339  GLU A CB    1 
ATOM   2491  C CG    . GLU A 1 308 ? 36.758  39.779  53.663 1.00 19.31 ? 339  GLU A CG    1 
ATOM   2492  C CD    . GLU A 1 308 ? 36.351  41.240  53.783 1.00 21.27 ? 339  GLU A CD    1 
ATOM   2493  O OE1   . GLU A 1 308 ? 37.114  42.136  53.353 1.00 20.99 ? 339  GLU A OE1   1 
ATOM   2494  O OE2   . GLU A 1 308 ? 35.252  41.495  54.309 1.00 23.58 ? 339  GLU A OE2   1 
ATOM   2495  N N     . THR A 1 309 ? 35.319  37.035  50.352 1.00 18.12 ? 340  THR A N     1 
ATOM   2496  C CA    . THR A 1 309 ? 34.379  36.486  49.387 1.00 18.30 ? 340  THR A CA    1 
ATOM   2497  C C     . THR A 1 309 ? 34.193  34.984  49.572 1.00 18.06 ? 340  THR A C     1 
ATOM   2498  O O     . THR A 1 309 ? 33.072  34.482  49.570 1.00 19.76 ? 340  THR A O     1 
ATOM   2499  C CB    . THR A 1 309 ? 34.858  36.749  47.952 1.00 18.95 ? 340  THR A CB    1 
ATOM   2500  O OG1   . THR A 1 309 ? 35.015  38.155  47.768 1.00 18.78 ? 340  THR A OG1   1 
ATOM   2501  C CG2   . THR A 1 309 ? 33.854  36.228  46.938 1.00 17.97 ? 340  THR A CG2   1 
ATOM   2502  N N     . ILE A 1 310 ? 35.291  34.254  49.716 1.00 17.10 ? 341  ILE A N     1 
ATOM   2503  C CA    . ILE A 1 310 ? 35.190  32.819  49.902 1.00 16.95 ? 341  ILE A CA    1 
ATOM   2504  C C     . ILE A 1 310 ? 34.510  32.499  51.228 1.00 18.11 ? 341  ILE A C     1 
ATOM   2505  O O     . ILE A 1 310 ? 33.683  31.591  51.307 1.00 19.08 ? 341  ILE A O     1 
ATOM   2506  C CB    . ILE A 1 310 ? 36.578  32.153  49.856 1.00 16.50 ? 341  ILE A CB    1 
ATOM   2507  C CG1   . ILE A 1 310 ? 37.098  32.164  48.416 1.00 15.27 ? 341  ILE A CG1   1 
ATOM   2508  C CG2   . ILE A 1 310 ? 36.486  30.713  50.360 1.00 14.35 ? 341  ILE A CG2   1 
ATOM   2509  C CD1   . ILE A 1 310 ? 38.603  31.981  48.289 1.00 14.50 ? 341  ILE A CD1   1 
ATOM   2510  N N     . LYS A 1 311 ? 34.860  33.252  52.267 1.00 17.15 ? 342  LYS A N     1 
ATOM   2511  C CA    . LYS A 1 311 ? 34.281  33.060  53.587 1.00 16.10 ? 342  LYS A CA    1 
ATOM   2512  C C     . LYS A 1 311 ? 32.754  33.196  53.525 1.00 17.96 ? 342  LYS A C     1 
ATOM   2513  O O     . LYS A 1 311 ? 32.010  32.331  53.992 1.00 19.39 ? 342  LYS A O     1 
ATOM   2514  C CB    . LYS A 1 311 ? 34.851  34.104  54.545 1.00 15.72 ? 342  LYS A CB    1 
ATOM   2515  C CG    . LYS A 1 311 ? 34.089  34.238  55.845 1.00 14.24 ? 342  LYS A CG    1 
ATOM   2516  C CD    . LYS A 1 311 ? 34.453  33.130  56.797 1.00 14.22 ? 342  LYS A CD    1 
ATOM   2517  C CE    . LYS A 1 311 ? 33.958  33.424  58.201 1.00 14.88 ? 342  LYS A CE    1 
ATOM   2518  N NZ    . LYS A 1 311 ? 34.552  32.457  59.166 1.00 16.09 ? 342  LYS A NZ    1 
ATOM   2519  N N     . ILE A 1 312 ? 32.298  34.295  52.944 1.00 16.79 ? 343  ILE A N     1 
ATOM   2520  C CA    . ILE A 1 312 ? 30.881  34.562  52.823 1.00 16.99 ? 343  ILE A CA    1 
ATOM   2521  C C     . ILE A 1 312 ? 30.181  33.524  51.961 1.00 18.00 ? 343  ILE A C     1 
ATOM   2522  O O     . ILE A 1 312 ? 29.112  33.031  52.303 1.00 19.22 ? 343  ILE A O     1 
ATOM   2523  C CB    . ILE A 1 312 ? 30.651  35.955  52.220 1.00 15.23 ? 343  ILE A CB    1 
ATOM   2524  C CG1   . ILE A 1 312 ? 31.008  37.011  53.258 1.00 12.05 ? 343  ILE A CG1   1 
ATOM   2525  C CG2   . ILE A 1 312 ? 29.194  36.115  51.769 1.00 14.91 ? 343  ILE A CG2   1 
ATOM   2526  C CD1   . ILE A 1 312 ? 31.224  38.391  52.652 1.00 10.89 ? 343  ILE A CD1   1 
ATOM   2527  N N     . VAL A 1 313 ? 30.779  33.179  50.837 1.00 18.05 ? 344  VAL A N     1 
ATOM   2528  C CA    . VAL A 1 313 ? 30.145  32.211  49.969 1.00 18.55 ? 344  VAL A CA    1 
ATOM   2529  C C     . VAL A 1 313 ? 29.917  30.869  50.643 1.00 18.95 ? 344  VAL A C     1 
ATOM   2530  O O     . VAL A 1 313 ? 28.924  30.214  50.377 1.00 20.19 ? 344  VAL A O     1 
ATOM   2531  C CB    . VAL A 1 313 ? 30.962  32.012  48.673 1.00 17.56 ? 344  VAL A CB    1 
ATOM   2532  C CG1   . VAL A 1 313 ? 30.440  30.814  47.894 1.00 16.34 ? 344  VAL A CG1   1 
ATOM   2533  C CG2   . VAL A 1 313 ? 30.873  33.268  47.828 1.00 15.88 ? 344  VAL A CG2   1 
ATOM   2534  N N     . ILE A 1 314 ? 30.814  30.455  51.527 1.00 21.56 ? 345  ILE A N     1 
ATOM   2535  C CA    . ILE A 1 314 ? 30.650  29.158  52.179 1.00 21.92 ? 345  ILE A CA    1 
ATOM   2536  C C     . ILE A 1 314 ? 29.748  29.222  53.396 1.00 23.91 ? 345  ILE A C     1 
ATOM   2537  O O     . ILE A 1 314 ? 28.775  28.475  53.515 1.00 23.86 ? 345  ILE A O     1 
ATOM   2538  C CB    . ILE A 1 314 ? 31.994  28.571  52.659 1.00 21.48 ? 345  ILE A CB    1 
ATOM   2539  C CG1   . ILE A 1 314 ? 32.836  28.110  51.465 1.00 22.14 ? 345  ILE A CG1   1 
ATOM   2540  C CG2   . ILE A 1 314 ? 31.736  27.387  53.577 1.00 18.56 ? 345  ILE A CG2   1 
ATOM   2541  C CD1   . ILE A 1 314 ? 34.306  27.856  51.808 1.00 22.35 ? 345  ILE A CD1   1 
ATOM   2542  N N     . GLU A 1 315 ? 30.073  30.134  54.300 1.00 25.33 ? 346  GLU A N     1 
ATOM   2543  C CA    . GLU A 1 315 ? 29.324  30.251  55.542 1.00 26.22 ? 346  GLU A CA    1 
ATOM   2544  C C     . GLU A 1 315 ? 27.975  30.962  55.469 1.00 25.43 ? 346  GLU A C     1 
ATOM   2545  O O     . GLU A 1 315 ? 27.137  30.779  56.340 1.00 25.24 ? 346  GLU A O     1 
ATOM   2546  C CB    . GLU A 1 315 ? 30.235  30.883  56.605 1.00 27.02 ? 346  GLU A CB    1 
ATOM   2547  C CG    . GLU A 1 315 ? 31.577  30.150  56.704 1.00 30.56 ? 346  GLU A CG    1 
ATOM   2548  C CD    . GLU A 1 315 ? 32.276  30.312  58.041 1.00 31.97 ? 346  GLU A CD    1 
ATOM   2549  O OE1   . GLU A 1 315 ? 31.709  30.953  58.945 1.00 34.15 ? 346  GLU A OE1   1 
ATOM   2550  O OE2   . GLU A 1 315 ? 33.403  29.794  58.195 1.00 33.55 ? 346  GLU A OE2   1 
ATOM   2551  N N     . ASP A 1 316 ? 27.755  31.755  54.430 1.00 25.55 ? 347  ASP A N     1 
ATOM   2552  C CA    . ASP A 1 316 ? 26.486  32.463  54.283 1.00 24.59 ? 347  ASP A CA    1 
ATOM   2553  C C     . ASP A 1 316 ? 25.720  31.967  53.052 1.00 24.42 ? 347  ASP A C     1 
ATOM   2554  O O     . ASP A 1 316 ? 24.616  31.446  53.163 1.00 24.58 ? 347  ASP A O     1 
ATOM   2555  C CB    . ASP A 1 316 ? 26.720  33.970  54.133 1.00 25.61 ? 347  ASP A CB    1 
ATOM   2556  C CG    . ASP A 1 316 ? 27.059  34.657  55.449 1.00 25.85 ? 347  ASP A CG    1 
ATOM   2557  O OD1   . ASP A 1 316 ? 26.390  34.369  56.459 1.00 29.09 ? 347  ASP A OD1   1 
ATOM   2558  O OD2   . ASP A 1 316 ? 27.985  35.496  55.481 1.00 24.61 ? 347  ASP A OD2   1 
ATOM   2559  N N     . TYR A 1 317 ? 26.315  32.141  51.879 1.00 22.42 ? 348  TYR A N     1 
ATOM   2560  C CA    . TYR A 1 317 ? 25.696  31.757  50.621 1.00 20.85 ? 348  TYR A CA    1 
ATOM   2561  C C     . TYR A 1 317 ? 25.363  30.282  50.542 1.00 20.46 ? 348  TYR A C     1 
ATOM   2562  O O     . TYR A 1 317 ? 24.201  29.912  50.497 1.00 20.48 ? 348  TYR A O     1 
ATOM   2563  C CB    . TYR A 1 317 ? 26.622  32.166  49.474 1.00 19.63 ? 348  TYR A CB    1 
ATOM   2564  C CG    . TYR A 1 317 ? 26.062  32.056  48.068 1.00 18.99 ? 348  TYR A CG    1 
ATOM   2565  C CD1   . TYR A 1 317 ? 25.325  33.101  47.498 1.00 17.36 ? 348  TYR A CD1   1 
ATOM   2566  C CD2   . TYR A 1 317 ? 26.373  30.951  47.260 1.00 19.09 ? 348  TYR A CD2   1 
ATOM   2567  C CE1   . TYR A 1 317 ? 24.933  33.048  46.159 1.00 17.12 ? 348  TYR A CE1   1 
ATOM   2568  C CE2   . TYR A 1 317 ? 25.984  30.896  45.922 1.00 17.03 ? 348  TYR A CE2   1 
ATOM   2569  C CZ    . TYR A 1 317 ? 25.278  31.947  45.382 1.00 18.29 ? 348  TYR A CZ    1 
ATOM   2570  O OH    . TYR A 1 317 ? 24.983  31.929  44.036 1.00 20.37 ? 348  TYR A OH    1 
ATOM   2571  N N     . VAL A 1 318 ? 26.383  29.436  50.520 1.00 20.17 ? 349  VAL A N     1 
ATOM   2572  C CA    . VAL A 1 318 ? 26.168  28.000  50.432 1.00 20.58 ? 349  VAL A CA    1 
ATOM   2573  C C     . VAL A 1 318 ? 25.379  27.503  51.648 1.00 20.69 ? 349  VAL A C     1 
ATOM   2574  O O     . VAL A 1 318 ? 24.471  26.668  51.525 1.00 20.38 ? 349  VAL A O     1 
ATOM   2575  C CB    . VAL A 1 318 ? 27.521  27.250  50.310 1.00 21.04 ? 349  VAL A CB    1 
ATOM   2576  C CG1   . VAL A 1 318 ? 27.301  25.737  50.358 1.00 21.89 ? 349  VAL A CG1   1 
ATOM   2577  C CG2   . VAL A 1 318 ? 28.195  27.629  49.001 1.00 21.15 ? 349  VAL A CG2   1 
ATOM   2578  N N     . GLN A 1 319 ? 25.711  28.033  52.820 1.00 19.61 ? 350  GLN A N     1 
ATOM   2579  C CA    . GLN A 1 319 ? 25.018  27.652  54.049 1.00 21.40 ? 350  GLN A CA    1 
ATOM   2580  C C     . GLN A 1 319 ? 23.509  27.735  53.822 1.00 22.42 ? 350  GLN A C     1 
ATOM   2581  O O     . GLN A 1 319 ? 22.776  26.775  54.049 1.00 24.32 ? 350  GLN A O     1 
ATOM   2582  C CB    . GLN A 1 319 ? 25.399  28.589  55.191 1.00 19.87 ? 350  GLN A CB    1 
ATOM   2583  C CG    . GLN A 1 319 ? 24.711  28.229  56.489 1.00 21.30 ? 350  GLN A CG    1 
ATOM   2584  C CD    . GLN A 1 319 ? 25.072  26.833  56.979 1.00 23.11 ? 350  GLN A CD    1 
ATOM   2585  O OE1   . GLN A 1 319 ? 26.247  26.473  57.037 1.00 26.72 ? 350  GLN A OE1   1 
ATOM   2586  N NE2   . GLN A 1 319 ? 24.067  26.041  57.327 1.00 22.90 ? 350  GLN A NE2   1 
ATOM   2587  N N     . HIS A 1 320 ? 23.066  28.900  53.370 1.00 21.41 ? 351  HIS A N     1 
ATOM   2588  C CA    . HIS A 1 320 ? 21.666  29.156  53.073 1.00 21.97 ? 351  HIS A CA    1 
ATOM   2589  C C     . HIS A 1 320 ? 21.121  28.153  52.058 1.00 21.85 ? 351  HIS A C     1 
ATOM   2590  O O     . HIS A 1 320 ? 20.153  27.449  52.323 1.00 22.67 ? 351  HIS A O     1 
ATOM   2591  C CB    . HIS A 1 320 ? 21.510  30.573  52.523 1.00 21.05 ? 351  HIS A CB    1 
ATOM   2592  C CG    . HIS A 1 320 ? 20.167  30.830  51.927 1.00 21.72 ? 351  HIS A CG    1 
ATOM   2593  N ND1   . HIS A 1 320 ? 19.027  30.925  52.689 1.00 21.99 ? 351  HIS A ND1   1 
ATOM   2594  C CD2   . HIS A 1 320 ? 19.775  30.967  50.640 1.00 23.62 ? 351  HIS A CD2   1 
ATOM   2595  C CE1   . HIS A 1 320 ? 17.985  31.106  51.901 1.00 22.99 ? 351  HIS A CE1   1 
ATOM   2596  N NE2   . HIS A 1 320 ? 18.412  31.137  50.649 1.00 23.68 ? 351  HIS A NE2   1 
ATOM   2597  N N     . LEU A 1 321 ? 21.754  28.096  50.898 1.00 20.64 ? 352  LEU A N     1 
ATOM   2598  C CA    . LEU A 1 321 ? 21.344  27.190  49.840 1.00 21.48 ? 352  LEU A CA    1 
ATOM   2599  C C     . LEU A 1 321 ? 21.189  25.768  50.337 1.00 21.22 ? 352  LEU A C     1 
ATOM   2600  O O     . LEU A 1 321 ? 20.248  25.087  49.975 1.00 22.30 ? 352  LEU A O     1 
ATOM   2601  C CB    . LEU A 1 321 ? 22.384  27.188  48.728 1.00 20.95 ? 352  LEU A CB    1 
ATOM   2602  C CG    . LEU A 1 321 ? 22.034  27.645  47.319 1.00 21.14 ? 352  LEU A CG    1 
ATOM   2603  C CD1   . LEU A 1 321 ? 20.800  28.527  47.339 1.00 21.75 ? 352  LEU A CD1   1 
ATOM   2604  C CD2   . LEU A 1 321 ? 23.230  28.393  46.745 1.00 21.17 ? 352  LEU A CD2   1 
ATOM   2605  N N     . SER A 1 322 ? 22.114  25.323  51.176 1.00 21.57 ? 353  SER A N     1 
ATOM   2606  C CA    . SER A 1 322 ? 22.097  23.949  51.663 1.00 22.03 ? 353  SER A CA    1 
ATOM   2607  C C     . SER A 1 322 ? 20.885  23.545  52.486 1.00 22.45 ? 353  SER A C     1 
ATOM   2608  O O     . SER A 1 322 ? 20.335  22.461  52.298 1.00 22.61 ? 353  SER A O     1 
ATOM   2609  C CB    . SER A 1 322 ? 23.347  23.676  52.484 1.00 21.13 ? 353  SER A CB    1 
ATOM   2610  O OG    . SER A 1 322 ? 23.161  24.126  53.809 1.00 20.87 ? 353  SER A OG    1 
ATOM   2611  N N     . GLY A 1 323 ? 20.472  24.408  53.404 1.00 23.54 ? 354  GLY A N     1 
ATOM   2612  C CA    . GLY A 1 323 ? 19.346  24.070  54.253 1.00 23.79 ? 354  GLY A CA    1 
ATOM   2613  C C     . GLY A 1 323 ? 19.809  23.199  55.408 1.00 24.38 ? 354  GLY A C     1 
ATOM   2614  O O     . GLY A 1 323 ? 19.003  22.681  56.182 1.00 25.34 ? 354  GLY A O     1 
ATOM   2615  N N     . TYR A 1 324 ? 21.120  23.037  55.538 1.00 24.58 ? 355  TYR A N     1 
ATOM   2616  C CA    . TYR A 1 324 ? 21.661  22.217  56.612 1.00 24.87 ? 355  TYR A CA    1 
ATOM   2617  C C     . TYR A 1 324 ? 21.541  22.880  57.975 1.00 25.13 ? 355  TYR A C     1 
ATOM   2618  O O     . TYR A 1 324 ? 21.533  24.107  58.081 1.00 25.03 ? 355  TYR A O     1 
ATOM   2619  C CB    . TYR A 1 324 ? 23.135  21.922  56.360 1.00 24.73 ? 355  TYR A CB    1 
ATOM   2620  C CG    . TYR A 1 324 ? 23.417  21.194  55.083 1.00 24.57 ? 355  TYR A CG    1 
ATOM   2621  C CD1   . TYR A 1 324 ? 22.412  20.517  54.398 1.00 24.87 ? 355  TYR A CD1   1 
ATOM   2622  C CD2   . TYR A 1 324 ? 24.699  21.176  54.557 1.00 25.41 ? 355  TYR A CD2   1 
ATOM   2623  C CE1   . TYR A 1 324 ? 22.688  19.834  53.209 1.00 26.02 ? 355  TYR A CE1   1 
ATOM   2624  C CE2   . TYR A 1 324 ? 24.984  20.501  53.379 1.00 25.58 ? 355  TYR A CE2   1 
ATOM   2625  C CZ    . TYR A 1 324 ? 23.984  19.834  52.712 1.00 25.59 ? 355  TYR A CZ    1 
ATOM   2626  O OH    . TYR A 1 324 ? 24.305  19.156  51.561 1.00 27.55 ? 355  TYR A OH    1 
ATOM   2627  N N     . HIS A 1 325 ? 21.454  22.062  59.020 1.00 26.46 ? 356  HIS A N     1 
ATOM   2628  C CA    . HIS A 1 325 ? 21.386  22.587  60.374 1.00 26.49 ? 356  HIS A CA    1 
ATOM   2629  C C     . HIS A 1 325 ? 22.811  22.705  60.838 1.00 26.92 ? 356  HIS A C     1 
ATOM   2630  O O     . HIS A 1 325 ? 23.118  23.440  61.775 1.00 27.31 ? 356  HIS A O     1 
ATOM   2631  C CB    . HIS A 1 325 ? 20.606  21.645  61.267 1.00 26.64 ? 356  HIS A CB    1 
ATOM   2632  C CG    . HIS A 1 325 ? 19.134  21.750  61.066 1.00 27.61 ? 356  HIS A CG    1 
ATOM   2633  N ND1   . HIS A 1 325 ? 18.305  20.649  60.984 1.00 28.74 ? 356  HIS A ND1   1 
ATOM   2634  C CD2   . HIS A 1 325 ? 18.341  22.833  60.878 1.00 27.53 ? 356  HIS A CD2   1 
ATOM   2635  C CE1   . HIS A 1 325 ? 17.069  21.050  60.753 1.00 28.73 ? 356  HIS A CE1   1 
ATOM   2636  N NE2   . HIS A 1 325 ? 17.065  22.368  60.686 1.00 28.22 ? 356  HIS A NE2   1 
ATOM   2637  N N     . PHE A 1 326 ? 23.680  21.967  60.154 1.00 26.89 ? 357  PHE A N     1 
ATOM   2638  C CA    . PHE A 1 326 ? 25.105  21.982  60.429 1.00 26.56 ? 357  PHE A CA    1 
ATOM   2639  C C     . PHE A 1 326 ? 25.694  23.292  59.876 1.00 26.48 ? 357  PHE A C     1 
ATOM   2640  O O     . PHE A 1 326 ? 25.378  23.696  58.749 1.00 27.17 ? 357  PHE A O     1 
ATOM   2641  C CB    . PHE A 1 326 ? 25.776  20.782  59.754 1.00 25.93 ? 357  PHE A CB    1 
ATOM   2642  C CG    . PHE A 1 326 ? 27.274  20.819  59.821 1.00 25.48 ? 357  PHE A CG    1 
ATOM   2643  C CD1   . PHE A 1 326 ? 27.924  20.821  61.056 1.00 25.75 ? 357  PHE A CD1   1 
ATOM   2644  C CD2   . PHE A 1 326 ? 28.034  20.896  58.658 1.00 23.50 ? 357  PHE A CD2   1 
ATOM   2645  C CE1   . PHE A 1 326 ? 29.310  20.903  61.133 1.00 25.44 ? 357  PHE A CE1   1 
ATOM   2646  C CE2   . PHE A 1 326 ? 29.422  20.977  58.721 1.00 24.39 ? 357  PHE A CE2   1 
ATOM   2647  C CZ    . PHE A 1 326 ? 30.062  20.984  59.961 1.00 25.31 ? 357  PHE A CZ    1 
ATOM   2648  N N     . LYS A 1 327 ? 26.536  23.955  60.666 1.00 25.83 ? 358  LYS A N     1 
ATOM   2649  C CA    . LYS A 1 327 ? 27.159  25.199  60.241 1.00 26.00 ? 358  LYS A CA    1 
ATOM   2650  C C     . LYS A 1 327 ? 28.404  24.958  59.396 1.00 25.47 ? 358  LYS A C     1 
ATOM   2651  O O     . LYS A 1 327 ? 29.460  24.612  59.925 1.00 24.73 ? 358  LYS A O     1 
ATOM   2652  C CB    . LYS A 1 327 ? 27.543  26.034  61.454 1.00 29.59 ? 358  LYS A CB    1 
ATOM   2653  C CG    . LYS A 1 327 ? 26.610  27.193  61.732 1.00 34.88 ? 358  LYS A CG    1 
ATOM   2654  C CD    . LYS A 1 327 ? 27.152  28.054  62.872 1.00 39.95 ? 358  LYS A CD    1 
ATOM   2655  C CE    . LYS A 1 327 ? 26.101  28.279  63.976 1.00 43.83 ? 358  LYS A CE    1 
ATOM   2656  N NZ    . LYS A 1 327 ? 26.712  28.437  65.346 1.00 43.84 ? 358  LYS A NZ    1 
ATOM   2657  N N     . LEU A 1 328 ? 28.262  25.131  58.079 1.00 24.76 ? 359  LEU A N     1 
ATOM   2658  C CA    . LEU A 1 328 ? 29.364  24.965  57.131 1.00 22.53 ? 359  LEU A CA    1 
ATOM   2659  C C     . LEU A 1 328 ? 30.510  25.878  57.554 1.00 22.62 ? 359  LEU A C     1 
ATOM   2660  O O     . LEU A 1 328 ? 30.285  26.950  58.120 1.00 22.50 ? 359  LEU A O     1 
ATOM   2661  C CB    . LEU A 1 328 ? 28.896  25.320  55.721 1.00 21.10 ? 359  LEU A CB    1 
ATOM   2662  C CG    . LEU A 1 328 ? 27.924  24.313  55.099 1.00 19.87 ? 359  LEU A CG    1 
ATOM   2663  C CD1   . LEU A 1 328 ? 27.599  24.699  53.667 1.00 16.61 ? 359  LEU A CD1   1 
ATOM   2664  C CD2   . LEU A 1 328 ? 28.549  22.937  55.138 1.00 17.73 ? 359  LEU A CD2   1 
ATOM   2665  N N     . LYS A 1 329 ? 31.744  25.466  57.283 1.00 22.69 ? 360  LYS A N     1 
ATOM   2666  C CA    . LYS A 1 329 ? 32.868  26.276  57.724 1.00 23.59 ? 360  LYS A CA    1 
ATOM   2667  C C     . LYS A 1 329 ? 33.966  26.479  56.705 1.00 23.14 ? 360  LYS A C     1 
ATOM   2668  O O     . LYS A 1 329 ? 34.300  25.571  55.959 1.00 23.20 ? 360  LYS A O     1 
ATOM   2669  C CB    . LYS A 1 329 ? 33.446  25.653  58.990 1.00 24.06 ? 360  LYS A CB    1 
ATOM   2670  C CG    . LYS A 1 329 ? 34.619  26.388  59.605 1.00 24.25 ? 360  LYS A CG    1 
ATOM   2671  C CD    . LYS A 1 329 ? 35.309  25.456  60.601 1.00 25.39 ? 360  LYS A CD    1 
ATOM   2672  C CE    . LYS A 1 329 ? 36.280  26.185  61.514 1.00 25.54 ? 360  LYS A CE    1 
ATOM   2673  N NZ    . LYS A 1 329 ? 37.087  25.209  62.297 1.00 25.13 ? 360  LYS A NZ    1 
ATOM   2674  N N     . PHE A 1 330 ? 34.509  27.690  56.665 1.00 24.19 ? 361  PHE A N     1 
ATOM   2675  C CA    . PHE A 1 330 ? 35.596  27.983  55.751 1.00 25.28 ? 361  PHE A CA    1 
ATOM   2676  C C     . PHE A 1 330 ? 36.892  27.816  56.538 1.00 26.50 ? 361  PHE A C     1 
ATOM   2677  O O     . PHE A 1 330 ? 37.233  28.673  57.350 1.00 27.45 ? 361  PHE A O     1 
ATOM   2678  C CB    . PHE A 1 330 ? 35.513  29.414  55.224 1.00 24.16 ? 361  PHE A CB    1 
ATOM   2679  C CG    . PHE A 1 330 ? 36.727  29.830  54.420 1.00 25.11 ? 361  PHE A CG    1 
ATOM   2680  C CD1   . PHE A 1 330 ? 37.297  28.963  53.489 1.00 24.46 ? 361  PHE A CD1   1 
ATOM   2681  C CD2   . PHE A 1 330 ? 37.299  31.090  54.586 1.00 24.94 ? 361  PHE A CD2   1 
ATOM   2682  C CE1   . PHE A 1 330 ? 38.417  29.346  52.736 1.00 23.84 ? 361  PHE A CE1   1 
ATOM   2683  C CE2   . PHE A 1 330 ? 38.425  31.478  53.831 1.00 24.47 ? 361  PHE A CE2   1 
ATOM   2684  C CZ    . PHE A 1 330 ? 38.980  30.604  52.906 1.00 23.16 ? 361  PHE A CZ    1 
ATOM   2685  N N     . ASP A 1 331 ? 37.604  26.712  56.309 1.00 26.95 ? 362  ASP A N     1 
ATOM   2686  C CA    . ASP A 1 331 ? 38.857  26.452  57.005 1.00 25.97 ? 362  ASP A CA    1 
ATOM   2687  C C     . ASP A 1 331 ? 39.819  25.677  56.110 1.00 25.94 ? 362  ASP A C     1 
ATOM   2688  O O     . ASP A 1 331 ? 39.767  24.447  56.033 1.00 25.21 ? 362  ASP A O     1 
ATOM   2689  C CB    . ASP A 1 331 ? 38.578  25.665  58.285 1.00 26.83 ? 362  ASP A CB    1 
ATOM   2690  C CG    . ASP A 1 331 ? 39.790  25.567  59.189 1.00 27.60 ? 362  ASP A CG    1 
ATOM   2691  O OD1   . ASP A 1 331 ? 40.885  26.055  58.813 1.00 28.63 ? 362  ASP A OD1   1 
ATOM   2692  O OD2   . ASP A 1 331 ? 39.635  24.993  60.284 1.00 27.85 ? 362  ASP A OD2   1 
ATOM   2693  N N     . PRO A 1 332 ? 40.709  26.394  55.409 1.00 26.71 ? 363  PRO A N     1 
ATOM   2694  C CA    . PRO A 1 332 ? 41.682  25.743  54.520 1.00 27.63 ? 363  PRO A CA    1 
ATOM   2695  C C     . PRO A 1 332 ? 42.486  24.638  55.216 1.00 28.17 ? 363  PRO A C     1 
ATOM   2696  O O     . PRO A 1 332 ? 42.869  23.642  54.588 1.00 29.95 ? 363  PRO A O     1 
ATOM   2697  C CB    . PRO A 1 332 ? 42.560  26.899  54.050 1.00 27.47 ? 363  PRO A CB    1 
ATOM   2698  C CG    . PRO A 1 332 ? 41.662  28.118  54.173 1.00 26.08 ? 363  PRO A CG    1 
ATOM   2699  C CD    . PRO A 1 332 ? 40.839  27.862  55.397 1.00 25.67 ? 363  PRO A CD    1 
ATOM   2700  N N     . GLU A 1 333 ? 42.729  24.815  56.514 1.00 28.82 ? 364  GLU A N     1 
ATOM   2701  C CA    . GLU A 1 333 ? 43.476  23.843  57.302 1.00 29.10 ? 364  GLU A CA    1 
ATOM   2702  C C     . GLU A 1 333 ? 42.870  22.458  57.252 1.00 28.41 ? 364  GLU A C     1 
ATOM   2703  O O     . GLU A 1 333 ? 43.573  21.458  57.384 1.00 29.36 ? 364  GLU A O     1 
ATOM   2704  C CB    . GLU A 1 333 ? 43.532  24.264  58.758 1.00 30.76 ? 364  GLU A CB    1 
ATOM   2705  C CG    . GLU A 1 333 ? 43.948  25.686  58.957 1.00 37.07 ? 364  GLU A CG    1 
ATOM   2706  C CD    . GLU A 1 333 ? 45.126  25.808  59.912 1.00 39.91 ? 364  GLU A CD    1 
ATOM   2707  O OE1   . GLU A 1 333 ? 45.668  26.935  60.047 1.00 43.30 ? 364  GLU A OE1   1 
ATOM   2708  O OE2   . GLU A 1 333 ? 45.507  24.781  60.526 1.00 40.48 ? 364  GLU A OE2   1 
ATOM   2709  N N     . LEU A 1 334 ? 41.560  22.397  57.074 1.00 27.13 ? 365  LEU A N     1 
ATOM   2710  C CA    . LEU A 1 334 ? 40.878  21.125  57.033 1.00 25.49 ? 365  LEU A CA    1 
ATOM   2711  C C     . LEU A 1 334 ? 41.393  20.247  55.905 1.00 25.35 ? 365  LEU A C     1 
ATOM   2712  O O     . LEU A 1 334 ? 41.295  19.021  55.975 1.00 25.71 ? 365  LEU A O     1 
ATOM   2713  C CB    . LEU A 1 334 ? 39.375  21.357  56.883 1.00 24.21 ? 365  LEU A CB    1 
ATOM   2714  C CG    . LEU A 1 334 ? 38.736  22.081  58.070 1.00 24.24 ? 365  LEU A CG    1 
ATOM   2715  C CD1   . LEU A 1 334 ? 37.238  22.242  57.821 1.00 23.57 ? 365  LEU A CD1   1 
ATOM   2716  C CD2   . LEU A 1 334 ? 38.995  21.304  59.363 1.00 21.17 ? 365  LEU A CD2   1 
ATOM   2717  N N     . LEU A 1 335 ? 41.948  20.876  54.872 1.00 25.87 ? 366  LEU A N     1 
ATOM   2718  C CA    . LEU A 1 335 ? 42.464  20.151  53.718 1.00 26.12 ? 366  LEU A CA    1 
ATOM   2719  C C     . LEU A 1 335 ? 43.970  19.868  53.732 1.00 27.79 ? 366  LEU A C     1 
ATOM   2720  O O     . LEU A 1 335 ? 44.471  19.065  52.938 1.00 27.98 ? 366  LEU A O     1 
ATOM   2721  C CB    . LEU A 1 335 ? 42.113  20.916  52.447 1.00 25.08 ? 366  LEU A CB    1 
ATOM   2722  C CG    . LEU A 1 335 ? 40.621  20.962  52.116 1.00 25.17 ? 366  LEU A CG    1 
ATOM   2723  C CD1   . LEU A 1 335 ? 40.403  21.840  50.908 1.00 24.12 ? 366  LEU A CD1   1 
ATOM   2724  C CD2   . LEU A 1 335 ? 40.112  19.548  51.849 1.00 23.07 ? 366  LEU A CD2   1 
ATOM   2725  N N     . PHE A 1 336 ? 44.691  20.507  54.646 1.00 29.17 ? 367  PHE A N     1 
ATOM   2726  C CA    . PHE A 1 336 ? 46.132  20.336  54.713 1.00 30.35 ? 367  PHE A CA    1 
ATOM   2727  C C     . PHE A 1 336 ? 46.657  18.904  54.813 1.00 34.42 ? 367  PHE A C     1 
ATOM   2728  O O     . PHE A 1 336 ? 47.734  18.609  54.293 1.00 36.06 ? 367  PHE A O     1 
ATOM   2729  C CB    . PHE A 1 336 ? 46.700  21.171  55.860 1.00 28.39 ? 367  PHE A CB    1 
ATOM   2730  C CG    . PHE A 1 336 ? 46.665  22.665  55.609 1.00 26.66 ? 367  PHE A CG    1 
ATOM   2731  C CD1   . PHE A 1 336 ? 47.039  23.560  56.609 1.00 24.26 ? 367  PHE A CD1   1 
ATOM   2732  C CD2   . PHE A 1 336 ? 46.217  23.176  54.392 1.00 25.95 ? 367  PHE A CD2   1 
ATOM   2733  C CE1   . PHE A 1 336 ? 46.964  24.948  56.410 1.00 23.39 ? 367  PHE A CE1   1 
ATOM   2734  C CE2   . PHE A 1 336 ? 46.140  24.560  54.185 1.00 26.07 ? 367  PHE A CE2   1 
ATOM   2735  C CZ    . PHE A 1 336 ? 46.515  25.446  55.203 1.00 23.81 ? 367  PHE A CZ    1 
ATOM   2736  N N     . ASN A 1 337 ? 45.936  18.006  55.470 1.00 36.34 ? 368  ASN A N     1 
ATOM   2737  C CA    . ASN A 1 337 ? 46.419  16.629  55.583 1.00 38.62 ? 368  ASN A CA    1 
ATOM   2738  C C     . ASN A 1 337 ? 45.754  15.747  54.538 1.00 39.21 ? 368  ASN A C     1 
ATOM   2739  O O     . ASN A 1 337 ? 45.875  14.527  54.565 1.00 40.07 ? 368  ASN A O     1 
ATOM   2740  C CB    . ASN A 1 337 ? 46.122  16.074  56.976 1.00 40.97 ? 368  ASN A CB    1 
ATOM   2741  C CG    . ASN A 1 337 ? 44.714  16.404  57.444 1.00 42.75 ? 368  ASN A CG    1 
ATOM   2742  O OD1   . ASN A 1 337 ? 43.818  16.674  56.632 1.00 44.43 ? 368  ASN A OD1   1 
ATOM   2743  N ND2   . ASN A 1 337 ? 44.511  16.397  58.761 1.00 44.52 ? 368  ASN A ND2   1 
ATOM   2744  N N     . GLN A 1 338 ? 45.052  16.380  53.613 1.00 38.83 ? 369  GLN A N     1 
ATOM   2745  C CA    . GLN A 1 338 ? 44.334  15.671  52.566 1.00 38.75 ? 369  GLN A CA    1 
ATOM   2746  C C     . GLN A 1 338 ? 45.036  15.843  51.226 1.00 36.55 ? 369  GLN A C     1 
ATOM   2747  O O     . GLN A 1 338 ? 45.806  16.778  51.043 1.00 37.67 ? 369  GLN A O     1 
ATOM   2748  C CB    . GLN A 1 338 ? 42.912  16.245  52.465 1.00 40.11 ? 369  GLN A CB    1 
ATOM   2749  C CG    . GLN A 1 338 ? 41.800  15.264  52.788 1.00 42.57 ? 369  GLN A CG    1 
ATOM   2750  C CD    . GLN A 1 338 ? 41.989  14.613  54.132 1.00 43.57 ? 369  GLN A CD    1 
ATOM   2751  O OE1   . GLN A 1 338 ? 42.147  15.296  55.145 1.00 45.51 ? 369  GLN A OE1   1 
ATOM   2752  N NE2   . GLN A 1 338 ? 41.984  13.287  54.154 1.00 44.66 ? 369  GLN A NE2   1 
ATOM   2753  N N     . GLN A 1 339 ? 44.769  14.947  50.287 1.00 33.25 ? 370  GLN A N     1 
ATOM   2754  C CA    . GLN A 1 339 ? 45.344  15.073  48.957 1.00 30.60 ? 370  GLN A CA    1 
ATOM   2755  C C     . GLN A 1 339 ? 44.374  15.998  48.246 1.00 28.42 ? 370  GLN A C     1 
ATOM   2756  O O     . GLN A 1 339 ? 43.209  15.662  48.075 1.00 30.62 ? 370  GLN A O     1 
ATOM   2757  C CB    . GLN A 1 339 ? 45.378  13.720  48.256 1.00 31.29 ? 370  GLN A CB    1 
ATOM   2758  C CG    . GLN A 1 339 ? 46.468  12.791  48.789 1.00 33.92 ? 370  GLN A CG    1 
ATOM   2759  C CD    . GLN A 1 339 ? 46.660  11.562  47.933 1.00 33.85 ? 370  GLN A CD    1 
ATOM   2760  O OE1   . GLN A 1 339 ? 45.893  10.604  48.019 1.00 37.42 ? 370  GLN A OE1   1 
ATOM   2761  N NE2   . GLN A 1 339 ? 47.682  11.582  47.098 1.00 33.69 ? 370  GLN A NE2   1 
ATOM   2762  N N     . PHE A 1 340 ? 44.832  17.166  47.830 1.00 25.68 ? 371  PHE A N     1 
ATOM   2763  C CA    . PHE A 1 340 ? 43.928  18.098  47.183 1.00 21.48 ? 371  PHE A CA    1 
ATOM   2764  C C     . PHE A 1 340 ? 44.758  18.992  46.276 1.00 19.79 ? 371  PHE A C     1 
ATOM   2765  O O     . PHE A 1 340 ? 45.851  19.396  46.639 1.00 20.09 ? 371  PHE A O     1 
ATOM   2766  C CB    . PHE A 1 340 ? 43.192  18.902  48.287 1.00 20.50 ? 371  PHE A CB    1 
ATOM   2767  C CG    . PHE A 1 340 ? 42.242  19.953  47.771 1.00 20.52 ? 371  PHE A CG    1 
ATOM   2768  C CD1   . PHE A 1 340 ? 40.949  19.614  47.376 1.00 20.46 ? 371  PHE A CD1   1 
ATOM   2769  C CD2   . PHE A 1 340 ? 42.651  21.280  47.641 1.00 19.81 ? 371  PHE A CD2   1 
ATOM   2770  C CE1   . PHE A 1 340 ? 40.086  20.573  46.852 1.00 20.07 ? 371  PHE A CE1   1 
ATOM   2771  C CE2   . PHE A 1 340 ? 41.791  22.241  47.119 1.00 19.68 ? 371  PHE A CE2   1 
ATOM   2772  C CZ    . PHE A 1 340 ? 40.505  21.882  46.723 1.00 20.13 ? 371  PHE A CZ    1 
ATOM   2773  N N     . GLN A 1 341 ? 44.246  19.280  45.085 1.00 19.78 ? 372  GLN A N     1 
ATOM   2774  C CA    . GLN A 1 341 ? 44.944  20.138  44.131 1.00 19.28 ? 372  GLN A CA    1 
ATOM   2775  C C     . GLN A 1 341 ? 44.476  21.595  44.208 1.00 19.46 ? 372  GLN A C     1 
ATOM   2776  O O     . GLN A 1 341 ? 43.303  21.900  43.982 1.00 21.07 ? 372  GLN A O     1 
ATOM   2777  C CB    . GLN A 1 341 ? 44.735  19.631  42.708 1.00 16.69 ? 372  GLN A CB    1 
ATOM   2778  C CG    . GLN A 1 341 ? 45.215  18.212  42.485 1.00 18.22 ? 372  GLN A CG    1 
ATOM   2779  C CD    . GLN A 1 341 ? 46.726  18.058  42.607 1.00 18.58 ? 372  GLN A CD    1 
ATOM   2780  O OE1   . GLN A 1 341 ? 47.491  18.717  41.914 1.00 18.65 ? 372  GLN A OE1   1 
ATOM   2781  N NE2   . GLN A 1 341 ? 47.157  17.172  43.491 1.00 20.35 ? 372  GLN A NE2   1 
ATOM   2782  N N     . TYR A 1 342 ? 45.404  22.495  44.512 1.00 19.28 ? 373  TYR A N     1 
ATOM   2783  C CA    . TYR A 1 342 ? 45.070  23.905  44.601 1.00 18.25 ? 373  TYR A CA    1 
ATOM   2784  C C     . TYR A 1 342 ? 45.132  24.528  43.229 1.00 18.28 ? 373  TYR A C     1 
ATOM   2785  O O     . TYR A 1 342 ? 46.029  25.306  42.906 1.00 18.54 ? 373  TYR A O     1 
ATOM   2786  C CB    . TYR A 1 342 ? 46.008  24.623  45.566 1.00 16.95 ? 373  TYR A CB    1 
ATOM   2787  C CG    . TYR A 1 342 ? 45.755  24.199  46.984 1.00 18.64 ? 373  TYR A CG    1 
ATOM   2788  C CD1   . TYR A 1 342 ? 46.614  23.310  47.627 1.00 18.57 ? 373  TYR A CD1   1 
ATOM   2789  C CD2   . TYR A 1 342 ? 44.619  24.627  47.665 1.00 18.38 ? 373  TYR A CD2   1 
ATOM   2790  C CE1   . TYR A 1 342 ? 46.346  22.850  48.913 1.00 18.58 ? 373  TYR A CE1   1 
ATOM   2791  C CE2   . TYR A 1 342 ? 44.340  24.171  48.954 1.00 20.55 ? 373  TYR A CE2   1 
ATOM   2792  C CZ    . TYR A 1 342 ? 45.212  23.278  49.571 1.00 18.79 ? 373  TYR A CZ    1 
ATOM   2793  O OH    . TYR A 1 342 ? 44.956  22.802  50.841 1.00 21.41 ? 373  TYR A OH    1 
ATOM   2794  N N     . GLN A 1 343 ? 44.174  24.137  42.409 1.00 17.76 ? 374  GLN A N     1 
ATOM   2795  C CA    . GLN A 1 343 ? 44.055  24.657  41.069 1.00 18.00 ? 374  GLN A CA    1 
ATOM   2796  C C     . GLN A 1 343 ? 42.631  24.361  40.655 1.00 18.20 ? 374  GLN A C     1 
ATOM   2797  O O     . GLN A 1 343 ? 41.984  23.477  41.226 1.00 18.36 ? 374  GLN A O     1 
ATOM   2798  C CB    . GLN A 1 343 ? 45.049  23.972  40.127 1.00 18.62 ? 374  GLN A CB    1 
ATOM   2799  C CG    . GLN A 1 343 ? 44.668  22.567  39.698 1.00 20.27 ? 374  GLN A CG    1 
ATOM   2800  C CD    . GLN A 1 343 ? 45.706  21.968  38.784 1.00 22.02 ? 374  GLN A CD    1 
ATOM   2801  O OE1   . GLN A 1 343 ? 45.478  21.807  37.585 1.00 23.31 ? 374  GLN A OE1   1 
ATOM   2802  N NE2   . GLN A 1 343 ? 46.862  21.637  39.344 1.00 21.43 ? 374  GLN A NE2   1 
ATOM   2803  N N     . ASN A 1 344 ? 42.140  25.101  39.670 1.00 18.48 ? 375  ASN A N     1 
ATOM   2804  C CA    . ASN A 1 344 ? 40.784  24.915  39.207 1.00 18.42 ? 375  ASN A CA    1 
ATOM   2805  C C     . ASN A 1 344 ? 40.600  25.459  37.814 1.00 18.37 ? 375  ASN A C     1 
ATOM   2806  O O     . ASN A 1 344 ? 41.217  26.449  37.430 1.00 19.90 ? 375  ASN A O     1 
ATOM   2807  C CB    . ASN A 1 344 ? 39.801  25.626  40.149 1.00 17.40 ? 375  ASN A CB    1 
ATOM   2808  C CG    . ASN A 1 344 ? 38.359  25.472  39.706 1.00 17.67 ? 375  ASN A CG    1 
ATOM   2809  O OD1   . ASN A 1 344 ? 37.845  24.346  39.589 1.00 16.73 ? 375  ASN A OD1   1 
ATOM   2810  N ND2   . ASN A 1 344 ? 37.698  26.600  39.445 1.00 15.46 ? 375  ASN A ND2   1 
ATOM   2811  N N     . ARG A 1 345 ? 39.735  24.798  37.061 1.00 18.67 ? 376  ARG A N     1 
ATOM   2812  C CA    . ARG A 1 345 ? 39.394  25.223  35.715 1.00 19.57 ? 376  ARG A CA    1 
ATOM   2813  C C     . ARG A 1 345 ? 37.868  25.163  35.666 1.00 20.91 ? 376  ARG A C     1 
ATOM   2814  O O     . ARG A 1 345 ? 37.264  24.109  35.914 1.00 21.81 ? 376  ARG A O     1 
ATOM   2815  C CB    . ARG A 1 345 ? 39.987  24.277  34.680 1.00 17.54 ? 376  ARG A CB    1 
ATOM   2816  C CG    . ARG A 1 345 ? 39.987  24.852  33.263 1.00 18.52 ? 376  ARG A CG    1 
ATOM   2817  C CD    . ARG A 1 345 ? 41.277  25.661  32.965 1.00 19.18 ? 376  ARG A CD    1 
ATOM   2818  N NE    . ARG A 1 345 ? 42.476  24.873  33.255 1.00 20.52 ? 376  ARG A NE    1 
ATOM   2819  C CZ    . ARG A 1 345 ? 43.182  24.269  32.309 1.00 20.94 ? 376  ARG A CZ    1 
ATOM   2820  N NH1   . ARG A 1 345 ? 42.803  24.379  31.039 1.00 16.80 ? 376  ARG A NH1   1 
ATOM   2821  N NH2   . ARG A 1 345 ? 44.198  23.484  32.629 1.00 24.42 ? 376  ARG A NH2   1 
ATOM   2822  N N     . ILE A 1 346 ? 37.237  26.286  35.349 1.00 21.34 ? 377  ILE A N     1 
ATOM   2823  C CA    . ILE A 1 346 ? 35.790  26.317  35.322 1.00 21.08 ? 377  ILE A CA    1 
ATOM   2824  C C     . ILE A 1 346 ? 35.159  25.467  34.237 1.00 21.70 ? 377  ILE A C     1 
ATOM   2825  O O     . ILE A 1 346 ? 35.497  25.577  33.057 1.00 21.61 ? 377  ILE A O     1 
ATOM   2826  C CB    . ILE A 1 346 ? 35.287  27.749  35.257 1.00 21.35 ? 377  ILE A CB    1 
ATOM   2827  C CG1   . ILE A 1 346 ? 35.172  28.272  36.687 1.00 21.84 ? 377  ILE A CG1   1 
ATOM   2828  C CG2   . ILE A 1 346 ? 33.895  27.811  34.625 1.00 22.57 ? 377  ILE A CG2   1 
ATOM   2829  C CD1   . ILE A 1 346 ? 35.926  29.508  36.916 1.00 21.90 ? 377  ILE A CD1   1 
ATOM   2830  N N     . ALA A 1 347 ? 34.234  24.609  34.675 1.00 21.33 ? 378  ALA A N     1 
ATOM   2831  C CA    . ALA A 1 347 ? 33.528  23.684  33.800 1.00 20.21 ? 378  ALA A CA    1 
ATOM   2832  C C     . ALA A 1 347 ? 32.324  24.310  33.110 1.00 19.53 ? 378  ALA A C     1 
ATOM   2833  O O     . ALA A 1 347 ? 31.589  25.096  33.701 1.00 17.08 ? 378  ALA A O     1 
ATOM   2834  C CB    . ALA A 1 347 ? 33.091  22.456  34.589 1.00 19.67 ? 378  ALA A CB    1 
ATOM   2835  N N     . SER A 1 348 ? 32.143  23.947  31.844 1.00 19.50 ? 379  SER A N     1 
ATOM   2836  C CA    . SER A 1 348 ? 31.031  24.436  31.053 1.00 20.06 ? 379  SER A CA    1 
ATOM   2837  C C     . SER A 1 348 ? 29.745  24.052  31.780 1.00 20.07 ? 379  SER A C     1 
ATOM   2838  O O     . SER A 1 348 ? 28.820  24.851  31.888 1.00 21.82 ? 379  SER A O     1 
ATOM   2839  C CB    . SER A 1 348 ? 31.075  23.801  29.655 1.00 18.89 ? 379  SER A CB    1 
ATOM   2840  O OG    . SER A 1 348 ? 29.961  24.191  28.888 1.00 18.17 ? 379  SER A OG    1 
ATOM   2841  N N     . GLU A 1 349 ? 29.710  22.826  32.295 1.00 21.32 ? 380  GLU A N     1 
ATOM   2842  C CA    . GLU A 1 349 ? 28.550  22.313  33.014 1.00 21.32 ? 380  GLU A CA    1 
ATOM   2843  C C     . GLU A 1 349 ? 28.216  23.096  34.274 1.00 21.93 ? 380  GLU A C     1 
ATOM   2844  O O     . GLU A 1 349 ? 27.053  23.194  34.665 1.00 22.96 ? 380  GLU A O     1 
ATOM   2845  C CB    . GLU A 1 349 ? 28.760  20.845  33.366 1.00 21.23 ? 380  GLU A CB    1 
ATOM   2846  C CG    . GLU A 1 349 ? 28.779  19.935  32.147 1.00 22.42 ? 380  GLU A CG    1 
ATOM   2847  C CD    . GLU A 1 349 ? 30.188  19.620  31.693 1.00 23.30 ? 380  GLU A CD    1 
ATOM   2848  O OE1   . GLU A 1 349 ? 31.119  20.311  32.136 1.00 23.88 ? 380  GLU A OE1   1 
ATOM   2849  O OE2   . GLU A 1 349 ? 30.375  18.684  30.899 1.00 24.16 ? 380  GLU A OE2   1 
ATOM   2850  N N     . PHE A 1 350 ? 29.235  23.643  34.920 1.00 22.53 ? 381  PHE A N     1 
ATOM   2851  C CA    . PHE A 1 350 ? 29.002  24.431  36.119 1.00 21.93 ? 381  PHE A CA    1 
ATOM   2852  C C     . PHE A 1 350 ? 28.278  25.694  35.689 1.00 21.16 ? 381  PHE A C     1 
ATOM   2853  O O     . PHE A 1 350 ? 27.407  26.197  36.383 1.00 20.62 ? 381  PHE A O     1 
ATOM   2854  C CB    . PHE A 1 350 ? 30.330  24.795  36.780 1.00 21.78 ? 381  PHE A CB    1 
ATOM   2855  C CG    . PHE A 1 350 ? 30.182  25.384  38.161 1.00 20.99 ? 381  PHE A CG    1 
ATOM   2856  C CD1   . PHE A 1 350 ? 29.177  24.945  39.030 1.00 19.45 ? 381  PHE A CD1   1 
ATOM   2857  C CD2   . PHE A 1 350 ? 31.051  26.382  38.595 1.00 19.76 ? 381  PHE A CD2   1 
ATOM   2858  C CE1   . PHE A 1 350 ? 29.047  25.500  40.318 1.00 18.79 ? 381  PHE A CE1   1 
ATOM   2859  C CE2   . PHE A 1 350 ? 30.926  26.943  39.879 1.00 19.87 ? 381  PHE A CE2   1 
ATOM   2860  C CZ    . PHE A 1 350 ? 29.918  26.497  40.741 1.00 17.70 ? 381  PHE A CZ    1 
ATOM   2861  N N     . ASN A 1 351 ? 28.647  26.206  34.526 1.00 23.05 ? 382  ASN A N     1 
ATOM   2862  C CA    . ASN A 1 351 ? 28.021  27.406  34.008 1.00 23.96 ? 382  ASN A CA    1 
ATOM   2863  C C     . ASN A 1 351 ? 26.560  27.128  33.661 1.00 24.25 ? 382  ASN A C     1 
ATOM   2864  O O     . ASN A 1 351 ? 25.665  27.908  33.991 1.00 24.67 ? 382  ASN A O     1 
ATOM   2865  C CB    . ASN A 1 351 ? 28.755  27.880  32.763 1.00 23.86 ? 382  ASN A CB    1 
ATOM   2866  C CG    . ASN A 1 351 ? 28.201  29.176  32.239 1.00 24.28 ? 382  ASN A CG    1 
ATOM   2867  O OD1   . ASN A 1 351 ? 27.206  29.683  32.744 1.00 28.39 ? 382  ASN A OD1   1 
ATOM   2868  N ND2   . ASN A 1 351 ? 28.843  29.729  31.234 1.00 26.28 ? 382  ASN A ND2   1 
ATOM   2869  N N     . THR A 1 352 ? 26.324  26.003  32.999 1.00 22.92 ? 383  THR A N     1 
ATOM   2870  C CA    . THR A 1 352 ? 24.984  25.612  32.594 1.00 22.97 ? 383  THR A CA    1 
ATOM   2871  C C     . THR A 1 352 ? 24.028  25.434  33.765 1.00 22.09 ? 383  THR A C     1 
ATOM   2872  O O     . THR A 1 352 ? 22.956  26.027  33.803 1.00 20.93 ? 383  THR A O     1 
ATOM   2873  C CB    . THR A 1 352 ? 25.041  24.309  31.812 1.00 24.39 ? 383  THR A CB    1 
ATOM   2874  O OG1   . THR A 1 352 ? 25.724  24.539  30.575 1.00 25.74 ? 383  THR A OG1   1 
ATOM   2875  C CG2   . THR A 1 352 ? 23.635  23.788  31.528 1.00 25.67 ? 383  THR A CG2   1 
ATOM   2876  N N     . LEU A 1 353 ? 24.423  24.602  34.717 1.00 22.02 ? 384  LEU A N     1 
ATOM   2877  C CA    . LEU A 1 353 ? 23.588  24.340  35.875 1.00 22.22 ? 384  LEU A CA    1 
ATOM   2878  C C     . LEU A 1 353 ? 23.298  25.611  36.659 1.00 22.53 ? 384  LEU A C     1 
ATOM   2879  O O     . LEU A 1 353 ? 22.272  25.712  37.343 1.00 22.38 ? 384  LEU A O     1 
ATOM   2880  C CB    . LEU A 1 353 ? 24.262  23.305  36.798 1.00 22.13 ? 384  LEU A CB    1 
ATOM   2881  C CG    . LEU A 1 353 ? 25.439  23.706  37.705 1.00 21.35 ? 384  LEU A CG    1 
ATOM   2882  C CD1   . LEU A 1 353 ? 24.965  24.299  39.024 1.00 19.99 ? 384  LEU A CD1   1 
ATOM   2883  C CD2   . LEU A 1 353 ? 26.278  22.480  37.972 1.00 21.49 ? 384  LEU A CD2   1 
ATOM   2884  N N     . TYR A 1 354 ? 24.203  26.582  36.552 1.00 23.11 ? 385  TYR A N     1 
ATOM   2885  C CA    . TYR A 1 354 ? 24.067  27.832  37.284 1.00 24.52 ? 385  TYR A CA    1 
ATOM   2886  C C     . TYR A 1 354 ? 23.086  28.833  36.685 1.00 25.88 ? 385  TYR A C     1 
ATOM   2887  O O     . TYR A 1 354 ? 22.927  29.919  37.225 1.00 27.14 ? 385  TYR A O     1 
ATOM   2888  C CB    . TYR A 1 354 ? 25.429  28.499  37.448 1.00 22.57 ? 385  TYR A CB    1 
ATOM   2889  C CG    . TYR A 1 354 ? 25.718  28.944  38.865 1.00 20.97 ? 385  TYR A CG    1 
ATOM   2890  C CD1   . TYR A 1 354 ? 26.720  28.332  39.612 1.00 20.48 ? 385  TYR A CD1   1 
ATOM   2891  C CD2   . TYR A 1 354 ? 25.011  29.988  39.443 1.00 17.86 ? 385  TYR A CD2   1 
ATOM   2892  C CE1   . TYR A 1 354 ? 27.018  28.750  40.903 1.00 21.64 ? 385  TYR A CE1   1 
ATOM   2893  C CE2   . TYR A 1 354 ? 25.292  30.414  40.720 1.00 19.38 ? 385  TYR A CE2   1 
ATOM   2894  C CZ    . TYR A 1 354 ? 26.301  29.793  41.457 1.00 21.39 ? 385  TYR A CZ    1 
ATOM   2895  O OH    . TYR A 1 354 ? 26.591  30.209  42.749 1.00 22.21 ? 385  TYR A OH    1 
ATOM   2896  N N     . HIS A 1 355 ? 22.439  28.491  35.573 1.00 26.10 ? 386  HIS A N     1 
ATOM   2897  C CA    . HIS A 1 355 ? 21.458  29.399  34.976 1.00 26.16 ? 386  HIS A CA    1 
ATOM   2898  C C     . HIS A 1 355 ? 20.185  29.331  35.820 1.00 25.74 ? 386  HIS A C     1 
ATOM   2899  O O     . HIS A 1 355 ? 19.175  28.742  35.435 1.00 24.95 ? 386  HIS A O     1 
ATOM   2900  C CB    . HIS A 1 355 ? 21.180  28.997  33.530 1.00 28.67 ? 386  HIS A CB    1 
ATOM   2901  C CG    . HIS A 1 355 ? 22.357  29.200  32.627 1.00 32.48 ? 386  HIS A CG    1 
ATOM   2902  N ND1   . HIS A 1 355 ? 22.816  30.448  32.277 1.00 34.00 ? 386  HIS A ND1   1 
ATOM   2903  C CD2   . HIS A 1 355 ? 23.167  28.312  32.005 1.00 34.89 ? 386  HIS A CD2   1 
ATOM   2904  C CE1   . HIS A 1 355 ? 23.856  30.326  31.477 1.00 33.97 ? 386  HIS A CE1   1 
ATOM   2905  N NE2   . HIS A 1 355 ? 24.091  29.040  31.293 1.00 34.45 ? 386  HIS A NE2   1 
ATOM   2906  N N     . TRP A 1 356 ? 20.263  29.953  36.990 1.00 24.65 ? 387  TRP A N     1 
ATOM   2907  C CA    . TRP A 1 356 ? 19.182  29.968  37.958 1.00 22.56 ? 387  TRP A CA    1 
ATOM   2908  C C     . TRP A 1 356 ? 18.206  31.117  37.741 1.00 25.66 ? 387  TRP A C     1 
ATOM   2909  O O     . TRP A 1 356 ? 17.897  31.852  38.686 1.00 26.52 ? 387  TRP A O     1 
ATOM   2910  C CB    . TRP A 1 356 ? 19.772  30.085  39.356 1.00 19.00 ? 387  TRP A CB    1 
ATOM   2911  C CG    . TRP A 1 356 ? 20.700  28.986  39.727 1.00 15.32 ? 387  TRP A CG    1 
ATOM   2912  C CD1   . TRP A 1 356 ? 20.835  27.773  39.106 1.00 14.69 ? 387  TRP A CD1   1 
ATOM   2913  C CD2   . TRP A 1 356 ? 21.543  28.946  40.883 1.00 13.58 ? 387  TRP A CD2   1 
ATOM   2914  N NE1   . TRP A 1 356 ? 21.705  26.975  39.821 1.00 14.49 ? 387  TRP A NE1   1 
ATOM   2915  C CE2   . TRP A 1 356 ? 22.153  27.671  40.919 1.00 13.27 ? 387  TRP A CE2   1 
ATOM   2916  C CE3   . TRP A 1 356 ? 21.835  29.868  41.904 1.00 12.87 ? 387  TRP A CE3   1 
ATOM   2917  C CZ2   . TRP A 1 356 ? 23.046  27.285  41.933 1.00 14.45 ? 387  TRP A CZ2   1 
ATOM   2918  C CZ3   . TRP A 1 356 ? 22.720  29.488  42.921 1.00 13.16 ? 387  TRP A CZ3   1 
ATOM   2919  C CH2   . TRP A 1 356 ? 23.314  28.201  42.924 1.00 13.42 ? 387  TRP A CH2   1 
ATOM   2920  N N     . HIS A 1 357 ? 17.694  31.267  36.521 1.00 26.75 ? 388  HIS A N     1 
ATOM   2921  C CA    . HIS A 1 357 ? 16.765  32.365  36.229 1.00 27.75 ? 388  HIS A CA    1 
ATOM   2922  C C     . HIS A 1 357 ? 15.398  32.336  36.936 1.00 25.81 ? 388  HIS A C     1 
ATOM   2923  O O     . HIS A 1 357 ? 14.827  33.386  37.228 1.00 25.80 ? 388  HIS A O     1 
ATOM   2924  C CB    . HIS A 1 357 ? 16.642  32.503  34.712 1.00 32.12 ? 388  HIS A CB    1 
ATOM   2925  C CG    . HIS A 1 357 ? 17.975  32.647  34.037 1.00 36.38 ? 388  HIS A CG    1 
ATOM   2926  N ND1   . HIS A 1 357 ? 18.804  33.728  34.269 1.00 39.17 ? 388  HIS A ND1   1 
ATOM   2927  C CD2   . HIS A 1 357 ? 18.680  31.795  33.252 1.00 38.30 ? 388  HIS A CD2   1 
ATOM   2928  C CE1   . HIS A 1 357 ? 19.962  33.532  33.656 1.00 38.81 ? 388  HIS A CE1   1 
ATOM   2929  N NE2   . HIS A 1 357 ? 19.910  32.370  33.036 1.00 39.19 ? 388  HIS A NE2   1 
ATOM   2930  N N     . PRO A 1 358 ? 14.869  31.143  37.245 1.00 24.41 ? 389  PRO A N     1 
ATOM   2931  C CA    . PRO A 1 358 ? 13.576  31.110  37.934 1.00 24.11 ? 389  PRO A CA    1 
ATOM   2932  C C     . PRO A 1 358 ? 13.649  31.887  39.247 1.00 25.48 ? 389  PRO A C     1 
ATOM   2933  O O     . PRO A 1 358 ? 12.634  32.115  39.908 1.00 26.72 ? 389  PRO A O     1 
ATOM   2934  C CB    . PRO A 1 358 ? 13.340  29.626  38.191 1.00 24.08 ? 389  PRO A CB    1 
ATOM   2935  C CG    . PRO A 1 358 ? 14.155  28.935  37.171 1.00 23.89 ? 389  PRO A CG    1 
ATOM   2936  C CD    . PRO A 1 358 ? 15.373  29.788  36.974 1.00 24.53 ? 389  PRO A CD    1 
ATOM   2937  N N     . LEU A 1 359 ? 14.856  32.285  39.630 1.00 23.58 ? 390  LEU A N     1 
ATOM   2938  C CA    . LEU A 1 359 ? 15.043  33.019  40.870 1.00 22.79 ? 390  LEU A CA    1 
ATOM   2939  C C     . LEU A 1 359 ? 14.449  34.397  40.736 1.00 23.79 ? 390  LEU A C     1 
ATOM   2940  O O     . LEU A 1 359 ? 13.959  34.975  41.707 1.00 23.64 ? 390  LEU A O     1 
ATOM   2941  C CB    . LEU A 1 359 ? 16.536  33.174  41.198 1.00 23.98 ? 390  LEU A CB    1 
ATOM   2942  C CG    . LEU A 1 359 ? 17.318  32.194  42.082 1.00 23.87 ? 390  LEU A CG    1 
ATOM   2943  C CD1   . LEU A 1 359 ? 18.790  32.652  42.094 1.00 25.14 ? 390  LEU A CD1   1 
ATOM   2944  C CD2   . LEU A 1 359 ? 16.763  32.160  43.486 1.00 21.32 ? 390  LEU A CD2   1 
ATOM   2945  N N     . LEU A 1 360 ? 14.510  34.929  39.522 1.00 24.47 ? 391  LEU A N     1 
ATOM   2946  C CA    . LEU A 1 360 ? 14.013  36.272  39.259 1.00 25.66 ? 391  LEU A CA    1 
ATOM   2947  C C     . LEU A 1 360 ? 12.527  36.470  39.473 1.00 26.19 ? 391  LEU A C     1 
ATOM   2948  O O     . LEU A 1 360 ? 11.708  35.665  39.032 1.00 25.86 ? 391  LEU A O     1 
ATOM   2949  C CB    . LEU A 1 360 ? 14.384  36.678  37.841 1.00 26.19 ? 391  LEU A CB    1 
ATOM   2950  C CG    . LEU A 1 360 ? 15.873  36.972  37.675 1.00 27.31 ? 391  LEU A CG    1 
ATOM   2951  C CD1   . LEU A 1 360 ? 16.121  37.443  36.245 1.00 27.18 ? 391  LEU A CD1   1 
ATOM   2952  C CD2   . LEU A 1 360 ? 16.310  38.034  38.697 1.00 25.95 ? 391  LEU A CD2   1 
ATOM   2953  N N     . PRO A 1 361 ? 12.159  37.564  40.151 1.00 26.74 ? 392  PRO A N     1 
ATOM   2954  C CA    . PRO A 1 361 ? 10.751  37.865  40.418 1.00 28.72 ? 392  PRO A CA    1 
ATOM   2955  C C     . PRO A 1 361 ? 10.127  38.439  39.157 1.00 29.34 ? 392  PRO A C     1 
ATOM   2956  O O     . PRO A 1 361 ? 10.820  38.647  38.165 1.00 30.30 ? 392  PRO A O     1 
ATOM   2957  C CB    . PRO A 1 361 ? 10.825  38.896  41.537 1.00 28.81 ? 392  PRO A CB    1 
ATOM   2958  C CG    . PRO A 1 361 ? 12.079  39.653  41.211 1.00 27.08 ? 392  PRO A CG    1 
ATOM   2959  C CD    . PRO A 1 361 ? 13.046  38.608  40.695 1.00 27.30 ? 392  PRO A CD    1 
ATOM   2960  N N     . ASP A 1 362 ? 8.829   38.701  39.187 1.00 30.76 ? 393  ASP A N     1 
ATOM   2961  C CA    . ASP A 1 362 ? 8.180   39.271  38.019 1.00 32.33 ? 393  ASP A CA    1 
ATOM   2962  C C     . ASP A 1 362 ? 8.399   40.785  37.972 1.00 32.34 ? 393  ASP A C     1 
ATOM   2963  O O     . ASP A 1 362 ? 8.391   41.391  36.900 1.00 32.86 ? 393  ASP A O     1 
ATOM   2964  C CB    . ASP A 1 362 ? 6.700   38.924  38.036 1.00 34.24 ? 393  ASP A CB    1 
ATOM   2965  C CG    . ASP A 1 362 ? 6.455   37.447  37.764 1.00 34.53 ? 393  ASP A CG    1 
ATOM   2966  O OD1   . ASP A 1 362 ? 5.807   36.791  38.607 1.00 34.60 ? 393  ASP A OD1   1 
ATOM   2967  O OD2   . ASP A 1 362 ? 6.916   36.948  36.710 1.00 34.99 ? 393  ASP A OD2   1 
ATOM   2968  N N     . THR A 1 363 ? 8.591   41.388  39.141 1.00 31.62 ? 394  THR A N     1 
ATOM   2969  C CA    . THR A 1 363 ? 8.874   42.814  39.236 1.00 31.51 ? 394  THR A CA    1 
ATOM   2970  C C     . THR A 1 363 ? 9.851   43.000  40.377 1.00 31.31 ? 394  THR A C     1 
ATOM   2971  O O     . THR A 1 363 ? 9.963   42.138  41.241 1.00 31.98 ? 394  THR A O     1 
ATOM   2972  C CB    . THR A 1 363 ? 7.616   43.653  39.525 1.00 31.28 ? 394  THR A CB    1 
ATOM   2973  O OG1   . THR A 1 363 ? 6.996   43.204  40.731 1.00 31.25 ? 394  THR A OG1   1 
ATOM   2974  C CG2   . THR A 1 363 ? 6.637   43.539  38.383 1.00 31.49 ? 394  THR A CG2   1 
ATOM   2975  N N     . PHE A 1 364 ? 10.572  44.115  40.374 1.00 31.16 ? 395  PHE A N     1 
ATOM   2976  C CA    . PHE A 1 364 ? 11.536  44.401  41.434 1.00 29.83 ? 395  PHE A CA    1 
ATOM   2977  C C     . PHE A 1 364 ? 10.988  45.482  42.341 1.00 30.65 ? 395  PHE A C     1 
ATOM   2978  O O     . PHE A 1 364 ? 10.856  46.640  41.949 1.00 31.17 ? 395  PHE A O     1 
ATOM   2979  C CB    . PHE A 1 364 ? 12.870  44.836  40.838 1.00 28.19 ? 395  PHE A CB    1 
ATOM   2980  C CG    . PHE A 1 364 ? 13.502  43.784  39.992 1.00 26.54 ? 395  PHE A CG    1 
ATOM   2981  C CD1   . PHE A 1 364 ? 13.290  43.764  38.621 1.00 25.00 ? 395  PHE A CD1   1 
ATOM   2982  C CD2   . PHE A 1 364 ? 14.246  42.766  40.572 1.00 26.90 ? 395  PHE A CD2   1 
ATOM   2983  C CE1   . PHE A 1 364 ? 13.800  42.740  37.838 1.00 25.75 ? 395  PHE A CE1   1 
ATOM   2984  C CE2   . PHE A 1 364 ? 14.766  41.731  39.797 1.00 26.66 ? 395  PHE A CE2   1 
ATOM   2985  C CZ    . PHE A 1 364 ? 14.542  41.716  38.431 1.00 26.13 ? 395  PHE A CZ    1 
ATOM   2986  N N     . ASN A 1 365 ? 10.662  45.086  43.562 1.00 32.01 ? 396  ASN A N     1 
ATOM   2987  C CA    . ASN A 1 365 ? 10.102  46.007  44.523 1.00 32.75 ? 396  ASN A CA    1 
ATOM   2988  C C     . ASN A 1 365 ? 11.164  46.673  45.380 1.00 34.23 ? 396  ASN A C     1 
ATOM   2989  O O     . ASN A 1 365 ? 11.780  46.017  46.212 1.00 34.30 ? 396  ASN A O     1 
ATOM   2990  C CB    . ASN A 1 365 ? 9.107   45.271  45.425 1.00 32.86 ? 396  ASN A CB    1 
ATOM   2991  C CG    . ASN A 1 365 ? 8.206   44.320  44.656 1.00 33.01 ? 396  ASN A CG    1 
ATOM   2992  O OD1   . ASN A 1 365 ? 8.045   44.436  43.438 1.00 34.45 ? 396  ASN A OD1   1 
ATOM   2993  N ND2   . ASN A 1 365 ? 7.611   43.375  45.364 1.00 31.36 ? 396  ASN A ND2   1 
ATOM   2994  N N     . ILE A 1 366 ? 11.383  47.969  45.166 1.00 36.06 ? 397  ILE A N     1 
ATOM   2995  C CA    . ILE A 1 366 ? 12.346  48.730  45.962 1.00 37.50 ? 397  ILE A CA    1 
ATOM   2996  C C     . ILE A 1 366 ? 11.581  49.835  46.679 1.00 40.26 ? 397  ILE A C     1 
ATOM   2997  O O     . ILE A 1 366 ? 11.017  50.730  46.050 1.00 39.75 ? 397  ILE A O     1 
ATOM   2998  C CB    . ILE A 1 366 ? 13.474  49.368  45.104 1.00 35.58 ? 397  ILE A CB    1 
ATOM   2999  C CG1   . ILE A 1 366 ? 14.508  48.309  44.743 1.00 33.69 ? 397  ILE A CG1   1 
ATOM   3000  C CG2   . ILE A 1 366 ? 14.201  50.444  45.914 1.00 35.05 ? 397  ILE A CG2   1 
ATOM   3001  C CD1   . ILE A 1 366 ? 14.542  47.978  43.290 1.00 34.40 ? 397  ILE A CD1   1 
ATOM   3002  N N     . GLU A 1 367 ? 11.557  49.754  48.002 1.00 42.60 ? 398  GLU A N     1 
ATOM   3003  C CA    . GLU A 1 367 ? 10.856  50.724  48.822 1.00 45.95 ? 398  GLU A CA    1 
ATOM   3004  C C     . GLU A 1 367 ? 9.367   50.750  48.520 1.00 47.95 ? 398  GLU A C     1 
ATOM   3005  O O     . GLU A 1 367 ? 8.615   49.936  49.062 1.00 48.59 ? 398  GLU A O     1 
ATOM   3006  C CB    . GLU A 1 367 ? 11.428  52.125  48.634 1.00 46.47 ? 398  GLU A CB    1 
ATOM   3007  C CG    . GLU A 1 367 ? 11.388  52.942  49.913 1.00 50.42 ? 398  GLU A CG    1 
ATOM   3008  C CD    . GLU A 1 367 ? 11.993  54.327  49.755 1.00 52.60 ? 398  GLU A CD    1 
ATOM   3009  O OE1   . GLU A 1 367 ? 12.769  54.539  48.797 1.00 53.25 ? 398  GLU A OE1   1 
ATOM   3010  O OE2   . GLU A 1 367 ? 11.690  55.207  50.593 1.00 55.46 ? 398  GLU A OE2   1 
ATOM   3011  N N     . ASP A 1 368 ? 8.944   51.650  47.652 1.00 50.02 ? 399  ASP A N     1 
ATOM   3012  C CA    . ASP A 1 368 ? 7.517   51.774  47.334 1.00 51.33 ? 399  ASP A CA    1 
ATOM   3013  C C     . ASP A 1 368 ? 7.153   51.477  45.894 1.00 49.73 ? 399  ASP A C     1 
ATOM   3014  O O     . ASP A 1 368 ? 5.990   51.290  45.561 1.00 50.05 ? 399  ASP A O     1 
ATOM   3015  C CB    . ASP A 1 368 ? 7.018   53.174  47.724 1.00 56.68 ? 399  ASP A CB    1 
ATOM   3016  C CG    . ASP A 1 368 ? 7.296   53.502  49.193 1.00 61.47 ? 399  ASP A CG    1 
ATOM   3017  O OD1   . ASP A 1 368 ? 7.378   52.540  50.004 1.00 64.41 ? 399  ASP A OD1   1 
ATOM   3018  O OD2   . ASP A 1 368 ? 7.438   54.702  49.550 1.00 63.80 ? 399  ASP A OD2   1 
ATOM   3019  N N     . GLN A 1 369 ? 8.174   51.418  45.043 1.00 47.19 ? 400  GLN A N     1 
ATOM   3020  C CA    . GLN A 1 369 ? 7.969   51.149  43.645 1.00 44.45 ? 400  GLN A CA    1 
ATOM   3021  C C     . GLN A 1 369 ? 8.064   49.680  43.319 1.00 41.94 ? 400  GLN A C     1 
ATOM   3022  O O     . GLN A 1 369 ? 8.511   48.865  44.116 1.00 41.51 ? 400  GLN A O     1 
ATOM   3023  C CB    . GLN A 1 369 ? 9.024   51.881  42.819 1.00 45.70 ? 400  GLN A CB    1 
ATOM   3024  C CG    . GLN A 1 369 ? 9.276   53.293  43.263 1.00 45.78 ? 400  GLN A CG    1 
ATOM   3025  C CD    . GLN A 1 369 ? 8.097   54.180  42.967 1.00 47.42 ? 400  GLN A CD    1 
ATOM   3026  O OE1   . GLN A 1 369 ? 8.040   54.832  41.919 1.00 48.09 ? 400  GLN A OE1   1 
ATOM   3027  N NE2   . GLN A 1 369 ? 7.134   54.202  43.881 1.00 49.22 ? 400  GLN A NE2   1 
ATOM   3028  N N     . GLU A 1 370 ? 7.628   49.366  42.112 1.00 40.34 ? 401  GLU A N     1 
ATOM   3029  C CA    . GLU A 1 370 ? 7.690   48.029  41.549 1.00 38.93 ? 401  GLU A CA    1 
ATOM   3030  C C     . GLU A 1 370 ? 8.165   48.351  40.146 1.00 36.67 ? 401  GLU A C     1 
ATOM   3031  O O     . GLU A 1 370 ? 7.540   49.142  39.445 1.00 36.84 ? 401  GLU A O     1 
ATOM   3032  C CB    . GLU A 1 370 ? 6.316   47.368  41.525 1.00 39.24 ? 401  GLU A CB    1 
ATOM   3033  C CG    . GLU A 1 370 ? 5.942   46.811  42.888 1.00 41.96 ? 401  GLU A CG    1 
ATOM   3034  C CD    . GLU A 1 370 ? 4.748   45.878  42.853 1.00 43.20 ? 401  GLU A CD    1 
ATOM   3035  O OE1   . GLU A 1 370 ? 4.430   45.297  43.924 1.00 44.17 ? 401  GLU A OE1   1 
ATOM   3036  O OE2   . GLU A 1 370 ? 4.136   45.730  41.763 1.00 44.38 ? 401  GLU A OE2   1 
ATOM   3037  N N     . TYR A 1 371 ? 9.300   47.790  39.759 1.00 33.91 ? 402  TYR A N     1 
ATOM   3038  C CA    . TYR A 1 371 ? 9.837   48.063  38.448 1.00 30.96 ? 402  TYR A CA    1 
ATOM   3039  C C     . TYR A 1 371 ? 9.778   46.817  37.646 1.00 30.55 ? 402  TYR A C     1 
ATOM   3040  O O     . TYR A 1 371 ? 10.025  45.734  38.165 1.00 30.50 ? 402  TYR A O     1 
ATOM   3041  C CB    . TYR A 1 371 ? 11.285  48.505  38.538 1.00 28.95 ? 402  TYR A CB    1 
ATOM   3042  C CG    . TYR A 1 371 ? 11.469  49.746  39.346 1.00 28.40 ? 402  TYR A CG    1 
ATOM   3043  C CD1   . TYR A 1 371 ? 11.406  51.000  38.753 1.00 28.65 ? 402  TYR A CD1   1 
ATOM   3044  C CD2   . TYR A 1 371 ? 11.721  49.676  40.707 1.00 28.68 ? 402  TYR A CD2   1 
ATOM   3045  C CE1   . TYR A 1 371 ? 11.595  52.165  39.501 1.00 27.57 ? 402  TYR A CE1   1 
ATOM   3046  C CE2   . TYR A 1 371 ? 11.912  50.832  41.466 1.00 29.02 ? 402  TYR A CE2   1 
ATOM   3047  C CZ    . TYR A 1 371 ? 11.848  52.069  40.854 1.00 28.49 ? 402  TYR A CZ    1 
ATOM   3048  O OH    . TYR A 1 371 ? 12.052  53.209  41.590 1.00 27.85 ? 402  TYR A OH    1 
ATOM   3049  N N     . SER A 1 372 ? 9.444   46.979  36.375 1.00 29.62 ? 403  SER A N     1 
ATOM   3050  C CA    . SER A 1 372 ? 9.374   45.864  35.463 1.00 29.98 ? 403  SER A CA    1 
ATOM   3051  C C     . SER A 1 372 ? 10.804  45.579  35.086 1.00 30.34 ? 403  SER A C     1 
ATOM   3052  O O     . SER A 1 372 ? 11.696  46.348  35.416 1.00 29.80 ? 403  SER A O     1 
ATOM   3053  C CB    . SER A 1 372 ? 8.597   46.264  34.216 1.00 30.05 ? 403  SER A CB    1 
ATOM   3054  O OG    . SER A 1 372 ? 9.271   47.304  33.542 1.00 28.42 ? 403  SER A OG    1 
ATOM   3055  N N     . PHE A 1 373 ? 11.019  44.473  34.396 1.00 33.26 ? 404  PHE A N     1 
ATOM   3056  C CA    . PHE A 1 373 ? 12.350  44.122  33.954 1.00 34.78 ? 404  PHE A CA    1 
ATOM   3057  C C     . PHE A 1 373 ? 12.892  45.248  33.087 1.00 36.37 ? 404  PHE A C     1 
ATOM   3058  O O     . PHE A 1 373 ? 14.072  45.600  33.160 1.00 37.49 ? 404  PHE A O     1 
ATOM   3059  C CB    . PHE A 1 373 ? 12.300  42.855  33.122 1.00 35.66 ? 404  PHE A CB    1 
ATOM   3060  C CG    . PHE A 1 373 ? 12.530  41.620  33.908 1.00 37.23 ? 404  PHE A CG    1 
ATOM   3061  C CD1   . PHE A 1 373 ? 11.603  41.213  34.856 1.00 37.21 ? 404  PHE A CD1   1 
ATOM   3062  C CD2   . PHE A 1 373 ? 13.676  40.861  33.709 1.00 38.12 ? 404  PHE A CD2   1 
ATOM   3063  C CE1   . PHE A 1 373 ? 11.807  40.060  35.603 1.00 38.79 ? 404  PHE A CE1   1 
ATOM   3064  C CE2   . PHE A 1 373 ? 13.895  39.704  34.449 1.00 38.48 ? 404  PHE A CE2   1 
ATOM   3065  C CZ    . PHE A 1 373 ? 12.956  39.304  35.401 1.00 39.37 ? 404  PHE A CZ    1 
ATOM   3066  N N     . LYS A 1 374 ? 12.013  45.816  32.268 1.00 38.60 ? 405  LYS A N     1 
ATOM   3067  C CA    . LYS A 1 374 ? 12.397  46.879  31.350 1.00 39.69 ? 405  LYS A CA    1 
ATOM   3068  C C     . LYS A 1 374 ? 12.891  48.164  31.990 1.00 38.97 ? 405  LYS A C     1 
ATOM   3069  O O     . LYS A 1 374 ? 13.923  48.692  31.587 1.00 39.71 ? 405  LYS A O     1 
ATOM   3070  C CB    . LYS A 1 374 ? 11.239  47.217  30.416 1.00 40.95 ? 405  LYS A CB    1 
ATOM   3071  C CG    . LYS A 1 374 ? 11.627  48.156  29.294 1.00 43.93 ? 405  LYS A CG    1 
ATOM   3072  C CD    . LYS A 1 374 ? 10.487  49.112  28.960 1.00 49.27 ? 405  LYS A CD    1 
ATOM   3073  C CE    . LYS A 1 374 ? 10.589  49.632  27.521 1.00 52.55 ? 405  LYS A CE    1 
ATOM   3074  N NZ    . LYS A 1 374 ? 9.260   49.735  26.835 1.00 53.30 ? 405  LYS A NZ    1 
ATOM   3075  N N     . GLN A 1 375 ? 12.145  48.680  32.962 1.00 39.06 ? 406  GLN A N     1 
ATOM   3076  C CA    . GLN A 1 375 ? 12.528  49.927  33.611 1.00 38.61 ? 406  GLN A CA    1 
ATOM   3077  C C     . GLN A 1 375 ? 13.589  49.726  34.674 1.00 38.02 ? 406  GLN A C     1 
ATOM   3078  O O     . GLN A 1 375 ? 14.016  50.676  35.318 1.00 38.60 ? 406  GLN A O     1 
ATOM   3079  C CB    . GLN A 1 375 ? 11.314  50.622  34.232 1.00 39.51 ? 406  GLN A CB    1 
ATOM   3080  C CG    . GLN A 1 375 ? 10.166  49.705  34.580 1.00 40.84 ? 406  GLN A CG    1 
ATOM   3081  C CD    . GLN A 1 375 ? 9.115   50.409  35.400 1.00 42.66 ? 406  GLN A CD    1 
ATOM   3082  O OE1   . GLN A 1 375 ? 8.495   49.820  36.284 1.00 42.68 ? 406  GLN A OE1   1 
ATOM   3083  N NE2   . GLN A 1 375 ? 8.915   51.688  35.118 1.00 44.79 ? 406  GLN A NE2   1 
ATOM   3084  N N     . PHE A 1 376 ? 14.021  48.489  34.855 1.00 36.64 ? 407  PHE A N     1 
ATOM   3085  C CA    . PHE A 1 376 ? 15.047  48.196  35.837 1.00 35.22 ? 407  PHE A CA    1 
ATOM   3086  C C     . PHE A 1 376 ? 16.385  48.032  35.130 1.00 36.58 ? 407  PHE A C     1 
ATOM   3087  O O     . PHE A 1 376 ? 17.426  48.428  35.642 1.00 36.26 ? 407  PHE A O     1 
ATOM   3088  C CB    . PHE A 1 376 ? 14.697  46.917  36.581 1.00 33.36 ? 407  PHE A CB    1 
ATOM   3089  C CG    . PHE A 1 376 ? 15.307  46.830  37.942 1.00 31.17 ? 407  PHE A CG    1 
ATOM   3090  C CD1   . PHE A 1 376 ? 15.036  47.797  38.891 1.00 30.45 ? 407  PHE A CD1   1 
ATOM   3091  C CD2   . PHE A 1 376 ? 16.148  45.773  38.281 1.00 29.98 ? 407  PHE A CD2   1 
ATOM   3092  C CE1   . PHE A 1 376 ? 15.589  47.715  40.160 1.00 30.32 ? 407  PHE A CE1   1 
ATOM   3093  C CE2   . PHE A 1 376 ? 16.704  45.685  39.543 1.00 29.04 ? 407  PHE A CE2   1 
ATOM   3094  C CZ    . PHE A 1 376 ? 16.424  46.657  40.487 1.00 29.03 ? 407  PHE A CZ    1 
ATOM   3095  N N     . LEU A 1 377 ? 16.341  47.452  33.939 1.00 38.20 ? 408  LEU A N     1 
ATOM   3096  C CA    . LEU A 1 377 ? 17.533  47.220  33.143 1.00 39.87 ? 408  LEU A CA    1 
ATOM   3097  C C     . LEU A 1 377 ? 18.221  48.496  32.726 1.00 40.46 ? 408  LEU A C     1 
ATOM   3098  O O     . LEU A 1 377 ? 17.611  49.362  32.108 1.00 39.34 ? 408  LEU A O     1 
ATOM   3099  C CB    . LEU A 1 377 ? 17.173  46.440  31.885 1.00 42.78 ? 408  LEU A CB    1 
ATOM   3100  C CG    . LEU A 1 377 ? 17.362  44.924  31.935 1.00 44.69 ? 408  LEU A CG    1 
ATOM   3101  C CD1   . LEU A 1 377 ? 18.631  44.555  31.188 1.00 46.11 ? 408  LEU A CD1   1 
ATOM   3102  C CD2   . LEU A 1 377 ? 17.430  44.445  33.386 1.00 47.37 ? 408  LEU A CD2   1 
ATOM   3103  N N     . TYR A 1 378 ? 19.501  48.595  33.059 1.00 41.14 ? 409  TYR A N     1 
ATOM   3104  C CA    . TYR A 1 378 ? 20.308  49.750  32.706 1.00 42.95 ? 409  TYR A CA    1 
ATOM   3105  C C     . TYR A 1 378 ? 19.864  51.045  33.369 1.00 43.23 ? 409  TYR A C     1 
ATOM   3106  O O     . TYR A 1 378 ? 20.096  52.131  32.835 1.00 43.27 ? 409  TYR A O     1 
ATOM   3107  C CB    . TYR A 1 378 ? 20.342  49.920  31.176 1.00 45.00 ? 409  TYR A CB    1 
ATOM   3108  C CG    . TYR A 1 378 ? 21.302  48.954  30.530 1.00 46.46 ? 409  TYR A CG    1 
ATOM   3109  C CD1   . TYR A 1 378 ? 20.841  47.912  29.728 1.00 46.90 ? 409  TYR A CD1   1 
ATOM   3110  C CD2   . TYR A 1 378 ? 22.663  48.993  30.848 1.00 46.88 ? 409  TYR A CD2   1 
ATOM   3111  C CE1   . TYR A 1 378 ? 21.711  46.922  29.278 1.00 47.99 ? 409  TYR A CE1   1 
ATOM   3112  C CE2   . TYR A 1 378 ? 23.535  48.016  30.406 1.00 46.88 ? 409  TYR A CE2   1 
ATOM   3113  C CZ    . TYR A 1 378 ? 23.060  46.978  29.632 1.00 48.05 ? 409  TYR A CZ    1 
ATOM   3114  O OH    . TYR A 1 378 ? 23.927  45.964  29.277 1.00 48.70 ? 409  TYR A OH    1 
ATOM   3115  N N     . ASN A 1 379 ? 19.248  50.949  34.541 1.00 43.41 ? 410  ASN A N     1 
ATOM   3116  C CA    . ASN A 1 379 ? 18.800  52.159  35.215 1.00 43.57 ? 410  ASN A CA    1 
ATOM   3117  C C     . ASN A 1 379 ? 19.495  52.378  36.556 1.00 42.45 ? 410  ASN A C     1 
ATOM   3118  O O     . ASN A 1 379 ? 18.946  52.047  37.609 1.00 41.25 ? 410  ASN A O     1 
ATOM   3119  C CB    . ASN A 1 379 ? 17.267  52.138  35.395 1.00 46.91 ? 410  ASN A CB    1 
ATOM   3120  C CG    . ASN A 1 379 ? 16.656  53.546  35.395 1.00 50.31 ? 410  ASN A CG    1 
ATOM   3121  O OD1   . ASN A 1 379 ? 17.274  54.461  35.925 1.00 50.48 ? 410  ASN A OD1   1 
ATOM   3122  N ND2   . ASN A 1 379 ? 15.470  53.728  34.804 1.00 54.33 ? 410  ASN A ND2   1 
ATOM   3123  N N     . ASN A 1 380 ? 20.699  52.953  36.509 1.00 41.05 ? 411  ASN A N     1 
ATOM   3124  C CA    . ASN A 1 380 ? 21.473  53.224  37.723 1.00 39.92 ? 411  ASN A CA    1 
ATOM   3125  C C     . ASN A 1 380 ? 20.893  54.383  38.535 1.00 37.60 ? 411  ASN A C     1 
ATOM   3126  O O     . ASN A 1 380 ? 21.291  54.591  39.692 1.00 38.11 ? 411  ASN A O     1 
ATOM   3127  C CB    . ASN A 1 380 ? 22.944  53.513  37.380 1.00 40.50 ? 411  ASN A CB    1 
ATOM   3128  C CG    . ASN A 1 380 ? 23.773  52.236  37.184 1.00 41.83 ? 411  ASN A CG    1 
ATOM   3129  O OD1   . ASN A 1 380 ? 23.460  51.172  37.744 1.00 41.57 ? 411  ASN A OD1   1 
ATOM   3130  N ND2   . ASN A 1 380 ? 24.833  52.339  36.378 1.00 40.88 ? 411  ASN A ND2   1 
ATOM   3131  N N     . SER A 1 381 ? 19.955  55.126  37.936 1.00 36.52 ? 412  SER A N     1 
ATOM   3132  C CA    . SER A 1 381 ? 19.308  56.244  38.624 1.00 34.83 ? 412  SER A CA    1 
ATOM   3133  C C     . SER A 1 381 ? 18.400  55.723  39.722 1.00 33.38 ? 412  SER A C     1 
ATOM   3134  O O     . SER A 1 381 ? 18.169  56.412  40.704 1.00 33.28 ? 412  SER A O     1 
ATOM   3135  C CB    . SER A 1 381 ? 18.480  57.102  37.673 1.00 34.85 ? 412  SER A CB    1 
ATOM   3136  O OG    . SER A 1 381 ? 18.407  56.523  36.392 1.00 37.18 ? 412  SER A OG    1 
ATOM   3137  N N     . ILE A 1 382 ? 17.879  54.509  39.549 1.00 33.65 ? 413  ILE A N     1 
ATOM   3138  C CA    . ILE A 1 382 ? 17.037  53.907  40.573 1.00 31.77 ? 413  ILE A CA    1 
ATOM   3139  C C     . ILE A 1 382 ? 17.899  53.705  41.824 1.00 31.34 ? 413  ILE A C     1 
ATOM   3140  O O     . ILE A 1 382 ? 17.454  53.952  42.944 1.00 30.75 ? 413  ILE A O     1 
ATOM   3141  C CB    . ILE A 1 382 ? 16.467  52.541  40.113 1.00 32.84 ? 413  ILE A CB    1 
ATOM   3142  C CG1   . ILE A 1 382 ? 15.607  52.736  38.865 1.00 32.71 ? 413  ILE A CG1   1 
ATOM   3143  C CG2   . ILE A 1 382 ? 15.612  51.915  41.223 1.00 32.11 ? 413  ILE A CG2   1 
ATOM   3144  C CD1   . ILE A 1 382 ? 15.239  51.451  38.165 1.00 33.94 ? 413  ILE A CD1   1 
ATOM   3145  N N     . LEU A 1 383 ? 19.140  53.263  41.631 1.00 31.26 ? 414  LEU A N     1 
ATOM   3146  C CA    . LEU A 1 383 ? 20.046  53.046  42.760 1.00 31.12 ? 414  LEU A CA    1 
ATOM   3147  C C     . LEU A 1 383 ? 20.389  54.371  43.447 1.00 31.16 ? 414  LEU A C     1 
ATOM   3148  O O     . LEU A 1 383 ? 20.349  54.471  44.675 1.00 30.48 ? 414  LEU A O     1 
ATOM   3149  C CB    . LEU A 1 383 ? 21.337  52.349  42.297 1.00 31.36 ? 414  LEU A CB    1 
ATOM   3150  C CG    . LEU A 1 383 ? 22.412  52.104  43.372 1.00 30.69 ? 414  LEU A CG    1 
ATOM   3151  C CD1   . LEU A 1 383 ? 21.886  51.152  44.430 1.00 29.20 ? 414  LEU A CD1   1 
ATOM   3152  C CD2   . LEU A 1 383 ? 23.675  51.524  42.732 1.00 30.53 ? 414  LEU A CD2   1 
ATOM   3153  N N     . LEU A 1 384 ? 20.722  55.387  42.657 1.00 31.59 ? 415  LEU A N     1 
ATOM   3154  C CA    . LEU A 1 384 ? 21.057  56.689  43.213 1.00 32.92 ? 415  LEU A CA    1 
ATOM   3155  C C     . LEU A 1 384 ? 19.816  57.310  43.829 1.00 33.39 ? 415  LEU A C     1 
ATOM   3156  O O     . LEU A 1 384 ? 19.896  58.033  44.826 1.00 34.64 ? 415  LEU A O     1 
ATOM   3157  C CB    . LEU A 1 384 ? 21.613  57.606  42.124 1.00 33.51 ? 415  LEU A CB    1 
ATOM   3158  C CG    . LEU A 1 384 ? 23.087  57.398  41.769 1.00 34.15 ? 415  LEU A CG    1 
ATOM   3159  C CD1   . LEU A 1 384 ? 23.529  58.444  40.766 1.00 35.18 ? 415  LEU A CD1   1 
ATOM   3160  C CD2   . LEU A 1 384 ? 23.926  57.502  43.008 1.00 34.21 ? 415  LEU A CD2   1 
ATOM   3161  N N     . GLU A 1 385 ? 18.666  57.005  43.237 1.00 33.77 ? 416  GLU A N     1 
ATOM   3162  C CA    . GLU A 1 385 ? 17.382  57.515  43.697 1.00 34.83 ? 416  GLU A CA    1 
ATOM   3163  C C     . GLU A 1 385 ? 16.999  56.991  45.070 1.00 33.61 ? 416  GLU A C     1 
ATOM   3164  O O     . GLU A 1 385 ? 16.626  57.755  45.956 1.00 35.44 ? 416  GLU A O     1 
ATOM   3165  C CB    . GLU A 1 385 ? 16.291  57.161  42.693 1.00 37.72 ? 416  GLU A CB    1 
ATOM   3166  C CG    . GLU A 1 385 ? 15.501  58.347  42.210 1.00 44.06 ? 416  GLU A CG    1 
ATOM   3167  C CD    . GLU A 1 385 ? 14.037  58.223  42.560 1.00 45.74 ? 416  GLU A CD    1 
ATOM   3168  O OE1   . GLU A 1 385 ? 13.506  57.095  42.475 1.00 47.54 ? 416  GLU A OE1   1 
ATOM   3169  O OE2   . GLU A 1 385 ? 13.419  59.248  42.921 1.00 49.41 ? 416  GLU A OE2   1 
ATOM   3170  N N     . HIS A 1 386 ? 17.099  55.684  45.253 1.00 30.97 ? 417  HIS A N     1 
ATOM   3171  C CA    . HIS A 1 386 ? 16.746  55.083  46.523 1.00 28.43 ? 417  HIS A CA    1 
ATOM   3172  C C     . HIS A 1 386 ? 17.913  55.002  47.480 1.00 28.86 ? 417  HIS A C     1 
ATOM   3173  O O     . HIS A 1 386 ? 17.739  55.152  48.678 1.00 29.02 ? 417  HIS A O     1 
ATOM   3174  C CB    . HIS A 1 386 ? 16.177  53.691  46.289 1.00 28.33 ? 417  HIS A CB    1 
ATOM   3175  C CG    . HIS A 1 386 ? 14.794  53.708  45.716 1.00 29.27 ? 417  HIS A CG    1 
ATOM   3176  N ND1   . HIS A 1 386 ? 14.544  53.613  44.365 1.00 30.24 ? 417  HIS A ND1   1 
ATOM   3177  C CD2   . HIS A 1 386 ? 13.588  53.847  46.311 1.00 29.08 ? 417  HIS A CD2   1 
ATOM   3178  C CE1   . HIS A 1 386 ? 13.245  53.700  44.151 1.00 27.90 ? 417  HIS A CE1   1 
ATOM   3179  N NE2   . HIS A 1 386 ? 12.643  53.841  45.319 1.00 28.05 ? 417  HIS A NE2   1 
ATOM   3180  N N     . GLY A 1 387 ? 19.106  54.764  46.949 1.00 27.70 ? 418  GLY A N     1 
ATOM   3181  C CA    . GLY A 1 387 ? 20.282  54.657  47.790 1.00 26.42 ? 418  GLY A CA    1 
ATOM   3182  C C     . GLY A 1 387 ? 20.510  53.209  48.178 1.00 25.39 ? 418  GLY A C     1 
ATOM   3183  O O     . GLY A 1 387 ? 19.578  52.395  48.144 1.00 25.18 ? 418  GLY A O     1 
ATOM   3184  N N     . LEU A 1 388 ? 21.745  52.887  48.553 1.00 23.77 ? 419  LEU A N     1 
ATOM   3185  C CA    . LEU A 1 388 ? 22.114  51.523  48.940 1.00 23.21 ? 419  LEU A CA    1 
ATOM   3186  C C     . LEU A 1 388 ? 21.322  50.989  50.141 1.00 23.53 ? 419  LEU A C     1 
ATOM   3187  O O     . LEU A 1 388 ? 20.957  49.817  50.175 1.00 21.42 ? 419  LEU A O     1 
ATOM   3188  C CB    . LEU A 1 388 ? 23.612  51.450  49.259 1.00 22.02 ? 419  LEU A CB    1 
ATOM   3189  C CG    . LEU A 1 388 ? 24.668  51.453  48.141 1.00 23.19 ? 419  LEU A CG    1 
ATOM   3190  C CD1   . LEU A 1 388 ? 25.005  50.041  47.811 1.00 23.78 ? 419  LEU A CD1   1 
ATOM   3191  C CD2   . LEU A 1 388 ? 24.189  52.155  46.899 1.00 23.20 ? 419  LEU A CD2   1 
ATOM   3192  N N     . THR A 1 389 ? 21.061  51.838  51.129 1.00 23.67 ? 420  THR A N     1 
ATOM   3193  C CA    . THR A 1 389 ? 20.315  51.405  52.304 1.00 24.87 ? 420  THR A CA    1 
ATOM   3194  C C     . THR A 1 389 ? 18.932  50.893  51.951 1.00 27.31 ? 420  THR A C     1 
ATOM   3195  O O     . THR A 1 389 ? 18.527  49.813  52.396 1.00 27.79 ? 420  THR A O     1 
ATOM   3196  C CB    . THR A 1 389 ? 20.136  52.527  53.309 1.00 24.79 ? 420  THR A CB    1 
ATOM   3197  O OG1   . THR A 1 389 ? 21.404  53.115  53.606 1.00 24.74 ? 420  THR A OG1   1 
ATOM   3198  C CG2   . THR A 1 389 ? 19.540  51.986  54.582 1.00 22.29 ? 420  THR A CG2   1 
ATOM   3199  N N     . GLN A 1 390 ? 18.204  51.667  51.152 1.00 28.90 ? 421  GLN A N     1 
ATOM   3200  C CA    . GLN A 1 390 ? 16.864  51.279  50.744 1.00 31.53 ? 421  GLN A CA    1 
ATOM   3201  C C     . GLN A 1 390 ? 16.958  50.040  49.873 1.00 29.64 ? 421  GLN A C     1 
ATOM   3202  O O     . GLN A 1 390 ? 16.169  49.111  50.014 1.00 31.08 ? 421  GLN A O     1 
ATOM   3203  C CB    . GLN A 1 390 ? 16.179  52.423  49.989 1.00 34.26 ? 421  GLN A CB    1 
ATOM   3204  C CG    . GLN A 1 390 ? 15.578  53.456  50.929 1.00 41.88 ? 421  GLN A CG    1 
ATOM   3205  C CD    . GLN A 1 390 ? 15.229  54.772  50.238 1.00 47.86 ? 421  GLN A CD    1 
ATOM   3206  O OE1   . GLN A 1 390 ? 15.327  54.889  49.013 1.00 52.09 ? 421  GLN A OE1   1 
ATOM   3207  N NE2   . GLN A 1 390 ? 14.818  55.770  51.025 1.00 50.26 ? 421  GLN A NE2   1 
ATOM   3208  N N     . PHE A 1 391 ? 17.929  50.015  48.976 1.00 26.42 ? 422  PHE A N     1 
ATOM   3209  C CA    . PHE A 1 391 ? 18.091  48.850  48.124 1.00 24.25 ? 422  PHE A CA    1 
ATOM   3210  C C     . PHE A 1 391 ? 18.266  47.577  48.945 1.00 22.15 ? 422  PHE A C     1 
ATOM   3211  O O     . PHE A 1 391 ? 17.662  46.556  48.643 1.00 21.90 ? 422  PHE A O     1 
ATOM   3212  C CB    . PHE A 1 391 ? 19.286  49.036  47.201 1.00 22.52 ? 422  PHE A CB    1 
ATOM   3213  C CG    . PHE A 1 391 ? 18.903  49.321  45.788 1.00 20.83 ? 422  PHE A CG    1 
ATOM   3214  C CD1   . PHE A 1 391 ? 18.293  50.523  45.453 1.00 20.34 ? 422  PHE A CD1   1 
ATOM   3215  C CD2   . PHE A 1 391 ? 19.142  48.383  44.787 1.00 20.65 ? 422  PHE A CD2   1 
ATOM   3216  C CE1   . PHE A 1 391 ? 17.926  50.793  44.129 1.00 21.12 ? 422  PHE A CE1   1 
ATOM   3217  C CE2   . PHE A 1 391 ? 18.781  48.633  43.457 1.00 20.75 ? 422  PHE A CE2   1 
ATOM   3218  C CZ    . PHE A 1 391 ? 18.172  49.841  43.125 1.00 21.61 ? 422  PHE A CZ    1 
ATOM   3219  N N     . VAL A 1 392 ? 19.082  47.647  49.992 1.00 22.83 ? 423  VAL A N     1 
ATOM   3220  C CA    . VAL A 1 392 ? 19.347  46.503  50.865 1.00 21.97 ? 423  VAL A CA    1 
ATOM   3221  C C     . VAL A 1 392 ? 18.119  46.071  51.661 1.00 23.35 ? 423  VAL A C     1 
ATOM   3222  O O     . VAL A 1 392 ? 17.809  44.873  51.770 1.00 22.84 ? 423  VAL A O     1 
ATOM   3223  C CB    . VAL A 1 392 ? 20.465  46.822  51.875 1.00 21.44 ? 423  VAL A CB    1 
ATOM   3224  C CG1   . VAL A 1 392 ? 20.602  45.679  52.885 1.00 18.15 ? 423  VAL A CG1   1 
ATOM   3225  C CG2   . VAL A 1 392 ? 21.769  47.062  51.143 1.00 20.11 ? 423  VAL A CG2   1 
ATOM   3226  N N     . GLU A 1 393 ? 17.432  47.047  52.248 1.00 24.83 ? 424  GLU A N     1 
ATOM   3227  C CA    . GLU A 1 393 ? 16.232  46.758  53.029 1.00 25.35 ? 424  GLU A CA    1 
ATOM   3228  C C     . GLU A 1 393 ? 15.187  46.133  52.126 1.00 23.98 ? 424  GLU A C     1 
ATOM   3229  O O     . GLU A 1 393 ? 14.521  45.188  52.510 1.00 24.21 ? 424  GLU A O     1 
ATOM   3230  C CB    . GLU A 1 393 ? 15.681  48.041  53.652 1.00 28.28 ? 424  GLU A CB    1 
ATOM   3231  C CG    . GLU A 1 393 ? 16.621  48.694  54.646 1.00 31.94 ? 424  GLU A CG    1 
ATOM   3232  C CD    . GLU A 1 393 ? 16.165  50.090  55.063 1.00 36.10 ? 424  GLU A CD    1 
ATOM   3233  O OE1   . GLU A 1 393 ? 15.510  50.805  54.261 1.00 39.99 ? 424  GLU A OE1   1 
ATOM   3234  O OE2   . GLU A 1 393 ? 16.471  50.479  56.209 1.00 39.82 ? 424  GLU A OE2   1 
ATOM   3235  N N     . SER A 1 394 ? 15.061  46.655  50.913 1.00 23.47 ? 425  SER A N     1 
ATOM   3236  C CA    . SER A 1 394 ? 14.092  46.135  49.955 1.00 24.17 ? 425  SER A CA    1 
ATOM   3237  C C     . SER A 1 394 ? 14.457  44.740  49.418 1.00 24.64 ? 425  SER A C     1 
ATOM   3238  O O     . SER A 1 394 ? 13.614  43.837  49.366 1.00 24.15 ? 425  SER A O     1 
ATOM   3239  C CB    . SER A 1 394 ? 13.946  47.117  48.788 1.00 23.89 ? 425  SER A CB    1 
ATOM   3240  O OG    . SER A 1 394 ? 13.638  48.422  49.253 1.00 24.04 ? 425  SER A OG    1 
ATOM   3241  N N     . PHE A 1 395 ? 15.711  44.568  49.012 1.00 24.75 ? 426  PHE A N     1 
ATOM   3242  C CA    . PHE A 1 395 ? 16.161  43.290  48.479 1.00 24.87 ? 426  PHE A CA    1 
ATOM   3243  C C     . PHE A 1 395 ? 16.161  42.230  49.548 1.00 24.71 ? 426  PHE A C     1 
ATOM   3244  O O     . PHE A 1 395 ? 16.021  41.050  49.257 1.00 25.89 ? 426  PHE A O     1 
ATOM   3245  C CB    . PHE A 1 395 ? 17.560  43.416  47.890 1.00 25.59 ? 426  PHE A CB    1 
ATOM   3246  C CG    . PHE A 1 395 ? 17.578  43.938  46.482 1.00 25.95 ? 426  PHE A CG    1 
ATOM   3247  C CD1   . PHE A 1 395 ? 16.393  44.276  45.829 1.00 26.25 ? 426  PHE A CD1   1 
ATOM   3248  C CD2   . PHE A 1 395 ? 18.783  44.090  45.802 1.00 26.36 ? 426  PHE A CD2   1 
ATOM   3249  C CE1   . PHE A 1 395 ? 16.404  44.753  44.525 1.00 26.19 ? 426  PHE A CE1   1 
ATOM   3250  C CE2   . PHE A 1 395 ? 18.807  44.566  44.497 1.00 27.92 ? 426  PHE A CE2   1 
ATOM   3251  C CZ    . PHE A 1 395 ? 17.611  44.899  43.858 1.00 27.10 ? 426  PHE A CZ    1 
ATOM   3252  N N     . THR A 1 396 ? 16.321  42.642  50.794 1.00 22.52 ? 427  THR A N     1 
ATOM   3253  C CA    . THR A 1 396 ? 16.316  41.676  51.876 1.00 23.64 ? 427  THR A CA    1 
ATOM   3254  C C     . THR A 1 396 ? 14.896  41.142  52.083 1.00 25.28 ? 427  THR A C     1 
ATOM   3255  O O     . THR A 1 396 ? 14.715  39.976  52.442 1.00 24.84 ? 427  THR A O     1 
ATOM   3256  C CB    . THR A 1 396 ? 16.804  42.315  53.191 1.00 22.96 ? 427  THR A CB    1 
ATOM   3257  O OG1   . THR A 1 396 ? 18.153  42.776  53.030 1.00 22.95 ? 427  THR A OG1   1 
ATOM   3258  C CG2   . THR A 1 396 ? 16.747  41.311  54.324 1.00 21.45 ? 427  THR A CG2   1 
ATOM   3259  N N     . ARG A 1 397 ? 13.904  42.001  51.848 1.00 27.06 ? 428  ARG A N     1 
ATOM   3260  C CA    . ARG A 1 397 ? 12.488  41.663  52.010 1.00 28.82 ? 428  ARG A CA    1 
ATOM   3261  C C     . ARG A 1 397 ? 11.901  40.864  50.862 1.00 27.49 ? 428  ARG A C     1 
ATOM   3262  O O     . ARG A 1 397 ? 11.099  39.970  51.086 1.00 28.82 ? 428  ARG A O     1 
ATOM   3263  C CB    . ARG A 1 397 ? 11.634  42.920  52.155 1.00 32.96 ? 428  ARG A CB    1 
ATOM   3264  C CG    . ARG A 1 397 ? 12.016  43.878  53.252 1.00 37.23 ? 428  ARG A CG    1 
ATOM   3265  C CD    . ARG A 1 397 ? 10.948  44.966  53.365 1.00 42.88 ? 428  ARG A CD    1 
ATOM   3266  N NE    . ARG A 1 397 ? 11.396  46.257  52.849 1.00 47.89 ? 428  ARG A NE    1 
ATOM   3267  C CZ    . ARG A 1 397 ? 11.770  47.278  53.616 1.00 51.06 ? 428  ARG A CZ    1 
ATOM   3268  N NH1   . ARG A 1 397 ? 11.752  47.159  54.945 1.00 52.32 ? 428  ARG A NH1   1 
ATOM   3269  N NH2   . ARG A 1 397 ? 12.163  48.419  53.055 1.00 52.62 ? 428  ARG A NH2   1 
ATOM   3270  N N     . GLN A 1 398 ? 12.280  41.186  49.631 1.00 26.55 ? 429  GLN A N     1 
ATOM   3271  C CA    . GLN A 1 398 ? 11.722  40.479  48.485 1.00 25.67 ? 429  GLN A CA    1 
ATOM   3272  C C     . GLN A 1 398 ? 12.194  39.044  48.292 1.00 25.26 ? 429  GLN A C     1 
ATOM   3273  O O     . GLN A 1 398 ? 13.396  38.784  48.198 1.00 26.33 ? 429  GLN A O     1 
ATOM   3274  C CB    . GLN A 1 398 ? 11.970  41.267  47.202 1.00 23.93 ? 429  GLN A CB    1 
ATOM   3275  C CG    . GLN A 1 398 ? 11.256  40.652  46.018 1.00 24.13 ? 429  GLN A CG    1 
ATOM   3276  C CD    . GLN A 1 398 ? 11.101  41.609  44.867 1.00 24.18 ? 429  GLN A CD    1 
ATOM   3277  O OE1   . GLN A 1 398 ? 10.376  41.328  43.913 1.00 24.97 ? 429  GLN A OE1   1 
ATOM   3278  N NE2   . GLN A 1 398 ? 11.784  42.745  44.942 1.00 25.10 ? 429  GLN A NE2   1 
ATOM   3279  N N     . ILE A 1 399 ? 11.233  38.121  48.217 1.00 24.72 ? 430  ILE A N     1 
ATOM   3280  C CA    . ILE A 1 399 ? 11.522  36.704  48.026 1.00 23.75 ? 430  ILE A CA    1 
ATOM   3281  C C     . ILE A 1 399 ? 11.833  36.385  46.566 1.00 24.13 ? 430  ILE A C     1 
ATOM   3282  O O     . ILE A 1 399 ? 11.338  37.045  45.653 1.00 23.05 ? 430  ILE A O     1 
ATOM   3283  C CB    . ILE A 1 399 ? 10.333  35.797  48.491 1.00 23.64 ? 430  ILE A CB    1 
ATOM   3284  C CG1   . ILE A 1 399 ? 10.734  34.319  48.423 1.00 22.46 ? 430  ILE A CG1   1 
ATOM   3285  C CG2   . ILE A 1 399 ? 9.119   36.001  47.600 1.00 21.88 ? 430  ILE A CG2   1 
ATOM   3286  C CD1   . ILE A 1 399 ? 10.404  33.542  49.670 1.00 21.20 ? 430  ILE A CD1   1 
ATOM   3287  N N     . ALA A 1 400 ? 12.663  35.363  46.367 1.00 24.43 ? 431  ALA A N     1 
ATOM   3288  C CA    . ALA A 1 400 ? 13.058  34.918  45.034 1.00 24.67 ? 431  ALA A CA    1 
ATOM   3289  C C     . ALA A 1 400 ? 12.231  33.694  44.640 1.00 23.91 ? 431  ALA A C     1 
ATOM   3290  O O     . ALA A 1 400 ? 11.640  33.031  45.495 1.00 22.82 ? 431  ALA A O     1 
ATOM   3291  C CB    . ALA A 1 400 ? 14.544  34.568  45.016 1.00 26.08 ? 431  ALA A CB    1 
ATOM   3292  N N     . GLY A 1 401 ? 12.209  33.392  43.349 1.00 22.72 ? 432  GLY A N     1 
ATOM   3293  C CA    . GLY A 1 401 ? 11.449  32.254  42.881 1.00 23.14 ? 432  GLY A CA    1 
ATOM   3294  C C     . GLY A 1 401 ? 12.191  30.947  43.078 1.00 23.46 ? 432  GLY A C     1 
ATOM   3295  O O     . GLY A 1 401 ? 13.416  30.932  43.218 1.00 24.10 ? 432  GLY A O     1 
ATOM   3296  N N     . ARG A 1 402 ? 11.450  29.846  43.128 1.00 23.20 ? 433  ARG A N     1 
ATOM   3297  C CA    . ARG A 1 402 ? 12.062  28.529  43.275 1.00 24.05 ? 433  ARG A CA    1 
ATOM   3298  C C     . ARG A 1 402 ? 12.656  28.175  41.903 1.00 24.20 ? 433  ARG A C     1 
ATOM   3299  O O     . ARG A 1 402 ? 12.158  28.592  40.849 1.00 24.69 ? 433  ARG A O     1 
ATOM   3300  C CB    . ARG A 1 402 ? 11.010  27.503  43.687 1.00 24.45 ? 433  ARG A CB    1 
ATOM   3301  C CG    . ARG A 1 402 ? 11.531  26.108  43.932 1.00 22.67 ? 433  ARG A CG    1 
ATOM   3302  C CD    . ARG A 1 402 ? 10.390  25.169  44.165 1.00 23.24 ? 433  ARG A CD    1 
ATOM   3303  N NE    . ARG A 1 402 ? 10.642  24.334  45.325 1.00 25.89 ? 433  ARG A NE    1 
ATOM   3304  C CZ    . ARG A 1 402 ? 9.736   23.510  45.844 1.00 25.92 ? 433  ARG A CZ    1 
ATOM   3305  N NH1   . ARG A 1 402 ? 8.538   23.455  45.287 1.00 26.73 ? 433  ARG A NH1   1 
ATOM   3306  N NH2   . ARG A 1 402 ? 10.034  22.778  46.913 1.00 23.67 ? 433  ARG A NH2   1 
ATOM   3307  N N     . VAL A 1 403 ? 13.752  27.421  41.935 1.00 23.27 ? 434  VAL A N     1 
ATOM   3308  C CA    . VAL A 1 403 ? 14.455  27.040  40.727 1.00 22.54 ? 434  VAL A CA    1 
ATOM   3309  C C     . VAL A 1 403 ? 14.021  25.673  40.254 1.00 22.53 ? 434  VAL A C     1 
ATOM   3310  O O     . VAL A 1 403 ? 13.550  25.538  39.113 1.00 21.96 ? 434  VAL A O     1 
ATOM   3311  C CB    . VAL A 1 403 ? 15.954  27.103  40.985 1.00 22.19 ? 434  VAL A CB    1 
ATOM   3312  C CG1   . VAL A 1 403 ? 16.722  26.730  39.728 1.00 20.56 ? 434  VAL A CG1   1 
ATOM   3313  C CG2   . VAL A 1 403 ? 16.295  28.514  41.457 1.00 21.43 ? 434  VAL A CG2   1 
ATOM   3314  N N     . ALA A 1 404 ? 14.191  24.652  41.106 1.00 23.24 ? 435  ALA A N     1 
ATOM   3315  C CA    . ALA A 1 404 ? 13.713  23.307  40.770 1.00 24.44 ? 435  ALA A CA    1 
ATOM   3316  C C     . ALA A 1 404 ? 12.208  23.468  40.743 1.00 25.79 ? 435  ALA A C     1 
ATOM   3317  O O     . ALA A 1 404 ? 11.699  24.576  40.825 1.00 27.82 ? 435  ALA A O     1 
ATOM   3318  C CB    . ALA A 1 404 ? 14.074  22.344  41.827 1.00 24.06 ? 435  ALA A CB    1 
ATOM   3319  N N     . GLY A 1 405 ? 11.467  22.377  40.660 1.00 24.74 ? 436  GLY A N     1 
ATOM   3320  C CA    . GLY A 1 405 ? 10.033  22.538  40.630 1.00 25.68 ? 436  GLY A CA    1 
ATOM   3321  C C     . GLY A 1 405 ? 9.336   22.568  39.289 1.00 26.48 ? 436  GLY A C     1 
ATOM   3322  O O     . GLY A 1 405 ? 8.303   21.927  39.129 1.00 26.41 ? 436  GLY A O     1 
ATOM   3323  N N     . GLY A 1 406 ? 9.857   23.341  38.324 1.00 26.37 ? 437  GLY A N     1 
ATOM   3324  C CA    . GLY A 1 406 ? 9.231   23.377  37.021 1.00 26.54 ? 437  GLY A CA    1 
ATOM   3325  C C     . GLY A 1 406 ? 8.457   24.658  36.783 1.00 26.92 ? 437  GLY A C     1 
ATOM   3326  O O     . GLY A 1 406 ? 8.032   25.334  37.721 1.00 26.56 ? 437  GLY A O     1 
ATOM   3327  N N     . ARG A 1 407 ? 8.320   25.036  35.512 1.00 26.79 ? 438  ARG A N     1 
ATOM   3328  C CA    . ARG A 1 407 ? 7.570   26.217  35.131 1.00 26.63 ? 438  ARG A CA    1 
ATOM   3329  C C     . ARG A 1 407 ? 7.702   27.400  36.079 1.00 25.84 ? 438  ARG A C     1 
ATOM   3330  O O     . ARG A 1 407 ? 6.728   27.778  36.729 1.00 26.30 ? 438  ARG A O     1 
ATOM   3331  C CB    . ARG A 1 407 ? 6.082   25.871  34.980 1.00 27.93 ? 438  ARG A CB    1 
ATOM   3332  C CG    . ARG A 1 407 ? 5.782   24.553  34.283 1.00 28.91 ? 438  ARG A CG    1 
ATOM   3333  C CD    . ARG A 1 407 ? 4.304   24.300  34.199 1.00 27.93 ? 438  ARG A CD    1 
ATOM   3334  N NE    . ARG A 1 407 ? 4.022   23.276  33.207 1.00 29.90 ? 438  ARG A NE    1 
ATOM   3335  C CZ    . ARG A 1 407 ? 2.952   22.475  33.236 1.00 30.18 ? 438  ARG A CZ    1 
ATOM   3336  N NH1   . ARG A 1 407 ? 2.066   22.588  34.210 1.00 29.47 ? 438  ARG A NH1   1 
ATOM   3337  N NH2   . ARG A 1 407 ? 2.797   21.563  32.287 1.00 31.25 ? 438  ARG A NH2   1 
ATOM   3338  N N     . ASN A 1 408 ? 8.895   27.979  36.171 1.00 24.79 ? 439  ASN A N     1 
ATOM   3339  C CA    . ASN A 1 408 ? 9.094   29.155  37.031 1.00 23.30 ? 439  ASN A CA    1 
ATOM   3340  C C     . ASN A 1 408 ? 10.081  30.146  36.416 1.00 22.60 ? 439  ASN A C     1 
ATOM   3341  O O     . ASN A 1 408 ? 10.590  31.048  37.092 1.00 23.84 ? 439  ASN A O     1 
ATOM   3342  C CB    . ASN A 1 408 ? 9.553   28.767  38.440 1.00 20.94 ? 439  ASN A CB    1 
ATOM   3343  C CG    . ASN A 1 408 ? 9.138   29.793  39.480 1.00 21.18 ? 439  ASN A CG    1 
ATOM   3344  O OD1   . ASN A 1 408 ? 8.257   30.623  39.239 1.00 20.81 ? 439  ASN A OD1   1 
ATOM   3345  N ND2   . ASN A 1 408 ? 9.773   29.748  40.633 1.00 21.41 ? 439  ASN A ND2   1 
ATOM   3346  N N     . VAL A 1 409 ? 10.340  29.980  35.122 1.00 21.93 ? 440  VAL A N     1 
ATOM   3347  C CA    . VAL A 1 409 ? 11.243  30.875  34.415 1.00 22.33 ? 440  VAL A CA    1 
ATOM   3348  C C     . VAL A 1 409 ? 10.428  32.066  33.912 1.00 23.76 ? 440  VAL A C     1 
ATOM   3349  O O     . VAL A 1 409 ? 9.530   31.911  33.086 1.00 25.85 ? 440  VAL A O     1 
ATOM   3350  C CB    . VAL A 1 409 ? 11.897  30.178  33.199 1.00 22.28 ? 440  VAL A CB    1 
ATOM   3351  C CG1   . VAL A 1 409 ? 12.730  31.174  32.437 1.00 21.21 ? 440  VAL A CG1   1 
ATOM   3352  C CG2   . VAL A 1 409 ? 12.741  29.001  33.643 1.00 20.39 ? 440  VAL A CG2   1 
ATOM   3353  N N     . PRO A 1 410 ? 10.723  33.273  34.408 1.00 25.11 ? 441  PRO A N     1 
ATOM   3354  C CA    . PRO A 1 410 ? 9.994   34.477  33.985 1.00 24.71 ? 441  PRO A CA    1 
ATOM   3355  C C     . PRO A 1 410 ? 10.001  34.612  32.469 1.00 25.12 ? 441  PRO A C     1 
ATOM   3356  O O     . PRO A 1 410 ? 11.058  34.556  31.854 1.00 26.43 ? 441  PRO A O     1 
ATOM   3357  C CB    . PRO A 1 410 ? 10.762  35.621  34.644 1.00 23.24 ? 441  PRO A CB    1 
ATOM   3358  C CG    . PRO A 1 410 ? 11.505  35.005  35.767 1.00 22.43 ? 441  PRO A CG    1 
ATOM   3359  C CD    . PRO A 1 410 ? 11.769  33.573  35.401 1.00 24.12 ? 441  PRO A CD    1 
ATOM   3360  N N     . ILE A 1 411 ? 8.830   34.787  31.867 1.00 26.22 ? 442  ILE A N     1 
ATOM   3361  C CA    . ILE A 1 411 ? 8.738   34.940  30.418 1.00 27.43 ? 442  ILE A CA    1 
ATOM   3362  C C     . ILE A 1 411 ? 9.670   36.060  29.928 1.00 27.07 ? 442  ILE A C     1 
ATOM   3363  O O     . ILE A 1 411 ? 10.223  35.995  28.830 1.00 26.77 ? 442  ILE A O     1 
ATOM   3364  C CB    . ILE A 1 411 ? 7.277   35.274  29.985 1.00 28.97 ? 442  ILE A CB    1 
ATOM   3365  C CG1   . ILE A 1 411 ? 6.457   33.993  29.821 1.00 28.44 ? 442  ILE A CG1   1 
ATOM   3366  C CG2   . ILE A 1 411 ? 7.273   36.004  28.666 1.00 29.49 ? 442  ILE A CG2   1 
ATOM   3367  C CD1   . ILE A 1 411 ? 6.412   33.140  31.084 1.00 30.59 ? 442  ILE A CD1   1 
ATOM   3368  N N     . ALA A 1 412 ? 9.842   37.090  30.748 1.00 26.63 ? 443  ALA A N     1 
ATOM   3369  C CA    . ALA A 1 412 ? 10.686  38.219  30.379 1.00 26.23 ? 443  ALA A CA    1 
ATOM   3370  C C     . ALA A 1 412 ? 12.105  37.801  30.043 1.00 26.13 ? 443  ALA A C     1 
ATOM   3371  O O     . ALA A 1 412 ? 12.841  38.538  29.397 1.00 27.19 ? 443  ALA A O     1 
ATOM   3372  C CB    . ALA A 1 412 ? 10.718  39.230  31.507 1.00 26.09 ? 443  ALA A CB    1 
ATOM   3373  N N     . VAL A 1 413 ? 12.490  36.610  30.468 1.00 26.51 ? 444  VAL A N     1 
ATOM   3374  C CA    . VAL A 1 413 ? 13.846  36.153  30.240 1.00 26.34 ? 444  VAL A CA    1 
ATOM   3375  C C     . VAL A 1 413 ? 13.878  34.799  29.544 1.00 25.65 ? 444  VAL A C     1 
ATOM   3376  O O     . VAL A 1 413 ? 14.854  34.067  29.633 1.00 26.09 ? 444  VAL A O     1 
ATOM   3377  C CB    . VAL A 1 413 ? 14.583  36.119  31.611 1.00 26.46 ? 444  VAL A CB    1 
ATOM   3378  C CG1   . VAL A 1 413 ? 14.559  34.721  32.221 1.00 25.78 ? 444  VAL A CG1   1 
ATOM   3379  C CG2   . VAL A 1 413 ? 15.974  36.638  31.454 1.00 27.36 ? 444  VAL A CG2   1 
ATOM   3380  N N     . GLN A 1 414 ? 12.815  34.483  28.818 1.00 26.00 ? 445  GLN A N     1 
ATOM   3381  C CA    . GLN A 1 414 ? 12.721  33.198  28.146 1.00 25.23 ? 445  GLN A CA    1 
ATOM   3382  C C     . GLN A 1 414 ? 13.778  32.922  27.083 1.00 25.78 ? 445  GLN A C     1 
ATOM   3383  O O     . GLN A 1 414 ? 14.172  31.768  26.887 1.00 25.70 ? 445  GLN A O     1 
ATOM   3384  C CB    . GLN A 1 414 ? 11.335  33.039  27.544 1.00 25.51 ? 445  GLN A CB    1 
ATOM   3385  C CG    . GLN A 1 414 ? 11.017  34.034  26.451 1.00 25.64 ? 445  GLN A CG    1 
ATOM   3386  C CD    . GLN A 1 414 ? 9.706   33.718  25.743 1.00 27.72 ? 445  GLN A CD    1 
ATOM   3387  O OE1   . GLN A 1 414 ? 9.249   32.579  25.741 1.00 28.10 ? 445  GLN A OE1   1 
ATOM   3388  N NE2   . GLN A 1 414 ? 9.096   34.730  25.141 1.00 29.04 ? 445  GLN A NE2   1 
ATOM   3389  N N     . ALA A 1 415 ? 14.234  33.962  26.387 1.00 26.07 ? 446  ALA A N     1 
ATOM   3390  C CA    . ALA A 1 415 ? 15.254  33.775  25.351 1.00 25.70 ? 446  ALA A CA    1 
ATOM   3391  C C     . ALA A 1 415 ? 16.531  33.243  25.992 1.00 25.81 ? 446  ALA A C     1 
ATOM   3392  O O     . ALA A 1 415 ? 17.263  32.453  25.395 1.00 26.92 ? 446  ALA A O     1 
ATOM   3393  C CB    . ALA A 1 415 ? 15.537  35.082  24.641 1.00 23.75 ? 446  ALA A CB    1 
ATOM   3394  N N     . VAL A 1 416 ? 16.790  33.681  27.217 1.00 26.31 ? 447  VAL A N     1 
ATOM   3395  C CA    . VAL A 1 416 ? 17.962  33.226  27.944 1.00 27.44 ? 447  VAL A CA    1 
ATOM   3396  C C     . VAL A 1 416 ? 17.815  31.743  28.274 1.00 26.58 ? 447  VAL A C     1 
ATOM   3397  O O     . VAL A 1 416 ? 18.765  30.978  28.182 1.00 27.70 ? 447  VAL A O     1 
ATOM   3398  C CB    . VAL A 1 416 ? 18.144  34.012  29.253 1.00 28.26 ? 447  VAL A CB    1 
ATOM   3399  C CG1   . VAL A 1 416 ? 19.194  33.341  30.119 1.00 29.35 ? 447  VAL A CG1   1 
ATOM   3400  C CG2   . VAL A 1 416 ? 18.546  35.443  28.945 1.00 27.75 ? 447  VAL A CG2   1 
ATOM   3401  N N     . ALA A 1 417 ? 16.618  31.331  28.659 1.00 26.68 ? 448  ALA A N     1 
ATOM   3402  C CA    . ALA A 1 417 ? 16.398  29.929  28.982 1.00 25.91 ? 448  ALA A CA    1 
ATOM   3403  C C     . ALA A 1 417 ? 16.455  29.063  27.724 1.00 24.91 ? 448  ALA A C     1 
ATOM   3404  O O     . ALA A 1 417 ? 16.864  27.908  27.777 1.00 23.62 ? 448  ALA A O     1 
ATOM   3405  C CB    . ALA A 1 417 ? 15.053  29.758  29.683 1.00 27.35 ? 448  ALA A CB    1 
ATOM   3406  N N     . LYS A 1 418 ? 16.045  29.619  26.591 1.00 25.01 ? 449  LYS A N     1 
ATOM   3407  C CA    . LYS A 1 418 ? 16.066  28.857  25.347 1.00 24.73 ? 449  LYS A CA    1 
ATOM   3408  C C     . LYS A 1 418 ? 17.493  28.671  24.902 1.00 25.62 ? 449  LYS A C     1 
ATOM   3409  O O     . LYS A 1 418 ? 17.841  27.621  24.362 1.00 26.94 ? 449  LYS A O     1 
ATOM   3410  C CB    . LYS A 1 418 ? 15.297  29.574  24.240 1.00 24.55 ? 449  LYS A CB    1 
ATOM   3411  C CG    . LYS A 1 418 ? 14.676  28.619  23.246 1.00 24.75 ? 449  LYS A CG    1 
ATOM   3412  C CD    . LYS A 1 418 ? 14.324  29.312  21.947 1.00 22.77 ? 449  LYS A CD    1 
ATOM   3413  C CE    . LYS A 1 418 ? 14.439  28.346  20.798 1.00 23.88 ? 449  LYS A CE    1 
ATOM   3414  N NZ    . LYS A 1 418 ? 15.139  28.983  19.650 1.00 25.43 ? 449  LYS A NZ    1 
ATOM   3415  N N     . ALA A 1 419 ? 18.312  29.702  25.136 1.00 26.22 ? 450  ALA A N     1 
ATOM   3416  C CA    . ALA A 1 419 ? 19.728  29.691  24.768 1.00 24.60 ? 450  ALA A CA    1 
ATOM   3417  C C     . ALA A 1 419 ? 20.469  28.626  25.560 1.00 24.93 ? 450  ALA A C     1 
ATOM   3418  O O     . ALA A 1 419 ? 21.339  27.937  25.028 1.00 25.96 ? 450  ALA A O     1 
ATOM   3419  C CB    . ALA A 1 419 ? 20.347  31.043  25.024 1.00 21.57 ? 450  ALA A CB    1 
ATOM   3420  N N     . SER A 1 420 ? 20.132  28.487  26.834 1.00 25.05 ? 451  SER A N     1 
ATOM   3421  C CA    . SER A 1 420 ? 20.785  27.471  27.637 1.00 25.69 ? 451  SER A CA    1 
ATOM   3422  C C     . SER A 1 420 ? 20.554  26.126  26.989 1.00 26.49 ? 451  SER A C     1 
ATOM   3423  O O     . SER A 1 420 ? 21.462  25.304  26.913 1.00 26.90 ? 451  SER A O     1 
ATOM   3424  C CB    . SER A 1 420 ? 20.208  27.444  29.042 1.00 27.01 ? 451  SER A CB    1 
ATOM   3425  O OG    . SER A 1 420 ? 20.358  28.702  29.668 1.00 28.36 ? 451  SER A OG    1 
ATOM   3426  N N     . ILE A 1 421 ? 19.332  25.908  26.514 1.00 26.83 ? 452  ILE A N     1 
ATOM   3427  C CA    . ILE A 1 421 ? 18.984  24.638  25.882 1.00 27.12 ? 452  ILE A CA    1 
ATOM   3428  C C     . ILE A 1 421 ? 19.738  24.485  24.578 1.00 27.57 ? 452  ILE A C     1 
ATOM   3429  O O     . ILE A 1 421 ? 20.446  23.496  24.359 1.00 26.78 ? 452  ILE A O     1 
ATOM   3430  C CB    . ILE A 1 421 ? 17.465  24.540  25.565 1.00 26.32 ? 452  ILE A CB    1 
ATOM   3431  C CG1   . ILE A 1 421 ? 16.639  24.721  26.838 1.00 27.08 ? 452  ILE A CG1   1 
ATOM   3432  C CG2   . ILE A 1 421 ? 17.160  23.192  24.933 1.00 25.35 ? 452  ILE A CG2   1 
ATOM   3433  C CD1   . ILE A 1 421 ? 15.154  24.456  26.655 1.00 25.98 ? 452  ILE A CD1   1 
ATOM   3434  N N     . ASP A 1 422 ? 19.569  25.484  23.716 1.00 27.07 ? 453  ASP A N     1 
ATOM   3435  C CA    . ASP A 1 422 ? 20.197  25.507  22.408 1.00 26.86 ? 453  ASP A CA    1 
ATOM   3436  C C     . ASP A 1 422 ? 21.713  25.405  22.496 1.00 26.41 ? 453  ASP A C     1 
ATOM   3437  O O     . ASP A 1 422 ? 22.330  24.615  21.791 1.00 26.84 ? 453  ASP A O     1 
ATOM   3438  C CB    . ASP A 1 422 ? 19.786  26.785  21.672 1.00 27.47 ? 453  ASP A CB    1 
ATOM   3439  C CG    . ASP A 1 422 ? 18.299  26.816  21.360 1.00 28.44 ? 453  ASP A CG    1 
ATOM   3440  O OD1   . ASP A 1 422 ? 17.660  25.749  21.466 1.00 29.08 ? 453  ASP A OD1   1 
ATOM   3441  O OD2   . ASP A 1 422 ? 17.761  27.887  21.011 1.00 28.80 ? 453  ASP A OD2   1 
ATOM   3442  N N     . GLN A 1 423 ? 22.317  26.192  23.371 1.00 25.06 ? 454  GLN A N     1 
ATOM   3443  C CA    . GLN A 1 423 ? 23.765  26.171  23.510 1.00 24.74 ? 454  GLN A CA    1 
ATOM   3444  C C     . GLN A 1 423 ? 24.317  24.852  24.044 1.00 24.86 ? 454  GLN A C     1 
ATOM   3445  O O     . GLN A 1 423 ? 25.375  24.405  23.605 1.00 24.83 ? 454  GLN A O     1 
ATOM   3446  C CB    . GLN A 1 423 ? 24.210  27.342  24.373 1.00 24.22 ? 454  GLN A CB    1 
ATOM   3447  C CG    . GLN A 1 423 ? 24.309  28.599  23.562 1.00 24.51 ? 454  GLN A CG    1 
ATOM   3448  C CD    . GLN A 1 423 ? 24.403  29.837  24.402 1.00 28.12 ? 454  GLN A CD    1 
ATOM   3449  O OE1   . GLN A 1 423 ? 24.568  30.924  23.875 1.00 31.37 ? 454  GLN A OE1   1 
ATOM   3450  N NE2   . GLN A 1 423 ? 24.296  29.688  25.720 1.00 32.05 ? 454  GLN A NE2   1 
ATOM   3451  N N     . SER A 1 424 ? 23.606  24.232  24.982 1.00 24.11 ? 455  SER A N     1 
ATOM   3452  C CA    . SER A 1 424 ? 24.037  22.948  25.530 1.00 24.25 ? 455  SER A CA    1 
ATOM   3453  C C     . SER A 1 424 ? 24.079  21.934  24.399 1.00 24.43 ? 455  SER A C     1 
ATOM   3454  O O     . SER A 1 424 ? 24.952  21.068  24.349 1.00 24.47 ? 455  SER A O     1 
ATOM   3455  C CB    . SER A 1 424 ? 23.055  22.440  26.585 1.00 23.03 ? 455  SER A CB    1 
ATOM   3456  O OG    . SER A 1 424 ? 22.843  23.410  27.589 1.00 25.01 ? 455  SER A OG    1 
ATOM   3457  N N     . ARG A 1 425 ? 23.110  22.041  23.500 1.00 24.84 ? 456  ARG A N     1 
ATOM   3458  C CA    . ARG A 1 425 ? 23.037  21.136  22.366 1.00 26.35 ? 456  ARG A CA    1 
ATOM   3459  C C     . ARG A 1 425 ? 24.210  21.413  21.437 1.00 26.39 ? 456  ARG A C     1 
ATOM   3460  O O     . ARG A 1 425 ? 24.823  20.491  20.905 1.00 25.94 ? 456  ARG A O     1 
ATOM   3461  C CB    . ARG A 1 425 ? 21.714  21.329  21.628 1.00 25.60 ? 456  ARG A CB    1 
ATOM   3462  C CG    . ARG A 1 425 ? 20.520  20.945  22.474 1.00 25.73 ? 456  ARG A CG    1 
ATOM   3463  C CD    . ARG A 1 425 ? 19.240  20.953  21.668 1.00 27.26 ? 456  ARG A CD    1 
ATOM   3464  N NE    . ARG A 1 425 ? 18.149  20.286  22.374 1.00 27.66 ? 456  ARG A NE    1 
ATOM   3465  C CZ    . ARG A 1 425 ? 16.868  20.612  22.249 1.00 28.13 ? 456  ARG A CZ    1 
ATOM   3466  N NH1   . ARG A 1 425 ? 16.508  21.592  21.443 1.00 29.28 ? 456  ARG A NH1   1 
ATOM   3467  N NH2   . ARG A 1 425 ? 15.944  19.976  22.949 1.00 27.43 ? 456  ARG A NH2   1 
ATOM   3468  N N     . GLU A 1 426 ? 24.515  22.693  21.253 1.00 26.58 ? 457  GLU A N     1 
ATOM   3469  C CA    . GLU A 1 426 ? 25.625  23.113  20.413 1.00 26.36 ? 457  GLU A CA    1 
ATOM   3470  C C     . GLU A 1 426 ? 26.919  22.462  20.892 1.00 26.33 ? 457  GLU A C     1 
ATOM   3471  O O     . GLU A 1 426 ? 27.660  21.879  20.108 1.00 25.56 ? 457  GLU A O     1 
ATOM   3472  C CB    . GLU A 1 426 ? 25.814  24.609  20.509 1.00 29.98 ? 457  GLU A CB    1 
ATOM   3473  C CG    . GLU A 1 426 ? 24.937  25.418  19.622 1.00 33.91 ? 457  GLU A CG    1 
ATOM   3474  C CD    . GLU A 1 426 ? 25.397  26.860  19.591 1.00 38.12 ? 457  GLU A CD    1 
ATOM   3475  O OE1   . GLU A 1 426 ? 26.624  27.076  19.396 1.00 41.16 ? 457  GLU A OE1   1 
ATOM   3476  O OE2   . GLU A 1 426 ? 24.544  27.760  19.771 1.00 38.36 ? 457  GLU A OE2   1 
ATOM   3477  N N     . MET A 1 427 ? 27.185  22.589  22.188 1.00 22.94 ? 458  MET A N     1 
ATOM   3478  C CA    . MET A 1 427 ? 28.376  22.042  22.790 1.00 20.18 ? 458  MET A CA    1 
ATOM   3479  C C     . MET A 1 427 ? 28.281  20.552  22.980 1.00 20.45 ? 458  MET A C     1 
ATOM   3480  O O     . MET A 1 427 ? 29.045  19.973  23.749 1.00 21.94 ? 458  MET A O     1 
ATOM   3481  C CB    . MET A 1 427 ? 28.611  22.723  24.124 1.00 20.86 ? 458  MET A CB    1 
ATOM   3482  C CG    . MET A 1 427 ? 28.604  24.231  24.028 1.00 19.25 ? 458  MET A CG    1 
ATOM   3483  S SD    . MET A 1 427 ? 29.022  24.961  25.612 1.00 19.64 ? 458  MET A SD    1 
ATOM   3484  C CE    . MET A 1 427 ? 27.373  24.988  26.366 1.00 16.31 ? 458  MET A CE    1 
ATOM   3485  N N     . LYS A 1 428 ? 27.332  19.939  22.286 1.00 18.96 ? 459  LYS A N     1 
ATOM   3486  C CA    . LYS A 1 428 ? 27.105  18.494  22.324 1.00 20.32 ? 459  LYS A CA    1 
ATOM   3487  C C     . LYS A 1 428 ? 27.197  17.824  23.688 1.00 20.37 ? 459  LYS A C     1 
ATOM   3488  O O     . LYS A 1 428 ? 27.928  16.850  23.876 1.00 22.05 ? 459  LYS A O     1 
ATOM   3489  C CB    . LYS A 1 428 ? 28.042  17.806  21.328 1.00 20.36 ? 459  LYS A CB    1 
ATOM   3490  C CG    . LYS A 1 428 ? 27.987  18.450  19.937 1.00 22.37 ? 459  LYS A CG    1 
ATOM   3491  C CD    . LYS A 1 428 ? 27.582  17.481  18.814 1.00 25.36 ? 459  LYS A CD    1 
ATOM   3492  C CE    . LYS A 1 428 ? 26.624  16.394  19.269 1.00 24.14 ? 459  LYS A CE    1 
ATOM   3493  N NZ    . LYS A 1 428 ? 26.826  15.193  18.405 1.00 28.16 ? 459  LYS A NZ    1 
ATOM   3494  N N     . TYR A 1 429 ? 26.425  18.353  24.629 1.00 20.70 ? 460  TYR A N     1 
ATOM   3495  C CA    . TYR A 1 429 ? 26.359  17.850  25.988 1.00 20.65 ? 460  TYR A CA    1 
ATOM   3496  C C     . TYR A 1 429 ? 25.758  16.460  25.993 1.00 22.72 ? 460  TYR A C     1 
ATOM   3497  O O     . TYR A 1 429 ? 24.919  16.149  25.155 1.00 24.00 ? 460  TYR A O     1 
ATOM   3498  C CB    . TYR A 1 429 ? 25.451  18.744  26.808 1.00 19.85 ? 460  TYR A CB    1 
ATOM   3499  C CG    . TYR A 1 429 ? 26.139  19.841  27.569 1.00 20.33 ? 460  TYR A CG    1 
ATOM   3500  C CD1   . TYR A 1 429 ? 27.180  20.584  26.998 1.00 18.89 ? 460  TYR A CD1   1 
ATOM   3501  C CD2   . TYR A 1 429 ? 25.718  20.163  28.859 1.00 19.27 ? 460  TYR A CD2   1 
ATOM   3502  C CE1   . TYR A 1 429 ? 27.782  21.632  27.703 1.00 18.96 ? 460  TYR A CE1   1 
ATOM   3503  C CE2   . TYR A 1 429 ? 26.304  21.196  29.565 1.00 20.27 ? 460  TYR A CE2   1 
ATOM   3504  C CZ    . TYR A 1 429 ? 27.333  21.931  28.987 1.00 19.62 ? 460  TYR A CZ    1 
ATOM   3505  O OH    . TYR A 1 429 ? 27.888  22.965  29.712 1.00 20.76 ? 460  TYR A OH    1 
ATOM   3506  N N     . GLN A 1 430 ? 26.167  15.625  26.939 1.00 23.03 ? 461  GLN A N     1 
ATOM   3507  C CA    . GLN A 1 430 ? 25.610  14.286  27.037 1.00 24.10 ? 461  GLN A CA    1 
ATOM   3508  C C     . GLN A 1 430 ? 24.300  14.370  27.831 1.00 24.38 ? 461  GLN A C     1 
ATOM   3509  O O     . GLN A 1 430 ? 24.010  15.391  28.452 1.00 24.86 ? 461  GLN A O     1 
ATOM   3510  C CB    . GLN A 1 430 ? 26.589  13.357  27.738 1.00 24.69 ? 461  GLN A CB    1 
ATOM   3511  C CG    . GLN A 1 430 ? 27.627  12.783  26.808 1.00 26.11 ? 461  GLN A CG    1 
ATOM   3512  C CD    . GLN A 1 430 ? 28.678  11.969  27.546 1.00 26.07 ? 461  GLN A CD    1 
ATOM   3513  O OE1   . GLN A 1 430 ? 28.355  11.065  28.323 1.00 24.42 ? 461  GLN A OE1   1 
ATOM   3514  N NE2   . GLN A 1 430 ? 29.948  12.290  27.308 1.00 25.64 ? 461  GLN A NE2   1 
ATOM   3515  N N     . SER A 1 431 ? 23.521  13.295  27.814 1.00 24.00 ? 462  SER A N     1 
ATOM   3516  C CA    . SER A 1 431 ? 22.235  13.262  28.496 1.00 23.97 ? 462  SER A CA    1 
ATOM   3517  C C     . SER A 1 431 ? 22.291  13.497  30.000 1.00 25.24 ? 462  SER A C     1 
ATOM   3518  O O     . SER A 1 431 ? 23.351  13.406  30.631 1.00 26.96 ? 462  SER A O     1 
ATOM   3519  C CB    . SER A 1 431 ? 21.559  11.932  28.251 1.00 21.94 ? 462  SER A CB    1 
ATOM   3520  O OG    . SER A 1 431 ? 22.045  10.994  29.185 1.00 21.04 ? 462  SER A OG    1 
ATOM   3521  N N     . LEU A 1 432 ? 21.126  13.784  30.569 1.00 25.35 ? 463  LEU A N     1 
ATOM   3522  C CA    . LEU A 1 432 ? 20.996  14.038  31.991 1.00 24.60 ? 463  LEU A CA    1 
ATOM   3523  C C     . LEU A 1 432 ? 21.458  12.820  32.762 1.00 25.05 ? 463  LEU A C     1 
ATOM   3524  O O     . LEU A 1 432 ? 22.162  12.932  33.758 1.00 25.05 ? 463  LEU A O     1 
ATOM   3525  C CB    . LEU A 1 432 ? 19.533  14.327  32.343 1.00 25.15 ? 463  LEU A CB    1 
ATOM   3526  C CG    . LEU A 1 432 ? 19.093  13.941  33.761 1.00 25.17 ? 463  LEU A CG    1 
ATOM   3527  C CD1   . LEU A 1 432 ? 19.517  15.043  34.744 1.00 24.30 ? 463  LEU A CD1   1 
ATOM   3528  C CD2   . LEU A 1 432 ? 17.581  13.718  33.807 1.00 25.56 ? 463  LEU A CD2   1 
ATOM   3529  N N     . ASN A 1 433 ? 21.063  11.644  32.297 1.00 26.80 ? 464  ASN A N     1 
ATOM   3530  C CA    . ASN A 1 433 ? 21.427  10.402  32.976 1.00 26.64 ? 464  ASN A CA    1 
ATOM   3531  C C     . ASN A 1 433 ? 22.922  10.098  32.931 1.00 24.89 ? 464  ASN A C     1 
ATOM   3532  O O     . ASN A 1 433 ? 23.460  9.477   33.844 1.00 25.19 ? 464  ASN A O     1 
ATOM   3533  C CB    . ASN A 1 433 ? 20.632  9.234   32.388 1.00 27.37 ? 464  ASN A CB    1 
ATOM   3534  C CG    . ASN A 1 433 ? 19.312  9.021   33.101 1.00 28.25 ? 464  ASN A CG    1 
ATOM   3535  O OD1   . ASN A 1 433 ? 18.423  8.340   32.597 1.00 30.19 ? 464  ASN A OD1   1 
ATOM   3536  N ND2   . ASN A 1 433 ? 19.178  9.605   34.283 1.00 28.79 ? 464  ASN A ND2   1 
ATOM   3537  N N     . GLU A 1 434 ? 23.590  10.523  31.866 1.00 25.03 ? 465  GLU A N     1 
ATOM   3538  C CA    . GLU A 1 434 ? 25.020  10.296  31.761 1.00 22.94 ? 465  GLU A CA    1 
ATOM   3539  C C     . GLU A 1 434 ? 25.697  11.148  32.813 1.00 22.08 ? 465  GLU A C     1 
ATOM   3540  O O     . GLU A 1 434 ? 26.616  10.693  33.491 1.00 23.87 ? 465  GLU A O     1 
ATOM   3541  C CB    . GLU A 1 434 ? 25.524  10.663  30.369 1.00 23.60 ? 465  GLU A CB    1 
ATOM   3542  C CG    . GLU A 1 434 ? 25.178  9.623   29.309 1.00 24.62 ? 465  GLU A CG    1 
ATOM   3543  C CD    . GLU A 1 434 ? 25.581  8.213   29.708 1.00 25.52 ? 465  GLU A CD    1 
ATOM   3544  O OE1   . GLU A 1 434 ? 26.321  8.048   30.685 1.00 28.78 ? 465  GLU A OE1   1 
ATOM   3545  O OE2   . GLU A 1 434 ? 25.166  7.249   29.051 1.00 27.40 ? 465  GLU A OE2   1 
ATOM   3546  N N     . TYR A 1 435 ? 25.239  12.386  32.961 1.00 21.12 ? 466  TYR A N     1 
ATOM   3547  C CA    . TYR A 1 435 ? 25.808  13.279  33.963 1.00 19.32 ? 466  TYR A CA    1 
ATOM   3548  C C     . TYR A 1 435 ? 25.477  12.804  35.382 1.00 19.97 ? 466  TYR A C     1 
ATOM   3549  O O     . TYR A 1 435 ? 26.249  12.995  36.318 1.00 20.37 ? 466  TYR A O     1 
ATOM   3550  C CB    . TYR A 1 435 ? 25.287  14.706  33.752 1.00 19.65 ? 466  TYR A CB    1 
ATOM   3551  C CG    . TYR A 1 435 ? 26.109  15.492  32.768 1.00 18.88 ? 466  TYR A CG    1 
ATOM   3552  C CD1   . TYR A 1 435 ? 27.395  15.944  33.110 1.00 17.94 ? 466  TYR A CD1   1 
ATOM   3553  C CD2   . TYR A 1 435 ? 25.644  15.713  31.467 1.00 19.42 ? 466  TYR A CD2   1 
ATOM   3554  C CE1   . TYR A 1 435 ? 28.211  16.592  32.176 1.00 18.69 ? 466  TYR A CE1   1 
ATOM   3555  C CE2   . TYR A 1 435 ? 26.449  16.361  30.516 1.00 21.26 ? 466  TYR A CE2   1 
ATOM   3556  C CZ    . TYR A 1 435 ? 27.738  16.794  30.873 1.00 21.07 ? 466  TYR A CZ    1 
ATOM   3557  O OH    . TYR A 1 435 ? 28.549  17.375  29.914 1.00 19.09 ? 466  TYR A OH    1 
ATOM   3558  N N     . ARG A 1 436 ? 24.323  12.181  35.549 1.00 20.66 ? 467  ARG A N     1 
ATOM   3559  C CA    . ARG A 1 436 ? 23.944  11.704  36.867 1.00 21.13 ? 467  ARG A CA    1 
ATOM   3560  C C     . ARG A 1 436 ? 24.897  10.574  37.248 1.00 22.18 ? 467  ARG A C     1 
ATOM   3561  O O     . ARG A 1 436 ? 25.385  10.505  38.385 1.00 22.20 ? 467  ARG A O     1 
ATOM   3562  C CB    . ARG A 1 436 ? 22.483  11.227  36.856 1.00 20.85 ? 467  ARG A CB    1 
ATOM   3563  C CG    . ARG A 1 436 ? 21.488  12.318  37.279 1.00 19.26 ? 467  ARG A CG    1 
ATOM   3564  C CD    . ARG A 1 436 ? 20.063  11.818  37.263 1.00 18.52 ? 467  ARG A CD    1 
ATOM   3565  N NE    . ARG A 1 436 ? 19.767  10.964  38.413 1.00 19.50 ? 467  ARG A NE    1 
ATOM   3566  C CZ    . ARG A 1 436 ? 19.730  11.380  39.679 1.00 19.40 ? 467  ARG A CZ    1 
ATOM   3567  N NH1   . ARG A 1 436 ? 19.976  12.649  39.971 1.00 18.88 ? 467  ARG A NH1   1 
ATOM   3568  N NH2   . ARG A 1 436 ? 19.457  10.524  40.657 1.00 17.79 ? 467  ARG A NH2   1 
ATOM   3569  N N     . LYS A 1 437 ? 25.170  9.686   36.297 1.00 21.18 ? 468  LYS A N     1 
ATOM   3570  C CA    . LYS A 1 437 ? 26.089  8.592   36.550 1.00 21.86 ? 468  LYS A CA    1 
ATOM   3571  C C     . LYS A 1 437 ? 27.461  9.213   36.812 1.00 23.55 ? 468  LYS A C     1 
ATOM   3572  O O     . LYS A 1 437 ? 28.169  8.840   37.738 1.00 23.03 ? 468  LYS A O     1 
ATOM   3573  C CB    . LYS A 1 437 ? 26.166  7.691   35.334 1.00 20.46 ? 468  LYS A CB    1 
ATOM   3574  C CG    . LYS A 1 437 ? 25.108  6.625   35.293 1.00 20.04 ? 468  LYS A CG    1 
ATOM   3575  C CD    . LYS A 1 437 ? 24.645  6.415   33.868 1.00 21.14 ? 468  LYS A CD    1 
ATOM   3576  C CE    . LYS A 1 437 ? 25.279  5.191   33.270 1.00 21.82 ? 468  LYS A CE    1 
ATOM   3577  N NZ    . LYS A 1 437 ? 25.023  5.105   31.805 1.00 22.45 ? 468  LYS A NZ    1 
ATOM   3578  N N     . ARG A 1 438 ? 27.825  10.182  35.981 1.00 23.70 ? 469  ARG A N     1 
ATOM   3579  C CA    . ARG A 1 438 ? 29.101  10.850  36.130 1.00 24.46 ? 469  ARG A CA    1 
ATOM   3580  C C     . ARG A 1 438 ? 29.309  11.337  37.558 1.00 23.97 ? 469  ARG A C     1 
ATOM   3581  O O     . ARG A 1 438 ? 30.435  11.433  38.034 1.00 24.25 ? 469  ARG A O     1 
ATOM   3582  C CB    . ARG A 1 438 ? 29.180  12.029  35.160 1.00 27.38 ? 469  ARG A CB    1 
ATOM   3583  C CG    . ARG A 1 438 ? 30.465  12.854  35.222 1.00 28.79 ? 469  ARG A CG    1 
ATOM   3584  C CD    . ARG A 1 438 ? 31.660  11.986  35.536 1.00 31.59 ? 469  ARG A CD    1 
ATOM   3585  N NE    . ARG A 1 438 ? 32.884  12.767  35.593 1.00 33.42 ? 469  ARG A NE    1 
ATOM   3586  C CZ    . ARG A 1 438 ? 33.272  13.449  36.663 1.00 34.70 ? 469  ARG A CZ    1 
ATOM   3587  N NH1   . ARG A 1 438 ? 32.539  13.453  37.765 1.00 34.88 ? 469  ARG A NH1   1 
ATOM   3588  N NH2   . ARG A 1 438 ? 34.414  14.104  36.636 1.00 36.48 ? 469  ARG A NH2   1 
ATOM   3589  N N     . PHE A 1 439 ? 28.227  11.637  38.253 1.00 24.14 ? 470  PHE A N     1 
ATOM   3590  C CA    . PHE A 1 439 ? 28.368  12.125  39.610 1.00 23.05 ? 470  PHE A CA    1 
ATOM   3591  C C     . PHE A 1 439 ? 27.858  11.165  40.667 1.00 22.65 ? 470  PHE A C     1 
ATOM   3592  O O     . PHE A 1 439 ? 27.437  11.582  41.742 1.00 23.44 ? 470  PHE A O     1 
ATOM   3593  C CB    . PHE A 1 439 ? 27.707  13.508  39.741 1.00 22.65 ? 470  PHE A CB    1 
ATOM   3594  C CG    . PHE A 1 439 ? 28.541  14.618  39.151 1.00 21.36 ? 470  PHE A CG    1 
ATOM   3595  C CD1   . PHE A 1 439 ? 29.426  15.353  39.946 1.00 19.71 ? 470  PHE A CD1   1 
ATOM   3596  C CD2   . PHE A 1 439 ? 28.525  14.850  37.777 1.00 20.45 ? 470  PHE A CD2   1 
ATOM   3597  C CE1   . PHE A 1 439 ? 30.300  16.304  39.372 1.00 19.45 ? 470  PHE A CE1   1 
ATOM   3598  C CE2   . PHE A 1 439 ? 29.387  15.792  37.195 1.00 21.03 ? 470  PHE A CE2   1 
ATOM   3599  C CZ    . PHE A 1 439 ? 30.280  16.518  37.997 1.00 19.47 ? 470  PHE A CZ    1 
ATOM   3600  N N     . SER A 1 440 ? 27.918  9.874   40.357 1.00 23.95 ? 471  SER A N     1 
ATOM   3601  C CA    . SER A 1 440 ? 27.509  8.819   41.283 1.00 24.64 ? 471  SER A CA    1 
ATOM   3602  C C     . SER A 1 440 ? 26.052  8.851   41.708 1.00 25.22 ? 471  SER A C     1 
ATOM   3603  O O     . SER A 1 440 ? 25.699  8.436   42.816 1.00 25.96 ? 471  SER A O     1 
ATOM   3604  C CB    . SER A 1 440 ? 28.384  8.858   42.522 1.00 23.59 ? 471  SER A CB    1 
ATOM   3605  O OG    . SER A 1 440 ? 29.683  8.422   42.199 1.00 26.83 ? 471  SER A OG    1 
ATOM   3606  N N     . LEU A 1 441 ? 25.206  9.346   40.823 1.00 26.18 ? 472  LEU A N     1 
ATOM   3607  C CA    . LEU A 1 441 ? 23.797  9.409   41.112 1.00 26.29 ? 472  LEU A CA    1 
ATOM   3608  C C     . LEU A 1 441 ? 23.116  8.329   40.294 1.00 27.91 ? 472  LEU A C     1 
ATOM   3609  O O     . LEU A 1 441 ? 23.594  7.932   39.236 1.00 27.93 ? 472  LEU A O     1 
ATOM   3610  C CB    . LEU A 1 441 ? 23.251  10.782  40.749 1.00 25.36 ? 472  LEU A CB    1 
ATOM   3611  C CG    . LEU A 1 441 ? 24.074  11.948  41.297 1.00 23.39 ? 472  LEU A CG    1 
ATOM   3612  C CD1   . LEU A 1 441 ? 23.509  13.249  40.758 1.00 22.27 ? 472  LEU A CD1   1 
ATOM   3613  C CD2   . LEU A 1 441 ? 24.062  11.935  42.811 1.00 20.99 ? 472  LEU A CD2   1 
ATOM   3614  N N     . LYS A 1 442 ? 21.995  7.844   40.794 1.00 30.55 ? 473  LYS A N     1 
ATOM   3615  C CA    . LYS A 1 442 ? 21.277  6.796   40.112 1.00 32.04 ? 473  LYS A CA    1 
ATOM   3616  C C     . LYS A 1 442 ? 20.488  7.401   38.966 1.00 30.30 ? 473  LYS A C     1 
ATOM   3617  O O     . LYS A 1 442 ? 19.776  8.380   39.146 1.00 30.71 ? 473  LYS A O     1 
ATOM   3618  C CB    . LYS A 1 442 ? 20.351  6.097   41.098 1.00 36.80 ? 473  LYS A CB    1 
ATOM   3619  C CG    . LYS A 1 442 ? 19.376  5.156   40.449 1.00 44.19 ? 473  LYS A CG    1 
ATOM   3620  C CD    . LYS A 1 442 ? 18.823  4.157   41.452 1.00 49.45 ? 473  LYS A CD    1 
ATOM   3621  C CE    . LYS A 1 442 ? 17.925  3.136   40.755 1.00 53.52 ? 473  LYS A CE    1 
ATOM   3622  N NZ    . LYS A 1 442 ? 17.098  2.330   41.699 1.00 55.76 ? 473  LYS A NZ    1 
ATOM   3623  N N     . PRO A 1 443 ? 20.636  6.846   37.755 1.00 29.02 ? 474  PRO A N     1 
ATOM   3624  C CA    . PRO A 1 443 ? 19.883  7.412   36.634 1.00 29.21 ? 474  PRO A CA    1 
ATOM   3625  C C     . PRO A 1 443 ? 18.379  7.296   36.864 1.00 28.42 ? 474  PRO A C     1 
ATOM   3626  O O     . PRO A 1 443 ? 17.912  6.410   37.581 1.00 30.15 ? 474  PRO A O     1 
ATOM   3627  C CB    . PRO A 1 443 ? 20.356  6.605   35.412 1.00 27.63 ? 474  PRO A CB    1 
ATOM   3628  C CG    . PRO A 1 443 ? 21.108  5.453   35.937 1.00 26.38 ? 474  PRO A CG    1 
ATOM   3629  C CD    . PRO A 1 443 ? 21.503  5.726   37.354 1.00 27.93 ? 474  PRO A CD    1 
ATOM   3630  N N     . TYR A 1 444 ? 17.621  8.216   36.285 1.00 27.12 ? 475  TYR A N     1 
ATOM   3631  C CA    . TYR A 1 444 ? 16.181  8.175   36.428 1.00 26.14 ? 475  TYR A CA    1 
ATOM   3632  C C     . TYR A 1 444 ? 15.658  7.159   35.431 1.00 24.92 ? 475  TYR A C     1 
ATOM   3633  O O     . TYR A 1 444 ? 16.179  7.058   34.331 1.00 24.22 ? 475  TYR A O     1 
ATOM   3634  C CB    . TYR A 1 444 ? 15.589  9.557   36.148 1.00 24.97 ? 475  TYR A CB    1 
ATOM   3635  C CG    . TYR A 1 444 ? 15.794  10.536  37.286 1.00 23.54 ? 475  TYR A CG    1 
ATOM   3636  C CD1   . TYR A 1 444 ? 16.353  11.794  37.060 1.00 23.84 ? 475  TYR A CD1   1 
ATOM   3637  C CD2   . TYR A 1 444 ? 15.408  10.213  38.590 1.00 23.59 ? 475  TYR A CD2   1 
ATOM   3638  C CE1   . TYR A 1 444 ? 16.516  12.709  38.110 1.00 22.84 ? 475  TYR A CE1   1 
ATOM   3639  C CE2   . TYR A 1 444 ? 15.572  11.128  39.641 1.00 21.89 ? 475  TYR A CE2   1 
ATOM   3640  C CZ    . TYR A 1 444 ? 16.123  12.371  39.391 1.00 22.49 ? 475  TYR A CZ    1 
ATOM   3641  O OH    . TYR A 1 444 ? 16.266  13.291  40.405 1.00 21.02 ? 475  TYR A OH    1 
ATOM   3642  N N     . THR A 1 445 ? 14.632  6.413   35.824 1.00 25.43 ? 476  THR A N     1 
ATOM   3643  C CA    . THR A 1 445 ? 14.033  5.391   34.979 1.00 26.38 ? 476  THR A CA    1 
ATOM   3644  C C     . THR A 1 445 ? 12.741  5.855   34.316 1.00 26.71 ? 476  THR A C     1 
ATOM   3645  O O     . THR A 1 445 ? 12.184  5.145   33.483 1.00 27.69 ? 476  THR A O     1 
ATOM   3646  C CB    . THR A 1 445 ? 13.731  4.134   35.795 1.00 26.90 ? 476  THR A CB    1 
ATOM   3647  O OG1   . THR A 1 445 ? 12.942  4.480   36.942 1.00 26.82 ? 476  THR A OG1   1 
ATOM   3648  C CG2   . THR A 1 445 ? 15.028  3.503   36.273 1.00 25.82 ? 476  THR A CG2   1 
ATOM   3649  N N     . SER A 1 446 ? 12.270  7.042   34.687 1.00 26.18 ? 477  SER A N     1 
ATOM   3650  C CA    . SER A 1 446 ? 11.048  7.590   34.119 1.00 25.66 ? 477  SER A CA    1 
ATOM   3651  C C     . SER A 1 446 ? 10.942  9.088   34.394 1.00 25.92 ? 477  SER A C     1 
ATOM   3652  O O     . SER A 1 446 ? 11.462  9.589   35.395 1.00 26.20 ? 477  SER A O     1 
ATOM   3653  C CB    . SER A 1 446 ? 9.840   6.878   34.711 1.00 25.10 ? 477  SER A CB    1 
ATOM   3654  O OG    . SER A 1 446 ? 9.528   7.425   35.975 1.00 25.06 ? 477  SER A OG    1 
ATOM   3655  N N     . PHE A 1 447 ? 10.263  9.801   33.504 1.00 25.23 ? 478  PHE A N     1 
ATOM   3656  C CA    . PHE A 1 447 ? 10.089  11.234  33.668 1.00 26.56 ? 478  PHE A CA    1 
ATOM   3657  C C     . PHE A 1 447 ? 9.306   11.558  34.928 1.00 28.85 ? 478  PHE A C     1 
ATOM   3658  O O     . PHE A 1 447 ? 9.474   12.627  35.513 1.00 29.08 ? 478  PHE A O     1 
ATOM   3659  C CB    . PHE A 1 447 ? 9.383   11.823  32.455 1.00 25.03 ? 478  PHE A CB    1 
ATOM   3660  C CG    . PHE A 1 447 ? 10.197  11.751  31.204 1.00 23.54 ? 478  PHE A CG    1 
ATOM   3661  C CD1   . PHE A 1 447 ? 10.090  10.650  30.355 1.00 22.65 ? 478  PHE A CD1   1 
ATOM   3662  C CD2   . PHE A 1 447 ? 11.089  12.767  30.883 1.00 21.38 ? 478  PHE A CD2   1 
ATOM   3663  C CE1   . PHE A 1 447 ? 10.864  10.553  29.199 1.00 22.77 ? 478  PHE A CE1   1 
ATOM   3664  C CE2   . PHE A 1 447 ? 11.873  12.688  29.727 1.00 23.54 ? 478  PHE A CE2   1 
ATOM   3665  C CZ    . PHE A 1 447 ? 11.763  11.577  28.880 1.00 23.50 ? 478  PHE A CZ    1 
ATOM   3666  N N     . GLU A 1 448 ? 8.441   10.642  35.343 1.00 30.63 ? 479  GLU A N     1 
ATOM   3667  C CA    . GLU A 1 448 ? 7.665   10.858  36.549 1.00 32.56 ? 479  GLU A CA    1 
ATOM   3668  C C     . GLU A 1 448 ? 8.617   10.785  37.742 1.00 32.47 ? 479  GLU A C     1 
ATOM   3669  O O     . GLU A 1 448 ? 8.450   11.479  38.741 1.00 32.60 ? 479  GLU A O     1 
ATOM   3670  C CB    . GLU A 1 448 ? 6.571   9.794   36.661 1.00 33.07 ? 479  GLU A CB    1 
ATOM   3671  C CG    . GLU A 1 448 ? 5.283   10.160  35.935 1.00 35.54 ? 479  GLU A CG    1 
ATOM   3672  C CD    . GLU A 1 448 ? 4.087   9.311   36.356 1.00 37.52 ? 479  GLU A CD    1 
ATOM   3673  O OE1   . GLU A 1 448 ? 4.277   8.294   37.063 1.00 38.10 ? 479  GLU A OE1   1 
ATOM   3674  O OE2   . GLU A 1 448 ? 2.949   9.666   35.975 1.00 38.94 ? 479  GLU A OE2   1 
ATOM   3675  N N     . GLU A 1 449 ? 9.629   9.940   37.631 1.00 32.67 ? 480  GLU A N     1 
ATOM   3676  C CA    . GLU A 1 449 ? 10.587  9.813   38.711 1.00 33.06 ? 480  GLU A CA    1 
ATOM   3677  C C     . GLU A 1 449 ? 11.370  11.106  38.839 1.00 31.42 ? 480  GLU A C     1 
ATOM   3678  O O     . GLU A 1 449 ? 11.703  11.549  39.941 1.00 31.69 ? 480  GLU A O     1 
ATOM   3679  C CB    . GLU A 1 449 ? 11.554  8.667   38.443 1.00 32.95 ? 480  GLU A CB    1 
ATOM   3680  C CG    . GLU A 1 449 ? 12.210  8.168   39.709 1.00 33.81 ? 480  GLU A CG    1 
ATOM   3681  C CD    . GLU A 1 449 ? 13.434  7.320   39.454 1.00 34.28 ? 480  GLU A CD    1 
ATOM   3682  O OE1   . GLU A 1 449 ? 14.182  7.069   40.417 1.00 35.91 ? 480  GLU A OE1   1 
ATOM   3683  O OE2   . GLU A 1 449 ? 13.656  6.900   38.303 1.00 35.57 ? 480  GLU A OE2   1 
ATOM   3684  N N     . LEU A 1 450 ? 11.651  11.710  37.693 1.00 30.93 ? 481  LEU A N     1 
ATOM   3685  C CA    . LEU A 1 450 ? 12.410  12.950  37.650 1.00 29.97 ? 481  LEU A CA    1 
ATOM   3686  C C     . LEU A 1 450 ? 11.685  14.144  38.257 1.00 28.68 ? 481  LEU A C     1 
ATOM   3687  O O     . LEU A 1 450 ? 12.222  14.837  39.113 1.00 29.39 ? 481  LEU A O     1 
ATOM   3688  C CB    . LEU A 1 450 ? 12.794  13.267  36.201 1.00 28.68 ? 481  LEU A CB    1 
ATOM   3689  C CG    . LEU A 1 450 ? 13.156  14.717  35.890 1.00 27.34 ? 481  LEU A CG    1 
ATOM   3690  C CD1   . LEU A 1 450 ? 14.482  15.073  36.553 1.00 26.67 ? 481  LEU A CD1   1 
ATOM   3691  C CD2   . LEU A 1 450 ? 13.225  14.904  34.380 1.00 25.62 ? 481  LEU A CD2   1 
ATOM   3692  N N     . THR A 1 451 ? 10.461  14.375  37.815 1.00 28.61 ? 482  THR A N     1 
ATOM   3693  C CA    . THR A 1 451 ? 9.676   15.500  38.277 1.00 26.86 ? 482  THR A CA    1 
ATOM   3694  C C     . THR A 1 451 ? 8.938   15.268  39.587 1.00 27.89 ? 482  THR A C     1 
ATOM   3695  O O     . THR A 1 451 ? 8.613   16.217  40.298 1.00 27.84 ? 482  THR A O     1 
ATOM   3696  C CB    . THR A 1 451 ? 8.643   15.876  37.226 1.00 27.34 ? 482  THR A CB    1 
ATOM   3697  O OG1   . THR A 1 451 ? 7.583   14.912  37.237 1.00 26.46 ? 482  THR A OG1   1 
ATOM   3698  C CG2   . THR A 1 451 ? 9.265   15.882  35.849 1.00 24.61 ? 482  THR A CG2   1 
ATOM   3699  N N     . GLY A 1 452 ? 8.659   14.010  39.902 1.00 29.49 ? 483  GLY A N     1 
ATOM   3700  C CA    . GLY A 1 452 ? 7.918   13.708  41.114 1.00 30.07 ? 483  GLY A CA    1 
ATOM   3701  C C     . GLY A 1 452 ? 6.432   14.021  40.955 1.00 30.67 ? 483  GLY A C     1 
ATOM   3702  O O     . GLY A 1 452 ? 5.718   14.175  41.942 1.00 31.22 ? 483  GLY A O     1 
ATOM   3703  N N     . GLU A 1 453 ? 5.967   14.129  39.714 1.00 31.63 ? 484  GLU A N     1 
ATOM   3704  C CA    . GLU A 1 453 ? 4.560   14.416  39.430 1.00 31.91 ? 484  GLU A CA    1 
ATOM   3705  C C     . GLU A 1 453 ? 4.178   13.813  38.074 1.00 32.96 ? 484  GLU A C     1 
ATOM   3706  O O     . GLU A 1 453 ? 4.973   13.070  37.494 1.00 33.34 ? 484  GLU A O     1 
ATOM   3707  C CB    . GLU A 1 453 ? 4.305   15.925  39.432 1.00 30.87 ? 484  GLU A CB    1 
ATOM   3708  C CG    . GLU A 1 453 ? 5.281   16.734  38.594 1.00 29.89 ? 484  GLU A CG    1 
ATOM   3709  C CD    . GLU A 1 453 ? 4.975   16.680  37.105 1.00 29.38 ? 484  GLU A CD    1 
ATOM   3710  O OE1   . GLU A 1 453 ? 5.578   15.843  36.397 1.00 29.18 ? 484  GLU A OE1   1 
ATOM   3711  O OE2   . GLU A 1 453 ? 4.135   17.476  36.637 1.00 27.94 ? 484  GLU A OE2   1 
ATOM   3712  N N     . LYS A 1 454 ? 2.985   14.131  37.563 1.00 34.49 ? 485  LYS A N     1 
ATOM   3713  C CA    . LYS A 1 454 ? 2.525   13.556  36.289 1.00 35.00 ? 485  LYS A CA    1 
ATOM   3714  C C     . LYS A 1 454 ? 2.345   14.475  35.086 1.00 33.63 ? 485  LYS A C     1 
ATOM   3715  O O     . LYS A 1 454 ? 2.676   14.097  33.971 1.00 33.70 ? 485  LYS A O     1 
ATOM   3716  C CB    . LYS A 1 454 ? 1.200   12.808  36.489 1.00 37.45 ? 485  LYS A CB    1 
ATOM   3717  C CG    . LYS A 1 454 ? 1.137   11.907  37.705 1.00 41.21 ? 485  LYS A CG    1 
ATOM   3718  C CD    . LYS A 1 454 ? 0.376   10.621  37.402 1.00 43.14 ? 485  LYS A CD    1 
ATOM   3719  C CE    . LYS A 1 454 ? 0.336   9.712   38.630 1.00 45.24 ? 485  LYS A CE    1 
ATOM   3720  N NZ    . LYS A 1 454 ? -0.200  8.346   38.327 1.00 47.53 ? 485  LYS A NZ    1 
ATOM   3721  N N     . GLU A 1 455 ? 1.803   15.668  35.291 1.00 34.12 ? 486  GLU A N     1 
ATOM   3722  C CA    . GLU A 1 455 ? 1.565   16.564  34.170 1.00 34.21 ? 486  GLU A CA    1 
ATOM   3723  C C     . GLU A 1 455 ? 2.797   16.891  33.346 1.00 34.72 ? 486  GLU A C     1 
ATOM   3724  O O     . GLU A 1 455 ? 2.846   16.619  32.149 1.00 35.11 ? 486  GLU A O     1 
ATOM   3725  C CB    . GLU A 1 455 ? 0.934   17.862  34.650 1.00 34.96 ? 486  GLU A CB    1 
ATOM   3726  C CG    . GLU A 1 455 ? 0.619   18.812  33.517 1.00 37.89 ? 486  GLU A CG    1 
ATOM   3727  C CD    . GLU A 1 455 ? -0.383  19.870  33.914 1.00 40.57 ? 486  GLU A CD    1 
ATOM   3728  O OE1   . GLU A 1 455 ? -0.282  21.006  33.394 1.00 42.19 ? 486  GLU A OE1   1 
ATOM   3729  O OE2   . GLU A 1 455 ? -1.268  19.563  34.748 1.00 42.01 ? 486  GLU A OE2   1 
ATOM   3730  N N     . MET A 1 456 ? 3.791   17.500  33.981 1.00 35.02 ? 487  MET A N     1 
ATOM   3731  C CA    . MET A 1 456 ? 5.014   17.858  33.278 1.00 34.99 ? 487  MET A CA    1 
ATOM   3732  C C     . MET A 1 456 ? 5.736   16.615  32.785 1.00 34.23 ? 487  MET A C     1 
ATOM   3733  O O     . MET A 1 456 ? 6.221   16.582  31.660 1.00 34.09 ? 487  MET A O     1 
ATOM   3734  C CB    . MET A 1 456 ? 5.924   18.655  34.203 1.00 34.18 ? 487  MET A CB    1 
ATOM   3735  C CG    . MET A 1 456 ? 5.452   20.081  34.435 1.00 33.33 ? 487  MET A CG    1 
ATOM   3736  S SD    . MET A 1 456 ? 6.598   21.030  35.453 1.00 32.47 ? 487  MET A SD    1 
ATOM   3737  C CE    . MET A 1 456 ? 6.840   19.878  36.796 1.00 34.36 ? 487  MET A CE    1 
ATOM   3738  N N     . ALA A 1 457 ? 5.799   15.589  33.627 1.00 34.49 ? 488  ALA A N     1 
ATOM   3739  C CA    . ALA A 1 457 ? 6.462   14.344  33.252 1.00 33.89 ? 488  ALA A CA    1 
ATOM   3740  C C     . ALA A 1 457 ? 5.887   13.808  31.949 1.00 33.42 ? 488  ALA A C     1 
ATOM   3741  O O     . ALA A 1 457 ? 6.622   13.387  31.052 1.00 33.49 ? 488  ALA A O     1 
ATOM   3742  C CB    . ALA A 1 457 ? 6.294   13.314  34.351 1.00 32.26 ? 488  ALA A CB    1 
ATOM   3743  N N     . ALA A 1 458 ? 4.564   13.838  31.847 1.00 33.48 ? 489  ALA A N     1 
ATOM   3744  C CA    . ALA A 1 458 ? 3.883   13.340  30.665 1.00 33.45 ? 489  ALA A CA    1 
ATOM   3745  C C     . ALA A 1 458 ? 4.227   14.191  29.462 1.00 33.07 ? 489  ALA A C     1 
ATOM   3746  O O     . ALA A 1 458 ? 4.421   13.671  28.372 1.00 33.64 ? 489  ALA A O     1 
ATOM   3747  C CB    . ALA A 1 458 ? 2.386   13.339  30.894 1.00 32.85 ? 489  ALA A CB    1 
ATOM   3748  N N     . GLU A 1 459 ? 4.306   15.501  29.655 1.00 33.10 ? 490  GLU A N     1 
ATOM   3749  C CA    . GLU A 1 459 ? 4.633   16.386  28.547 1.00 32.97 ? 490  GLU A CA    1 
ATOM   3750  C C     . GLU A 1 459 ? 6.064   16.124  28.095 1.00 32.62 ? 490  GLU A C     1 
ATOM   3751  O O     . GLU A 1 459 ? 6.371   16.161  26.903 1.00 32.09 ? 490  GLU A O     1 
ATOM   3752  C CB    . GLU A 1 459 ? 4.452   17.841  28.968 1.00 34.47 ? 490  GLU A CB    1 
ATOM   3753  C CG    . GLU A 1 459 ? 3.001   18.237  29.023 1.00 37.03 ? 490  GLU A CG    1 
ATOM   3754  C CD    . GLU A 1 459 ? 2.811   19.689  29.320 1.00 40.03 ? 490  GLU A CD    1 
ATOM   3755  O OE1   . GLU A 1 459 ? 3.574   20.223  30.152 1.00 41.49 ? 490  GLU A OE1   1 
ATOM   3756  O OE2   . GLU A 1 459 ? 1.896   20.295  28.721 1.00 43.47 ? 490  GLU A OE2   1 
ATOM   3757  N N     . LEU A 1 460 ? 6.935   15.844  29.057 1.00 31.93 ? 491  LEU A N     1 
ATOM   3758  C CA    . LEU A 1 460 ? 8.331   15.554  28.759 1.00 31.07 ? 491  LEU A CA    1 
ATOM   3759  C C     . LEU A 1 460 ? 8.400   14.226  28.014 1.00 31.07 ? 491  LEU A C     1 
ATOM   3760  O O     . LEU A 1 460 ? 9.088   14.114  27.001 1.00 30.03 ? 491  LEU A O     1 
ATOM   3761  C CB    . LEU A 1 460 ? 9.150   15.475  30.054 1.00 30.11 ? 491  LEU A CB    1 
ATOM   3762  C CG    . LEU A 1 460 ? 9.416   16.820  30.742 1.00 29.81 ? 491  LEU A CG    1 
ATOM   3763  C CD1   . LEU A 1 460 ? 9.870   16.604  32.170 1.00 29.27 ? 491  LEU A CD1   1 
ATOM   3764  C CD2   . LEU A 1 460 ? 10.466  17.596  29.959 1.00 28.80 ? 491  LEU A CD2   1 
ATOM   3765  N N     . LYS A 1 461 ? 7.677   13.227  28.514 1.00 31.11 ? 492  LYS A N     1 
ATOM   3766  C CA    . LYS A 1 461 ? 7.682   11.925  27.878 1.00 32.23 ? 492  LYS A CA    1 
ATOM   3767  C C     . LYS A 1 461 ? 7.255   12.083  26.435 1.00 31.57 ? 492  LYS A C     1 
ATOM   3768  O O     . LYS A 1 461 ? 7.831   11.477  25.544 1.00 32.55 ? 492  LYS A O     1 
ATOM   3769  C CB    . LYS A 1 461 ? 6.729   10.971  28.584 1.00 32.88 ? 492  LYS A CB    1 
ATOM   3770  C CG    . LYS A 1 461 ? 6.659   9.603   27.927 1.00 33.92 ? 492  LYS A CG    1 
ATOM   3771  C CD    . LYS A 1 461 ? 6.998   8.507   28.918 1.00 36.15 ? 492  LYS A CD    1 
ATOM   3772  C CE    . LYS A 1 461 ? 6.882   7.128   28.298 1.00 36.97 ? 492  LYS A CE    1 
ATOM   3773  N NZ    . LYS A 1 461 ? 7.964   6.866   27.300 1.00 38.67 ? 492  LYS A NZ    1 
ATOM   3774  N N     . ALA A 1 462 ? 6.242   12.908  26.203 1.00 30.84 ? 493  ALA A N     1 
ATOM   3775  C CA    . ALA A 1 462 ? 5.750   13.134  24.847 1.00 30.50 ? 493  ALA A CA    1 
ATOM   3776  C C     . ALA A 1 462 ? 6.834   13.697  23.940 1.00 30.15 ? 493  ALA A C     1 
ATOM   3777  O O     . ALA A 1 462 ? 7.011   13.250  22.813 1.00 31.61 ? 493  ALA A O     1 
ATOM   3778  C CB    . ALA A 1 462 ? 4.561   14.082  24.873 1.00 28.49 ? 493  ALA A CB    1 
ATOM   3779  N N     . LEU A 1 463 ? 7.560   14.687  24.438 1.00 31.60 ? 494  LEU A N     1 
ATOM   3780  C CA    . LEU A 1 463 ? 8.619   15.323  23.665 1.00 30.45 ? 494  LEU A CA    1 
ATOM   3781  C C     . LEU A 1 463 ? 9.912   14.510  23.490 1.00 30.41 ? 494  LEU A C     1 
ATOM   3782  O O     . LEU A 1 463 ? 10.479  14.479  22.400 1.00 30.59 ? 494  LEU A O     1 
ATOM   3783  C CB    . LEU A 1 463 ? 8.956   16.676  24.292 1.00 31.04 ? 494  LEU A CB    1 
ATOM   3784  C CG    . LEU A 1 463 ? 7.946   17.815  24.115 1.00 32.60 ? 494  LEU A CG    1 
ATOM   3785  C CD1   . LEU A 1 463 ? 8.124   18.840  25.235 1.00 33.85 ? 494  LEU A CD1   1 
ATOM   3786  C CD2   . LEU A 1 463 ? 8.147   18.484  22.763 1.00 32.47 ? 494  LEU A CD2   1 
ATOM   3787  N N     . TYR A 1 464 ? 10.370  13.853  24.552 1.00 30.34 ? 495  TYR A N     1 
ATOM   3788  C CA    . TYR A 1 464 ? 11.613  13.089  24.512 1.00 30.20 ? 495  TYR A CA    1 
ATOM   3789  C C     . TYR A 1 464 ? 11.480  11.587  24.267 1.00 31.33 ? 495  TYR A C     1 
ATOM   3790  O O     . TYR A 1 464 ? 12.390  10.974  23.705 1.00 32.63 ? 495  TYR A O     1 
ATOM   3791  C CB    . TYR A 1 464 ? 12.381  13.307  25.812 1.00 29.37 ? 495  TYR A CB    1 
ATOM   3792  C CG    . TYR A 1 464 ? 12.951  14.701  25.962 1.00 28.75 ? 495  TYR A CG    1 
ATOM   3793  C CD1   . TYR A 1 464 ? 12.238  15.696  26.625 1.00 27.84 ? 495  TYR A CD1   1 
ATOM   3794  C CD2   . TYR A 1 464 ? 14.214  15.026  25.450 1.00 28.41 ? 495  TYR A CD2   1 
ATOM   3795  C CE1   . TYR A 1 464 ? 12.767  16.977  26.777 1.00 27.76 ? 495  TYR A CE1   1 
ATOM   3796  C CE2   . TYR A 1 464 ? 14.748  16.302  25.599 1.00 27.22 ? 495  TYR A CE2   1 
ATOM   3797  C CZ    . TYR A 1 464 ? 14.018  17.270  26.265 1.00 27.49 ? 495  TYR A CZ    1 
ATOM   3798  O OH    . TYR A 1 464 ? 14.532  18.532  26.438 1.00 26.50 ? 495  TYR A OH    1 
ATOM   3799  N N     . SER A 1 465 ? 10.369  10.998  24.708 1.00 31.51 ? 496  SER A N     1 
ATOM   3800  C CA    . SER A 1 465 ? 10.106  9.562   24.542 1.00 31.07 ? 496  SER A CA    1 
ATOM   3801  C C     . SER A 1 465 ? 10.871  8.669   25.506 1.00 30.50 ? 496  SER A C     1 
ATOM   3802  O O     . SER A 1 465 ? 10.296  7.808   26.160 1.00 31.58 ? 496  SER A O     1 
ATOM   3803  C CB    . SER A 1 465 ? 10.427  9.113   23.113 1.00 32.23 ? 496  SER A CB    1 
ATOM   3804  O OG    . SER A 1 465 ? 9.793   9.942   22.146 1.00 34.65 ? 496  SER A OG    1 
ATOM   3805  N N     . ASP A 1 466 ? 12.178  8.882   25.582 1.00 30.84 ? 497  ASP A N     1 
ATOM   3806  C CA    . ASP A 1 466 ? 13.060  8.096   26.441 1.00 29.76 ? 497  ASP A CA    1 
ATOM   3807  C C     . ASP A 1 466 ? 13.689  8.988   27.509 1.00 28.76 ? 497  ASP A C     1 
ATOM   3808  O O     . ASP A 1 466 ? 14.222  10.053  27.200 1.00 29.19 ? 497  ASP A O     1 
ATOM   3809  C CB    . ASP A 1 466 ? 14.161  7.474   25.578 1.00 30.74 ? 497  ASP A CB    1 
ATOM   3810  C CG    . ASP A 1 466 ? 14.969  6.410   26.304 1.00 30.23 ? 497  ASP A CG    1 
ATOM   3811  O OD1   . ASP A 1 466 ? 15.781  5.745   25.629 1.00 30.89 ? 497  ASP A OD1   1 
ATOM   3812  O OD2   . ASP A 1 466 ? 14.809  6.230   27.526 1.00 30.58 ? 497  ASP A OD2   1 
ATOM   3813  N N     . ILE A 1 467 ? 13.630  8.551   28.761 1.00 28.26 ? 498  ILE A N     1 
ATOM   3814  C CA    . ILE A 1 467 ? 14.208  9.323   29.858 1.00 28.44 ? 498  ILE A CA    1 
ATOM   3815  C C     . ILE A 1 467 ? 15.720  9.444   29.663 1.00 28.79 ? 498  ILE A C     1 
ATOM   3816  O O     . ILE A 1 467 ? 16.330  10.450  30.034 1.00 30.36 ? 498  ILE A O     1 
ATOM   3817  C CB    . ILE A 1 467 ? 13.920  8.656   31.229 1.00 27.27 ? 498  ILE A CB    1 
ATOM   3818  C CG1   . ILE A 1 467 ? 14.585  9.449   32.351 1.00 26.82 ? 498  ILE A CG1   1 
ATOM   3819  C CG2   . ILE A 1 467 ? 14.439  7.223   31.236 1.00 26.77 ? 498  ILE A CG2   1 
ATOM   3820  C CD1   . ILE A 1 467 ? 13.868  10.710  32.728 1.00 27.79 ? 498  ILE A CD1   1 
ATOM   3821  N N     . ASP A 1 468 ? 16.312  8.420   29.056 1.00 29.35 ? 499  ASP A N     1 
ATOM   3822  C CA    . ASP A 1 468 ? 17.749  8.389   28.811 1.00 28.58 ? 499  ASP A CA    1 
ATOM   3823  C C     . ASP A 1 468 ? 18.207  9.408   27.769 1.00 29.37 ? 499  ASP A C     1 
ATOM   3824  O O     . ASP A 1 468 ? 19.395  9.530   27.478 1.00 29.88 ? 499  ASP A O     1 
ATOM   3825  C CB    . ASP A 1 468 ? 18.162  6.983   28.378 1.00 27.27 ? 499  ASP A CB    1 
ATOM   3826  C CG    . ASP A 1 468 ? 18.126  5.995   29.520 1.00 25.93 ? 499  ASP A CG    1 
ATOM   3827  O OD1   . ASP A 1 468 ? 18.261  6.444   30.671 1.00 25.29 ? 499  ASP A OD1   1 
ATOM   3828  O OD2   . ASP A 1 468 ? 17.962  4.777   29.281 1.00 25.03 ? 499  ASP A OD2   1 
ATOM   3829  N N     . VAL A 1 469 ? 17.261  10.143  27.207 1.00 30.81 ? 500  VAL A N     1 
ATOM   3830  C CA    . VAL A 1 469 ? 17.585  11.154  26.208 1.00 30.42 ? 500  VAL A CA    1 
ATOM   3831  C C     . VAL A 1 469 ? 17.255  12.534  26.778 1.00 27.72 ? 500  VAL A C     1 
ATOM   3832  O O     . VAL A 1 469 ? 17.476  13.565  26.143 1.00 28.19 ? 500  VAL A O     1 
ATOM   3833  C CB    . VAL A 1 469 ? 16.786  10.883  24.907 1.00 31.83 ? 500  VAL A CB    1 
ATOM   3834  C CG1   . VAL A 1 469 ? 16.906  12.039  23.938 1.00 32.55 ? 500  VAL A CG1   1 
ATOM   3835  C CG2   . VAL A 1 469 ? 17.306  9.609   24.263 1.00 33.34 ? 500  VAL A CG2   1 
ATOM   3836  N N     . MET A 1 470 ? 16.735  12.540  27.998 1.00 26.58 ? 501  MET A N     1 
ATOM   3837  C CA    . MET A 1 470 ? 16.391  13.788  28.651 1.00 26.03 ? 501  MET A CA    1 
ATOM   3838  C C     . MET A 1 470 ? 17.657  14.629  28.815 1.00 24.80 ? 501  MET A C     1 
ATOM   3839  O O     . MET A 1 470 ? 18.735  14.105  29.077 1.00 23.55 ? 501  MET A O     1 
ATOM   3840  C CB    . MET A 1 470 ? 15.745  13.506  30.012 1.00 26.62 ? 501  MET A CB    1 
ATOM   3841  C CG    . MET A 1 470 ? 15.278  14.741  30.769 1.00 26.83 ? 501  MET A CG    1 
ATOM   3842  S SD    . MET A 1 470 ? 14.266  15.881  29.767 1.00 29.96 ? 501  MET A SD    1 
ATOM   3843  C CE    . MET A 1 470 ? 14.017  17.237  30.947 1.00 26.38 ? 501  MET A CE    1 
ATOM   3844  N N     . GLU A 1 471 ? 17.509  15.938  28.650 1.00 25.11 ? 502  GLU A N     1 
ATOM   3845  C CA    . GLU A 1 471 ? 18.619  16.871  28.757 1.00 24.36 ? 502  GLU A CA    1 
ATOM   3846  C C     . GLU A 1 471 ? 18.823  17.407  30.179 1.00 25.21 ? 502  GLU A C     1 
ATOM   3847  O O     . GLU A 1 471 ? 17.872  17.585  30.951 1.00 26.10 ? 502  GLU A O     1 
ATOM   3848  C CB    . GLU A 1 471 ? 18.408  18.030  27.789 1.00 23.83 ? 502  GLU A CB    1 
ATOM   3849  C CG    . GLU A 1 471 ? 18.416  17.617  26.342 1.00 23.76 ? 502  GLU A CG    1 
ATOM   3850  C CD    . GLU A 1 471 ? 17.984  18.742  25.423 1.00 24.68 ? 502  GLU A CD    1 
ATOM   3851  O OE1   . GLU A 1 471 ? 18.841  19.563  25.033 1.00 27.11 ? 502  GLU A OE1   1 
ATOM   3852  O OE2   . GLU A 1 471 ? 16.783  18.810  25.090 1.00 26.52 ? 502  GLU A OE2   1 
ATOM   3853  N N     . LEU A 1 472 ? 20.081  17.680  30.502 1.00 24.72 ? 503  LEU A N     1 
ATOM   3854  C CA    . LEU A 1 472 ? 20.486  18.163  31.810 1.00 23.43 ? 503  LEU A CA    1 
ATOM   3855  C C     . LEU A 1 472 ? 19.874  19.488  32.255 1.00 22.76 ? 503  LEU A C     1 
ATOM   3856  O O     . LEU A 1 472 ? 19.256  19.560  33.306 1.00 23.69 ? 503  LEU A O     1 
ATOM   3857  C CB    . LEU A 1 472 ? 22.026  18.257  31.850 1.00 23.34 ? 503  LEU A CB    1 
ATOM   3858  C CG    . LEU A 1 472 ? 22.709  18.859  33.085 1.00 22.28 ? 503  LEU A CG    1 
ATOM   3859  C CD1   . LEU A 1 472 ? 22.569  17.907  34.255 1.00 21.63 ? 503  LEU A CD1   1 
ATOM   3860  C CD2   . LEU A 1 472 ? 24.181  19.122  32.789 1.00 23.14 ? 503  LEU A CD2   1 
ATOM   3861  N N     . TYR A 1 473 ? 20.045  20.542  31.469 1.00 23.51 ? 504  TYR A N     1 
ATOM   3862  C CA    . TYR A 1 473 ? 19.538  21.847  31.869 1.00 24.16 ? 504  TYR A CA    1 
ATOM   3863  C C     . TYR A 1 473 ? 18.047  21.911  32.167 1.00 23.63 ? 504  TYR A C     1 
ATOM   3864  O O     . TYR A 1 473 ? 17.647  22.393  33.228 1.00 23.66 ? 504  TYR A O     1 
ATOM   3865  C CB    . TYR A 1 473 ? 19.878  22.909  30.828 1.00 23.98 ? 504  TYR A CB    1 
ATOM   3866  C CG    . TYR A 1 473 ? 19.256  24.242  31.159 1.00 25.76 ? 504  TYR A CG    1 
ATOM   3867  C CD1   . TYR A 1 473 ? 19.626  24.923  32.321 1.00 26.11 ? 504  TYR A CD1   1 
ATOM   3868  C CD2   . TYR A 1 473 ? 18.265  24.799  30.349 1.00 24.09 ? 504  TYR A CD2   1 
ATOM   3869  C CE1   . TYR A 1 473 ? 19.025  26.121  32.677 1.00 26.25 ? 504  TYR A CE1   1 
ATOM   3870  C CE2   . TYR A 1 473 ? 17.651  26.000  30.693 1.00 26.38 ? 504  TYR A CE2   1 
ATOM   3871  C CZ    . TYR A 1 473 ? 18.035  26.654  31.861 1.00 27.30 ? 504  TYR A CZ    1 
ATOM   3872  O OH    . TYR A 1 473 ? 17.428  27.837  32.226 1.00 30.48 ? 504  TYR A OH    1 
ATOM   3873  N N     . PRO A 1 474 ? 17.201  21.438  31.232 1.00 23.99 ? 505  PRO A N     1 
ATOM   3874  C CA    . PRO A 1 474 ? 15.749  21.477  31.469 1.00 24.32 ? 505  PRO A CA    1 
ATOM   3875  C C     . PRO A 1 474 ? 15.406  20.625  32.685 1.00 23.18 ? 505  PRO A C     1 
ATOM   3876  O O     . PRO A 1 474 ? 14.612  21.020  33.550 1.00 23.08 ? 505  PRO A O     1 
ATOM   3877  C CB    . PRO A 1 474 ? 15.148  20.895  30.189 1.00 23.94 ? 505  PRO A CB    1 
ATOM   3878  C CG    . PRO A 1 474 ? 16.254  20.927  29.181 1.00 25.45 ? 505  PRO A CG    1 
ATOM   3879  C CD    . PRO A 1 474 ? 17.531  20.818  29.938 1.00 24.11 ? 505  PRO A CD    1 
ATOM   3880  N N     . ALA A 1 475 ? 16.025  19.452  32.744 1.00 21.64 ? 506  ALA A N     1 
ATOM   3881  C CA    . ALA A 1 475 ? 15.805  18.543  33.842 1.00 20.56 ? 506  ALA A CA    1 
ATOM   3882  C C     . ALA A 1 475 ? 16.065  19.227  35.182 1.00 21.65 ? 506  ALA A C     1 
ATOM   3883  O O     . ALA A 1 475 ? 15.304  19.037  36.141 1.00 22.91 ? 506  ALA A O     1 
ATOM   3884  C CB    . ALA A 1 475 ? 16.698  17.337  33.689 1.00 19.25 ? 506  ALA A CB    1 
ATOM   3885  N N     . LEU A 1 476 ? 17.113  20.044  35.253 1.00 20.81 ? 507  LEU A N     1 
ATOM   3886  C CA    . LEU A 1 476 ? 17.445  20.714  36.509 1.00 20.77 ? 507  LEU A CA    1 
ATOM   3887  C C     . LEU A 1 476 ? 16.340  21.665  36.998 1.00 21.72 ? 507  LEU A C     1 
ATOM   3888  O O     . LEU A 1 476 ? 16.098  21.781  38.212 1.00 22.37 ? 507  LEU A O     1 
ATOM   3889  C CB    . LEU A 1 476 ? 18.779  21.481  36.381 1.00 20.62 ? 507  LEU A CB    1 
ATOM   3890  C CG    . LEU A 1 476 ? 20.100  20.687  36.321 1.00 19.64 ? 507  LEU A CG    1 
ATOM   3891  C CD1   . LEU A 1 476 ? 21.198  21.609  35.829 1.00 18.60 ? 507  LEU A CD1   1 
ATOM   3892  C CD2   . LEU A 1 476 ? 20.469  20.128  37.678 1.00 18.35 ? 507  LEU A CD2   1 
ATOM   3893  N N     . LEU A 1 477 ? 15.667  22.329  36.057 1.00 21.95 ? 508  LEU A N     1 
ATOM   3894  C CA    . LEU A 1 477 ? 14.599  23.279  36.377 1.00 22.39 ? 508  LEU A CA    1 
ATOM   3895  C C     . LEU A 1 477 ? 13.226  22.612  36.567 1.00 22.15 ? 508  LEU A C     1 
ATOM   3896  O O     . LEU A 1 477 ? 12.259  23.250  36.984 1.00 22.72 ? 508  LEU A O     1 
ATOM   3897  C CB    . LEU A 1 477 ? 14.503  24.324  35.257 1.00 21.11 ? 508  LEU A CB    1 
ATOM   3898  C CG    . LEU A 1 477 ? 15.678  25.275  35.024 1.00 21.78 ? 508  LEU A CG    1 
ATOM   3899  C CD1   . LEU A 1 477 ? 15.192  26.523  34.299 1.00 22.94 ? 508  LEU A CD1   1 
ATOM   3900  C CD2   . LEU A 1 477 ? 16.296  25.656  36.336 1.00 21.79 ? 508  LEU A CD2   1 
ATOM   3901  N N     . VAL A 1 478 ? 13.149  21.326  36.281 1.00 22.92 ? 509  VAL A N     1 
ATOM   3902  C CA    . VAL A 1 478 ? 11.889  20.605  36.390 1.00 24.30 ? 509  VAL A CA    1 
ATOM   3903  C C     . VAL A 1 478 ? 11.971  19.493  37.446 1.00 24.07 ? 509  VAL A C     1 
ATOM   3904  O O     . VAL A 1 478 ? 10.965  18.920  37.850 1.00 24.38 ? 509  VAL A O     1 
ATOM   3905  C CB    . VAL A 1 478 ? 11.545  20.009  34.996 1.00 24.85 ? 509  VAL A CB    1 
ATOM   3906  C CG1   . VAL A 1 478 ? 11.374  18.523  35.080 1.00 25.88 ? 509  VAL A CG1   1 
ATOM   3907  C CG2   . VAL A 1 478 ? 10.322  20.672  34.431 1.00 24.54 ? 509  VAL A CG2   1 
ATOM   3908  N N     . GLU A 1 479 ? 13.185  19.194  37.884 1.00 23.85 ? 510  GLU A N     1 
ATOM   3909  C CA    . GLU A 1 479 ? 13.409  18.141  38.853 1.00 24.28 ? 510  GLU A CA    1 
ATOM   3910  C C     . GLU A 1 479 ? 12.623  18.304  40.133 1.00 24.34 ? 510  GLU A C     1 
ATOM   3911  O O     . GLU A 1 479 ? 12.410  19.414  40.609 1.00 25.20 ? 510  GLU A O     1 
ATOM   3912  C CB    . GLU A 1 479 ? 14.893  18.055  39.181 1.00 23.21 ? 510  GLU A CB    1 
ATOM   3913  C CG    . GLU A 1 479 ? 15.297  16.763  39.844 1.00 23.84 ? 510  GLU A CG    1 
ATOM   3914  C CD    . GLU A 1 479 ? 16.761  16.741  40.186 1.00 23.46 ? 510  GLU A CD    1 
ATOM   3915  O OE1   . GLU A 1 479 ? 17.331  17.840  40.344 1.00 24.73 ? 510  GLU A OE1   1 
ATOM   3916  O OE2   . GLU A 1 479 ? 17.334  15.637  40.292 1.00 24.19 ? 510  GLU A OE2   1 
ATOM   3917  N N     . LYS A 1 480 ? 12.197  17.183  40.693 1.00 25.02 ? 511  LYS A N     1 
ATOM   3918  C CA    . LYS A 1 480 ? 11.451  17.209  41.935 1.00 26.68 ? 511  LYS A CA    1 
ATOM   3919  C C     . LYS A 1 480 ? 12.362  17.821  42.989 1.00 26.66 ? 511  LYS A C     1 
ATOM   3920  O O     . LYS A 1 480 ? 13.414  17.265  43.306 1.00 26.92 ? 511  LYS A O     1 
ATOM   3921  C CB    . LYS A 1 480 ? 11.066  15.783  42.330 1.00 26.84 ? 511  LYS A CB    1 
ATOM   3922  C CG    . LYS A 1 480 ? 10.566  15.619  43.741 1.00 27.04 ? 511  LYS A CG    1 
ATOM   3923  C CD    . LYS A 1 480 ? 10.568  14.152  44.121 1.00 29.46 ? 511  LYS A CD    1 
ATOM   3924  C CE    . LYS A 1 480 ? 9.912   13.937  45.477 1.00 32.39 ? 511  LYS A CE    1 
ATOM   3925  N NZ    . LYS A 1 480 ? 10.007  12.505  45.936 1.00 37.49 ? 511  LYS A NZ    1 
ATOM   3926  N N     . PRO A 1 481 ? 11.976  18.979  43.549 1.00 26.37 ? 512  PRO A N     1 
ATOM   3927  C CA    . PRO A 1 481 ? 12.855  19.564  44.563 1.00 26.05 ? 512  PRO A CA    1 
ATOM   3928  C C     . PRO A 1 481 ? 12.916  18.653  45.772 1.00 26.67 ? 512  PRO A C     1 
ATOM   3929  O O     . PRO A 1 481 ? 12.197  17.662  45.857 1.00 27.14 ? 512  PRO A O     1 
ATOM   3930  C CB    . PRO A 1 481 ? 12.197  20.897  44.908 1.00 24.92 ? 512  PRO A CB    1 
ATOM   3931  C CG    . PRO A 1 481 ? 11.183  21.132  43.849 1.00 26.19 ? 512  PRO A CG    1 
ATOM   3932  C CD    . PRO A 1 481 ? 10.769  19.791  43.337 1.00 26.07 ? 512  PRO A CD    1 
ATOM   3933  N N     . ARG A 1 482 ? 13.794  18.980  46.706 1.00 27.42 ? 513  ARG A N     1 
ATOM   3934  C CA    . ARG A 1 482 ? 13.898  18.184  47.903 1.00 26.91 ? 513  ARG A CA    1 
ATOM   3935  C C     . ARG A 1 482 ? 12.858  18.775  48.831 1.00 26.42 ? 513  ARG A C     1 
ATOM   3936  O O     . ARG A 1 482 ? 12.317  19.844  48.554 1.00 25.87 ? 513  ARG A O     1 
ATOM   3937  C CB    . ARG A 1 482 ? 15.311  18.280  48.459 1.00 27.56 ? 513  ARG A CB    1 
ATOM   3938  C CG    . ARG A 1 482 ? 16.305  17.628  47.517 1.00 27.21 ? 513  ARG A CG    1 
ATOM   3939  C CD    . ARG A 1 482 ? 17.515  17.182  48.256 1.00 29.63 ? 513  ARG A CD    1 
ATOM   3940  N NE    . ARG A 1 482 ? 18.239  16.111  47.581 1.00 29.23 ? 513  ARG A NE    1 
ATOM   3941  C CZ    . ARG A 1 482 ? 19.557  16.110  47.446 1.00 28.74 ? 513  ARG A CZ    1 
ATOM   3942  N NH1   . ARG A 1 482 ? 20.265  17.117  47.930 1.00 28.32 ? 513  ARG A NH1   1 
ATOM   3943  N NH2   . ARG A 1 482 ? 20.166  15.090  46.868 1.00 32.01 ? 513  ARG A NH2   1 
ATOM   3944  N N     . PRO A 1 483 ? 12.546  18.086  49.935 1.00 27.47 ? 514  PRO A N     1 
ATOM   3945  C CA    . PRO A 1 483 ? 11.538  18.592  50.875 1.00 25.83 ? 514  PRO A CA    1 
ATOM   3946  C C     . PRO A 1 483 ? 11.641  20.078  51.171 1.00 26.42 ? 514  PRO A C     1 
ATOM   3947  O O     . PRO A 1 483 ? 12.511  20.508  51.927 1.00 26.80 ? 514  PRO A O     1 
ATOM   3948  C CB    . PRO A 1 483 ? 11.755  17.747  52.121 1.00 26.39 ? 514  PRO A CB    1 
ATOM   3949  C CG    . PRO A 1 483 ? 12.273  16.443  51.584 1.00 26.71 ? 514  PRO A CG    1 
ATOM   3950  C CD    . PRO A 1 483 ? 13.125  16.806  50.380 1.00 26.30 ? 514  PRO A CD    1 
ATOM   3951  N N     . ASP A 1 484 ? 10.753  20.855  50.557 1.00 26.21 ? 515  ASP A N     1 
ATOM   3952  C CA    . ASP A 1 484 ? 10.700  22.299  50.764 1.00 26.16 ? 515  ASP A CA    1 
ATOM   3953  C C     . ASP A 1 484 ? 12.001  22.998  50.437 1.00 25.57 ? 515  ASP A C     1 
ATOM   3954  O O     . ASP A 1 484 ? 12.326  24.028  51.025 1.00 26.22 ? 515  ASP A O     1 
ATOM   3955  C CB    . ASP A 1 484 ? 10.303  22.595  52.211 1.00 28.78 ? 515  ASP A CB    1 
ATOM   3956  C CG    . ASP A 1 484 ? 8.907   22.072  52.551 1.00 31.48 ? 515  ASP A CG    1 
ATOM   3957  O OD1   . ASP A 1 484 ? 7.946   22.446  51.830 1.00 35.24 ? 515  ASP A OD1   1 
ATOM   3958  O OD2   . ASP A 1 484 ? 8.765   21.289  53.525 1.00 31.57 ? 515  ASP A OD2   1 
ATOM   3959  N N     . ALA A 1 485 ? 12.736  22.438  49.487 1.00 23.08 ? 516  ALA A N     1 
ATOM   3960  C CA    . ALA A 1 485 ? 14.011  22.988  49.080 1.00 20.82 ? 516  ALA A CA    1 
ATOM   3961  C C     . ALA A 1 485 ? 13.887  23.705  47.753 1.00 20.80 ? 516  ALA A C     1 
ATOM   3962  O O     . ALA A 1 485 ? 12.907  23.527  47.033 1.00 21.40 ? 516  ALA A O     1 
ATOM   3963  C CB    . ALA A 1 485 ? 15.030  21.864  48.975 1.00 20.62 ? 516  ALA A CB    1 
ATOM   3964  N N     . ILE A 1 486 ? 14.897  24.509  47.432 1.00 20.38 ? 517  ILE A N     1 
ATOM   3965  C CA    . ILE A 1 486 ? 14.931  25.249  46.181 1.00 18.15 ? 517  ILE A CA    1 
ATOM   3966  C C     . ILE A 1 486 ? 15.445  24.364  45.024 1.00 19.64 ? 517  ILE A C     1 
ATOM   3967  O O     . ILE A 1 486 ? 15.068  24.554  43.862 1.00 18.58 ? 517  ILE A O     1 
ATOM   3968  C CB    . ILE A 1 486 ? 15.824  26.518  46.340 1.00 18.20 ? 517  ILE A CB    1 
ATOM   3969  C CG1   . ILE A 1 486 ? 15.796  27.355  45.068 1.00 18.97 ? 517  ILE A CG1   1 
ATOM   3970  C CG2   . ILE A 1 486 ? 17.237  26.123  46.693 1.00 17.73 ? 517  ILE A CG2   1 
ATOM   3971  C CD1   . ILE A 1 486 ? 16.450  28.709  45.230 1.00 19.06 ? 517  ILE A CD1   1 
ATOM   3972  N N     . PHE A 1 487 ? 16.279  23.374  45.348 1.00 20.41 ? 518  PHE A N     1 
ATOM   3973  C CA    . PHE A 1 487 ? 16.852  22.481  44.331 1.00 20.30 ? 518  PHE A CA    1 
ATOM   3974  C C     . PHE A 1 487 ? 16.555  21.000  44.529 1.00 21.70 ? 518  PHE A C     1 
ATOM   3975  O O     . PHE A 1 487 ? 16.124  20.564  45.600 1.00 21.99 ? 518  PHE A O     1 
ATOM   3976  C CB    . PHE A 1 487 ? 18.380  22.591  44.291 1.00 18.54 ? 518  PHE A CB    1 
ATOM   3977  C CG    . PHE A 1 487 ? 18.902  23.975  44.066 1.00 18.45 ? 518  PHE A CG    1 
ATOM   3978  C CD1   . PHE A 1 487 ? 18.319  24.813  43.125 1.00 15.98 ? 518  PHE A CD1   1 
ATOM   3979  C CD2   . PHE A 1 487 ? 20.041  24.417  44.758 1.00 17.92 ? 518  PHE A CD2   1 
ATOM   3980  C CE1   . PHE A 1 487 ? 18.863  26.077  42.861 1.00 17.17 ? 518  PHE A CE1   1 
ATOM   3981  C CE2   . PHE A 1 487 ? 20.589  25.678  44.501 1.00 16.61 ? 518  PHE A CE2   1 
ATOM   3982  C CZ    . PHE A 1 487 ? 19.997  26.503  43.549 1.00 16.47 ? 518  PHE A CZ    1 
ATOM   3983  N N     . GLY A 1 488 ? 16.838  20.232  43.474 1.00 23.62 ? 519  GLY A N     1 
ATOM   3984  C CA    . GLY A 1 488 ? 16.669  18.788  43.502 1.00 23.20 ? 519  GLY A CA    1 
ATOM   3985  C C     . GLY A 1 488 ? 18.047  18.157  43.616 1.00 23.53 ? 519  GLY A C     1 
ATOM   3986  O O     . GLY A 1 488 ? 19.050  18.857  43.540 1.00 23.89 ? 519  GLY A O     1 
ATOM   3987  N N     . GLU A 1 489 ? 18.108  16.839  43.778 1.00 24.66 ? 520  GLU A N     1 
ATOM   3988  C CA    . GLU A 1 489 ? 19.383  16.134  43.923 1.00 24.69 ? 520  GLU A CA    1 
ATOM   3989  C C     . GLU A 1 489 ? 20.470  16.464  42.895 1.00 25.27 ? 520  GLU A C     1 
ATOM   3990  O O     . GLU A 1 489 ? 21.596  16.778  43.265 1.00 26.10 ? 520  GLU A O     1 
ATOM   3991  C CB    . GLU A 1 489 ? 19.154  14.621  43.918 1.00 24.85 ? 520  GLU A CB    1 
ATOM   3992  C CG    . GLU A 1 489 ? 20.430  13.823  44.097 1.00 24.37 ? 520  GLU A CG    1 
ATOM   3993  C CD    . GLU A 1 489 ? 20.252  12.353  43.772 1.00 25.81 ? 520  GLU A CD    1 
ATOM   3994  O OE1   . GLU A 1 489 ? 20.889  11.518  44.447 1.00 25.52 ? 520  GLU A OE1   1 
ATOM   3995  O OE2   . GLU A 1 489 ? 19.476  12.034  42.843 1.00 27.21 ? 520  GLU A OE2   1 
ATOM   3996  N N     . THR A 1 490 ? 20.139  16.385  41.610 1.00 24.62 ? 521  THR A N     1 
ATOM   3997  C CA    . THR A 1 490 ? 21.113  16.638  40.553 1.00 24.32 ? 521  THR A CA    1 
ATOM   3998  C C     . THR A 1 490 ? 21.820  17.998  40.633 1.00 24.31 ? 521  THR A C     1 
ATOM   3999  O O     . THR A 1 490 ? 23.031  18.104  40.416 1.00 23.79 ? 521  THR A O     1 
ATOM   4000  C CB    . THR A 1 490 ? 20.455  16.498  39.168 1.00 24.55 ? 521  THR A CB    1 
ATOM   4001  O OG1   . THR A 1 490 ? 19.866  15.202  39.052 1.00 24.08 ? 521  THR A OG1   1 
ATOM   4002  C CG2   . THR A 1 490 ? 21.477  16.666  38.065 1.00 22.83 ? 521  THR A CG2   1 
ATOM   4003  N N     . MET A 1 491 ? 21.076  19.044  40.950 1.00 23.87 ? 522  MET A N     1 
ATOM   4004  C CA    . MET A 1 491 ? 21.681  20.361  41.029 1.00 23.87 ? 522  MET A CA    1 
ATOM   4005  C C     . MET A 1 491 ? 22.729  20.421  42.139 1.00 23.56 ? 522  MET A C     1 
ATOM   4006  O O     . MET A 1 491 ? 23.849  20.900  41.933 1.00 24.29 ? 522  MET A O     1 
ATOM   4007  C CB    . MET A 1 491 ? 20.589  21.414  41.271 1.00 24.84 ? 522  MET A CB    1 
ATOM   4008  C CG    . MET A 1 491 ? 21.090  22.852  41.381 1.00 23.51 ? 522  MET A CG    1 
ATOM   4009  S SD    . MET A 1 491 ? 21.478  23.576  39.779 1.00 25.81 ? 522  MET A SD    1 
ATOM   4010  C CE    . MET A 1 491 ? 19.895  24.300  39.316 1.00 25.94 ? 522  MET A CE    1 
ATOM   4011  N N     . VAL A 1 492 ? 22.374  19.920  43.317 1.00 23.24 ? 523  VAL A N     1 
ATOM   4012  C CA    . VAL A 1 492 ? 23.284  19.971  44.444 1.00 23.23 ? 523  VAL A CA    1 
ATOM   4013  C C     . VAL A 1 492 ? 24.520  19.115  44.247 1.00 23.26 ? 523  VAL A C     1 
ATOM   4014  O O     . VAL A 1 492 ? 25.634  19.555  44.498 1.00 24.65 ? 523  VAL A O     1 
ATOM   4015  C CB    . VAL A 1 492 ? 22.583  19.550  45.745 1.00 23.00 ? 523  VAL A CB    1 
ATOM   4016  C CG1   . VAL A 1 492 ? 23.577  19.552  46.900 1.00 23.25 ? 523  VAL A CG1   1 
ATOM   4017  C CG2   . VAL A 1 492 ? 21.444  20.494  46.031 1.00 20.78 ? 523  VAL A CG2   1 
ATOM   4018  N N     . GLU A 1 493 ? 24.319  17.898  43.772 1.00 23.06 ? 524  GLU A N     1 
ATOM   4019  C CA    . GLU A 1 493 ? 25.416  16.971  43.582 1.00 21.53 ? 524  GLU A CA    1 
ATOM   4020  C C     . GLU A 1 493 ? 26.396  17.310  42.457 1.00 21.37 ? 524  GLU A C     1 
ATOM   4021  O O     . GLU A 1 493 ? 27.550  16.883  42.496 1.00 21.90 ? 524  GLU A O     1 
ATOM   4022  C CB    . GLU A 1 493 ? 24.849  15.556  43.403 1.00 21.14 ? 524  GLU A CB    1 
ATOM   4023  C CG    . GLU A 1 493 ? 24.192  15.012  44.662 1.00 22.54 ? 524  GLU A CG    1 
ATOM   4024  C CD    . GLU A 1 493 ? 25.101  15.107  45.881 1.00 24.26 ? 524  GLU A CD    1 
ATOM   4025  O OE1   . GLU A 1 493 ? 26.092  14.343  45.948 1.00 26.21 ? 524  GLU A OE1   1 
ATOM   4026  O OE2   . GLU A 1 493 ? 24.832  15.947  46.771 1.00 25.31 ? 524  GLU A OE2   1 
ATOM   4027  N N     . LEU A 1 494 ? 25.951  18.050  41.447 1.00 21.63 ? 525  LEU A N     1 
ATOM   4028  C CA    . LEU A 1 494 ? 26.854  18.420  40.367 1.00 20.74 ? 525  LEU A CA    1 
ATOM   4029  C C     . LEU A 1 494 ? 27.554  19.723  40.731 1.00 20.75 ? 525  LEU A C     1 
ATOM   4030  O O     . LEU A 1 494 ? 28.751  19.880  40.508 1.00 20.86 ? 525  LEU A O     1 
ATOM   4031  C CB    . LEU A 1 494 ? 26.096  18.625  39.061 1.00 19.97 ? 525  LEU A CB    1 
ATOM   4032  C CG    . LEU A 1 494 ? 25.364  17.509  38.300 1.00 20.11 ? 525  LEU A CG    1 
ATOM   4033  C CD1   . LEU A 1 494 ? 25.846  17.520  36.863 1.00 19.28 ? 525  LEU A CD1   1 
ATOM   4034  C CD2   . LEU A 1 494 ? 25.574  16.134  38.941 1.00 20.56 ? 525  LEU A CD2   1 
ATOM   4035  N N     . GLY A 1 495 ? 26.801  20.650  41.311 1.00 20.54 ? 526  GLY A N     1 
ATOM   4036  C CA    . GLY A 1 495 ? 27.357  21.944  41.671 1.00 20.70 ? 526  GLY A CA    1 
ATOM   4037  C C     . GLY A 1 495 ? 28.294  22.019  42.856 1.00 20.24 ? 526  GLY A C     1 
ATOM   4038  O O     . GLY A 1 495 ? 29.236  22.803  42.843 1.00 21.90 ? 526  GLY A O     1 
ATOM   4039  N N     . ALA A 1 496 ? 28.033  21.223  43.887 1.00 20.46 ? 527  ALA A N     1 
ATOM   4040  C CA    . ALA A 1 496 ? 28.868  21.203  45.088 1.00 19.92 ? 527  ALA A CA    1 
ATOM   4041  C C     . ALA A 1 496 ? 30.352  20.942  44.767 1.00 19.86 ? 527  ALA A C     1 
ATOM   4042  O O     . ALA A 1 496 ? 31.215  21.685  45.214 1.00 19.72 ? 527  ALA A O     1 
ATOM   4043  C CB    . ALA A 1 496 ? 28.335  20.149  46.069 1.00 19.93 ? 527  ALA A CB    1 
ATOM   4044  N N     . PRO A 1 497 ? 30.665  19.874  44.006 1.00 20.38 ? 528  PRO A N     1 
ATOM   4045  C CA    . PRO A 1 497 ? 32.063  19.592  43.664 1.00 20.89 ? 528  PRO A CA    1 
ATOM   4046  C C     . PRO A 1 497 ? 32.740  20.721  42.873 1.00 21.14 ? 528  PRO A C     1 
ATOM   4047  O O     . PRO A 1 497 ? 33.910  21.023  43.090 1.00 22.04 ? 528  PRO A O     1 
ATOM   4048  C CB    . PRO A 1 497 ? 31.995  18.306  42.844 1.00 22.04 ? 528  PRO A CB    1 
ATOM   4049  C CG    . PRO A 1 497 ? 30.643  17.738  43.097 1.00 21.31 ? 528  PRO A CG    1 
ATOM   4050  C CD    . PRO A 1 497 ? 29.748  18.862  43.454 1.00 20.16 ? 528  PRO A CD    1 
ATOM   4051  N N     . PHE A 1 498 ? 32.008  21.334  41.949 1.00 21.99 ? 529  PHE A N     1 
ATOM   4052  C CA    . PHE A 1 498 ? 32.551  22.423  41.145 1.00 21.59 ? 529  PHE A CA    1 
ATOM   4053  C C     . PHE A 1 498 ? 32.845  23.612  42.054 1.00 22.59 ? 529  PHE A C     1 
ATOM   4054  O O     . PHE A 1 498 ? 33.854  24.301  41.905 1.00 22.81 ? 529  PHE A O     1 
ATOM   4055  C CB    . PHE A 1 498 ? 31.539  22.865  40.087 1.00 21.13 ? 529  PHE A CB    1 
ATOM   4056  C CG    . PHE A 1 498 ? 31.335  21.876  38.974 1.00 21.66 ? 529  PHE A CG    1 
ATOM   4057  C CD1   . PHE A 1 498 ? 30.047  21.508  38.581 1.00 22.30 ? 529  PHE A CD1   1 
ATOM   4058  C CD2   . PHE A 1 498 ? 32.417  21.335  38.295 1.00 21.91 ? 529  PHE A CD2   1 
ATOM   4059  C CE1   . PHE A 1 498 ? 29.836  20.612  37.527 1.00 21.46 ? 529  PHE A CE1   1 
ATOM   4060  C CE2   . PHE A 1 498 ? 32.219  20.434  37.233 1.00 21.36 ? 529  PHE A CE2   1 
ATOM   4061  C CZ    . PHE A 1 498 ? 30.920  20.076  36.852 1.00 21.33 ? 529  PHE A CZ    1 
ATOM   4062  N N     . SER A 1 499 ? 31.946  23.857  42.997 1.00 23.50 ? 530  SER A N     1 
ATOM   4063  C CA    . SER A 1 499 ? 32.085  24.972  43.920 1.00 23.69 ? 530  SER A CA    1 
ATOM   4064  C C     . SER A 1 499 ? 33.277  24.820  44.865 1.00 25.19 ? 530  SER A C     1 
ATOM   4065  O O     . SER A 1 499 ? 34.071  25.745  45.060 1.00 25.23 ? 530  SER A O     1 
ATOM   4066  C CB    . SER A 1 499 ? 30.802  25.107  44.729 1.00 24.33 ? 530  SER A CB    1 
ATOM   4067  O OG    . SER A 1 499 ? 31.002  25.875  45.903 1.00 26.37 ? 530  SER A OG    1 
ATOM   4068  N N     . LEU A 1 500 ? 33.389  23.647  45.464 1.00 25.97 ? 531  LEU A N     1 
ATOM   4069  C CA    . LEU A 1 500 ? 34.475  23.375  46.381 1.00 25.96 ? 531  LEU A CA    1 
ATOM   4070  C C     . LEU A 1 500 ? 35.822  23.629  45.704 1.00 25.97 ? 531  LEU A C     1 
ATOM   4071  O O     . LEU A 1 500 ? 36.723  24.239  46.283 1.00 26.00 ? 531  LEU A O     1 
ATOM   4072  C CB    . LEU A 1 500 ? 34.370  21.930  46.849 1.00 27.53 ? 531  LEU A CB    1 
ATOM   4073  C CG    . LEU A 1 500 ? 35.652  21.229  47.260 1.00 30.54 ? 531  LEU A CG    1 
ATOM   4074  C CD1   . LEU A 1 500 ? 36.270  21.936  48.457 1.00 31.39 ? 531  LEU A CD1   1 
ATOM   4075  C CD2   . LEU A 1 500 ? 35.331  19.782  47.584 1.00 31.56 ? 531  LEU A CD2   1 
ATOM   4076  N N     . LYS A 1 501 ? 35.964  23.155  44.471 1.00 24.82 ? 532  LYS A N     1 
ATOM   4077  C CA    . LYS A 1 501 ? 37.207  23.345  43.729 1.00 24.04 ? 532  LYS A CA    1 
ATOM   4078  C C     . LYS A 1 501 ? 37.458  24.811  43.442 1.00 22.04 ? 532  LYS A C     1 
ATOM   4079  O O     . LYS A 1 501 ? 38.592  25.268  43.476 1.00 22.89 ? 532  LYS A O     1 
ATOM   4080  C CB    . LYS A 1 501 ? 37.174  22.581  42.407 1.00 24.76 ? 532  LYS A CB    1 
ATOM   4081  C CG    . LYS A 1 501 ? 37.386  21.099  42.572 1.00 25.15 ? 532  LYS A CG    1 
ATOM   4082  C CD    . LYS A 1 501 ? 38.757  20.674  42.073 1.00 28.23 ? 532  LYS A CD    1 
ATOM   4083  C CE    . LYS A 1 501 ? 39.876  21.419  42.789 1.00 28.83 ? 532  LYS A CE    1 
ATOM   4084  N NZ    . LYS A 1 501 ? 41.188  20.833  42.409 1.00 26.50 ? 532  LYS A NZ    1 
ATOM   4085  N N     . GLY A 1 502 ? 36.392  25.544  43.150 1.00 22.28 ? 533  GLY A N     1 
ATOM   4086  C CA    . GLY A 1 502 ? 36.536  26.954  42.862 1.00 21.05 ? 533  GLY A CA    1 
ATOM   4087  C C     . GLY A 1 502 ? 36.817  27.754  44.112 1.00 21.30 ? 533  GLY A C     1 
ATOM   4088  O O     . GLY A 1 502 ? 37.485  28.787  44.058 1.00 22.33 ? 533  GLY A O     1 
ATOM   4089  N N     . LEU A 1 503 ? 36.328  27.270  45.248 1.00 20.49 ? 534  LEU A N     1 
ATOM   4090  C CA    . LEU A 1 503 ? 36.511  27.974  46.511 1.00 19.99 ? 534  LEU A CA    1 
ATOM   4091  C C     . LEU A 1 503 ? 37.790  27.569  47.240 1.00 20.58 ? 534  LEU A C     1 
ATOM   4092  O O     . LEU A 1 503 ? 38.664  28.396  47.503 1.00 21.25 ? 534  LEU A O     1 
ATOM   4093  C CB    . LEU A 1 503 ? 35.290  27.748  47.415 1.00 18.86 ? 534  LEU A CB    1 
ATOM   4094  C CG    . LEU A 1 503 ? 34.132  28.768  47.482 1.00 19.51 ? 534  LEU A CG    1 
ATOM   4095  C CD1   . LEU A 1 503 ? 34.347  29.962  46.579 1.00 17.34 ? 534  LEU A CD1   1 
ATOM   4096  C CD2   . LEU A 1 503 ? 32.857  28.065  47.101 1.00 19.74 ? 534  LEU A CD2   1 
ATOM   4097  N N     . MET A 1 504 ? 37.907  26.295  47.568 1.00 21.22 ? 535  MET A N     1 
ATOM   4098  C CA    . MET A 1 504 ? 39.086  25.809  48.280 1.00 22.27 ? 535  MET A CA    1 
ATOM   4099  C C     . MET A 1 504 ? 40.336  25.685  47.397 1.00 23.09 ? 535  MET A C     1 
ATOM   4100  O O     . MET A 1 504 ? 41.457  25.665  47.903 1.00 23.18 ? 535  MET A O     1 
ATOM   4101  C CB    . MET A 1 504 ? 38.781  24.458  48.931 1.00 23.04 ? 535  MET A CB    1 
ATOM   4102  C CG    . MET A 1 504 ? 37.560  24.462  49.845 1.00 22.30 ? 535  MET A CG    1 
ATOM   4103  S SD    . MET A 1 504 ? 37.627  25.701  51.148 1.00 25.68 ? 535  MET A SD    1 
ATOM   4104  C CE    . MET A 1 504 ? 39.058  25.143  52.117 1.00 22.28 ? 535  MET A CE    1 
ATOM   4105  N N     . GLY A 1 505 ? 40.142  25.604  46.085 1.00 22.16 ? 536  GLY A N     1 
ATOM   4106  C CA    . GLY A 1 505 ? 41.263  25.482  45.171 1.00 21.23 ? 536  GLY A CA    1 
ATOM   4107  C C     . GLY A 1 505 ? 42.000  26.792  44.922 1.00 22.14 ? 536  GLY A C     1 
ATOM   4108  O O     . GLY A 1 505 ? 42.960  26.840  44.153 1.00 22.00 ? 536  GLY A O     1 
ATOM   4109  N N     . ASN A 1 506 ? 41.550  27.863  45.565 1.00 21.32 ? 537  ASN A N     1 
ATOM   4110  C CA    . ASN A 1 506 ? 42.178  29.168  45.410 1.00 19.59 ? 537  ASN A CA    1 
ATOM   4111  C C     . ASN A 1 506 ? 43.540  29.117  46.101 1.00 19.72 ? 537  ASN A C     1 
ATOM   4112  O O     . ASN A 1 506 ? 43.676  28.510  47.157 1.00 20.64 ? 537  ASN A O     1 
ATOM   4113  C CB    . ASN A 1 506 ? 41.302  30.236  46.051 1.00 19.69 ? 537  ASN A CB    1 
ATOM   4114  C CG    . ASN A 1 506 ? 41.742  31.639  45.702 1.00 21.00 ? 537  ASN A CG    1 
ATOM   4115  O OD1   . ASN A 1 506 ? 42.690  32.167  46.285 1.00 21.09 ? 537  ASN A OD1   1 
ATOM   4116  N ND2   . ASN A 1 506 ? 41.047  32.260  44.748 1.00 21.60 ? 537  ASN A ND2   1 
ATOM   4117  N N     . PRO A 1 507 ? 44.570  29.741  45.501 1.00 18.05 ? 538  PRO A N     1 
ATOM   4118  C CA    . PRO A 1 507 ? 45.920  29.747  46.085 1.00 17.76 ? 538  PRO A CA    1 
ATOM   4119  C C     . PRO A 1 507 ? 46.004  30.200  47.545 1.00 17.35 ? 538  PRO A C     1 
ATOM   4120  O O     . PRO A 1 507 ? 46.795  29.666  48.330 1.00 17.59 ? 538  PRO A O     1 
ATOM   4121  C CB    . PRO A 1 507 ? 46.716  30.667  45.157 1.00 16.12 ? 538  PRO A CB    1 
ATOM   4122  C CG    . PRO A 1 507 ? 45.715  31.352  44.292 1.00 16.09 ? 538  PRO A CG    1 
ATOM   4123  C CD    . PRO A 1 507 ? 44.532  30.451  44.210 1.00 18.82 ? 538  PRO A CD    1 
ATOM   4124  N N     . ILE A 1 508 ? 45.190  31.180  47.917 1.00 17.21 ? 539  ILE A N     1 
ATOM   4125  C CA    . ILE A 1 508 ? 45.225  31.669  49.285 1.00 16.28 ? 539  ILE A CA    1 
ATOM   4126  C C     . ILE A 1 508 ? 44.779  30.608  50.269 1.00 17.36 ? 539  ILE A C     1 
ATOM   4127  O O     . ILE A 1 508 ? 44.909  30.789  51.476 1.00 17.59 ? 539  ILE A O     1 
ATOM   4128  C CB    . ILE A 1 508 ? 44.351  32.932  49.467 1.00 16.20 ? 539  ILE A CB    1 
ATOM   4129  C CG1   . ILE A 1 508 ? 42.880  32.548  49.631 1.00 16.23 ? 539  ILE A CG1   1 
ATOM   4130  C CG2   . ILE A 1 508 ? 44.506  33.857  48.263 1.00 16.34 ? 539  ILE A CG2   1 
ATOM   4131  C CD1   . ILE A 1 508 ? 42.086  33.552  50.426 1.00 13.74 ? 539  ILE A CD1   1 
ATOM   4132  N N     . CYS A 1 509 ? 44.248  29.500  49.759 1.00 18.10 ? 540  CYS A N     1 
ATOM   4133  C CA    . CYS A 1 509 ? 43.793  28.408  50.629 1.00 19.14 ? 540  CYS A CA    1 
ATOM   4134  C C     . CYS A 1 509 ? 44.913  27.398  50.858 1.00 18.09 ? 540  CYS A C     1 
ATOM   4135  O O     . CYS A 1 509 ? 44.818  26.529  51.731 1.00 17.93 ? 540  CYS A O     1 
ATOM   4136  C CB    . CYS A 1 509 ? 42.566  27.700  50.025 1.00 19.39 ? 540  CYS A CB    1 
ATOM   4137  S SG    . CYS A 1 509 ? 41.048  28.687  50.099 1.00 20.15 ? 540  CYS A SG    1 
ATOM   4138  N N     . SER A 1 510 ? 45.970  27.523  50.064 1.00 17.77 ? 541  SER A N     1 
ATOM   4139  C CA    . SER A 1 510 ? 47.116  26.630  50.182 1.00 19.81 ? 541  SER A CA    1 
ATOM   4140  C C     . SER A 1 510 ? 47.957  26.993  51.392 1.00 21.21 ? 541  SER A C     1 
ATOM   4141  O O     . SER A 1 510 ? 47.983  28.142  51.827 1.00 22.08 ? 541  SER A O     1 
ATOM   4142  C CB    . SER A 1 510 ? 47.970  26.686  48.916 1.00 18.70 ? 541  SER A CB    1 
ATOM   4143  O OG    . SER A 1 510 ? 48.558  27.959  48.768 1.00 18.18 ? 541  SER A OG    1 
ATOM   4144  N N     . PRO A 1 511 ? 48.670  26.009  51.953 1.00 22.25 ? 542  PRO A N     1 
ATOM   4145  C CA    . PRO A 1 511 ? 49.512  26.238  53.131 1.00 22.48 ? 542  PRO A CA    1 
ATOM   4146  C C     . PRO A 1 511 ? 50.476  27.427  53.054 1.00 23.24 ? 542  PRO A C     1 
ATOM   4147  O O     . PRO A 1 511 ? 50.538  28.234  53.981 1.00 23.10 ? 542  PRO A O     1 
ATOM   4148  C CB    . PRO A 1 511 ? 50.239  24.911  53.305 1.00 22.74 ? 542  PRO A CB    1 
ATOM   4149  C CG    . PRO A 1 511 ? 49.353  23.909  52.649 1.00 20.93 ? 542  PRO A CG    1 
ATOM   4150  C CD    . PRO A 1 511 ? 48.726  24.609  51.493 1.00 21.70 ? 542  PRO A CD    1 
ATOM   4151  N N     . GLN A 1 512 ? 51.222  27.553  51.958 1.00 24.28 ? 543  GLN A N     1 
ATOM   4152  C CA    . GLN A 1 512 ? 52.174  28.661  51.836 1.00 24.98 ? 543  GLN A CA    1 
ATOM   4153  C C     . GLN A 1 512 ? 51.504  30.028  51.890 1.00 24.79 ? 543  GLN A C     1 
ATOM   4154  O O     . GLN A 1 512 ? 52.141  31.018  52.269 1.00 26.10 ? 543  GLN A O     1 
ATOM   4155  C CB    . GLN A 1 512 ? 53.007  28.561  50.544 1.00 27.49 ? 543  GLN A CB    1 
ATOM   4156  C CG    . GLN A 1 512 ? 54.355  27.814  50.674 1.00 29.71 ? 543  GLN A CG    1 
ATOM   4157  C CD    . GLN A 1 512 ? 55.041  27.930  52.068 1.00 33.58 ? 543  GLN A CD    1 
ATOM   4158  O OE1   . GLN A 1 512 ? 54.470  28.433  53.041 1.00 35.36 ? 543  GLN A OE1   1 
ATOM   4159  N NE2   . GLN A 1 512 ? 56.273  27.449  52.149 1.00 34.48 ? 543  GLN A NE2   1 
ATOM   4160  N N     . TYR A 1 513 ? 50.220  30.092  51.527 1.00 22.17 ? 544  TYR A N     1 
ATOM   4161  C CA    . TYR A 1 513 ? 49.496  31.364  51.543 1.00 20.22 ? 544  TYR A CA    1 
ATOM   4162  C C     . TYR A 1 513 ? 48.656  31.573  52.795 1.00 19.95 ? 544  TYR A C     1 
ATOM   4163  O O     . TYR A 1 513 ? 48.569  32.685  53.314 1.00 18.85 ? 544  TYR A O     1 
ATOM   4164  C CB    . TYR A 1 513 ? 48.570  31.470  50.333 1.00 18.95 ? 544  TYR A CB    1 
ATOM   4165  C CG    . TYR A 1 513 ? 49.232  31.936  49.055 1.00 18.15 ? 544  TYR A CG    1 
ATOM   4166  C CD1   . TYR A 1 513 ? 48.971  33.201  48.535 1.00 17.18 ? 544  TYR A CD1   1 
ATOM   4167  C CD2   . TYR A 1 513 ? 50.095  31.100  48.349 1.00 17.73 ? 544  TYR A CD2   1 
ATOM   4168  C CE1   . TYR A 1 513 ? 49.556  33.626  47.331 1.00 17.57 ? 544  TYR A CE1   1 
ATOM   4169  C CE2   . TYR A 1 513 ? 50.684  31.507  47.145 1.00 15.98 ? 544  TYR A CE2   1 
ATOM   4170  C CZ    . TYR A 1 513 ? 50.415  32.767  46.636 1.00 16.64 ? 544  TYR A CZ    1 
ATOM   4171  O OH    . TYR A 1 513 ? 50.992  33.164  45.437 1.00 15.40 ? 544  TYR A OH    1 
ATOM   4172  N N     . TRP A 1 514 ? 48.036  30.503  53.275 1.00 19.04 ? 545  TRP A N     1 
ATOM   4173  C CA    . TRP A 1 514 ? 47.162  30.588  54.437 1.00 18.74 ? 545  TRP A CA    1 
ATOM   4174  C C     . TRP A 1 514 ? 47.864  30.862  55.750 1.00 19.56 ? 545  TRP A C     1 
ATOM   4175  O O     . TRP A 1 514 ? 47.946  29.984  56.603 1.00 20.58 ? 545  TRP A O     1 
ATOM   4176  C CB    . TRP A 1 514 ? 46.330  29.307  54.570 1.00 17.73 ? 545  TRP A CB    1 
ATOM   4177  C CG    . TRP A 1 514 ? 45.128  29.475  55.468 1.00 16.75 ? 545  TRP A CG    1 
ATOM   4178  C CD1   . TRP A 1 514 ? 44.879  28.811  56.630 1.00 16.24 ? 545  TRP A CD1   1 
ATOM   4179  C CD2   . TRP A 1 514 ? 44.054  30.417  55.308 1.00 16.63 ? 545  TRP A CD2   1 
ATOM   4180  N NE1   . TRP A 1 514 ? 43.724  29.283  57.208 1.00 17.96 ? 545  TRP A NE1   1 
ATOM   4181  C CE2   . TRP A 1 514 ? 43.197  30.269  56.419 1.00 17.17 ? 545  TRP A CE2   1 
ATOM   4182  C CE3   . TRP A 1 514 ? 43.736  31.372  54.331 1.00 15.27 ? 545  TRP A CE3   1 
ATOM   4183  C CZ2   . TRP A 1 514 ? 42.044  31.040  56.588 1.00 17.00 ? 545  TRP A CZ2   1 
ATOM   4184  C CZ3   . TRP A 1 514 ? 42.586  32.140  54.496 1.00 16.13 ? 545  TRP A CZ3   1 
ATOM   4185  C CH2   . TRP A 1 514 ? 41.755  31.970  55.617 1.00 16.37 ? 545  TRP A CH2   1 
ATOM   4186  N N     . LYS A 1 515 ? 48.364  32.086  55.908 1.00 21.73 ? 546  LYS A N     1 
ATOM   4187  C CA    . LYS A 1 515 ? 49.047  32.514  57.131 1.00 20.04 ? 546  LYS A CA    1 
ATOM   4188  C C     . LYS A 1 515 ? 48.863  34.021  57.281 1.00 20.25 ? 546  LYS A C     1 
ATOM   4189  O O     . LYS A 1 515 ? 48.741  34.754  56.299 1.00 22.59 ? 546  LYS A O     1 
ATOM   4190  C CB    . LYS A 1 515 ? 50.538  32.149  57.081 1.00 19.00 ? 546  LYS A CB    1 
ATOM   4191  C CG    . LYS A 1 515 ? 51.239  32.517  55.791 1.00 18.80 ? 546  LYS A CG    1 
ATOM   4192  C CD    . LYS A 1 515 ? 52.725  32.211  55.860 1.00 17.96 ? 546  LYS A CD    1 
ATOM   4193  C CE    . LYS A 1 515 ? 52.979  30.733  55.747 1.00 18.62 ? 546  LYS A CE    1 
ATOM   4194  N NZ    . LYS A 1 515 ? 54.362  30.466  55.256 1.00 18.19 ? 546  LYS A NZ    1 
ATOM   4195  N N     . PRO A 1 516 ? 48.822  34.506  58.518 1.00 20.88 ? 547  PRO A N     1 
ATOM   4196  C CA    . PRO A 1 516 ? 48.644  35.933  58.793 1.00 21.24 ? 547  PRO A CA    1 
ATOM   4197  C C     . PRO A 1 516 ? 49.484  36.884  57.950 1.00 20.97 ? 547  PRO A C     1 
ATOM   4198  O O     . PRO A 1 516 ? 48.958  37.840  57.383 1.00 21.99 ? 547  PRO A O     1 
ATOM   4199  C CB    . PRO A 1 516 ? 48.979  36.056  60.277 1.00 20.80 ? 547  PRO A CB    1 
ATOM   4200  C CG    . PRO A 1 516 ? 48.720  34.704  60.844 1.00 20.33 ? 547  PRO A CG    1 
ATOM   4201  C CD    . PRO A 1 516 ? 48.942  33.708  59.750 1.00 20.99 ? 547  PRO A CD    1 
ATOM   4202  N N     . SER A 1 517 ? 50.789  36.641  57.865 1.00 20.60 ? 548  SER A N     1 
ATOM   4203  C CA    . SER A 1 517 ? 51.645  37.549  57.120 1.00 20.78 ? 548  SER A CA    1 
ATOM   4204  C C     . SER A 1 517 ? 51.182  37.796  55.697 1.00 20.25 ? 548  SER A C     1 
ATOM   4205  O O     . SER A 1 517 ? 51.458  38.867  55.140 1.00 21.28 ? 548  SER A O     1 
ATOM   4206  C CB    . SER A 1 517 ? 53.098  37.065  57.114 1.00 21.06 ? 548  SER A CB    1 
ATOM   4207  O OG    . SER A 1 517 ? 53.185  35.729  56.664 1.00 24.06 ? 548  SER A OG    1 
ATOM   4208  N N     . THR A 1 518 ? 50.472  36.838  55.107 1.00 17.92 ? 549  THR A N     1 
ATOM   4209  C CA    . THR A 1 518 ? 50.005  37.008  53.729 1.00 18.21 ? 549  THR A CA    1 
ATOM   4210  C C     . THR A 1 518 ? 48.982  38.128  53.580 1.00 17.31 ? 549  THR A C     1 
ATOM   4211  O O     . THR A 1 518 ? 48.841  38.725  52.514 1.00 17.37 ? 549  THR A O     1 
ATOM   4212  C CB    . THR A 1 518 ? 49.356  35.730  53.186 1.00 17.41 ? 549  THR A CB    1 
ATOM   4213  O OG1   . THR A 1 518 ? 50.296  34.655  53.257 1.00 19.70 ? 549  THR A OG1   1 
ATOM   4214  C CG2   . THR A 1 518 ? 48.924  35.929  51.724 1.00 17.31 ? 549  THR A CG2   1 
ATOM   4215  N N     . PHE A 1 519 ? 48.276  38.409  54.661 1.00 17.67 ? 550  PHE A N     1 
ATOM   4216  C CA    . PHE A 1 519 ? 47.248  39.424  54.647 1.00 18.01 ? 550  PHE A CA    1 
ATOM   4217  C C     . PHE A 1 519 ? 47.591  40.601  55.514 1.00 18.97 ? 550  PHE A C     1 
ATOM   4218  O O     . PHE A 1 519 ? 46.703  41.255  56.045 1.00 19.51 ? 550  PHE A O     1 
ATOM   4219  C CB    . PHE A 1 519 ? 45.936  38.807  55.095 1.00 14.64 ? 550  PHE A CB    1 
ATOM   4220  C CG    . PHE A 1 519 ? 45.682  37.470  54.480 1.00 13.90 ? 550  PHE A CG    1 
ATOM   4221  C CD1   . PHE A 1 519 ? 46.005  36.302  55.157 1.00 12.55 ? 550  PHE A CD1   1 
ATOM   4222  C CD2   . PHE A 1 519 ? 45.152  37.376  53.204 1.00 14.07 ? 550  PHE A CD2   1 
ATOM   4223  C CE1   . PHE A 1 519 ? 45.808  35.058  54.567 1.00 12.44 ? 550  PHE A CE1   1 
ATOM   4224  C CE2   . PHE A 1 519 ? 44.949  36.132  52.599 1.00 12.79 ? 550  PHE A CE2   1 
ATOM   4225  C CZ    . PHE A 1 519 ? 45.277  34.971  53.283 1.00 12.39 ? 550  PHE A CZ    1 
ATOM   4226  N N     . GLY A 1 520 ? 48.889  40.861  55.659 1.00 21.44 ? 551  GLY A N     1 
ATOM   4227  C CA    . GLY A 1 520 ? 49.343  41.994  56.445 1.00 21.88 ? 551  GLY A CA    1 
ATOM   4228  C C     . GLY A 1 520 ? 49.291  41.819  57.944 1.00 23.35 ? 551  GLY A C     1 
ATOM   4229  O O     . GLY A 1 520 ? 49.390  42.799  58.678 1.00 23.26 ? 551  GLY A O     1 
ATOM   4230  N N     . GLY A 1 521 ? 49.123  40.583  58.404 1.00 24.50 ? 552  GLY A N     1 
ATOM   4231  C CA    . GLY A 1 521 ? 49.085  40.342  59.831 1.00 26.35 ? 552  GLY A CA    1 
ATOM   4232  C C     . GLY A 1 521 ? 47.767  39.841  60.386 1.00 27.69 ? 552  GLY A C     1 
ATOM   4233  O O     . GLY A 1 521 ? 46.804  39.623  59.656 1.00 28.55 ? 552  GLY A O     1 
ATOM   4234  N N     . GLU A 1 522 ? 47.740  39.671  61.702 1.00 29.38 ? 553  GLU A N     1 
ATOM   4235  C CA    . GLU A 1 522 ? 46.572  39.178  62.418 1.00 31.35 ? 553  GLU A CA    1 
ATOM   4236  C C     . GLU A 1 522 ? 45.328  39.986  62.148 1.00 29.80 ? 553  GLU A C     1 
ATOM   4237  O O     . GLU A 1 522 ? 44.242  39.433  62.030 1.00 30.94 ? 553  GLU A O     1 
ATOM   4238  C CB    . GLU A 1 522 ? 46.855  39.156  63.921 1.00 33.54 ? 553  GLU A CB    1 
ATOM   4239  C CG    . GLU A 1 522 ? 47.593  37.905  64.389 1.00 39.85 ? 553  GLU A CG    1 
ATOM   4240  C CD    . GLU A 1 522 ? 47.062  36.631  63.730 1.00 43.88 ? 553  GLU A CD    1 
ATOM   4241  O OE1   . GLU A 1 522 ? 47.383  36.378  62.547 1.00 47.85 ? 553  GLU A OE1   1 
ATOM   4242  O OE2   . GLU A 1 522 ? 46.316  35.876  64.389 1.00 47.47 ? 553  GLU A OE2   1 
ATOM   4243  N N     . VAL A 1 523 ? 45.486  41.299  62.056 1.00 29.65 ? 554  VAL A N     1 
ATOM   4244  C CA    . VAL A 1 523 ? 44.361  42.179  61.787 1.00 27.04 ? 554  VAL A CA    1 
ATOM   4245  C C     . VAL A 1 523 ? 43.718  41.822  60.443 1.00 26.95 ? 554  VAL A C     1 
ATOM   4246  O O     . VAL A 1 523 ? 42.531  41.509  60.374 1.00 27.16 ? 554  VAL A O     1 
ATOM   4247  C CB    . VAL A 1 523 ? 44.813  43.653  61.751 1.00 26.71 ? 554  VAL A CB    1 
ATOM   4248  C CG1   . VAL A 1 523 ? 43.702  44.536  61.242 1.00 24.83 ? 554  VAL A CG1   1 
ATOM   4249  C CG2   . VAL A 1 523 ? 45.244  44.086  63.133 1.00 24.38 ? 554  VAL A CG2   1 
ATOM   4250  N N     . GLY A 1 524 ? 44.511  41.857  59.379 1.00 25.95 ? 555  GLY A N     1 
ATOM   4251  C CA    . GLY A 1 524 ? 43.981  41.551  58.064 1.00 25.71 ? 555  GLY A CA    1 
ATOM   4252  C C     . GLY A 1 524 ? 43.429  40.143  57.995 1.00 24.55 ? 555  GLY A C     1 
ATOM   4253  O O     . GLY A 1 524 ? 42.426  39.893  57.330 1.00 25.66 ? 555  GLY A O     1 
ATOM   4254  N N     . PHE A 1 525 ? 44.079  39.223  58.694 1.00 24.34 ? 556  PHE A N     1 
ATOM   4255  C CA    . PHE A 1 525 ? 43.658  37.832  58.698 1.00 23.00 ? 556  PHE A CA    1 
ATOM   4256  C C     . PHE A 1 525 ? 42.295  37.708  59.364 1.00 22.98 ? 556  PHE A C     1 
ATOM   4257  O O     . PHE A 1 525 ? 41.472  36.895  58.962 1.00 23.21 ? 556  PHE A O     1 
ATOM   4258  C CB    . PHE A 1 525 ? 44.700  37.000  59.447 1.00 23.00 ? 556  PHE A CB    1 
ATOM   4259  C CG    . PHE A 1 525 ? 44.687  35.537  59.103 1.00 21.88 ? 556  PHE A CG    1 
ATOM   4260  C CD1   . PHE A 1 525 ? 44.473  35.113  57.800 1.00 19.99 ? 556  PHE A CD1   1 
ATOM   4261  C CD2   . PHE A 1 525 ? 44.930  34.580  60.090 1.00 21.11 ? 556  PHE A CD2   1 
ATOM   4262  C CE1   . PHE A 1 525 ? 44.503  33.761  57.472 1.00 18.75 ? 556  PHE A CE1   1 
ATOM   4263  C CE2   . PHE A 1 525 ? 44.962  33.220  59.773 1.00 21.70 ? 556  PHE A CE2   1 
ATOM   4264  C CZ    . PHE A 1 525 ? 44.748  32.813  58.455 1.00 19.37 ? 556  PHE A CZ    1 
ATOM   4265  N N     . LYS A 1 526 ? 42.056  38.527  60.378 1.00 23.28 ? 557  LYS A N     1 
ATOM   4266  C CA    . LYS A 1 526 ? 40.785  38.484  61.086 1.00 24.44 ? 557  LYS A CA    1 
ATOM   4267  C C     . LYS A 1 526 ? 39.646  38.972  60.213 1.00 23.74 ? 557  LYS A C     1 
ATOM   4268  O O     . LYS A 1 526 ? 38.515  38.512  60.341 1.00 25.12 ? 557  LYS A O     1 
ATOM   4269  C CB    . LYS A 1 526 ? 40.843  39.330  62.355 1.00 26.38 ? 557  LYS A CB    1 
ATOM   4270  C CG    . LYS A 1 526 ? 39.829  38.888  63.396 1.00 28.58 ? 557  LYS A CG    1 
ATOM   4271  C CD    . LYS A 1 526 ? 39.651  39.929  64.478 1.00 30.09 ? 557  LYS A CD    1 
ATOM   4272  C CE    . LYS A 1 526 ? 38.737  39.400  65.557 1.00 32.15 ? 557  LYS A CE    1 
ATOM   4273  N NZ    . LYS A 1 526 ? 38.469  40.450  66.571 1.00 36.03 ? 557  LYS A NZ    1 
ATOM   4274  N N     . ILE A 1 527 ? 39.934  39.921  59.338 1.00 22.65 ? 558  ILE A N     1 
ATOM   4275  C CA    . ILE A 1 527 ? 38.908  40.429  58.445 1.00 22.57 ? 558  ILE A CA    1 
ATOM   4276  C C     . ILE A 1 527 ? 38.337  39.250  57.662 1.00 22.49 ? 558  ILE A C     1 
ATOM   4277  O O     . ILE A 1 527 ? 37.124  39.112  57.506 1.00 23.75 ? 558  ILE A O     1 
ATOM   4278  C CB    . ILE A 1 527 ? 39.499  41.457  57.457 1.00 21.87 ? 558  ILE A CB    1 
ATOM   4279  C CG1   . ILE A 1 527 ? 39.843  42.750  58.196 1.00 19.81 ? 558  ILE A CG1   1 
ATOM   4280  C CG2   . ILE A 1 527 ? 38.501  41.780  56.358 1.00 19.97 ? 558  ILE A CG2   1 
ATOM   4281  C CD1   . ILE A 1 527 ? 40.662  43.721  57.356 1.00 21.74 ? 558  ILE A CD1   1 
ATOM   4282  N N     . ILE A 1 528 ? 39.221  38.386  57.189 1.00 21.36 ? 559  ILE A N     1 
ATOM   4283  C CA    . ILE A 1 528 ? 38.796  37.243  56.415 1.00 21.07 ? 559  ILE A CA    1 
ATOM   4284  C C     . ILE A 1 528 ? 37.976  36.282  57.240 1.00 22.04 ? 559  ILE A C     1 
ATOM   4285  O O     . ILE A 1 528 ? 36.877  35.872  56.857 1.00 22.12 ? 559  ILE A O     1 
ATOM   4286  C CB    . ILE A 1 528 ? 39.992  36.461  55.876 1.00 19.08 ? 559  ILE A CB    1 
ATOM   4287  C CG1   . ILE A 1 528 ? 40.756  37.316  54.869 1.00 18.92 ? 559  ILE A CG1   1 
ATOM   4288  C CG2   . ILE A 1 528 ? 39.506  35.163  55.216 1.00 18.59 ? 559  ILE A CG2   1 
ATOM   4289  C CD1   . ILE A 1 528 ? 41.921  36.601  54.201 1.00 16.72 ? 559  ILE A CD1   1 
ATOM   4290  N N     . ASN A 1 529 ? 38.527  35.932  58.388 1.00 22.69 ? 560  ASN A N     1 
ATOM   4291  C CA    . ASN A 1 529 ? 37.909  34.960  59.267 1.00 24.36 ? 560  ASN A CA    1 
ATOM   4292  C C     . ASN A 1 529 ? 36.654  35.360  60.040 1.00 24.13 ? 560  ASN A C     1 
ATOM   4293  O O     . ASN A 1 529 ? 36.035  34.512  60.690 1.00 25.10 ? 560  ASN A O     1 
ATOM   4294  C CB    . ASN A 1 529 ? 38.982  34.414  60.210 1.00 23.06 ? 560  ASN A CB    1 
ATOM   4295  C CG    . ASN A 1 529 ? 40.066  33.643  59.460 1.00 25.27 ? 560  ASN A CG    1 
ATOM   4296  O OD1   . ASN A 1 529 ? 39.767  32.686  58.742 1.00 25.85 ? 560  ASN A OD1   1 
ATOM   4297  N ND2   . ASN A 1 529 ? 41.324  34.058  59.616 1.00 24.92 ? 560  ASN A ND2   1 
ATOM   4298  N N     . THR A 1 530 ? 36.268  36.631  59.980 1.00 23.76 ? 561  THR A N     1 
ATOM   4299  C CA    . THR A 1 530 ? 35.056  37.053  60.671 1.00 23.21 ? 561  THR A CA    1 
ATOM   4300  C C     . THR A 1 530 ? 34.071  37.634  59.656 1.00 23.89 ? 561  THR A C     1 
ATOM   4301  O O     . THR A 1 530 ? 33.012  38.140  60.014 1.00 25.18 ? 561  THR A O     1 
ATOM   4302  C CB    . THR A 1 530 ? 35.346  38.117  61.750 1.00 22.40 ? 561  THR A CB    1 
ATOM   4303  O OG1   . THR A 1 530 ? 36.001  39.238  61.155 1.00 22.56 ? 561  THR A OG1   1 
ATOM   4304  C CG2   . THR A 1 530 ? 36.218  37.546  62.833 1.00 20.87 ? 561  THR A CG2   1 
ATOM   4305  N N     . ALA A 1 531 ? 34.426  37.555  58.381 1.00 22.87 ? 562  ALA A N     1 
ATOM   4306  C CA    . ALA A 1 531 ? 33.580  38.091  57.319 1.00 22.35 ? 562  ALA A CA    1 
ATOM   4307  C C     . ALA A 1 531 ? 32.206  37.418  57.185 1.00 21.92 ? 562  ALA A C     1 
ATOM   4308  O O     . ALA A 1 531 ? 32.067  36.208  57.326 1.00 22.76 ? 562  ALA A O     1 
ATOM   4309  C CB    . ALA A 1 531 ? 34.326  38.014  56.004 1.00 20.51 ? 562  ALA A CB    1 
ATOM   4310  N N     . SER A 1 532 ? 31.184  38.219  56.918 1.00 22.22 ? 563  SER A N     1 
ATOM   4311  C CA    . SER A 1 532 ? 29.830  37.699  56.730 1.00 22.50 ? 563  SER A CA    1 
ATOM   4312  C C     . SER A 1 532 ? 29.074  38.667  55.840 1.00 21.69 ? 563  SER A C     1 
ATOM   4313  O O     . SER A 1 532 ? 29.478  39.811  55.675 1.00 22.15 ? 563  SER A O     1 
ATOM   4314  C CB    . SER A 1 532 ? 29.106  37.563  58.063 1.00 22.27 ? 563  SER A CB    1 
ATOM   4315  O OG    . SER A 1 532 ? 28.690  38.833  58.530 1.00 24.59 ? 563  SER A OG    1 
ATOM   4316  N N     . ILE A 1 533 ? 27.980  38.224  55.249 1.00 21.21 ? 564  ILE A N     1 
ATOM   4317  C CA    . ILE A 1 533 ? 27.225  39.129  54.396 1.00 21.53 ? 564  ILE A CA    1 
ATOM   4318  C C     . ILE A 1 533 ? 26.659  40.311  55.204 1.00 22.03 ? 564  ILE A C     1 
ATOM   4319  O O     . ILE A 1 533 ? 26.486  41.411  54.668 1.00 22.03 ? 564  ILE A O     1 
ATOM   4320  C CB    . ILE A 1 533 ? 26.089  38.367  53.646 1.00 21.11 ? 564  ILE A CB    1 
ATOM   4321  C CG1   . ILE A 1 533 ? 25.433  39.293  52.626 1.00 20.63 ? 564  ILE A CG1   1 
ATOM   4322  C CG2   . ILE A 1 533 ? 25.078  37.800  54.628 1.00 20.24 ? 564  ILE A CG2   1 
ATOM   4323  C CD1   . ILE A 1 533 ? 26.354  39.707  51.499 1.00 20.50 ? 564  ILE A CD1   1 
ATOM   4324  N N     . GLN A 1 534 ? 26.396  40.101  56.493 1.00 20.71 ? 565  GLN A N     1 
ATOM   4325  C CA    . GLN A 1 534 ? 25.863  41.185  57.319 1.00 21.59 ? 565  GLN A CA    1 
ATOM   4326  C C     . GLN A 1 534 ? 26.937  42.233  57.610 1.00 21.56 ? 565  GLN A C     1 
ATOM   4327  O O     . GLN A 1 534 ? 26.659  43.441  57.607 1.00 20.96 ? 565  GLN A O     1 
ATOM   4328  C CB    . GLN A 1 534 ? 25.287  40.638  58.641 1.00 21.42 ? 565  GLN A CB    1 
ATOM   4329  C CG    . GLN A 1 534 ? 24.844  41.711  59.648 1.00 22.25 ? 565  GLN A CG    1 
ATOM   4330  C CD    . GLN A 1 534 ? 23.685  42.572  59.156 1.00 23.23 ? 565  GLN A CD    1 
ATOM   4331  O OE1   . GLN A 1 534 ? 22.522  42.245  59.376 1.00 22.99 ? 565  GLN A OE1   1 
ATOM   4332  N NE2   . GLN A 1 534 ? 24.002  43.676  58.494 1.00 21.31 ? 565  GLN A NE2   1 
ATOM   4333  N N     . SER A 1 535 ? 28.161  41.774  57.857 1.00 20.94 ? 566  SER A N     1 
ATOM   4334  C CA    . SER A 1 535 ? 29.260  42.690  58.154 1.00 21.31 ? 566  SER A CA    1 
ATOM   4335  C C     . SER A 1 535 ? 29.580  43.516  56.939 1.00 21.09 ? 566  SER A C     1 
ATOM   4336  O O     . SER A 1 535 ? 29.785  44.720  57.024 1.00 22.10 ? 566  SER A O     1 
ATOM   4337  C CB    . SER A 1 535 ? 30.523  41.930  58.547 1.00 20.48 ? 566  SER A CB    1 
ATOM   4338  O OG    . SER A 1 535 ? 30.289  41.096  59.652 1.00 25.22 ? 566  SER A OG    1 
ATOM   4339  N N     . LEU A 1 536 ? 29.643  42.847  55.798 1.00 21.30 ? 567  LEU A N     1 
ATOM   4340  C CA    . LEU A 1 536 ? 29.967  43.512  54.554 1.00 22.22 ? 567  LEU A CA    1 
ATOM   4341  C C     . LEU A 1 536 ? 29.035  44.694  54.326 1.00 23.07 ? 567  LEU A C     1 
ATOM   4342  O O     . LEU A 1 536 ? 29.474  45.794  53.993 1.00 24.28 ? 567  LEU A O     1 
ATOM   4343  C CB    . LEU A 1 536 ? 29.851  42.513  53.411 1.00 21.83 ? 567  LEU A CB    1 
ATOM   4344  C CG    . LEU A 1 536 ? 30.087  43.068  52.021 1.00 22.09 ? 567  LEU A CG    1 
ATOM   4345  C CD1   . LEU A 1 536 ? 31.575  43.309  51.809 1.00 21.82 ? 567  LEU A CD1   1 
ATOM   4346  C CD2   . LEU A 1 536 ? 29.532  42.084  51.002 1.00 22.23 ? 567  LEU A CD2   1 
ATOM   4347  N N     . ILE A 1 537 ? 27.743  44.461  54.526 1.00 24.42 ? 568  ILE A N     1 
ATOM   4348  C CA    . ILE A 1 537 ? 26.739  45.495  54.335 1.00 23.36 ? 568  ILE A CA    1 
ATOM   4349  C C     . ILE A 1 537 ? 26.809  46.508  55.474 1.00 24.36 ? 568  ILE A C     1 
ATOM   4350  O O     . ILE A 1 537 ? 26.845  47.719  55.262 1.00 23.56 ? 568  ILE A O     1 
ATOM   4351  C CB    . ILE A 1 537 ? 25.322  44.863  54.266 1.00 22.87 ? 568  ILE A CB    1 
ATOM   4352  C CG1   . ILE A 1 537 ? 24.991  44.527  52.815 1.00 21.65 ? 568  ILE A CG1   1 
ATOM   4353  C CG2   . ILE A 1 537 ? 24.270  45.812  54.875 1.00 20.95 ? 568  ILE A CG2   1 
ATOM   4354  C CD1   . ILE A 1 537 ? 25.904  43.498  52.201 1.00 21.49 ? 568  ILE A CD1   1 
ATOM   4355  N N     . CYS A 1 538 ? 26.842  45.998  56.693 1.00 25.02 ? 569  CYS A N     1 
ATOM   4356  C CA    . CYS A 1 538 ? 26.896  46.858  57.860 1.00 24.99 ? 569  CYS A CA    1 
ATOM   4357  C C     . CYS A 1 538 ? 28.006  47.865  57.777 1.00 24.47 ? 569  CYS A C     1 
ATOM   4358  O O     . CYS A 1 538 ? 27.795  49.041  58.025 1.00 25.55 ? 569  CYS A O     1 
ATOM   4359  C CB    . CYS A 1 538 ? 27.094  46.029  59.129 1.00 26.76 ? 569  CYS A CB    1 
ATOM   4360  S SG    . CYS A 1 538 ? 26.913  47.016  60.646 1.00 27.77 ? 569  CYS A SG    1 
ATOM   4361  N N     . ASN A 1 539 ? 29.194  47.384  57.436 1.00 25.80 ? 570  ASN A N     1 
ATOM   4362  C CA    . ASN A 1 539 ? 30.383  48.224  57.340 1.00 25.67 ? 570  ASN A CA    1 
ATOM   4363  C C     . ASN A 1 539 ? 30.356  49.176  56.166 1.00 25.89 ? 570  ASN A C     1 
ATOM   4364  O O     . ASN A 1 539 ? 31.020  50.207  56.194 1.00 25.99 ? 570  ASN A O     1 
ATOM   4365  C CB    . ASN A 1 539 ? 31.644  47.368  57.188 1.00 27.08 ? 570  ASN A CB    1 
ATOM   4366  C CG    . ASN A 1 539 ? 32.043  46.677  58.464 1.00 28.02 ? 570  ASN A CG    1 
ATOM   4367  O OD1   . ASN A 1 539 ? 31.872  47.205  59.558 1.00 28.00 ? 570  ASN A OD1   1 
ATOM   4368  N ND2   . ASN A 1 539 ? 32.577  45.477  58.329 1.00 30.05 ? 570  ASN A ND2   1 
ATOM   4369  N N     . ASN A 1 540 ? 29.597  48.841  55.131 1.00 26.26 ? 571  ASN A N     1 
ATOM   4370  C CA    . ASN A 1 540 ? 29.610  49.677  53.946 1.00 26.16 ? 571  ASN A CA    1 
ATOM   4371  C C     . ASN A 1 540 ? 28.307  50.290  53.487 1.00 26.09 ? 571  ASN A C     1 
ATOM   4372  O O     . ASN A 1 540 ? 28.262  50.914  52.430 1.00 27.47 ? 571  ASN A O     1 
ATOM   4373  C CB    . ASN A 1 540 ? 30.224  48.878  52.797 1.00 27.10 ? 571  ASN A CB    1 
ATOM   4374  C CG    . ASN A 1 540 ? 31.613  48.405  53.113 1.00 27.04 ? 571  ASN A CG    1 
ATOM   4375  O OD1   . ASN A 1 540 ? 32.547  49.205  53.184 1.00 27.74 ? 571  ASN A OD1   1 
ATOM   4376  N ND2   . ASN A 1 540 ? 31.765  47.104  53.322 1.00 27.69 ? 571  ASN A ND2   1 
ATOM   4377  N N     . VAL A 1 541 ? 27.240  50.107  54.252 1.00 25.68 ? 572  VAL A N     1 
ATOM   4378  C CA    . VAL A 1 541 ? 25.957  50.683  53.875 1.00 24.39 ? 572  VAL A CA    1 
ATOM   4379  C C     . VAL A 1 541 ? 25.499  51.569  55.017 1.00 24.38 ? 572  VAL A C     1 
ATOM   4380  O O     . VAL A 1 541 ? 25.428  51.126  56.162 1.00 24.10 ? 572  VAL A O     1 
ATOM   4381  C CB    . VAL A 1 541 ? 24.918  49.576  53.580 1.00 23.59 ? 572  VAL A CB    1 
ATOM   4382  C CG1   . VAL A 1 541 ? 23.603  50.192  53.081 1.00 21.09 ? 572  VAL A CG1   1 
ATOM   4383  C CG2   . VAL A 1 541 ? 25.484  48.624  52.530 1.00 21.49 ? 572  VAL A CG2   1 
ATOM   4384  N N     . LYS A 1 542 ? 25.221  52.829  54.700 1.00 24.74 ? 573  LYS A N     1 
ATOM   4385  C CA    . LYS A 1 542 ? 24.803  53.792  55.700 1.00 25.21 ? 573  LYS A CA    1 
ATOM   4386  C C     . LYS A 1 542 ? 23.664  53.218  56.499 1.00 24.59 ? 573  LYS A C     1 
ATOM   4387  O O     . LYS A 1 542 ? 22.704  52.713  55.931 1.00 24.48 ? 573  LYS A O     1 
ATOM   4388  C CB    . LYS A 1 542 ? 24.379  55.102  55.032 1.00 26.67 ? 573  LYS A CB    1 
ATOM   4389  C CG    . LYS A 1 542 ? 23.953  56.177  56.000 1.00 30.66 ? 573  LYS A CG    1 
ATOM   4390  C CD    . LYS A 1 542 ? 24.040  57.569  55.383 1.00 33.04 ? 573  LYS A CD    1 
ATOM   4391  C CE    . LYS A 1 542 ? 24.154  58.630  56.478 1.00 36.61 ? 573  LYS A CE    1 
ATOM   4392  N NZ    . LYS A 1 542 ? 23.502  59.927  56.115 1.00 38.32 ? 573  LYS A NZ    1 
ATOM   4393  N N     . GLY A 1 543 ? 23.803  53.266  57.818 1.00 24.57 ? 574  GLY A N     1 
ATOM   4394  C CA    . GLY A 1 543 ? 22.766  52.769  58.699 1.00 23.48 ? 574  GLY A CA    1 
ATOM   4395  C C     . GLY A 1 543 ? 22.921  51.330  59.130 1.00 23.71 ? 574  GLY A C     1 
ATOM   4396  O O     . GLY A 1 543 ? 22.240  50.877  60.051 1.00 23.04 ? 574  GLY A O     1 
ATOM   4397  N N     . CYS A 1 544 ? 23.815  50.610  58.470 1.00 23.91 ? 575  CYS A N     1 
ATOM   4398  C CA    . CYS A 1 544 ? 24.031  49.212  58.792 1.00 24.24 ? 575  CYS A CA    1 
ATOM   4399  C C     . CYS A 1 544 ? 22.689  48.464  58.839 1.00 24.44 ? 575  CYS A C     1 
ATOM   4400  O O     . CYS A 1 544 ? 22.285  47.954  59.897 1.00 24.01 ? 575  CYS A O     1 
ATOM   4401  C CB    . CYS A 1 544 ? 24.737  49.080  60.142 1.00 25.14 ? 575  CYS A CB    1 
ATOM   4402  S SG    . CYS A 1 544 ? 24.911  47.353  60.711 1.00 29.70 ? 575  CYS A SG    1 
ATOM   4403  N N     . PRO A 1 545 ? 21.983  48.381  57.690 1.00 23.06 ? 576  PRO A N     1 
ATOM   4404  C CA    . PRO A 1 545 ? 20.695  47.680  57.673 1.00 23.25 ? 576  PRO A CA    1 
ATOM   4405  C C     . PRO A 1 545 ? 20.903  46.190  57.937 1.00 22.62 ? 576  PRO A C     1 
ATOM   4406  O O     . PRO A 1 545 ? 21.921  45.635  57.547 1.00 23.15 ? 576  PRO A O     1 
ATOM   4407  C CB    . PRO A 1 545 ? 20.150  47.928  56.265 1.00 22.92 ? 576  PRO A CB    1 
ATOM   4408  C CG    . PRO A 1 545 ? 21.145  48.770  55.559 1.00 22.75 ? 576  PRO A CG    1 
ATOM   4409  C CD    . PRO A 1 545 ? 22.367  48.894  56.362 1.00 23.32 ? 576  PRO A CD    1 
ATOM   4410  N N     . PHE A 1 546 ? 19.967  45.550  58.632 1.00 21.84 ? 577  PHE A N     1 
ATOM   4411  C CA    . PHE A 1 546 ? 20.081  44.120  58.879 1.00 21.47 ? 577  PHE A CA    1 
ATOM   4412  C C     . PHE A 1 546 ? 19.916  43.468  57.518 1.00 21.08 ? 577  PHE A C     1 
ATOM   4413  O O     . PHE A 1 546 ? 19.192  43.978  56.676 1.00 20.63 ? 577  PHE A O     1 
ATOM   4414  C CB    . PHE A 1 546 ? 18.966  43.645  59.802 1.00 22.45 ? 577  PHE A CB    1 
ATOM   4415  C CG    . PHE A 1 546 ? 19.192  43.976  61.242 1.00 23.97 ? 577  PHE A CG    1 
ATOM   4416  C CD1   . PHE A 1 546 ? 18.681  45.148  61.790 1.00 24.66 ? 577  PHE A CD1   1 
ATOM   4417  C CD2   . PHE A 1 546 ? 19.906  43.110  62.063 1.00 23.71 ? 577  PHE A CD2   1 
ATOM   4418  C CE1   . PHE A 1 546 ? 18.876  45.452  63.154 1.00 26.02 ? 577  PHE A CE1   1 
ATOM   4419  C CE2   . PHE A 1 546 ? 20.106  43.398  63.415 1.00 25.01 ? 577  PHE A CE2   1 
ATOM   4420  C CZ    . PHE A 1 546 ? 19.590  44.573  63.965 1.00 25.19 ? 577  PHE A CZ    1 
ATOM   4421  N N     . THR A 1 547 ? 20.584  42.350  57.284 1.00 20.78 ? 578  THR A N     1 
ATOM   4422  C CA    . THR A 1 547 ? 20.465  41.683  55.997 1.00 20.23 ? 578  THR A CA    1 
ATOM   4423  C C     . THR A 1 547 ? 20.826  40.221  56.114 1.00 20.87 ? 578  THR A C     1 
ATOM   4424  O O     . THR A 1 547 ? 21.427  39.803  57.092 1.00 21.36 ? 578  THR A O     1 
ATOM   4425  C CB    . THR A 1 547 ? 21.359  42.353  54.930 1.00 21.25 ? 578  THR A CB    1 
ATOM   4426  O OG1   . THR A 1 547 ? 20.799  42.127  53.632 1.00 21.38 ? 578  THR A OG1   1 
ATOM   4427  C CG2   . THR A 1 547 ? 22.767  41.799  54.975 1.00 19.45 ? 578  THR A CG2   1 
ATOM   4428  N N     . SER A 1 548 ? 20.435  39.447  55.113 1.00 21.03 ? 579  SER A N     1 
ATOM   4429  C CA    . SER A 1 548 ? 20.705  38.021  55.084 1.00 20.37 ? 579  SER A CA    1 
ATOM   4430  C C     . SER A 1 548 ? 20.281  37.511  53.715 1.00 21.59 ? 579  SER A C     1 
ATOM   4431  O O     . SER A 1 548 ? 19.731  38.268  52.916 1.00 22.11 ? 579  SER A O     1 
ATOM   4432  C CB    . SER A 1 548 ? 19.918  37.321  56.193 1.00 21.79 ? 579  SER A CB    1 
ATOM   4433  O OG    . SER A 1 548 ? 18.739  36.726  55.694 1.00 24.44 ? 579  SER A OG    1 
ATOM   4434  N N     . PHE A 1 549 ? 20.513  36.236  53.438 1.00 22.62 ? 580  PHE A N     1 
ATOM   4435  C CA    . PHE A 1 549 ? 20.159  35.694  52.129 1.00 25.62 ? 580  PHE A CA    1 
ATOM   4436  C C     . PHE A 1 549 ? 18.762  35.126  52.089 1.00 28.08 ? 580  PHE A C     1 
ATOM   4437  O O     . PHE A 1 549 ? 18.292  34.685  51.044 1.00 27.89 ? 580  PHE A O     1 
ATOM   4438  C CB    . PHE A 1 549 ? 21.168  34.625  51.695 1.00 23.77 ? 580  PHE A CB    1 
ATOM   4439  C CG    . PHE A 1 549 ? 22.479  35.191  51.218 1.00 22.81 ? 580  PHE A CG    1 
ATOM   4440  C CD1   . PHE A 1 549 ? 23.683  34.579  51.548 1.00 21.43 ? 580  PHE A CD1   1 
ATOM   4441  C CD2   . PHE A 1 549 ? 22.512  36.357  50.451 1.00 22.22 ? 580  PHE A CD2   1 
ATOM   4442  C CE1   . PHE A 1 549 ? 24.903  35.128  51.117 1.00 21.21 ? 580  PHE A CE1   1 
ATOM   4443  C CE2   . PHE A 1 549 ? 23.728  36.910  50.018 1.00 20.27 ? 580  PHE A CE2   1 
ATOM   4444  C CZ    . PHE A 1 549 ? 24.917  36.297  50.350 1.00 20.10 ? 580  PHE A CZ    1 
ATOM   4445  N N     . ASN A 1 550 ? 18.100  35.120  53.236 1.00 31.71 ? 581  ASN A N     1 
ATOM   4446  C CA    . ASN A 1 550 ? 16.738  34.623  53.293 1.00 35.80 ? 581  ASN A CA    1 
ATOM   4447  C C     . ASN A 1 550 ? 15.807  35.731  53.756 1.00 37.61 ? 581  ASN A C     1 
ATOM   4448  O O     . ASN A 1 550 ? 16.223  36.702  54.393 1.00 36.48 ? 581  ASN A O     1 
ATOM   4449  C CB    . ASN A 1 550 ? 16.614  33.406  54.220 1.00 35.66 ? 581  ASN A CB    1 
ATOM   4450  C CG    . ASN A 1 550 ? 17.242  33.631  55.574 1.00 37.25 ? 581  ASN A CG    1 
ATOM   4451  O OD1   . ASN A 1 550 ? 16.624  34.215  56.468 1.00 40.15 ? 581  ASN A OD1   1 
ATOM   4452  N ND2   . ASN A 1 550 ? 18.478  33.152  55.745 1.00 39.30 ? 581  ASN A ND2   1 
ATOM   4453  N N     . VAL A 1 551 ? 14.541  35.583  53.394 1.00 40.03 ? 582  VAL A N     1 
ATOM   4454  C CA    . VAL A 1 551 ? 13.513  36.541  53.754 1.00 43.15 ? 582  VAL A CA    1 
ATOM   4455  C C     . VAL A 1 551 ? 13.081  36.225  55.194 1.00 45.45 ? 582  VAL A C     1 
ATOM   4456  O O     . VAL A 1 551 ? 12.196  35.420  55.418 1.00 45.99 ? 582  VAL A O     1 
ATOM   4457  C CB    . VAL A 1 551 ? 12.321  36.417  52.769 1.00 42.61 ? 582  VAL A CB    1 
ATOM   4458  C CG1   . VAL A 1 551 ? 11.065  36.987  53.377 1.00 45.29 ? 582  VAL A CG1   1 
ATOM   4459  C CG2   . VAL A 1 551 ? 12.646  37.138  51.472 1.00 40.72 ? 582  VAL A CG2   1 
ATOM   4460  N N     . GLN A 1 552 ? 13.744  36.847  56.164 1.00 48.10 ? 583  GLN A N     1 
ATOM   4461  C CA    . GLN A 1 552 ? 13.461  36.655  57.596 1.00 50.88 ? 583  GLN A CA    1 
ATOM   4462  C C     . GLN A 1 552 ? 12.771  35.335  57.953 1.00 52.54 ? 583  GLN A C     1 
ATOM   4463  O O     . GLN A 1 552 ? 11.626  35.391  58.471 1.00 54.30 ? 583  GLN A O     1 
ATOM   4464  C CB    . GLN A 1 552 ? 12.620  37.820  58.129 1.00 51.75 ? 583  GLN A CB    1 
ATOM   4465  C CG    . GLN A 1 552 ? 11.573  38.319  57.156 1.00 55.05 ? 583  GLN A CG    1 
ATOM   4466  C CD    . GLN A 1 552 ? 12.171  39.140  56.012 1.00 55.99 ? 583  GLN A CD    1 
ATOM   4467  O OE1   . GLN A 1 552 ? 11.586  39.238  54.936 1.00 58.51 ? 583  GLN A OE1   1 
ATOM   4468  N NE2   . GLN A 1 552 ? 13.335  39.730  56.245 1.00 57.31 ? 583  GLN A NE2   1 
ATOM   4469  O OXT   . GLN A 1 552 ? 13.386  34.265  57.719 1.00 53.33 ? 583  GLN A OXT   1 
ATOM   4470  N N     . ALA B 1 1   ? 66.093  50.608  54.324 1.00 39.39 ? 2033 ALA B N     1 
ATOM   4471  C CA    . ALA B 1 1   ? 65.356  51.056  55.536 1.00 39.74 ? 2033 ALA B CA    1 
ATOM   4472  C C     . ALA B 1 1   ? 64.322  50.005  55.943 1.00 39.73 ? 2033 ALA B C     1 
ATOM   4473  O O     . ALA B 1 1   ? 63.927  49.923  57.113 1.00 40.30 ? 2033 ALA B O     1 
ATOM   4474  C CB    . ALA B 1 1   ? 64.679  52.399  55.268 1.00 39.82 ? 2033 ALA B CB    1 
ATOM   4475  N N     . ASN B 1 2   ? 63.891  49.200  54.977 1.00 38.96 ? 2034 ASN B N     1 
ATOM   4476  C CA    . ASN B 1 2   ? 62.926  48.147  55.255 1.00 38.44 ? 2034 ASN B CA    1 
ATOM   4477  C C     . ASN B 1 2   ? 63.479  47.265  56.377 1.00 37.72 ? 2034 ASN B C     1 
ATOM   4478  O O     . ASN B 1 2   ? 64.512  46.624  56.216 1.00 38.58 ? 2034 ASN B O     1 
ATOM   4479  C CB    . ASN B 1 2   ? 62.694  47.317  53.994 1.00 38.93 ? 2034 ASN B CB    1 
ATOM   4480  C CG    . ASN B 1 2   ? 61.469  46.442  54.095 1.00 39.87 ? 2034 ASN B CG    1 
ATOM   4481  O OD1   . ASN B 1 2   ? 60.813  46.163  53.092 1.00 40.91 ? 2034 ASN B OD1   1 
ATOM   4482  N ND2   . ASN B 1 2   ? 61.148  46.004  55.307 1.00 38.68 ? 2034 ASN B ND2   1 
ATOM   4483  N N     . PRO B 1 3   ? 62.785  47.211  57.522 1.00 36.53 ? 2035 PRO B N     1 
ATOM   4484  C CA    . PRO B 1 3   ? 63.212  46.408  58.679 1.00 35.25 ? 2035 PRO B CA    1 
ATOM   4485  C C     . PRO B 1 3   ? 63.477  44.934  58.373 1.00 33.47 ? 2035 PRO B C     1 
ATOM   4486  O O     . PRO B 1 3   ? 64.017  44.197  59.208 1.00 32.70 ? 2035 PRO B O     1 
ATOM   4487  C CB    . PRO B 1 3   ? 62.068  46.580  59.686 1.00 36.28 ? 2035 PRO B CB    1 
ATOM   4488  C CG    . PRO B 1 3   ? 60.907  47.083  58.883 1.00 36.28 ? 2035 PRO B CG    1 
ATOM   4489  C CD    . PRO B 1 3   ? 61.506  47.897  57.774 1.00 36.42 ? 2035 PRO B CD    1 
ATOM   4490  N N     . CYS B 1 4   ? 63.099  44.499  57.179 1.00 31.52 ? 2036 CYS B N     1 
ATOM   4491  C CA    . CYS B 1 4   ? 63.305  43.109  56.825 1.00 30.47 ? 2036 CYS B CA    1 
ATOM   4492  C C     . CYS B 1 4   ? 64.520  42.931  55.938 1.00 30.93 ? 2036 CYS B C     1 
ATOM   4493  O O     . CYS B 1 4   ? 64.804  41.826  55.494 1.00 29.30 ? 2036 CYS B O     1 
ATOM   4494  C CB    . CYS B 1 4   ? 62.062  42.546  56.133 1.00 29.86 ? 2036 CYS B CB    1 
ATOM   4495  S SG    . CYS B 1 4   ? 60.643  42.266  57.239 1.00 28.59 ? 2036 CYS B SG    1 
ATOM   4496  N N     . CYS B 1 5   ? 65.240  44.019  55.694 1.00 31.34 ? 2037 CYS B N     1 
ATOM   4497  C CA    . CYS B 1 5   ? 66.430  43.982  54.849 1.00 31.09 ? 2037 CYS B CA    1 
ATOM   4498  C C     . CYS B 1 5   ? 67.498  42.978  55.266 1.00 30.84 ? 2037 CYS B C     1 
ATOM   4499  O O     . CYS B 1 5   ? 68.250  42.503  54.421 1.00 29.54 ? 2037 CYS B O     1 
ATOM   4500  C CB    . CYS B 1 5   ? 67.061  45.365  54.775 1.00 32.27 ? 2037 CYS B CB    1 
ATOM   4501  S SG    . CYS B 1 5   ? 66.200  46.462  53.612 1.00 32.32 ? 2037 CYS B SG    1 
ATOM   4502  N N     . SER B 1 6   ? 67.568  42.650  56.557 1.00 31.38 ? 2038 SER B N     1 
ATOM   4503  C CA    . SER B 1 6   ? 68.572  41.694  57.048 1.00 30.92 ? 2038 SER B CA    1 
ATOM   4504  C C     . SER B 1 6   ? 68.143  40.234  56.953 1.00 31.04 ? 2038 SER B C     1 
ATOM   4505  O O     . SER B 1 6   ? 68.894  39.346  57.358 1.00 33.06 ? 2038 SER B O     1 
ATOM   4506  C CB    . SER B 1 6   ? 68.957  42.001  58.508 1.00 30.45 ? 2038 SER B CB    1 
ATOM   4507  O OG    . SER B 1 6   ? 67.850  41.934  59.392 1.00 30.32 ? 2038 SER B OG    1 
ATOM   4508  N N     . ASN B 1 7   ? 66.952  39.977  56.416 1.00 29.43 ? 2039 ASN B N     1 
ATOM   4509  C CA    . ASN B 1 7   ? 66.457  38.615  56.309 1.00 28.61 ? 2039 ASN B CA    1 
ATOM   4510  C C     . ASN B 1 7   ? 66.546  37.973  57.682 1.00 27.73 ? 2039 ASN B C     1 
ATOM   4511  O O     . ASN B 1 7   ? 67.083  36.872  57.842 1.00 26.86 ? 2039 ASN B O     1 
ATOM   4512  C CB    . ASN B 1 7   ? 67.300  37.823  55.322 1.00 28.40 ? 2039 ASN B CB    1 
ATOM   4513  C CG    . ASN B 1 7   ? 67.658  38.625  54.097 1.00 28.52 ? 2039 ASN B CG    1 
ATOM   4514  O OD1   . ASN B 1 7   ? 68.808  38.634  53.677 1.00 31.31 ? 2039 ASN B OD1   1 
ATOM   4515  N ND2   . ASN B 1 7   ? 66.677  39.303  53.515 1.00 25.77 ? 2039 ASN B ND2   1 
ATOM   4516  N N     . PRO B 1 8   ? 65.988  38.646  58.697 1.00 28.21 ? 2040 PRO B N     1 
ATOM   4517  C CA    . PRO B 1 8   ? 65.994  38.170  60.081 1.00 27.74 ? 2040 PRO B CA    1 
ATOM   4518  C C     . PRO B 1 8   ? 65.306  36.830  60.366 1.00 28.48 ? 2040 PRO B C     1 
ATOM   4519  O O     . PRO B 1 8   ? 65.785  36.051  61.198 1.00 28.27 ? 2040 PRO B O     1 
ATOM   4520  C CB    . PRO B 1 8   ? 65.323  39.310  60.846 1.00 28.10 ? 2040 PRO B CB    1 
ATOM   4521  C CG    . PRO B 1 8   ? 64.446  39.957  59.838 1.00 28.14 ? 2040 PRO B CG    1 
ATOM   4522  C CD    . PRO B 1 8   ? 65.251  39.915  58.573 1.00 27.75 ? 2040 PRO B CD    1 
ATOM   4523  N N     . CYS B 1 9   ? 64.176  36.569  59.703 1.00 27.44 ? 2041 CYS B N     1 
ATOM   4524  C CA    . CYS B 1 9   ? 63.419  35.337  59.946 1.00 26.44 ? 2041 CYS B CA    1 
ATOM   4525  C C     . CYS B 1 9   ? 64.056  34.102  59.358 1.00 25.07 ? 2041 CYS B C     1 
ATOM   4526  O O     . CYS B 1 9   ? 64.291  34.022  58.167 1.00 24.49 ? 2041 CYS B O     1 
ATOM   4527  C CB    . CYS B 1 9   ? 61.987  35.490  59.429 1.00 25.94 ? 2041 CYS B CB    1 
ATOM   4528  S SG    . CYS B 1 9   ? 61.249  37.089  59.889 1.00 26.62 ? 2041 CYS B SG    1 
ATOM   4529  N N     . GLN B 1 10  ? 64.321  33.129  60.215 1.00 25.50 ? 2042 GLN B N     1 
ATOM   4530  C CA    . GLN B 1 10  ? 64.951  31.890  59.797 1.00 26.47 ? 2042 GLN B CA    1 
ATOM   4531  C C     . GLN B 1 10  ? 63.954  30.767  59.553 1.00 27.31 ? 2042 GLN B C     1 
ATOM   4532  O O     . GLN B 1 10  ? 62.750  30.912  59.769 1.00 28.12 ? 2042 GLN B O     1 
ATOM   4533  C CB    . GLN B 1 10  ? 65.946  31.434  60.867 1.00 27.27 ? 2042 GLN B CB    1 
ATOM   4534  C CG    . GLN B 1 10  ? 66.994  32.463  61.239 1.00 25.47 ? 2042 GLN B CG    1 
ATOM   4535  C CD    . GLN B 1 10  ? 67.674  33.034  60.029 1.00 25.73 ? 2042 GLN B CD    1 
ATOM   4536  O OE1   . GLN B 1 10  ? 68.315  32.320  59.264 1.00 24.98 ? 2042 GLN B OE1   1 
ATOM   4537  N NE2   . GLN B 1 10  ? 67.535  34.334  59.842 1.00 28.13 ? 2042 GLN B NE2   1 
ATOM   4538  N N     . ASN B 1 11  ? 64.474  29.637  59.093 1.00 27.83 ? 2043 ASN B N     1 
ATOM   4539  C CA    . ASN B 1 11  ? 63.660  28.461  58.852 1.00 28.28 ? 2043 ASN B CA    1 
ATOM   4540  C C     . ASN B 1 11  ? 62.374  28.671  58.077 1.00 28.09 ? 2043 ASN B C     1 
ATOM   4541  O O     . ASN B 1 11  ? 61.360  28.048  58.366 1.00 27.13 ? 2043 ASN B O     1 
ATOM   4542  C CB    . ASN B 1 11  ? 63.368  27.808  60.190 1.00 29.48 ? 2043 ASN B CB    1 
ATOM   4543  C CG    . ASN B 1 11  ? 64.636  27.455  60.920 1.00 29.10 ? 2043 ASN B CG    1 
ATOM   4544  O OD1   . ASN B 1 11  ? 65.477  26.742  60.382 1.00 31.64 ? 2043 ASN B OD1   1 
ATOM   4545  N ND2   . ASN B 1 11  ? 64.799  27.969  62.135 1.00 29.84 ? 2043 ASN B ND2   1 
ATOM   4546  N N     . ARG B 1 12  ? 62.440  29.543  57.079 1.00 28.39 ? 2044 ARG B N     1 
ATOM   4547  C CA    . ARG B 1 12  ? 61.311  29.844  56.210 1.00 29.38 ? 2044 ARG B CA    1 
ATOM   4548  C C     . ARG B 1 12  ? 60.229  30.727  56.829 1.00 30.09 ? 2044 ARG B C     1 
ATOM   4549  O O     . ARG B 1 12  ? 59.199  30.981  56.208 1.00 31.84 ? 2044 ARG B O     1 
ATOM   4550  C CB    . ARG B 1 12  ? 60.709  28.543  55.672 1.00 28.35 ? 2044 ARG B CB    1 
ATOM   4551  C CG    . ARG B 1 12  ? 61.700  27.714  54.867 1.00 28.91 ? 2044 ARG B CG    1 
ATOM   4552  C CD    . ARG B 1 12  ? 61.540  27.932  53.376 1.00 30.69 ? 2044 ARG B CD    1 
ATOM   4553  N NE    . ARG B 1 12  ? 60.861  26.792  52.768 1.00 33.23 ? 2044 ARG B NE    1 
ATOM   4554  C CZ    . ARG B 1 12  ? 59.971  26.889  51.788 1.00 35.94 ? 2044 ARG B CZ    1 
ATOM   4555  N NH1   . ARG B 1 12  ? 59.660  28.086  51.301 1.00 37.19 ? 2044 ARG B NH1   1 
ATOM   4556  N NH2   . ARG B 1 12  ? 59.373  25.795  51.311 1.00 35.19 ? 2044 ARG B NH2   1 
ATOM   4557  N N     . GLY B 1 13  ? 60.451  31.194  58.050 1.00 30.12 ? 2045 GLY B N     1 
ATOM   4558  C CA    . GLY B 1 13  ? 59.479  32.082  58.649 1.00 31.18 ? 2045 GLY B CA    1 
ATOM   4559  C C     . GLY B 1 13  ? 59.460  33.329  57.774 1.00 31.41 ? 2045 GLY B C     1 
ATOM   4560  O O     . GLY B 1 13  ? 60.475  33.682  57.187 1.00 30.29 ? 2045 GLY B O     1 
ATOM   4561  N N     . GLU B 1 14  ? 58.320  34.003  57.679 1.00 31.91 ? 2046 GLU B N     1 
ATOM   4562  C CA    . GLU B 1 14  ? 58.222  35.193  56.839 1.00 32.49 ? 2046 GLU B CA    1 
ATOM   4563  C C     . GLU B 1 14  ? 58.326  36.507  57.598 1.00 30.72 ? 2046 GLU B C     1 
ATOM   4564  O O     . GLU B 1 14  ? 57.726  36.689  58.651 1.00 29.79 ? 2046 GLU B O     1 
ATOM   4565  C CB    . GLU B 1 14  ? 56.913  35.167  56.048 1.00 34.20 ? 2046 GLU B CB    1 
ATOM   4566  C CG    . GLU B 1 14  ? 56.549  33.798  55.510 1.00 38.19 ? 2046 GLU B CG    1 
ATOM   4567  C CD    . GLU B 1 14  ? 55.518  33.869  54.401 1.00 40.99 ? 2046 GLU B CD    1 
ATOM   4568  O OE1   . GLU B 1 14  ? 54.866  34.939  54.258 1.00 41.38 ? 2046 GLU B OE1   1 
ATOM   4569  O OE2   . GLU B 1 14  ? 55.369  32.853  53.676 1.00 41.70 ? 2046 GLU B OE2   1 
ATOM   4570  N N     . CYS B 1 15  ? 59.089  37.429  57.035 1.00 28.97 ? 2047 CYS B N     1 
ATOM   4571  C CA    . CYS B 1 15  ? 59.286  38.729  57.645 1.00 29.03 ? 2047 CYS B CA    1 
ATOM   4572  C C     . CYS B 1 15  ? 58.295  39.758  57.137 1.00 28.89 ? 2047 CYS B C     1 
ATOM   4573  O O     . CYS B 1 15  ? 58.102  39.898  55.937 1.00 28.37 ? 2047 CYS B O     1 
ATOM   4574  C CB    . CYS B 1 15  ? 60.698  39.232  57.365 1.00 28.36 ? 2047 CYS B CB    1 
ATOM   4575  S SG    . CYS B 1 15  ? 61.141  40.664  58.387 1.00 29.57 ? 2047 CYS B SG    1 
ATOM   4576  N N     . MET B 1 16  ? 57.676  40.488  58.053 1.00 28.58 ? 2048 MET B N     1 
ATOM   4577  C CA    . MET B 1 16  ? 56.725  41.518  57.675 1.00 28.82 ? 2048 MET B CA    1 
ATOM   4578  C C     . MET B 1 16  ? 57.034  42.736  58.527 1.00 29.39 ? 2048 MET B C     1 
ATOM   4579  O O     . MET B 1 16  ? 57.329  42.599  59.715 1.00 29.36 ? 2048 MET B O     1 
ATOM   4580  C CB    . MET B 1 16  ? 55.294  41.044  57.946 1.00 29.14 ? 2048 MET B CB    1 
ATOM   4581  C CG    . MET B 1 16  ? 54.227  42.100  57.707 1.00 28.95 ? 2048 MET B CG    1 
ATOM   4582  S SD    . MET B 1 16  ? 52.649  41.544  58.347 1.00 31.31 ? 2048 MET B SD    1 
ATOM   4583  C CE    . MET B 1 16  ? 52.920  41.548  60.110 1.00 26.46 ? 2048 MET B CE    1 
ATOM   4584  N N     . SER B 1 17  ? 56.992  43.924  57.927 1.00 29.43 ? 2049 SER B N     1 
ATOM   4585  C CA    . SER B 1 17  ? 57.254  45.142  58.687 1.00 30.63 ? 2049 SER B CA    1 
ATOM   4586  C C     . SER B 1 17  ? 56.034  45.445  59.538 1.00 31.22 ? 2049 SER B C     1 
ATOM   4587  O O     . SER B 1 17  ? 54.902  45.249  59.097 1.00 32.03 ? 2049 SER B O     1 
ATOM   4588  C CB    . SER B 1 17  ? 57.541  46.329  57.760 1.00 29.41 ? 2049 SER B CB    1 
ATOM   4589  O OG    . SER B 1 17  ? 56.719  46.307  56.612 1.00 29.60 ? 2049 SER B OG    1 
ATOM   4590  N N     . THR B 1 18  ? 56.257  45.916  60.759 1.00 31.97 ? 2050 THR B N     1 
ATOM   4591  C CA    . THR B 1 18  ? 55.151  46.235  61.643 1.00 32.46 ? 2050 THR B CA    1 
ATOM   4592  C C     . THR B 1 18  ? 55.177  47.710  61.978 1.00 33.70 ? 2050 THR B C     1 
ATOM   4593  O O     . THR B 1 18  ? 54.366  48.201  62.750 1.00 34.72 ? 2050 THR B O     1 
ATOM   4594  C CB    . THR B 1 18  ? 55.240  45.454  62.926 1.00 31.98 ? 2050 THR B CB    1 
ATOM   4595  O OG1   . THR B 1 18  ? 56.563  45.580  63.443 1.00 32.32 ? 2050 THR B OG1   1 
ATOM   4596  C CG2   . THR B 1 18  ? 54.925  43.988  62.674 1.00 31.14 ? 2050 THR B CG2   1 
ATOM   4597  N N     . GLY B 1 19  ? 56.124  48.417  61.388 1.00 34.14 ? 2051 GLY B N     1 
ATOM   4598  C CA    . GLY B 1 19  ? 56.258  49.840  61.614 1.00 33.87 ? 2051 GLY B CA    1 
ATOM   4599  C C     . GLY B 1 19  ? 57.453  50.231  60.775 1.00 34.96 ? 2051 GLY B C     1 
ATOM   4600  O O     . GLY B 1 19  ? 58.048  49.372  60.125 1.00 34.76 ? 2051 GLY B O     1 
ATOM   4601  N N     . PHE B 1 20  ? 57.825  51.502  60.768 1.00 36.05 ? 2052 PHE B N     1 
ATOM   4602  C CA    . PHE B 1 20  ? 58.962  51.920  59.964 1.00 37.07 ? 2052 PHE B CA    1 
ATOM   4603  C C     . PHE B 1 20  ? 60.245  51.172  60.319 1.00 39.71 ? 2052 PHE B C     1 
ATOM   4604  O O     . PHE B 1 20  ? 60.997  50.760  59.435 1.00 39.94 ? 2052 PHE B O     1 
ATOM   4605  C CB    . PHE B 1 20  ? 59.174  53.423  60.116 1.00 35.45 ? 2052 PHE B CB    1 
ATOM   4606  C CG    . PHE B 1 20  ? 58.084  54.242  59.500 1.00 32.50 ? 2052 PHE B CG    1 
ATOM   4607  C CD1   . PHE B 1 20  ? 57.050  54.746  60.285 1.00 32.01 ? 2052 PHE B CD1   1 
ATOM   4608  C CD2   . PHE B 1 20  ? 58.072  54.483  58.128 1.00 31.30 ? 2052 PHE B CD2   1 
ATOM   4609  C CE1   . PHE B 1 20  ? 56.015  55.480  59.719 1.00 32.91 ? 2052 PHE B CE1   1 
ATOM   4610  C CE2   . PHE B 1 20  ? 57.053  55.209  57.545 1.00 31.95 ? 2052 PHE B CE2   1 
ATOM   4611  C CZ    . PHE B 1 20  ? 56.012  55.714  58.342 1.00 32.89 ? 2052 PHE B CZ    1 
ATOM   4612  N N     . ASP B 1 21  ? 60.481  50.979  61.614 1.00 42.96 ? 2053 ASP B N     1 
ATOM   4613  C CA    . ASP B 1 21  ? 61.688  50.303  62.061 1.00 45.12 ? 2053 ASP B CA    1 
ATOM   4614  C C     . ASP B 1 21  ? 61.416  49.070  62.901 1.00 44.56 ? 2053 ASP B C     1 
ATOM   4615  O O     . ASP B 1 21  ? 62.086  48.834  63.905 1.00 45.04 ? 2053 ASP B O     1 
ATOM   4616  C CB    . ASP B 1 21  ? 62.560  51.271  62.863 1.00 49.30 ? 2053 ASP B CB    1 
ATOM   4617  C CG    . ASP B 1 21  ? 62.700  52.626  62.190 1.00 52.44 ? 2053 ASP B CG    1 
ATOM   4618  O OD1   . ASP B 1 21  ? 63.162  52.684  61.023 1.00 53.90 ? 2053 ASP B OD1   1 
ATOM   4619  O OD2   . ASP B 1 21  ? 62.343  53.639  62.835 1.00 56.82 ? 2053 ASP B OD2   1 
ATOM   4620  N N     . GLN B 1 22  ? 60.427  48.284  62.505 1.00 43.78 ? 2054 GLN B N     1 
ATOM   4621  C CA    . GLN B 1 22  ? 60.129  47.075  63.248 1.00 42.26 ? 2054 GLN B CA    1 
ATOM   4622  C C     . GLN B 1 22  ? 59.617  46.014  62.304 1.00 40.46 ? 2054 GLN B C     1 
ATOM   4623  O O     . GLN B 1 22  ? 59.074  46.322  61.246 1.00 39.13 ? 2054 GLN B O     1 
ATOM   4624  C CB    . GLN B 1 22  ? 59.103  47.357  64.343 1.00 44.62 ? 2054 GLN B CB    1 
ATOM   4625  C CG    . GLN B 1 22  ? 59.319  48.678  65.066 1.00 47.41 ? 2054 GLN B CG    1 
ATOM   4626  C CD    . GLN B 1 22  ? 58.015  49.433  65.290 1.00 50.03 ? 2054 GLN B CD    1 
ATOM   4627  O OE1   . GLN B 1 22  ? 57.870  50.599  64.888 1.00 49.01 ? 2054 GLN B OE1   1 
ATOM   4628  N NE2   . GLN B 1 22  ? 57.052  48.761  65.936 1.00 50.53 ? 2054 GLN B NE2   1 
ATOM   4629  N N     . TYR B 1 23  ? 59.808  44.760  62.684 1.00 37.25 ? 2055 TYR B N     1 
ATOM   4630  C CA    . TYR B 1 23  ? 59.356  43.653  61.865 1.00 34.97 ? 2055 TYR B CA    1 
ATOM   4631  C C     . TYR B 1 23  ? 58.767  42.573  62.744 1.00 34.22 ? 2055 TYR B C     1 
ATOM   4632  O O     . TYR B 1 23  ? 58.826  42.643  63.970 1.00 33.94 ? 2055 TYR B O     1 
ATOM   4633  C CB    . TYR B 1 23  ? 60.516  43.078  61.060 1.00 33.69 ? 2055 TYR B CB    1 
ATOM   4634  C CG    . TYR B 1 23  ? 61.491  42.272  61.877 1.00 32.02 ? 2055 TYR B CG    1 
ATOM   4635  C CD1   . TYR B 1 23  ? 61.289  40.911  62.108 1.00 32.78 ? 2055 TYR B CD1   1 
ATOM   4636  C CD2   . TYR B 1 23  ? 62.637  42.864  62.406 1.00 32.47 ? 2055 TYR B CD2   1 
ATOM   4637  C CE1   . TYR B 1 23  ? 62.212  40.155  62.847 1.00 32.23 ? 2055 TYR B CE1   1 
ATOM   4638  C CE2   . TYR B 1 23  ? 63.566  42.120  63.144 1.00 31.65 ? 2055 TYR B CE2   1 
ATOM   4639  C CZ    . TYR B 1 23  ? 63.347  40.772  63.358 1.00 31.64 ? 2055 TYR B CZ    1 
ATOM   4640  O OH    . TYR B 1 23  ? 64.263  40.043  64.073 1.00 31.63 ? 2055 TYR B OH    1 
ATOM   4641  N N     . LYS B 1 24  ? 58.207  41.560  62.111 1.00 32.33 ? 2056 LYS B N     1 
ATOM   4642  C CA    . LYS B 1 24  ? 57.618  40.454  62.837 1.00 32.37 ? 2056 LYS B CA    1 
ATOM   4643  C C     . LYS B 1 24  ? 57.831  39.242  61.948 1.00 31.36 ? 2056 LYS B C     1 
ATOM   4644  O O     . LYS B 1 24  ? 57.767  39.365  60.727 1.00 30.55 ? 2056 LYS B O     1 
ATOM   4645  C CB    . LYS B 1 24  ? 56.124  40.718  63.036 1.00 33.15 ? 2056 LYS B CB    1 
ATOM   4646  C CG    . LYS B 1 24  ? 55.285  39.472  63.238 1.00 35.33 ? 2056 LYS B CG    1 
ATOM   4647  C CD    . LYS B 1 24  ? 54.605  39.502  64.592 1.00 36.65 ? 2056 LYS B CD    1 
ATOM   4648  C CE    . LYS B 1 24  ? 54.164  38.114  65.015 1.00 38.46 ? 2056 LYS B CE    1 
ATOM   4649  N NZ    . LYS B 1 24  ? 52.967  38.184  65.908 1.00 42.06 ? 2056 LYS B NZ    1 
ATOM   4650  N N     . CYS B 1 25  ? 58.104  38.083  62.541 1.00 29.82 ? 2057 CYS B N     1 
ATOM   4651  C CA    . CYS B 1 25  ? 58.288  36.873  61.751 1.00 28.86 ? 2057 CYS B CA    1 
ATOM   4652  C C     . CYS B 1 25  ? 57.066  35.993  61.909 1.00 27.83 ? 2057 CYS B C     1 
ATOM   4653  O O     . CYS B 1 25  ? 56.573  35.802  63.010 1.00 26.42 ? 2057 CYS B O     1 
ATOM   4654  C CB    . CYS B 1 25  ? 59.524  36.097  62.201 1.00 28.29 ? 2057 CYS B CB    1 
ATOM   4655  S SG    . CYS B 1 25  ? 61.064  37.005  61.912 1.00 26.42 ? 2057 CYS B SG    1 
ATOM   4656  N N     . ASP B 1 26  ? 56.584  35.466  60.795 1.00 26.99 ? 2058 ASP B N     1 
ATOM   4657  C CA    . ASP B 1 26  ? 55.427  34.594  60.796 1.00 26.43 ? 2058 ASP B CA    1 
ATOM   4658  C C     . ASP B 1 26  ? 56.025  33.207  60.705 1.00 25.74 ? 2058 ASP B C     1 
ATOM   4659  O O     . ASP B 1 26  ? 56.406  32.769  59.625 1.00 25.98 ? 2058 ASP B O     1 
ATOM   4660  C CB    . ASP B 1 26  ? 54.559  34.895  59.569 1.00 25.83 ? 2058 ASP B CB    1 
ATOM   4661  C CG    . ASP B 1 26  ? 53.284  34.083  59.532 1.00 25.81 ? 2058 ASP B CG    1 
ATOM   4662  O OD1   . ASP B 1 26  ? 53.130  33.138  60.335 1.00 25.51 ? 2058 ASP B OD1   1 
ATOM   4663  O OD2   . ASP B 1 26  ? 52.427  34.392  58.687 1.00 26.22 ? 2058 ASP B OD2   1 
ATOM   4664  N N     . CYS B 1 27  ? 56.119  32.524  61.841 1.00 25.46 ? 2059 CYS B N     1 
ATOM   4665  C CA    . CYS B 1 27  ? 56.699  31.185  61.878 1.00 25.21 ? 2059 CYS B CA    1 
ATOM   4666  C C     . CYS B 1 27  ? 55.713  30.068  61.603 1.00 24.95 ? 2059 CYS B C     1 
ATOM   4667  O O     . CYS B 1 27  ? 56.009  28.901  61.863 1.00 24.31 ? 2059 CYS B O     1 
ATOM   4668  C CB    . CYS B 1 27  ? 57.344  30.937  63.235 1.00 26.54 ? 2059 CYS B CB    1 
ATOM   4669  S SG    . CYS B 1 27  ? 58.406  32.301  63.778 1.00 28.98 ? 2059 CYS B SG    1 
ATOM   4670  N N     . THR B 1 28  ? 54.549  30.417  61.075 1.00 26.02 ? 2060 THR B N     1 
ATOM   4671  C CA    . THR B 1 28  ? 53.520  29.428  60.791 1.00 25.90 ? 2060 THR B CA    1 
ATOM   4672  C C     . THR B 1 28  ? 54.057  28.220  60.032 1.00 26.82 ? 2060 THR B C     1 
ATOM   4673  O O     . THR B 1 28  ? 54.740  28.363  59.021 1.00 28.18 ? 2060 THR B O     1 
ATOM   4674  C CB    . THR B 1 28  ? 52.383  30.048  59.979 1.00 25.80 ? 2060 THR B CB    1 
ATOM   4675  O OG1   . THR B 1 28  ? 51.793  31.117  60.729 1.00 26.86 ? 2060 THR B OG1   1 
ATOM   4676  C CG2   . THR B 1 28  ? 51.335  29.013  59.665 1.00 25.05 ? 2060 THR B CG2   1 
ATOM   4677  N N     . ARG B 1 29  ? 53.748  27.032  60.542 1.00 27.62 ? 2061 ARG B N     1 
ATOM   4678  C CA    . ARG B 1 29  ? 54.163  25.774  59.927 1.00 27.87 ? 2061 ARG B CA    1 
ATOM   4679  C C     . ARG B 1 29  ? 55.670  25.624  59.707 1.00 27.86 ? 2061 ARG B C     1 
ATOM   4680  O O     . ARG B 1 29  ? 56.109  24.713  59.013 1.00 28.80 ? 2061 ARG B O     1 
ATOM   4681  C CB    . ARG B 1 29  ? 53.443  25.591  58.590 1.00 28.55 ? 2061 ARG B CB    1 
ATOM   4682  C CG    . ARG B 1 29  ? 52.183  24.722  58.652 1.00 27.97 ? 2061 ARG B CG    1 
ATOM   4683  C CD    . ARG B 1 29  ? 51.243  25.025  57.484 1.00 28.09 ? 2061 ARG B CD    1 
ATOM   4684  N NE    . ARG B 1 29  ? 50.099  25.795  57.945 1.00 30.67 ? 2061 ARG B NE    1 
ATOM   4685  C CZ    . ARG B 1 29  ? 49.668  26.926  57.399 1.00 30.75 ? 2061 ARG B CZ    1 
ATOM   4686  N NH1   . ARG B 1 29  ? 50.281  27.455  56.355 1.00 32.40 ? 2061 ARG B NH1   1 
ATOM   4687  N NH2   . ARG B 1 29  ? 48.635  27.551  57.935 1.00 33.48 ? 2061 ARG B NH2   1 
ATOM   4688  N N     . THR B 1 30  ? 56.468  26.502  60.297 1.00 28.67 ? 2062 THR B N     1 
ATOM   4689  C CA    . THR B 1 30  ? 57.915  26.408  60.127 1.00 29.12 ? 2062 THR B CA    1 
ATOM   4690  C C     . THR B 1 30  ? 58.550  25.326  61.024 1.00 30.26 ? 2062 THR B C     1 
ATOM   4691  O O     . THR B 1 30  ? 59.680  24.889  60.786 1.00 29.48 ? 2062 THR B O     1 
ATOM   4692  C CB    . THR B 1 30  ? 58.595  27.757  60.434 1.00 28.28 ? 2062 THR B CB    1 
ATOM   4693  O OG1   . THR B 1 30  ? 58.371  28.103  61.808 1.00 29.20 ? 2062 THR B OG1   1 
ATOM   4694  C CG2   . THR B 1 30  ? 58.047  28.840  59.540 1.00 26.61 ? 2062 THR B CG2   1 
ATOM   4695  N N     . GLY B 1 31  ? 57.819  24.895  62.050 1.00 30.33 ? 2063 GLY B N     1 
ATOM   4696  C CA    . GLY B 1 31  ? 58.348  23.900  62.969 1.00 29.56 ? 2063 GLY B CA    1 
ATOM   4697  C C     . GLY B 1 31  ? 59.202  24.570  64.036 1.00 28.95 ? 2063 GLY B C     1 
ATOM   4698  O O     . GLY B 1 31  ? 59.802  23.904  64.878 1.00 28.56 ? 2063 GLY B O     1 
ATOM   4699  N N     . PHE B 1 32  ? 59.255  25.899  63.995 1.00 29.14 ? 2064 PHE B N     1 
ATOM   4700  C CA    . PHE B 1 32  ? 60.040  26.690  64.946 1.00 28.83 ? 2064 PHE B CA    1 
ATOM   4701  C C     . PHE B 1 32  ? 59.193  27.846  65.422 1.00 28.79 ? 2064 PHE B C     1 
ATOM   4702  O O     . PHE B 1 32  ? 58.114  28.093  64.903 1.00 28.11 ? 2064 PHE B O     1 
ATOM   4703  C CB    . PHE B 1 32  ? 61.288  27.298  64.281 1.00 27.61 ? 2064 PHE B CB    1 
ATOM   4704  C CG    . PHE B 1 32  ? 62.287  26.290  63.792 1.00 26.89 ? 2064 PHE B CG    1 
ATOM   4705  C CD1   . PHE B 1 32  ? 62.113  25.650  62.570 1.00 26.57 ? 2064 PHE B CD1   1 
ATOM   4706  C CD2   . PHE B 1 32  ? 63.412  25.994  64.544 1.00 26.12 ? 2064 PHE B CD2   1 
ATOM   4707  C CE1   . PHE B 1 32  ? 63.051  24.729  62.109 1.00 26.81 ? 2064 PHE B CE1   1 
ATOM   4708  C CE2   . PHE B 1 32  ? 64.347  25.078  64.090 1.00 26.04 ? 2064 PHE B CE2   1 
ATOM   4709  C CZ    . PHE B 1 32  ? 64.166  24.445  62.872 1.00 26.40 ? 2064 PHE B CZ    1 
ATOM   4710  N N     . TYR B 1 33  ? 59.713  28.571  66.401 1.00 30.88 ? 2065 TYR B N     1 
ATOM   4711  C CA    . TYR B 1 33  ? 59.038  29.747  66.924 1.00 31.77 ? 2065 TYR B CA    1 
ATOM   4712  C C     . TYR B 1 33  ? 60.086  30.696  67.481 1.00 32.26 ? 2065 TYR B C     1 
ATOM   4713  O O     . TYR B 1 33  ? 61.277  30.410  67.428 1.00 32.18 ? 2065 TYR B O     1 
ATOM   4714  C CB    . TYR B 1 33  ? 58.010  29.380  67.996 1.00 33.03 ? 2065 TYR B CB    1 
ATOM   4715  C CG    . TYR B 1 33  ? 58.559  28.590  69.148 1.00 34.42 ? 2065 TYR B CG    1 
ATOM   4716  C CD1   . TYR B 1 33  ? 59.100  29.230  70.262 1.00 35.27 ? 2065 TYR B CD1   1 
ATOM   4717  C CD2   . TYR B 1 33  ? 58.532  27.202  69.131 1.00 34.75 ? 2065 TYR B CD2   1 
ATOM   4718  C CE1   . TYR B 1 33  ? 59.600  28.502  71.336 1.00 36.28 ? 2065 TYR B CE1   1 
ATOM   4719  C CE2   . TYR B 1 33  ? 59.024  26.468  70.189 1.00 34.79 ? 2065 TYR B CE2   1 
ATOM   4720  C CZ    . TYR B 1 33  ? 59.555  27.118  71.290 1.00 36.06 ? 2065 TYR B CZ    1 
ATOM   4721  O OH    . TYR B 1 33  ? 60.023  26.372  72.347 1.00 37.59 ? 2065 TYR B OH    1 
ATOM   4722  N N     . GLY B 1 34  ? 59.646  31.829  68.002 1.00 32.72 ? 2066 GLY B N     1 
ATOM   4723  C CA    . GLY B 1 34  ? 60.586  32.795  68.516 1.00 32.87 ? 2066 GLY B CA    1 
ATOM   4724  C C     . GLY B 1 34  ? 60.620  33.956  67.547 1.00 33.96 ? 2066 GLY B C     1 
ATOM   4725  O O     . GLY B 1 34  ? 60.208  33.825  66.398 1.00 34.14 ? 2066 GLY B O     1 
ATOM   4726  N N     . GLU B 1 35  ? 61.107  35.096  68.012 1.00 34.31 ? 2067 GLU B N     1 
ATOM   4727  C CA    . GLU B 1 35  ? 61.175  36.292  67.194 1.00 35.70 ? 2067 GLU B CA    1 
ATOM   4728  C C     . GLU B 1 35  ? 61.644  36.024  65.771 1.00 35.33 ? 2067 GLU B C     1 
ATOM   4729  O O     . GLU B 1 35  ? 61.141  36.620  64.827 1.00 36.97 ? 2067 GLU B O     1 
ATOM   4730  C CB    . GLU B 1 35  ? 62.092  37.313  67.875 1.00 36.52 ? 2067 GLU B CB    1 
ATOM   4731  C CG    . GLU B 1 35  ? 62.196  38.643  67.168 1.00 40.24 ? 2067 GLU B CG    1 
ATOM   4732  C CD    . GLU B 1 35  ? 63.245  39.542  67.796 1.00 41.44 ? 2067 GLU B CD    1 
ATOM   4733  O OE1   . GLU B 1 35  ? 63.729  39.197  68.892 1.00 44.12 ? 2067 GLU B OE1   1 
ATOM   4734  O OE2   . GLU B 1 35  ? 63.589  40.587  67.198 1.00 44.97 ? 2067 GLU B OE2   1 
ATOM   4735  N N     . ASN B 1 36  ? 62.597  35.117  65.616 1.00 36.04 ? 2068 ASN B N     1 
ATOM   4736  C CA    . ASN B 1 36  ? 63.137  34.815  64.299 1.00 36.29 ? 2068 ASN B CA    1 
ATOM   4737  C C     . ASN B 1 36  ? 62.911  33.378  63.863 1.00 35.65 ? 2068 ASN B C     1 
ATOM   4738  O O     . ASN B 1 36  ? 63.600  32.876  62.972 1.00 35.38 ? 2068 ASN B O     1 
ATOM   4739  C CB    . ASN B 1 36  ? 64.625  35.147  64.289 1.00 38.57 ? 2068 ASN B CB    1 
ATOM   4740  C CG    . ASN B 1 36  ? 64.893  36.542  64.797 1.00 42.57 ? 2068 ASN B CG    1 
ATOM   4741  O OD1   . ASN B 1 36  ? 64.243  37.478  64.348 1.00 39.91 ? 2068 ASN B OD1   1 
ATOM   4742  N ND2   . ASN B 1 36  ? 65.827  36.707  65.732 1.00 46.14 ? 2068 ASN B ND2   1 
ATOM   4743  N N     . CYS B 1 37  ? 61.932  32.728  64.488 1.00 33.82 ? 2069 CYS B N     1 
ATOM   4744  C CA    . CYS B 1 37  ? 61.599  31.348  64.184 1.00 32.61 ? 2069 CYS B CA    1 
ATOM   4745  C C     . CYS B 1 37  ? 62.845  30.484  64.301 1.00 33.27 ? 2069 CYS B C     1 
ATOM   4746  O O     . CYS B 1 37  ? 63.135  29.699  63.403 1.00 33.36 ? 2069 CYS B O     1 
ATOM   4747  C CB    . CYS B 1 37  ? 61.028  31.220  62.762 1.00 32.26 ? 2069 CYS B CB    1 
ATOM   4748  S SG    . CYS B 1 37  ? 59.799  32.476  62.311 1.00 30.81 ? 2069 CYS B SG    1 
ATOM   4749  N N     . THR B 1 38  ? 63.595  30.619  65.393 1.00 34.00 ? 2070 THR B N     1 
ATOM   4750  C CA    . THR B 1 38  ? 64.795  29.796  65.551 1.00 34.04 ? 2070 THR B CA    1 
ATOM   4751  C C     . THR B 1 38  ? 64.689  28.776  66.662 1.00 34.30 ? 2070 THR B C     1 
ATOM   4752  O O     . THR B 1 38  ? 65.518  27.873  66.735 1.00 35.18 ? 2070 THR B O     1 
ATOM   4753  C CB    . THR B 1 38  ? 66.059  30.625  65.805 1.00 33.06 ? 2070 THR B CB    1 
ATOM   4754  O OG1   . THR B 1 38  ? 65.780  31.630  66.779 1.00 34.68 ? 2070 THR B OG1   1 
ATOM   4755  C CG2   . THR B 1 38  ? 66.532  31.287  64.522 1.00 31.77 ? 2070 THR B CG2   1 
ATOM   4756  N N     . THR B 1 39  ? 63.690  28.908  67.533 1.00 34.71 ? 2071 THR B N     1 
ATOM   4757  C CA    . THR B 1 39  ? 63.522  27.942  68.618 1.00 34.96 ? 2071 THR B CA    1 
ATOM   4758  C C     . THR B 1 39  ? 62.679  26.782  68.093 1.00 36.11 ? 2071 THR B C     1 
ATOM   4759  O O     . THR B 1 39  ? 61.482  26.935  67.825 1.00 35.94 ? 2071 THR B O     1 
ATOM   4760  C CB    . THR B 1 39  ? 62.824  28.562  69.839 1.00 35.58 ? 2071 THR B CB    1 
ATOM   4761  O OG1   . THR B 1 39  ? 63.589  29.676  70.319 1.00 34.50 ? 2071 THR B OG1   1 
ATOM   4762  C CG2   . THR B 1 39  ? 62.699  27.530  70.951 1.00 34.58 ? 2071 THR B CG2   1 
ATOM   4763  N N     . PRO B 1 40  ? 63.292  25.590  67.973 1.00 36.26 ? 2072 PRO B N     1 
ATOM   4764  C CA    . PRO B 1 40  ? 62.628  24.389  67.471 1.00 37.75 ? 2072 PRO B CA    1 
ATOM   4765  C C     . PRO B 1 40  ? 61.611  23.734  68.387 1.00 39.13 ? 2072 PRO B C     1 
ATOM   4766  O O     . PRO B 1 40  ? 61.750  23.709  69.617 1.00 39.89 ? 2072 PRO B O     1 
ATOM   4767  C CB    . PRO B 1 40  ? 63.788  23.448  67.164 1.00 36.50 ? 2072 PRO B CB    1 
ATOM   4768  C CG    . PRO B 1 40  ? 64.782  23.796  68.187 1.00 35.46 ? 2072 PRO B CG    1 
ATOM   4769  C CD    . PRO B 1 40  ? 64.679  25.298  68.371 1.00 36.20 ? 2072 PRO B CD    1 
ATOM   4770  N N     . GLU B 1 41  ? 60.579  23.192  67.765 1.00 39.53 ? 2073 GLU B N     1 
ATOM   4771  C CA    . GLU B 1 41  ? 59.554  22.500  68.505 1.00 39.38 ? 2073 GLU B CA    1 
ATOM   4772  C C     . GLU B 1 41  ? 60.123  21.108  68.736 1.00 39.74 ? 2073 GLU B C     1 
ATOM   4773  O O     . GLU B 1 41  ? 60.847  20.584  67.892 1.00 38.87 ? 2073 GLU B O     1 
ATOM   4774  C CB    . GLU B 1 41  ? 58.267  22.464  67.688 1.00 40.08 ? 2073 GLU B CB    1 
ATOM   4775  C CG    . GLU B 1 41  ? 57.435  23.717  67.899 1.00 40.81 ? 2073 GLU B CG    1 
ATOM   4776  C CD    . GLU B 1 41  ? 56.463  23.974  66.773 1.00 42.26 ? 2073 GLU B CD    1 
ATOM   4777  O OE1   . GLU B 1 41  ? 56.461  23.182  65.805 1.00 44.46 ? 2073 GLU B OE1   1 
ATOM   4778  O OE2   . GLU B 1 41  ? 55.699  24.967  66.857 1.00 43.07 ? 2073 GLU B OE2   1 
ATOM   4779  N N     . PHE B 1 42  ? 59.821  20.528  69.892 1.00 40.75 ? 2074 PHE B N     1 
ATOM   4780  C CA    . PHE B 1 42  ? 60.332  19.208  70.237 1.00 41.44 ? 2074 PHE B CA    1 
ATOM   4781  C C     . PHE B 1 42  ? 60.537  18.312  69.030 1.00 40.72 ? 2074 PHE B C     1 
ATOM   4782  O O     . PHE B 1 42  ? 61.663  17.932  68.701 1.00 40.05 ? 2074 PHE B O     1 
ATOM   4783  C CB    . PHE B 1 42  ? 59.395  18.500  71.217 1.00 43.60 ? 2074 PHE B CB    1 
ATOM   4784  C CG    . PHE B 1 42  ? 59.871  17.129  71.605 1.00 44.81 ? 2074 PHE B CG    1 
ATOM   4785  C CD1   . PHE B 1 42  ? 61.118  16.967  72.232 1.00 45.54 ? 2074 PHE B CD1   1 
ATOM   4786  C CD2   . PHE B 1 42  ? 59.120  16.000  71.291 1.00 44.80 ? 2074 PHE B CD2   1 
ATOM   4787  C CE1   . PHE B 1 42  ? 61.614  15.707  72.537 1.00 44.77 ? 2074 PHE B CE1   1 
ATOM   4788  C CE2   . PHE B 1 42  ? 59.609  14.728  71.593 1.00 46.05 ? 2074 PHE B CE2   1 
ATOM   4789  C CZ    . PHE B 1 42  ? 60.862  14.584  72.216 1.00 46.17 ? 2074 PHE B CZ    1 
ATOM   4790  N N     . LEU B 1 43  ? 59.430  17.973  68.380 1.00 41.04 ? 2075 LEU B N     1 
ATOM   4791  C CA    . LEU B 1 43  ? 59.457  17.118  67.207 1.00 41.65 ? 2075 LEU B CA    1 
ATOM   4792  C C     . LEU B 1 43  ? 60.430  17.611  66.147 1.00 40.59 ? 2075 LEU B C     1 
ATOM   4793  O O     . LEU B 1 43  ? 61.097  16.814  65.495 1.00 39.92 ? 2075 LEU B O     1 
ATOM   4794  C CB    . LEU B 1 43  ? 58.071  17.019  66.601 1.00 43.28 ? 2075 LEU B CB    1 
ATOM   4795  C CG    . LEU B 1 43  ? 58.124  16.118  65.378 1.00 43.70 ? 2075 LEU B CG    1 
ATOM   4796  C CD1   . LEU B 1 43  ? 58.020  14.674  65.847 1.00 45.98 ? 2075 LEU B CD1   1 
ATOM   4797  C CD2   . LEU B 1 43  ? 57.008  16.482  64.407 1.00 46.17 ? 2075 LEU B CD2   1 
ATOM   4798  N N     . THR B 1 44  ? 60.489  18.923  65.957 1.00 39.58 ? 2076 THR B N     1 
ATOM   4799  C CA    . THR B 1 44  ? 61.416  19.498  64.992 1.00 40.43 ? 2076 THR B CA    1 
ATOM   4800  C C     . THR B 1 44  ? 62.811  18.979  65.358 1.00 42.20 ? 2076 THR B C     1 
ATOM   4801  O O     . THR B 1 44  ? 63.526  18.409  64.528 1.00 41.20 ? 2076 THR B O     1 
ATOM   4802  C CB    . THR B 1 44  ? 61.402  21.032  65.074 1.00 40.06 ? 2076 THR B CB    1 
ATOM   4803  O OG1   . THR B 1 44  ? 60.118  21.511  64.667 1.00 39.63 ? 2076 THR B OG1   1 
ATOM   4804  C CG2   . THR B 1 44  ? 62.467  21.631  64.181 1.00 39.29 ? 2076 THR B CG2   1 
ATOM   4805  N N     . ARG B 1 45  ? 63.176  19.175  66.621 1.00 43.37 ? 2077 ARG B N     1 
ATOM   4806  C CA    . ARG B 1 45  ? 64.454  18.721  67.150 1.00 45.58 ? 2077 ARG B CA    1 
ATOM   4807  C C     . ARG B 1 45  ? 64.650  17.237  66.846 1.00 45.34 ? 2077 ARG B C     1 
ATOM   4808  O O     . ARG B 1 45  ? 65.673  16.825  66.289 1.00 43.76 ? 2077 ARG B O     1 
ATOM   4809  C CB    . ARG B 1 45  ? 64.492  18.974  68.660 1.00 48.45 ? 2077 ARG B CB    1 
ATOM   4810  C CG    . ARG B 1 45  ? 64.423  20.459  68.993 1.00 53.50 ? 2077 ARG B CG    1 
ATOM   4811  C CD    . ARG B 1 45  ? 64.161  20.700  70.457 1.00 58.15 ? 2077 ARG B CD    1 
ATOM   4812  N NE    . ARG B 1 45  ? 65.305  20.311  71.272 1.00 62.78 ? 2077 ARG B NE    1 
ATOM   4813  C CZ    . ARG B 1 45  ? 65.210  19.660  72.428 1.00 65.41 ? 2077 ARG B CZ    1 
ATOM   4814  N NH1   . ARG B 1 45  ? 64.011  19.325  72.902 1.00 65.88 ? 2077 ARG B NH1   1 
ATOM   4815  N NH2   . ARG B 1 45  ? 66.309  19.348  73.112 1.00 65.63 ? 2077 ARG B NH2   1 
ATOM   4816  N N     . ILE B 1 46  ? 63.658  16.440  67.212 1.00 44.90 ? 2078 ILE B N     1 
ATOM   4817  C CA    . ILE B 1 46  ? 63.719  15.020  66.947 1.00 46.12 ? 2078 ILE B CA    1 
ATOM   4818  C C     . ILE B 1 46  ? 64.070  14.832  65.476 1.00 45.53 ? 2078 ILE B C     1 
ATOM   4819  O O     . ILE B 1 46  ? 65.090  14.240  65.151 1.00 46.13 ? 2078 ILE B O     1 
ATOM   4820  C CB    . ILE B 1 46  ? 62.356  14.337  67.228 1.00 47.94 ? 2078 ILE B CB    1 
ATOM   4821  C CG1   . ILE B 1 46  ? 62.078  14.311  68.738 1.00 48.50 ? 2078 ILE B CG1   1 
ATOM   4822  C CG2   . ILE B 1 46  ? 62.334  12.925  66.635 1.00 46.24 ? 2078 ILE B CG2   1 
ATOM   4823  C CD1   . ILE B 1 46  ? 63.272  13.941  69.626 1.00 49.37 ? 2078 ILE B CD1   1 
ATOM   4824  N N     . LYS B 1 47  ? 63.228  15.352  64.593 1.00 45.24 ? 2079 LYS B N     1 
ATOM   4825  C CA    . LYS B 1 47  ? 63.436  15.230  63.154 1.00 45.22 ? 2079 LYS B CA    1 
ATOM   4826  C C     . LYS B 1 47  ? 64.824  15.637  62.668 1.00 45.19 ? 2079 LYS B C     1 
ATOM   4827  O O     . LYS B 1 47  ? 65.450  14.902  61.912 1.00 45.08 ? 2079 LYS B O     1 
ATOM   4828  C CB    . LYS B 1 47  ? 62.383  16.047  62.397 1.00 46.98 ? 2079 LYS B CB    1 
ATOM   4829  C CG    . LYS B 1 47  ? 60.942  15.502  62.482 1.00 49.72 ? 2079 LYS B CG    1 
ATOM   4830  C CD    . LYS B 1 47  ? 60.866  14.114  63.155 1.00 51.08 ? 2079 LYS B CD    1 
ATOM   4831  C CE    . LYS B 1 47  ? 59.508  13.434  62.954 1.00 51.52 ? 2079 LYS B CE    1 
ATOM   4832  N NZ    . LYS B 1 47  ? 59.390  12.222  63.814 1.00 51.21 ? 2079 LYS B NZ    1 
ATOM   4833  N N     . LEU B 1 48  ? 65.289  16.810  63.091 1.00 44.44 ? 2080 LEU B N     1 
ATOM   4834  C CA    . LEU B 1 48  ? 66.603  17.340  62.708 1.00 44.01 ? 2080 LEU B CA    1 
ATOM   4835  C C     . LEU B 1 48  ? 67.740  16.389  63.041 1.00 43.75 ? 2080 LEU B C     1 
ATOM   4836  O O     . LEU B 1 48  ? 68.721  16.274  62.307 1.00 43.23 ? 2080 LEU B O     1 
ATOM   4837  C CB    . LEU B 1 48  ? 66.861  18.663  63.431 1.00 44.49 ? 2080 LEU B CB    1 
ATOM   4838  C CG    . LEU B 1 48  ? 66.109  19.909  62.958 1.00 44.11 ? 2080 LEU B CG    1 
ATOM   4839  C CD1   . LEU B 1 48  ? 66.394  21.075  63.906 1.00 43.74 ? 2080 LEU B CD1   1 
ATOM   4840  C CD2   . LEU B 1 48  ? 66.530  20.249  61.535 1.00 44.79 ? 2080 LEU B CD2   1 
ATOM   4841  N N     . LEU B 1 49  ? 67.601  15.731  64.178 1.00 44.23 ? 2081 LEU B N     1 
ATOM   4842  C CA    . LEU B 1 49  ? 68.592  14.785  64.655 1.00 45.18 ? 2081 LEU B CA    1 
ATOM   4843  C C     . LEU B 1 49  ? 68.623  13.523  63.804 1.00 43.41 ? 2081 LEU B C     1 
ATOM   4844  O O     . LEU B 1 49  ? 69.616  12.809  63.774 1.00 42.97 ? 2081 LEU B O     1 
ATOM   4845  C CB    . LEU B 1 49  ? 68.266  14.409  66.101 1.00 47.79 ? 2081 LEU B CB    1 
ATOM   4846  C CG    . LEU B 1 49  ? 69.445  14.077  67.007 1.00 48.98 ? 2081 LEU B CG    1 
ATOM   4847  C CD1   . LEU B 1 49  ? 70.415  15.264  67.069 1.00 49.99 ? 2081 LEU B CD1   1 
ATOM   4848  C CD2   . LEU B 1 49  ? 68.903  13.723  68.388 1.00 50.95 ? 2081 LEU B CD2   1 
ATOM   4849  N N     . LEU B 1 50  ? 67.534  13.267  63.098 1.00 43.11 ? 2082 LEU B N     1 
ATOM   4850  C CA    . LEU B 1 50  ? 67.425  12.070  62.277 1.00 41.60 ? 2082 LEU B CA    1 
ATOM   4851  C C     . LEU B 1 50  ? 67.584  12.281  60.778 1.00 40.91 ? 2082 LEU B C     1 
ATOM   4852  O O     . LEU B 1 50  ? 67.524  11.333  60.003 1.00 40.08 ? 2082 LEU B O     1 
ATOM   4853  C CB    . LEU B 1 50  ? 66.080  11.404  62.556 1.00 42.49 ? 2082 LEU B CB    1 
ATOM   4854  C CG    . LEU B 1 50  ? 66.053  10.562  63.833 1.00 42.07 ? 2082 LEU B CG    1 
ATOM   4855  C CD1   . LEU B 1 50  ? 66.484  11.408  65.028 1.00 42.40 ? 2082 LEU B CD1   1 
ATOM   4856  C CD2   . LEU B 1 50  ? 64.657  10.009  64.031 1.00 40.94 ? 2082 LEU B CD2   1 
ATOM   4857  N N     . LYS B 1 51  ? 67.772  13.520  60.360 1.00 40.60 ? 2083 LYS B N     1 
ATOM   4858  C CA    . LYS B 1 51  ? 67.929  13.789  58.947 1.00 40.01 ? 2083 LYS B CA    1 
ATOM   4859  C C     . LYS B 1 51  ? 69.408  13.787  58.590 1.00 39.65 ? 2083 LYS B C     1 
ATOM   4860  O O     . LYS B 1 51  ? 70.199  14.551  59.147 1.00 40.97 ? 2083 LYS B O     1 
ATOM   4861  C CB    . LYS B 1 51  ? 67.298  15.136  58.596 1.00 41.49 ? 2083 LYS B CB    1 
ATOM   4862  C CG    . LYS B 1 51  ? 67.315  15.457  57.125 1.00 43.03 ? 2083 LYS B CG    1 
ATOM   4863  C CD    . LYS B 1 51  ? 67.171  16.940  56.926 1.00 46.59 ? 2083 LYS B CD    1 
ATOM   4864  C CE    . LYS B 1 51  ? 67.954  17.417  55.721 1.00 51.53 ? 2083 LYS B CE    1 
ATOM   4865  N NZ    . LYS B 1 51  ? 67.522  18.785  55.319 1.00 53.54 ? 2083 LYS B NZ    1 
ATOM   4866  N N     . PRO B 1 52  ? 69.808  12.905  57.669 1.00 37.05 ? 2084 PRO B N     1 
ATOM   4867  C CA    . PRO B 1 52  ? 71.208  12.831  57.254 1.00 36.83 ? 2084 PRO B CA    1 
ATOM   4868  C C     . PRO B 1 52  ? 71.473  13.961  56.273 1.00 35.40 ? 2084 PRO B C     1 
ATOM   4869  O O     . PRO B 1 52  ? 70.569  14.389  55.569 1.00 35.28 ? 2084 PRO B O     1 
ATOM   4870  C CB    . PRO B 1 52  ? 71.305  11.470  56.592 1.00 36.74 ? 2084 PRO B CB    1 
ATOM   4871  C CG    . PRO B 1 52  ? 69.942  11.245  56.037 1.00 36.00 ? 2084 PRO B CG    1 
ATOM   4872  C CD    . PRO B 1 52  ? 68.969  11.922  56.965 1.00 37.61 ? 2084 PRO B CD    1 
ATOM   4873  N N     . THR B 1 53  ? 72.704  14.448  56.226 1.00 34.24 ? 2085 THR B N     1 
ATOM   4874  C CA    . THR B 1 53  ? 73.047  15.533  55.318 1.00 31.38 ? 2085 THR B CA    1 
ATOM   4875  C C     . THR B 1 53  ? 73.052  15.098  53.857 1.00 30.72 ? 2085 THR B C     1 
ATOM   4876  O O     . THR B 1 53  ? 73.185  13.917  53.537 1.00 29.65 ? 2085 THR B O     1 
ATOM   4877  C CB    . THR B 1 53  ? 74.434  16.094  55.652 1.00 32.69 ? 2085 THR B CB    1 
ATOM   4878  O OG1   . THR B 1 53  ? 75.448  15.229  55.111 1.00 31.01 ? 2085 THR B OG1   1 
ATOM   4879  C CG2   . THR B 1 53  ? 74.595  16.202  57.153 1.00 28.45 ? 2085 THR B CG2   1 
ATOM   4880  N N     . PRO B 1 54  ? 72.873  16.054  52.945 1.00 28.23 ? 2086 PRO B N     1 
ATOM   4881  C CA    . PRO B 1 54  ? 72.880  15.704  51.529 1.00 28.26 ? 2086 PRO B CA    1 
ATOM   4882  C C     . PRO B 1 54  ? 74.145  14.949  51.123 1.00 28.66 ? 2086 PRO B C     1 
ATOM   4883  O O     . PRO B 1 54  ? 74.094  14.037  50.309 1.00 28.39 ? 2086 PRO B O     1 
ATOM   4884  C CB    . PRO B 1 54  ? 72.765  17.059  50.834 1.00 27.46 ? 2086 PRO B CB    1 
ATOM   4885  C CG    . PRO B 1 54  ? 72.042  17.923  51.829 1.00 26.48 ? 2086 PRO B CG    1 
ATOM   4886  C CD    . PRO B 1 54  ? 72.589  17.484  53.157 1.00 27.87 ? 2086 PRO B CD    1 
ATOM   4887  N N     . ASN B 1 55  ? 75.281  15.309  51.709 1.00 28.76 ? 2087 ASN B N     1 
ATOM   4888  C CA    . ASN B 1 55  ? 76.539  14.661  51.362 1.00 28.47 ? 2087 ASN B CA    1 
ATOM   4889  C C     . ASN B 1 55  ? 76.621  13.232  51.845 1.00 29.44 ? 2087 ASN B C     1 
ATOM   4890  O O     . ASN B 1 55  ? 77.255  12.389  51.214 1.00 27.27 ? 2087 ASN B O     1 
ATOM   4891  C CB    . ASN B 1 55  ? 77.701  15.453  51.926 1.00 30.15 ? 2087 ASN B CB    1 
ATOM   4892  C CG    . ASN B 1 55  ? 77.865  16.786  51.247 1.00 29.33 ? 2087 ASN B CG    1 
ATOM   4893  O OD1   . ASN B 1 55  ? 77.550  16.937  50.068 1.00 30.05 ? 2087 ASN B OD1   1 
ATOM   4894  N ND2   . ASN B 1 55  ? 78.357  17.766  51.989 1.00 29.94 ? 2087 ASN B ND2   1 
ATOM   4895  N N     . THR B 1 56  ? 75.988  12.964  52.981 1.00 29.85 ? 2088 THR B N     1 
ATOM   4896  C CA    . THR B 1 56  ? 75.964  11.617  53.525 1.00 30.19 ? 2088 THR B CA    1 
ATOM   4897  C C     . THR B 1 56  ? 75.120  10.762  52.592 1.00 31.18 ? 2088 THR B C     1 
ATOM   4898  O O     . THR B 1 56  ? 75.497  9.640   52.221 1.00 30.84 ? 2088 THR B O     1 
ATOM   4899  C CB    . THR B 1 56  ? 75.315  11.601  54.888 1.00 30.88 ? 2088 THR B CB    1 
ATOM   4900  O OG1   . THR B 1 56  ? 76.021  12.499  55.753 1.00 33.20 ? 2088 THR B OG1   1 
ATOM   4901  C CG2   . THR B 1 56  ? 75.335  10.206  55.457 1.00 29.84 ? 2088 THR B CG2   1 
ATOM   4902  N N     . VAL B 1 57  ? 73.972  11.309  52.205 1.00 30.10 ? 2089 VAL B N     1 
ATOM   4903  C CA    . VAL B 1 57  ? 73.064  10.612  51.310 1.00 29.99 ? 2089 VAL B CA    1 
ATOM   4904  C C     . VAL B 1 57  ? 73.706  10.421  49.943 1.00 28.70 ? 2089 VAL B C     1 
ATOM   4905  O O     . VAL B 1 57  ? 73.581  9.364   49.325 1.00 28.41 ? 2089 VAL B O     1 
ATOM   4906  C CB    . VAL B 1 57  ? 71.743  11.388  51.141 1.00 31.58 ? 2089 VAL B CB    1 
ATOM   4907  C CG1   . VAL B 1 57  ? 70.853  10.683  50.142 1.00 30.97 ? 2089 VAL B CG1   1 
ATOM   4908  C CG2   . VAL B 1 57  ? 71.029  11.496  52.475 1.00 32.08 ? 2089 VAL B CG2   1 
ATOM   4909  N N     . HIS B 1 58  ? 74.399  11.448  49.469 1.00 28.56 ? 2090 HIS B N     1 
ATOM   4910  C CA    . HIS B 1 58  ? 75.061  11.360  48.175 1.00 27.32 ? 2090 HIS B CA    1 
ATOM   4911  C C     . HIS B 1 58  ? 76.129  10.283  48.218 1.00 28.65 ? 2090 HIS B C     1 
ATOM   4912  O O     . HIS B 1 58  ? 76.359  9.572   47.245 1.00 28.14 ? 2090 HIS B O     1 
ATOM   4913  C CB    . HIS B 1 58  ? 75.721  12.682  47.823 1.00 26.94 ? 2090 HIS B CB    1 
ATOM   4914  C CG    . HIS B 1 58  ? 76.608  12.596  46.619 1.00 27.67 ? 2090 HIS B CG    1 
ATOM   4915  N ND1   . HIS B 1 58  ? 76.133  12.739  45.338 1.00 28.20 ? 2090 HIS B ND1   1 
ATOM   4916  C CD2   . HIS B 1 58  ? 77.935  12.375  46.513 1.00 27.21 ? 2090 HIS B CD2   1 
ATOM   4917  C CE1   . HIS B 1 58  ? 77.132  12.605  44.483 1.00 28.98 ? 2090 HIS B CE1   1 
ATOM   4918  N NE2   . HIS B 1 58  ? 78.236  12.387  45.176 1.00 28.61 ? 2090 HIS B NE2   1 
ATOM   4919  N N     . TYR B 1 59  ? 76.788  10.176  49.363 1.00 30.50 ? 2091 TYR B N     1 
ATOM   4920  C CA    . TYR B 1 59  ? 77.837  9.190   49.534 1.00 30.84 ? 2091 TYR B CA    1 
ATOM   4921  C C     . TYR B 1 59  ? 77.238  7.795   49.403 1.00 30.51 ? 2091 TYR B C     1 
ATOM   4922  O O     . TYR B 1 59  ? 77.669  6.989   48.582 1.00 31.26 ? 2091 TYR B O     1 
ATOM   4923  C CB    . TYR B 1 59  ? 78.492  9.360   50.904 1.00 32.78 ? 2091 TYR B CB    1 
ATOM   4924  C CG    . TYR B 1 59  ? 79.502  8.289   51.207 1.00 35.21 ? 2091 TYR B CG    1 
ATOM   4925  C CD1   . TYR B 1 59  ? 80.861  8.541   51.098 1.00 35.78 ? 2091 TYR B CD1   1 
ATOM   4926  C CD2   . TYR B 1 59  ? 79.095  7.005   51.566 1.00 37.63 ? 2091 TYR B CD2   1 
ATOM   4927  C CE1   . TYR B 1 59  ? 81.796  7.539   51.333 1.00 36.54 ? 2091 TYR B CE1   1 
ATOM   4928  C CE2   . TYR B 1 59  ? 80.017  5.995   51.801 1.00 37.87 ? 2091 TYR B CE2   1 
ATOM   4929  C CZ    . TYR B 1 59  ? 81.364  6.267   51.681 1.00 37.72 ? 2091 TYR B CZ    1 
ATOM   4930  O OH    . TYR B 1 59  ? 82.270  5.254   51.894 1.00 39.04 ? 2091 TYR B OH    1 
ATOM   4931  N N     . ILE B 1 60  ? 76.233  7.518   50.217 1.00 29.58 ? 2092 ILE B N     1 
ATOM   4932  C CA    . ILE B 1 60  ? 75.586  6.219   50.196 1.00 29.14 ? 2092 ILE B CA    1 
ATOM   4933  C C     . ILE B 1 60  ? 75.095  5.816   48.804 1.00 28.88 ? 2092 ILE B C     1 
ATOM   4934  O O     . ILE B 1 60  ? 75.246  4.663   48.395 1.00 30.00 ? 2092 ILE B O     1 
ATOM   4935  C CB    . ILE B 1 60  ? 74.404  6.212   51.174 1.00 28.75 ? 2092 ILE B CB    1 
ATOM   4936  C CG1   . ILE B 1 60  ? 74.912  6.513   52.583 1.00 27.82 ? 2092 ILE B CG1   1 
ATOM   4937  C CG2   . ILE B 1 60  ? 73.694  4.890   51.127 1.00 27.16 ? 2092 ILE B CG2   1 
ATOM   4938  C CD1   . ILE B 1 60  ? 73.835  6.682   53.598 1.00 26.96 ? 2092 ILE B CD1   1 
ATOM   4939  N N     . LEU B 1 61  ? 74.512  6.772   48.084 1.00 29.14 ? 2093 LEU B N     1 
ATOM   4940  C CA    . LEU B 1 61  ? 73.971  6.547   46.738 1.00 28.17 ? 2093 LEU B CA    1 
ATOM   4941  C C     . LEU B 1 61  ? 75.069  6.279   45.700 1.00 28.42 ? 2093 LEU B C     1 
ATOM   4942  O O     . LEU B 1 61  ? 74.813  5.709   44.636 1.00 27.62 ? 2093 LEU B O     1 
ATOM   4943  C CB    . LEU B 1 61  ? 73.164  7.777   46.313 1.00 26.43 ? 2093 LEU B CB    1 
ATOM   4944  C CG    . LEU B 1 61  ? 71.650  7.760   46.109 1.00 25.40 ? 2093 LEU B CG    1 
ATOM   4945  C CD1   . LEU B 1 61  ? 71.019  6.494   46.606 1.00 26.04 ? 2093 LEU B CD1   1 
ATOM   4946  C CD2   . LEU B 1 61  ? 71.074  8.943   46.830 1.00 24.06 ? 2093 LEU B CD2   1 
ATOM   4947  N N     . THR B 1 62  ? 76.292  6.702   46.016 1.00 29.87 ? 2094 THR B N     1 
ATOM   4948  C CA    . THR B 1 62  ? 77.429  6.524   45.109 1.00 29.59 ? 2094 THR B CA    1 
ATOM   4949  C C     . THR B 1 62  ? 78.436  5.484   45.568 1.00 29.82 ? 2094 THR B C     1 
ATOM   4950  O O     . THR B 1 62  ? 79.558  5.462   45.087 1.00 31.20 ? 2094 THR B O     1 
ATOM   4951  C CB    . THR B 1 62  ? 78.182  7.851   44.879 1.00 27.81 ? 2094 THR B CB    1 
ATOM   4952  O OG1   . THR B 1 62  ? 78.475  8.454   46.146 1.00 26.46 ? 2094 THR B OG1   1 
ATOM   4953  C CG2   . THR B 1 62  ? 77.337  8.808   44.022 1.00 24.02 ? 2094 THR B CG2   1 
ATOM   4954  N N     . HIS B 1 63  ? 78.037  4.620   46.492 1.00 31.48 ? 2095 HIS B N     1 
ATOM   4955  C CA    . HIS B 1 63  ? 78.915  3.562   46.989 1.00 33.25 ? 2095 HIS B CA    1 
ATOM   4956  C C     . HIS B 1 63  ? 78.067  2.319   47.158 1.00 33.82 ? 2095 HIS B C     1 
ATOM   4957  O O     . HIS B 1 63  ? 76.881  2.337   46.847 1.00 33.63 ? 2095 HIS B O     1 
ATOM   4958  C CB    . HIS B 1 63  ? 79.539  3.951   48.337 1.00 32.24 ? 2095 HIS B CB    1 
ATOM   4959  C CG    . HIS B 1 63  ? 80.564  5.032   48.231 1.00 32.09 ? 2095 HIS B CG    1 
ATOM   4960  N ND1   . HIS B 1 63  ? 80.280  6.359   48.475 1.00 32.83 ? 2095 HIS B ND1   1 
ATOM   4961  C CD2   . HIS B 1 63  ? 81.859  4.996   47.838 1.00 32.08 ? 2095 HIS B CD2   1 
ATOM   4962  C CE1   . HIS B 1 63  ? 81.347  7.091   48.233 1.00 32.67 ? 2095 HIS B CE1   1 
ATOM   4963  N NE2   . HIS B 1 63  ? 82.322  6.291   47.845 1.00 31.64 ? 2095 HIS B NE2   1 
ATOM   4964  N N     . PHE B 1 64  ? 78.670  1.240   47.652 1.00 36.48 ? 2096 PHE B N     1 
ATOM   4965  C CA    . PHE B 1 64  ? 77.937  -0.001  47.864 1.00 38.37 ? 2096 PHE B CA    1 
ATOM   4966  C C     . PHE B 1 64  ? 77.272  -0.391  46.563 1.00 39.57 ? 2096 PHE B C     1 
ATOM   4967  O O     . PHE B 1 64  ? 76.116  -0.808  46.543 1.00 39.88 ? 2096 PHE B O     1 
ATOM   4968  C CB    . PHE B 1 64  ? 76.867  0.186   48.946 1.00 38.96 ? 2096 PHE B CB    1 
ATOM   4969  C CG    . PHE B 1 64  ? 77.308  1.062   50.091 1.00 40.31 ? 2096 PHE B CG    1 
ATOM   4970  C CD1   . PHE B 1 64  ? 77.064  2.437   50.070 1.00 40.12 ? 2096 PHE B CD1   1 
ATOM   4971  C CD2   . PHE B 1 64  ? 77.972  0.514   51.189 1.00 41.21 ? 2096 PHE B CD2   1 
ATOM   4972  C CE1   . PHE B 1 64  ? 77.474  3.259   51.125 1.00 41.38 ? 2096 PHE B CE1   1 
ATOM   4973  C CE2   . PHE B 1 64  ? 78.387  1.324   52.250 1.00 40.73 ? 2096 PHE B CE2   1 
ATOM   4974  C CZ    . PHE B 1 64  ? 78.136  2.701   52.217 1.00 41.78 ? 2096 PHE B CZ    1 
ATOM   4975  N N     . LYS B 1 65  ? 78.006  -0.242  45.470 1.00 41.53 ? 2097 LYS B N     1 
ATOM   4976  C CA    . LYS B 1 65  ? 77.475  -0.576  44.165 1.00 42.99 ? 2097 LYS B CA    1 
ATOM   4977  C C     . LYS B 1 65  ? 76.856  -1.968  44.155 1.00 43.31 ? 2097 LYS B C     1 
ATOM   4978  O O     . LYS B 1 65  ? 75.878  -2.226  43.451 1.00 43.36 ? 2097 LYS B O     1 
ATOM   4979  C CB    . LYS B 1 65  ? 78.579  -0.507  43.124 1.00 45.53 ? 2097 LYS B CB    1 
ATOM   4980  C CG    . LYS B 1 65  ? 78.057  -0.645  41.719 1.00 47.83 ? 2097 LYS B CG    1 
ATOM   4981  C CD    . LYS B 1 65  ? 79.093  -0.212  40.708 1.00 50.59 ? 2097 LYS B CD    1 
ATOM   4982  C CE    . LYS B 1 65  ? 78.719  -0.713  39.327 1.00 52.80 ? 2097 LYS B CE    1 
ATOM   4983  N NZ    . LYS B 1 65  ? 79.906  -0.873  38.439 1.00 53.34 ? 2097 LYS B NZ    1 
ATOM   4984  N N     . GLY B 1 66  ? 77.428  -2.859  44.956 1.00 43.46 ? 2098 GLY B N     1 
ATOM   4985  C CA    . GLY B 1 66  ? 76.945  -4.225  45.023 1.00 41.97 ? 2098 GLY B CA    1 
ATOM   4986  C C     . GLY B 1 66  ? 75.517  -4.376  45.498 1.00 41.13 ? 2098 GLY B C     1 
ATOM   4987  O O     . GLY B 1 66  ? 74.742  -5.135  44.914 1.00 40.86 ? 2098 GLY B O     1 
ATOM   4988  N N     . VAL B 1 67  ? 75.166  -3.672  46.568 1.00 40.97 ? 2099 VAL B N     1 
ATOM   4989  C CA    . VAL B 1 67  ? 73.810  -3.746  47.100 1.00 40.46 ? 2099 VAL B CA    1 
ATOM   4990  C C     . VAL B 1 67  ? 72.864  -2.994  46.171 1.00 39.27 ? 2099 VAL B C     1 
ATOM   4991  O O     . VAL B 1 67  ? 71.720  -3.402  45.969 1.00 39.95 ? 2099 VAL B O     1 
ATOM   4992  C CB    . VAL B 1 67  ? 73.721  -3.162  48.538 1.00 41.29 ? 2099 VAL B CB    1 
ATOM   4993  C CG1   . VAL B 1 67  ? 75.067  -2.658  48.977 1.00 42.14 ? 2099 VAL B CG1   1 
ATOM   4994  C CG2   . VAL B 1 67  ? 72.696  -2.050  48.602 1.00 42.56 ? 2099 VAL B CG2   1 
ATOM   4995  N N     . TRP B 1 68  ? 73.348  -1.897  45.598 1.00 38.44 ? 2100 TRP B N     1 
ATOM   4996  C CA    . TRP B 1 68  ? 72.532  -1.118  44.677 1.00 36.69 ? 2100 TRP B CA    1 
ATOM   4997  C C     . TRP B 1 68  ? 72.152  -2.006  43.508 1.00 37.42 ? 2100 TRP B C     1 
ATOM   4998  O O     . TRP B 1 68  ? 71.133  -1.803  42.856 1.00 38.16 ? 2100 TRP B O     1 
ATOM   4999  C CB    . TRP B 1 68  ? 73.316  0.091   44.181 1.00 32.22 ? 2100 TRP B CB    1 
ATOM   5000  C CG    . TRP B 1 68  ? 73.306  1.173   45.176 1.00 27.93 ? 2100 TRP B CG    1 
ATOM   5001  C CD1   . TRP B 1 68  ? 74.382  1.809   45.707 1.00 27.49 ? 2100 TRP B CD1   1 
ATOM   5002  C CD2   . TRP B 1 68  ? 72.156  1.709   45.832 1.00 26.33 ? 2100 TRP B CD2   1 
ATOM   5003  N NE1   . TRP B 1 68  ? 73.979  2.712   46.664 1.00 25.64 ? 2100 TRP B NE1   1 
ATOM   5004  C CE2   . TRP B 1 68  ? 72.617  2.667   46.762 1.00 25.58 ? 2100 TRP B CE2   1 
ATOM   5005  C CE3   . TRP B 1 68  ? 70.774  1.465   45.725 1.00 24.89 ? 2100 TRP B CE3   1 
ATOM   5006  C CZ2   . TRP B 1 68  ? 71.747  3.389   47.585 1.00 24.42 ? 2100 TRP B CZ2   1 
ATOM   5007  C CZ3   . TRP B 1 68  ? 69.908  2.184   46.545 1.00 24.06 ? 2100 TRP B CZ3   1 
ATOM   5008  C CH2   . TRP B 1 68  ? 70.400  3.134   47.465 1.00 24.07 ? 2100 TRP B CH2   1 
ATOM   5009  N N     . ASN B 1 69  ? 72.985  -3.006  43.257 1.00 39.39 ? 2101 ASN B N     1 
ATOM   5010  C CA    . ASN B 1 69  ? 72.747  -3.924  42.166 1.00 41.25 ? 2101 ASN B CA    1 
ATOM   5011  C C     . ASN B 1 69  ? 71.548  -4.798  42.448 1.00 41.30 ? 2101 ASN B C     1 
ATOM   5012  O O     . ASN B 1 69  ? 70.691  -4.994  41.588 1.00 41.40 ? 2101 ASN B O     1 
ATOM   5013  C CB    . ASN B 1 69  ? 73.971  -4.791  41.953 1.00 43.93 ? 2101 ASN B CB    1 
ATOM   5014  C CG    . ASN B 1 69  ? 74.579  -4.580  40.613 1.00 46.50 ? 2101 ASN B CG    1 
ATOM   5015  O OD1   . ASN B 1 69  ? 75.637  -3.958  40.490 1.00 48.71 ? 2101 ASN B OD1   1 
ATOM   5016  N ND2   . ASN B 1 69  ? 73.908  -5.085  39.578 1.00 49.42 ? 2101 ASN B ND2   1 
ATOM   5017  N N     . ILE B 1 70  ? 71.489  -5.329  43.661 1.00 41.74 ? 2102 ILE B N     1 
ATOM   5018  C CA    . ILE B 1 70  ? 70.377  -6.181  44.034 1.00 41.03 ? 2102 ILE B CA    1 
ATOM   5019  C C     . ILE B 1 70  ? 69.110  -5.319  44.042 1.00 39.90 ? 2102 ILE B C     1 
ATOM   5020  O O     . ILE B 1 70  ? 68.069  -5.710  43.503 1.00 38.85 ? 2102 ILE B O     1 
ATOM   5021  C CB    . ILE B 1 70  ? 70.611  -6.839  45.435 1.00 43.19 ? 2102 ILE B CB    1 
ATOM   5022  C CG1   . ILE B 1 70  ? 70.078  -5.928  46.545 1.00 43.81 ? 2102 ILE B CG1   1 
ATOM   5023  C CG2   . ILE B 1 70  ? 72.109  -7.141  45.634 1.00 41.34 ? 2102 ILE B CG2   1 
ATOM   5024  C CD1   . ILE B 1 70  ? 70.047  -6.574  47.917 1.00 47.66 ? 2102 ILE B CD1   1 
ATOM   5025  N N     . VAL B 1 71  ? 69.222  -4.128  44.626 1.00 38.34 ? 2103 VAL B N     1 
ATOM   5026  C CA    . VAL B 1 71  ? 68.098  -3.211  44.715 1.00 37.27 ? 2103 VAL B CA    1 
ATOM   5027  C C     . VAL B 1 71  ? 67.586  -2.872  43.331 1.00 35.70 ? 2103 VAL B C     1 
ATOM   5028  O O     . VAL B 1 71  ? 66.388  -2.963  43.058 1.00 34.91 ? 2103 VAL B O     1 
ATOM   5029  C CB    . VAL B 1 71  ? 68.505  -1.913  45.408 1.00 36.69 ? 2103 VAL B CB    1 
ATOM   5030  C CG1   . VAL B 1 71  ? 67.375  -0.901  45.330 1.00 35.01 ? 2103 VAL B CG1   1 
ATOM   5031  C CG2   . VAL B 1 71  ? 68.894  -2.208  46.841 1.00 35.34 ? 2103 VAL B CG2   1 
ATOM   5032  N N     . ASN B 1 72  ? 68.507  -2.489  42.455 1.00 35.10 ? 2104 ASN B N     1 
ATOM   5033  C CA    . ASN B 1 72  ? 68.150  -2.121  41.089 1.00 35.75 ? 2104 ASN B CA    1 
ATOM   5034  C C     . ASN B 1 72  ? 67.389  -3.231  40.384 1.00 36.56 ? 2104 ASN B C     1 
ATOM   5035  O O     . ASN B 1 72  ? 66.752  -3.004  39.352 1.00 36.63 ? 2104 ASN B O     1 
ATOM   5036  C CB    . ASN B 1 72  ? 69.404  -1.773  40.290 1.00 33.88 ? 2104 ASN B CB    1 
ATOM   5037  C CG    . ASN B 1 72  ? 69.897  -0.369  40.570 1.00 33.45 ? 2104 ASN B CG    1 
ATOM   5038  O OD1   . ASN B 1 72  ? 69.238  0.409   41.265 1.00 31.08 ? 2104 ASN B OD1   1 
ATOM   5039  N ND2   . ASN B 1 72  ? 71.061  -0.039  40.032 1.00 32.27 ? 2104 ASN B ND2   1 
ATOM   5040  N N     . ASN B 1 73  ? 67.462  -4.435  40.950 1.00 37.87 ? 2105 ASN B N     1 
ATOM   5041  C CA    . ASN B 1 73  ? 66.788  -5.593  40.376 1.00 37.89 ? 2105 ASN B CA    1 
ATOM   5042  C C     . ASN B 1 73  ? 65.619  -6.117  41.201 1.00 38.89 ? 2105 ASN B C     1 
ATOM   5043  O O     . ASN B 1 73  ? 65.069  -7.173  40.909 1.00 38.76 ? 2105 ASN B O     1 
ATOM   5044  C CB    . ASN B 1 73  ? 67.791  -6.708  40.138 1.00 37.72 ? 2105 ASN B CB    1 
ATOM   5045  C CG    . ASN B 1 73  ? 68.670  -6.425  38.963 1.00 37.56 ? 2105 ASN B CG    1 
ATOM   5046  O OD1   . ASN B 1 73  ? 68.215  -6.431  37.828 1.00 39.16 ? 2105 ASN B OD1   1 
ATOM   5047  N ND2   . ASN B 1 73  ? 69.935  -6.157  39.222 1.00 38.47 ? 2105 ASN B ND2   1 
ATOM   5048  N N     . ILE B 1 74  B 65.251  -5.377  42.238 1.00 39.20 ? 105  ILE B N     1 
ATOM   5049  C CA    . ILE B 1 74  B 64.124  -5.739  43.077 1.00 38.77 ? 105  ILE B CA    1 
ATOM   5050  C C     . ILE B 1 74  B 63.135  -4.599  42.898 1.00 37.71 ? 105  ILE B C     1 
ATOM   5051  O O     . ILE B 1 74  B 63.110  -3.644  43.682 1.00 37.62 ? 105  ILE B O     1 
ATOM   5052  C CB    . ILE B 1 74  B 64.523  -5.854  44.558 1.00 41.01 ? 105  ILE B CB    1 
ATOM   5053  C CG1   . ILE B 1 74  B 65.376  -7.110  44.768 1.00 41.51 ? 105  ILE B CG1   1 
ATOM   5054  C CG2   . ILE B 1 74  B 63.275  -5.907  45.442 1.00 40.97 ? 105  ILE B CG2   1 
ATOM   5055  C CD1   . ILE B 1 74  B 66.244  -7.059  46.015 1.00 42.00 ? 105  ILE B CD1   1 
ATOM   5056  N N     . PRO B 1 75  ? 62.323  -4.680  41.832 1.00 37.19 ? 2106 PRO B N     1 
ATOM   5057  C CA    . PRO B 1 75  ? 61.301  -3.699  41.466 1.00 35.55 ? 2106 PRO B CA    1 
ATOM   5058  C C     . PRO B 1 75  ? 60.671  -3.041  42.667 1.00 35.01 ? 2106 PRO B C     1 
ATOM   5059  O O     . PRO B 1 75  ? 60.627  -1.821  42.766 1.00 35.39 ? 2106 PRO B O     1 
ATOM   5060  C CB    . PRO B 1 75  ? 60.301  -4.521  40.682 1.00 36.01 ? 2106 PRO B CB    1 
ATOM   5061  C CG    . PRO B 1 75  ? 61.152  -5.572  40.016 1.00 36.25 ? 2106 PRO B CG    1 
ATOM   5062  C CD    . PRO B 1 75  ? 62.352  -5.808  40.883 1.00 36.32 ? 2106 PRO B CD    1 
ATOM   5063  N N     . PHE B 1 76  ? 60.182  -3.855  43.584 1.00 34.86 ? 2107 PHE B N     1 
ATOM   5064  C CA    . PHE B 1 76  ? 59.566  -3.323  44.785 1.00 35.14 ? 2107 PHE B CA    1 
ATOM   5065  C C     . PHE B 1 76  ? 60.507  -2.397  45.534 1.00 34.19 ? 2107 PHE B C     1 
ATOM   5066  O O     . PHE B 1 76  ? 60.110  -1.334  46.018 1.00 34.62 ? 2107 PHE B O     1 
ATOM   5067  C CB    . PHE B 1 76  ? 59.166  -4.449  45.722 1.00 38.08 ? 2107 PHE B CB    1 
ATOM   5068  C CG    . PHE B 1 76  ? 58.447  -3.972  46.939 1.00 40.94 ? 2107 PHE B CG    1 
ATOM   5069  C CD1   . PHE B 1 76  ? 57.118  -3.559  46.851 1.00 43.75 ? 2107 PHE B CD1   1 
ATOM   5070  C CD2   . PHE B 1 76  ? 59.100  -3.903  48.168 1.00 41.49 ? 2107 PHE B CD2   1 
ATOM   5071  C CE1   . PHE B 1 76  ? 56.442  -3.080  47.972 1.00 46.66 ? 2107 PHE B CE1   1 
ATOM   5072  C CE2   . PHE B 1 76  ? 58.441  -3.427  49.299 1.00 44.60 ? 2107 PHE B CE2   1 
ATOM   5073  C CZ    . PHE B 1 76  ? 57.107  -3.012  49.205 1.00 46.54 ? 2107 PHE B CZ    1 
ATOM   5074  N N     . LEU B 1 77  ? 61.757  -2.831  45.650 1.00 34.10 ? 2108 LEU B N     1 
ATOM   5075  C CA    . LEU B 1 77  ? 62.779  -2.072  46.348 1.00 32.27 ? 2108 LEU B CA    1 
ATOM   5076  C C     . LEU B 1 77  ? 63.119  -0.808  45.598 1.00 31.04 ? 2108 LEU B C     1 
ATOM   5077  O O     . LEU B 1 77  ? 63.161  0.284   46.171 1.00 30.19 ? 2108 LEU B O     1 
ATOM   5078  C CB    . LEU B 1 77  ? 64.023  -2.927  46.485 1.00 32.62 ? 2108 LEU B CB    1 
ATOM   5079  C CG    . LEU B 1 77  ? 64.156  -3.651  47.814 1.00 32.54 ? 2108 LEU B CG    1 
ATOM   5080  C CD1   . LEU B 1 77  ? 65.524  -4.303  47.867 1.00 32.28 ? 2108 LEU B CD1   1 
ATOM   5081  C CD2   . LEU B 1 77  ? 63.961  -2.658  48.959 1.00 33.18 ? 2108 LEU B CD2   1 
ATOM   5082  N N     . ARG B 1 78  ? 63.362  -0.972  44.305 1.00 31.29 ? 2109 ARG B N     1 
ATOM   5083  C CA    . ARG B 1 78  ? 63.706  0.146   43.449 1.00 32.30 ? 2109 ARG B CA    1 
ATOM   5084  C C     . ARG B 1 78  ? 62.634  1.231   43.536 1.00 32.05 ? 2109 ARG B C     1 
ATOM   5085  O O     . ARG B 1 78  ? 62.953  2.417   43.656 1.00 33.48 ? 2109 ARG B O     1 
ATOM   5086  C CB    . ARG B 1 78  ? 63.848  -0.336  42.014 1.00 32.52 ? 2109 ARG B CB    1 
ATOM   5087  C CG    . ARG B 1 78  ? 64.701  0.564   41.153 1.00 32.46 ? 2109 ARG B CG    1 
ATOM   5088  C CD    . ARG B 1 78  ? 64.494  0.248   39.685 1.00 32.48 ? 2109 ARG B CD    1 
ATOM   5089  N NE    . ARG B 1 78  ? 64.823  1.383   38.833 1.00 32.61 ? 2109 ARG B NE    1 
ATOM   5090  C CZ    . ARG B 1 78  ? 64.408  1.509   37.575 1.00 33.41 ? 2109 ARG B CZ    1 
ATOM   5091  N NH1   . ARG B 1 78  ? 63.652  0.571   37.033 1.00 31.48 ? 2109 ARG B NH1   1 
ATOM   5092  N NH2   . ARG B 1 78  ? 64.743  2.573   36.856 1.00 34.09 ? 2109 ARG B NH2   1 
ATOM   5093  N N     . SER B 1 79  ? 61.368  0.819   43.482 1.00 32.41 ? 2110 SER B N     1 
ATOM   5094  C CA    . SER B 1 79  ? 60.236  1.744   43.573 1.00 30.81 ? 2110 SER B CA    1 
ATOM   5095  C C     . SER B 1 79  ? 60.301  2.423   44.919 1.00 31.67 ? 2110 SER B C     1 
ATOM   5096  O O     . SER B 1 79  ? 60.179  3.648   45.042 1.00 31.44 ? 2110 SER B O     1 
ATOM   5097  C CB    . SER B 1 79  ? 58.922  0.977   43.495 1.00 29.72 ? 2110 SER B CB    1 
ATOM   5098  O OG    . SER B 1 79  ? 58.578  0.690   42.155 1.00 30.64 ? 2110 SER B OG    1 
ATOM   5099  N N     . LEU B 1 80  ? 60.467  1.593   45.936 1.00 31.44 ? 2111 LEU B N     1 
ATOM   5100  C CA    . LEU B 1 80  ? 60.551  2.063   47.301 1.00 32.43 ? 2111 LEU B CA    1 
ATOM   5101  C C     . LEU B 1 80  ? 61.585  3.166   47.414 1.00 32.61 ? 2111 LEU B C     1 
ATOM   5102  O O     . LEU B 1 80  ? 61.312  4.240   47.953 1.00 33.18 ? 2111 LEU B O     1 
ATOM   5103  C CB    . LEU B 1 80  ? 60.945  0.907   48.201 1.00 34.92 ? 2111 LEU B CB    1 
ATOM   5104  C CG    . LEU B 1 80  ? 60.466  0.980   49.640 1.00 35.76 ? 2111 LEU B CG    1 
ATOM   5105  C CD1   . LEU B 1 80  ? 60.334  -0.452  50.160 1.00 36.98 ? 2111 LEU B CD1   1 
ATOM   5106  C CD2   . LEU B 1 80  ? 61.447  1.797   50.491 1.00 35.82 ? 2111 LEU B CD2   1 
ATOM   5107  N N     . ILE B 1 81  ? 62.779  2.901   46.898 1.00 31.41 ? 2112 ILE B N     1 
ATOM   5108  C CA    . ILE B 1 81  ? 63.844  3.887   46.958 1.00 30.59 ? 2112 ILE B CA    1 
ATOM   5109  C C     . ILE B 1 81  ? 63.529  5.149   46.158 1.00 29.30 ? 2112 ILE B C     1 
ATOM   5110  O O     . ILE B 1 81  ? 63.683  6.266   46.648 1.00 28.76 ? 2112 ILE B O     1 
ATOM   5111  C CB    . ILE B 1 81  ? 65.160  3.302   46.452 1.00 30.78 ? 2112 ILE B CB    1 
ATOM   5112  C CG1   . ILE B 1 81  ? 65.419  1.959   47.128 1.00 31.60 ? 2112 ILE B CG1   1 
ATOM   5113  C CG2   . ILE B 1 81  ? 66.300  4.265   46.756 1.00 30.83 ? 2112 ILE B CG2   1 
ATOM   5114  C CD1   . ILE B 1 81  ? 65.769  2.087   48.585 1.00 31.15 ? 2112 ILE B CD1   1 
ATOM   5115  N N     . MET B 1 82  ? 63.083  4.973   44.924 1.00 29.98 ? 2113 MET B N     1 
ATOM   5116  C CA    . MET B 1 82  ? 62.763  6.119   44.087 1.00 31.21 ? 2113 MET B CA    1 
ATOM   5117  C C     . MET B 1 82  ? 61.717  6.992   44.752 1.00 31.69 ? 2113 MET B C     1 
ATOM   5118  O O     . MET B 1 82  ? 61.699  8.209   44.566 1.00 32.31 ? 2113 MET B O     1 
ATOM   5119  C CB    . MET B 1 82  ? 62.252  5.669   42.720 1.00 30.18 ? 2113 MET B CB    1 
ATOM   5120  C CG    . MET B 1 82  ? 62.071  6.825   41.754 1.00 29.31 ? 2113 MET B CG    1 
ATOM   5121  S SD    . MET B 1 82  ? 63.627  7.643   41.393 1.00 28.09 ? 2113 MET B SD    1 
ATOM   5122  C CE    . MET B 1 82  ? 63.071  9.282   40.889 1.00 30.27 ? 2113 MET B CE    1 
ATOM   5123  N N     . LYS B 1 83  ? 60.832  6.363   45.513 1.00 32.97 ? 2114 LYS B N     1 
ATOM   5124  C CA    . LYS B 1 83  ? 59.802  7.103   46.211 1.00 33.73 ? 2114 LYS B CA    1 
ATOM   5125  C C     . LYS B 1 83  ? 60.454  8.022   47.240 1.00 33.65 ? 2114 LYS B C     1 
ATOM   5126  O O     . LYS B 1 83  ? 60.088  9.195   47.353 1.00 34.81 ? 2114 LYS B O     1 
ATOM   5127  C CB    . LYS B 1 83  ? 58.851  6.135   46.898 1.00 36.06 ? 2114 LYS B CB    1 
ATOM   5128  C CG    . LYS B 1 83  ? 57.472  6.700   47.139 1.00 39.10 ? 2114 LYS B CG    1 
ATOM   5129  C CD    . LYS B 1 83  ? 56.482  5.586   47.370 1.00 41.60 ? 2114 LYS B CD    1 
ATOM   5130  C CE    . LYS B 1 83  ? 55.112  6.132   47.700 1.00 44.82 ? 2114 LYS B CE    1 
ATOM   5131  N NZ    . LYS B 1 83  ? 54.450  5.314   48.760 1.00 45.76 ? 2114 LYS B NZ    1 
ATOM   5132  N N     . TYR B 1 84  ? 61.427  7.490   47.979 1.00 33.93 ? 2115 TYR B N     1 
ATOM   5133  C CA    . TYR B 1 84  ? 62.124  8.271   48.992 1.00 32.93 ? 2115 TYR B CA    1 
ATOM   5134  C C     . TYR B 1 84  ? 62.778  9.499   48.371 1.00 30.60 ? 2115 TYR B C     1 
ATOM   5135  O O     . TYR B 1 84  ? 62.613  10.618  48.854 1.00 29.13 ? 2115 TYR B O     1 
ATOM   5136  C CB    . TYR B 1 84  ? 63.202  7.424   49.702 1.00 36.22 ? 2115 TYR B CB    1 
ATOM   5137  C CG    . TYR B 1 84  ? 64.295  8.258   50.375 1.00 39.84 ? 2115 TYR B CG    1 
ATOM   5138  C CD1   . TYR B 1 84  ? 64.043  8.947   51.565 1.00 41.96 ? 2115 TYR B CD1   1 
ATOM   5139  C CD2   . TYR B 1 84  ? 65.548  8.428   49.773 1.00 40.37 ? 2115 TYR B CD2   1 
ATOM   5140  C CE1   . TYR B 1 84  ? 65.004  9.796   52.131 1.00 44.00 ? 2115 TYR B CE1   1 
ATOM   5141  C CE2   . TYR B 1 84  ? 66.517  9.275   50.330 1.00 42.97 ? 2115 TYR B CE2   1 
ATOM   5142  C CZ    . TYR B 1 84  ? 66.237  9.963   51.507 1.00 44.88 ? 2115 TYR B CZ    1 
ATOM   5143  O OH    . TYR B 1 84  ? 67.157  10.853  52.044 1.00 44.04 ? 2115 TYR B OH    1 
ATOM   5144  N N     . VAL B 1 85  ? 63.523  9.287   47.294 1.00 30.14 ? 2116 VAL B N     1 
ATOM   5145  C CA    . VAL B 1 85  ? 64.219  10.394  46.648 1.00 29.11 ? 2116 VAL B CA    1 
ATOM   5146  C C     . VAL B 1 85  ? 63.247  11.430  46.138 1.00 27.28 ? 2116 VAL B C     1 
ATOM   5147  O O     . VAL B 1 85  ? 63.550  12.610  46.123 1.00 26.94 ? 2116 VAL B O     1 
ATOM   5148  C CB    . VAL B 1 85  ? 65.129  9.903   45.479 1.00 28.70 ? 2116 VAL B CB    1 
ATOM   5149  C CG1   . VAL B 1 85  ? 65.123  8.395   45.428 1.00 28.83 ? 2116 VAL B CG1   1 
ATOM   5150  C CG2   . VAL B 1 85  ? 64.693  10.509  44.153 1.00 29.01 ? 2116 VAL B CG2   1 
ATOM   5151  N N     . LEU B 1 86  ? 62.072  10.974  45.726 1.00 28.28 ? 2117 LEU B N     1 
ATOM   5152  C CA    . LEU B 1 86  ? 61.041  11.859  45.203 1.00 28.88 ? 2117 LEU B CA    1 
ATOM   5153  C C     . LEU B 1 86  ? 60.454  12.689  46.335 1.00 29.08 ? 2117 LEU B C     1 
ATOM   5154  O O     . LEU B 1 86  ? 60.490  13.914  46.317 1.00 29.47 ? 2117 LEU B O     1 
ATOM   5155  C CB    . LEU B 1 86  ? 59.943  11.032  44.544 1.00 27.75 ? 2117 LEU B CB    1 
ATOM   5156  C CG    . LEU B 1 86  ? 59.777  11.046  43.023 1.00 26.14 ? 2117 LEU B CG    1 
ATOM   5157  C CD1   . LEU B 1 86  ? 60.990  11.628  42.344 1.00 26.76 ? 2117 LEU B CD1   1 
ATOM   5158  C CD2   . LEU B 1 86  ? 59.524  9.637   42.547 1.00 25.88 ? 2117 LEU B CD2   1 
ATOM   5159  N N     . THR B 1 87  ? 59.928  12.015  47.344 1.00 31.37 ? 2118 THR B N     1 
ATOM   5160  C CA    . THR B 1 87  ? 59.332  12.726  48.459 1.00 32.96 ? 2118 THR B CA    1 
ATOM   5161  C C     . THR B 1 87  ? 60.343  13.499  49.298 1.00 33.80 ? 2118 THR B C     1 
ATOM   5162  O O     . THR B 1 87  ? 59.981  14.464  49.953 1.00 33.47 ? 2118 THR B O     1 
ATOM   5163  C CB    . THR B 1 87  ? 58.557  11.765  49.360 1.00 32.72 ? 2118 THR B CB    1 
ATOM   5164  O OG1   . THR B 1 87  ? 59.468  10.842  49.957 1.00 32.87 ? 2118 THR B OG1   1 
ATOM   5165  C CG2   . THR B 1 87  ? 57.525  10.998  48.545 1.00 30.55 ? 2118 THR B CG2   1 
ATOM   5166  N N     . SER B 1 88  ? 61.608  13.094  49.286 1.00 35.71 ? 2119 SER B N     1 
ATOM   5167  C CA    . SER B 1 88  ? 62.612  13.809  50.075 1.00 38.32 ? 2119 SER B CA    1 
ATOM   5168  C C     . SER B 1 88  ? 62.794  15.235  49.546 1.00 40.57 ? 2119 SER B C     1 
ATOM   5169  O O     . SER B 1 88  ? 63.148  16.150  50.301 1.00 42.11 ? 2119 SER B O     1 
ATOM   5170  C CB    . SER B 1 88  ? 63.960  13.063  50.068 1.00 36.93 ? 2119 SER B CB    1 
ATOM   5171  O OG    . SER B 1 88  ? 64.294  12.549  48.791 1.00 36.49 ? 2119 SER B OG    1 
ATOM   5172  N N     . ARG B 1 89  ? 62.535  15.422  48.253 1.00 42.07 ? 2120 ARG B N     1 
ATOM   5173  C CA    . ARG B 1 89  ? 62.665  16.730  47.632 1.00 42.49 ? 2120 ARG B CA    1 
ATOM   5174  C C     . ARG B 1 89  ? 61.415  17.546  47.898 1.00 44.22 ? 2120 ARG B C     1 
ATOM   5175  O O     . ARG B 1 89  ? 61.479  18.693  48.333 1.00 44.75 ? 2120 ARG B O     1 
ATOM   5176  C CB    . ARG B 1 89  ? 62.885  16.572  46.119 1.00 41.92 ? 2120 ARG B CB    1 
ATOM   5177  C CG    . ARG B 1 89  ? 64.358  16.364  45.729 1.00 39.74 ? 2120 ARG B CG    1 
ATOM   5178  C CD    . ARG B 1 89  ? 65.265  16.676  46.930 1.00 39.44 ? 2120 ARG B CD    1 
ATOM   5179  N NE    . ARG B 1 89  ? 66.708  16.638  46.671 1.00 37.44 ? 2120 ARG B NE    1 
ATOM   5180  C CZ    . ARG B 1 89  ? 67.355  15.617  46.121 1.00 34.14 ? 2120 ARG B CZ    1 
ATOM   5181  N NH1   . ARG B 1 89  ? 66.698  14.531  45.751 1.00 32.81 ? 2120 ARG B NH1   1 
ATOM   5182  N NH2   . ARG B 1 89  ? 68.675  15.658  46.005 1.00 32.85 ? 2120 ARG B NH2   1 
ATOM   5183  N N     . SER B 1 90  ? 60.275  16.919  47.651 1.00 46.42 ? 2121 SER B N     1 
ATOM   5184  C CA    . SER B 1 90  ? 58.960  17.526  47.817 1.00 46.05 ? 2121 SER B CA    1 
ATOM   5185  C C     . SER B 1 90  ? 58.804  18.807  48.631 1.00 46.45 ? 2121 SER B C     1 
ATOM   5186  O O     . SER B 1 90  ? 58.643  19.891  48.071 1.00 48.96 ? 2121 SER B O     1 
ATOM   5187  C CB    . SER B 1 90  ? 57.991  16.479  48.349 1.00 46.70 ? 2121 SER B CB    1 
ATOM   5188  O OG    . SER B 1 90  ? 57.809  15.476  47.367 1.00 47.71 ? 2121 SER B OG    1 
ATOM   5189  N N     . TYR B 1 91  ? 58.845  18.696  49.946 1.00 45.77 ? 2122 TYR B N     1 
ATOM   5190  C CA    . TYR B 1 91  ? 58.653  19.861  50.797 1.00 43.63 ? 2122 TYR B CA    1 
ATOM   5191  C C     . TYR B 1 91  ? 59.464  21.129  50.505 1.00 41.93 ? 2122 TYR B C     1 
ATOM   5192  O O     . TYR B 1 91  ? 59.355  22.100  51.241 1.00 42.53 ? 2122 TYR B O     1 
ATOM   5193  C CB    . TYR B 1 91  ? 58.895  19.457  52.247 1.00 46.19 ? 2122 TYR B CB    1 
ATOM   5194  C CG    . TYR B 1 91  ? 60.339  19.576  52.678 1.00 47.36 ? 2122 TYR B CG    1 
ATOM   5195  C CD1   . TYR B 1 91  ? 60.782  20.699  53.391 1.00 47.94 ? 2122 TYR B CD1   1 
ATOM   5196  C CD2   . TYR B 1 91  ? 61.263  18.560  52.398 1.00 48.38 ? 2122 TYR B CD2   1 
ATOM   5197  C CE1   . TYR B 1 91  ? 62.112  20.814  53.819 1.00 48.71 ? 2122 TYR B CE1   1 
ATOM   5198  C CE2   . TYR B 1 91  ? 62.603  18.663  52.821 1.00 48.26 ? 2122 TYR B CE2   1 
ATOM   5199  C CZ    . TYR B 1 91  ? 63.014  19.794  53.535 1.00 48.42 ? 2122 TYR B CZ    1 
ATOM   5200  O OH    . TYR B 1 91  ? 64.316  19.909  53.971 1.00 48.02 ? 2122 TYR B OH    1 
ATOM   5201  N N     . LEU B 1 92  ? 60.254  21.156  49.442 1.00 39.68 ? 2123 LEU B N     1 
ATOM   5202  C CA    . LEU B 1 92  ? 61.087  22.329  49.176 1.00 36.70 ? 2123 LEU B CA    1 
ATOM   5203  C C     . LEU B 1 92  ? 60.558  23.496  48.345 1.00 35.63 ? 2123 LEU B C     1 
ATOM   5204  O O     . LEU B 1 92  ? 60.864  24.658  48.647 1.00 34.93 ? 2123 LEU B O     1 
ATOM   5205  C CB    . LEU B 1 92  ? 62.409  21.880  48.560 1.00 37.54 ? 2123 LEU B CB    1 
ATOM   5206  C CG    . LEU B 1 92  ? 63.634  21.698  49.455 1.00 35.81 ? 2123 LEU B CG    1 
ATOM   5207  C CD1   . LEU B 1 92  ? 63.433  22.390  50.776 1.00 37.04 ? 2123 LEU B CD1   1 
ATOM   5208  C CD2   . LEU B 1 92  ? 63.875  20.230  49.664 1.00 36.62 ? 2123 LEU B CD2   1 
ATOM   5209  N N     . ILE B 1 93  ? 59.797  23.213  47.291 1.00 34.26 ? 2124 ILE B N     1 
ATOM   5210  C CA    . ILE B 1 93  ? 59.294  24.294  46.437 1.00 32.44 ? 2124 ILE B CA    1 
ATOM   5211  C C     . ILE B 1 93  ? 57.898  24.819  46.783 1.00 31.89 ? 2124 ILE B C     1 
ATOM   5212  O O     . ILE B 1 93  ? 57.001  24.053  47.138 1.00 32.36 ? 2124 ILE B O     1 
ATOM   5213  C CB    . ILE B 1 93  ? 59.292  23.867  44.951 1.00 32.72 ? 2124 ILE B CB    1 
ATOM   5214  C CG1   . ILE B 1 93  ? 60.689  23.413  44.528 1.00 32.00 ? 2124 ILE B CG1   1 
ATOM   5215  C CG2   . ILE B 1 93  ? 58.862  25.029  44.080 1.00 31.47 ? 2124 ILE B CG2   1 
ATOM   5216  C CD1   . ILE B 1 93  ? 61.726  24.522  44.560 1.00 30.14 ? 2124 ILE B CD1   1 
ATOM   5217  N N     . ASP B 1 94  ? 57.722  26.134  46.685 1.00 30.80 ? 2125 ASP B N     1 
ATOM   5218  C CA    . ASP B 1 94  ? 56.430  26.753  46.963 1.00 30.14 ? 2125 ASP B CA    1 
ATOM   5219  C C     . ASP B 1 94  ? 55.525  26.526  45.757 1.00 30.10 ? 2125 ASP B C     1 
ATOM   5220  O O     . ASP B 1 94  ? 55.801  27.010  44.653 1.00 30.27 ? 2125 ASP B O     1 
ATOM   5221  C CB    . ASP B 1 94  ? 56.582  28.255  47.185 1.00 30.56 ? 2125 ASP B CB    1 
ATOM   5222  C CG    . ASP B 1 94  ? 57.217  28.590  48.515 1.00 32.59 ? 2125 ASP B CG    1 
ATOM   5223  O OD1   . ASP B 1 94  ? 57.502  27.652  49.290 1.00 32.02 ? 2125 ASP B OD1   1 
ATOM   5224  O OD2   . ASP B 1 94  ? 57.429  29.801  48.783 1.00 34.39 ? 2125 ASP B OD2   1 
ATOM   5225  N N     . SER B 1 95  ? 54.440  25.794  45.963 1.00 28.88 ? 2126 SER B N     1 
ATOM   5226  C CA    . SER B 1 95  ? 53.518  25.525  44.876 1.00 27.76 ? 2126 SER B CA    1 
ATOM   5227  C C     . SER B 1 95  ? 52.111  25.312  45.413 1.00 27.41 ? 2126 SER B C     1 
ATOM   5228  O O     . SER B 1 95  ? 51.868  24.365  46.146 1.00 28.48 ? 2126 SER B O     1 
ATOM   5229  C CB    . SER B 1 95  ? 53.978  24.280  44.116 1.00 27.81 ? 2126 SER B CB    1 
ATOM   5230  O OG    . SER B 1 95  ? 53.039  23.883  43.134 1.00 30.14 ? 2126 SER B OG    1 
ATOM   5231  N N     . PRO B 1 96  ? 51.160  26.198  45.076 1.00 26.92 ? 2127 PRO B N     1 
ATOM   5232  C CA    . PRO B 1 96  ? 51.206  27.400  44.225 1.00 25.72 ? 2127 PRO B CA    1 
ATOM   5233  C C     . PRO B 1 96  ? 52.384  28.328  44.505 1.00 24.36 ? 2127 PRO B C     1 
ATOM   5234  O O     . PRO B 1 96  ? 52.798  28.503  45.652 1.00 25.39 ? 2127 PRO B O     1 
ATOM   5235  C CB    . PRO B 1 96  ? 49.874  28.085  44.510 1.00 26.21 ? 2127 PRO B CB    1 
ATOM   5236  C CG    . PRO B 1 96  ? 48.965  26.955  44.903 1.00 24.83 ? 2127 PRO B CG    1 
ATOM   5237  C CD    . PRO B 1 96  ? 49.807  25.949  45.609 1.00 25.52 ? 2127 PRO B CD    1 
ATOM   5238  N N     . PRO B 1 97  ? 52.906  28.973  43.452 1.00 24.72 ? 2128 PRO B N     1 
ATOM   5239  C CA    . PRO B 1 97  ? 54.050  29.890  43.548 1.00 22.74 ? 2128 PRO B CA    1 
ATOM   5240  C C     . PRO B 1 97  ? 53.777  31.165  44.336 1.00 22.84 ? 2128 PRO B C     1 
ATOM   5241  O O     . PRO B 1 97  ? 52.631  31.582  44.496 1.00 24.26 ? 2128 PRO B O     1 
ATOM   5242  C CB    . PRO B 1 97  ? 54.406  30.178  42.090 1.00 20.85 ? 2128 PRO B CB    1 
ATOM   5243  C CG    . PRO B 1 97  ? 53.159  29.933  41.349 1.00 21.23 ? 2128 PRO B CG    1 
ATOM   5244  C CD    . PRO B 1 97  ? 52.378  28.888  42.079 1.00 22.01 ? 2128 PRO B CD    1 
ATOM   5245  N N     . THR B 1 98  ? 54.852  31.804  44.791 1.00 23.84 ? 2129 THR B N     1 
ATOM   5246  C CA    . THR B 1 98  ? 54.758  33.025  45.584 1.00 22.32 ? 2129 THR B CA    1 
ATOM   5247  C C     . THR B 1 98  ? 55.372  34.290  44.967 1.00 21.81 ? 2129 THR B C     1 
ATOM   5248  O O     . THR B 1 98  ? 54.707  34.992  44.218 1.00 22.54 ? 2129 THR B O     1 
ATOM   5249  C CB    . THR B 1 98  ? 55.379  32.792  46.956 1.00 21.28 ? 2129 THR B CB    1 
ATOM   5250  O OG1   . THR B 1 98  ? 56.623  32.092  46.808 1.00 20.29 ? 2129 THR B OG1   1 
ATOM   5251  C CG2   . THR B 1 98  ? 54.450  31.953  47.800 1.00 20.22 ? 2129 THR B CG2   1 
ATOM   5252  N N     . TYR B 1 99  ? 56.636  34.570  45.284 1.00 21.69 ? 2130 TYR B N     1 
ATOM   5253  C CA    . TYR B 1 99  ? 57.335  35.775  44.797 1.00 21.12 ? 2130 TYR B CA    1 
ATOM   5254  C C     . TYR B 1 99  ? 57.847  35.798  43.367 1.00 19.75 ? 2130 TYR B C     1 
ATOM   5255  O O     . TYR B 1 99  ? 57.844  34.796  42.668 1.00 20.88 ? 2130 TYR B O     1 
ATOM   5256  C CB    . TYR B 1 99  ? 58.517  36.080  45.715 1.00 19.20 ? 2130 TYR B CB    1 
ATOM   5257  C CG    . TYR B 1 99  ? 58.226  35.718  47.136 1.00 18.50 ? 2130 TYR B CG    1 
ATOM   5258  C CD1   . TYR B 1 99  ? 58.732  34.546  47.708 1.00 17.59 ? 2130 TYR B CD1   1 
ATOM   5259  C CD2   . TYR B 1 99  ? 57.415  36.532  47.911 1.00 18.20 ? 2130 TYR B CD2   1 
ATOM   5260  C CE1   . TYR B 1 99  ? 58.426  34.205  49.035 1.00 17.51 ? 2130 TYR B CE1   1 
ATOM   5261  C CE2   . TYR B 1 99  ? 57.106  36.202  49.224 1.00 18.79 ? 2130 TYR B CE2   1 
ATOM   5262  C CZ    . TYR B 1 99  ? 57.610  35.045  49.784 1.00 16.59 ? 2130 TYR B CZ    1 
ATOM   5263  O OH    . TYR B 1 99  ? 57.295  34.748  51.090 1.00 15.53 ? 2130 TYR B OH    1 
ATOM   5264  N N     . ASN B 1 100 ? 58.259  36.985  42.947 1.00 18.63 ? 2131 ASN B N     1 
ATOM   5265  C CA    . ASN B 1 100 ? 58.847  37.196  41.641 1.00 19.73 ? 2131 ASN B CA    1 
ATOM   5266  C C     . ASN B 1 100 ? 59.706  38.456  41.740 1.00 20.24 ? 2131 ASN B C     1 
ATOM   5267  O O     . ASN B 1 100 ? 59.799  39.072  42.807 1.00 18.06 ? 2131 ASN B O     1 
ATOM   5268  C CB    . ASN B 1 100 ? 57.790  37.253  40.515 1.00 20.75 ? 2131 ASN B CB    1 
ATOM   5269  C CG    . ASN B 1 100 ? 56.840  38.455  40.602 1.00 21.11 ? 2131 ASN B CG    1 
ATOM   5270  O OD1   . ASN B 1 100 ? 55.765  38.438  40.004 1.00 22.00 ? 2131 ASN B OD1   1 
ATOM   5271  N ND2   . ASN B 1 100 ? 57.232  39.493  41.314 1.00 22.59 ? 2131 ASN B ND2   1 
ATOM   5272  N N     . VAL B 1 101 ? 60.348  38.828  40.635 1.00 19.89 ? 2132 VAL B N     1 
ATOM   5273  C CA    . VAL B 1 101 ? 61.224  39.981  40.656 1.00 22.03 ? 2132 VAL B CA    1 
ATOM   5274  C C     . VAL B 1 101 ? 60.637  41.224  41.287 1.00 22.10 ? 2132 VAL B C     1 
ATOM   5275  O O     . VAL B 1 101 ? 61.324  41.939  42.002 1.00 22.90 ? 2132 VAL B O     1 
ATOM   5276  C CB    . VAL B 1 101 ? 61.728  40.335  39.223 1.00 21.90 ? 2132 VAL B CB    1 
ATOM   5277  C CG1   . VAL B 1 101 ? 60.571  40.820  38.356 1.00 21.73 ? 2132 VAL B CG1   1 
ATOM   5278  C CG2   . VAL B 1 101 ? 62.822  41.382  39.324 1.00 20.91 ? 2132 VAL B CG2   1 
ATOM   5279  N N     . HIS B 1 102 ? 59.338  41.476  41.036 1.00 22.70 ? 2133 HIS B N     1 
ATOM   5280  C CA    . HIS B 1 102 ? 58.684  42.655  41.567 1.00 22.85 ? 2133 HIS B CA    1 
ATOM   5281  C C     . HIS B 1 102 ? 57.945  42.536  42.883 1.00 22.48 ? 2133 HIS B C     1 
ATOM   5282  O O     . HIS B 1 102 ? 57.581  43.550  43.482 1.00 24.12 ? 2133 HIS B O     1 
ATOM   5283  C CB    . HIS B 1 102 ? 57.743  43.206  40.511 1.00 24.73 ? 2133 HIS B CB    1 
ATOM   5284  C CG    . HIS B 1 102 ? 58.465  43.709  39.302 1.00 28.35 ? 2133 HIS B CG    1 
ATOM   5285  N ND1   . HIS B 1 102 ? 57.855  43.856  38.077 1.00 29.96 ? 2133 HIS B ND1   1 
ATOM   5286  C CD2   . HIS B 1 102 ? 59.756  44.061  39.125 1.00 28.97 ? 2133 HIS B CD2   1 
ATOM   5287  C CE1   . HIS B 1 102 ? 58.737  44.276  37.191 1.00 29.58 ? 2133 HIS B CE1   1 
ATOM   5288  N NE2   . HIS B 1 102 ? 59.911  44.410  37.807 1.00 28.71 ? 2133 HIS B NE2   1 
ATOM   5289  N N     . TYR B 1 103 ? 57.740  41.318  43.362 1.00 21.69 ? 2134 TYR B N     1 
ATOM   5290  C CA    . TYR B 1 103 ? 57.016  41.153  44.603 1.00 19.69 ? 2134 TYR B CA    1 
ATOM   5291  C C     . TYR B 1 103 ? 57.742  40.357  45.668 1.00 18.93 ? 2134 TYR B C     1 
ATOM   5292  O O     . TYR B 1 103 ? 57.948  39.152  45.545 1.00 19.72 ? 2134 TYR B O     1 
ATOM   5293  C CB    . TYR B 1 103 ? 55.649  40.547  44.297 1.00 20.20 ? 2134 TYR B CB    1 
ATOM   5294  C CG    . TYR B 1 103 ? 54.759  41.502  43.526 1.00 19.89 ? 2134 TYR B CG    1 
ATOM   5295  C CD1   . TYR B 1 103 ? 54.796  41.550  42.130 1.00 18.85 ? 2134 TYR B CD1   1 
ATOM   5296  C CD2   . TYR B 1 103 ? 53.895  42.384  44.201 1.00 20.07 ? 2134 TYR B CD2   1 
ATOM   5297  C CE1   . TYR B 1 103 ? 54.001  42.462  41.417 1.00 18.51 ? 2134 TYR B CE1   1 
ATOM   5298  C CE2   . TYR B 1 103 ? 53.099  43.295  43.501 1.00 20.06 ? 2134 TYR B CE2   1 
ATOM   5299  C CZ    . TYR B 1 103 ? 53.160  43.327  42.112 1.00 19.14 ? 2134 TYR B CZ    1 
ATOM   5300  O OH    . TYR B 1 103 ? 52.394  44.241  41.426 1.00 19.38 ? 2134 TYR B OH    1 
ATOM   5301  N N     . GLY B 1 104 ? 58.144  41.064  46.713 1.00 18.50 ? 2135 GLY B N     1 
ATOM   5302  C CA    . GLY B 1 104 ? 58.831  40.436  47.819 1.00 18.93 ? 2135 GLY B CA    1 
ATOM   5303  C C     . GLY B 1 104 ? 57.819  39.957  48.834 1.00 19.24 ? 2135 GLY B C     1 
ATOM   5304  O O     . GLY B 1 104 ? 58.181  39.497  49.915 1.00 20.23 ? 2135 GLY B O     1 
ATOM   5305  N N     . TYR B 1 105 ? 56.540  40.081  48.490 1.00 19.56 ? 2136 TYR B N     1 
ATOM   5306  C CA    . TYR B 1 105 ? 55.448  39.627  49.350 1.00 19.00 ? 2136 TYR B CA    1 
ATOM   5307  C C     . TYR B 1 105 ? 54.376  39.012  48.429 1.00 20.67 ? 2136 TYR B C     1 
ATOM   5308  O O     . TYR B 1 105 ? 54.256  39.408  47.259 1.00 21.11 ? 2136 TYR B O     1 
ATOM   5309  C CB    . TYR B 1 105 ? 54.875  40.806  50.138 1.00 17.73 ? 2136 TYR B CB    1 
ATOM   5310  C CG    . TYR B 1 105 ? 54.431  41.946  49.263 1.00 18.15 ? 2136 TYR B CG    1 
ATOM   5311  C CD1   . TYR B 1 105 ? 53.183  41.927  48.659 1.00 18.94 ? 2136 TYR B CD1   1 
ATOM   5312  C CD2   . TYR B 1 105 ? 55.276  43.005  48.981 1.00 18.21 ? 2136 TYR B CD2   1 
ATOM   5313  C CE1   . TYR B 1 105 ? 52.789  42.924  47.790 1.00 18.25 ? 2136 TYR B CE1   1 
ATOM   5314  C CE2   . TYR B 1 105 ? 54.890  44.016  48.107 1.00 18.38 ? 2136 TYR B CE2   1 
ATOM   5315  C CZ    . TYR B 1 105 ? 53.645  43.965  47.514 1.00 19.84 ? 2136 TYR B CZ    1 
ATOM   5316  O OH    . TYR B 1 105 ? 53.244  44.954  46.638 1.00 21.83 ? 2136 TYR B OH    1 
ATOM   5317  N N     . LYS B 1 106 ? 53.617  38.035  48.929 1.00 20.49 ? 2137 LYS B N     1 
ATOM   5318  C CA    . LYS B 1 106 ? 52.583  37.402  48.114 1.00 19.78 ? 2137 LYS B CA    1 
ATOM   5319  C C     . LYS B 1 106 ? 51.569  38.431  47.665 1.00 20.29 ? 2137 LYS B C     1 
ATOM   5320  O O     . LYS B 1 106 ? 51.182  39.330  48.426 1.00 20.45 ? 2137 LYS B O     1 
ATOM   5321  C CB    . LYS B 1 106 ? 51.859  36.305  48.887 1.00 20.08 ? 2137 LYS B CB    1 
ATOM   5322  C CG    . LYS B 1 106 ? 52.747  35.552  49.829 1.00 18.94 ? 2137 LYS B CG    1 
ATOM   5323  C CD    . LYS B 1 106 ? 52.601  34.075  49.669 1.00 19.32 ? 2137 LYS B CD    1 
ATOM   5324  C CE    . LYS B 1 106 ? 53.166  33.369  50.877 1.00 19.76 ? 2137 LYS B CE    1 
ATOM   5325  N NZ    . LYS B 1 106 ? 52.941  34.141  52.123 1.00 20.93 ? 2137 LYS B NZ    1 
ATOM   5326  N N     . SER B 1 107 ? 51.145  38.304  46.414 1.00 18.61 ? 2138 SER B N     1 
ATOM   5327  C CA    . SER B 1 107 ? 50.168  39.218  45.856 1.00 18.06 ? 2138 SER B CA    1 
ATOM   5328  C C     . SER B 1 107 ? 49.473  38.466  44.742 1.00 17.44 ? 2138 SER B C     1 
ATOM   5329  O O     . SER B 1 107 ? 49.998  37.470  44.239 1.00 18.33 ? 2138 SER B O     1 
ATOM   5330  C CB    . SER B 1 107 ? 50.871  40.454  45.311 1.00 17.01 ? 2138 SER B CB    1 
ATOM   5331  O OG    . SER B 1 107 ? 51.607  40.126  44.153 1.00 19.05 ? 2138 SER B OG    1 
ATOM   5332  N N     . TRP B 1 108 ? 48.293  38.929  44.351 1.00 17.01 ? 2139 TRP B N     1 
ATOM   5333  C CA    . TRP B 1 108 ? 47.572  38.250  43.293 1.00 15.24 ? 2139 TRP B CA    1 
ATOM   5334  C C     . TRP B 1 108 ? 48.271  38.484  41.971 1.00 15.64 ? 2139 TRP B C     1 
ATOM   5335  O O     . TRP B 1 108 ? 48.182  37.672  41.057 1.00 15.45 ? 2139 TRP B O     1 
ATOM   5336  C CB    . TRP B 1 108 ? 46.112  38.715  43.225 1.00 12.87 ? 2139 TRP B CB    1 
ATOM   5337  C CG    . TRP B 1 108 ? 45.309  37.841  42.324 1.00 10.19 ? 2139 TRP B CG    1 
ATOM   5338  C CD1   . TRP B 1 108 ? 45.039  38.065  41.008 1.00 9.57  ? 2139 TRP B CD1   1 
ATOM   5339  C CD2   . TRP B 1 108 ? 44.814  36.523  42.617 1.00 10.03 ? 2139 TRP B CD2   1 
ATOM   5340  N NE1   . TRP B 1 108 ? 44.424  36.968  40.457 1.00 9.08  ? 2139 TRP B NE1   1 
ATOM   5341  C CE2   . TRP B 1 108 ? 44.270  36.008  41.422 1.00 9.33  ? 2139 TRP B CE2   1 
ATOM   5342  C CE3   . TRP B 1 108 ? 44.781  35.726  43.773 1.00 11.94 ? 2139 TRP B CE3   1 
ATOM   5343  C CZ2   . TRP B 1 108 ? 43.700  34.728  41.343 1.00 9.33  ? 2139 TRP B CZ2   1 
ATOM   5344  C CZ3   . TRP B 1 108 ? 44.211  34.450  43.697 1.00 11.65 ? 2139 TRP B CZ3   1 
ATOM   5345  C CH2   . TRP B 1 108 ? 43.680  33.967  42.487 1.00 10.16 ? 2139 TRP B CH2   1 
ATOM   5346  N N     . GLU B 1 109 ? 48.982  39.592  41.867 1.00 16.97 ? 2140 GLU B N     1 
ATOM   5347  C CA    . GLU B 1 109 ? 49.693  39.882  40.633 1.00 18.24 ? 2140 GLU B CA    1 
ATOM   5348  C C     . GLU B 1 109 ? 50.820  38.868  40.470 1.00 18.46 ? 2140 GLU B C     1 
ATOM   5349  O O     . GLU B 1 109 ? 50.994  38.265  39.402 1.00 18.39 ? 2140 GLU B O     1 
ATOM   5350  C CB    . GLU B 1 109 ? 50.267  41.297  40.670 1.00 19.23 ? 2140 GLU B CB    1 
ATOM   5351  C CG    . GLU B 1 109 ? 51.243  41.581  39.566 1.00 20.03 ? 2140 GLU B CG    1 
ATOM   5352  C CD    . GLU B 1 109 ? 50.568  41.712  38.217 1.00 21.15 ? 2140 GLU B CD    1 
ATOM   5353  O OE1   . GLU B 1 109 ? 51.282  41.655  37.181 1.00 24.47 ? 2140 GLU B OE1   1 
ATOM   5354  O OE2   . GLU B 1 109 ? 49.329  41.876  38.188 1.00 19.61 ? 2140 GLU B OE2   1 
ATOM   5355  N N     . ALA B 1 110 ? 51.580  38.667  41.541 1.00 18.96 ? 2141 ALA B N     1 
ATOM   5356  C CA    . ALA B 1 110 ? 52.681  37.721  41.494 1.00 19.77 ? 2141 ALA B CA    1 
ATOM   5357  C C     . ALA B 1 110 ? 52.139  36.339  41.171 1.00 19.62 ? 2141 ALA B C     1 
ATOM   5358  O O     . ALA B 1 110 ? 52.710  35.605  40.369 1.00 21.03 ? 2141 ALA B O     1 
ATOM   5359  C CB    . ALA B 1 110 ? 53.427  37.703  42.821 1.00 19.07 ? 2141 ALA B CB    1 
ATOM   5360  N N     . PHE B 1 111 ? 51.027  35.974  41.786 1.00 19.39 ? 2142 PHE B N     1 
ATOM   5361  C CA    . PHE B 1 111 ? 50.466  34.657  41.520 1.00 18.38 ? 2142 PHE B CA    1 
ATOM   5362  C C     . PHE B 1 111 ? 49.949  34.462  40.111 1.00 19.08 ? 2142 PHE B C     1 
ATOM   5363  O O     . PHE B 1 111 ? 50.311  33.494  39.429 1.00 19.93 ? 2142 PHE B O     1 
ATOM   5364  C CB    . PHE B 1 111 ? 49.297  34.352  42.458 1.00 16.58 ? 2142 PHE B CB    1 
ATOM   5365  C CG    . PHE B 1 111 ? 48.483  33.172  42.017 1.00 15.69 ? 2142 PHE B CG    1 
ATOM   5366  C CD1   . PHE B 1 111 ? 48.987  31.870  42.146 1.00 16.43 ? 2142 PHE B CD1   1 
ATOM   5367  C CD2   . PHE B 1 111 ? 47.257  33.358  41.400 1.00 15.67 ? 2142 PHE B CD2   1 
ATOM   5368  C CE1   . PHE B 1 111 ? 48.288  30.772  41.657 1.00 14.33 ? 2142 PHE B CE1   1 
ATOM   5369  C CE2   . PHE B 1 111 ? 46.542  32.272  40.904 1.00 14.95 ? 2142 PHE B CE2   1 
ATOM   5370  C CZ    . PHE B 1 111 ? 47.061  30.967  41.031 1.00 15.62 ? 2142 PHE B CZ    1 
ATOM   5371  N N     . SER B 1 112 ? 49.091  35.380  39.681 1.00 18.68 ? 2143 SER B N     1 
ATOM   5372  C CA    . SER B 1 112 ? 48.445  35.240  38.394 1.00 18.74 ? 2143 SER B CA    1 
ATOM   5373  C C     . SER B 1 112 ? 49.247  35.523  37.154 1.00 18.72 ? 2143 SER B C     1 
ATOM   5374  O O     . SER B 1 112 ? 48.998  34.922  36.111 1.00 18.81 ? 2143 SER B O     1 
ATOM   5375  C CB    . SER B 1 112 ? 47.179  36.097  38.362 1.00 18.33 ? 2143 SER B CB    1 
ATOM   5376  O OG    . SER B 1 112 ? 47.466  37.459  38.634 1.00 19.35 ? 2143 SER B OG    1 
ATOM   5377  N N     . ASN B 1 113 ? 50.202  36.435  37.239 1.00 19.73 ? 2144 ASN B N     1 
ATOM   5378  C CA    . ASN B 1 113 ? 50.948  36.790  36.047 1.00 20.79 ? 2144 ASN B CA    1 
ATOM   5379  C C     . ASN B 1 113 ? 51.968  35.759  35.604 1.00 19.98 ? 2144 ASN B C     1 
ATOM   5380  O O     . ASN B 1 113 ? 53.071  35.702  36.125 1.00 21.47 ? 2144 ASN B O     1 
ATOM   5381  C CB    . ASN B 1 113 ? 51.626  38.123  36.260 1.00 22.27 ? 2144 ASN B CB    1 
ATOM   5382  C CG    . ASN B 1 113 ? 51.945  38.800  34.971 1.00 23.10 ? 2144 ASN B CG    1 
ATOM   5383  O OD1   . ASN B 1 113 ? 52.362  38.148  34.013 1.00 23.96 ? 2144 ASN B OD1   1 
ATOM   5384  N ND2   . ASN B 1 113 ? 51.750  40.110  34.942 1.00 23.34 ? 2144 ASN B ND2   1 
ATOM   5385  N N     . LEU B 1 114 ? 51.596  34.957  34.617 1.00 20.27 ? 2145 LEU B N     1 
ATOM   5386  C CA    . LEU B 1 114 ? 52.465  33.899  34.108 1.00 20.15 ? 2145 LEU B CA    1 
ATOM   5387  C C     . LEU B 1 114 ? 53.658  34.368  33.300 1.00 19.29 ? 2145 LEU B C     1 
ATOM   5388  O O     . LEU B 1 114 ? 54.461  33.552  32.868 1.00 20.20 ? 2145 LEU B O     1 
ATOM   5389  C CB    . LEU B 1 114 ? 51.662  32.924  33.247 1.00 17.52 ? 2145 LEU B CB    1 
ATOM   5390  C CG    . LEU B 1 114 ? 50.451  32.270  33.910 1.00 17.70 ? 2145 LEU B CG    1 
ATOM   5391  C CD1   . LEU B 1 114 ? 49.771  31.353  32.899 1.00 16.51 ? 2145 LEU B CD1   1 
ATOM   5392  C CD2   . LEU B 1 114 ? 50.872  31.496  35.133 1.00 13.72 ? 2145 LEU B CD2   1 
ATOM   5393  N N     . SER B 1 115 ? 53.776  35.672  33.097 1.00 20.03 ? 2146 SER B N     1 
ATOM   5394  C CA    . SER B 1 115 ? 54.874  36.222  32.312 1.00 21.02 ? 2146 SER B CA    1 
ATOM   5395  C C     . SER B 1 115 ? 56.178  36.356  33.103 1.00 21.39 ? 2146 SER B C     1 
ATOM   5396  O O     . SER B 1 115 ? 57.236  36.642  32.535 1.00 21.67 ? 2146 SER B O     1 
ATOM   5397  C CB    . SER B 1 115 ? 54.470  37.586  31.771 1.00 19.78 ? 2146 SER B CB    1 
ATOM   5398  O OG    . SER B 1 115 ? 53.834  37.433  30.520 1.00 23.81 ? 2146 SER B OG    1 
ATOM   5399  N N     . TYR B 1 116 ? 56.081  36.149  34.413 1.00 21.58 ? 2147 TYR B N     1 
ATOM   5400  C CA    . TYR B 1 116 ? 57.205  36.258  35.324 1.00 21.22 ? 2147 TYR B CA    1 
ATOM   5401  C C     . TYR B 1 116 ? 57.769  34.895  35.637 1.00 20.24 ? 2147 TYR B C     1 
ATOM   5402  O O     . TYR B 1 116 ? 57.049  33.905  35.619 1.00 21.97 ? 2147 TYR B O     1 
ATOM   5403  C CB    . TYR B 1 116 ? 56.737  36.814  36.667 1.00 22.07 ? 2147 TYR B CB    1 
ATOM   5404  C CG    . TYR B 1 116 ? 56.505  38.293  36.783 1.00 21.80 ? 2147 TYR B CG    1 
ATOM   5405  C CD1   . TYR B 1 116 ? 55.216  38.817  36.708 1.00 22.30 ? 2147 TYR B CD1   1 
ATOM   5406  C CD2   . TYR B 1 116 ? 57.555  39.159  37.091 1.00 22.26 ? 2147 TYR B CD2   1 
ATOM   5407  C CE1   . TYR B 1 116 ? 54.970  40.163  36.949 1.00 21.66 ? 2147 TYR B CE1   1 
ATOM   5408  C CE2   . TYR B 1 116 ? 57.322  40.510  37.330 1.00 21.95 ? 2147 TYR B CE2   1 
ATOM   5409  C CZ    . TYR B 1 116 ? 56.026  40.999  37.263 1.00 21.33 ? 2147 TYR B CZ    1 
ATOM   5410  O OH    . TYR B 1 116 ? 55.790  42.313  37.552 1.00 21.29 ? 2147 TYR B OH    1 
ATOM   5411  N N     . TYR B 1 117 ? 59.056  34.844  35.939 1.00 19.69 ? 2148 TYR B N     1 
ATOM   5412  C CA    . TYR B 1 117 ? 59.639  33.594  36.389 1.00 19.34 ? 2148 TYR B CA    1 
ATOM   5413  C C     . TYR B 1 117 ? 59.263  33.716  37.868 1.00 19.54 ? 2148 TYR B C     1 
ATOM   5414  O O     . TYR B 1 117 ? 59.215  34.834  38.409 1.00 18.24 ? 2148 TYR B O     1 
ATOM   5415  C CB    . TYR B 1 117 ? 61.166  33.613  36.302 1.00 18.21 ? 2148 TYR B CB    1 
ATOM   5416  C CG    . TYR B 1 117 ? 61.745  33.198  34.982 1.00 19.12 ? 2148 TYR B CG    1 
ATOM   5417  C CD1   . TYR B 1 117 ? 61.622  31.896  34.522 1.00 19.75 ? 2148 TYR B CD1   1 
ATOM   5418  C CD2   . TYR B 1 117 ? 62.427  34.117  34.186 1.00 20.81 ? 2148 TYR B CD2   1 
ATOM   5419  C CE1   . TYR B 1 117 ? 62.168  31.516  33.295 1.00 20.28 ? 2148 TYR B CE1   1 
ATOM   5420  C CE2   . TYR B 1 117 ? 62.975  33.750  32.960 1.00 20.44 ? 2148 TYR B CE2   1 
ATOM   5421  C CZ    . TYR B 1 117 ? 62.844  32.449  32.519 1.00 20.38 ? 2148 TYR B CZ    1 
ATOM   5422  O OH    . TYR B 1 117 ? 63.399  32.085  31.307 1.00 21.08 ? 2148 TYR B OH    1 
ATOM   5423  N N     . THR B 1 118 ? 58.987  32.610  38.541 1.00 19.51 ? 2149 THR B N     1 
ATOM   5424  C CA    . THR B 1 118 ? 58.688  32.756  39.959 1.00 20.08 ? 2149 THR B CA    1 
ATOM   5425  C C     . THR B 1 118 ? 60.032  32.826  40.725 1.00 20.87 ? 2149 THR B C     1 
ATOM   5426  O O     . THR B 1 118 ? 61.106  32.636  40.134 1.00 21.41 ? 2149 THR B O     1 
ATOM   5427  C CB    . THR B 1 118 ? 57.802  31.595  40.467 1.00 18.69 ? 2149 THR B CB    1 
ATOM   5428  O OG1   . THR B 1 118 ? 57.295  31.922  41.768 1.00 19.48 ? 2149 THR B OG1   1 
ATOM   5429  C CG2   . THR B 1 118 ? 58.583  30.312  40.531 1.00 18.10 ? 2149 THR B CG2   1 
ATOM   5430  N N     . ARG B 1 119 ? 59.992  33.102  42.028 1.00 20.35 ? 2150 ARG B N     1 
ATOM   5431  C CA    . ARG B 1 119 ? 61.229  33.201  42.808 1.00 18.44 ? 2150 ARG B CA    1 
ATOM   5432  C C     . ARG B 1 119 ? 61.239  32.320  44.062 1.00 18.19 ? 2150 ARG B C     1 
ATOM   5433  O O     . ARG B 1 119 ? 60.295  32.326  44.852 1.00 18.76 ? 2150 ARG B O     1 
ATOM   5434  C CB    . ARG B 1 119 ? 61.469  34.663  43.213 1.00 18.38 ? 2150 ARG B CB    1 
ATOM   5435  C CG    . ARG B 1 119 ? 62.135  35.513  42.145 1.00 19.56 ? 2150 ARG B CG    1 
ATOM   5436  C CD    . ARG B 1 119 ? 63.656  35.278  42.113 1.00 21.18 ? 2150 ARG B CD    1 
ATOM   5437  N NE    . ARG B 1 119 ? 64.381  36.153  43.039 1.00 22.11 ? 2150 ARG B NE    1 
ATOM   5438  C CZ    . ARG B 1 119 ? 64.691  37.419  42.778 1.00 20.33 ? 2150 ARG B CZ    1 
ATOM   5439  N NH1   . ARG B 1 119 ? 64.339  37.949  41.624 1.00 20.12 ? 2150 ARG B NH1   1 
ATOM   5440  N NH2   . ARG B 1 119 ? 65.344  38.154  43.670 1.00 21.09 ? 2150 ARG B NH2   1 
ATOM   5441  N N     . ALA B 1 120 ? 62.316  31.567  44.251 1.00 17.79 ? 2151 ALA B N     1 
ATOM   5442  C CA    . ALA B 1 120 ? 62.440  30.720  45.430 1.00 17.59 ? 2151 ALA B CA    1 
ATOM   5443  C C     . ALA B 1 120 ? 62.652  31.599  46.670 1.00 17.84 ? 2151 ALA B C     1 
ATOM   5444  O O     . ALA B 1 120 ? 62.187  31.280  47.769 1.00 19.47 ? 2151 ALA B O     1 
ATOM   5445  C CB    . ALA B 1 120 ? 63.598  29.761  45.258 1.00 18.49 ? 2151 ALA B CB    1 
ATOM   5446  N N     . LEU B 1 121 ? 63.365  32.703  46.496 1.00 17.15 ? 2152 LEU B N     1 
ATOM   5447  C CA    . LEU B 1 121 ? 63.593  33.638  47.590 1.00 16.95 ? 2152 LEU B CA    1 
ATOM   5448  C C     . LEU B 1 121 ? 63.181  35.005  47.050 1.00 17.75 ? 2152 LEU B C     1 
ATOM   5449  O O     . LEU B 1 121 ? 63.513  35.353  45.913 1.00 18.10 ? 2152 LEU B O     1 
ATOM   5450  C CB    . LEU B 1 121 ? 65.070  33.658  48.005 1.00 17.47 ? 2152 LEU B CB    1 
ATOM   5451  C CG    . LEU B 1 121 ? 65.564  32.673  49.080 1.00 18.27 ? 2152 LEU B CG    1 
ATOM   5452  C CD1   . LEU B 1 121 ? 66.924  33.139  49.634 1.00 17.65 ? 2152 LEU B CD1   1 
ATOM   5453  C CD2   . LEU B 1 121 ? 64.539  32.576  50.215 1.00 16.85 ? 2152 LEU B CD2   1 
ATOM   5454  N N     . PRO B 1 122 ? 62.429  35.791  47.842 1.00 16.54 ? 2153 PRO B N     1 
ATOM   5455  C CA    . PRO B 1 122 ? 62.005  37.119  47.380 1.00 18.29 ? 2153 PRO B CA    1 
ATOM   5456  C C     . PRO B 1 122 ? 63.190  38.033  47.035 1.00 19.65 ? 2153 PRO B C     1 
ATOM   5457  O O     . PRO B 1 122 ? 64.319  37.822  47.498 1.00 20.93 ? 2153 PRO B O     1 
ATOM   5458  C CB    . PRO B 1 122 ? 61.209  37.676  48.559 1.00 15.86 ? 2153 PRO B CB    1 
ATOM   5459  C CG    . PRO B 1 122 ? 61.664  36.881  49.729 1.00 15.14 ? 2153 PRO B CG    1 
ATOM   5460  C CD    . PRO B 1 122 ? 61.938  35.510  49.197 1.00 14.53 ? 2153 PRO B CD    1 
ATOM   5461  N N     . PRO B 1 123 ? 62.951  39.066  46.220 1.00 18.23 ? 2154 PRO B N     1 
ATOM   5462  C CA    . PRO B 1 123 ? 64.079  39.948  45.894 1.00 21.34 ? 2154 PRO B CA    1 
ATOM   5463  C C     . PRO B 1 123 ? 64.475  40.756  47.128 1.00 22.64 ? 2154 PRO B C     1 
ATOM   5464  O O     . PRO B 1 123 ? 63.730  40.807  48.105 1.00 23.60 ? 2154 PRO B O     1 
ATOM   5465  C CB    . PRO B 1 123 ? 63.520  40.855  44.807 1.00 18.88 ? 2154 PRO B CB    1 
ATOM   5466  C CG    . PRO B 1 123 ? 62.034  40.876  45.083 1.00 17.34 ? 2154 PRO B CG    1 
ATOM   5467  C CD    . PRO B 1 123 ? 61.702  39.486  45.557 1.00 17.91 ? 2154 PRO B CD    1 
ATOM   5468  N N     . VAL B 1 124 ? 65.652  41.375  47.093 1.00 24.41 ? 2155 VAL B N     1 
ATOM   5469  C CA    . VAL B 1 124 ? 66.095  42.216  48.202 1.00 25.22 ? 2155 VAL B CA    1 
ATOM   5470  C C     . VAL B 1 124 ? 65.375  43.533  47.947 1.00 24.70 ? 2155 VAL B C     1 
ATOM   5471  O O     . VAL B 1 124 ? 65.445  44.068  46.842 1.00 25.63 ? 2155 VAL B O     1 
ATOM   5472  C CB    . VAL B 1 124 ? 67.648  42.408  48.178 1.00 23.85 ? 2155 VAL B CB    1 
ATOM   5473  C CG1   . VAL B 1 124 ? 68.092  43.408  49.244 1.00 20.87 ? 2155 VAL B CG1   1 
ATOM   5474  C CG2   . VAL B 1 124 ? 68.320  41.064  48.414 1.00 23.70 ? 2155 VAL B CG2   1 
ATOM   5475  N N     . ALA B 1 125 ? 64.658  44.035  48.947 1.00 26.93 ? 2156 ALA B N     1 
ATOM   5476  C CA    . ALA B 1 125 ? 63.900  45.274  48.802 1.00 28.34 ? 2156 ALA B CA    1 
ATOM   5477  C C     . ALA B 1 125 ? 64.774  46.396  48.283 1.00 29.99 ? 2156 ALA B C     1 
ATOM   5478  O O     . ALA B 1 125 ? 65.908  46.557  48.727 1.00 30.57 ? 2156 ALA B O     1 
ATOM   5479  C CB    . ALA B 1 125 ? 63.282  45.660  50.125 1.00 27.02 ? 2156 ALA B CB    1 
ATOM   5480  N N     . ASP B 1 126 ? 64.237  47.175  47.349 1.00 32.65 ? 2157 ASP B N     1 
ATOM   5481  C CA    . ASP B 1 126 ? 64.967  48.278  46.752 1.00 34.76 ? 2157 ASP B CA    1 
ATOM   5482  C C     . ASP B 1 126 ? 65.547  49.288  47.724 1.00 36.93 ? 2157 ASP B C     1 
ATOM   5483  O O     . ASP B 1 126 ? 66.565  49.914  47.428 1.00 38.47 ? 2157 ASP B O     1 
ATOM   5484  C CB    . ASP B 1 126 ? 64.083  49.017  45.762 1.00 35.86 ? 2157 ASP B CB    1 
ATOM   5485  C CG    . ASP B 1 126 ? 63.799  48.202  44.519 1.00 37.70 ? 2157 ASP B CG    1 
ATOM   5486  O OD1   . ASP B 1 126 ? 64.292  47.055  44.436 1.00 38.21 ? 2157 ASP B OD1   1 
ATOM   5487  O OD2   . ASP B 1 126 ? 63.081  48.712  43.626 1.00 40.32 ? 2157 ASP B OD2   1 
ATOM   5488  N N     . ASP B 1 127 ? 64.930  49.463  48.883 1.00 38.21 ? 2158 ASP B N     1 
ATOM   5489  C CA    . ASP B 1 127 ? 65.455  50.445  49.817 1.00 38.95 ? 2158 ASP B CA    1 
ATOM   5490  C C     . ASP B 1 127 ? 66.520  49.950  50.797 1.00 38.68 ? 2158 ASP B C     1 
ATOM   5491  O O     . ASP B 1 127 ? 66.945  50.691  51.687 1.00 38.71 ? 2158 ASP B O     1 
ATOM   5492  C CB    . ASP B 1 127 ? 64.299  51.131  50.563 1.00 41.44 ? 2158 ASP B CB    1 
ATOM   5493  C CG    . ASP B 1 127 ? 63.704  50.279  51.661 1.00 44.07 ? 2158 ASP B CG    1 
ATOM   5494  O OD1   . ASP B 1 127 ? 62.607  50.647  52.140 1.00 47.52 ? 2158 ASP B OD1   1 
ATOM   5495  O OD2   . ASP B 1 127 ? 64.313  49.261  52.055 1.00 46.10 ? 2158 ASP B OD2   1 
ATOM   5496  N N     . CYS B 1 128 ? 66.972  48.714  50.632 1.00 37.39 ? 2159 CYS B N     1 
ATOM   5497  C CA    . CYS B 1 128 ? 67.992  48.193  51.524 1.00 35.77 ? 2159 CYS B CA    1 
ATOM   5498  C C     . CYS B 1 128 ? 69.303  48.936  51.276 1.00 35.23 ? 2159 CYS B C     1 
ATOM   5499  O O     . CYS B 1 128 ? 69.569  49.373  50.163 1.00 34.31 ? 2159 CYS B O     1 
ATOM   5500  C CB    . CYS B 1 128 ? 68.164  46.698  51.297 1.00 35.90 ? 2159 CYS B CB    1 
ATOM   5501  S SG    . CYS B 1 128 ? 66.694  45.743  51.783 1.00 34.82 ? 2159 CYS B SG    1 
ATOM   5502  N N     . PRO B 1 129 ? 70.126  49.106  52.323 1.00 35.20 ? 2160 PRO B N     1 
ATOM   5503  C CA    . PRO B 1 129 ? 71.416  49.796  52.253 1.00 35.28 ? 2160 PRO B CA    1 
ATOM   5504  C C     . PRO B 1 129 ? 72.398  49.135  51.300 1.00 35.03 ? 2160 PRO B C     1 
ATOM   5505  O O     . PRO B 1 129 ? 72.953  49.783  50.401 1.00 35.92 ? 2160 PRO B O     1 
ATOM   5506  C CB    . PRO B 1 129 ? 71.913  49.768  53.691 1.00 34.92 ? 2160 PRO B CB    1 
ATOM   5507  C CG    . PRO B 1 129 ? 71.189  48.648  54.321 1.00 35.20 ? 2160 PRO B CG    1 
ATOM   5508  C CD    . PRO B 1 129 ? 69.845  48.635  53.688 1.00 34.77 ? 2160 PRO B CD    1 
ATOM   5509  N N     . THR B 1 130 ? 72.615  47.842  51.504 1.00 34.53 ? 2161 THR B N     1 
ATOM   5510  C CA    . THR B 1 130 ? 73.527  47.090  50.653 1.00 34.01 ? 2161 THR B CA    1 
ATOM   5511  C C     . THR B 1 130 ? 72.761  46.158  49.727 1.00 32.69 ? 2161 THR B C     1 
ATOM   5512  O O     . THR B 1 130 ? 71.599  45.817  49.971 1.00 32.47 ? 2161 THR B O     1 
ATOM   5513  C CB    . THR B 1 130 ? 74.511  46.242  51.485 1.00 34.49 ? 2161 THR B CB    1 
ATOM   5514  O OG1   . THR B 1 130 ? 73.793  45.213  52.180 1.00 32.13 ? 2161 THR B OG1   1 
ATOM   5515  C CG2   . THR B 1 130 ? 75.239  47.111  52.495 1.00 32.49 ? 2161 THR B CG2   1 
ATOM   5516  N N     . PRO B 1 131 ? 73.410  45.728  48.643 1.00 32.38 ? 2162 PRO B N     1 
ATOM   5517  C CA    . PRO B 1 131 ? 72.811  44.830  47.656 1.00 32.76 ? 2162 PRO B CA    1 
ATOM   5518  C C     . PRO B 1 131 ? 72.277  43.512  48.194 1.00 31.84 ? 2162 PRO B C     1 
ATOM   5519  O O     . PRO B 1 131 ? 71.318  42.965  47.661 1.00 33.60 ? 2162 PRO B O     1 
ATOM   5520  C CB    . PRO B 1 131 ? 73.934  44.626  46.638 1.00 33.12 ? 2162 PRO B CB    1 
ATOM   5521  C CG    . PRO B 1 131 ? 74.784  45.857  46.776 1.00 31.57 ? 2162 PRO B CG    1 
ATOM   5522  C CD    . PRO B 1 131 ? 74.777  46.113  48.256 1.00 31.81 ? 2162 PRO B CD    1 
ATOM   5523  N N     . MET B 1 132 ? 72.890  42.989  49.239 1.00 31.06 ? 2163 MET B N     1 
ATOM   5524  C CA    . MET B 1 132 ? 72.427  41.728  49.790 1.00 30.72 ? 2163 MET B CA    1 
ATOM   5525  C C     . MET B 1 132 ? 71.522  41.979  50.978 1.00 30.60 ? 2163 MET B C     1 
ATOM   5526  O O     . MET B 1 132 ? 71.114  41.052  51.668 1.00 30.41 ? 2163 MET B O     1 
ATOM   5527  C CB    . MET B 1 132 ? 73.618  40.871  50.211 1.00 30.69 ? 2163 MET B CB    1 
ATOM   5528  C CG    . MET B 1 132 ? 74.473  40.413  49.043 1.00 29.90 ? 2163 MET B CG    1 
ATOM   5529  S SD    . MET B 1 132 ? 73.617  39.232  47.998 1.00 29.65 ? 2163 MET B SD    1 
ATOM   5530  C CE    . MET B 1 132 ? 74.798  38.951  46.756 1.00 28.18 ? 2163 MET B CE    1 
ATOM   5531  N N     . GLY B 1 133 ? 71.213  43.247  51.208 1.00 31.32 ? 2164 GLY B N     1 
ATOM   5532  C CA    . GLY B 1 133 ? 70.363  43.607  52.320 1.00 31.90 ? 2164 GLY B CA    1 
ATOM   5533  C C     . GLY B 1 133 ? 71.054  44.661  53.151 1.00 31.84 ? 2164 GLY B C     1 
ATOM   5534  O O     . GLY B 1 133 ? 70.931  45.856  52.889 1.00 32.78 ? 2164 GLY B O     1 
ATOM   5535  N N     . VAL B 1 134 ? 71.796  44.219  54.156 1.00 32.96 ? 2165 VAL B N     1 
ATOM   5536  C CA    . VAL B 1 134 ? 72.522  45.140  55.024 1.00 34.03 ? 2165 VAL B CA    1 
ATOM   5537  C C     . VAL B 1 134 ? 74.007  44.755  55.141 1.00 34.96 ? 2165 VAL B C     1 
ATOM   5538  O O     . VAL B 1 134 ? 74.793  45.503  55.709 1.00 34.77 ? 2165 VAL B O     1 
ATOM   5539  C CB    . VAL B 1 134 ? 71.892  45.201  56.445 1.00 33.14 ? 2165 VAL B CB    1 
ATOM   5540  C CG1   . VAL B 1 134 ? 70.429  45.606  56.347 1.00 31.21 ? 2165 VAL B CG1   1 
ATOM   5541  C CG2   . VAL B 1 134 ? 72.046  43.854  57.146 1.00 32.32 ? 2165 VAL B CG2   1 
ATOM   5542  N N     . LYS B 1 135 ? 74.381  43.600  54.591 1.00 35.59 ? 2166 LYS B N     1 
ATOM   5543  C CA    . LYS B 1 135 ? 75.765  43.131  54.632 1.00 36.22 ? 2166 LYS B CA    1 
ATOM   5544  C C     . LYS B 1 135 ? 76.529  43.514  53.374 1.00 37.74 ? 2166 LYS B C     1 
ATOM   5545  O O     . LYS B 1 135 ? 75.931  43.735  52.313 1.00 38.09 ? 2166 LYS B O     1 
ATOM   5546  C CB    . LYS B 1 135 ? 75.811  41.618  54.790 1.00 36.79 ? 2166 LYS B CB    1 
ATOM   5547  C CG    . LYS B 1 135 ? 75.794  41.172  56.225 1.00 38.15 ? 2166 LYS B CG    1 
ATOM   5548  C CD    . LYS B 1 135 ? 75.503  39.695  56.347 1.00 39.06 ? 2166 LYS B CD    1 
ATOM   5549  C CE    . LYS B 1 135 ? 75.249  39.344  57.802 1.00 42.42 ? 2166 LYS B CE    1 
ATOM   5550  N NZ    . LYS B 1 135 ? 75.705  37.971  58.128 1.00 42.95 ? 2166 LYS B NZ    1 
ATOM   5551  N N     . GLY B 1 136 ? 77.855  43.591  53.496 1.00 37.79 ? 2167 GLY B N     1 
ATOM   5552  C CA    . GLY B 1 136 ? 78.691  43.949  52.361 1.00 37.45 ? 2167 GLY B CA    1 
ATOM   5553  C C     . GLY B 1 136 ? 78.796  45.448  52.181 1.00 39.01 ? 2167 GLY B C     1 
ATOM   5554  O O     . GLY B 1 136 ? 78.441  46.217  53.076 1.00 38.72 ? 2167 GLY B O     1 
ATOM   5555  N N     . ASN B 1 137 ? 79.272  45.870  51.017 1.00 40.01 ? 2168 ASN B N     1 
ATOM   5556  C CA    . ASN B 1 137 ? 79.421  47.291  50.733 1.00 42.16 ? 2168 ASN B CA    1 
ATOM   5557  C C     . ASN B 1 137 ? 78.274  47.809  49.889 1.00 43.76 ? 2168 ASN B C     1 
ATOM   5558  O O     . ASN B 1 137 ? 77.465  47.025  49.393 1.00 43.94 ? 2168 ASN B O     1 
ATOM   5559  C CB    . ASN B 1 137 ? 80.736  47.533  50.012 1.00 42.83 ? 2168 ASN B CB    1 
ATOM   5560  C CG    . ASN B 1 137 ? 81.926  47.318  50.912 1.00 44.73 ? 2168 ASN B CG    1 
ATOM   5561  O OD1   . ASN B 1 137 ? 82.177  48.108  51.836 1.00 46.50 ? 2168 ASN B OD1   1 
ATOM   5562  N ND2   . ASN B 1 137 ? 82.666  46.243  50.664 1.00 44.44 ? 2168 ASN B ND2   1 
ATOM   5563  N N     . LYS B 1 138 ? 78.207  49.128  49.726 1.00 44.23 ? 2169 LYS B N     1 
ATOM   5564  C CA    . LYS B 1 138 ? 77.145  49.736  48.937 1.00 46.37 ? 2169 LYS B CA    1 
ATOM   5565  C C     . LYS B 1 138 ? 77.127  49.092  47.563 1.00 46.25 ? 2169 LYS B C     1 
ATOM   5566  O O     . LYS B 1 138 ? 76.137  49.183  46.830 1.00 46.87 ? 2169 LYS B O     1 
ATOM   5567  C CB    . LYS B 1 138 ? 77.366  51.245  48.797 1.00 47.92 ? 2169 LYS B CB    1 
ATOM   5568  C CG    . LYS B 1 138 ? 76.904  52.056  49.997 1.00 50.44 ? 2169 LYS B CG    1 
ATOM   5569  C CD    . LYS B 1 138 ? 77.190  53.546  49.812 1.00 52.19 ? 2169 LYS B CD    1 
ATOM   5570  C CE    . LYS B 1 138 ? 78.168  54.074  50.875 1.00 52.58 ? 2169 LYS B CE    1 
ATOM   5571  N NZ    . LYS B 1 138 ? 79.078  55.149  50.354 1.00 52.66 ? 2169 LYS B NZ    1 
ATOM   5572  N N     . GLU B 1 139 ? 78.231  48.430  47.224 1.00 44.80 ? 2170 GLU B N     1 
ATOM   5573  C CA    . GLU B 1 139 ? 78.347  47.769  45.940 1.00 44.11 ? 2170 GLU B CA    1 
ATOM   5574  C C     . GLU B 1 139 ? 78.991  46.404  46.018 1.00 41.92 ? 2170 GLU B C     1 
ATOM   5575  O O     . GLU B 1 139 ? 79.852  46.163  46.854 1.00 42.05 ? 2170 GLU B O     1 
ATOM   5576  C CB    . GLU B 1 139 ? 79.159  48.628  44.995 1.00 47.09 ? 2170 GLU B CB    1 
ATOM   5577  C CG    . GLU B 1 139 ? 78.384  49.750  44.365 1.00 53.46 ? 2170 GLU B CG    1 
ATOM   5578  C CD    . GLU B 1 139 ? 79.321  50.863  43.774 1.00 57.78 ? 2170 GLU B CD    1 
ATOM   5579  O OE1   . GLU B 1 139 ? 80.264  50.450  42.957 1.00 60.86 ? 2170 GLU B OE1   1 
ATOM   5580  O OE2   . GLU B 1 139 ? 79.072  52.095  44.158 1.00 61.12 ? 2170 GLU B OE2   1 
ATOM   5581  N N     . LEU B 1 140 ? 78.552  45.512  45.138 1.00 39.73 ? 2171 LEU B N     1 
ATOM   5582  C CA    . LEU B 1 140 ? 79.092  44.158  45.037 1.00 37.18 ? 2171 LEU B CA    1 
ATOM   5583  C C     . LEU B 1 140 ? 80.350  44.319  44.159 1.00 35.17 ? 2171 LEU B C     1 
ATOM   5584  O O     . LEU B 1 140 ? 80.452  45.280  43.388 1.00 34.48 ? 2171 LEU B O     1 
ATOM   5585  C CB    . LEU B 1 140 ? 78.074  43.245  44.337 1.00 36.64 ? 2171 LEU B CB    1 
ATOM   5586  C CG    . LEU B 1 140 ? 77.275  42.173  45.090 1.00 33.65 ? 2171 LEU B CG    1 
ATOM   5587  C CD1   . LEU B 1 140 ? 77.599  42.169  46.557 1.00 34.91 ? 2171 LEU B CD1   1 
ATOM   5588  C CD2   . LEU B 1 140 ? 75.807  42.420  44.873 1.00 32.20 ? 2171 LEU B CD2   1 
ATOM   5589  N N     . PRO B 1 141 ? 81.317  43.391  44.263 1.00 33.40 ? 2172 PRO B N     1 
ATOM   5590  C CA    . PRO B 1 141 ? 82.542  43.491  43.459 1.00 33.45 ? 2172 PRO B CA    1 
ATOM   5591  C C     . PRO B 1 141 ? 82.348  43.421  41.943 1.00 33.21 ? 2172 PRO B C     1 
ATOM   5592  O O     . PRO B 1 141 ? 81.487  42.702  41.447 1.00 34.54 ? 2172 PRO B O     1 
ATOM   5593  C CB    . PRO B 1 141 ? 83.408  42.343  43.974 1.00 32.44 ? 2172 PRO B CB    1 
ATOM   5594  C CG    . PRO B 1 141 ? 82.465  41.403  44.616 1.00 32.90 ? 2172 PRO B CG    1 
ATOM   5595  C CD    . PRO B 1 141 ? 81.323  42.213  45.146 1.00 32.82 ? 2172 PRO B CD    1 
ATOM   5596  N N     . ASP B 1 142 ? 83.160  44.181  41.217 1.00 33.51 ? 2173 ASP B N     1 
ATOM   5597  C CA    . ASP B 1 142 ? 83.116  44.224  39.760 1.00 32.98 ? 2173 ASP B CA    1 
ATOM   5598  C C     . ASP B 1 142 ? 82.944  42.815  39.193 1.00 32.10 ? 2173 ASP B C     1 
ATOM   5599  O O     . ASP B 1 142 ? 83.692  41.909  39.533 1.00 31.29 ? 2173 ASP B O     1 
ATOM   5600  C CB    . ASP B 1 142 ? 84.408  44.860  39.252 1.00 35.51 ? 2173 ASP B CB    1 
ATOM   5601  C CG    . ASP B 1 142 ? 84.430  45.045  37.742 1.00 37.51 ? 2173 ASP B CG    1 
ATOM   5602  O OD1   . ASP B 1 142 ? 85.123  45.980  37.281 1.00 38.86 ? 2173 ASP B OD1   1 
ATOM   5603  O OD2   . ASP B 1 142 ? 83.769  44.264  37.018 1.00 40.08 ? 2173 ASP B OD2   1 
ATOM   5604  N N     . SER B 1 143 ? 81.952  42.636  38.328 1.00 32.00 ? 2174 SER B N     1 
ATOM   5605  C CA    . SER B 1 143 ? 81.675  41.328  37.752 1.00 32.15 ? 2174 SER B CA    1 
ATOM   5606  C C     . SER B 1 143 ? 82.744  40.869  36.772 1.00 32.31 ? 2174 SER B C     1 
ATOM   5607  O O     . SER B 1 143 ? 82.967  39.668  36.596 1.00 33.14 ? 2174 SER B O     1 
ATOM   5608  C CB    . SER B 1 143 ? 80.290  41.319  37.082 1.00 31.19 ? 2174 SER B CB    1 
ATOM   5609  O OG    . SER B 1 143 ? 80.076  42.464  36.282 1.00 31.14 ? 2174 SER B OG    1 
ATOM   5610  N N     . LYS B 1 144 ? 83.403  41.817  36.121 1.00 32.13 ? 2175 LYS B N     1 
ATOM   5611  C CA    . LYS B 1 144 ? 84.464  41.468  35.191 1.00 32.83 ? 2175 LYS B CA    1 
ATOM   5612  C C     . LYS B 1 144 ? 85.596  40.839  35.996 1.00 33.21 ? 2175 LYS B C     1 
ATOM   5613  O O     . LYS B 1 144 ? 86.204  39.856  35.564 1.00 33.29 ? 2175 LYS B O     1 
ATOM   5614  C CB    . LYS B 1 144 ? 84.979  42.707  34.488 1.00 33.74 ? 2175 LYS B CB    1 
ATOM   5615  C CG    . LYS B 1 144 ? 85.854  42.405  33.291 1.00 36.00 ? 2175 LYS B CG    1 
ATOM   5616  C CD    . LYS B 1 144 ? 86.454  43.692  32.731 1.00 37.74 ? 2175 LYS B CD    1 
ATOM   5617  C CE    . LYS B 1 144 ? 87.854  43.459  32.191 1.00 38.32 ? 2175 LYS B CE    1 
ATOM   5618  N NZ    . LYS B 1 144 ? 88.283  44.538  31.243 1.00 40.23 ? 2175 LYS B NZ    1 
ATOM   5619  N N     . GLU B 1 145 ? 85.857  41.420  37.171 1.00 33.15 ? 2176 GLU B N     1 
ATOM   5620  C CA    . GLU B 1 145 ? 86.896  40.961  38.099 1.00 32.71 ? 2176 GLU B CA    1 
ATOM   5621  C C     . GLU B 1 145 ? 86.635  39.538  38.558 1.00 32.10 ? 2176 GLU B C     1 
ATOM   5622  O O     . GLU B 1 145 ? 87.520  38.684  38.519 1.00 31.63 ? 2176 GLU B O     1 
ATOM   5623  C CB    . GLU B 1 145 ? 86.939  41.865  39.326 1.00 34.88 ? 2176 GLU B CB    1 
ATOM   5624  C CG    . GLU B 1 145 ? 87.753  43.118  39.139 1.00 38.62 ? 2176 GLU B CG    1 
ATOM   5625  C CD    . GLU B 1 145 ? 89.194  42.799  38.849 1.00 42.70 ? 2176 GLU B CD    1 
ATOM   5626  O OE1   . GLU B 1 145 ? 89.954  42.631  39.828 1.00 45.02 ? 2176 GLU B OE1   1 
ATOM   5627  O OE2   . GLU B 1 145 ? 89.560  42.705  37.649 1.00 45.00 ? 2176 GLU B OE2   1 
ATOM   5628  N N     . VAL B 1 146 ? 85.409  39.298  39.010 1.00 31.15 ? 2177 VAL B N     1 
ATOM   5629  C CA    . VAL B 1 146 ? 85.003  37.978  39.472 1.00 29.45 ? 2177 VAL B CA    1 
ATOM   5630  C C     . VAL B 1 146 ? 85.105  37.015  38.298 1.00 28.58 ? 2177 VAL B C     1 
ATOM   5631  O O     . VAL B 1 146 ? 85.674  35.937  38.404 1.00 28.15 ? 2177 VAL B O     1 
ATOM   5632  C CB    . VAL B 1 146 ? 83.551  38.003  39.997 1.00 29.83 ? 2177 VAL B CB    1 
ATOM   5633  C CG1   . VAL B 1 146 ? 83.198  36.653  40.629 1.00 30.53 ? 2177 VAL B CG1   1 
ATOM   5634  C CG2   . VAL B 1 146 ? 83.387  39.122  41.019 1.00 26.46 ? 2177 VAL B CG2   1 
ATOM   5635  N N     . LEU B 1 147 ? 84.554  37.432  37.169 1.00 28.87 ? 2178 LEU B N     1 
ATOM   5636  C CA    . LEU B 1 147 ? 84.575  36.646  35.940 1.00 29.44 ? 2178 LEU B CA    1 
ATOM   5637  C C     . LEU B 1 147 ? 85.989  36.128  35.630 1.00 30.95 ? 2178 LEU B C     1 
ATOM   5638  O O     . LEU B 1 147 ? 86.244  34.920  35.583 1.00 30.05 ? 2178 LEU B O     1 
ATOM   5639  C CB    . LEU B 1 147 ? 84.094  37.527  34.790 1.00 28.82 ? 2178 LEU B CB    1 
ATOM   5640  C CG    . LEU B 1 147 ? 83.418  36.945  33.552 1.00 30.11 ? 2178 LEU B CG    1 
ATOM   5641  C CD1   . LEU B 1 147 ? 83.943  37.699  32.352 1.00 28.71 ? 2178 LEU B CD1   1 
ATOM   5642  C CD2   . LEU B 1 147 ? 83.677  35.459  33.404 1.00 30.71 ? 2178 LEU B CD2   1 
ATOM   5643  N N     . GLU B 1 148 ? 86.909  37.062  35.423 1.00 32.05 ? 2179 GLU B N     1 
ATOM   5644  C CA    . GLU B 1 148 ? 88.299  36.731  35.103 1.00 33.58 ? 2179 GLU B CA    1 
ATOM   5645  C C     . GLU B 1 148 ? 89.079  35.964  36.172 1.00 33.38 ? 2179 GLU B C     1 
ATOM   5646  O O     . GLU B 1 148 ? 89.658  34.915  35.898 1.00 33.61 ? 2179 GLU B O     1 
ATOM   5647  C CB    . GLU B 1 148 ? 89.049  38.011  34.774 1.00 33.10 ? 2179 GLU B CB    1 
ATOM   5648  C CG    . GLU B 1 148 ? 88.360  38.843  33.741 1.00 36.74 ? 2179 GLU B CG    1 
ATOM   5649  C CD    . GLU B 1 148 ? 89.188  40.046  33.366 1.00 37.53 ? 2179 GLU B CD    1 
ATOM   5650  O OE1   . GLU B 1 148 ? 89.667  40.748  34.291 1.00 39.19 ? 2179 GLU B OE1   1 
ATOM   5651  O OE2   . GLU B 1 148 ? 89.366  40.279  32.153 1.00 38.07 ? 2179 GLU B OE2   1 
ATOM   5652  N N     . LYS B 1 149 ? 89.093  36.494  37.389 1.00 32.96 ? 2180 LYS B N     1 
ATOM   5653  C CA    . LYS B 1 149 ? 89.829  35.865  38.470 1.00 32.05 ? 2180 LYS B CA    1 
ATOM   5654  C C     . LYS B 1 149 ? 89.457  34.434  38.786 1.00 30.70 ? 2180 LYS B C     1 
ATOM   5655  O O     . LYS B 1 149 ? 90.330  33.613  39.040 1.00 31.40 ? 2180 LYS B O     1 
ATOM   5656  C CB    . LYS B 1 149 ? 89.690  36.686  39.739 1.00 32.79 ? 2180 LYS B CB    1 
ATOM   5657  C CG    . LYS B 1 149 ? 90.183  38.094  39.586 1.00 34.25 ? 2180 LYS B CG    1 
ATOM   5658  C CD    . LYS B 1 149 ? 91.050  38.493  40.747 1.00 35.39 ? 2180 LYS B CD    1 
ATOM   5659  C CE    . LYS B 1 149 ? 92.234  39.297  40.252 1.00 36.74 ? 2180 LYS B CE    1 
ATOM   5660  N NZ    . LYS B 1 149 ? 92.022  40.733  40.545 1.00 37.92 ? 2180 LYS B NZ    1 
ATOM   5661  N N     . VAL B 1 150 ? 88.170  34.114  38.777 1.00 30.42 ? 2181 VAL B N     1 
ATOM   5662  C CA    . VAL B 1 150 ? 87.778  32.761  39.138 1.00 28.53 ? 2181 VAL B CA    1 
ATOM   5663  C C     . VAL B 1 150 ? 86.811  32.010  38.233 1.00 27.74 ? 2181 VAL B C     1 
ATOM   5664  O O     . VAL B 1 150 ? 86.548  30.835  38.481 1.00 27.55 ? 2181 VAL B O     1 
ATOM   5665  C CB    . VAL B 1 150 ? 87.198  32.741  40.565 1.00 29.14 ? 2181 VAL B CB    1 
ATOM   5666  C CG1   . VAL B 1 150 ? 88.315  32.923  41.577 1.00 27.44 ? 2181 VAL B CG1   1 
ATOM   5667  C CG2   . VAL B 1 150 ? 86.160  33.851  40.727 1.00 28.02 ? 2181 VAL B CG2   1 
ATOM   5668  N N     . LEU B 1 151 ? 86.301  32.649  37.183 1.00 26.33 ? 2182 LEU B N     1 
ATOM   5669  C CA    . LEU B 1 151 ? 85.348  31.973  36.303 1.00 25.15 ? 2182 LEU B CA    1 
ATOM   5670  C C     . LEU B 1 151 ? 85.915  31.588  34.948 1.00 24.66 ? 2182 LEU B C     1 
ATOM   5671  O O     . LEU B 1 151 ? 85.635  30.507  34.437 1.00 25.17 ? 2182 LEU B O     1 
ATOM   5672  C CB    . LEU B 1 151 ? 84.092  32.841  36.084 1.00 23.26 ? 2182 LEU B CB    1 
ATOM   5673  C CG    . LEU B 1 151 ? 83.199  33.186  37.287 1.00 21.96 ? 2182 LEU B CG    1 
ATOM   5674  C CD1   . LEU B 1 151 ? 81.846  33.654  36.789 1.00 18.96 ? 2182 LEU B CD1   1 
ATOM   5675  C CD2   . LEU B 1 151 ? 83.030  31.970  38.201 1.00 20.76 ? 2182 LEU B CD2   1 
ATOM   5676  N N     . LEU B 1 152 ? 86.701  32.469  34.352 1.00 25.30 ? 2183 LEU B N     1 
ATOM   5677  C CA    . LEU B 1 152 ? 87.256  32.171  33.041 1.00 25.83 ? 2183 LEU B CA    1 
ATOM   5678  C C     . LEU B 1 152 ? 88.157  30.953  33.002 1.00 26.16 ? 2183 LEU B C     1 
ATOM   5679  O O     . LEU B 1 152 ? 88.884  30.646  33.945 1.00 24.77 ? 2183 LEU B O     1 
ATOM   5680  C CB    . LEU B 1 152 ? 87.987  33.390  32.484 1.00 24.98 ? 2183 LEU B CB    1 
ATOM   5681  C CG    . LEU B 1 152 ? 86.980  34.435  32.011 1.00 26.09 ? 2183 LEU B CG    1 
ATOM   5682  C CD1   . LEU B 1 152 ? 87.713  35.621  31.424 1.00 28.18 ? 2183 LEU B CD1   1 
ATOM   5683  C CD2   . LEU B 1 152 ? 86.057  33.837  30.971 1.00 25.80 ? 2183 LEU B CD2   1 
ATOM   5684  N N     . ARG B 1 153 ? 88.091  30.262  31.875 1.00 27.64 ? 2184 ARG B N     1 
ATOM   5685  C CA    . ARG B 1 153 ? 88.869  29.053  31.658 1.00 29.82 ? 2184 ARG B CA    1 
ATOM   5686  C C     . ARG B 1 153 ? 90.279  29.353  31.167 1.00 31.49 ? 2184 ARG B C     1 
ATOM   5687  O O     . ARG B 1 153 ? 90.465  30.166  30.261 1.00 31.63 ? 2184 ARG B O     1 
ATOM   5688  C CB    . ARG B 1 153 ? 88.165  28.171  30.618 1.00 26.29 ? 2184 ARG B CB    1 
ATOM   5689  C CG    . ARG B 1 153 ? 89.031  27.085  30.013 1.00 24.41 ? 2184 ARG B CG    1 
ATOM   5690  C CD    . ARG B 1 153 ? 88.270  26.327  28.945 1.00 23.97 ? 2184 ARG B CD    1 
ATOM   5691  N NE    . ARG B 1 153 ? 87.046  25.715  29.467 1.00 25.19 ? 2184 ARG B NE    1 
ATOM   5692  C CZ    . ARG B 1 153 ? 86.094  25.163  28.712 1.00 24.20 ? 2184 ARG B CZ    1 
ATOM   5693  N NH1   . ARG B 1 153 ? 86.212  25.138  27.391 1.00 23.09 ? 2184 ARG B NH1   1 
ATOM   5694  N NH2   . ARG B 1 153 ? 85.017  24.639  29.283 1.00 22.77 ? 2184 ARG B NH2   1 
ATOM   5695  N N     . ARG B 1 154 ? 91.268  28.711  31.777 1.00 33.96 ? 2185 ARG B N     1 
ATOM   5696  C CA    . ARG B 1 154 ? 92.645  28.863  31.312 1.00 37.60 ? 2185 ARG B CA    1 
ATOM   5697  C C     . ARG B 1 154 ? 92.852  27.606  30.458 1.00 38.74 ? 2185 ARG B C     1 
ATOM   5698  O O     . ARG B 1 154 ? 92.890  27.671  29.228 1.00 40.58 ? 2185 ARG B O     1 
ATOM   5699  C CB    . ARG B 1 154 ? 93.634  28.893  32.478 1.00 37.16 ? 2185 ARG B CB    1 
ATOM   5700  C CG    . ARG B 1 154 ? 93.063  29.423  33.774 1.00 38.48 ? 2185 ARG B CG    1 
ATOM   5701  C CD    . ARG B 1 154 ? 92.831  30.916  33.745 1.00 38.89 ? 2185 ARG B CD    1 
ATOM   5702  N NE    . ARG B 1 154 ? 92.017  31.340  34.884 1.00 40.50 ? 2185 ARG B NE    1 
ATOM   5703  C CZ    . ARG B 1 154 ? 91.887  32.600  35.293 1.00 41.53 ? 2185 ARG B CZ    1 
ATOM   5704  N NH1   . ARG B 1 154 ? 92.516  33.575  34.663 1.00 43.52 ? 2185 ARG B NH1   1 
ATOM   5705  N NH2   . ARG B 1 154 ? 91.119  32.888  36.328 1.00 41.89 ? 2185 ARG B NH2   1 
ATOM   5706  N N     . GLU B 1 155 ? 92.946  26.458  31.114 1.00 40.00 ? 2186 GLU B N     1 
ATOM   5707  C CA    . GLU B 1 155 ? 93.094  25.189  30.406 1.00 39.99 ? 2186 GLU B CA    1 
ATOM   5708  C C     . GLU B 1 155 ? 91.770  24.438  30.553 1.00 37.00 ? 2186 GLU B C     1 
ATOM   5709  O O     . GLU B 1 155 ? 91.173  24.415  31.627 1.00 35.22 ? 2186 GLU B O     1 
ATOM   5710  C CB    . GLU B 1 155 ? 94.217  24.349  31.017 1.00 44.01 ? 2186 GLU B CB    1 
ATOM   5711  C CG    . GLU B 1 155 ? 95.612  24.807  30.656 1.00 50.50 ? 2186 GLU B CG    1 
ATOM   5712  C CD    . GLU B 1 155 ? 96.698  24.065  31.438 1.00 55.68 ? 2186 GLU B CD    1 
ATOM   5713  O OE1   . GLU B 1 155 ? 96.382  23.008  32.040 1.00 57.09 ? 2186 GLU B OE1   1 
ATOM   5714  O OE2   . GLU B 1 155 ? 97.866  24.541  31.445 1.00 58.79 ? 2186 GLU B OE2   1 
ATOM   5715  N N     . PHE B 1 156 ? 91.315  23.822  29.476 1.00 33.94 ? 2187 PHE B N     1 
ATOM   5716  C CA    . PHE B 1 156 ? 90.065  23.075  29.519 1.00 30.72 ? 2187 PHE B CA    1 
ATOM   5717  C C     . PHE B 1 156 ? 90.123  22.060  30.657 1.00 29.35 ? 2187 PHE B C     1 
ATOM   5718  O O     . PHE B 1 156 ? 91.081  21.296  30.770 1.00 30.22 ? 2187 PHE B O     1 
ATOM   5719  C CB    . PHE B 1 156 ? 89.848  22.359  28.169 1.00 28.82 ? 2187 PHE B CB    1 
ATOM   5720  C CG    . PHE B 1 156 ? 88.609  21.494  28.112 1.00 26.99 ? 2187 PHE B CG    1 
ATOM   5721  C CD1   . PHE B 1 156 ? 88.715  20.109  28.004 1.00 25.19 ? 2187 PHE B CD1   1 
ATOM   5722  C CD2   . PHE B 1 156 ? 87.333  22.064  28.166 1.00 27.07 ? 2187 PHE B CD2   1 
ATOM   5723  C CE1   . PHE B 1 156 ? 87.574  19.305  27.954 1.00 24.35 ? 2187 PHE B CE1   1 
ATOM   5724  C CE2   . PHE B 1 156 ? 86.190  21.269  28.117 1.00 23.80 ? 2187 PHE B CE2   1 
ATOM   5725  C CZ    . PHE B 1 156 ? 86.313  19.890  28.011 1.00 23.89 ? 2187 PHE B CZ    1 
ATOM   5726  N N     . ILE B 1 157 ? 89.117  22.080  31.525 1.00 28.27 ? 2188 ILE B N     1 
ATOM   5727  C CA    . ILE B 1 157 ? 89.051  21.117  32.617 1.00 26.13 ? 2188 ILE B CA    1 
ATOM   5728  C C     . ILE B 1 157 ? 87.914  20.183  32.215 1.00 26.97 ? 2188 ILE B C     1 
ATOM   5729  O O     . ILE B 1 157 ? 86.750  20.579  32.220 1.00 27.30 ? 2188 ILE B O     1 
ATOM   5730  C CB    . ILE B 1 157 ? 88.671  21.767  33.966 1.00 23.82 ? 2188 ILE B CB    1 
ATOM   5731  C CG1   . ILE B 1 157 ? 89.723  22.786  34.383 1.00 21.27 ? 2188 ILE B CG1   1 
ATOM   5732  C CG2   . ILE B 1 157 ? 88.507  20.680  35.039 1.00 22.21 ? 2188 ILE B CG2   1 
ATOM   5733  C CD1   . ILE B 1 157 ? 89.337  23.553  35.637 1.00 17.14 ? 2188 ILE B CD1   1 
ATOM   5734  N N     . PRO B 1 158 ? 88.239  18.942  31.841 1.00 27.77 ? 2189 PRO B N     1 
ATOM   5735  C CA    . PRO B 1 158 ? 87.216  17.969  31.431 1.00 27.84 ? 2189 PRO B CA    1 
ATOM   5736  C C     . PRO B 1 158 ? 86.372  17.509  32.594 1.00 27.97 ? 2189 PRO B C     1 
ATOM   5737  O O     . PRO B 1 158 ? 86.868  17.414  33.716 1.00 28.97 ? 2189 PRO B O     1 
ATOM   5738  C CB    . PRO B 1 158 ? 88.025  16.817  30.840 1.00 28.60 ? 2189 PRO B CB    1 
ATOM   5739  C CG    . PRO B 1 158 ? 89.350  16.901  31.561 1.00 27.45 ? 2189 PRO B CG    1 
ATOM   5740  C CD    . PRO B 1 158 ? 89.600  18.376  31.779 1.00 27.66 ? 2189 PRO B CD    1 
ATOM   5741  N N     . ASP B 1 159 ? 85.102  17.221  32.323 1.00 27.64 ? 2190 ASP B N     1 
ATOM   5742  C CA    . ASP B 1 159 ? 84.178  16.753  33.359 1.00 27.84 ? 2190 ASP B CA    1 
ATOM   5743  C C     . ASP B 1 159 ? 84.555  15.340  33.796 1.00 27.04 ? 2190 ASP B C     1 
ATOM   5744  O O     . ASP B 1 159 ? 84.577  14.411  32.993 1.00 26.69 ? 2190 ASP B O     1 
ATOM   5745  C CB    . ASP B 1 159 ? 82.737  16.762  32.828 1.00 27.66 ? 2190 ASP B CB    1 
ATOM   5746  C CG    . ASP B 1 159 ? 81.790  15.891  33.658 1.00 27.94 ? 2190 ASP B CG    1 
ATOM   5747  O OD1   . ASP B 1 159 ? 81.952  15.831  34.895 1.00 30.83 ? 2190 ASP B OD1   1 
ATOM   5748  O OD2   . ASP B 1 159 ? 80.875  15.266  33.078 1.00 27.56 ? 2190 ASP B OD2   1 
ATOM   5749  N N     . PRO B 1 160 ? 84.847  15.155  35.085 1.00 27.34 ? 2191 PRO B N     1 
ATOM   5750  C CA    . PRO B 1 160 ? 85.219  13.821  35.573 1.00 28.18 ? 2191 PRO B CA    1 
ATOM   5751  C C     . PRO B 1 160 ? 84.151  12.741  35.363 1.00 27.78 ? 2191 PRO B C     1 
ATOM   5752  O O     . PRO B 1 160 ? 84.472  11.561  35.270 1.00 27.61 ? 2191 PRO B O     1 
ATOM   5753  C CB    . PRO B 1 160 ? 85.516  14.049  37.054 1.00 27.59 ? 2191 PRO B CB    1 
ATOM   5754  C CG    . PRO B 1 160 ? 84.813  15.318  37.395 1.00 28.86 ? 2191 PRO B CG    1 
ATOM   5755  C CD    . PRO B 1 160 ? 84.846  16.160  36.159 1.00 27.58 ? 2191 PRO B CD    1 
ATOM   5756  N N     . GLN B 1 161 ? 82.886  13.148  35.297 1.00 28.15 ? 2192 GLN B N     1 
ATOM   5757  C CA    . GLN B 1 161 ? 81.780  12.206  35.111 1.00 27.17 ? 2192 GLN B CA    1 
ATOM   5758  C C     . GLN B 1 161 ? 81.587  11.776  33.671 1.00 25.73 ? 2192 GLN B C     1 
ATOM   5759  O O     . GLN B 1 161 ? 80.718  10.965  33.381 1.00 25.26 ? 2192 GLN B O     1 
ATOM   5760  C CB    . GLN B 1 161 ? 80.478  12.807  35.641 1.00 27.92 ? 2192 GLN B CB    1 
ATOM   5761  C CG    . GLN B 1 161 ? 80.527  13.083  37.133 1.00 29.30 ? 2192 GLN B CG    1 
ATOM   5762  C CD    . GLN B 1 161 ? 79.162  13.287  37.738 1.00 30.19 ? 2192 GLN B CD    1 
ATOM   5763  O OE1   . GLN B 1 161 ? 78.991  14.114  38.637 1.00 32.18 ? 2192 GLN B OE1   1 
ATOM   5764  N NE2   . GLN B 1 161 ? 78.175  12.533  37.253 1.00 30.22 ? 2192 GLN B NE2   1 
ATOM   5765  N N     . GLY B 1 162 ? 82.387  12.330  32.768 1.00 24.73 ? 2193 GLY B N     1 
ATOM   5766  C CA    . GLY B 1 162 ? 82.307  11.935  31.373 1.00 24.51 ? 2193 GLY B CA    1 
ATOM   5767  C C     . GLY B 1 162 ? 81.243  12.531  30.471 1.00 24.49 ? 2193 GLY B C     1 
ATOM   5768  O O     . GLY B 1 162 ? 81.025  12.033  29.362 1.00 22.94 ? 2193 GLY B O     1 
ATOM   5769  N N     . SER B 1 163 ? 80.582  13.590  30.919 1.00 24.26 ? 2194 SER B N     1 
ATOM   5770  C CA    . SER B 1 163 ? 79.554  14.212  30.098 1.00 23.73 ? 2194 SER B CA    1 
ATOM   5771  C C     . SER B 1 163 ? 80.117  14.499  28.706 1.00 24.77 ? 2194 SER B C     1 
ATOM   5772  O O     . SER B 1 163 ? 81.271  14.878  28.570 1.00 24.56 ? 2194 SER B O     1 
ATOM   5773  C CB    . SER B 1 163 ? 79.086  15.510  30.750 1.00 23.71 ? 2194 SER B CB    1 
ATOM   5774  O OG    . SER B 1 163 ? 78.541  15.264  32.027 1.00 24.04 ? 2194 SER B OG    1 
ATOM   5775  N N     . ASN B 1 164 ? 79.312  14.311  27.664 1.00 25.61 ? 2195 ASN B N     1 
ATOM   5776  C CA    . ASN B 1 164 ? 79.784  14.575  26.312 1.00 24.92 ? 2195 ASN B CA    1 
ATOM   5777  C C     . ASN B 1 164 ? 78.976  15.679  25.639 1.00 25.60 ? 2195 ASN B C     1 
ATOM   5778  O O     . ASN B 1 164 ? 78.220  16.396  26.291 1.00 26.22 ? 2195 ASN B O     1 
ATOM   5779  C CB    . ASN B 1 164 ? 79.742  13.300  25.473 1.00 24.96 ? 2195 ASN B CB    1 
ATOM   5780  C CG    . ASN B 1 164 ? 78.369  12.672  25.436 1.00 26.37 ? 2195 ASN B CG    1 
ATOM   5781  O OD1   . ASN B 1 164 ? 77.365  13.343  25.669 1.00 28.20 ? 2195 ASN B OD1   1 
ATOM   5782  N ND2   . ASN B 1 164 ? 78.316  11.376  25.134 1.00 24.38 ? 2195 ASN B ND2   1 
ATOM   5783  N N     . MET B 1 165 ? 79.145  15.827  24.331 1.00 25.15 ? 2196 MET B N     1 
ATOM   5784  C CA    . MET B 1 165 ? 78.427  16.864  23.605 1.00 24.52 ? 2196 MET B CA    1 
ATOM   5785  C C     . MET B 1 165 ? 76.971  16.496  23.358 1.00 23.61 ? 2196 MET B C     1 
ATOM   5786  O O     . MET B 1 165 ? 76.147  17.363  23.081 1.00 24.29 ? 2196 MET B O     1 
ATOM   5787  C CB    . MET B 1 165 ? 79.135  17.164  22.286 1.00 23.55 ? 2196 MET B CB    1 
ATOM   5788  C CG    . MET B 1 165 ? 80.428  17.949  22.472 1.00 23.84 ? 2196 MET B CG    1 
ATOM   5789  S SD    . MET B 1 165 ? 80.238  19.457  23.480 1.00 24.83 ? 2196 MET B SD    1 
ATOM   5790  C CE    . MET B 1 165 ? 80.670  18.852  25.064 1.00 26.26 ? 2196 MET B CE    1 
ATOM   5791  N N     . MET B 1 166 ? 76.654  15.211  23.443 1.00 21.94 ? 2197 MET B N     1 
ATOM   5792  C CA    . MET B 1 166 ? 75.280  14.785  23.266 1.00 21.93 ? 2197 MET B CA    1 
ATOM   5793  C C     . MET B 1 166 ? 74.533  15.349  24.473 1.00 21.66 ? 2197 MET B C     1 
ATOM   5794  O O     . MET B 1 166 ? 73.426  15.872  24.348 1.00 22.50 ? 2197 MET B O     1 
ATOM   5795  C CB    . MET B 1 166 ? 75.180  13.259  23.284 1.00 22.11 ? 2197 MET B CB    1 
ATOM   5796  C CG    . MET B 1 166 ? 75.461  12.595  21.956 1.00 23.91 ? 2197 MET B CG    1 
ATOM   5797  S SD    . MET B 1 166 ? 74.528  13.327  20.601 1.00 25.11 ? 2197 MET B SD    1 
ATOM   5798  C CE    . MET B 1 166 ? 73.095  12.229  20.582 1.00 24.88 ? 2197 MET B CE    1 
ATOM   5799  N N     . PHE B 1 167 ? 75.159  15.251  25.643 1.00 19.26 ? 2198 PHE B N     1 
ATOM   5800  C CA    . PHE B 1 167 ? 74.557  15.740  26.873 1.00 18.03 ? 2198 PHE B CA    1 
ATOM   5801  C C     . PHE B 1 167 ? 74.478  17.267  26.895 1.00 19.28 ? 2198 PHE B C     1 
ATOM   5802  O O     . PHE B 1 167 ? 73.444  17.853  27.244 1.00 20.40 ? 2198 PHE B O     1 
ATOM   5803  C CB    . PHE B 1 167 ? 75.357  15.258  28.088 1.00 16.72 ? 2198 PHE B CB    1 
ATOM   5804  C CG    . PHE B 1 167 ? 74.903  15.872  29.383 1.00 15.36 ? 2198 PHE B CG    1 
ATOM   5805  C CD1   . PHE B 1 167 ? 73.929  15.252  30.153 1.00 14.23 ? 2198 PHE B CD1   1 
ATOM   5806  C CD2   . PHE B 1 167 ? 75.390  17.102  29.791 1.00 13.79 ? 2198 PHE B CD2   1 
ATOM   5807  C CE1   . PHE B 1 167 ? 73.436  15.851  31.310 1.00 15.59 ? 2198 PHE B CE1   1 
ATOM   5808  C CE2   . PHE B 1 167 ? 74.902  17.708  30.948 1.00 14.89 ? 2198 PHE B CE2   1 
ATOM   5809  C CZ    . PHE B 1 167 ? 73.919  17.080  31.708 1.00 14.07 ? 2198 PHE B CZ    1 
ATOM   5810  N N     . ALA B 1 168 ? 75.573  17.920  26.530 1.00 18.30 ? 2199 ALA B N     1 
ATOM   5811  C CA    . ALA B 1 168 ? 75.606  19.371  26.534 1.00 17.75 ? 2199 ALA B CA    1 
ATOM   5812  C C     . ALA B 1 168 ? 74.511  19.982  25.671 1.00 18.66 ? 2199 ALA B C     1 
ATOM   5813  O O     . ALA B 1 168 ? 73.850  20.937  26.077 1.00 19.78 ? 2199 ALA B O     1 
ATOM   5814  C CB    . ALA B 1 168 ? 76.972  19.867  26.072 1.00 15.56 ? 2199 ALA B CB    1 
ATOM   5815  N N     . PHE B 1 169 ? 74.325  19.444  24.471 1.00 19.68 ? 2200 PHE B N     1 
ATOM   5816  C CA    . PHE B 1 169 ? 73.315  19.970  23.570 1.00 18.81 ? 2200 PHE B CA    1 
ATOM   5817  C C     . PHE B 1 169 ? 71.904  19.563  23.940 1.00 19.15 ? 2200 PHE B C     1 
ATOM   5818  O O     . PHE B 1 169 ? 70.956  20.285  23.638 1.00 20.05 ? 2200 PHE B O     1 
ATOM   5819  C CB    . PHE B 1 169 ? 73.639  19.570  22.145 1.00 18.20 ? 2200 PHE B CB    1 
ATOM   5820  C CG    . PHE B 1 169 ? 74.668  20.459  21.510 1.00 19.36 ? 2200 PHE B CG    1 
ATOM   5821  C CD1   . PHE B 1 169 ? 74.315  21.714  21.027 1.00 18.92 ? 2200 PHE B CD1   1 
ATOM   5822  C CD2   . PHE B 1 169 ? 76.006  20.065  21.440 1.00 19.77 ? 2200 PHE B CD2   1 
ATOM   5823  C CE1   . PHE B 1 169 ? 75.289  22.576  20.477 1.00 20.14 ? 2200 PHE B CE1   1 
ATOM   5824  C CE2   . PHE B 1 169 ? 76.991  20.916  20.892 1.00 18.70 ? 2200 PHE B CE2   1 
ATOM   5825  C CZ    . PHE B 1 169 ? 76.631  22.174  20.412 1.00 18.24 ? 2200 PHE B CZ    1 
ATOM   5826  N N     . PHE B 1 170 ? 71.753  18.421  24.603 1.00 19.45 ? 2201 PHE B N     1 
ATOM   5827  C CA    . PHE B 1 170 ? 70.430  17.994  25.031 1.00 18.81 ? 2201 PHE B CA    1 
ATOM   5828  C C     . PHE B 1 170 ? 69.982  18.940  26.140 1.00 21.17 ? 2201 PHE B C     1 
ATOM   5829  O O     . PHE B 1 170 ? 68.811  19.309  26.227 1.00 20.08 ? 2201 PHE B O     1 
ATOM   5830  C CB    . PHE B 1 170 ? 70.475  16.583  25.577 1.00 17.36 ? 2201 PHE B CB    1 
ATOM   5831  C CG    . PHE B 1 170 ? 69.124  16.042  25.960 1.00 17.40 ? 2201 PHE B CG    1 
ATOM   5832  C CD1   . PHE B 1 170 ? 68.468  15.130  25.128 1.00 15.44 ? 2201 PHE B CD1   1 
ATOM   5833  C CD2   . PHE B 1 170 ? 68.504  16.444  27.147 1.00 15.32 ? 2201 PHE B CD2   1 
ATOM   5834  C CE1   . PHE B 1 170 ? 67.211  14.623  25.468 1.00 15.07 ? 2201 PHE B CE1   1 
ATOM   5835  C CE2   . PHE B 1 170 ? 67.245  15.947  27.502 1.00 15.15 ? 2201 PHE B CE2   1 
ATOM   5836  C CZ    . PHE B 1 170 ? 66.594  15.033  26.661 1.00 15.37 ? 2201 PHE B CZ    1 
ATOM   5837  N N     . ALA B 1 171 ? 70.926  19.327  26.994 1.00 22.08 ? 2202 ALA B N     1 
ATOM   5838  C CA    . ALA B 1 171 ? 70.635  20.235  28.102 1.00 23.12 ? 2202 ALA B CA    1 
ATOM   5839  C C     . ALA B 1 171 ? 70.157  21.558  27.544 1.00 23.82 ? 2202 ALA B C     1 
ATOM   5840  O O     . ALA B 1 171 ? 69.222  22.165  28.041 1.00 25.68 ? 2202 ALA B O     1 
ATOM   5841  C CB    . ALA B 1 171 ? 71.890  20.456  28.955 1.00 21.88 ? 2202 ALA B CB    1 
ATOM   5842  N N     . GLN B 1 172 ? 70.816  22.007  26.489 1.00 24.63 ? 2203 GLN B N     1 
ATOM   5843  C CA    . GLN B 1 172 ? 70.476  23.262  25.856 1.00 25.22 ? 2203 GLN B CA    1 
ATOM   5844  C C     . GLN B 1 172 ? 69.128  23.207  25.144 1.00 23.73 ? 2203 GLN B C     1 
ATOM   5845  O O     . GLN B 1 172 ? 68.287  24.091  25.275 1.00 22.48 ? 2203 GLN B O     1 
ATOM   5846  C CB    . GLN B 1 172 ? 71.544  23.581  24.851 1.00 27.44 ? 2203 GLN B CB    1 
ATOM   5847  C CG    . GLN B 1 172 ? 71.260  24.779  24.039 1.00 35.14 ? 2203 GLN B CG    1 
ATOM   5848  C CD    . GLN B 1 172 ? 72.027  25.935  24.708 1.00 41.36 ? 2203 GLN B CD    1 
ATOM   5849  O OE1   . GLN B 1 172 ? 72.439  25.854  25.803 1.00 45.17 ? 2203 GLN B OE1   1 
ATOM   5850  N NE2   . GLN B 1 172 ? 72.254  26.967  23.988 1.00 42.20 ? 2203 GLN B NE2   1 
ATOM   5851  N N     . HIS B 1 173 ? 68.942  22.149  24.371 1.00 22.73 ? 2204 HIS B N     1 
ATOM   5852  C CA    . HIS B 1 173 ? 67.709  21.959  23.627 1.00 21.09 ? 2204 HIS B CA    1 
ATOM   5853  C C     . HIS B 1 173 ? 66.499  21.767  24.580 1.00 20.80 ? 2204 HIS B C     1 
ATOM   5854  O O     . HIS B 1 173 ? 65.480  22.465  24.501 1.00 21.35 ? 2204 HIS B O     1 
ATOM   5855  C CB    . HIS B 1 173 ? 67.892  20.739  22.720 1.00 20.03 ? 2204 HIS B CB    1 
ATOM   5856  C CG    . HIS B 1 173 ? 66.687  20.413  21.892 1.00 20.07 ? 2204 HIS B CG    1 
ATOM   5857  N ND1   . HIS B 1 173 ? 65.777  19.444  22.255 1.00 19.68 ? 2204 HIS B ND1   1 
ATOM   5858  C CD2   . HIS B 1 173 ? 66.256  20.917  20.711 1.00 18.40 ? 2204 HIS B CD2   1 
ATOM   5859  C CE1   . HIS B 1 173 ? 64.836  19.360  21.338 1.00 19.25 ? 2204 HIS B CE1   1 
ATOM   5860  N NE2   . HIS B 1 173 ? 65.101  20.244  20.388 1.00 19.35 ? 2204 HIS B NE2   1 
ATOM   5861  N N     . PHE B 1 174 ? 66.628  20.821  25.498 1.00 19.40 ? 2205 PHE B N     1 
ATOM   5862  C CA    . PHE B 1 174 ? 65.576  20.535  26.448 1.00 16.83 ? 2205 PHE B CA    1 
ATOM   5863  C C     . PHE B 1 174 ? 65.120  21.761  27.218 1.00 15.93 ? 2205 PHE B C     1 
ATOM   5864  O O     . PHE B 1 174 ? 63.970  22.146  27.136 1.00 14.63 ? 2205 PHE B O     1 
ATOM   5865  C CB    . PHE B 1 174 ? 66.063  19.469  27.419 1.00 16.70 ? 2205 PHE B CB    1 
ATOM   5866  C CG    . PHE B 1 174 ? 65.127  19.205  28.546 1.00 16.98 ? 2205 PHE B CG    1 
ATOM   5867  C CD1   . PHE B 1 174 ? 63.844  18.707  28.298 1.00 17.49 ? 2205 PHE B CD1   1 
ATOM   5868  C CD2   . PHE B 1 174 ? 65.514  19.456  29.863 1.00 17.44 ? 2205 PHE B CD2   1 
ATOM   5869  C CE1   . PHE B 1 174 ? 62.949  18.461  29.349 1.00 15.43 ? 2205 PHE B CE1   1 
ATOM   5870  C CE2   . PHE B 1 174 ? 64.623  19.211  30.931 1.00 17.64 ? 2205 PHE B CE2   1 
ATOM   5871  C CZ    . PHE B 1 174 ? 63.338  18.714  30.666 1.00 15.96 ? 2205 PHE B CZ    1 
ATOM   5872  N N     . THR B 1 175 ? 66.030  22.383  27.959 1.00 16.83 ? 2206 THR B N     1 
ATOM   5873  C CA    . THR B 1 175 ? 65.689  23.546  28.790 1.00 17.33 ? 2206 THR B CA    1 
ATOM   5874  C C     . THR B 1 175 ? 65.250  24.773  28.024 1.00 16.67 ? 2206 THR B C     1 
ATOM   5875  O O     . THR B 1 175 ? 64.717  25.723  28.591 1.00 16.38 ? 2206 THR B O     1 
ATOM   5876  C CB    . THR B 1 175 ? 66.868  23.951  29.689 1.00 17.71 ? 2206 THR B CB    1 
ATOM   5877  O OG1   . THR B 1 175 ? 67.940  24.428  28.872 1.00 19.79 ? 2206 THR B OG1   1 
ATOM   5878  C CG2   . THR B 1 175 ? 67.341  22.758  30.517 1.00 18.46 ? 2206 THR B CG2   1 
ATOM   5879  N N     . ALA B 1 176 ? 65.478  24.754  26.724 1.00 17.45 ? 2207 ALA B N     1 
ATOM   5880  C CA    . ALA B 1 176 ? 65.092  25.873  25.889 1.00 18.49 ? 2207 ALA B CA    1 
ATOM   5881  C C     . ALA B 1 176 ? 63.570  26.024  25.800 1.00 19.12 ? 2207 ALA B C     1 
ATOM   5882  O O     . ALA B 1 176 ? 63.073  27.076  25.397 1.00 20.53 ? 2207 ALA B O     1 
ATOM   5883  C CB    . ALA B 1 176 ? 65.677  25.701  24.489 1.00 17.80 ? 2207 ALA B CB    1 
ATOM   5884  N N     . GLN B 1 177 ? 62.825  24.977  26.152 1.00 19.35 ? 2208 GLN B N     1 
ATOM   5885  C CA    . GLN B 1 177 ? 61.368  25.058  26.083 1.00 19.52 ? 2208 GLN B CA    1 
ATOM   5886  C C     . GLN B 1 177 ? 60.795  25.786  27.293 1.00 18.76 ? 2208 GLN B C     1 
ATOM   5887  O O     . GLN B 1 177 ? 59.699  26.345  27.221 1.00 19.12 ? 2208 GLN B O     1 
ATOM   5888  C CB    . GLN B 1 177 ? 60.751  23.667  25.959 1.00 19.28 ? 2208 GLN B CB    1 
ATOM   5889  C CG    . GLN B 1 177 ? 60.788  22.861  27.221 1.00 19.31 ? 2208 GLN B CG    1 
ATOM   5890  C CD    . GLN B 1 177 ? 60.613  21.400  26.947 1.00 18.95 ? 2208 GLN B CD    1 
ATOM   5891  O OE1   . GLN B 1 177 ? 59.529  20.957  26.642 1.00 20.00 ? 2208 GLN B OE1   1 
ATOM   5892  N NE2   . GLN B 1 177 ? 61.684  20.644  27.049 1.00 20.15 ? 2208 GLN B NE2   1 
ATOM   5893  N N     . PHE B 1 178 ? 61.526  25.799  28.404 1.00 18.26 ? 2209 PHE B N     1 
ATOM   5894  C CA    . PHE B 1 178 ? 61.014  26.515  29.555 1.00 17.97 ? 2209 PHE B CA    1 
ATOM   5895  C C     . PHE B 1 178 ? 61.847  27.691  30.052 1.00 17.83 ? 2209 PHE B C     1 
ATOM   5896  O O     . PHE B 1 178 ? 61.392  28.445  30.889 1.00 17.93 ? 2209 PHE B O     1 
ATOM   5897  C CB    . PHE B 1 178 ? 60.676  25.558  30.701 1.00 16.33 ? 2209 PHE B CB    1 
ATOM   5898  C CG    . PHE B 1 178 ? 61.761  24.589  31.065 1.00 15.26 ? 2209 PHE B CG    1 
ATOM   5899  C CD1   . PHE B 1 178 ? 61.707  23.275  30.627 1.00 15.30 ? 2209 PHE B CD1   1 
ATOM   5900  C CD2   . PHE B 1 178 ? 62.775  24.956  31.930 1.00 15.20 ? 2209 PHE B CD2   1 
ATOM   5901  C CE1   . PHE B 1 178 ? 62.638  22.336  31.044 1.00 14.26 ? 2209 PHE B CE1   1 
ATOM   5902  C CE2   . PHE B 1 178 ? 63.713  24.024  32.356 1.00 15.69 ? 2209 PHE B CE2   1 
ATOM   5903  C CZ    . PHE B 1 178 ? 63.642  22.707  31.909 1.00 14.29 ? 2209 PHE B CZ    1 
ATOM   5904  N N     . PHE B 1 179 ? 63.069  27.851  29.546 1.00 20.86 ? 2210 PHE B N     1 
ATOM   5905  C CA    . PHE B 1 179 ? 63.898  29.002  29.921 1.00 21.80 ? 2210 PHE B CA    1 
ATOM   5906  C C     . PHE B 1 179 ? 63.889  29.861  28.661 1.00 22.92 ? 2210 PHE B C     1 
ATOM   5907  O O     . PHE B 1 179 ? 64.779  29.760  27.816 1.00 23.60 ? 2210 PHE B O     1 
ATOM   5908  C CB    . PHE B 1 179 ? 65.346  28.603  30.226 1.00 19.18 ? 2210 PHE B CB    1 
ATOM   5909  C CG    . PHE B 1 179 ? 65.525  27.843  31.515 1.00 18.79 ? 2210 PHE B CG    1 
ATOM   5910  C CD1   . PHE B 1 179 ? 64.667  28.045  32.595 1.00 16.06 ? 2210 PHE B CD1   1 
ATOM   5911  C CD2   . PHE B 1 179 ? 66.541  26.889  31.632 1.00 16.41 ? 2210 PHE B CD2   1 
ATOM   5912  C CE1   . PHE B 1 179 ? 64.817  27.312  33.753 1.00 16.38 ? 2210 PHE B CE1   1 
ATOM   5913  C CE2   . PHE B 1 179 ? 66.695  26.151  32.790 1.00 15.25 ? 2210 PHE B CE2   1 
ATOM   5914  C CZ    . PHE B 1 179 ? 65.832  26.360  33.851 1.00 16.71 ? 2210 PHE B CZ    1 
ATOM   5915  N N     . LYS B 1 180 ? 62.864  30.686  28.514 1.00 25.29 ? 2211 LYS B N     1 
ATOM   5916  C CA    . LYS B 1 180 ? 62.763  31.538  27.343 1.00 26.06 ? 2211 LYS B CA    1 
ATOM   5917  C C     . LYS B 1 180 ? 62.583  32.956  27.806 1.00 26.67 ? 2211 LYS B C     1 
ATOM   5918  O O     . LYS B 1 180 ? 61.500  33.537  27.702 1.00 28.13 ? 2211 LYS B O     1 
ATOM   5919  C CB    . LYS B 1 180 ? 61.578  31.115  26.488 1.00 24.84 ? 2211 LYS B CB    1 
ATOM   5920  C CG    . LYS B 1 180 ? 61.617  29.660  26.086 1.00 21.82 ? 2211 LYS B CG    1 
ATOM   5921  C CD    . LYS B 1 180 ? 60.231  29.195  25.755 1.00 20.69 ? 2211 LYS B CD    1 
ATOM   5922  C CE    . LYS B 1 180 ? 59.686  30.004  24.611 1.00 20.67 ? 2211 LYS B CE    1 
ATOM   5923  N NZ    . LYS B 1 180 ? 58.426  29.412  24.124 1.00 21.57 ? 2211 LYS B NZ    1 
ATOM   5924  N N     . THR B 1 181 ? 63.665  33.510  28.315 1.00 29.31 ? 2212 THR B N     1 
ATOM   5925  C CA    . THR B 1 181 ? 63.631  34.853  28.830 1.00 31.23 ? 2212 THR B CA    1 
ATOM   5926  C C     . THR B 1 181 ? 63.106  35.876  27.834 1.00 32.97 ? 2212 THR B C     1 
ATOM   5927  O O     . THR B 1 181 ? 63.465  35.868  26.659 1.00 32.05 ? 2212 THR B O     1 
ATOM   5928  C CB    . THR B 1 181 ? 65.015  35.221  29.333 1.00 31.83 ? 2212 THR B CB    1 
ATOM   5929  O OG1   . THR B 1 181 ? 65.461  34.178  30.215 1.00 31.16 ? 2212 THR B OG1   1 
ATOM   5930  C CG2   . THR B 1 181 ? 64.991  36.552  30.079 1.00 30.81 ? 2212 THR B CG2   1 
ATOM   5931  N N     . ASP B 1 182 ? 62.223  36.739  28.326 1.00 35.62 ? 2213 ASP B N     1 
ATOM   5932  C CA    . ASP B 1 182 ? 61.607  37.793  27.529 1.00 37.13 ? 2213 ASP B CA    1 
ATOM   5933  C C     . ASP B 1 182 ? 62.442  39.067  27.658 1.00 38.31 ? 2213 ASP B C     1 
ATOM   5934  O O     . ASP B 1 182 ? 62.099  39.978  28.412 1.00 37.20 ? 2213 ASP B O     1 
ATOM   5935  C CB    . ASP B 1 182 ? 60.197  38.039  28.037 1.00 37.67 ? 2213 ASP B CB    1 
ATOM   5936  C CG    . ASP B 1 182 ? 59.367  38.836  27.079 1.00 39.03 ? 2213 ASP B CG    1 
ATOM   5937  O OD1   . ASP B 1 182 ? 59.919  39.380  26.089 1.00 38.70 ? 2213 ASP B OD1   1 
ATOM   5938  O OD2   . ASP B 1 182 ? 58.147  38.916  27.329 1.00 41.27 ? 2213 ASP B OD2   1 
ATOM   5939  N N     . HIS B 1 183 ? 63.537  39.109  26.903 1.00 40.58 ? 2214 HIS B N     1 
ATOM   5940  C CA    . HIS B 1 183 ? 64.481  40.222  26.913 1.00 42.22 ? 2214 HIS B CA    1 
ATOM   5941  C C     . HIS B 1 183 ? 63.885  41.615  26.813 1.00 41.91 ? 2214 HIS B C     1 
ATOM   5942  O O     . HIS B 1 183 ? 64.390  42.541  27.442 1.00 41.34 ? 2214 HIS B O     1 
ATOM   5943  C CB    . HIS B 1 183 ? 65.514  40.032  25.804 1.00 45.19 ? 2214 HIS B CB    1 
ATOM   5944  C CG    . HIS B 1 183 ? 66.217  38.714  25.878 1.00 48.16 ? 2214 HIS B CG    1 
ATOM   5945  N ND1   . HIS B 1 183 ? 67.045  38.370  26.919 1.00 50.03 ? 2214 HIS B ND1   1 
ATOM   5946  C CD2   . HIS B 1 183 ? 66.176  37.641  25.050 1.00 50.32 ? 2214 HIS B CD2   1 
ATOM   5947  C CE1   . HIS B 1 183 ? 67.489  37.141  26.741 1.00 52.12 ? 2214 HIS B CE1   1 
ATOM   5948  N NE2   . HIS B 1 183 ? 66.979  36.672  25.614 1.00 52.04 ? 2214 HIS B NE2   1 
ATOM   5949  N N     . LYS B 1 184 ? 62.818  41.776  26.039 1.00 41.30 ? 2215 LYS B N     1 
ATOM   5950  C CA    . LYS B 1 184 ? 62.210  43.092  25.914 1.00 40.39 ? 2215 LYS B CA    1 
ATOM   5951  C C     . LYS B 1 184 ? 61.602  43.534  27.240 1.00 39.24 ? 2215 LYS B C     1 
ATOM   5952  O O     . LYS B 1 184 ? 61.396  44.726  27.460 1.00 39.18 ? 2215 LYS B O     1 
ATOM   5953  C CB    . LYS B 1 184 ? 61.131  43.078  24.841 1.00 42.41 ? 2215 LYS B CB    1 
ATOM   5954  C CG    . LYS B 1 184 ? 61.671  42.765  23.460 1.00 45.75 ? 2215 LYS B CG    1 
ATOM   5955  C CD    . LYS B 1 184 ? 61.230  43.799  22.430 1.00 48.69 ? 2215 LYS B CD    1 
ATOM   5956  C CE    . LYS B 1 184 ? 61.214  43.203  21.020 1.00 50.87 ? 2215 LYS B CE    1 
ATOM   5957  N NZ    . LYS B 1 184 ? 60.600  44.120  20.006 1.00 51.68 ? 2215 LYS B NZ    1 
ATOM   5958  N N     . ARG B 1 185 ? 61.325  42.571  28.120 1.00 36.86 ? 2216 ARG B N     1 
ATOM   5959  C CA    . ARG B 1 185 ? 60.725  42.858  29.422 1.00 34.49 ? 2216 ARG B CA    1 
ATOM   5960  C C     . ARG B 1 185 ? 61.745  42.829  30.540 1.00 32.36 ? 2216 ARG B C     1 
ATOM   5961  O O     . ARG B 1 185 ? 61.698  43.645  31.451 1.00 32.51 ? 2216 ARG B O     1 
ATOM   5962  C CB    . ARG B 1 185 ? 59.620  41.853  29.751 1.00 35.02 ? 2216 ARG B CB    1 
ATOM   5963  C CG    . ARG B 1 185 ? 58.299  42.109  29.051 1.00 35.64 ? 2216 ARG B CG    1 
ATOM   5964  C CD    . ARG B 1 185 ? 57.233  41.155  29.608 1.00 37.74 ? 2216 ARG B CD    1 
ATOM   5965  N NE    . ARG B 1 185 ? 56.054  41.046  28.754 1.00 38.11 ? 2216 ARG B NE    1 
ATOM   5966  C CZ    . ARG B 1 185 ? 54.996  41.803  28.935 1.00 39.36 ? 2216 ARG B CZ    1 
ATOM   5967  N NH1   . ARG B 1 185 ? 55.072  42.649  29.931 1.00 39.09 ? 2216 ARG B NH1   1 
ATOM   5968  N NH2   . ARG B 1 185 ? 53.954  41.801  28.107 1.00 39.85 ? 2216 ARG B NH2   1 
ATOM   5969  N N     . GLY B 1 186 ? 62.650  41.867  30.498 1.00 30.02 ? 2217 GLY B N     1 
ATOM   5970  C CA    . GLY B 1 186 ? 63.645  41.816  31.544 1.00 27.50 ? 2217 GLY B CA    1 
ATOM   5971  C C     . GLY B 1 186 ? 64.019  40.400  31.899 1.00 26.51 ? 2217 GLY B C     1 
ATOM   5972  O O     . GLY B 1 186 ? 63.338  39.437  31.518 1.00 26.81 ? 2217 GLY B O     1 
ATOM   5973  N N     . PRO B 1 187 ? 65.122  40.239  32.632 1.00 24.67 ? 2218 PRO B N     1 
ATOM   5974  C CA    . PRO B 1 187 ? 65.599  38.919  33.044 1.00 23.31 ? 2218 PRO B CA    1 
ATOM   5975  C C     . PRO B 1 187 ? 64.609  38.109  33.893 1.00 22.35 ? 2218 PRO B C     1 
ATOM   5976  O O     . PRO B 1 187 ? 64.619  36.875  33.867 1.00 22.04 ? 2218 PRO B O     1 
ATOM   5977  C CB    . PRO B 1 187 ? 66.900  39.228  33.792 1.00 23.22 ? 2218 PRO B CB    1 
ATOM   5978  C CG    . PRO B 1 187 ? 66.786  40.650  34.184 1.00 23.08 ? 2218 PRO B CG    1 
ATOM   5979  C CD    . PRO B 1 187 ? 66.008  41.316  33.096 1.00 22.74 ? 2218 PRO B CD    1 
ATOM   5980  N N     . GLY B 1 188 ? 63.755  38.794  34.643 1.00 20.16 ? 2219 GLY B N     1 
ATOM   5981  C CA    . GLY B 1 188 ? 62.801  38.086  35.477 1.00 18.87 ? 2219 GLY B CA    1 
ATOM   5982  C C     . GLY B 1 188 ? 61.499  37.722  34.777 1.00 19.22 ? 2219 GLY B C     1 
ATOM   5983  O O     . GLY B 1 188 ? 60.535  37.331  35.435 1.00 19.80 ? 2219 GLY B O     1 
ATOM   5984  N N     . PHE B 1 189 ? 61.464  37.843  33.448 1.00 19.70 ? 2220 PHE B N     1 
ATOM   5985  C CA    . PHE B 1 189 ? 60.267  37.520  32.657 1.00 20.66 ? 2220 PHE B CA    1 
ATOM   5986  C C     . PHE B 1 189 ? 60.516  36.389  31.677 1.00 19.88 ? 2220 PHE B C     1 
ATOM   5987  O O     . PHE B 1 189 ? 61.626  36.221  31.199 1.00 21.12 ? 2220 PHE B O     1 
ATOM   5988  C CB    . PHE B 1 189 ? 59.797  38.732  31.864 1.00 18.29 ? 2220 PHE B CB    1 
ATOM   5989  C CG    . PHE B 1 189 ? 59.285  39.846  32.716 1.00 19.98 ? 2220 PHE B CG    1 
ATOM   5990  C CD1   . PHE B 1 189 ? 60.154  40.817  33.207 1.00 20.77 ? 2220 PHE B CD1   1 
ATOM   5991  C CD2   . PHE B 1 189 ? 57.931  39.933  33.018 1.00 18.22 ? 2220 PHE B CD2   1 
ATOM   5992  C CE1   . PHE B 1 189 ? 59.678  41.869  33.992 1.00 21.62 ? 2220 PHE B CE1   1 
ATOM   5993  C CE2   . PHE B 1 189 ? 57.442  40.969  33.793 1.00 19.95 ? 2220 PHE B CE2   1 
ATOM   5994  C CZ    . PHE B 1 189 ? 58.315  41.944  34.285 1.00 21.64 ? 2220 PHE B CZ    1 
ATOM   5995  N N     . THR B 1 190 ? 59.480  35.622  31.369 1.00 21.33 ? 2221 THR B N     1 
ATOM   5996  C CA    . THR B 1 190 ? 59.604  34.512  30.430 1.00 22.15 ? 2221 THR B CA    1 
ATOM   5997  C C     . THR B 1 190 ? 58.515  34.491  29.366 1.00 21.87 ? 2221 THR B C     1 
ATOM   5998  O O     . THR B 1 190 ? 57.444  35.050  29.537 1.00 23.08 ? 2221 THR B O     1 
ATOM   5999  C CB    . THR B 1 190 ? 59.549  33.171  31.141 1.00 21.38 ? 2221 THR B CB    1 
ATOM   6000  O OG1   . THR B 1 190 ? 59.520  32.136  30.163 1.00 20.22 ? 2221 THR B OG1   1 
ATOM   6001  C CG2   . THR B 1 190 ? 58.296  33.067  31.999 1.00 21.91 ? 2221 THR B CG2   1 
ATOM   6002  N N     . ARG B 1 191 ? 58.790  33.838  28.257 1.00 22.98 ? 2222 ARG B N     1 
ATOM   6003  C CA    . ARG B 1 191 ? 57.805  33.742  27.204 1.00 23.50 ? 2222 ARG B CA    1 
ATOM   6004  C C     . ARG B 1 191 ? 57.225  32.331  27.202 1.00 23.17 ? 2222 ARG B C     1 
ATOM   6005  O O     . ARG B 1 191 ? 56.318  32.023  26.445 1.00 23.97 ? 2222 ARG B O     1 
ATOM   6006  C CB    . ARG B 1 191 ? 58.451  34.053  25.871 1.00 26.76 ? 2222 ARG B CB    1 
ATOM   6007  C CG    . ARG B 1 191 ? 58.574  35.524  25.624 1.00 31.82 ? 2222 ARG B CG    1 
ATOM   6008  C CD    . ARG B 1 191 ? 59.173  35.768  24.272 1.00 37.69 ? 2222 ARG B CD    1 
ATOM   6009  N NE    . ARG B 1 191 ? 60.625  35.714  24.353 1.00 43.43 ? 2222 ARG B NE    1 
ATOM   6010  C CZ    . ARG B 1 191 ? 61.360  34.655  24.023 1.00 46.13 ? 2222 ARG B CZ    1 
ATOM   6011  N NH1   . ARG B 1 191 ? 60.779  33.540  23.584 1.00 45.45 ? 2222 ARG B NH1   1 
ATOM   6012  N NH2   . ARG B 1 191 ? 62.683  34.712  24.142 1.00 45.97 ? 2222 ARG B NH2   1 
ATOM   6013  N N     . GLY B 1 192 ? 57.768  31.470  28.053 1.00 22.75 ? 2223 GLY B N     1 
ATOM   6014  C CA    . GLY B 1 192 ? 57.278  30.108  28.155 1.00 22.04 ? 2223 GLY B CA    1 
ATOM   6015  C C     . GLY B 1 192 ? 56.149  30.061  29.172 1.00 22.29 ? 2223 GLY B C     1 
ATOM   6016  O O     . GLY B 1 192 ? 56.341  29.660  30.328 1.00 21.68 ? 2223 GLY B O     1 
ATOM   6017  N N     . LEU B 1 193 ? 54.959  30.468  28.741 1.00 21.28 ? 2224 LEU B N     1 
ATOM   6018  C CA    . LEU B 1 193 ? 53.810  30.488  29.627 1.00 18.31 ? 2224 LEU B CA    1 
ATOM   6019  C C     . LEU B 1 193 ? 53.373  29.108  30.059 1.00 17.96 ? 2224 LEU B C     1 
ATOM   6020  O O     . LEU B 1 193 ? 52.547  28.972  30.952 1.00 18.53 ? 2224 LEU B O     1 
ATOM   6021  C CB    . LEU B 1 193 ? 52.661  31.243  28.969 1.00 17.31 ? 2224 LEU B CB    1 
ATOM   6022  C CG    . LEU B 1 193 ? 53.086  32.627  28.466 1.00 19.06 ? 2224 LEU B CG    1 
ATOM   6023  C CD1   . LEU B 1 193 ? 51.850  33.419  28.095 1.00 19.33 ? 2224 LEU B CD1   1 
ATOM   6024  C CD2   . LEU B 1 193 ? 53.900  33.357  29.529 1.00 16.37 ? 2224 LEU B CD2   1 
ATOM   6025  N N     . GLY B 1 194 ? 53.941  28.079  29.448 1.00 17.60 ? 2225 GLY B N     1 
ATOM   6026  C CA    . GLY B 1 194 ? 53.589  26.726  29.847 1.00 16.43 ? 2225 GLY B CA    1 
ATOM   6027  C C     . GLY B 1 194 ? 54.307  26.336  31.128 1.00 16.30 ? 2225 GLY B C     1 
ATOM   6028  O O     . GLY B 1 194 ? 53.894  25.415  31.835 1.00 17.09 ? 2225 GLY B O     1 
ATOM   6029  N N     . HIS B 1 195 ? 55.413  27.029  31.408 1.00 17.14 ? 2226 HIS B N     1 
ATOM   6030  C CA    . HIS B 1 195 ? 56.214  26.793  32.602 1.00 15.03 ? 2226 HIS B CA    1 
ATOM   6031  C C     . HIS B 1 195 ? 56.589  25.336  32.833 1.00 15.13 ? 2226 HIS B C     1 
ATOM   6032  O O     . HIS B 1 195 ? 56.515  24.839  33.954 1.00 15.21 ? 2226 HIS B O     1 
ATOM   6033  C CB    . HIS B 1 195 ? 55.485  27.332  33.827 1.00 15.43 ? 2226 HIS B CB    1 
ATOM   6034  C CG    . HIS B 1 195 ? 55.492  28.825  33.917 1.00 16.41 ? 2226 HIS B CG    1 
ATOM   6035  N ND1   . HIS B 1 195 ? 56.411  29.522  34.664 1.00 17.59 ? 2226 HIS B ND1   1 
ATOM   6036  C CD2   . HIS B 1 195 ? 54.697  29.754  33.334 1.00 17.01 ? 2226 HIS B CD2   1 
ATOM   6037  C CE1   . HIS B 1 195 ? 56.190  30.818  34.541 1.00 18.22 ? 2226 HIS B CE1   1 
ATOM   6038  N NE2   . HIS B 1 195 ? 55.156  30.988  33.738 1.00 17.72 ? 2226 HIS B NE2   1 
ATOM   6039  N N     . GLY B 1 196 ? 57.023  24.654  31.778 1.00 15.53 ? 2227 GLY B N     1 
ATOM   6040  C CA    . GLY B 1 196 ? 57.406  23.260  31.918 1.00 14.84 ? 2227 GLY B CA    1 
ATOM   6041  C C     . GLY B 1 196 ? 57.693  22.514  30.626 1.00 14.82 ? 2227 GLY B C     1 
ATOM   6042  O O     . GLY B 1 196 ? 57.911  23.096  29.554 1.00 14.55 ? 2227 GLY B O     1 
ATOM   6043  N N     . VAL B 1 197 ? 57.697  21.192  30.739 1.00 13.86 ? 2228 VAL B N     1 
ATOM   6044  C CA    . VAL B 1 197 ? 57.960  20.338  29.604 1.00 14.01 ? 2228 VAL B CA    1 
ATOM   6045  C C     . VAL B 1 197 ? 56.707  20.191  28.740 1.00 14.86 ? 2228 VAL B C     1 
ATOM   6046  O O     . VAL B 1 197 ? 55.981  19.208  28.860 1.00 16.34 ? 2228 VAL B O     1 
ATOM   6047  C CB    . VAL B 1 197 ? 58.428  18.950  30.100 1.00 12.62 ? 2228 VAL B CB    1 
ATOM   6048  C CG1   . VAL B 1 197 ? 58.830  18.065  28.927 1.00 9.27  ? 2228 VAL B CG1   1 
ATOM   6049  C CG2   . VAL B 1 197 ? 59.579  19.133  31.109 1.00 11.04 ? 2228 VAL B CG2   1 
ATOM   6050  N N     . ASP B 1 198 ? 56.445  21.164  27.871 1.00 14.46 ? 2229 ASP B N     1 
ATOM   6051  C CA    . ASP B 1 198 ? 55.267  21.068  27.012 1.00 16.31 ? 2229 ASP B CA    1 
ATOM   6052  C C     . ASP B 1 198 ? 55.671  20.829  25.587 1.00 17.09 ? 2229 ASP B C     1 
ATOM   6053  O O     . ASP B 1 198 ? 54.825  20.663  24.716 1.00 17.35 ? 2229 ASP B O     1 
ATOM   6054  C CB    . ASP B 1 198 ? 54.402  22.327  27.079 1.00 16.77 ? 2229 ASP B CB    1 
ATOM   6055  C CG    . ASP B 1 198 ? 55.157  23.570  26.746 1.00 17.79 ? 2229 ASP B CG    1 
ATOM   6056  O OD1   . ASP B 1 198 ? 56.292  23.463  26.241 1.00 21.47 ? 2229 ASP B OD1   1 
ATOM   6057  O OD2   . ASP B 1 198 ? 54.605  24.659  26.994 1.00 17.49 ? 2229 ASP B OD2   1 
ATOM   6058  N N     . LEU B 1 199 ? 56.983  20.813  25.367 1.00 17.89 ? 2230 LEU B N     1 
ATOM   6059  C CA    . LEU B 1 199 ? 57.572  20.587  24.052 1.00 18.31 ? 2230 LEU B CA    1 
ATOM   6060  C C     . LEU B 1 199 ? 57.226  21.665  23.035 1.00 18.27 ? 2230 LEU B C     1 
ATOM   6061  O O     . LEU B 1 199 ? 57.098  21.385  21.843 1.00 19.31 ? 2230 LEU B O     1 
ATOM   6062  C CB    . LEU B 1 199 ? 57.155  19.220  23.512 1.00 17.28 ? 2230 LEU B CB    1 
ATOM   6063  C CG    . LEU B 1 199 ? 57.612  17.938  24.231 1.00 16.77 ? 2230 LEU B CG    1 
ATOM   6064  C CD1   . LEU B 1 199 ? 58.162  16.999  23.183 1.00 16.26 ? 2230 LEU B CD1   1 
ATOM   6065  C CD2   . LEU B 1 199 ? 58.663  18.216  25.287 1.00 14.51 ? 2230 LEU B CD2   1 
ATOM   6066  N N     . ASN B 1 200 ? 57.091  22.900  23.506 1.00 17.68 ? 2231 ASN B N     1 
ATOM   6067  C CA    . ASN B 1 200 ? 56.780  24.021  22.624 1.00 18.43 ? 2231 ASN B CA    1 
ATOM   6068  C C     . ASN B 1 200 ? 57.984  24.340  21.727 1.00 20.14 ? 2231 ASN B C     1 
ATOM   6069  O O     . ASN B 1 200 ? 57.854  25.073  20.740 1.00 20.07 ? 2231 ASN B O     1 
ATOM   6070  C CB    . ASN B 1 200 ? 56.438  25.260  23.445 1.00 18.28 ? 2231 ASN B CB    1 
ATOM   6071  C CG    . ASN B 1 200 ? 57.655  25.851  24.145 1.00 20.41 ? 2231 ASN B CG    1 
ATOM   6072  O OD1   . ASN B 1 200 ? 58.436  26.603  23.546 1.00 19.96 ? 2231 ASN B OD1   1 
ATOM   6073  N ND2   . ASN B 1 200 ? 57.822  25.515  25.425 1.00 20.13 ? 2231 ASN B ND2   1 
ATOM   6074  N N     . HIS B 1 201 ? 59.156  23.805  22.071 1.00 19.92 ? 2232 HIS B N     1 
ATOM   6075  C CA    . HIS B 1 201 ? 60.345  24.050  21.271 1.00 20.22 ? 2232 HIS B CA    1 
ATOM   6076  C C     . HIS B 1 201 ? 60.312  23.162  20.024 1.00 20.44 ? 2232 HIS B C     1 
ATOM   6077  O O     . HIS B 1 201 ? 61.166  23.282  19.135 1.00 20.97 ? 2232 HIS B O     1 
ATOM   6078  C CB    . HIS B 1 201 ? 61.629  23.824  22.097 1.00 19.92 ? 2232 HIS B CB    1 
ATOM   6079  C CG    . HIS B 1 201 ? 61.770  22.451  22.672 1.00 20.60 ? 2232 HIS B CG    1 
ATOM   6080  N ND1   . HIS B 1 201 ? 60.707  21.744  23.201 1.00 22.03 ? 2232 HIS B ND1   1 
ATOM   6081  C CD2   . HIS B 1 201 ? 62.853  21.654  22.816 1.00 20.77 ? 2232 HIS B CD2   1 
ATOM   6082  C CE1   . HIS B 1 201 ? 61.132  20.575  23.642 1.00 22.77 ? 2232 HIS B CE1   1 
ATOM   6083  N NE2   . HIS B 1 201 ? 62.434  20.496  23.417 1.00 21.69 ? 2232 HIS B NE2   1 
ATOM   6084  N N     . ILE B 1 202 ? 59.320  22.275  19.963 1.00 19.51 ? 2233 ILE B N     1 
ATOM   6085  C CA    . ILE B 1 202 ? 59.151  21.405  18.805 1.00 19.68 ? 2233 ILE B CA    1 
ATOM   6086  C C     . ILE B 1 202 ? 57.883  21.853  18.083 1.00 20.10 ? 2233 ILE B C     1 
ATOM   6087  O O     . ILE B 1 202 ? 57.882  22.054  16.860 1.00 20.97 ? 2233 ILE B O     1 
ATOM   6088  C CB    . ILE B 1 202 ? 58.946  19.912  19.202 1.00 19.96 ? 2233 ILE B CB    1 
ATOM   6089  C CG1   . ILE B 1 202 ? 60.232  19.320  19.757 1.00 20.31 ? 2233 ILE B CG1   1 
ATOM   6090  C CG2   . ILE B 1 202 ? 58.537  19.084  17.981 1.00 17.95 ? 2233 ILE B CG2   1 
ATOM   6091  C CD1   . ILE B 1 202 ? 60.034  17.938  20.328 1.00 20.69 ? 2233 ILE B CD1   1 
ATOM   6092  N N     . TYR B 1 203 ? 56.814  22.023  18.861 1.00 19.90 ? 2234 TYR B N     1 
ATOM   6093  C CA    . TYR B 1 203 ? 55.503  22.394  18.336 1.00 18.98 ? 2234 TYR B CA    1 
ATOM   6094  C C     . TYR B 1 203 ? 55.130  23.876  18.272 1.00 19.96 ? 2234 TYR B C     1 
ATOM   6095  O O     . TYR B 1 203 ? 54.151  24.231  17.623 1.00 19.86 ? 2234 TYR B O     1 
ATOM   6096  C CB    . TYR B 1 203 ? 54.429  21.657  19.136 1.00 17.83 ? 2234 TYR B CB    1 
ATOM   6097  C CG    . TYR B 1 203 ? 54.645  20.166  19.203 1.00 16.03 ? 2234 TYR B CG    1 
ATOM   6098  C CD1   . TYR B 1 203 ? 54.446  19.358  18.083 1.00 16.25 ? 2234 TYR B CD1   1 
ATOM   6099  C CD2   . TYR B 1 203 ? 55.052  19.560  20.381 1.00 16.42 ? 2234 TYR B CD2   1 
ATOM   6100  C CE1   . TYR B 1 203 ? 54.652  17.973  18.142 1.00 15.76 ? 2234 TYR B CE1   1 
ATOM   6101  C CE2   . TYR B 1 203 ? 55.258  18.176  20.445 1.00 16.64 ? 2234 TYR B CE2   1 
ATOM   6102  C CZ    . TYR B 1 203 ? 55.056  17.398  19.324 1.00 14.90 ? 2234 TYR B CZ    1 
ATOM   6103  O OH    . TYR B 1 203 ? 55.235  16.046  19.396 1.00 14.81 ? 2234 TYR B OH    1 
ATOM   6104  N N     . GLY B 1 204 ? 55.883  24.736  18.950 1.00 21.29 ? 2235 GLY B N     1 
ATOM   6105  C CA    . GLY B 1 204 ? 55.569  26.153  18.930 1.00 22.20 ? 2235 GLY B CA    1 
ATOM   6106  C C     . GLY B 1 204 ? 54.776  26.554  20.163 1.00 23.84 ? 2235 GLY B C     1 
ATOM   6107  O O     . GLY B 1 204 ? 53.997  25.750  20.687 1.00 23.81 ? 2235 GLY B O     1 
ATOM   6108  N N     . GLU B 1 205 ? 54.976  27.792  20.626 1.00 24.72 ? 2236 GLU B N     1 
ATOM   6109  C CA    . GLU B 1 205 ? 54.284  28.334  21.801 1.00 25.17 ? 2236 GLU B CA    1 
ATOM   6110  C C     . GLU B 1 205 ? 52.818  28.616  21.521 1.00 25.77 ? 2236 GLU B C     1 
ATOM   6111  O O     . GLU B 1 205 ? 51.986  28.536  22.415 1.00 26.50 ? 2236 GLU B O     1 
ATOM   6112  C CB    . GLU B 1 205 ? 54.893  29.676  22.235 1.00 25.51 ? 2236 GLU B CB    1 
ATOM   6113  C CG    . GLU B 1 205 ? 55.839  29.642  23.421 1.00 26.80 ? 2236 GLU B CG    1 
ATOM   6114  C CD    . GLU B 1 205 ? 55.175  29.378  24.753 1.00 26.59 ? 2236 GLU B CD    1 
ATOM   6115  O OE1   . GLU B 1 205 ? 54.054  29.874  24.999 1.00 27.21 ? 2236 GLU B OE1   1 
ATOM   6116  O OE2   . GLU B 1 205 ? 55.801  28.667  25.559 1.00 25.33 ? 2236 GLU B OE2   1 
ATOM   6117  N N     . THR B 1 206 ? 52.522  28.982  20.282 1.00 26.29 ? 2237 THR B N     1 
ATOM   6118  C CA    . THR B 1 206 ? 51.172  29.339  19.893 1.00 27.61 ? 2237 THR B CA    1 
ATOM   6119  C C     . THR B 1 206 ? 50.575  28.434  18.851 1.00 27.69 ? 2237 THR B C     1 
ATOM   6120  O O     . THR B 1 206 ? 51.290  27.799  18.085 1.00 27.56 ? 2237 THR B O     1 
ATOM   6121  C CB    . THR B 1 206 ? 51.126  30.762  19.311 1.00 27.33 ? 2237 THR B CB    1 
ATOM   6122  O OG1   . THR B 1 206 ? 51.792  30.779  18.042 1.00 26.60 ? 2237 THR B OG1   1 
ATOM   6123  C CG2   . THR B 1 206 ? 51.812  31.737  20.243 1.00 28.84 ? 2237 THR B CG2   1 
ATOM   6124  N N     . LEU B 1 207 ? 49.244  28.429  18.809 1.00 29.77 ? 2238 LEU B N     1 
ATOM   6125  C CA    . LEU B 1 207 ? 48.477  27.636  17.864 1.00 30.28 ? 2238 LEU B CA    1 
ATOM   6126  C C     . LEU B 1 207 ? 48.834  28.035  16.439 1.00 31.35 ? 2238 LEU B C     1 
ATOM   6127  O O     . LEU B 1 207 ? 49.044  27.183  15.582 1.00 31.99 ? 2238 LEU B O     1 
ATOM   6128  C CB    . LEU B 1 207 ? 46.979  27.858  18.097 1.00 30.46 ? 2238 LEU B CB    1 
ATOM   6129  C CG    . LEU B 1 207 ? 46.018  26.663  17.969 1.00 29.54 ? 2238 LEU B CG    1 
ATOM   6130  C CD1   . LEU B 1 207 ? 44.668  27.149  17.452 1.00 26.00 ? 2238 LEU B CD1   1 
ATOM   6131  C CD2   . LEU B 1 207 ? 46.608  25.608  17.049 1.00 28.29 ? 2238 LEU B CD2   1 
ATOM   6132  N N     . ASP B 1 208 ? 48.900  29.336  16.189 1.00 33.32 ? 2239 ASP B N     1 
ATOM   6133  C CA    . ASP B 1 208 ? 49.236  29.833  14.861 1.00 35.12 ? 2239 ASP B CA    1 
ATOM   6134  C C     . ASP B 1 208 ? 50.541  29.229  14.361 1.00 33.36 ? 2239 ASP B C     1 
ATOM   6135  O O     . ASP B 1 208 ? 50.664  28.837  13.202 1.00 32.25 ? 2239 ASP B O     1 
ATOM   6136  C CB    . ASP B 1 208 ? 49.341  31.355  14.889 1.00 39.60 ? 2239 ASP B CB    1 
ATOM   6137  C CG    . ASP B 1 208 ? 48.061  32.025  14.433 1.00 43.82 ? 2239 ASP B CG    1 
ATOM   6138  O OD1   . ASP B 1 208 ? 47.094  32.084  15.226 1.00 45.64 ? 2239 ASP B OD1   1 
ATOM   6139  O OD2   . ASP B 1 208 ? 48.020  32.483  13.269 1.00 48.83 ? 2239 ASP B OD2   1 
ATOM   6140  N N     . ARG B 1 209 ? 51.522  29.156  15.246 1.00 32.49 ? 2240 ARG B N     1 
ATOM   6141  C CA    . ARG B 1 209 ? 52.809  28.586  14.883 1.00 31.13 ? 2240 ARG B CA    1 
ATOM   6142  C C     . ARG B 1 209 ? 52.664  27.103  14.616 1.00 29.47 ? 2240 ARG B C     1 
ATOM   6143  O O     . ARG B 1 209 ? 53.024  26.613  13.548 1.00 30.21 ? 2240 ARG B O     1 
ATOM   6144  C CB    . ARG B 1 209 ? 53.801  28.760  16.010 1.00 31.96 ? 2240 ARG B CB    1 
ATOM   6145  C CG    . ARG B 1 209 ? 55.169  28.283  15.656 1.00 32.45 ? 2240 ARG B CG    1 
ATOM   6146  C CD    . ARG B 1 209 ? 56.075  29.414  15.945 1.00 35.23 ? 2240 ARG B CD    1 
ATOM   6147  N NE    . ARG B 1 209 ? 57.472  29.064  15.859 1.00 36.35 ? 2240 ARG B NE    1 
ATOM   6148  C CZ    . ARG B 1 209 ? 58.415  29.960  15.620 1.00 36.04 ? 2240 ARG B CZ    1 
ATOM   6149  N NH1   . ARG B 1 209 ? 58.081  31.236  15.444 1.00 35.67 ? 2240 ARG B NH1   1 
ATOM   6150  N NH2   . ARG B 1 209 ? 59.684  29.586  15.559 1.00 36.77 ? 2240 ARG B NH2   1 
ATOM   6151  N N     . GLN B 1 210 ? 52.149  26.395  15.613 1.00 27.31 ? 2241 GLN B N     1 
ATOM   6152  C CA    . GLN B 1 210 ? 51.946  24.962  15.520 1.00 24.90 ? 2241 GLN B CA    1 
ATOM   6153  C C     . GLN B 1 210 ? 51.298  24.609  14.197 1.00 24.34 ? 2241 GLN B C     1 
ATOM   6154  O O     . GLN B 1 210 ? 51.740  23.717  13.482 1.00 25.64 ? 2241 GLN B O     1 
ATOM   6155  C CB    . GLN B 1 210 ? 51.045  24.494  16.656 1.00 24.11 ? 2241 GLN B CB    1 
ATOM   6156  C CG    . GLN B 1 210 ? 50.699  23.025  16.567 1.00 24.65 ? 2241 GLN B CG    1 
ATOM   6157  C CD    . GLN B 1 210 ? 49.425  22.675  17.304 1.00 22.45 ? 2241 GLN B CD    1 
ATOM   6158  O OE1   . GLN B 1 210 ? 48.416  22.296  16.706 1.00 20.76 ? 2241 GLN B OE1   1 
ATOM   6159  N NE2   . GLN B 1 210 ? 49.470  22.798  18.611 1.00 22.33 ? 2241 GLN B NE2   1 
ATOM   6160  N N     . HIS B 1 211 ? 50.242  25.324  13.867 1.00 23.78 ? 2242 HIS B N     1 
ATOM   6161  C CA    . HIS B 1 211 ? 49.546  25.060  12.636 1.00 24.00 ? 2242 HIS B CA    1 
ATOM   6162  C C     . HIS B 1 211 ? 50.434  25.200  11.402 1.00 23.81 ? 2242 HIS B C     1 
ATOM   6163  O O     . HIS B 1 211 ? 50.305  24.430  10.453 1.00 24.88 ? 2242 HIS B O     1 
ATOM   6164  C CB    . HIS B 1 211 ? 48.321  25.970  12.559 1.00 25.10 ? 2242 HIS B CB    1 
ATOM   6165  C CG    . HIS B 1 211 ? 47.144  25.430  13.313 1.00 25.92 ? 2242 HIS B CG    1 
ATOM   6166  N ND1   . HIS B 1 211 ? 47.202  24.259  14.032 1.00 26.20 ? 2242 HIS B ND1   1 
ATOM   6167  C CD2   . HIS B 1 211 ? 45.866  25.860  13.396 1.00 26.69 ? 2242 HIS B CD2   1 
ATOM   6168  C CE1   . HIS B 1 211 ? 46.012  23.980  14.523 1.00 26.68 ? 2242 HIS B CE1   1 
ATOM   6169  N NE2   . HIS B 1 211 ? 45.178  24.939  14.150 1.00 28.17 ? 2242 HIS B NE2   1 
ATOM   6170  N N     . LYS B 1 212 ? 51.344  26.171  11.414 1.00 25.28 ? 2243 LYS B N     1 
ATOM   6171  C CA    . LYS B 1 212 ? 52.256  26.388  10.285 1.00 24.86 ? 2243 LYS B CA    1 
ATOM   6172  C C     . LYS B 1 212 ? 53.298  25.282  10.170 1.00 22.64 ? 2243 LYS B C     1 
ATOM   6173  O O     . LYS B 1 212 ? 53.882  25.075  9.116  1.00 22.96 ? 2243 LYS B O     1 
ATOM   6174  C CB    . LYS B 1 212 ? 52.987  27.719  10.438 1.00 26.28 ? 2243 LYS B CB    1 
ATOM   6175  C CG    . LYS B 1 212 ? 52.172  28.932  10.077 1.00 28.76 ? 2243 LYS B CG    1 
ATOM   6176  C CD    . LYS B 1 212 ? 52.671  30.118  10.871 1.00 33.64 ? 2243 LYS B CD    1 
ATOM   6177  C CE    . LYS B 1 212 ? 52.619  31.417  10.061 1.00 35.85 ? 2243 LYS B CE    1 
ATOM   6178  N NZ    . LYS B 1 212 ? 53.149  32.551  10.886 1.00 37.36 ? 2243 LYS B NZ    1 
ATOM   6179  N N     . LEU B 1 213 ? 53.536  24.574  11.267 1.00 22.64 ? 2244 LEU B N     1 
ATOM   6180  C CA    . LEU B 1 213 ? 54.527  23.508  11.275 1.00 21.30 ? 2244 LEU B CA    1 
ATOM   6181  C C     . LEU B 1 213 ? 53.915  22.144  11.002 1.00 20.10 ? 2244 LEU B C     1 
ATOM   6182  O O     . LEU B 1 213 ? 54.624  21.191  10.725 1.00 21.76 ? 2244 LEU B O     1 
ATOM   6183  C CB    . LEU B 1 213 ? 55.256  23.482  12.627 1.00 19.71 ? 2244 LEU B CB    1 
ATOM   6184  C CG    . LEU B 1 213 ? 56.101  24.711  12.965 1.00 17.56 ? 2244 LEU B CG    1 
ATOM   6185  C CD1   . LEU B 1 213 ? 56.541  24.657  14.414 1.00 16.68 ? 2244 LEU B CD1   1 
ATOM   6186  C CD2   . LEU B 1 213 ? 57.294  24.765  12.048 1.00 16.22 ? 2244 LEU B CD2   1 
ATOM   6187  N N     . ARG B 1 214 ? 52.594  22.051  11.075 1.00 20.69 ? 2245 ARG B N     1 
ATOM   6188  C CA    . ARG B 1 214 ? 51.904  20.785  10.855 1.00 18.07 ? 2245 ARG B CA    1 
ATOM   6189  C C     . ARG B 1 214 ? 51.576  20.472  9.409  1.00 18.46 ? 2245 ARG B C     1 
ATOM   6190  O O     . ARG B 1 214 ? 51.339  21.356  8.593  1.00 20.83 ? 2245 ARG B O     1 
ATOM   6191  C CB    . ARG B 1 214 ? 50.618  20.743  11.663 1.00 17.14 ? 2245 ARG B CB    1 
ATOM   6192  C CG    . ARG B 1 214 ? 50.834  20.517  13.124 1.00 15.87 ? 2245 ARG B CG    1 
ATOM   6193  C CD    . ARG B 1 214 ? 49.540  20.695  13.870 1.00 16.82 ? 2245 ARG B CD    1 
ATOM   6194  N NE    . ARG B 1 214 ? 48.518  19.755  13.405 1.00 16.06 ? 2245 ARG B NE    1 
ATOM   6195  C CZ    . ARG B 1 214 ? 47.306  19.638  13.955 1.00 16.21 ? 2245 ARG B CZ    1 
ATOM   6196  N NH1   . ARG B 1 214 ? 46.966  20.403  14.990 1.00 15.55 ? 2245 ARG B NH1   1 
ATOM   6197  N NH2   . ARG B 1 214 ? 46.436  18.756  13.483 1.00 13.45 ? 2245 ARG B NH2   1 
ATOM   6198  N N     . LEU B 1 215 ? 51.544  19.187  9.111  1.00 18.67 ? 2246 LEU B N     1 
ATOM   6199  C CA    . LEU B 1 215 ? 51.262  18.713  7.774  1.00 19.62 ? 2246 LEU B CA    1 
ATOM   6200  C C     . LEU B 1 215 ? 49.765  18.576  7.546  1.00 20.96 ? 2246 LEU B C     1 
ATOM   6201  O O     . LEU B 1 215 ? 49.291  18.656  6.409  1.00 20.81 ? 2246 LEU B O     1 
ATOM   6202  C CB    . LEU B 1 215 ? 51.913  17.350  7.581  1.00 18.62 ? 2246 LEU B CB    1 
ATOM   6203  C CG    . LEU B 1 215 ? 51.799  16.729  6.200  1.00 17.55 ? 2246 LEU B CG    1 
ATOM   6204  C CD1   . LEU B 1 215 ? 52.454  17.650  5.215  1.00 17.97 ? 2246 LEU B CD1   1 
ATOM   6205  C CD2   . LEU B 1 215 ? 52.472  15.364  6.196  1.00 17.59 ? 2246 LEU B CD2   1 
ATOM   6206  N N     . PHE B 1 216 ? 49.037  18.352  8.638  1.00 21.37 ? 2247 PHE B N     1 
ATOM   6207  C CA    . PHE B 1 216 ? 47.587  18.159  8.611  1.00 22.01 ? 2247 PHE B CA    1 
ATOM   6208  C C     . PHE B 1 216 ? 47.209  16.914  7.838  1.00 22.98 ? 2247 PHE B C     1 
ATOM   6209  O O     . PHE B 1 216 ? 46.210  16.869  7.128  1.00 23.38 ? 2247 PHE B O     1 
ATOM   6210  C CB    . PHE B 1 216 ? 46.865  19.394  8.070  1.00 19.25 ? 2247 PHE B CB    1 
ATOM   6211  C CG    . PHE B 1 216 ? 46.820  20.513  9.064  1.00 17.96 ? 2247 PHE B CG    1 
ATOM   6212  C CD1   . PHE B 1 216 ? 47.606  21.645  8.907  1.00 17.36 ? 2247 PHE B CD1   1 
ATOM   6213  C CD2   . PHE B 1 216 ? 46.059  20.394  10.212 1.00 18.25 ? 2247 PHE B CD2   1 
ATOM   6214  C CE1   . PHE B 1 216 ? 47.639  22.642  9.889  1.00 16.11 ? 2247 PHE B CE1   1 
ATOM   6215  C CE2   . PHE B 1 216 ? 46.083  21.382  11.199 1.00 18.27 ? 2247 PHE B CE2   1 
ATOM   6216  C CZ    . PHE B 1 216 ? 46.876  22.507  11.034 1.00 17.42 ? 2247 PHE B CZ    1 
ATOM   6217  N N     . LYS B 1 217 ? 48.049  15.903  7.999  1.00 23.28 ? 2248 LYS B N     1 
ATOM   6218  C CA    . LYS B 1 217 ? 47.843  14.606  7.407  1.00 25.15 ? 2248 LYS B CA    1 
ATOM   6219  C C     . LYS B 1 217 ? 48.558  13.659  8.350  1.00 25.30 ? 2248 LYS B C     1 
ATOM   6220  O O     . LYS B 1 217 ? 49.706  13.895  8.713  1.00 26.64 ? 2248 LYS B O     1 
ATOM   6221  C CB    . LYS B 1 217 ? 48.460  14.519  6.015  1.00 27.28 ? 2248 LYS B CB    1 
ATOM   6222  C CG    . LYS B 1 217 ? 47.764  13.494  5.106  1.00 30.49 ? 2248 LYS B CG    1 
ATOM   6223  C CD    . LYS B 1 217 ? 48.676  12.328  4.718  1.00 33.19 ? 2248 LYS B CD    1 
ATOM   6224  C CE    . LYS B 1 217 ? 48.059  11.475  3.607  1.00 33.89 ? 2248 LYS B CE    1 
ATOM   6225  N NZ    . LYS B 1 217 ? 48.854  11.586  2.342  1.00 36.75 ? 2248 LYS B NZ    1 
ATOM   6226  N N     . ASP B 1 218 ? 47.859  12.610  8.766  1.00 25.09 ? 2249 ASP B N     1 
ATOM   6227  C CA    . ASP B 1 218 ? 48.404  11.606  9.660  1.00 25.55 ? 2249 ASP B CA    1 
ATOM   6228  C C     . ASP B 1 218 ? 48.924  12.157  10.983 1.00 25.14 ? 2249 ASP B C     1 
ATOM   6229  O O     . ASP B 1 218 ? 49.667  11.476  11.693 1.00 25.52 ? 2249 ASP B O     1 
ATOM   6230  C CB    . ASP B 1 218 ? 49.508  10.845  8.939  1.00 28.40 ? 2249 ASP B CB    1 
ATOM   6231  C CG    . ASP B 1 218 ? 48.992  10.098  7.713  1.00 31.32 ? 2249 ASP B CG    1 
ATOM   6232  O OD1   . ASP B 1 218 ? 49.767  9.928   6.748  1.00 34.26 ? 2249 ASP B OD1   1 
ATOM   6233  O OD2   . ASP B 1 218 ? 47.814  9.678   7.710  1.00 31.21 ? 2249 ASP B OD2   1 
ATOM   6234  N N     . GLY B 1 219 ? 48.522  13.384  11.309 1.00 23.79 ? 2250 GLY B N     1 
ATOM   6235  C CA    . GLY B 1 219 ? 48.942  14.026  12.547 1.00 22.94 ? 2250 GLY B CA    1 
ATOM   6236  C C     . GLY B 1 219 ? 50.397  14.461  12.577 1.00 22.06 ? 2250 GLY B C     1 
ATOM   6237  O O     . GLY B 1 219 ? 50.926  14.876  13.611 1.00 22.12 ? 2250 GLY B O     1 
ATOM   6238  N N     . LYS B 1 220 ? 51.037  14.395  11.419 1.00 21.39 ? 2251 LYS B N     1 
ATOM   6239  C CA    . LYS B 1 220 ? 52.442  14.722  11.296 1.00 21.32 ? 2251 LYS B CA    1 
ATOM   6240  C C     . LYS B 1 220 ? 52.844  16.179  11.220 1.00 21.77 ? 2251 LYS B C     1 
ATOM   6241  O O     . LYS B 1 220 ? 52.013  17.067  11.085 1.00 21.92 ? 2251 LYS B O     1 
ATOM   6242  C CB    . LYS B 1 220 ? 53.016  13.986  10.082 1.00 20.12 ? 2251 LYS B CB    1 
ATOM   6243  C CG    . LYS B 1 220 ? 52.981  12.476  10.241 1.00 17.49 ? 2251 LYS B CG    1 
ATOM   6244  C CD    . LYS B 1 220 ? 53.632  11.781  9.085  1.00 15.85 ? 2251 LYS B CD    1 
ATOM   6245  C CE    . LYS B 1 220 ? 53.330  10.313  9.154  1.00 16.65 ? 2251 LYS B CE    1 
ATOM   6246  N NZ    . LYS B 1 220 ? 54.244  9.494   8.314  1.00 16.30 ? 2251 LYS B NZ    1 
ATOM   6247  N N     . LEU B 1 221 ? 54.158  16.384  11.291 1.00 23.22 ? 2252 LEU B N     1 
ATOM   6248  C CA    . LEU B 1 221 ? 54.787  17.688  11.212 1.00 23.50 ? 2252 LEU B CA    1 
ATOM   6249  C C     . LEU B 1 221 ? 55.335  17.791  9.790  1.00 24.60 ? 2252 LEU B C     1 
ATOM   6250  O O     . LEU B 1 221 ? 55.762  16.789  9.220  1.00 24.37 ? 2252 LEU B O     1 
ATOM   6251  C CB    . LEU B 1 221 ? 55.950  17.745  12.197 1.00 22.86 ? 2252 LEU B CB    1 
ATOM   6252  C CG    . LEU B 1 221 ? 55.865  18.564  13.486 1.00 22.91 ? 2252 LEU B CG    1 
ATOM   6253  C CD1   . LEU B 1 221 ? 54.430  18.778  13.901 1.00 22.38 ? 2252 LEU B CD1   1 
ATOM   6254  C CD2   . LEU B 1 221 ? 56.638  17.847  14.567 1.00 22.06 ? 2252 LEU B CD2   1 
ATOM   6255  N N     . LYS B 1 222 ? 55.318  18.986  9.206  1.00 26.48 ? 2253 LYS B N     1 
ATOM   6256  C CA    . LYS B 1 222 ? 55.863  19.163  7.861  1.00 27.54 ? 2253 LYS B CA    1 
ATOM   6257  C C     . LYS B 1 222 ? 57.355  18.862  7.920  1.00 27.94 ? 2253 LYS B C     1 
ATOM   6258  O O     . LYS B 1 222 ? 57.972  18.935  8.987  1.00 28.97 ? 2253 LYS B O     1 
ATOM   6259  C CB    . LYS B 1 222 ? 55.680  20.600  7.384  1.00 27.75 ? 2253 LYS B CB    1 
ATOM   6260  C CG    . LYS B 1 222 ? 54.276  20.929  6.966  1.00 30.87 ? 2253 LYS B CG    1 
ATOM   6261  C CD    . LYS B 1 222 ? 54.295  21.915  5.844  1.00 32.15 ? 2253 LYS B CD    1 
ATOM   6262  C CE    . LYS B 1 222 ? 53.376  23.058  6.137  1.00 34.58 ? 2253 LYS B CE    1 
ATOM   6263  N NZ    . LYS B 1 222 ? 53.550  24.119  5.096  1.00 35.79 ? 2253 LYS B NZ    1 
ATOM   6264  N N     . TYR B 1 223 ? 57.941  18.540  6.775  1.00 27.17 ? 2254 TYR B N     1 
ATOM   6265  C CA    . TYR B 1 223 ? 59.364  18.244  6.720  1.00 26.74 ? 2254 TYR B CA    1 
ATOM   6266  C C     . TYR B 1 223 ? 59.792  18.196  5.272  1.00 26.25 ? 2254 TYR B C     1 
ATOM   6267  O O     . TYR B 1 223 ? 58.962  18.033  4.383  1.00 26.60 ? 2254 TYR B O     1 
ATOM   6268  C CB    . TYR B 1 223 ? 59.644  16.887  7.363  1.00 26.65 ? 2254 TYR B CB    1 
ATOM   6269  C CG    . TYR B 1 223 ? 58.978  15.747  6.627  1.00 27.21 ? 2254 TYR B CG    1 
ATOM   6270  C CD1   . TYR B 1 223 ? 59.664  15.029  5.644  1.00 26.93 ? 2254 TYR B CD1   1 
ATOM   6271  C CD2   . TYR B 1 223 ? 57.641  15.417  6.880  1.00 27.46 ? 2254 TYR B CD2   1 
ATOM   6272  C CE1   . TYR B 1 223 ? 59.033  14.012  4.928  1.00 27.33 ? 2254 TYR B CE1   1 
ATOM   6273  C CE2   . TYR B 1 223 ? 57.002  14.410  6.177  1.00 26.13 ? 2254 TYR B CE2   1 
ATOM   6274  C CZ    . TYR B 1 223 ? 57.703  13.712  5.202  1.00 27.37 ? 2254 TYR B CZ    1 
ATOM   6275  O OH    . TYR B 1 223 ? 57.074  12.717  4.494  1.00 27.31 ? 2254 TYR B OH    1 
ATOM   6276  N N     . GLN B 1 224 ? 61.086  18.350  5.028  1.00 24.94 ? 2255 GLN B N     1 
ATOM   6277  C CA    . GLN B 1 224 ? 61.600  18.265  3.670  1.00 23.55 ? 2255 GLN B CA    1 
ATOM   6278  C C     . GLN B 1 224 ? 62.553  17.100  3.653  1.00 22.76 ? 2255 GLN B C     1 
ATOM   6279  O O     . GLN B 1 224 ? 63.021  16.654  4.699  1.00 22.95 ? 2255 GLN B O     1 
ATOM   6280  C CB    . GLN B 1 224 ? 62.338  19.533  3.262  1.00 22.59 ? 2255 GLN B CB    1 
ATOM   6281  C CG    . GLN B 1 224 ? 63.517  19.894  4.129  1.00 23.45 ? 2255 GLN B CG    1 
ATOM   6282  C CD    . GLN B 1 224 ? 64.049  21.279  3.806  1.00 22.73 ? 2255 GLN B CD    1 
ATOM   6283  O OE1   . GLN B 1 224 ? 63.900  21.761  2.686  1.00 24.06 ? 2255 GLN B OE1   1 
ATOM   6284  N NE2   . GLN B 1 224 ? 64.667  21.929  4.788  1.00 22.93 ? 2255 GLN B NE2   1 
ATOM   6285  N N     . VAL B 1 225 ? 62.830  16.595  2.464  1.00 23.12 ? 2256 VAL B N     1 
ATOM   6286  C CA    . VAL B 1 225 ? 63.732  15.470  2.323  1.00 23.86 ? 2256 VAL B CA    1 
ATOM   6287  C C     . VAL B 1 225 ? 64.900  15.900  1.445  1.00 24.06 ? 2256 VAL B C     1 
ATOM   6288  O O     . VAL B 1 225 ? 64.748  16.090  0.240  1.00 23.86 ? 2256 VAL B O     1 
ATOM   6289  C CB    . VAL B 1 225 ? 63.011  14.263  1.698  1.00 22.90 ? 2256 VAL B CB    1 
ATOM   6290  C CG1   . VAL B 1 225 ? 63.934  13.065  1.677  1.00 23.36 ? 2256 VAL B CG1   1 
ATOM   6291  C CG2   . VAL B 1 225 ? 61.753  13.938  2.500  1.00 23.15 ? 2256 VAL B CG2   1 
ATOM   6292  N N     . ILE B 1 226 ? 66.058  16.079  2.069  1.00 24.36 ? 2257 ILE B N     1 
ATOM   6293  C CA    . ILE B 1 226 ? 67.254  16.501  1.355  1.00 24.62 ? 2257 ILE B CA    1 
ATOM   6294  C C     . ILE B 1 226 ? 68.213  15.340  1.301  1.00 24.92 ? 2257 ILE B C     1 
ATOM   6295  O O     . ILE B 1 226 ? 68.589  14.790  2.330  1.00 26.30 ? 2257 ILE B O     1 
ATOM   6296  C CB    . ILE B 1 226 ? 67.952  17.672  2.058  1.00 24.91 ? 2257 ILE B CB    1 
ATOM   6297  C CG1   . ILE B 1 226 ? 66.985  18.850  2.200  1.00 25.63 ? 2257 ILE B CG1   1 
ATOM   6298  C CG2   . ILE B 1 226 ? 69.148  18.110  1.253  1.00 24.39 ? 2257 ILE B CG2   1 
ATOM   6299  C CD1   . ILE B 1 226 ? 67.372  19.830  3.282  1.00 25.45 ? 2257 ILE B CD1   1 
ATOM   6300  N N     . GLY B 1 227 ? 68.593  14.954  0.092  1.00 25.14 ? 2258 GLY B N     1 
ATOM   6301  C CA    . GLY B 1 227 ? 69.502  13.843  -0.049 1.00 23.90 ? 2258 GLY B CA    1 
ATOM   6302  C C     . GLY B 1 227 ? 68.987  12.589  0.626  1.00 23.66 ? 2258 GLY B C     1 
ATOM   6303  O O     . GLY B 1 227 ? 69.760  11.817  1.201  1.00 24.03 ? 2258 GLY B O     1 
ATOM   6304  N N     . GLY B 1 228 ? 67.677  12.378  0.550  1.00 23.58 ? 2259 GLY B N     1 
ATOM   6305  C CA    . GLY B 1 228 ? 67.077  11.205  1.160  1.00 24.20 ? 2259 GLY B CA    1 
ATOM   6306  C C     . GLY B 1 228 ? 66.894  11.308  2.665  1.00 23.87 ? 2259 GLY B C     1 
ATOM   6307  O O     . GLY B 1 228 ? 66.373  10.388  3.285  1.00 24.53 ? 2259 GLY B O     1 
ATOM   6308  N N     . GLU B 1 229 ? 67.319  12.428  3.249  1.00 24.65 ? 2260 GLU B N     1 
ATOM   6309  C CA    . GLU B 1 229 ? 67.215  12.674  4.694  1.00 24.96 ? 2260 GLU B CA    1 
ATOM   6310  C C     . GLU B 1 229 ? 66.086  13.640  5.078  1.00 24.28 ? 2260 GLU B C     1 
ATOM   6311  O O     . GLU B 1 229 ? 65.915  14.702  4.453  1.00 25.11 ? 2260 GLU B O     1 
ATOM   6312  C CB    . GLU B 1 229 ? 68.528  13.255  5.227  1.00 25.77 ? 2260 GLU B CB    1 
ATOM   6313  C CG    . GLU B 1 229 ? 69.709  12.321  5.176  1.00 27.01 ? 2260 GLU B CG    1 
ATOM   6314  C CD    . GLU B 1 229 ? 69.530  11.104  6.063  1.00 29.19 ? 2260 GLU B CD    1 
ATOM   6315  O OE1   . GLU B 1 229 ? 69.285  10.010  5.512  1.00 30.28 ? 2260 GLU B OE1   1 
ATOM   6316  O OE2   . GLU B 1 229 ? 69.634  11.240  7.304  1.00 29.85 ? 2260 GLU B OE2   1 
ATOM   6317  N N     . VAL B 1 230 ? 65.350  13.287  6.131  1.00 22.94 ? 2261 VAL B N     1 
ATOM   6318  C CA    . VAL B 1 230 ? 64.238  14.102  6.617  1.00 21.76 ? 2261 VAL B CA    1 
ATOM   6319  C C     . VAL B 1 230 ? 64.729  15.213  7.522  1.00 20.98 ? 2261 VAL B C     1 
ATOM   6320  O O     . VAL B 1 230 ? 65.426  14.959  8.485  1.00 20.27 ? 2261 VAL B O     1 
ATOM   6321  C CB    . VAL B 1 230 ? 63.214  13.244  7.406  1.00 22.11 ? 2261 VAL B CB    1 
ATOM   6322  C CG1   . VAL B 1 230 ? 62.352  14.133  8.299  1.00 21.49 ? 2261 VAL B CG1   1 
ATOM   6323  C CG2   . VAL B 1 230 ? 62.330  12.474  6.434  1.00 21.92 ? 2261 VAL B CG2   1 
ATOM   6324  N N     . TYR B 1 231 ? 64.360  16.450  7.214  1.00 21.01 ? 2262 TYR B N     1 
ATOM   6325  C CA    . TYR B 1 231 ? 64.778  17.589  8.024  1.00 21.75 ? 2262 TYR B CA    1 
ATOM   6326  C C     . TYR B 1 231 ? 63.580  18.506  8.173  1.00 21.67 ? 2262 TYR B C     1 
ATOM   6327  O O     . TYR B 1 231 ? 62.615  18.387  7.406  1.00 23.15 ? 2262 TYR B O     1 
ATOM   6328  C CB    . TYR B 1 231 ? 65.893  18.373  7.330  1.00 22.36 ? 2262 TYR B CB    1 
ATOM   6329  C CG    . TYR B 1 231 ? 67.228  17.674  7.275  1.00 23.93 ? 2262 TYR B CG    1 
ATOM   6330  C CD1   . TYR B 1 231 ? 67.666  17.069  6.101  1.00 24.36 ? 2262 TYR B CD1   1 
ATOM   6331  C CD2   . TYR B 1 231 ? 68.069  17.645  8.394  1.00 24.78 ? 2262 TYR B CD2   1 
ATOM   6332  C CE1   . TYR B 1 231 ? 68.912  16.447  6.040  1.00 26.14 ? 2262 TYR B CE1   1 
ATOM   6333  C CE2   . TYR B 1 231 ? 69.316  17.030  8.348  1.00 26.34 ? 2262 TYR B CE2   1 
ATOM   6334  C CZ    . TYR B 1 231 ? 69.738  16.432  7.167  1.00 27.83 ? 2262 TYR B CZ    1 
ATOM   6335  O OH    . TYR B 1 231 ? 70.995  15.847  7.100  1.00 29.64 ? 2262 TYR B OH    1 
ATOM   6336  N N     . PRO B 1 232 ? 63.610  19.422  9.169  1.00 20.38 ? 2263 PRO B N     1 
ATOM   6337  C CA    . PRO B 1 232 ? 62.479  20.344  9.347  1.00 20.68 ? 2263 PRO B CA    1 
ATOM   6338  C C     . PRO B 1 232 ? 62.226  21.110  8.049  1.00 19.86 ? 2263 PRO B C     1 
ATOM   6339  O O     . PRO B 1 232 ? 63.115  21.225  7.205  1.00 20.43 ? 2263 PRO B O     1 
ATOM   6340  C CB    . PRO B 1 232 ? 62.926  21.250  10.495 1.00 19.44 ? 2263 PRO B CB    1 
ATOM   6341  C CG    . PRO B 1 232 ? 63.895  20.402  11.277 1.00 18.42 ? 2263 PRO B CG    1 
ATOM   6342  C CD    . PRO B 1 232 ? 64.638  19.623  10.208 1.00 20.37 ? 2263 PRO B CD    1 
ATOM   6343  N N     . PRO B 1 233 ? 61.008  21.643  7.871  1.00 18.76 ? 2264 PRO B N     1 
ATOM   6344  C CA    . PRO B 1 233 ? 60.712  22.381  6.643  1.00 20.48 ? 2264 PRO B CA    1 
ATOM   6345  C C     . PRO B 1 233 ? 61.375  23.749  6.621  1.00 19.55 ? 2264 PRO B C     1 
ATOM   6346  O O     . PRO B 1 233 ? 62.024  24.155  7.575  1.00 20.71 ? 2264 PRO B O     1 
ATOM   6347  C CB    . PRO B 1 233 ? 59.186  22.473  6.640  1.00 18.75 ? 2264 PRO B CB    1 
ATOM   6348  C CG    . PRO B 1 233 ? 58.812  22.475  8.085  1.00 18.81 ? 2264 PRO B CG    1 
ATOM   6349  C CD    . PRO B 1 233 ? 59.855  21.627  8.794  1.00 19.64 ? 2264 PRO B CD    1 
ATOM   6350  N N     . THR B 1 234 ? 61.197  24.469  5.527  1.00 20.11 ? 2265 THR B N     1 
ATOM   6351  C CA    . THR B 1 234 ? 61.795  25.779  5.402  1.00 20.93 ? 2265 THR B CA    1 
ATOM   6352  C C     . THR B 1 234 ? 60.843  26.891  5.836  1.00 21.40 ? 2265 THR B C     1 
ATOM   6353  O O     . THR B 1 234 ? 59.663  26.658  6.094  1.00 21.77 ? 2265 THR B O     1 
ATOM   6354  C CB    . THR B 1 234 ? 62.239  26.013  3.947  1.00 20.30 ? 2265 THR B CB    1 
ATOM   6355  O OG1   . THR B 1 234 ? 61.092  26.239  3.123  1.00 20.27 ? 2265 THR B OG1   1 
ATOM   6356  C CG2   . THR B 1 234 ? 62.959  24.798  3.428  1.00 19.39 ? 2265 THR B CG2   1 
ATOM   6357  N N     . VAL B 1 235 ? 61.372  28.102  5.930  1.00 23.02 ? 2266 VAL B N     1 
ATOM   6358  C CA    . VAL B 1 235 ? 60.566  29.251  6.294  1.00 24.79 ? 2266 VAL B CA    1 
ATOM   6359  C C     . VAL B 1 235 ? 59.678  29.662  5.124  1.00 25.98 ? 2266 VAL B C     1 
ATOM   6360  O O     . VAL B 1 235 ? 58.535  30.073  5.316  1.00 26.40 ? 2266 VAL B O     1 
ATOM   6361  C CB    . VAL B 1 235 ? 61.439  30.455  6.652  1.00 24.50 ? 2266 VAL B CB    1 
ATOM   6362  C CG1   . VAL B 1 235 ? 60.555  31.643  6.975  1.00 23.21 ? 2266 VAL B CG1   1 
ATOM   6363  C CG2   . VAL B 1 235 ? 62.336  30.109  7.831  1.00 24.45 ? 2266 VAL B CG2   1 
ATOM   6364  N N     . LYS B 1 236 ? 60.209  29.557  3.908  1.00 27.69 ? 2267 LYS B N     1 
ATOM   6365  C CA    . LYS B 1 236 ? 59.445  29.937  2.729  1.00 29.16 ? 2267 LYS B CA    1 
ATOM   6366  C C     . LYS B 1 236 ? 58.192  29.083  2.612  1.00 30.17 ? 2267 LYS B C     1 
ATOM   6367  O O     . LYS B 1 236 ? 57.135  29.556  2.210  1.00 30.99 ? 2267 LYS B O     1 
ATOM   6368  C CB    . LYS B 1 236 ? 60.273  29.771  1.454  1.00 28.34 ? 2267 LYS B CB    1 
ATOM   6369  C CG    . LYS B 1 236 ? 59.418  29.829  0.198  1.00 29.01 ? 2267 LYS B CG    1 
ATOM   6370  C CD    . LYS B 1 236 ? 60.073  30.578  -0.943 1.00 29.36 ? 2267 LYS B CD    1 
ATOM   6371  C CE    . LYS B 1 236 ? 60.885  31.737  -0.458 1.00 27.88 ? 2267 LYS B CE    1 
ATOM   6372  N NZ    . LYS B 1 236 ? 61.150  32.674  -1.578 1.00 31.48 ? 2267 LYS B NZ    1 
ATOM   6373  N N     . ASP B 1 237 ? 58.308  27.815  2.965  1.00 31.21 ? 2268 ASP B N     1 
ATOM   6374  C CA    . ASP B 1 237 ? 57.168  26.934  2.855  1.00 31.46 ? 2268 ASP B CA    1 
ATOM   6375  C C     . ASP B 1 237 ? 56.158  27.057  3.983  1.00 32.38 ? 2268 ASP B C     1 
ATOM   6376  O O     . ASP B 1 237 ? 54.958  27.053  3.747  1.00 33.42 ? 2268 ASP B O     1 
ATOM   6377  C CB    . ASP B 1 237 ? 57.642  25.496  2.769  1.00 31.50 ? 2268 ASP B CB    1 
ATOM   6378  C CG    . ASP B 1 237 ? 56.500  24.533  2.618  1.00 31.64 ? 2268 ASP B CG    1 
ATOM   6379  O OD1   . ASP B 1 237 ? 55.783  24.296  3.601  1.00 32.76 ? 2268 ASP B OD1   1 
ATOM   6380  O OD2   . ASP B 1 237 ? 56.303  24.011  1.512  1.00 34.87 ? 2268 ASP B OD2   1 
ATOM   6381  N N     . THR B 1 238 ? 56.637  27.155  5.213  1.00 34.20 ? 2269 THR B N     1 
ATOM   6382  C CA    . THR B 1 238 ? 55.742  27.237  6.349  1.00 34.94 ? 2269 THR B CA    1 
ATOM   6383  C C     . THR B 1 238 ? 55.349  28.652  6.697  1.00 37.17 ? 2269 THR B C     1 
ATOM   6384  O O     . THR B 1 238 ? 54.313  28.868  7.309  1.00 37.65 ? 2269 THR B O     1 
ATOM   6385  C CB    . THR B 1 238 ? 56.373  26.619  7.605  1.00 34.78 ? 2269 THR B CB    1 
ATOM   6386  O OG1   . THR B 1 238 ? 57.588  27.317  7.912  1.00 34.84 ? 2269 THR B OG1   1 
ATOM   6387  C CG2   . THR B 1 238 ? 56.654  25.127  7.399  1.00 32.15 ? 2269 THR B CG2   1 
ATOM   6388  N N     . GLN B 1 239 ? 56.181  29.617  6.329  1.00 39.49 ? 2270 GLN B N     1 
ATOM   6389  C CA    . GLN B 1 239 ? 55.903  31.017  6.632  1.00 42.32 ? 2270 GLN B CA    1 
ATOM   6390  C C     . GLN B 1 239 ? 55.852  31.297  8.126  1.00 44.18 ? 2270 GLN B C     1 
ATOM   6391  O O     . GLN B 1 239 ? 55.223  32.255  8.572  1.00 43.61 ? 2270 GLN B O     1 
ATOM   6392  C CB    . GLN B 1 239 ? 54.590  31.442  6.007  1.00 44.25 ? 2270 GLN B CB    1 
ATOM   6393  C CG    . GLN B 1 239 ? 54.380  30.890  4.626  1.00 47.72 ? 2270 GLN B CG    1 
ATOM   6394  C CD    . GLN B 1 239 ? 52.985  31.169  4.121  1.00 52.00 ? 2270 GLN B CD    1 
ATOM   6395  O OE1   . GLN B 1 239 ? 52.025  30.456  4.460  1.00 55.30 ? 2270 GLN B OE1   1 
ATOM   6396  N NE2   . GLN B 1 239 ? 52.854  32.217  3.307  1.00 52.61 ? 2270 GLN B NE2   1 
ATOM   6397  N N     . VAL B 1 240 ? 56.522  30.458  8.899  1.00 46.43 ? 2271 VAL B N     1 
ATOM   6398  C CA    . VAL B 1 240 ? 56.551  30.647  10.334 1.00 48.62 ? 2271 VAL B CA    1 
ATOM   6399  C C     . VAL B 1 240 ? 57.464  31.819  10.565 1.00 50.96 ? 2271 VAL B C     1 
ATOM   6400  O O     . VAL B 1 240 ? 58.616  31.801  10.126 1.00 51.37 ? 2271 VAL B O     1 
ATOM   6401  C CB    . VAL B 1 240 ? 57.162  29.444  11.062 1.00 47.55 ? 2271 VAL B CB    1 
ATOM   6402  C CG1   . VAL B 1 240 ? 56.190  28.296  11.062 1.00 46.19 ? 2271 VAL B CG1   1 
ATOM   6403  C CG2   . VAL B 1 240 ? 58.468  29.051  10.400 1.00 45.71 ? 2271 VAL B CG2   1 
ATOM   6404  N N     . GLU B 1 241 ? 56.959  32.840  11.245 1.00 53.02 ? 2272 GLU B N     1 
ATOM   6405  C CA    . GLU B 1 241 ? 57.789  33.994  11.530 1.00 55.32 ? 2272 GLU B CA    1 
ATOM   6406  C C     . GLU B 1 241 ? 59.092  33.486  12.125 1.00 55.09 ? 2272 GLU B C     1 
ATOM   6407  O O     . GLU B 1 241 ? 59.118  32.805  13.149 1.00 55.04 ? 2272 GLU B O     1 
ATOM   6408  C CB    . GLU B 1 241 ? 57.099  34.929  12.508 1.00 57.98 ? 2272 GLU B CB    1 
ATOM   6409  C CG    . GLU B 1 241 ? 57.351  36.385  12.193 1.00 62.60 ? 2272 GLU B CG    1 
ATOM   6410  C CD    . GLU B 1 241 ? 57.347  37.254  13.436 1.00 66.15 ? 2272 GLU B CD    1 
ATOM   6411  O OE1   . GLU B 1 241 ? 57.561  36.708  14.545 1.00 67.29 ? 2272 GLU B OE1   1 
ATOM   6412  O OE2   . GLU B 1 241 ? 57.125  38.483  13.304 1.00 68.21 ? 2272 GLU B OE2   1 
ATOM   6413  N N     . MET B 1 242 ? 60.174  33.820  11.448 1.00 54.32 ? 2273 MET B N     1 
ATOM   6414  C CA    . MET B 1 242 ? 61.506  33.408  11.834 1.00 53.09 ? 2273 MET B CA    1 
ATOM   6415  C C     . MET B 1 242 ? 62.272  34.119  10.733 1.00 52.37 ? 2273 MET B C     1 
ATOM   6416  O O     . MET B 1 242 ? 61.922  34.007  9.558  1.00 52.33 ? 2273 MET B O     1 
ATOM   6417  C CB    . MET B 1 242 ? 61.651  31.876  11.710 1.00 54.30 ? 2273 MET B CB    1 
ATOM   6418  C CG    . MET B 1 242 ? 62.568  31.197  12.755 1.00 55.27 ? 2273 MET B CG    1 
ATOM   6419  S SD    . MET B 1 242 ? 62.349  29.363  13.016 1.00 53.31 ? 2273 MET B SD    1 
ATOM   6420  C CE    . MET B 1 242 ? 60.589  29.205  12.996 1.00 55.59 ? 2273 MET B CE    1 
ATOM   6421  N N     . ILE B 1 243 ? 63.287  34.882  11.108 1.00 51.78 ? 2274 ILE B N     1 
ATOM   6422  C CA    . ILE B 1 243 ? 64.063  35.610  10.121 1.00 48.96 ? 2274 ILE B CA    1 
ATOM   6423  C C     . ILE B 1 243 ? 65.527  35.282  10.348 1.00 47.14 ? 2274 ILE B C     1 
ATOM   6424  O O     . ILE B 1 243 ? 66.088  35.573  11.403 1.00 48.12 ? 2274 ILE B O     1 
ATOM   6425  C CB    . ILE B 1 243 ? 63.809  37.128  10.242 1.00 50.09 ? 2274 ILE B CB    1 
ATOM   6426  C CG1   . ILE B 1 243 ? 62.466  37.473  9.595  1.00 51.25 ? 2274 ILE B CG1   1 
ATOM   6427  C CG2   . ILE B 1 243 ? 64.919  37.911  9.569  1.00 51.05 ? 2274 ILE B CG2   1 
ATOM   6428  C CD1   . ILE B 1 243 ? 62.327  36.985  8.154  1.00 52.05 ? 2274 ILE B CD1   1 
ATOM   6429  N N     . TYR B 1 244 ? 66.127  34.645  9.352  1.00 45.38 ? 2275 TYR B N     1 
ATOM   6430  C CA    . TYR B 1 244 ? 67.528  34.234  9.409  1.00 42.62 ? 2275 TYR B CA    1 
ATOM   6431  C C     . TYR B 1 244 ? 68.386  35.276  8.731  1.00 40.00 ? 2275 TYR B C     1 
ATOM   6432  O O     . TYR B 1 244 ? 67.882  36.079  7.946  1.00 40.57 ? 2275 TYR B O     1 
ATOM   6433  C CB    . TYR B 1 244 ? 67.730  32.955  8.603  1.00 40.36 ? 2275 TYR B CB    1 
ATOM   6434  C CG    . TYR B 1 244 ? 67.350  31.663  9.269  1.00 38.75 ? 2275 TYR B CG    1 
ATOM   6435  C CD1   . TYR B 1 244 ? 66.013  31.258  9.363  1.00 37.54 ? 2275 TYR B CD1   1 
ATOM   6436  C CD2   . TYR B 1 244 ? 68.340  30.791  9.724  1.00 38.11 ? 2275 TYR B CD2   1 
ATOM   6437  C CE1   . TYR B 1 244 ? 65.681  30.008  9.892  1.00 35.96 ? 2275 TYR B CE1   1 
ATOM   6438  C CE2   . TYR B 1 244 ? 68.021  29.546  10.251 1.00 36.84 ? 2275 TYR B CE2   1 
ATOM   6439  C CZ    . TYR B 1 244 ? 66.700  29.161  10.331 1.00 36.02 ? 2275 TYR B CZ    1 
ATOM   6440  O OH    . TYR B 1 244 ? 66.423  27.919  10.842 1.00 35.19 ? 2275 TYR B OH    1 
ATOM   6441  N N     . PRO B 1 245 ? 69.685  35.314  9.063  1.00 39.06 ? 2276 PRO B N     1 
ATOM   6442  C CA    . PRO B 1 245 ? 70.508  36.299  8.370  1.00 38.00 ? 2276 PRO B CA    1 
ATOM   6443  C C     . PRO B 1 245 ? 70.176  36.011  6.894  1.00 38.25 ? 2276 PRO B C     1 
ATOM   6444  O O     . PRO B 1 245 ? 70.070  34.854  6.474  1.00 36.86 ? 2276 PRO B O     1 
ATOM   6445  C CB    . PRO B 1 245 ? 71.919  35.896  8.743  1.00 38.14 ? 2276 PRO B CB    1 
ATOM   6446  C CG    . PRO B 1 245 ? 71.771  35.265  10.080 1.00 37.45 ? 2276 PRO B CG    1 
ATOM   6447  C CD    . PRO B 1 245 ? 70.440  34.580  10.088 1.00 38.55 ? 2276 PRO B CD    1 
ATOM   6448  N N     . PRO B 1 246 ? 69.989  37.063  6.098  1.00 36.57 ? 2277 PRO B N     1 
ATOM   6449  C CA    . PRO B 1 246 ? 69.646  36.990  4.674  1.00 35.66 ? 2277 PRO B CA    1 
ATOM   6450  C C     . PRO B 1 246 ? 70.467  36.104  3.765  1.00 35.10 ? 2277 PRO B C     1 
ATOM   6451  O O     . PRO B 1 246 ? 70.017  35.740  2.677  1.00 36.79 ? 2277 PRO B O     1 
ATOM   6452  C CB    . PRO B 1 246 ? 69.682  38.448  4.217  1.00 35.03 ? 2277 PRO B CB    1 
ATOM   6453  C CG    . PRO B 1 246 ? 70.443  39.169  5.279  1.00 36.24 ? 2277 PRO B CG    1 
ATOM   6454  C CD    . PRO B 1 246 ? 70.148  38.451  6.550  1.00 37.37 ? 2277 PRO B CD    1 
ATOM   6455  N N     . HIS B 1 247 ? 71.666  35.746  4.181  1.00 34.05 ? 2278 HIS B N     1 
ATOM   6456  C CA    . HIS B 1 247 ? 72.477  34.925  3.311  1.00 32.91 ? 2278 HIS B CA    1 
ATOM   6457  C C     . HIS B 1 247 ? 72.198  33.432  3.414  1.00 31.88 ? 2278 HIS B C     1 
ATOM   6458  O O     . HIS B 1 247 ? 72.588  32.667  2.536  1.00 31.97 ? 2278 HIS B O     1 
ATOM   6459  C CB    . HIS B 1 247 ? 73.947  35.201  3.578  1.00 34.91 ? 2278 HIS B CB    1 
ATOM   6460  C CG    . HIS B 1 247 ? 74.393  34.802  4.943  1.00 36.28 ? 2278 HIS B CG    1 
ATOM   6461  N ND1   . HIS B 1 247 ? 74.003  35.481  6.081  1.00 37.13 ? 2278 HIS B ND1   1 
ATOM   6462  C CD2   . HIS B 1 247 ? 75.178  33.781  5.363  1.00 36.25 ? 2278 HIS B CD2   1 
ATOM   6463  C CE1   . HIS B 1 247 ? 74.532  34.892  7.141  1.00 37.59 ? 2278 HIS B CE1   1 
ATOM   6464  N NE2   . HIS B 1 247 ? 75.246  33.861  6.732  1.00 37.15 ? 2278 HIS B NE2   1 
ATOM   6465  N N     . ILE B 1 248 ? 71.515  32.999  4.466  1.00 30.92 ? 2279 ILE B N     1 
ATOM   6466  C CA    . ILE B 1 248 ? 71.253  31.577  4.598  1.00 29.37 ? 2279 ILE B CA    1 
ATOM   6467  C C     . ILE B 1 248 ? 70.423  31.039  3.452  1.00 28.74 ? 2279 ILE B C     1 
ATOM   6468  O O     . ILE B 1 248 ? 69.364  31.577  3.143  1.00 29.89 ? 2279 ILE B O     1 
ATOM   6469  C CB    . ILE B 1 248 ? 70.543  31.252  5.915  1.00 28.01 ? 2279 ILE B CB    1 
ATOM   6470  C CG1   . ILE B 1 248 ? 71.499  31.497  7.068  1.00 27.80 ? 2279 ILE B CG1   1 
ATOM   6471  C CG2   . ILE B 1 248 ? 70.145  29.784  5.954  1.00 28.69 ? 2279 ILE B CG2   1 
ATOM   6472  C CD1   . ILE B 1 248 ? 71.219  32.753  7.762  1.00 28.42 ? 2279 ILE B CD1   1 
ATOM   6473  N N     . PRO B 1 249 ? 70.926  29.998  2.767  1.00 28.13 ? 2280 PRO B N     1 
ATOM   6474  C CA    . PRO B 1 249 ? 70.178  29.407  1.650  1.00 25.85 ? 2280 PRO B CA    1 
ATOM   6475  C C     . PRO B 1 249 ? 68.746  29.119  2.083  1.00 24.83 ? 2280 PRO B C     1 
ATOM   6476  O O     . PRO B 1 249 ? 68.491  28.805  3.244  1.00 23.69 ? 2280 PRO B O     1 
ATOM   6477  C CB    . PRO B 1 249 ? 70.929  28.114  1.325  1.00 26.40 ? 2280 PRO B CB    1 
ATOM   6478  C CG    . PRO B 1 249 ? 72.202  28.132  2.142  1.00 26.11 ? 2280 PRO B CG    1 
ATOM   6479  C CD    . PRO B 1 249 ? 72.251  29.382  2.965  1.00 26.86 ? 2280 PRO B CD    1 
ATOM   6480  N N     . GLU B 1 250 ? 67.820  29.231  1.140  1.00 24.63 ? 2281 GLU B N     1 
ATOM   6481  C CA    . GLU B 1 250 ? 66.409  29.000  1.392  1.00 23.50 ? 2281 GLU B CA    1 
ATOM   6482  C C     . GLU B 1 250 ? 66.154  27.677  2.122  1.00 24.22 ? 2281 GLU B C     1 
ATOM   6483  O O     . GLU B 1 250 ? 65.562  27.660  3.207  1.00 25.29 ? 2281 GLU B O     1 
ATOM   6484  C CB    . GLU B 1 250 ? 65.636  29.036  0.065  1.00 22.67 ? 2281 GLU B CB    1 
ATOM   6485  C CG    . GLU B 1 250 ? 64.134  28.758  0.182  1.00 24.06 ? 2281 GLU B CG    1 
ATOM   6486  C CD    . GLU B 1 250 ? 63.413  28.647  -1.180 1.00 24.30 ? 2281 GLU B CD    1 
ATOM   6487  O OE1   . GLU B 1 250 ? 63.787  29.342  -2.146 1.00 25.11 ? 2281 GLU B OE1   1 
ATOM   6488  O OE2   . GLU B 1 250 ? 62.458  27.855  -1.295 1.00 23.52 ? 2281 GLU B OE2   1 
ATOM   6489  N N     . ASN B 1 251 ? 66.601  26.565  1.546  1.00 24.38 ? 2282 ASN B N     1 
ATOM   6490  C CA    . ASN B 1 251 ? 66.374  25.271  2.181  1.00 23.67 ? 2282 ASN B CA    1 
ATOM   6491  C C     . ASN B 1 251 ? 67.097  25.066  3.501  1.00 23.12 ? 2282 ASN B C     1 
ATOM   6492  O O     . ASN B 1 251 ? 66.857  24.072  4.182  1.00 23.15 ? 2282 ASN B O     1 
ATOM   6493  C CB    . ASN B 1 251 ? 66.741  24.136  1.231  1.00 24.69 ? 2282 ASN B CB    1 
ATOM   6494  C CG    . ASN B 1 251 ? 65.614  23.795  0.302  1.00 25.81 ? 2282 ASN B CG    1 
ATOM   6495  O OD1   . ASN B 1 251 ? 64.742  24.634  0.048  1.00 25.44 ? 2282 ASN B OD1   1 
ATOM   6496  N ND2   . ASN B 1 251 ? 65.611  22.566  -0.214 1.00 26.11 ? 2282 ASN B ND2   1 
ATOM   6497  N N     . LEU B 1 252 ? 67.981  25.990  3.867  1.00 22.09 ? 2283 LEU B N     1 
ATOM   6498  C CA    . LEU B 1 252 ? 68.705  25.854  5.125  1.00 22.36 ? 2283 LEU B CA    1 
ATOM   6499  C C     . LEU B 1 252 ? 68.076  26.713  6.205  1.00 22.36 ? 2283 LEU B C     1 
ATOM   6500  O O     . LEU B 1 252 ? 68.557  26.777  7.333  1.00 21.83 ? 2283 LEU B O     1 
ATOM   6501  C CB    . LEU B 1 252 ? 70.179  26.224  4.955  1.00 21.18 ? 2283 LEU B CB    1 
ATOM   6502  C CG    . LEU B 1 252 ? 71.079  25.053  4.561  1.00 20.44 ? 2283 LEU B CG    1 
ATOM   6503  C CD1   . LEU B 1 252 ? 72.534  25.471  4.693  1.00 19.02 ? 2283 LEU B CD1   1 
ATOM   6504  C CD2   . LEU B 1 252 ? 70.761  23.842  5.431  1.00 18.47 ? 2283 LEU B CD2   1 
ATOM   6505  N N     . GLN B 1 253 ? 66.988  27.379  5.850  1.00 23.19 ? 2284 GLN B N     1 
ATOM   6506  C CA    . GLN B 1 253 ? 66.280  28.207  6.811  1.00 24.20 ? 2284 GLN B CA    1 
ATOM   6507  C C     . GLN B 1 253 ? 65.166  27.360  7.415  1.00 24.56 ? 2284 GLN B C     1 
ATOM   6508  O O     . GLN B 1 253 ? 63.980  27.537  7.095  1.00 24.08 ? 2284 GLN B O     1 
ATOM   6509  C CB    . GLN B 1 253 ? 65.702  29.429  6.118  1.00 23.27 ? 2284 GLN B CB    1 
ATOM   6510  C CG    . GLN B 1 253 ? 66.757  30.319  5.574  1.00 24.57 ? 2284 GLN B CG    1 
ATOM   6511  C CD    . GLN B 1 253 ? 66.190  31.609  5.065  1.00 27.32 ? 2284 GLN B CD    1 
ATOM   6512  O OE1   . GLN B 1 253 ? 65.072  31.993  5.430  1.00 29.68 ? 2284 GLN B OE1   1 
ATOM   6513  N NE2   . GLN B 1 253 ? 66.956  32.304  4.215  1.00 26.44 ? 2284 GLN B NE2   1 
ATOM   6514  N N     . PHE B 1 254 ? 65.571  26.426  8.277  1.00 23.52 ? 2285 PHE B N     1 
ATOM   6515  C CA    . PHE B 1 254 ? 64.648  25.516  8.939  1.00 23.70 ? 2285 PHE B CA    1 
ATOM   6516  C C     . PHE B 1 254 ? 63.618  26.218  9.790  1.00 24.05 ? 2285 PHE B C     1 
ATOM   6517  O O     . PHE B 1 254 ? 63.864  27.276  10.384 1.00 24.14 ? 2285 PHE B O     1 
ATOM   6518  C CB    . PHE B 1 254 ? 65.401  24.525  9.817  1.00 23.36 ? 2285 PHE B CB    1 
ATOM   6519  C CG    . PHE B 1 254 ? 66.434  23.765  9.081  1.00 24.62 ? 2285 PHE B CG    1 
ATOM   6520  C CD1   . PHE B 1 254 ? 67.784  23.899  9.417  1.00 25.87 ? 2285 PHE B CD1   1 
ATOM   6521  C CD2   . PHE B 1 254 ? 66.071  22.955  8.012  1.00 23.72 ? 2285 PHE B CD2   1 
ATOM   6522  C CE1   . PHE B 1 254 ? 68.776  23.229  8.685  1.00 27.91 ? 2285 PHE B CE1   1 
ATOM   6523  C CE2   . PHE B 1 254 ? 67.037  22.278  7.269  1.00 24.67 ? 2285 PHE B CE2   1 
ATOM   6524  C CZ    . PHE B 1 254 ? 68.401  22.414  7.602  1.00 26.43 ? 2285 PHE B CZ    1 
ATOM   6525  N N     . ALA B 1 255 ? 62.440  25.620  9.828  1.00 22.54 ? 2286 ALA B N     1 
ATOM   6526  C CA    . ALA B 1 255 ? 61.370  26.152  10.631 1.00 21.84 ? 2286 ALA B CA    1 
ATOM   6527  C C     . ALA B 1 255 ? 61.136  25.115  11.711 1.00 21.49 ? 2286 ALA B C     1 
ATOM   6528  O O     . ALA B 1 255 ? 60.808  23.971  11.420 1.00 21.85 ? 2286 ALA B O     1 
ATOM   6529  C CB    . ALA B 1 255 ? 60.125  26.334  9.787  1.00 21.29 ? 2286 ALA B CB    1 
ATOM   6530  N N     . VAL B 1 256 ? 61.337  25.502  12.962 1.00 22.14 ? 2287 VAL B N     1 
ATOM   6531  C CA    . VAL B 1 256 ? 61.119  24.580  14.058 1.00 23.90 ? 2287 VAL B CA    1 
ATOM   6532  C C     . VAL B 1 256 ? 60.364  25.310  15.148 1.00 25.28 ? 2287 VAL B C     1 
ATOM   6533  O O     . VAL B 1 256 ? 60.178  26.522  15.073 1.00 24.43 ? 2287 VAL B O     1 
ATOM   6534  C CB    . VAL B 1 256 ? 62.459  24.011  14.609 1.00 24.16 ? 2287 VAL B CB    1 
ATOM   6535  C CG1   . VAL B 1 256 ? 63.106  23.103  13.544 1.00 22.06 ? 2287 VAL B CG1   1 
ATOM   6536  C CG2   . VAL B 1 256 ? 63.401  25.151  15.003 1.00 21.14 ? 2287 VAL B CG2   1 
ATOM   6537  N N     . GLY B 1 257 ? 59.924  24.565  16.155 1.00 27.43 ? 2288 GLY B N     1 
ATOM   6538  C CA    . GLY B 1 257 ? 59.172  25.159  17.242 1.00 29.50 ? 2288 GLY B CA    1 
ATOM   6539  C C     . GLY B 1 257 ? 59.851  26.345  17.885 1.00 31.47 ? 2288 GLY B C     1 
ATOM   6540  O O     . GLY B 1 257 ? 59.236  27.388  18.082 1.00 31.51 ? 2288 GLY B O     1 
ATOM   6541  N N     . GLN B 1 258 ? 61.122  26.188  18.232 1.00 34.02 ? 2289 GLN B N     1 
ATOM   6542  C CA    . GLN B 1 258 ? 61.862  27.269  18.865 1.00 35.87 ? 2289 GLN B CA    1 
ATOM   6543  C C     . GLN B 1 258 ? 62.671  28.019  17.823 1.00 38.17 ? 2289 GLN B C     1 
ATOM   6544  O O     . GLN B 1 258 ? 63.601  27.482  17.219 1.00 37.54 ? 2289 GLN B O     1 
ATOM   6545  C CB    . GLN B 1 258 ? 62.765  26.705  19.949 1.00 37.14 ? 2289 GLN B CB    1 
ATOM   6546  C CG    . GLN B 1 258 ? 62.449  27.246  21.316 1.00 38.53 ? 2289 GLN B CG    1 
ATOM   6547  C CD    . GLN B 1 258 ? 63.204  28.526  21.570 1.00 38.63 ? 2289 GLN B CD    1 
ATOM   6548  O OE1   . GLN B 1 258 ? 63.291  29.389  20.693 1.00 35.74 ? 2289 GLN B OE1   1 
ATOM   6549  N NE2   . GLN B 1 258 ? 63.770  28.657  22.769 1.00 40.21 ? 2289 GLN B NE2   1 
ATOM   6550  N N     . GLU B 1 259 ? 62.303  29.275  17.622 1.00 40.49 ? 2290 GLU B N     1 
ATOM   6551  C CA    . GLU B 1 259 ? 62.949  30.120  16.627 1.00 43.15 ? 2290 GLU B CA    1 
ATOM   6552  C C     . GLU B 1 259 ? 64.434  30.404  16.835 1.00 42.73 ? 2290 GLU B C     1 
ATOM   6553  O O     . GLU B 1 259 ? 65.045  31.089  16.023 1.00 43.70 ? 2290 GLU B O     1 
ATOM   6554  C CB    . GLU B 1 259 ? 62.199  31.454  16.510 1.00 47.03 ? 2290 GLU B CB    1 
ATOM   6555  C CG    . GLU B 1 259 ? 61.245  31.738  17.660 1.00 54.19 ? 2290 GLU B CG    1 
ATOM   6556  C CD    . GLU B 1 259 ? 61.776  32.813  18.590 1.00 57.79 ? 2290 GLU B CD    1 
ATOM   6557  O OE1   . GLU B 1 259 ? 61.501  34.015  18.334 1.00 60.22 ? 2290 GLU B OE1   1 
ATOM   6558  O OE2   . GLU B 1 259 ? 62.472  32.455  19.574 1.00 59.91 ? 2290 GLU B OE2   1 
ATOM   6559  N N     . VAL B 1 260 ? 65.025  29.871  17.895 1.00 41.38 ? 2291 VAL B N     1 
ATOM   6560  C CA    . VAL B 1 260 ? 66.433  30.131  18.172 1.00 38.96 ? 2291 VAL B CA    1 
ATOM   6561  C C     . VAL B 1 260 ? 67.391  28.965  17.857 1.00 37.35 ? 2291 VAL B C     1 
ATOM   6562  O O     . VAL B 1 260 ? 68.613  29.143  17.826 1.00 36.47 ? 2291 VAL B O     1 
ATOM   6563  C CB    . VAL B 1 260 ? 66.584  30.569  19.652 1.00 39.49 ? 2291 VAL B CB    1 
ATOM   6564  C CG1   . VAL B 1 260 ? 67.036  29.402  20.524 1.00 38.38 ? 2291 VAL B CG1   1 
ATOM   6565  C CG2   . VAL B 1 260 ? 67.533  31.732  19.745 1.00 38.70 ? 2291 VAL B CG2   1 
ATOM   6566  N N     . PHE B 1 261 ? 66.839  27.782  17.612 1.00 35.13 ? 2292 PHE B N     1 
ATOM   6567  C CA    . PHE B 1 261 ? 67.648  26.601  17.322 1.00 32.82 ? 2292 PHE B CA    1 
ATOM   6568  C C     . PHE B 1 261 ? 68.238  26.657  15.919 1.00 32.52 ? 2292 PHE B C     1 
ATOM   6569  O O     . PHE B 1 261 ? 69.300  26.103  15.656 1.00 30.39 ? 2292 PHE B O     1 
ATOM   6570  C CB    . PHE B 1 261 ? 66.795  25.330  17.422 1.00 30.24 ? 2292 PHE B CB    1 
ATOM   6571  C CG    . PHE B 1 261 ? 66.228  25.062  18.793 1.00 27.74 ? 2292 PHE B CG    1 
ATOM   6572  C CD1   . PHE B 1 261 ? 66.764  25.661  19.923 1.00 26.64 ? 2292 PHE B CD1   1 
ATOM   6573  C CD2   . PHE B 1 261 ? 65.155  24.185  18.951 1.00 25.33 ? 2292 PHE B CD2   1 
ATOM   6574  C CE1   . PHE B 1 261 ? 66.237  25.390  21.194 1.00 26.44 ? 2292 PHE B CE1   1 
ATOM   6575  C CE2   . PHE B 1 261 ? 64.626  23.912  20.208 1.00 24.55 ? 2292 PHE B CE2   1 
ATOM   6576  C CZ    . PHE B 1 261 ? 65.165  24.512  21.333 1.00 24.39 ? 2292 PHE B CZ    1 
ATOM   6577  N N     . GLY B 1 262 ? 67.516  27.321  15.025 1.00 32.84 ? 2293 GLY B N     1 
ATOM   6578  C CA    . GLY B 1 262 ? 67.911  27.423  13.637 1.00 33.62 ? 2293 GLY B CA    1 
ATOM   6579  C C     . GLY B 1 262 ? 69.353  27.784  13.401 1.00 34.73 ? 2293 GLY B C     1 
ATOM   6580  O O     . GLY B 1 262 ? 69.898  27.523  12.331 1.00 34.70 ? 2293 GLY B O     1 
ATOM   6581  N N     . LEU B 1 263 ? 69.978  28.392  14.392 1.00 36.28 ? 2294 LEU B N     1 
ATOM   6582  C CA    . LEU B 1 263 ? 71.364  28.790  14.245 1.00 37.58 ? 2294 LEU B CA    1 
ATOM   6583  C C     . LEU B 1 263 ? 72.298  27.597  14.457 1.00 37.15 ? 2294 LEU B C     1 
ATOM   6584  O O     . LEU B 1 263 ? 72.918  27.076  13.516 1.00 36.06 ? 2294 LEU B O     1 
ATOM   6585  C CB    . LEU B 1 263 ? 71.691  29.900  15.258 1.00 41.91 ? 2294 LEU B CB    1 
ATOM   6586  C CG    . LEU B 1 263 ? 70.572  30.644  16.009 1.00 42.61 ? 2294 LEU B CG    1 
ATOM   6587  C CD1   . LEU B 1 263 ? 71.198  31.761  16.840 1.00 44.13 ? 2294 LEU B CD1   1 
ATOM   6588  C CD2   . LEU B 1 263 ? 69.555  31.221  15.029 1.00 44.93 ? 2294 LEU B CD2   1 
ATOM   6589  N N     . VAL B 1 264 ? 72.356  27.159  15.709 1.00 35.90 ? 2295 VAL B N     1 
ATOM   6590  C CA    . VAL B 1 264 ? 73.202  26.057  16.133 1.00 35.21 ? 2295 VAL B CA    1 
ATOM   6591  C C     . VAL B 1 264 ? 72.949  24.673  15.513 1.00 33.88 ? 2295 VAL B C     1 
ATOM   6592  O O     . VAL B 1 264 ? 71.871  24.084  15.684 1.00 33.99 ? 2295 VAL B O     1 
ATOM   6593  C CB    . VAL B 1 264 ? 73.126  25.936  17.654 1.00 34.99 ? 2295 VAL B CB    1 
ATOM   6594  C CG1   . VAL B 1 264 ? 74.098  24.892  18.155 1.00 36.25 ? 2295 VAL B CG1   1 
ATOM   6595  C CG2   . VAL B 1 264 ? 73.424  27.272  18.261 1.00 35.08 ? 2295 VAL B CG2   1 
ATOM   6596  N N     . PRO B 1 265 ? 73.949  24.140  14.783 1.00 32.17 ? 2296 PRO B N     1 
ATOM   6597  C CA    . PRO B 1 265 ? 73.829  22.819  14.153 1.00 31.56 ? 2296 PRO B CA    1 
ATOM   6598  C C     . PRO B 1 265 ? 73.531  21.727  15.186 1.00 29.70 ? 2296 PRO B C     1 
ATOM   6599  O O     . PRO B 1 265 ? 72.876  20.732  14.879 1.00 29.17 ? 2296 PRO B O     1 
ATOM   6600  C CB    . PRO B 1 265 ? 75.192  22.607  13.483 1.00 31.64 ? 2296 PRO B CB    1 
ATOM   6601  C CG    . PRO B 1 265 ? 75.769  23.979  13.328 1.00 31.43 ? 2296 PRO B CG    1 
ATOM   6602  C CD    . PRO B 1 265 ? 75.239  24.785  14.478 1.00 32.14 ? 2296 PRO B CD    1 
ATOM   6603  N N     . GLY B 1 266 ? 74.029  21.924  16.406 1.00 28.73 ? 2297 GLY B N     1 
ATOM   6604  C CA    . GLY B 1 266 ? 73.821  20.957  17.468 1.00 26.53 ? 2297 GLY B CA    1 
ATOM   6605  C C     . GLY B 1 266 ? 72.399  20.958  17.978 1.00 25.97 ? 2297 GLY B C     1 
ATOM   6606  O O     . GLY B 1 266 ? 71.881  19.916  18.374 1.00 25.58 ? 2297 GLY B O     1 
ATOM   6607  N N     . LEU B 1 267 ? 71.774  22.136  17.988 1.00 25.72 ? 2298 LEU B N     1 
ATOM   6608  C CA    . LEU B 1 267 ? 70.386  22.271  18.426 1.00 23.06 ? 2298 LEU B CA    1 
ATOM   6609  C C     . LEU B 1 267 ? 69.471  21.768  17.308 1.00 23.60 ? 2298 LEU B C     1 
ATOM   6610  O O     . LEU B 1 267 ? 68.493  21.058  17.552 1.00 23.55 ? 2298 LEU B O     1 
ATOM   6611  C CB    . LEU B 1 267 ? 70.082  23.735  18.735 1.00 22.69 ? 2298 LEU B CB    1 
ATOM   6612  C CG    . LEU B 1 267 ? 70.052  24.167  20.208 1.00 22.21 ? 2298 LEU B CG    1 
ATOM   6613  C CD1   . LEU B 1 267 ? 70.759  23.160  21.087 1.00 21.25 ? 2298 LEU B CD1   1 
ATOM   6614  C CD2   . LEU B 1 267 ? 70.683  25.524  20.340 1.00 18.73 ? 2298 LEU B CD2   1 
ATOM   6615  N N     . MET B 1 268 ? 69.806  22.135  16.075 1.00 25.34 ? 2299 MET B N     1 
ATOM   6616  C CA    . MET B 1 268 ? 69.037  21.718  14.906 1.00 25.52 ? 2299 MET B CA    1 
ATOM   6617  C C     . MET B 1 268 ? 69.055  20.190  14.746 1.00 24.83 ? 2299 MET B C     1 
ATOM   6618  O O     . MET B 1 268 ? 68.164  19.593  14.125 1.00 25.04 ? 2299 MET B O     1 
ATOM   6619  C CB    . MET B 1 268 ? 69.604  22.395  13.652 1.00 26.72 ? 2299 MET B CB    1 
ATOM   6620  C CG    . MET B 1 268 ? 68.666  22.376  12.459 1.00 29.77 ? 2299 MET B CG    1 
ATOM   6621  S SD    . MET B 1 268 ? 67.055  23.122  12.801 1.00 32.06 ? 2299 MET B SD    1 
ATOM   6622  C CE    . MET B 1 268 ? 67.497  24.396  13.853 1.00 30.26 ? 2299 MET B CE    1 
ATOM   6623  N N     . MET B 1 269 ? 70.079  19.560  15.305 1.00 24.59 ? 2300 MET B N     1 
ATOM   6624  C CA    . MET B 1 269 ? 70.225  18.114  15.237 1.00 24.65 ? 2300 MET B CA    1 
ATOM   6625  C C     . MET B 1 269 ? 69.146  17.464  16.108 1.00 24.89 ? 2300 MET B C     1 
ATOM   6626  O O     . MET B 1 269 ? 68.499  16.482  15.718 1.00 24.57 ? 2300 MET B O     1 
ATOM   6627  C CB    . MET B 1 269 ? 71.625  17.722  15.729 1.00 24.16 ? 2300 MET B CB    1 
ATOM   6628  C CG    . MET B 1 269 ? 71.874  16.231  15.877 1.00 24.77 ? 2300 MET B CG    1 
ATOM   6629  S SD    . MET B 1 269 ? 72.898  15.847  17.326 1.00 26.82 ? 2300 MET B SD    1 
ATOM   6630  C CE    . MET B 1 269 ? 73.888  14.659  16.644 1.00 28.00 ? 2300 MET B CE    1 
ATOM   6631  N N     . TYR B 1 270 ? 68.951  18.003  17.303 1.00 23.74 ? 2301 TYR B N     1 
ATOM   6632  C CA    . TYR B 1 270 ? 67.940  17.445  18.178 1.00 23.23 ? 2301 TYR B CA    1 
ATOM   6633  C C     . TYR B 1 270 ? 66.578  17.812  17.610 1.00 23.89 ? 2301 TYR B C     1 
ATOM   6634  O O     . TYR B 1 270 ? 65.651  17.012  17.650 1.00 25.84 ? 2301 TYR B O     1 
ATOM   6635  C CB    . TYR B 1 270 ? 68.107  17.981  19.598 1.00 22.51 ? 2301 TYR B CB    1 
ATOM   6636  C CG    . TYR B 1 270 ? 69.023  17.124  20.447 1.00 19.79 ? 2301 TYR B CG    1 
ATOM   6637  C CD1   . TYR B 1 270 ? 68.730  15.781  20.680 1.00 19.53 ? 2301 TYR B CD1   1 
ATOM   6638  C CD2   . TYR B 1 270 ? 70.198  17.640  20.972 1.00 18.70 ? 2301 TYR B CD2   1 
ATOM   6639  C CE1   . TYR B 1 270 ? 69.588  14.968  21.417 1.00 19.52 ? 2301 TYR B CE1   1 
ATOM   6640  C CE2   . TYR B 1 270 ? 71.068  16.841  21.713 1.00 19.43 ? 2301 TYR B CE2   1 
ATOM   6641  C CZ    . TYR B 1 270 ? 70.758  15.505  21.932 1.00 20.56 ? 2301 TYR B CZ    1 
ATOM   6642  O OH    . TYR B 1 270 ? 71.614  14.706  22.666 1.00 21.32 ? 2301 TYR B OH    1 
ATOM   6643  N N     . ALA B 1 271 ? 66.456  19.014  17.060 1.00 23.83 ? 2302 ALA B N     1 
ATOM   6644  C CA    . ALA B 1 271 ? 65.185  19.434  16.479 1.00 22.93 ? 2302 ALA B CA    1 
ATOM   6645  C C     . ALA B 1 271 ? 64.755  18.423  15.411 1.00 23.17 ? 2302 ALA B C     1 
ATOM   6646  O O     . ALA B 1 271 ? 63.584  18.039  15.330 1.00 24.52 ? 2302 ALA B O     1 
ATOM   6647  C CB    . ALA B 1 271 ? 65.320  20.836  15.861 1.00 20.91 ? 2302 ALA B CB    1 
ATOM   6648  N N     . THR B 1 272 ? 65.714  17.990  14.598 1.00 24.00 ? 2303 THR B N     1 
ATOM   6649  C CA    . THR B 1 272 ? 65.468  17.036  13.521 1.00 22.18 ? 2303 THR B CA    1 
ATOM   6650  C C     . THR B 1 272 ? 65.124  15.659  14.068 1.00 21.93 ? 2303 THR B C     1 
ATOM   6651  O O     . THR B 1 272 ? 64.270  14.955  13.526 1.00 22.91 ? 2303 THR B O     1 
ATOM   6652  C CB    . THR B 1 272 ? 66.716  16.907  12.609 1.00 21.69 ? 2303 THR B CB    1 
ATOM   6653  O OG1   . THR B 1 272 ? 67.002  18.179  12.017 1.00 22.47 ? 2303 THR B OG1   1 
ATOM   6654  C CG2   . THR B 1 272 ? 66.487  15.893  11.514 1.00 20.10 ? 2303 THR B CG2   1 
ATOM   6655  N N     . ILE B 1 273 ? 65.791  15.276  15.147 1.00 22.23 ? 2304 ILE B N     1 
ATOM   6656  C CA    . ILE B 1 273 ? 65.564  13.972  15.745 1.00 22.44 ? 2304 ILE B CA    1 
ATOM   6657  C C     . ILE B 1 273 ? 64.160  13.871  16.327 1.00 21.72 ? 2304 ILE B C     1 
ATOM   6658  O O     . ILE B 1 273 ? 63.454  12.886  16.091 1.00 22.82 ? 2304 ILE B O     1 
ATOM   6659  C CB    . ILE B 1 273 ? 66.624  13.679  16.843 1.00 23.06 ? 2304 ILE B CB    1 
ATOM   6660  C CG1   . ILE B 1 273 ? 67.965  13.350  16.178 1.00 24.20 ? 2304 ILE B CG1   1 
ATOM   6661  C CG2   . ILE B 1 273 ? 66.182  12.506  17.722 1.00 22.01 ? 2304 ILE B CG2   1 
ATOM   6662  C CD1   . ILE B 1 273 ? 69.135  13.258  17.140 1.00 23.10 ? 2304 ILE B CD1   1 
ATOM   6663  N N     . TRP B 1 274 ? 63.744  14.885  17.082 1.00 20.10 ? 2305 TRP B N     1 
ATOM   6664  C CA    . TRP B 1 274 ? 62.415  14.862  17.675 1.00 19.12 ? 2305 TRP B CA    1 
ATOM   6665  C C     . TRP B 1 274 ? 61.317  15.012  16.616 1.00 20.86 ? 2305 TRP B C     1 
ATOM   6666  O O     . TRP B 1 274 ? 60.245  14.421  16.755 1.00 19.76 ? 2305 TRP B O     1 
ATOM   6667  C CB    . TRP B 1 274 ? 62.292  15.945  18.747 1.00 17.82 ? 2305 TRP B CB    1 
ATOM   6668  C CG    . TRP B 1 274 ? 62.973  15.581  20.057 1.00 16.85 ? 2305 TRP B CG    1 
ATOM   6669  C CD1   . TRP B 1 274 ? 64.114  16.136  20.565 1.00 16.21 ? 2305 TRP B CD1   1 
ATOM   6670  C CD2   . TRP B 1 274 ? 62.520  14.640  21.049 1.00 15.32 ? 2305 TRP B CD2   1 
ATOM   6671  N NE1   . TRP B 1 274 ? 64.396  15.611  21.808 1.00 15.11 ? 2305 TRP B NE1   1 
ATOM   6672  C CE2   . TRP B 1 274 ? 63.436  14.695  22.128 1.00 14.81 ? 2305 TRP B CE2   1 
ATOM   6673  C CE3   . TRP B 1 274 ? 61.428  13.763  21.129 1.00 15.17 ? 2305 TRP B CE3   1 
ATOM   6674  C CZ2   . TRP B 1 274 ? 63.293  13.910  23.272 1.00 14.46 ? 2305 TRP B CZ2   1 
ATOM   6675  C CZ3   . TRP B 1 274 ? 61.284  12.977  22.276 1.00 14.13 ? 2305 TRP B CZ3   1 
ATOM   6676  C CH2   . TRP B 1 274 ? 62.214  13.060  23.331 1.00 14.65 ? 2305 TRP B CH2   1 
ATOM   6677  N N     . LEU B 1 275 ? 61.573  15.794  15.562 1.00 20.49 ? 2306 LEU B N     1 
ATOM   6678  C CA    . LEU B 1 275 ? 60.589  15.952  14.482 1.00 20.47 ? 2306 LEU B CA    1 
ATOM   6679  C C     . LEU B 1 275 ? 60.375  14.554  13.907 1.00 21.86 ? 2306 LEU B C     1 
ATOM   6680  O O     . LEU B 1 275 ? 59.243  14.102  13.693 1.00 21.51 ? 2306 LEU B O     1 
ATOM   6681  C CB    . LEU B 1 275 ? 61.124  16.862  13.369 1.00 20.12 ? 2306 LEU B CB    1 
ATOM   6682  C CG    . LEU B 1 275 ? 60.179  17.206  12.205 1.00 20.03 ? 2306 LEU B CG    1 
ATOM   6683  C CD1   . LEU B 1 275 ? 60.709  18.418  11.451 1.00 20.30 ? 2306 LEU B CD1   1 
ATOM   6684  C CD2   . LEU B 1 275 ? 60.074  16.049  11.258 1.00 20.70 ? 2306 LEU B CD2   1 
ATOM   6685  N N     . ARG B 1 276 ? 61.491  13.872  13.667 1.00 22.38 ? 2307 ARG B N     1 
ATOM   6686  C CA    . ARG B 1 276 ? 61.465  12.518  13.124 1.00 21.99 ? 2307 ARG B CA    1 
ATOM   6687  C C     . ARG B 1 276 ? 60.685  11.596  14.068 1.00 19.78 ? 2307 ARG B C     1 
ATOM   6688  O O     . ARG B 1 276 ? 59.829  10.836  13.641 1.00 19.80 ? 2307 ARG B O     1 
ATOM   6689  C CB    . ARG B 1 276 ? 62.907  12.017  12.925 1.00 20.75 ? 2307 ARG B CB    1 
ATOM   6690  C CG    . ARG B 1 276 ? 63.383  12.142  11.496 1.00 21.61 ? 2307 ARG B CG    1 
ATOM   6691  C CD    . ARG B 1 276 ? 64.708  12.860  11.353 1.00 22.93 ? 2307 ARG B CD    1 
ATOM   6692  N NE    . ARG B 1 276 ? 65.786  11.911  11.113 1.00 25.73 ? 2307 ARG B NE    1 
ATOM   6693  C CZ    . ARG B 1 276 ? 66.758  12.053  10.214 1.00 24.09 ? 2307 ARG B CZ    1 
ATOM   6694  N NH1   . ARG B 1 276 ? 66.823  13.108  9.422  1.00 25.07 ? 2307 ARG B NH1   1 
ATOM   6695  N NH2   . ARG B 1 276 ? 67.682  11.122  10.117 1.00 25.47 ? 2307 ARG B NH2   1 
ATOM   6696  N N     . GLU B 1 277 ? 60.971  11.686  15.359 1.00 18.97 ? 2308 GLU B N     1 
ATOM   6697  C CA    . GLU B 1 277 ? 60.295  10.854  16.345 1.00 19.42 ? 2308 GLU B CA    1 
ATOM   6698  C C     . GLU B 1 277 ? 58.772  11.093  16.393 1.00 20.00 ? 2308 GLU B C     1 
ATOM   6699  O O     . GLU B 1 277 ? 57.993  10.172  16.665 1.00 20.31 ? 2308 GLU B O     1 
ATOM   6700  C CB    . GLU B 1 277 ? 60.921  11.092  17.725 1.00 18.50 ? 2308 GLU B CB    1 
ATOM   6701  C CG    . GLU B 1 277 ? 60.178  10.447  18.880 1.00 19.09 ? 2308 GLU B CG    1 
ATOM   6702  C CD    . GLU B 1 277 ? 60.219  8.924   18.849 1.00 20.30 ? 2308 GLU B CD    1 
ATOM   6703  O OE1   . GLU B 1 277 ? 59.600  8.305   19.743 1.00 20.05 ? 2308 GLU B OE1   1 
ATOM   6704  O OE2   . GLU B 1 277 ? 60.868  8.343   17.948 1.00 20.71 ? 2308 GLU B OE2   1 
ATOM   6705  N N     . HIS B 1 278 ? 58.345  12.324  16.124 1.00 21.04 ? 2309 HIS B N     1 
ATOM   6706  C CA    . HIS B 1 278 ? 56.920  12.647  16.138 1.00 20.76 ? 2309 HIS B CA    1 
ATOM   6707  C C     . HIS B 1 278 ? 56.230  11.867  15.044 1.00 21.30 ? 2309 HIS B C     1 
ATOM   6708  O O     . HIS B 1 278 ? 55.239  11.194  15.294 1.00 23.46 ? 2309 HIS B O     1 
ATOM   6709  C CB    . HIS B 1 278 ? 56.698  14.143  15.910 1.00 21.03 ? 2309 HIS B CB    1 
ATOM   6710  C CG    . HIS B 1 278 ? 55.253  14.536  15.854 1.00 21.34 ? 2309 HIS B CG    1 
ATOM   6711  N ND1   . HIS B 1 278 ? 54.525  14.840  16.984 1.00 20.50 ? 2309 HIS B ND1   1 
ATOM   6712  C CD2   . HIS B 1 278 ? 54.404  14.670  14.810 1.00 20.07 ? 2309 HIS B CD2   1 
ATOM   6713  C CE1   . HIS B 1 278 ? 53.287  15.146  16.635 1.00 21.23 ? 2309 HIS B CE1   1 
ATOM   6714  N NE2   . HIS B 1 278 ? 53.189  15.049  15.317 1.00 20.34 ? 2309 HIS B NE2   1 
ATOM   6715  N N     . GLN B 1 279 ? 56.761  11.972  13.829 1.00 22.15 ? 2310 GLN B N     1 
ATOM   6716  C CA    . GLN B 1 279 ? 56.229  11.276  12.657 1.00 23.71 ? 2310 GLN B CA    1 
ATOM   6717  C C     . GLN B 1 279 ? 56.215  9.774   12.877 1.00 24.26 ? 2310 GLN B C     1 
ATOM   6718  O O     . GLN B 1 279 ? 55.288  9.071   12.479 1.00 24.97 ? 2310 GLN B O     1 
ATOM   6719  C CB    . GLN B 1 279 ? 57.104  11.556  11.450 1.00 24.74 ? 2310 GLN B CB    1 
ATOM   6720  C CG    . GLN B 1 279 ? 56.476  12.440  10.454 1.00 27.91 ? 2310 GLN B CG    1 
ATOM   6721  C CD    . GLN B 1 279 ? 56.227  13.784  11.010 1.00 29.87 ? 2310 GLN B CD    1 
ATOM   6722  O OE1   . GLN B 1 279 ? 55.561  13.927  12.030 1.00 30.15 ? 2310 GLN B OE1   1 
ATOM   6723  N NE2   . GLN B 1 279 ? 56.763  14.802  10.349 1.00 33.75 ? 2310 GLN B NE2   1 
ATOM   6724  N N     . ARG B 1 280 ? 57.287  9.290   13.484 1.00 25.61 ? 2311 ARG B N     1 
ATOM   6725  C CA    . ARG B 1 280 ? 57.437  7.879   13.778 1.00 24.61 ? 2311 ARG B CA    1 
ATOM   6726  C C     . ARG B 1 280 ? 56.243  7.438   14.606 1.00 23.46 ? 2311 ARG B C     1 
ATOM   6727  O O     . ARG B 1 280 ? 55.527  6.504   14.260 1.00 24.02 ? 2311 ARG B O     1 
ATOM   6728  C CB    . ARG B 1 280 ? 58.713  7.681   14.574 1.00 24.53 ? 2311 ARG B CB    1 
ATOM   6729  C CG    . ARG B 1 280 ? 59.286  6.297   14.509 1.00 24.34 ? 2311 ARG B CG    1 
ATOM   6730  C CD    . ARG B 1 280 ? 60.236  6.099   15.662 1.00 23.40 ? 2311 ARG B CD    1 
ATOM   6731  N NE    . ARG B 1 280 ? 59.782  4.978   16.457 1.00 25.42 ? 2311 ARG B NE    1 
ATOM   6732  C CZ    . ARG B 1 280 ? 59.464  5.048   17.739 1.00 25.42 ? 2311 ARG B CZ    1 
ATOM   6733  N NH1   . ARG B 1 280 ? 59.548  6.197   18.390 1.00 25.86 ? 2311 ARG B NH1   1 
ATOM   6734  N NH2   . ARG B 1 280 ? 59.044  3.961   18.360 1.00 27.57 ? 2311 ARG B NH2   1 
ATOM   6735  N N     . VAL B 1 281 ? 56.043  8.133   15.716 1.00 23.65 ? 2312 VAL B N     1 
ATOM   6736  C CA    . VAL B 1 281 ? 54.946  7.816   16.601 1.00 22.62 ? 2312 VAL B CA    1 
ATOM   6737  C C     . VAL B 1 281 ? 53.621  7.959   15.863 1.00 22.46 ? 2312 VAL B C     1 
ATOM   6738  O O     . VAL B 1 281 ? 52.698  7.195   16.105 1.00 23.10 ? 2312 VAL B O     1 
ATOM   6739  C CB    . VAL B 1 281 ? 54.974  8.728   17.839 1.00 22.00 ? 2312 VAL B CB    1 
ATOM   6740  C CG1   . VAL B 1 281 ? 53.689  8.595   18.618 1.00 20.18 ? 2312 VAL B CG1   1 
ATOM   6741  C CG2   . VAL B 1 281 ? 56.161  8.361   18.712 1.00 19.76 ? 2312 VAL B CG2   1 
ATOM   6742  N N     . CYS B 1 282 ? 53.530  8.929   14.961 1.00 23.16 ? 2313 CYS B N     1 
ATOM   6743  C CA    . CYS B 1 282 ? 52.299  9.144   14.200 1.00 22.74 ? 2313 CYS B CA    1 
ATOM   6744  C C     . CYS B 1 282 ? 51.987  7.900   13.374 1.00 24.11 ? 2313 CYS B C     1 
ATOM   6745  O O     . CYS B 1 282 ? 50.833  7.456   13.300 1.00 23.87 ? 2313 CYS B O     1 
ATOM   6746  C CB    . CYS B 1 282 ? 52.435  10.350  13.261 1.00 22.51 ? 2313 CYS B CB    1 
ATOM   6747  S SG    . CYS B 1 282 ? 52.167  11.924  14.070 1.00 22.66 ? 2313 CYS B SG    1 
ATOM   6748  N N     . ASP B 1 283 ? 53.028  7.348   12.753 1.00 24.12 ? 2314 ASP B N     1 
ATOM   6749  C CA    . ASP B 1 283 ? 52.895  6.155   11.926 1.00 22.99 ? 2314 ASP B CA    1 
ATOM   6750  C C     . ASP B 1 283 ? 52.454  4.973   12.777 1.00 22.42 ? 2314 ASP B C     1 
ATOM   6751  O O     . ASP B 1 283 ? 51.608  4.185   12.370 1.00 21.92 ? 2314 ASP B O     1 
ATOM   6752  C CB    . ASP B 1 283 ? 54.227  5.841   11.253 1.00 22.61 ? 2314 ASP B CB    1 
ATOM   6753  C CG    . ASP B 1 283 ? 54.501  6.732   10.061 1.00 23.91 ? 2314 ASP B CG    1 
ATOM   6754  O OD1   . ASP B 1 283 ? 53.557  7.364   9.557  1.00 25.66 ? 2314 ASP B OD1   1 
ATOM   6755  O OD2   . ASP B 1 283 ? 55.664  6.808   9.620  1.00 25.63 ? 2314 ASP B OD2   1 
ATOM   6756  N N     . ILE B 1 284 ? 53.029  4.858   13.965 1.00 21.75 ? 2315 ILE B N     1 
ATOM   6757  C CA    . ILE B 1 284 ? 52.691  3.776   14.866 1.00 21.69 ? 2315 ILE B CA    1 
ATOM   6758  C C     . ILE B 1 284 ? 51.231  3.859   15.308 1.00 22.21 ? 2315 ILE B C     1 
ATOM   6759  O O     . ILE B 1 284 ? 50.523  2.863   15.323 1.00 21.48 ? 2315 ILE B O     1 
ATOM   6760  C CB    . ILE B 1 284 ? 53.577  3.817   16.107 1.00 21.55 ? 2315 ILE B CB    1 
ATOM   6761  C CG1   . ILE B 1 284 ? 54.988  3.385   15.738 1.00 22.54 ? 2315 ILE B CG1   1 
ATOM   6762  C CG2   . ILE B 1 284 ? 53.022  2.905   17.181 1.00 20.73 ? 2315 ILE B CG2   1 
ATOM   6763  C CD1   . ILE B 1 284 ? 56.020  3.826   16.752 1.00 24.47 ? 2315 ILE B CD1   1 
ATOM   6764  N N     . LEU B 1 285 ? 50.786  5.054   15.674 1.00 23.02 ? 2316 LEU B N     1 
ATOM   6765  C CA    . LEU B 1 285 ? 49.418  5.244   16.134 1.00 23.89 ? 2316 LEU B CA    1 
ATOM   6766  C C     . LEU B 1 285 ? 48.423  5.061   15.000 1.00 25.41 ? 2316 LEU B C     1 
ATOM   6767  O O     . LEU B 1 285 ? 47.332  4.527   15.205 1.00 26.54 ? 2316 LEU B O     1 
ATOM   6768  C CB    . LEU B 1 285 ? 49.260  6.638   16.734 1.00 22.07 ? 2316 LEU B CB    1 
ATOM   6769  C CG    . LEU B 1 285 ? 49.875  6.853   18.116 1.00 21.40 ? 2316 LEU B CG    1 
ATOM   6770  C CD1   . LEU B 1 285 ? 49.710  8.297   18.545 1.00 18.66 ? 2316 LEU B CD1   1 
ATOM   6771  C CD2   . LEU B 1 285 ? 49.205  5.924   19.112 1.00 22.74 ? 2316 LEU B CD2   1 
ATOM   6772  N N     . LYS B 1 286 ? 48.796  5.500   13.805 1.00 26.35 ? 2317 LYS B N     1 
ATOM   6773  C CA    . LYS B 1 286 ? 47.912  5.365   12.660 1.00 28.68 ? 2317 LYS B CA    1 
ATOM   6774  C C     . LYS B 1 286 ? 47.643  3.896   12.440 1.00 29.67 ? 2317 LYS B C     1 
ATOM   6775  O O     . LYS B 1 286 ? 46.532  3.491   12.135 1.00 30.24 ? 2317 LYS B O     1 
ATOM   6776  C CB    . LYS B 1 286 ? 48.557  5.949   11.410 1.00 29.67 ? 2317 LYS B CB    1 
ATOM   6777  C CG    . LYS B 1 286 ? 47.725  5.758   10.163 1.00 31.60 ? 2317 LYS B CG    1 
ATOM   6778  C CD    . LYS B 1 286 ? 48.019  6.848   9.140  1.00 34.53 ? 2317 LYS B CD    1 
ATOM   6779  C CE    . LYS B 1 286 ? 46.899  6.951   8.115  1.00 36.52 ? 2317 LYS B CE    1 
ATOM   6780  N NZ    . LYS B 1 286 ? 45.582  7.198   8.795  1.00 37.04 ? 2317 LYS B NZ    1 
ATOM   6781  N N     . GLN B 1 287 ? 48.677  3.094   12.619 1.00 31.13 ? 2318 GLN B N     1 
ATOM   6782  C CA    . GLN B 1 287 ? 48.557  1.668   12.437 1.00 31.87 ? 2318 GLN B CA    1 
ATOM   6783  C C     . GLN B 1 287 ? 47.586  1.060   13.433 1.00 30.52 ? 2318 GLN B C     1 
ATOM   6784  O O     . GLN B 1 287 ? 46.825  0.151   13.096 1.00 31.21 ? 2318 GLN B O     1 
ATOM   6785  C CB    . GLN B 1 287 ? 49.919  1.032   12.599 1.00 33.88 ? 2318 GLN B CB    1 
ATOM   6786  C CG    . GLN B 1 287 ? 49.985  -0.355  12.075 1.00 39.31 ? 2318 GLN B CG    1 
ATOM   6787  C CD    . GLN B 1 287 ? 51.413  -0.827  11.959 1.00 44.15 ? 2318 GLN B CD    1 
ATOM   6788  O OE1   . GLN B 1 287 ? 52.307  -0.309  12.644 1.00 48.63 ? 2318 GLN B OE1   1 
ATOM   6789  N NE2   . GLN B 1 287 ? 51.647  -1.816  11.095 1.00 46.03 ? 2318 GLN B NE2   1 
ATOM   6790  N N     . GLU B 1 288 ? 47.621  1.560   14.663 1.00 28.98 ? 2319 GLU B N     1 
ATOM   6791  C CA    . GLU B 1 288 ? 46.743  1.065   15.717 1.00 26.87 ? 2319 GLU B CA    1 
ATOM   6792  C C     . GLU B 1 288 ? 45.352  1.660   15.606 1.00 25.57 ? 2319 GLU B C     1 
ATOM   6793  O O     . GLU B 1 288 ? 44.375  1.050   16.016 1.00 23.25 ? 2319 GLU B O     1 
ATOM   6794  C CB    . GLU B 1 288 ? 47.297  1.431   17.091 1.00 27.87 ? 2319 GLU B CB    1 
ATOM   6795  C CG    . GLU B 1 288 ? 48.612  0.799   17.411 1.00 29.49 ? 2319 GLU B CG    1 
ATOM   6796  C CD    . GLU B 1 288 ? 48.530  -0.706  17.431 1.00 31.95 ? 2319 GLU B CD    1 
ATOM   6797  O OE1   . GLU B 1 288 ? 47.836  -1.250  18.319 1.00 31.24 ? 2319 GLU B OE1   1 
ATOM   6798  O OE2   . GLU B 1 288 ? 49.161  -1.339  16.555 1.00 33.23 ? 2319 GLU B OE2   1 
ATOM   6799  N N     . HIS B 1 289 ? 45.274  2.862   15.053 1.00 24.57 ? 2320 HIS B N     1 
ATOM   6800  C CA    . HIS B 1 289 ? 44.010  3.550   14.942 1.00 22.95 ? 2320 HIS B CA    1 
ATOM   6801  C C     . HIS B 1 289 ? 43.762  4.066   13.545 1.00 24.41 ? 2320 HIS B C     1 
ATOM   6802  O O     . HIS B 1 289 ? 43.793  5.271   13.303 1.00 25.41 ? 2320 HIS B O     1 
ATOM   6803  C CB    . HIS B 1 289 ? 43.985  4.702   15.931 1.00 22.31 ? 2320 HIS B CB    1 
ATOM   6804  C CG    . HIS B 1 289 ? 44.090  4.268   17.358 1.00 20.08 ? 2320 HIS B CG    1 
ATOM   6805  N ND1   . HIS B 1 289 ? 43.102  3.544   17.992 1.00 20.36 ? 2320 HIS B ND1   1 
ATOM   6806  C CD2   . HIS B 1 289 ? 45.057  4.465   18.283 1.00 19.57 ? 2320 HIS B CD2   1 
ATOM   6807  C CE1   . HIS B 1 289 ? 43.456  3.314   19.242 1.00 19.44 ? 2320 HIS B CE1   1 
ATOM   6808  N NE2   . HIS B 1 289 ? 44.638  3.863   19.444 1.00 19.66 ? 2320 HIS B NE2   1 
ATOM   6809  N N     . PRO B 1 290 ? 43.489  3.153   12.606 1.00 24.46 ? 2321 PRO B N     1 
ATOM   6810  C CA    . PRO B 1 290 ? 43.225  3.502   11.209 1.00 24.16 ? 2321 PRO B CA    1 
ATOM   6811  C C     . PRO B 1 290 ? 41.984  4.370   11.147 1.00 25.87 ? 2321 PRO B C     1 
ATOM   6812  O O     . PRO B 1 290 ? 41.707  5.019   10.139 1.00 27.82 ? 2321 PRO B O     1 
ATOM   6813  C CB    . PRO B 1 290 ? 42.998  2.150   10.540 1.00 23.67 ? 2321 PRO B CB    1 
ATOM   6814  C CG    . PRO B 1 290 ? 42.582  1.246   11.667 1.00 21.40 ? 2321 PRO B CG    1 
ATOM   6815  C CD    . PRO B 1 290 ? 43.372  1.706   12.841 1.00 24.17 ? 2321 PRO B CD    1 
ATOM   6816  N N     . GLU B 1 291 ? 41.256  4.381   12.255 1.00 25.98 ? 2322 GLU B N     1 
ATOM   6817  C CA    . GLU B 1 291 ? 40.019  5.136   12.388 1.00 25.90 ? 2322 GLU B CA    1 
ATOM   6818  C C     . GLU B 1 291 ? 40.218  6.540   12.929 1.00 24.88 ? 2322 GLU B C     1 
ATOM   6819  O O     . GLU B 1 291 ? 39.262  7.300   13.008 1.00 25.78 ? 2322 GLU B O     1 
ATOM   6820  C CB    . GLU B 1 291 ? 39.079  4.378   13.316 1.00 26.21 ? 2322 GLU B CB    1 
ATOM   6821  C CG    . GLU B 1 291 ? 39.776  3.218   13.993 1.00 29.08 ? 2322 GLU B CG    1 
ATOM   6822  C CD    . GLU B 1 291 ? 40.228  3.533   15.406 1.00 30.75 ? 2322 GLU B CD    1 
ATOM   6823  O OE1   . GLU B 1 291 ? 39.854  4.583   15.955 1.00 34.33 ? 2322 GLU B OE1   1 
ATOM   6824  O OE2   . GLU B 1 291 ? 40.957  2.721   15.983 1.00 34.14 ? 2322 GLU B OE2   1 
ATOM   6825  N N     . TRP B 1 292 ? 41.443  6.884   13.313 1.00 24.08 ? 2323 TRP B N     1 
ATOM   6826  C CA    . TRP B 1 292 ? 41.706  8.212   13.860 1.00 23.15 ? 2323 TRP B CA    1 
ATOM   6827  C C     . TRP B 1 292 ? 41.979  9.212   12.762 1.00 23.92 ? 2323 TRP B C     1 
ATOM   6828  O O     . TRP B 1 292 ? 42.323  8.838   11.642 1.00 23.36 ? 2323 TRP B O     1 
ATOM   6829  C CB    . TRP B 1 292 ? 42.907  8.187   14.803 1.00 19.85 ? 2323 TRP B CB    1 
ATOM   6830  C CG    . TRP B 1 292 ? 42.570  7.745   16.174 1.00 18.93 ? 2323 TRP B CG    1 
ATOM   6831  C CD1   . TRP B 1 292 ? 41.371  7.254   16.611 1.00 17.75 ? 2323 TRP B CD1   1 
ATOM   6832  C CD2   . TRP B 1 292 ? 43.446  7.738   17.306 1.00 17.74 ? 2323 TRP B CD2   1 
ATOM   6833  N NE1   . TRP B 1 292 ? 41.450  6.942   17.948 1.00 17.35 ? 2323 TRP B NE1   1 
ATOM   6834  C CE2   . TRP B 1 292 ? 42.709  7.228   18.399 1.00 17.06 ? 2323 TRP B CE2   1 
ATOM   6835  C CE3   . TRP B 1 292 ? 44.778  8.114   17.500 1.00 17.32 ? 2323 TRP B CE3   1 
ATOM   6836  C CZ2   . TRP B 1 292 ? 43.262  7.082   19.670 1.00 16.83 ? 2323 TRP B CZ2   1 
ATOM   6837  C CZ3   . TRP B 1 292 ? 45.333  7.969   18.770 1.00 17.47 ? 2323 TRP B CZ3   1 
ATOM   6838  C CH2   . TRP B 1 292 ? 44.569  7.453   19.841 1.00 17.33 ? 2323 TRP B CH2   1 
ATOM   6839  N N     . GLY B 1 293 ? 41.830  10.489  13.102 1.00 25.44 ? 2324 GLY B N     1 
ATOM   6840  C CA    . GLY B 1 293 ? 42.097  11.554  12.154 1.00 25.24 ? 2324 GLY B CA    1 
ATOM   6841  C C     . GLY B 1 293 ? 43.391  12.264  12.515 1.00 25.85 ? 2324 GLY B C     1 
ATOM   6842  O O     . GLY B 1 293 ? 44.061  11.920  13.492 1.00 25.49 ? 2324 GLY B O     1 
ATOM   6843  N N     . ASP B 1 294 ? 43.728  13.266  11.720 1.00 25.83 ? 2325 ASP B N     1 
ATOM   6844  C CA    . ASP B 1 294 ? 44.932  14.054  11.893 1.00 26.75 ? 2325 ASP B CA    1 
ATOM   6845  C C     . ASP B 1 294 ? 45.080  14.691  13.285 1.00 26.03 ? 2325 ASP B C     1 
ATOM   6846  O O     . ASP B 1 294 ? 46.109  14.531  13.932 1.00 27.55 ? 2325 ASP B O     1 
ATOM   6847  C CB    . ASP B 1 294 ? 44.964  15.120  10.795 1.00 26.92 ? 2325 ASP B CB    1 
ATOM   6848  C CG    . ASP B 1 294 ? 46.144  16.046  10.913 1.00 28.33 ? 2325 ASP B CG    1 
ATOM   6849  O OD1   . ASP B 1 294 ? 47.286  15.575  10.719 1.00 28.90 ? 2325 ASP B OD1   1 
ATOM   6850  O OD2   . ASP B 1 294 ? 45.936  17.249  11.193 1.00 28.26 ? 2325 ASP B OD2   1 
ATOM   6851  N N     . GLU B 1 295 ? 44.056  15.395  13.752 1.00 24.58 ? 2326 GLU B N     1 
ATOM   6852  C CA    . GLU B 1 295 ? 44.112  16.041  15.057 1.00 24.20 ? 2326 GLU B CA    1 
ATOM   6853  C C     . GLU B 1 295 ? 44.505  15.093  16.186 1.00 23.44 ? 2326 GLU B C     1 
ATOM   6854  O O     . GLU B 1 295 ? 45.449  15.354  16.921 1.00 23.12 ? 2326 GLU B O     1 
ATOM   6855  C CB    . GLU B 1 295 ? 42.756  16.644  15.418 1.00 24.69 ? 2326 GLU B CB    1 
ATOM   6856  C CG    . GLU B 1 295 ? 42.634  18.161  15.390 1.00 25.68 ? 2326 GLU B CG    1 
ATOM   6857  C CD    . GLU B 1 295 ? 43.739  18.921  16.101 1.00 25.79 ? 2326 GLU B CD    1 
ATOM   6858  O OE1   . GLU B 1 295 ? 44.629  19.427  15.389 1.00 28.56 ? 2326 GLU B OE1   1 
ATOM   6859  O OE2   . GLU B 1 295 ? 43.716  19.042  17.347 1.00 24.33 ? 2326 GLU B OE2   1 
ATOM   6860  N N     . GLN B 1 296 ? 43.751  14.009  16.349 1.00 22.56 ? 2327 GLN B N     1 
ATOM   6861  C CA    . GLN B 1 296 ? 44.027  13.057  17.421 1.00 21.14 ? 2327 GLN B CA    1 
ATOM   6862  C C     . GLN B 1 296 ? 45.388  12.389  17.262 1.00 20.91 ? 2327 GLN B C     1 
ATOM   6863  O O     . GLN B 1 296 ? 46.081  12.100  18.243 1.00 20.86 ? 2327 GLN B O     1 
ATOM   6864  C CB    . GLN B 1 296 ? 42.941  11.988  17.471 1.00 19.89 ? 2327 GLN B CB    1 
ATOM   6865  C CG    . GLN B 1 296 ? 42.993  11.148  18.737 1.00 21.99 ? 2327 GLN B CG    1 
ATOM   6866  C CD    . GLN B 1 296 ? 41.694  10.417  19.016 1.00 21.36 ? 2327 GLN B CD    1 
ATOM   6867  O OE1   . GLN B 1 296 ? 40.818  10.340  18.152 1.00 21.75 ? 2327 GLN B OE1   1 
ATOM   6868  N NE2   . GLN B 1 296 ? 41.561  9.876   20.224 1.00 20.16 ? 2327 GLN B NE2   1 
ATOM   6869  N N     . LEU B 1 297 ? 45.764  12.127  16.019 1.00 20.43 ? 2328 LEU B N     1 
ATOM   6870  C CA    . LEU B 1 297 ? 47.045  11.519  15.759 1.00 19.15 ? 2328 LEU B CA    1 
ATOM   6871  C C     . LEU B 1 297 ? 48.103  12.512  16.250 1.00 20.12 ? 2328 LEU B C     1 
ATOM   6872  O O     . LEU B 1 297 ? 49.010  12.154  17.013 1.00 21.59 ? 2328 LEU B O     1 
ATOM   6873  C CB    . LEU B 1 297 ? 47.193  11.260  14.263 1.00 18.68 ? 2328 LEU B CB    1 
ATOM   6874  C CG    . LEU B 1 297 ? 46.396  10.070  13.715 1.00 17.78 ? 2328 LEU B CG    1 
ATOM   6875  C CD1   . LEU B 1 297 ? 46.530  10.014  12.189 1.00 16.18 ? 2328 LEU B CD1   1 
ATOM   6876  C CD2   . LEU B 1 297 ? 46.914  8.774   14.335 1.00 16.54 ? 2328 LEU B CD2   1 
ATOM   6877  N N     . PHE B 1 298 ? 47.974  13.766  15.830 1.00 19.72 ? 2329 PHE B N     1 
ATOM   6878  C CA    . PHE B 1 298 ? 48.924  14.787  16.249 1.00 19.33 ? 2329 PHE B CA    1 
ATOM   6879  C C     . PHE B 1 298 ? 48.964  14.947  17.764 1.00 20.13 ? 2329 PHE B C     1 
ATOM   6880  O O     . PHE B 1 298 ? 50.016  14.811  18.392 1.00 20.71 ? 2329 PHE B O     1 
ATOM   6881  C CB    . PHE B 1 298 ? 48.577  16.139  15.643 1.00 18.79 ? 2329 PHE B CB    1 
ATOM   6882  C CG    . PHE B 1 298 ? 49.346  17.266  16.254 1.00 18.87 ? 2329 PHE B CG    1 
ATOM   6883  C CD1   . PHE B 1 298 ? 50.626  17.575  15.794 1.00 18.15 ? 2329 PHE B CD1   1 
ATOM   6884  C CD2   . PHE B 1 298 ? 48.825  17.984  17.323 1.00 17.41 ? 2329 PHE B CD2   1 
ATOM   6885  C CE1   . PHE B 1 298 ? 51.378  18.574  16.396 1.00 17.64 ? 2329 PHE B CE1   1 
ATOM   6886  C CE2   . PHE B 1 298 ? 49.579  18.990  17.930 1.00 18.44 ? 2329 PHE B CE2   1 
ATOM   6887  C CZ    . PHE B 1 298 ? 50.857  19.282  17.465 1.00 17.44 ? 2329 PHE B CZ    1 
ATOM   6888  N N     . GLN B 1 299 ? 47.809  15.251  18.345 1.00 20.45 ? 2330 GLN B N     1 
ATOM   6889  C CA    . GLN B 1 299 ? 47.694  15.462  19.782 1.00 20.81 ? 2330 GLN B CA    1 
ATOM   6890  C C     . GLN B 1 299 ? 48.187  14.303  20.617 1.00 21.51 ? 2330 GLN B C     1 
ATOM   6891  O O     . GLN B 1 299 ? 48.864  14.510  21.630 1.00 21.15 ? 2330 GLN B O     1 
ATOM   6892  C CB    . GLN B 1 299 ? 46.243  15.756  20.164 1.00 20.82 ? 2330 GLN B CB    1 
ATOM   6893  C CG    . GLN B 1 299 ? 45.642  16.989  19.486 1.00 20.20 ? 2330 GLN B CG    1 
ATOM   6894  C CD    . GLN B 1 299 ? 46.241  18.284  19.962 1.00 20.20 ? 2330 GLN B CD    1 
ATOM   6895  O OE1   . GLN B 1 299 ? 46.899  18.341  20.990 1.00 22.92 ? 2330 GLN B OE1   1 
ATOM   6896  N NE2   . GLN B 1 299 ? 46.009  19.338  19.214 1.00 22.63 ? 2330 GLN B NE2   1 
ATOM   6897  N N     . THR B 1 300 ? 47.851  13.086  20.201 1.00 21.23 ? 2331 THR B N     1 
ATOM   6898  C CA    . THR B 1 300 ? 48.263  11.915  20.961 1.00 19.82 ? 2331 THR B CA    1 
ATOM   6899  C C     . THR B 1 300 ? 49.766  11.702  20.853 1.00 20.64 ? 2331 THR B C     1 
ATOM   6900  O O     . THR B 1 300 ? 50.409  11.289  21.818 1.00 20.28 ? 2331 THR B O     1 
ATOM   6901  C CB    . THR B 1 300 ? 47.529  10.654  20.499 1.00 20.96 ? 2331 THR B CB    1 
ATOM   6902  O OG1   . THR B 1 300 ? 46.135  10.938  20.385 1.00 20.77 ? 2331 THR B OG1   1 
ATOM   6903  C CG2   . THR B 1 300 ? 47.717  9.534   21.500 1.00 19.58 ? 2331 THR B CG2   1 
ATOM   6904  N N     . SER B 1 301 ? 50.324  11.986  19.681 1.00 19.87 ? 2332 SER B N     1 
ATOM   6905  C CA    . SER B 1 301 ? 51.761  11.849  19.490 1.00 19.93 ? 2332 SER B CA    1 
ATOM   6906  C C     . SER B 1 301 ? 52.490  12.879  20.377 1.00 20.22 ? 2332 SER B C     1 
ATOM   6907  O O     . SER B 1 301 ? 53.518  12.559  20.978 1.00 21.72 ? 2332 SER B O     1 
ATOM   6908  C CB    . SER B 1 301 ? 52.137  12.069  18.021 1.00 19.43 ? 2332 SER B CB    1 
ATOM   6909  O OG    . SER B 1 301 ? 51.521  11.112  17.193 1.00 18.73 ? 2332 SER B OG    1 
ATOM   6910  N N     . LYS B 1 302 ? 51.960  14.105  20.462 1.00 19.06 ? 2333 LYS B N     1 
ATOM   6911  C CA    . LYS B 1 302 ? 52.587  15.135  21.288 1.00 18.14 ? 2333 LYS B CA    1 
ATOM   6912  C C     . LYS B 1 302 ? 52.594  14.709  22.746 1.00 18.32 ? 2333 LYS B C     1 
ATOM   6913  O O     . LYS B 1 302 ? 53.545  14.977  23.466 1.00 20.35 ? 2333 LYS B O     1 
ATOM   6914  C CB    . LYS B 1 302 ? 51.854  16.475  21.171 1.00 15.71 ? 2333 LYS B CB    1 
ATOM   6915  C CG    . LYS B 1 302 ? 52.280  17.495  22.234 1.00 13.45 ? 2333 LYS B CG    1 
ATOM   6916  C CD    . LYS B 1 302 ? 51.801  18.899  21.889 1.00 12.86 ? 2333 LYS B CD    1 
ATOM   6917  C CE    . LYS B 1 302 ? 52.541  19.986  22.673 1.00 12.53 ? 2333 LYS B CE    1 
ATOM   6918  N NZ    . LYS B 1 302 ? 52.191  21.356  22.180 1.00 11.19 ? 2333 LYS B NZ    1 
ATOM   6919  N N     . LEU B 1 303 ? 51.532  14.045  23.186 1.00 17.81 ? 2334 LEU B N     1 
ATOM   6920  C CA    . LEU B 1 303 ? 51.438  13.606  24.567 1.00 17.10 ? 2334 LEU B CA    1 
ATOM   6921  C C     . LEU B 1 303 ? 52.471  12.535  24.850 1.00 16.59 ? 2334 LEU B C     1 
ATOM   6922  O O     . LEU B 1 303 ? 53.050  12.480  25.938 1.00 16.44 ? 2334 LEU B O     1 
ATOM   6923  C CB    . LEU B 1 303 ? 50.047  13.050  24.861 1.00 16.87 ? 2334 LEU B CB    1 
ATOM   6924  C CG    . LEU B 1 303 ? 48.943  14.073  25.151 1.00 17.33 ? 2334 LEU B CG    1 
ATOM   6925  C CD1   . LEU B 1 303 ? 47.750  13.358  25.807 1.00 16.83 ? 2334 LEU B CD1   1 
ATOM   6926  C CD2   . LEU B 1 303 ? 49.459  15.171  26.062 1.00 14.17 ? 2334 LEU B CD2   1 
ATOM   6927  N N     . ILE B 1 304 ? 52.697  11.680  23.859 1.00 17.38 ? 2335 ILE B N     1 
ATOM   6928  C CA    . ILE B 1 304 ? 53.660  10.597  23.997 1.00 17.48 ? 2335 ILE B CA    1 
ATOM   6929  C C     . ILE B 1 304 ? 55.087  11.129  24.036 1.00 16.91 ? 2335 ILE B C     1 
ATOM   6930  O O     . ILE B 1 304 ? 55.905  10.671  24.844 1.00 16.94 ? 2335 ILE B O     1 
ATOM   6931  C CB    . ILE B 1 304 ? 53.497  9.592   22.850 1.00 17.46 ? 2335 ILE B CB    1 
ATOM   6932  C CG1   . ILE B 1 304 ? 52.207  8.797   23.062 1.00 16.49 ? 2335 ILE B CG1   1 
ATOM   6933  C CG2   . ILE B 1 304 ? 54.692  8.645   22.796 1.00 16.95 ? 2335 ILE B CG2   1 
ATOM   6934  C CD1   . ILE B 1 304 ? 51.888  7.819   21.945 1.00 17.04 ? 2335 ILE B CD1   1 
ATOM   6935  N N     . LEU B 1 305 ? 55.392  12.105  23.184 1.00 16.35 ? 2336 LEU B N     1 
ATOM   6936  C CA    . LEU B 1 305 ? 56.734  12.665  23.176 1.00 16.37 ? 2336 LEU B CA    1 
ATOM   6937  C C     . LEU B 1 305 ? 57.009  13.405  24.480 1.00 16.12 ? 2336 LEU B C     1 
ATOM   6938  O O     . LEU B 1 305 ? 58.134  13.405  24.976 1.00 17.99 ? 2336 LEU B O     1 
ATOM   6939  C CB    . LEU B 1 305 ? 56.932  13.588  21.980 1.00 14.97 ? 2336 LEU B CB    1 
ATOM   6940  C CG    . LEU B 1 305 ? 57.588  12.917  20.765 1.00 13.71 ? 2336 LEU B CG    1 
ATOM   6941  C CD1   . LEU B 1 305 ? 56.681  11.812  20.203 1.00 12.85 ? 2336 LEU B CD1   1 
ATOM   6942  C CD2   . LEU B 1 305 ? 57.839  13.970  19.700 1.00 13.65 ? 2336 LEU B CD2   1 
ATOM   6943  N N     . ILE B 1 306 ? 55.987  14.030  25.050 1.00 16.75 ? 2337 ILE B N     1 
ATOM   6944  C CA    . ILE B 1 306 ? 56.171  14.729  26.317 1.00 16.96 ? 2337 ILE B CA    1 
ATOM   6945  C C     . ILE B 1 306 ? 56.602  13.656  27.319 1.00 17.31 ? 2337 ILE B C     1 
ATOM   6946  O O     . ILE B 1 306 ? 57.535  13.852  28.089 1.00 19.09 ? 2337 ILE B O     1 
ATOM   6947  C CB    . ILE B 1 306 ? 54.848  15.411  26.799 1.00 17.19 ? 2337 ILE B CB    1 
ATOM   6948  C CG1   . ILE B 1 306 ? 54.508  16.596  25.895 1.00 16.66 ? 2337 ILE B CG1   1 
ATOM   6949  C CG2   . ILE B 1 306 ? 55.002  15.951  28.215 1.00 15.35 ? 2337 ILE B CG2   1 
ATOM   6950  C CD1   . ILE B 1 306 ? 53.174  17.259  26.225 1.00 15.68 ? 2337 ILE B CD1   1 
ATOM   6951  N N     . GLY B 1 307 ? 55.932  12.505  27.282 1.00 18.33 ? 2338 GLY B N     1 
ATOM   6952  C CA    . GLY B 1 307 ? 56.255  11.421  28.193 1.00 17.29 ? 2338 GLY B CA    1 
ATOM   6953  C C     . GLY B 1 307 ? 57.641  10.851  27.942 1.00 19.19 ? 2338 GLY B C     1 
ATOM   6954  O O     . GLY B 1 307 ? 58.373  10.537  28.876 1.00 17.86 ? 2338 GLY B O     1 
ATOM   6955  N N     . GLU B 1 308 ? 57.996  10.705  26.670 1.00 19.40 ? 2339 GLU B N     1 
ATOM   6956  C CA    . GLU B 1 308 ? 59.299  10.186  26.297 1.00 18.54 ? 2339 GLU B CA    1 
ATOM   6957  C C     . GLU B 1 308 ? 60.362  11.124  26.833 1.00 19.40 ? 2339 GLU B C     1 
ATOM   6958  O O     . GLU B 1 308 ? 61.380  10.683  27.366 1.00 20.91 ? 2339 GLU B O     1 
ATOM   6959  C CB    . GLU B 1 308 ? 59.413  10.112  24.782 1.00 18.40 ? 2339 GLU B CB    1 
ATOM   6960  C CG    . GLU B 1 308 ? 58.680  8.954   24.148 1.00 18.91 ? 2339 GLU B CG    1 
ATOM   6961  C CD    . GLU B 1 308 ? 59.076  8.764   22.697 1.00 19.55 ? 2339 GLU B CD    1 
ATOM   6962  O OE1   . GLU B 1 308 ? 58.289  9.098   21.792 1.00 21.31 ? 2339 GLU B OE1   1 
ATOM   6963  O OE2   . GLU B 1 308 ? 60.189  8.281   22.452 1.00 23.52 ? 2339 GLU B OE2   1 
ATOM   6964  N N     . THR B 1 309 ? 60.118  12.421  26.690 1.00 19.44 ? 2340 THR B N     1 
ATOM   6965  C CA    . THR B 1 309 ? 61.052  13.437  27.151 1.00 19.18 ? 2340 THR B CA    1 
ATOM   6966  C C     . THR B 1 309 ? 61.278  13.331  28.657 1.00 20.47 ? 2340 THR B C     1 
ATOM   6967  O O     . THR B 1 309 ? 62.411  13.339  29.138 1.00 20.79 ? 2340 THR B O     1 
ATOM   6968  C CB    . THR B 1 309 ? 60.534  14.852  26.810 1.00 19.87 ? 2340 THR B CB    1 
ATOM   6969  O OG1   . THR B 1 309 ? 60.353  14.962  25.394 1.00 17.67 ? 2340 THR B OG1   1 
ATOM   6970  C CG2   . THR B 1 309 ? 61.521  15.918  27.264 1.00 20.39 ? 2340 THR B CG2   1 
ATOM   6971  N N     . ILE B 1 310 ? 60.197  13.221  29.415 1.00 20.27 ? 2341 ILE B N     1 
ATOM   6972  C CA    . ILE B 1 310 ? 60.327  13.114  30.861 1.00 18.53 ? 2341 ILE B CA    1 
ATOM   6973  C C     . ILE B 1 310 ? 61.029  11.818  31.246 1.00 18.45 ? 2341 ILE B C     1 
ATOM   6974  O O     . ILE B 1 310 ? 61.847  11.798  32.160 1.00 17.95 ? 2341 ILE B O     1 
ATOM   6975  C CB    . ILE B 1 310 ? 58.953  13.177  31.529 1.00 17.79 ? 2341 ILE B CB    1 
ATOM   6976  C CG1   . ILE B 1 310 ? 58.405  14.607  31.430 1.00 15.84 ? 2341 ILE B CG1   1 
ATOM   6977  C CG2   . ILE B 1 310 ? 59.061  12.745  32.975 1.00 16.88 ? 2341 ILE B CG2   1 
ATOM   6978  C CD1   . ILE B 1 310 ? 56.899  14.701  31.598 1.00 13.06 ? 2341 ILE B CD1   1 
ATOM   6979  N N     . LYS B 1 311 ? 60.705  10.738  30.544 1.00 18.61 ? 2342 LYS B N     1 
ATOM   6980  C CA    . LYS B 1 311 ? 61.317  9.439   30.795 1.00 17.74 ? 2342 LYS B CA    1 
ATOM   6981  C C     . LYS B 1 311 ? 62.833  9.513   30.611 1.00 19.32 ? 2342 LYS B C     1 
ATOM   6982  O O     . LYS B 1 311 ? 63.610  9.103   31.480 1.00 21.74 ? 2342 LYS B O     1 
ATOM   6983  C CB    . LYS B 1 311 ? 60.753  8.414   29.826 1.00 16.66 ? 2342 LYS B CB    1 
ATOM   6984  C CG    . LYS B 1 311 ? 61.547  7.132   29.769 1.00 14.79 ? 2342 LYS B CG    1 
ATOM   6985  C CD    . LYS B 1 311 ? 61.186  6.238   30.917 1.00 14.90 ? 2342 LYS B CD    1 
ATOM   6986  C CE    . LYS B 1 311 ? 61.702  4.833   30.686 1.00 17.22 ? 2342 LYS B CE    1 
ATOM   6987  N NZ    . LYS B 1 311 ? 61.138  3.910   31.714 1.00 17.44 ? 2342 LYS B NZ    1 
ATOM   6988  N N     . ILE B 1 312 ? 63.255  10.034  29.467 1.00 19.64 ? 2343 ILE B N     1 
ATOM   6989  C CA    . ILE B 1 312 ? 64.670  10.175  29.174 1.00 18.65 ? 2343 ILE B CA    1 
ATOM   6990  C C     . ILE B 1 312 ? 65.375  11.123  30.139 1.00 20.09 ? 2343 ILE B C     1 
ATOM   6991  O O     . ILE B 1 312 ? 66.484  10.854  30.593 1.00 20.95 ? 2343 ILE B O     1 
ATOM   6992  C CB    . ILE B 1 312 ? 64.870  10.709  27.761 1.00 18.01 ? 2343 ILE B CB    1 
ATOM   6993  C CG1   . ILE B 1 312 ? 64.517  9.615   26.764 1.00 16.65 ? 2343 ILE B CG1   1 
ATOM   6994  C CG2   . ILE B 1 312 ? 66.305  11.168  27.567 1.00 16.86 ? 2343 ILE B CG2   1 
ATOM   6995  C CD1   . ILE B 1 312 ? 64.308  10.122  25.373 1.00 17.23 ? 2343 ILE B CD1   1 
ATOM   6996  N N     . VAL B 1 313 ? 64.747  12.243  30.452 1.00 19.63 ? 2344 VAL B N     1 
ATOM   6997  C CA    . VAL B 1 313 ? 65.386  13.181  31.350 1.00 19.06 ? 2344 VAL B CA    1 
ATOM   6998  C C     . VAL B 1 313 ? 65.638  12.587  32.724 1.00 20.53 ? 2344 VAL B C     1 
ATOM   6999  O O     . VAL B 1 313 ? 66.640  12.917  33.359 1.00 21.49 ? 2344 VAL B O     1 
ATOM   7000  C CB    . VAL B 1 313 ? 64.557  14.493  31.479 1.00 18.95 ? 2344 VAL B CB    1 
ATOM   7001  C CG1   . VAL B 1 313 ? 65.092  15.371  32.621 1.00 18.81 ? 2344 VAL B CG1   1 
ATOM   7002  C CG2   . VAL B 1 313 ? 64.608  15.251  30.171 1.00 15.47 ? 2344 VAL B CG2   1 
ATOM   7003  N N     . ILE B 1 314 ? 64.759  11.711  33.199 1.00 20.86 ? 2345 ILE B N     1 
ATOM   7004  C CA    . ILE B 1 314 ? 64.964  11.144  34.530 1.00 21.12 ? 2345 ILE B CA    1 
ATOM   7005  C C     . ILE B 1 314 ? 65.889  9.943   34.531 1.00 23.36 ? 2345 ILE B C     1 
ATOM   7006  O O     . ILE B 1 314 ? 66.861  9.894   35.280 1.00 23.31 ? 2345 ILE B O     1 
ATOM   7007  C CB    . ILE B 1 314 ? 63.648  10.682  35.179 1.00 21.10 ? 2345 ILE B CB    1 
ATOM   7008  C CG1   . ILE B 1 314 ? 62.800  11.884  35.584 1.00 20.62 ? 2345 ILE B CG1   1 
ATOM   7009  C CG2   . ILE B 1 314 ? 63.955  9.816   36.409 1.00 19.67 ? 2345 ILE B CG2   1 
ATOM   7010  C CD1   . ILE B 1 314 ? 61.350  11.519  35.906 1.00 20.61 ? 2345 ILE B CD1   1 
ATOM   7011  N N     . GLU B 1 315 ? 65.576  8.971   33.686 1.00 23.80 ? 2346 GLU B N     1 
ATOM   7012  C CA    . GLU B 1 315 ? 66.352  7.741   33.631 1.00 23.82 ? 2346 GLU B CA    1 
ATOM   7013  C C     . GLU B 1 315 ? 67.680  7.798   32.887 1.00 23.77 ? 2346 GLU B C     1 
ATOM   7014  O O     . GLU B 1 315 ? 68.540  6.948   33.102 1.00 24.95 ? 2346 GLU B O     1 
ATOM   7015  C CB    . GLU B 1 315 ? 65.458  6.622   33.092 1.00 23.12 ? 2346 GLU B CB    1 
ATOM   7016  C CG    . GLU B 1 315 ? 64.128  6.561   33.849 1.00 25.06 ? 2346 GLU B CG    1 
ATOM   7017  C CD    . GLU B 1 315 ? 63.435  5.213   33.774 1.00 26.13 ? 2346 GLU B CD    1 
ATOM   7018  O OE1   . GLU B 1 315 ? 63.995  4.278   33.174 1.00 28.70 ? 2346 GLU B OE1   1 
ATOM   7019  O OE2   . GLU B 1 315 ? 62.320  5.089   34.316 1.00 27.44 ? 2346 GLU B OE2   1 
ATOM   7020  N N     . ASP B 1 316 ? 67.862  8.795   32.028 1.00 23.68 ? 2347 ASP B N     1 
ATOM   7021  C CA    . ASP B 1 316 ? 69.110  8.932   31.287 1.00 22.14 ? 2347 ASP B CA    1 
ATOM   7022  C C     . ASP B 1 316 ? 69.876  10.197  31.694 1.00 21.57 ? 2347 ASP B C     1 
ATOM   7023  O O     . ASP B 1 316 ? 70.985  10.126  32.206 1.00 22.30 ? 2347 ASP B O     1 
ATOM   7024  C CB    . ASP B 1 316 ? 68.835  8.988   29.781 1.00 23.28 ? 2347 ASP B CB    1 
ATOM   7025  C CG    . ASP B 1 316 ? 68.516  7.634   29.189 1.00 24.40 ? 2347 ASP B CG    1 
ATOM   7026  O OD1   . ASP B 1 316 ? 69.220  6.655   29.524 1.00 24.43 ? 2347 ASP B OD1   1 
ATOM   7027  O OD2   . ASP B 1 316 ? 67.557  7.550   28.382 1.00 26.97 ? 2347 ASP B OD2   1 
ATOM   7028  N N     . TYR B 1 317 ? 69.260  11.353  31.469 1.00 20.68 ? 2348 TYR B N     1 
ATOM   7029  C CA    . TYR B 1 317 ? 69.864  12.644  31.756 1.00 18.94 ? 2348 TYR B CA    1 
ATOM   7030  C C     . TYR B 1 317 ? 70.221  12.818  33.217 1.00 20.00 ? 2348 TYR B C     1 
ATOM   7031  O O     . TYR B 1 317 ? 71.395  12.913  33.561 1.00 21.13 ? 2348 TYR B O     1 
ATOM   7032  C CB    . TYR B 1 317 ? 68.907  13.747  31.301 1.00 17.63 ? 2348 TYR B CB    1 
ATOM   7033  C CG    . TYR B 1 317 ? 69.440  15.172  31.322 1.00 16.98 ? 2348 TYR B CG    1 
ATOM   7034  C CD1   . TYR B 1 317 ? 70.130  15.705  30.223 1.00 16.38 ? 2348 TYR B CD1   1 
ATOM   7035  C CD2   . TYR B 1 317 ? 69.131  16.028  32.379 1.00 15.56 ? 2348 TYR B CD2   1 
ATOM   7036  C CE1   . TYR B 1 317 ? 70.476  17.060  30.181 1.00 17.05 ? 2348 TYR B CE1   1 
ATOM   7037  C CE2   . TYR B 1 317 ? 69.473  17.381  32.346 1.00 16.11 ? 2348 TYR B CE2   1 
ATOM   7038  C CZ    . TYR B 1 317 ? 70.130  17.890  31.251 1.00 16.62 ? 2348 TYR B CZ    1 
ATOM   7039  O OH    . TYR B 1 317 ? 70.364  19.240  31.202 1.00 17.64 ? 2348 TYR B OH    1 
ATOM   7040  N N     . VAL B 1 318 ? 69.216  12.861  34.086 1.00 22.45 ? 2349 VAL B N     1 
ATOM   7041  C CA    . VAL B 1 318 ? 69.460  13.050  35.518 1.00 22.03 ? 2349 VAL B CA    1 
ATOM   7042  C C     . VAL B 1 318 ? 70.273  11.880  36.075 1.00 24.04 ? 2349 VAL B C     1 
ATOM   7043  O O     . VAL B 1 318 ? 71.186  12.074  36.882 1.00 24.66 ? 2349 VAL B O     1 
ATOM   7044  C CB    . VAL B 1 318 ? 68.124  13.192  36.283 1.00 23.09 ? 2349 VAL B CB    1 
ATOM   7045  C CG1   . VAL B 1 318 ? 68.367  13.249  37.790 1.00 22.29 ? 2349 VAL B CG1   1 
ATOM   7046  C CG2   . VAL B 1 318 ? 67.399  14.458  35.815 1.00 22.67 ? 2349 VAL B CG2   1 
ATOM   7047  N N     . GLN B 1 319 ? 69.953  10.667  35.630 1.00 24.72 ? 2350 GLN B N     1 
ATOM   7048  C CA    . GLN B 1 319 ? 70.676  9.480   36.071 1.00 24.40 ? 2350 GLN B CA    1 
ATOM   7049  C C     . GLN B 1 319 ? 72.170  9.755   35.923 1.00 25.18 ? 2350 GLN B C     1 
ATOM   7050  O O     . GLN B 1 319 ? 72.941  9.626   36.879 1.00 25.95 ? 2350 GLN B O     1 
ATOM   7051  C CB    . GLN B 1 319 ? 70.299  8.276   35.210 1.00 24.24 ? 2350 GLN B CB    1 
ATOM   7052  C CG    . GLN B 1 319 ? 71.012  7.004   35.608 1.00 27.12 ? 2350 GLN B CG    1 
ATOM   7053  C CD    . GLN B 1 319 ? 70.699  6.606   37.027 1.00 27.96 ? 2350 GLN B CD    1 
ATOM   7054  O OE1   . GLN B 1 319 ? 69.541  6.536   37.408 1.00 32.99 ? 2350 GLN B OE1   1 
ATOM   7055  N NE2   . GLN B 1 319 ? 71.725  6.349   37.817 1.00 28.72 ? 2350 GLN B NE2   1 
ATOM   7056  N N     . HIS B 1 320 ? 72.567  10.142  34.712 1.00 25.05 ? 2351 HIS B N     1 
ATOM   7057  C CA    . HIS B 1 320 ? 73.962  10.450  34.407 1.00 24.44 ? 2351 HIS B CA    1 
ATOM   7058  C C     . HIS B 1 320 ? 74.518  11.522  35.341 1.00 24.57 ? 2351 HIS B C     1 
ATOM   7059  O O     . HIS B 1 320 ? 75.522  11.317  36.020 1.00 25.97 ? 2351 HIS B O     1 
ATOM   7060  C CB    . HIS B 1 320 ? 74.080  10.927  32.955 1.00 23.91 ? 2351 HIS B CB    1 
ATOM   7061  C CG    . HIS B 1 320 ? 75.409  11.525  32.625 1.00 23.73 ? 2351 HIS B CG    1 
ATOM   7062  N ND1   . HIS B 1 320 ? 76.566  10.776  32.552 1.00 23.95 ? 2351 HIS B ND1   1 
ATOM   7063  C CD2   . HIS B 1 320 ? 75.776  12.807  32.388 1.00 23.21 ? 2351 HIS B CD2   1 
ATOM   7064  C CE1   . HIS B 1 320 ? 77.588  11.572  32.284 1.00 23.80 ? 2351 HIS B CE1   1 
ATOM   7065  N NE2   . HIS B 1 320 ? 77.136  12.805  32.180 1.00 23.69 ? 2351 HIS B NE2   1 
ATOM   7066  N N     . LEU B 1 321 ? 73.854  12.667  35.364 1.00 24.41 ? 2352 LEU B N     1 
ATOM   7067  C CA    . LEU B 1 321 ? 74.261  13.783  36.197 1.00 23.13 ? 2352 LEU B CA    1 
ATOM   7068  C C     . LEU B 1 321 ? 74.460  13.384  37.637 1.00 23.57 ? 2352 LEU B C     1 
ATOM   7069  O O     . LEU B 1 321 ? 75.410  13.807  38.271 1.00 24.61 ? 2352 LEU B O     1 
ATOM   7070  C CB    . LEU B 1 321 ? 73.202  14.870  36.159 1.00 23.72 ? 2352 LEU B CB    1 
ATOM   7071  C CG    . LEU B 1 321 ? 73.514  16.248  35.599 1.00 24.19 ? 2352 LEU B CG    1 
ATOM   7072  C CD1   . LEU B 1 321 ? 74.735  16.211  34.712 1.00 23.14 ? 2352 LEU B CD1   1 
ATOM   7073  C CD2   . LEU B 1 321 ? 72.287  16.725  34.833 1.00 25.36 ? 2352 LEU B CD2   1 
ATOM   7074  N N     . SER B 1 322 ? 73.560  12.565  38.156 1.00 23.24 ? 2353 SER B N     1 
ATOM   7075  C CA    . SER B 1 322 ? 73.625  12.152  39.552 1.00 23.39 ? 2353 SER B CA    1 
ATOM   7076  C C     . SER B 1 322 ? 74.877  11.372  39.974 1.00 24.12 ? 2353 SER B C     1 
ATOM   7077  O O     . SER B 1 322 ? 75.468  11.646  41.029 1.00 23.70 ? 2353 SER B O     1 
ATOM   7078  C CB    . SER B 1 322 ? 72.390  11.316  39.891 1.00 22.71 ? 2353 SER B CB    1 
ATOM   7079  O OG    . SER B 1 322 ? 72.577  9.962   39.521 1.00 22.41 ? 2353 SER B OG    1 
ATOM   7080  N N     . GLY B 1 323 ? 75.272  10.397  39.157 1.00 24.28 ? 2354 GLY B N     1 
ATOM   7081  C CA    . GLY B 1 323 ? 76.417  9.574   39.496 1.00 24.98 ? 2354 GLY B CA    1 
ATOM   7082  C C     . GLY B 1 323 ? 75.996  8.463   40.445 1.00 24.61 ? 2354 GLY B C     1 
ATOM   7083  O O     . GLY B 1 323 ? 76.824  7.742   40.987 1.00 24.64 ? 2354 GLY B O     1 
ATOM   7084  N N     . TYR B 1 324 ? 74.695  8.315   40.642 1.00 24.77 ? 2355 TYR B N     1 
ATOM   7085  C CA    . TYR B 1 324 ? 74.190  7.293   41.545 1.00 25.59 ? 2355 TYR B CA    1 
ATOM   7086  C C     . TYR B 1 324 ? 74.327  5.899   40.964 1.00 26.10 ? 2355 TYR B C     1 
ATOM   7087  O O     . TYR B 1 324 ? 74.313  5.720   39.746 1.00 26.46 ? 2355 TYR B O     1 
ATOM   7088  C CB    . TYR B 1 324 ? 72.711  7.536   41.859 1.00 24.98 ? 2355 TYR B CB    1 
ATOM   7089  C CG    . TYR B 1 324 ? 72.406  8.852   42.530 1.00 23.69 ? 2355 TYR B CG    1 
ATOM   7090  C CD1   . TYR B 1 324 ? 73.409  9.593   43.160 1.00 23.86 ? 2355 TYR B CD1   1 
ATOM   7091  C CD2   . TYR B 1 324 ? 71.113  9.360   42.531 1.00 21.72 ? 2355 TYR B CD2   1 
ATOM   7092  C CE1   . TYR B 1 324 ? 73.123  10.815  43.776 1.00 23.45 ? 2355 TYR B CE1   1 
ATOM   7093  C CE2   . TYR B 1 324 ? 70.818  10.570  43.139 1.00 22.56 ? 2355 TYR B CE2   1 
ATOM   7094  C CZ    . TYR B 1 324 ? 71.818  11.294  43.758 1.00 22.81 ? 2355 TYR B CZ    1 
ATOM   7095  O OH    . TYR B 1 324 ? 71.499  12.493  44.358 1.00 23.23 ? 2355 TYR B OH    1 
ATOM   7096  N N     . HIS B 1 325 ? 74.452  4.910   41.846 1.00 27.33 ? 2356 HIS B N     1 
ATOM   7097  C CA    . HIS B 1 325 ? 74.535  3.527   41.409 1.00 29.04 ? 2356 HIS B CA    1 
ATOM   7098  C C     . HIS B 1 325 ? 73.102  3.034   41.335 1.00 29.15 ? 2356 HIS B C     1 
ATOM   7099  O O     . HIS B 1 325 ? 72.790  2.070   40.640 1.00 30.58 ? 2356 HIS B O     1 
ATOM   7100  C CB    . HIS B 1 325 ? 75.356  2.696   42.397 1.00 30.32 ? 2356 HIS B CB    1 
ATOM   7101  C CG    . HIS B 1 325 ? 76.828  2.901   42.243 1.00 31.30 ? 2356 HIS B CG    1 
ATOM   7102  N ND1   . HIS B 1 325 ? 77.679  3.051   43.317 1.00 31.05 ? 2356 HIS B ND1   1 
ATOM   7103  C CD2   . HIS B 1 325 ? 77.589  3.068   41.135 1.00 31.64 ? 2356 HIS B CD2   1 
ATOM   7104  C CE1   . HIS B 1 325 ? 78.899  3.306   42.876 1.00 32.57 ? 2356 HIS B CE1   1 
ATOM   7105  N NE2   . HIS B 1 325 ? 78.871  3.321   41.555 1.00 31.86 ? 2356 HIS B NE2   1 
ATOM   7106  N N     . PHE B 1 326 ? 72.232  3.729   42.055 1.00 29.26 ? 2357 PHE B N     1 
ATOM   7107  C CA    . PHE B 1 326 ? 70.805  3.426   42.074 1.00 28.59 ? 2357 PHE B CA    1 
ATOM   7108  C C     . PHE B 1 326 ? 70.171  3.901   40.754 1.00 28.03 ? 2357 PHE B C     1 
ATOM   7109  O O     . PHE B 1 326 ? 70.424  5.018   40.298 1.00 28.10 ? 2357 PHE B O     1 
ATOM   7110  C CB    . PHE B 1 326 ? 70.143  4.141   43.253 1.00 28.44 ? 2357 PHE B CB    1 
ATOM   7111  C CG    . PHE B 1 326 ? 68.661  4.042   43.248 1.00 29.43 ? 2357 PHE B CG    1 
ATOM   7112  C CD1   . PHE B 1 326 ? 68.040  2.798   43.309 1.00 28.83 ? 2357 PHE B CD1   1 
ATOM   7113  C CD2   . PHE B 1 326 ? 67.879  5.187   43.125 1.00 30.39 ? 2357 PHE B CD2   1 
ATOM   7114  C CE1   . PHE B 1 326 ? 66.653  2.687   43.241 1.00 30.40 ? 2357 PHE B CE1   1 
ATOM   7115  C CE2   . PHE B 1 326 ? 66.492  5.095   43.054 1.00 31.79 ? 2357 PHE B CE2   1 
ATOM   7116  C CZ    . PHE B 1 326 ? 65.873  3.837   43.111 1.00 31.96 ? 2357 PHE B CZ    1 
ATOM   7117  N N     . LYS B 1 327 ? 69.353  3.053   40.139 1.00 27.78 ? 2358 LYS B N     1 
ATOM   7118  C CA    . LYS B 1 327 ? 68.706  3.404   38.881 1.00 27.96 ? 2358 LYS B CA    1 
ATOM   7119  C C     . LYS B 1 327 ? 67.447  4.249   39.088 1.00 26.46 ? 2358 LYS B C     1 
ATOM   7120  O O     . LYS B 1 327 ? 66.399  3.732   39.462 1.00 26.63 ? 2358 LYS B O     1 
ATOM   7121  C CB    . LYS B 1 327 ? 68.341  2.134   38.122 1.00 31.30 ? 2358 LYS B CB    1 
ATOM   7122  C CG    . LYS B 1 327 ? 69.261  1.802   36.968 1.00 36.64 ? 2358 LYS B CG    1 
ATOM   7123  C CD    . LYS B 1 327 ? 68.715  0.599   36.171 1.00 40.94 ? 2358 LYS B CD    1 
ATOM   7124  C CE    . LYS B 1 327 ? 69.771  -0.507  35.996 1.00 44.09 ? 2358 LYS B CE    1 
ATOM   7125  N NZ    . LYS B 1 327 ? 69.185  -1.899  35.951 1.00 44.61 ? 2358 LYS B NZ    1 
ATOM   7126  N N     . LEU B 1 328 ? 67.560  5.551   38.848 1.00 25.40 ? 2359 LEU B N     1 
ATOM   7127  C CA    . LEU B 1 328 ? 66.443  6.476   38.982 1.00 23.73 ? 2359 LEU B CA    1 
ATOM   7128  C C     . LEU B 1 328 ? 65.301  5.973   38.113 1.00 24.66 ? 2359 LEU B C     1 
ATOM   7129  O O     . LEU B 1 328 ? 65.532  5.368   37.073 1.00 24.90 ? 2359 LEU B O     1 
ATOM   7130  C CB    . LEU B 1 328 ? 66.870  7.873   38.539 1.00 21.55 ? 2359 LEU B CB    1 
ATOM   7131  C CG    . LEU B 1 328 ? 67.848  8.545   39.507 1.00 18.54 ? 2359 LEU B CG    1 
ATOM   7132  C CD1   . LEU B 1 328 ? 68.182  9.946   39.033 1.00 17.25 ? 2359 LEU B CD1   1 
ATOM   7133  C CD2   . LEU B 1 328 ? 67.220  8.601   40.894 1.00 16.55 ? 2359 LEU B CD2   1 
ATOM   7134  N N     . LYS B 1 329 ? 64.068  6.239   38.519 1.00 26.26 ? 2360 LYS B N     1 
ATOM   7135  C CA    . LYS B 1 329 ? 62.939  5.727   37.764 1.00 26.29 ? 2360 LYS B CA    1 
ATOM   7136  C C     . LYS B 1 329 ? 61.818  6.726   37.528 1.00 26.23 ? 2360 LYS B C     1 
ATOM   7137  O O     . LYS B 1 329 ? 61.499  7.534   38.393 1.00 26.14 ? 2360 LYS B O     1 
ATOM   7138  C CB    . LYS B 1 329 ? 62.397  4.492   38.483 1.00 27.73 ? 2360 LYS B CB    1 
ATOM   7139  C CG    . LYS B 1 329 ? 61.233  3.800   37.802 1.00 30.37 ? 2360 LYS B CG    1 
ATOM   7140  C CD    . LYS B 1 329 ? 60.596  2.854   38.797 1.00 33.25 ? 2360 LYS B CD    1 
ATOM   7141  C CE    . LYS B 1 329 ? 59.613  1.899   38.140 1.00 35.34 ? 2360 LYS B CE    1 
ATOM   7142  N NZ    . LYS B 1 329 ? 58.799  1.151   39.175 1.00 34.45 ? 2360 LYS B NZ    1 
ATOM   7143  N N     . PHE B 1 330 ? 61.236  6.676   36.337 1.00 24.91 ? 2361 PHE B N     1 
ATOM   7144  C CA    . PHE B 1 330 ? 60.126  7.552   36.022 1.00 24.67 ? 2361 PHE B CA    1 
ATOM   7145  C C     . PHE B 1 330 ? 58.846  6.757   36.272 1.00 24.48 ? 2361 PHE B C     1 
ATOM   7146  O O     . PHE B 1 330 ? 58.475  5.897   35.471 1.00 25.38 ? 2361 PHE B O     1 
ATOM   7147  C CB    . PHE B 1 330 ? 60.165  7.993   34.557 1.00 24.41 ? 2361 PHE B CB    1 
ATOM   7148  C CG    . PHE B 1 330 ? 58.921  8.741   34.117 1.00 24.80 ? 2361 PHE B CG    1 
ATOM   7149  C CD1   . PHE B 1 330 ? 58.355  9.727   34.937 1.00 23.83 ? 2361 PHE B CD1   1 
ATOM   7150  C CD2   . PHE B 1 330 ? 58.326  8.477   32.879 1.00 24.18 ? 2361 PHE B CD2   1 
ATOM   7151  C CE1   . PHE B 1 330 ? 57.223  10.445  34.532 1.00 22.64 ? 2361 PHE B CE1   1 
ATOM   7152  C CE2   . PHE B 1 330 ? 57.185  9.197   32.464 1.00 24.82 ? 2361 PHE B CE2   1 
ATOM   7153  C CZ    . PHE B 1 330 ? 56.636  10.184  33.298 1.00 22.44 ? 2361 PHE B CZ    1 
ATOM   7154  N N     . ASP B 1 331 ? 58.177  7.029   37.383 1.00 23.72 ? 2362 ASP B N     1 
ATOM   7155  C CA    . ASP B 1 331 ? 56.944  6.327   37.704 1.00 24.51 ? 2362 ASP B CA    1 
ATOM   7156  C C     . ASP B 1 331 ? 55.967  7.251   38.439 1.00 24.31 ? 2362 ASP B C     1 
ATOM   7157  O O     . ASP B 1 331 ? 56.031  7.404   39.663 1.00 25.09 ? 2362 ASP B O     1 
ATOM   7158  C CB    . ASP B 1 331 ? 57.257  5.104   38.563 1.00 24.42 ? 2362 ASP B CB    1 
ATOM   7159  C CG    . ASP B 1 331 ? 56.069  4.185   38.728 1.00 25.77 ? 2362 ASP B CG    1 
ATOM   7160  O OD1   . ASP B 1 331 ? 54.962  4.515   38.246 1.00 27.28 ? 2362 ASP B OD1   1 
ATOM   7161  O OD2   . ASP B 1 331 ? 56.240  3.116   39.348 1.00 26.69 ? 2362 ASP B OD2   1 
ATOM   7162  N N     . PRO B 1 332 ? 55.055  7.886   37.693 1.00 24.95 ? 2363 PRO B N     1 
ATOM   7163  C CA    . PRO B 1 332 ? 54.080  8.790   38.314 1.00 24.92 ? 2363 PRO B CA    1 
ATOM   7164  C C     . PRO B 1 332 ? 53.327  8.153   39.474 1.00 25.24 ? 2363 PRO B C     1 
ATOM   7165  O O     . PRO B 1 332 ? 52.971  8.830   40.443 1.00 25.59 ? 2363 PRO B O     1 
ATOM   7166  C CB    . PRO B 1 332 ? 53.156  9.168   37.158 1.00 25.42 ? 2363 PRO B CB    1 
ATOM   7167  C CG    . PRO B 1 332 ? 54.042  8.994   35.920 1.00 25.72 ? 2363 PRO B CG    1 
ATOM   7168  C CD    . PRO B 1 332 ? 54.901  7.804   36.229 1.00 24.17 ? 2363 PRO B CD    1 
ATOM   7169  N N     . GLU B 1 333 ? 53.104  6.846   39.374 1.00 25.57 ? 2364 GLU B N     1 
ATOM   7170  C CA    . GLU B 1 333 ? 52.384  6.102   40.402 1.00 27.12 ? 2364 GLU B CA    1 
ATOM   7171  C C     . GLU B 1 333 ? 53.009  6.243   41.758 1.00 27.19 ? 2364 GLU B C     1 
ATOM   7172  O O     . GLU B 1 333 ? 52.322  6.151   42.771 1.00 27.79 ? 2364 GLU B O     1 
ATOM   7173  C CB    . GLU B 1 333 ? 52.329  4.618   40.070 1.00 28.54 ? 2364 GLU B CB    1 
ATOM   7174  C CG    . GLU B 1 333 ? 51.890  4.341   38.671 1.00 33.42 ? 2364 GLU B CG    1 
ATOM   7175  C CD    . GLU B 1 333 ? 50.758  3.341   38.612 1.00 36.17 ? 2364 GLU B CD    1 
ATOM   7176  O OE1   . GLU B 1 333 ? 50.200  3.131   37.509 1.00 38.45 ? 2364 GLU B OE1   1 
ATOM   7177  O OE2   . GLU B 1 333 ? 50.428  2.768   39.673 1.00 38.08 ? 2364 GLU B OE2   1 
ATOM   7178  N N     . LEU B 1 334 ? 54.314  6.459   41.780 1.00 25.76 ? 2365 LEU B N     1 
ATOM   7179  C CA    . LEU B 1 334 ? 55.017  6.587   43.035 1.00 24.62 ? 2365 LEU B CA    1 
ATOM   7180  C C     . LEU B 1 334 ? 54.511  7.749   43.864 1.00 24.72 ? 2365 LEU B C     1 
ATOM   7181  O O     . LEU B 1 334 ? 54.647  7.751   45.089 1.00 25.70 ? 2365 LEU B O     1 
ATOM   7182  C CB    . LEU B 1 334 ? 56.495  6.757   42.771 1.00 24.39 ? 2365 LEU B CB    1 
ATOM   7183  C CG    . LEU B 1 334 ? 57.122  5.544   42.095 1.00 24.44 ? 2365 LEU B CG    1 
ATOM   7184  C CD1   . LEU B 1 334 ? 58.621  5.830   41.887 1.00 24.43 ? 2365 LEU B CD1   1 
ATOM   7185  C CD2   . LEU B 1 334 ? 56.901  4.286   42.956 1.00 21.55 ? 2365 LEU B CD2   1 
ATOM   7186  N N     . LEU B 1 335 ? 53.912  8.730   43.194 1.00 25.05 ? 2366 LEU B N     1 
ATOM   7187  C CA    . LEU B 1 335 ? 53.391  9.913   43.863 1.00 24.28 ? 2366 LEU B CA    1 
ATOM   7188  C C     . LEU B 1 335 ? 51.905  9.881   44.176 1.00 25.58 ? 2366 LEU B C     1 
ATOM   7189  O O     . LEU B 1 335 ? 51.423  10.697  44.952 1.00 26.30 ? 2366 LEU B O     1 
ATOM   7190  C CB    . LEU B 1 335 ? 53.686  11.142  43.015 1.00 24.59 ? 2366 LEU B CB    1 
ATOM   7191  C CG    . LEU B 1 335 ? 55.168  11.476  42.904 1.00 22.65 ? 2366 LEU B CG    1 
ATOM   7192  C CD1   . LEU B 1 335 ? 55.334  12.637  41.963 1.00 23.03 ? 2366 LEU B CD1   1 
ATOM   7193  C CD2   . LEU B 1 335 ? 55.706  11.820  44.286 1.00 21.53 ? 2366 LEU B CD2   1 
ATOM   7194  N N     . PHE B 1 336 ? 51.177  8.938   43.590 1.00 27.12 ? 2367 PHE B N     1 
ATOM   7195  C CA    . PHE B 1 336 ? 49.727  8.845   43.800 1.00 28.68 ? 2367 PHE B CA    1 
ATOM   7196  C C     . PHE B 1 336 ? 49.222  8.806   45.253 1.00 31.11 ? 2367 PHE B C     1 
ATOM   7197  O O     . PHE B 1 336 ? 48.125  9.284   45.536 1.00 31.25 ? 2367 PHE B O     1 
ATOM   7198  C CB    . PHE B 1 336 ? 49.165  7.640   43.037 1.00 25.91 ? 2367 PHE B CB    1 
ATOM   7199  C CG    . PHE B 1 336 ? 49.187  7.802   41.534 1.00 23.28 ? 2367 PHE B CG    1 
ATOM   7200  C CD1   . PHE B 1 336 ? 48.800  6.757   40.709 1.00 21.60 ? 2367 PHE B CD1   1 
ATOM   7201  C CD2   . PHE B 1 336 ? 49.610  8.984   40.948 1.00 22.32 ? 2367 PHE B CD2   1 
ATOM   7202  C CE1   . PHE B 1 336 ? 48.832  6.886   39.325 1.00 20.60 ? 2367 PHE B CE1   1 
ATOM   7203  C CE2   . PHE B 1 336 ? 49.645  9.114   39.567 1.00 22.68 ? 2367 PHE B CE2   1 
ATOM   7204  C CZ    . PHE B 1 336 ? 49.254  8.058   38.755 1.00 21.56 ? 2367 PHE B CZ    1 
ATOM   7205  N N     . ASN B 1 337 ? 49.989  8.233   46.172 1.00 33.72 ? 2368 ASN B N     1 
ATOM   7206  C CA    . ASN B 1 337 ? 49.543  8.186   47.567 1.00 37.76 ? 2368 ASN B CA    1 
ATOM   7207  C C     . ASN B 1 337 ? 50.204  9.293   48.381 1.00 38.19 ? 2368 ASN B C     1 
ATOM   7208  O O     . ASN B 1 337 ? 50.109  9.327   49.607 1.00 38.61 ? 2368 ASN B O     1 
ATOM   7209  C CB    . ASN B 1 337 ? 49.878  6.834   48.200 1.00 40.17 ? 2368 ASN B CB    1 
ATOM   7210  C CG    . ASN B 1 337 ? 51.284  6.368   47.869 1.00 44.67 ? 2368 ASN B CG    1 
ATOM   7211  O OD1   . ASN B 1 337 ? 52.165  7.168   47.521 1.00 44.48 ? 2368 ASN B OD1   1 
ATOM   7212  N ND2   . ASN B 1 337 ? 51.498  5.056   47.949 1.00 46.86 ? 2368 ASN B ND2   1 
ATOM   7213  N N     . GLN B 1 338 ? 50.871  10.201  47.680 1.00 38.01 ? 2369 GLN B N     1 
ATOM   7214  C CA    . GLN B 1 338 ? 51.582  11.302  48.310 1.00 36.53 ? 2369 GLN B CA    1 
ATOM   7215  C C     . GLN B 1 338 ? 50.847  12.603  48.067 1.00 35.47 ? 2369 GLN B C     1 
ATOM   7216  O O     . GLN B 1 338 ? 50.050  12.704  47.135 1.00 35.63 ? 2369 GLN B O     1 
ATOM   7217  C CB    . GLN B 1 338 ? 52.981  11.409  47.703 1.00 37.39 ? 2369 GLN B CB    1 
ATOM   7218  C CG    . GLN B 1 338 ? 54.114  11.137  48.668 1.00 40.14 ? 2369 GLN B CG    1 
ATOM   7219  C CD    . GLN B 1 338 ? 53.965  9.818   49.397 1.00 41.37 ? 2369 GLN B CD    1 
ATOM   7220  O OE1   . GLN B 1 338 ? 53.829  8.767   48.776 1.00 44.71 ? 2369 GLN B OE1   1 
ATOM   7221  N NE2   . GLN B 1 338 ? 53.992  9.864   50.723 1.00 42.72 ? 2369 GLN B NE2   1 
ATOM   7222  N N     . GLN B 1 339 ? 51.107  13.597  48.906 1.00 32.92 ? 2370 GLN B N     1 
ATOM   7223  C CA    . GLN B 1 339 ? 50.493  14.899  48.711 1.00 30.58 ? 2370 GLN B CA    1 
ATOM   7224  C C     . GLN B 1 339 ? 51.435  15.570  47.732 1.00 29.18 ? 2370 GLN B C     1 
ATOM   7225  O O     . GLN B 1 339 ? 52.603  15.789  48.049 1.00 29.98 ? 2370 GLN B O     1 
ATOM   7226  C CB    . GLN B 1 339 ? 50.459  15.678  50.015 1.00 31.02 ? 2370 GLN B CB    1 
ATOM   7227  C CG    . GLN B 1 339 ? 49.397  15.192  50.992 1.00 33.63 ? 2370 GLN B CG    1 
ATOM   7228  C CD    . GLN B 1 339 ? 49.231  16.120  52.184 1.00 34.58 ? 2370 GLN B CD    1 
ATOM   7229  O OE1   . GLN B 1 339 ? 50.024  16.095  53.120 1.00 37.88 ? 2370 GLN B OE1   1 
ATOM   7230  N NE2   . GLN B 1 339 ? 48.204  16.946  52.149 1.00 36.19 ? 2370 GLN B NE2   1 
ATOM   7231  N N     . PHE B 1 340 ? 50.952  15.891  46.539 1.00 25.45 ? 2371 PHE B N     1 
ATOM   7232  C CA    . PHE B 1 340 ? 51.824  16.497  45.547 1.00 21.84 ? 2371 PHE B CA    1 
ATOM   7233  C C     . PHE B 1 340 ? 50.966  17.337  44.610 1.00 21.85 ? 2371 PHE B C     1 
ATOM   7234  O O     . PHE B 1 340 ? 49.870  16.918  44.244 1.00 21.32 ? 2371 PHE B O     1 
ATOM   7235  C CB    . PHE B 1 340 ? 52.552  15.384  44.790 1.00 18.99 ? 2371 PHE B CB    1 
ATOM   7236  C CG    . PHE B 1 340 ? 53.469  15.877  43.697 1.00 19.26 ? 2371 PHE B CG    1 
ATOM   7237  C CD1   . PHE B 1 340 ? 54.765  16.305  43.987 1.00 17.80 ? 2371 PHE B CD1   1 
ATOM   7238  C CD2   . PHE B 1 340 ? 53.036  15.925  42.375 1.00 18.31 ? 2371 PHE B CD2   1 
ATOM   7239  C CE1   . PHE B 1 340 ? 55.614  16.772  42.977 1.00 16.78 ? 2371 PHE B CE1   1 
ATOM   7240  C CE2   . PHE B 1 340 ? 53.877  16.392  41.363 1.00 17.04 ? 2371 PHE B CE2   1 
ATOM   7241  C CZ    . PHE B 1 340 ? 55.168  16.816  41.670 1.00 17.04 ? 2371 PHE B CZ    1 
ATOM   7242  N N     . GLN B 1 341 ? 51.454  18.524  44.236 1.00 20.77 ? 2372 GLN B N     1 
ATOM   7243  C CA    . GLN B 1 341 ? 50.713  19.421  43.355 1.00 19.01 ? 2372 GLN B CA    1 
ATOM   7244  C C     . GLN B 1 341 ? 51.147  19.271  41.919 1.00 19.18 ? 2372 GLN B C     1 
ATOM   7245  O O     . GLN B 1 341 ? 52.311  19.484  41.586 1.00 18.72 ? 2372 GLN B O     1 
ATOM   7246  C CB    . GLN B 1 341 ? 50.902  20.876  43.787 1.00 19.38 ? 2372 GLN B CB    1 
ATOM   7247  C CG    . GLN B 1 341 ? 50.437  21.178  45.208 1.00 18.37 ? 2372 GLN B CG    1 
ATOM   7248  C CD    . GLN B 1 341 ? 48.938  21.036  45.378 1.00 19.36 ? 2372 GLN B CD    1 
ATOM   7249  O OE1   . GLN B 1 341 ? 48.159  21.676  44.679 1.00 20.43 ? 2372 GLN B OE1   1 
ATOM   7250  N NE2   . GLN B 1 341 ? 48.528  20.194  46.309 1.00 19.70 ? 2372 GLN B NE2   1 
ATOM   7251  N N     . TYR B 1 342 ? 50.201  18.904  41.059 1.00 19.12 ? 2373 TYR B N     1 
ATOM   7252  C CA    . TYR B 1 342 ? 50.501  18.745  39.654 1.00 18.81 ? 2373 TYR B CA    1 
ATOM   7253  C C     . TYR B 1 342 ? 50.398  20.079  38.948 1.00 19.16 ? 2373 TYR B C     1 
ATOM   7254  O O     . TYR B 1 342 ? 49.486  20.322  38.154 1.00 19.81 ? 2373 TYR B O     1 
ATOM   7255  C CB    . TYR B 1 342 ? 49.571  17.721  39.021 1.00 17.16 ? 2373 TYR B CB    1 
ATOM   7256  C CG    . TYR B 1 342 ? 49.874  16.334  39.515 1.00 17.29 ? 2373 TYR B CG    1 
ATOM   7257  C CD1   . TYR B 1 342 ? 49.057  15.731  40.457 1.00 18.24 ? 2373 TYR B CD1   1 
ATOM   7258  C CD2   . TYR B 1 342 ? 51.021  15.651  39.093 1.00 17.33 ? 2373 TYR B CD2   1 
ATOM   7259  C CE1   . TYR B 1 342 ? 49.363  14.483  40.980 1.00 19.85 ? 2373 TYR B CE1   1 
ATOM   7260  C CE2   . TYR B 1 342 ? 51.346  14.397  39.606 1.00 18.60 ? 2373 TYR B CE2   1 
ATOM   7261  C CZ    . TYR B 1 342 ? 50.509  13.817  40.555 1.00 21.14 ? 2373 TYR B CZ    1 
ATOM   7262  O OH    . TYR B 1 342 ? 50.797  12.578  41.099 1.00 21.40 ? 2373 TYR B OH    1 
ATOM   7263  N N     . GLN B 1 343 ? 51.345  20.948  39.278 1.00 19.20 ? 2374 GLN B N     1 
ATOM   7264  C CA    . GLN B 1 343 ? 51.445  22.262  38.673 1.00 19.65 ? 2374 GLN B CA    1 
ATOM   7265  C C     . GLN B 1 343 ? 52.867  22.723  38.921 1.00 19.73 ? 2374 GLN B C     1 
ATOM   7266  O O     . GLN B 1 343 ? 53.533  22.251  39.846 1.00 20.55 ? 2374 GLN B O     1 
ATOM   7267  C CB    . GLN B 1 343 ? 50.460  23.237  39.301 1.00 19.46 ? 2374 GLN B CB    1 
ATOM   7268  C CG    . GLN B 1 343 ? 50.828  23.715  40.672 1.00 21.44 ? 2374 GLN B CG    1 
ATOM   7269  C CD    . GLN B 1 343 ? 49.773  24.642  41.236 1.00 24.04 ? 2374 GLN B CD    1 
ATOM   7270  O OE1   . GLN B 1 343 ? 49.979  25.854  41.327 1.00 28.82 ? 2374 GLN B OE1   1 
ATOM   7271  N NE2   . GLN B 1 343 ? 48.629  24.081  41.617 1.00 22.82 ? 2374 GLN B NE2   1 
ATOM   7272  N N     . ASN B 1 344 ? 53.331  23.655  38.099 1.00 20.15 ? 2375 ASN B N     1 
ATOM   7273  C CA    . ASN B 1 344 ? 54.684  24.146  38.246 1.00 18.76 ? 2375 ASN B CA    1 
ATOM   7274  C C     . ASN B 1 344 ? 54.816  25.494  37.622 1.00 18.96 ? 2375 ASN B C     1 
ATOM   7275  O O     . ASN B 1 344 ? 54.162  25.803  36.639 1.00 19.23 ? 2375 ASN B O     1 
ATOM   7276  C CB    . ASN B 1 344 ? 55.663  23.194  37.563 1.00 19.57 ? 2375 ASN B CB    1 
ATOM   7277  C CG    . ASN B 1 344 ? 57.087  23.672  37.667 1.00 19.34 ? 2375 ASN B CG    1 
ATOM   7278  O OD1   . ASN B 1 344 ? 57.596  23.876  38.761 1.00 18.70 ? 2375 ASN B OD1   1 
ATOM   7279  N ND2   . ASN B 1 344 ? 57.740  23.856  36.525 1.00 19.31 ? 2375 ASN B ND2   1 
ATOM   7280  N N     . ARG B 1 345 ? 55.690  26.321  38.222 1.00 18.69 ? 2376 ARG B N     1 
ATOM   7281  C CA    . ARG B 1 345 ? 55.973  27.654  37.703 1.00 17.17 ? 2376 ARG B CA    1 
ATOM   7282  C C     . ARG B 1 345 ? 57.479  27.733  37.738 1.00 18.82 ? 2376 ARG B C     1 
ATOM   7283  O O     . ARG B 1 345 ? 58.083  27.588  38.782 1.00 18.91 ? 2376 ARG B O     1 
ATOM   7284  C CB    . ARG B 1 345 ? 55.412  28.728  38.628 1.00 15.75 ? 2376 ARG B CB    1 
ATOM   7285  C CG    . ARG B 1 345 ? 55.357  30.098  37.950 1.00 15.85 ? 2376 ARG B CG    1 
ATOM   7286  C CD    . ARG B 1 345 ? 54.101  30.238  37.115 1.00 16.61 ? 2376 ARG B CD    1 
ATOM   7287  N NE    . ARG B 1 345 ? 52.945  30.023  37.985 1.00 20.15 ? 2376 ARG B NE    1 
ATOM   7288  C CZ    . ARG B 1 345 ? 52.199  30.979  38.548 1.00 19.83 ? 2376 ARG B CZ    1 
ATOM   7289  N NH1   . ARG B 1 345 ? 52.464  32.267  38.385 1.00 18.41 ? 2376 ARG B NH1   1 
ATOM   7290  N NH2   . ARG B 1 345 ? 51.124  30.619  39.263 1.00 21.17 ? 2376 ARG B NH2   1 
ATOM   7291  N N     . ILE B 1 346 ? 58.111  27.977  36.567 1.00 19.92 ? 2377 ILE B N     1 
ATOM   7292  C CA    . ILE B 1 346 ? 59.562  28.025  36.508 1.00 19.78 ? 2377 ILE B CA    1 
ATOM   7293  C C     . ILE B 1 346 ? 60.180  29.173  37.287 1.00 21.02 ? 2377 ILE B C     1 
ATOM   7294  O O     . ILE B 1 346 ? 59.781  30.340  37.146 1.00 20.27 ? 2377 ILE B O     1 
ATOM   7295  C CB    . ILE B 1 346 ? 60.040  28.026  35.048 1.00 19.79 ? 2377 ILE B CB    1 
ATOM   7296  C CG1   . ILE B 1 346 ? 60.173  26.579  34.589 1.00 18.65 ? 2377 ILE B CG1   1 
ATOM   7297  C CG2   . ILE B 1 346 ? 61.421  28.673  34.931 1.00 20.54 ? 2377 ILE B CG2   1 
ATOM   7298  C CD1   . ILE B 1 346 ? 59.404  26.278  33.397 1.00 19.43 ? 2377 ILE B CD1   1 
ATOM   7299  N N     . ALA B 1 347 ? 61.155  28.810  38.125 1.00 20.82 ? 2378 ALA B N     1 
ATOM   7300  C CA    . ALA B 1 347 ? 61.852  29.749  39.004 1.00 19.65 ? 2378 ALA B CA    1 
ATOM   7301  C C     . ALA B 1 347 ? 63.012  30.441  38.327 1.00 19.27 ? 2378 ALA B C     1 
ATOM   7302  O O     . ALA B 1 347 ? 63.740  29.842  37.546 1.00 18.07 ? 2378 ALA B O     1 
ATOM   7303  C CB    . ALA B 1 347 ? 62.346  29.031  40.248 1.00 18.77 ? 2378 ALA B CB    1 
ATOM   7304  N N     . SER B 1 348 ? 63.178  31.718  38.634 1.00 19.66 ? 2379 SER B N     1 
ATOM   7305  C CA    . SER B 1 348 ? 64.260  32.493  38.057 1.00 20.60 ? 2379 SER B CA    1 
ATOM   7306  C C     . SER B 1 348 ? 65.577  31.818  38.453 1.00 22.09 ? 2379 SER B C     1 
ATOM   7307  O O     . SER B 1 348 ? 66.505  31.688  37.645 1.00 22.23 ? 2379 SER B O     1 
ATOM   7308  C CB    . SER B 1 348 ? 64.197  33.922  38.599 1.00 20.14 ? 2379 SER B CB    1 
ATOM   7309  O OG    . SER B 1 348 ? 65.306  34.669  38.160 1.00 21.77 ? 2379 SER B OG    1 
ATOM   7310  N N     . GLU B 1 349 ? 65.636  31.368  39.705 1.00 22.93 ? 2380 GLU B N     1 
ATOM   7311  C CA    . GLU B 1 349 ? 66.824  30.713  40.228 1.00 22.70 ? 2380 GLU B CA    1 
ATOM   7312  C C     . GLU B 1 349 ? 67.171  29.411  39.505 1.00 23.21 ? 2380 GLU B C     1 
ATOM   7313  O O     . GLU B 1 349 ? 68.345  29.037  39.401 1.00 24.20 ? 2380 GLU B O     1 
ATOM   7314  C CB    . GLU B 1 349 ? 66.658  30.452  41.721 1.00 22.28 ? 2380 GLU B CB    1 
ATOM   7315  C CG    . GLU B 1 349 ? 66.637  31.722  42.557 1.00 23.76 ? 2380 GLU B CG    1 
ATOM   7316  C CD    . GLU B 1 349 ? 65.228  32.159  42.887 1.00 25.19 ? 2380 GLU B CD    1 
ATOM   7317  O OE1   . GLU B 1 349 ? 64.283  31.645  42.263 1.00 26.23 ? 2380 GLU B OE1   1 
ATOM   7318  O OE2   . GLU B 1 349 ? 65.061  33.012  43.773 1.00 26.09 ? 2380 GLU B OE2   1 
ATOM   7319  N N     . PHE B 1 350 ? 66.161  28.715  39.005 1.00 23.00 ? 2381 PHE B N     1 
ATOM   7320  C CA    . PHE B 1 350 ? 66.413  27.477  38.289 1.00 21.74 ? 2381 PHE B CA    1 
ATOM   7321  C C     . PHE B 1 350 ? 67.097  27.852  36.989 1.00 21.75 ? 2381 PHE B C     1 
ATOM   7322  O O     . PHE B 1 350 ? 67.964  27.146  36.487 1.00 21.44 ? 2381 PHE B O     1 
ATOM   7323  C CB    . PHE B 1 350 ? 65.094  26.773  37.993 1.00 21.83 ? 2381 PHE B CB    1 
ATOM   7324  C CG    . PHE B 1 350 ? 65.254  25.370  37.471 1.00 20.47 ? 2381 PHE B CG    1 
ATOM   7325  C CD1   . PHE B 1 350 ? 66.297  24.561  37.918 1.00 18.41 ? 2381 PHE B CD1   1 
ATOM   7326  C CD2   . PHE B 1 350 ? 64.346  24.853  36.542 1.00 18.82 ? 2381 PHE B CD2   1 
ATOM   7327  C CE1   . PHE B 1 350 ? 66.431  23.254  37.445 1.00 18.92 ? 2381 PHE B CE1   1 
ATOM   7328  C CE2   . PHE B 1 350 ? 64.469  23.543  36.060 1.00 17.67 ? 2381 PHE B CE2   1 
ATOM   7329  C CZ    . PHE B 1 350 ? 65.511  22.745  36.512 1.00 16.86 ? 2381 PHE B CZ    1 
ATOM   7330  N N     . ASN B 1 351 ? 66.698  28.985  36.436 1.00 22.04 ? 2382 ASN B N     1 
ATOM   7331  C CA    . ASN B 1 351 ? 67.291  29.433  35.192 1.00 23.85 ? 2382 ASN B CA    1 
ATOM   7332  C C     . ASN B 1 351 ? 68.747  29.825  35.422 1.00 23.87 ? 2382 ASN B C     1 
ATOM   7333  O O     . ASN B 1 351 ? 69.628  29.477  34.643 1.00 25.46 ? 2382 ASN B O     1 
ATOM   7334  C CB    . ASN B 1 351 ? 66.524  30.633  34.647 1.00 24.62 ? 2382 ASN B CB    1 
ATOM   7335  C CG    . ASN B 1 351 ? 67.051  31.096  33.299 1.00 26.89 ? 2382 ASN B CG    1 
ATOM   7336  O OD1   . ASN B 1 351 ? 68.027  30.562  32.779 1.00 29.22 ? 2382 ASN B OD1   1 
ATOM   7337  N ND2   . ASN B 1 351 ? 66.400  32.090  32.723 1.00 29.53 ? 2382 ASN B ND2   1 
ATOM   7338  N N     . THR B 1 352 ? 68.990  30.555  36.500 1.00 23.60 ? 2383 THR B N     1 
ATOM   7339  C CA    . THR B 1 352 ? 70.321  31.009  36.847 1.00 23.70 ? 2383 THR B CA    1 
ATOM   7340  C C     . THR B 1 352 ? 71.301  29.859  37.086 1.00 22.11 ? 2383 THR B C     1 
ATOM   7341  O O     . THR B 1 352 ? 72.371  29.801  36.487 1.00 23.57 ? 2383 THR B O     1 
ATOM   7342  C CB    . THR B 1 352 ? 70.270  31.859  38.106 1.00 23.90 ? 2383 THR B CB    1 
ATOM   7343  O OG1   . THR B 1 352 ? 69.539  33.059  37.831 1.00 23.79 ? 2383 THR B OG1   1 
ATOM   7344  C CG2   . THR B 1 352 ? 71.673  32.197  38.575 1.00 24.90 ? 2383 THR B CG2   1 
ATOM   7345  N N     . LEU B 1 353 ? 70.941  28.946  37.972 1.00 20.60 ? 2384 LEU B N     1 
ATOM   7346  C CA    . LEU B 1 353 ? 71.814  27.824  38.273 1.00 20.59 ? 2384 LEU B CA    1 
ATOM   7347  C C     . LEU B 1 353 ? 72.126  26.973  37.041 1.00 20.91 ? 2384 LEU B C     1 
ATOM   7348  O O     . LEU B 1 353 ? 73.187  26.324  36.957 1.00 20.91 ? 2384 LEU B O     1 
ATOM   7349  C CB    . LEU B 1 353 ? 71.189  26.946  39.368 1.00 19.56 ? 2384 LEU B CB    1 
ATOM   7350  C CG    . LEU B 1 353 ? 70.004  26.041  39.043 1.00 19.95 ? 2384 LEU B CG    1 
ATOM   7351  C CD1   . LEU B 1 353 ? 70.489  24.694  38.508 1.00 20.84 ? 2384 LEU B CD1   1 
ATOM   7352  C CD2   . LEU B 1 353 ? 69.191  25.841  40.313 1.00 19.99 ? 2384 LEU B CD2   1 
ATOM   7353  N N     . TYR B 1 354 ? 71.212  26.996  36.080 1.00 21.12 ? 2385 TYR B N     1 
ATOM   7354  C CA    . TYR B 1 354 ? 71.361  26.197  34.878 1.00 20.33 ? 2385 TYR B CA    1 
ATOM   7355  C C     . TYR B 1 354 ? 72.307  26.784  33.841 1.00 22.02 ? 2385 TYR B C     1 
ATOM   7356  O O     . TYR B 1 354 ? 72.469  26.219  32.768 1.00 21.59 ? 2385 TYR B O     1 
ATOM   7357  C CB    . TYR B 1 354 ? 69.987  25.950  34.258 1.00 20.02 ? 2385 TYR B CB    1 
ATOM   7358  C CG    . TYR B 1 354 ? 69.718  24.501  33.920 1.00 18.99 ? 2385 TYR B CG    1 
ATOM   7359  C CD1   . TYR B 1 354 ? 68.739  23.768  34.598 1.00 19.30 ? 2385 TYR B CD1   1 
ATOM   7360  C CD2   . TYR B 1 354 ? 70.411  23.868  32.883 1.00 18.34 ? 2385 TYR B CD2   1 
ATOM   7361  C CE1   . TYR B 1 354 ? 68.450  22.422  34.240 1.00 18.63 ? 2385 TYR B CE1   1 
ATOM   7362  C CE2   . TYR B 1 354 ? 70.136  22.544  32.522 1.00 17.07 ? 2385 TYR B CE2   1 
ATOM   7363  C CZ    . TYR B 1 354 ? 69.160  21.826  33.194 1.00 19.07 ? 2385 TYR B CZ    1 
ATOM   7364  O OH    . TYR B 1 354 ? 68.907  20.518  32.804 1.00 19.11 ? 2385 TYR B OH    1 
ATOM   7365  N N     . HIS B 1 355 ? 72.941  27.909  34.147 1.00 22.47 ? 2386 HIS B N     1 
ATOM   7366  C CA    . HIS B 1 355 ? 73.877  28.505  33.197 1.00 23.33 ? 2386 HIS B CA    1 
ATOM   7367  C C     . HIS B 1 355 ? 75.166  27.693  33.269 1.00 23.39 ? 2386 HIS B C     1 
ATOM   7368  O O     . HIS B 1 355 ? 76.168  28.149  33.801 1.00 23.82 ? 2386 HIS B O     1 
ATOM   7369  C CB    . HIS B 1 355 ? 74.135  29.961  33.567 1.00 24.91 ? 2386 HIS B CB    1 
ATOM   7370  C CG    . HIS B 1 355 ? 72.959  30.854  33.323 1.00 27.05 ? 2386 HIS B CG    1 
ATOM   7371  N ND1   . HIS B 1 355 ? 72.517  31.184  32.063 1.00 29.58 ? 2386 HIS B ND1   1 
ATOM   7372  C CD2   . HIS B 1 355 ? 72.112  31.467  34.185 1.00 28.74 ? 2386 HIS B CD2   1 
ATOM   7373  C CE1   . HIS B 1 355 ? 71.455  31.956  32.150 1.00 29.82 ? 2386 HIS B CE1   1 
ATOM   7374  N NE2   . HIS B 1 355 ? 71.183  32.145  33.427 1.00 30.53 ? 2386 HIS B NE2   1 
ATOM   7375  N N     . TRP B 1 356 ? 75.106  26.480  32.731 1.00 23.57 ? 2387 TRP B N     1 
ATOM   7376  C CA    . TRP B 1 356 ? 76.217  25.528  32.722 1.00 23.95 ? 2387 TRP B CA    1 
ATOM   7377  C C     . TRP B 1 356 ? 77.171  25.673  31.534 1.00 25.65 ? 2387 TRP B C     1 
ATOM   7378  O O     . TRP B 1 356 ? 77.528  24.682  30.886 1.00 26.79 ? 2387 TRP B O     1 
ATOM   7379  C CB    . TRP B 1 356 ? 75.655  24.106  32.706 1.00 20.86 ? 2387 TRP B CB    1 
ATOM   7380  C CG    . TRP B 1 356 ? 74.773  23.768  33.872 1.00 17.81 ? 2387 TRP B CG    1 
ATOM   7381  C CD1   . TRP B 1 356 ? 74.647  24.469  35.032 1.00 15.11 ? 2387 TRP B CD1   1 
ATOM   7382  C CD2   . TRP B 1 356 ? 73.952  22.593  34.013 1.00 16.86 ? 2387 TRP B CD2   1 
ATOM   7383  N NE1   . TRP B 1 356 ? 73.807  23.807  35.890 1.00 17.02 ? 2387 TRP B NE1   1 
ATOM   7384  C CE2   . TRP B 1 356 ? 73.364  22.654  35.296 1.00 16.71 ? 2387 TRP B CE2   1 
ATOM   7385  C CE3   . TRP B 1 356 ? 73.661  21.497  33.183 1.00 16.58 ? 2387 TRP B CE3   1 
ATOM   7386  C CZ2   . TRP B 1 356 ? 72.487  21.652  35.776 1.00 17.36 ? 2387 TRP B CZ2   1 
ATOM   7387  C CZ3   . TRP B 1 356 ? 72.791  20.491  33.660 1.00 17.81 ? 2387 TRP B CZ3   1 
ATOM   7388  C CH2   . TRP B 1 356 ? 72.214  20.582  34.950 1.00 17.26 ? 2387 TRP B CH2   1 
ATOM   7389  N N     . HIS B 1 357 ? 77.600  26.895  31.252 1.00 27.00 ? 2388 HIS B N     1 
ATOM   7390  C CA    . HIS B 1 357 ? 78.488  27.133  30.124 1.00 27.26 ? 2388 HIS B CA    1 
ATOM   7391  C C     . HIS B 1 357 ? 79.862  26.459  30.169 1.00 25.95 ? 2388 HIS B C     1 
ATOM   7392  O O     . HIS B 1 357 ? 80.419  26.119  29.125 1.00 24.89 ? 2388 HIS B O     1 
ATOM   7393  C CB    . HIS B 1 357 ? 78.574  28.636  29.916 1.00 29.66 ? 2388 HIS B CB    1 
ATOM   7394  C CG    . HIS B 1 357 ? 77.222  29.265  29.770 1.00 33.86 ? 2388 HIS B CG    1 
ATOM   7395  N ND1   . HIS B 1 357 ? 76.382  28.970  28.713 1.00 34.67 ? 2388 HIS B ND1   1 
ATOM   7396  C CD2   . HIS B 1 357 ? 76.517  30.078  30.594 1.00 34.65 ? 2388 HIS B CD2   1 
ATOM   7397  C CE1   . HIS B 1 357 ? 75.219  29.568  28.896 1.00 35.87 ? 2388 HIS B CE1   1 
ATOM   7398  N NE2   . HIS B 1 357 ? 75.276  30.249  30.029 1.00 36.94 ? 2388 HIS B NE2   1 
ATOM   7399  N N     . PRO B 1 358 ? 80.423  26.235  31.371 1.00 25.39 ? 2389 PRO B N     1 
ATOM   7400  C CA    . PRO B 1 358 ? 81.731  25.577  31.413 1.00 24.31 ? 2389 PRO B CA    1 
ATOM   7401  C C     . PRO B 1 358 ? 81.673  24.213  30.714 1.00 24.92 ? 2389 PRO B C     1 
ATOM   7402  O O     . PRO B 1 358 ? 82.694  23.565  30.496 1.00 25.46 ? 2389 PRO B O     1 
ATOM   7403  C CB    . PRO B 1 358 ? 82.008  25.426  32.904 1.00 23.57 ? 2389 PRO B CB    1 
ATOM   7404  C CG    . PRO B 1 358 ? 81.187  26.470  33.543 1.00 23.93 ? 2389 PRO B CG    1 
ATOM   7405  C CD    . PRO B 1 358 ? 79.947  26.569  32.722 1.00 24.48 ? 2389 PRO B CD    1 
ATOM   7406  N N     . LEU B 1 359 ? 80.467  23.775  30.374 1.00 24.84 ? 2390 LEU B N     1 
ATOM   7407  C CA    . LEU B 1 359 ? 80.281  22.493  29.712 1.00 23.10 ? 2390 LEU B CA    1 
ATOM   7408  C C     . LEU B 1 359 ? 80.848  22.573  28.300 1.00 23.59 ? 2390 LEU B C     1 
ATOM   7409  O O     . LEU B 1 359 ? 81.332  21.590  27.737 1.00 23.51 ? 2390 LEU B O     1 
ATOM   7410  C CB    . LEU B 1 359 ? 78.791  22.168  29.604 1.00 22.36 ? 2390 LEU B CB    1 
ATOM   7411  C CG    . LEU B 1 359 ? 78.046  21.317  30.629 1.00 20.96 ? 2390 LEU B CG    1 
ATOM   7412  C CD1   . LEU B 1 359 ? 76.592  21.244  30.173 1.00 20.89 ? 2390 LEU B CD1   1 
ATOM   7413  C CD2   . LEU B 1 359 ? 78.647  19.910  30.742 1.00 20.86 ? 2390 LEU B CD2   1 
ATOM   7414  N N     . LEU B 1 360 ? 80.760  23.754  27.716 1.00 23.99 ? 2391 LEU B N     1 
ATOM   7415  C CA    . LEU B 1 360 ? 81.213  23.939  26.357 1.00 26.10 ? 2391 LEU B CA    1 
ATOM   7416  C C     . LEU B 1 360 ? 82.705  23.753  26.139 1.00 28.01 ? 2391 LEU B C     1 
ATOM   7417  O O     . LEU B 1 360 ? 83.528  24.289  26.888 1.00 28.22 ? 2391 LEU B O     1 
ATOM   7418  C CB    . LEU B 1 360 ? 80.789  25.316  25.879 1.00 24.51 ? 2391 LEU B CB    1 
ATOM   7419  C CG    . LEU B 1 360 ? 79.290  25.444  25.594 1.00 24.68 ? 2391 LEU B CG    1 
ATOM   7420  C CD1   . LEU B 1 360 ? 78.998  26.835  25.035 1.00 24.45 ? 2391 LEU B CD1   1 
ATOM   7421  C CD2   . LEU B 1 360 ? 78.862  24.364  24.611 1.00 20.32 ? 2391 LEU B CD2   1 
ATOM   7422  N N     . PRO B 1 361 ? 83.077  23.006  25.085 1.00 29.27 ? 2392 PRO B N     1 
ATOM   7423  C CA    . PRO B 1 361 ? 84.484  22.752  24.766 1.00 31.62 ? 2392 PRO B CA    1 
ATOM   7424  C C     . PRO B 1 361 ? 85.065  23.991  24.107 1.00 33.04 ? 2392 PRO B C     1 
ATOM   7425  O O     . PRO B 1 361 ? 84.343  24.950  23.843 1.00 33.15 ? 2392 PRO B O     1 
ATOM   7426  C CB    . PRO B 1 361 ? 84.419  21.585  23.789 1.00 31.72 ? 2392 PRO B CB    1 
ATOM   7427  C CG    . PRO B 1 361 ? 83.141  21.817  23.058 1.00 30.21 ? 2392 PRO B CG    1 
ATOM   7428  C CD    . PRO B 1 361 ? 82.180  22.384  24.092 1.00 30.33 ? 2392 PRO B CD    1 
ATOM   7429  N N     . ASP B 1 362 ? 86.358  23.974  23.824 1.00 33.56 ? 2393 ASP B N     1 
ATOM   7430  C CA    . ASP B 1 362 ? 86.966  25.128  23.177 1.00 34.67 ? 2393 ASP B CA    1 
ATOM   7431  C C     . ASP B 1 362 ? 86.721  25.088  21.676 1.00 34.36 ? 2393 ASP B C     1 
ATOM   7432  O O     . ASP B 1 362 ? 86.690  26.126  21.012 1.00 33.41 ? 2393 ASP B O     1 
ATOM   7433  C CB    . ASP B 1 362 ? 88.458  25.179  23.496 1.00 37.06 ? 2393 ASP B CB    1 
ATOM   7434  C CG    . ASP B 1 362 ? 88.724  25.523  24.956 1.00 37.65 ? 2393 ASP B CG    1 
ATOM   7435  O OD1   . ASP B 1 362 ? 89.382  24.707  25.644 1.00 38.80 ? 2393 ASP B OD1   1 
ATOM   7436  O OD2   . ASP B 1 362 ? 88.266  26.602  25.410 1.00 36.58 ? 2393 ASP B OD2   1 
ATOM   7437  N N     . THR B 1 363 ? 86.562  23.879  21.149 1.00 33.75 ? 2394 THR B N     1 
ATOM   7438  C CA    . THR B 1 363 ? 86.257  23.681  19.735 1.00 33.70 ? 2394 THR B CA    1 
ATOM   7439  C C     . THR B 1 363 ? 85.327  22.491  19.627 1.00 33.68 ? 2394 THR B C     1 
ATOM   7440  O O     . THR B 1 363 ? 85.244  21.664  20.537 1.00 33.96 ? 2394 THR B O     1 
ATOM   7441  C CB    . THR B 1 363 ? 87.504  23.379  18.893 1.00 33.50 ? 2394 THR B CB    1 
ATOM   7442  O OG1   . THR B 1 363 ? 88.166  22.213  19.402 1.00 33.60 ? 2394 THR B OG1   1 
ATOM   7443  C CG2   . THR B 1 363 ? 88.446  24.544  18.931 1.00 31.36 ? 2394 THR B CG2   1 
ATOM   7444  N N     . PHE B 1 364 ? 84.623  22.396  18.514 1.00 34.56 ? 2395 PHE B N     1 
ATOM   7445  C CA    . PHE B 1 364 ? 83.714  21.289  18.323 1.00 35.33 ? 2395 PHE B CA    1 
ATOM   7446  C C     . PHE B 1 364 ? 84.262  20.408  17.233 1.00 36.20 ? 2395 PHE B C     1 
ATOM   7447  O O     . PHE B 1 364 ? 84.423  20.835  16.099 1.00 37.85 ? 2395 PHE B O     1 
ATOM   7448  C CB    . PHE B 1 364 ? 82.334  21.823  17.976 1.00 33.43 ? 2395 PHE B CB    1 
ATOM   7449  C CG    . PHE B 1 364 ? 81.793  22.746  19.021 1.00 31.68 ? 2395 PHE B CG    1 
ATOM   7450  C CD1   . PHE B 1 364 ? 82.116  24.103  19.003 1.00 30.70 ? 2395 PHE B CD1   1 
ATOM   7451  C CD2   . PHE B 1 364 ? 81.047  22.250  20.074 1.00 30.45 ? 2395 PHE B CD2   1 
ATOM   7452  C CE1   . PHE B 1 364 ? 81.711  24.947  20.024 1.00 29.83 ? 2395 PHE B CE1   1 
ATOM   7453  C CE2   . PHE B 1 364 ? 80.636  23.088  21.104 1.00 31.42 ? 2395 PHE B CE2   1 
ATOM   7454  C CZ    . PHE B 1 364 ? 80.970  24.440  21.079 1.00 30.31 ? 2395 PHE B CZ    1 
ATOM   7455  N N     . ASN B 1 365 ? 84.558  19.169  17.591 1.00 39.08 ? 2396 ASN B N     1 
ATOM   7456  C CA    . ASN B 1 365 ? 85.119  18.232  16.643 1.00 41.23 ? 2396 ASN B CA    1 
ATOM   7457  C C     . ASN B 1 365 ? 84.093  17.287  16.060 1.00 40.81 ? 2396 ASN B C     1 
ATOM   7458  O O     . ASN B 1 365 ? 83.544  16.444  16.764 1.00 41.69 ? 2396 ASN B O     1 
ATOM   7459  C CB    . ASN B 1 365 ? 86.240  17.444  17.317 1.00 42.64 ? 2396 ASN B CB    1 
ATOM   7460  C CG    . ASN B 1 365 ? 87.253  18.357  18.000 1.00 44.45 ? 2396 ASN B CG    1 
ATOM   7461  O OD1   . ASN B 1 365 ? 87.655  19.384  17.441 1.00 45.62 ? 2396 ASN B OD1   1 
ATOM   7462  N ND2   . ASN B 1 365 ? 87.666  17.993  19.212 1.00 45.45 ? 2396 ASN B ND2   1 
ATOM   7463  N N     . ILE B 1 366 ? 83.823  17.457  14.770 1.00 41.98 ? 2397 ILE B N     1 
ATOM   7464  C CA    . ILE B 1 366 ? 82.886  16.604  14.049 1.00 42.43 ? 2397 ILE B CA    1 
ATOM   7465  C C     . ILE B 1 366 ? 83.724  15.914  12.995 1.00 43.78 ? 2397 ILE B C     1 
ATOM   7466  O O     . ILE B 1 366 ? 84.304  16.563  12.126 1.00 42.09 ? 2397 ILE B O     1 
ATOM   7467  C CB    . ILE B 1 366 ? 81.771  17.403  13.352 1.00 40.59 ? 2397 ILE B CB    1 
ATOM   7468  C CG1   . ILE B 1 366 ? 81.101  18.336  14.364 1.00 40.15 ? 2397 ILE B CG1   1 
ATOM   7469  C CG2   . ILE B 1 366 ? 80.785  16.432  12.693 1.00 40.04 ? 2397 ILE B CG2   1 
ATOM   7470  C CD1   . ILE B 1 366 ? 79.617  18.217  14.454 1.00 40.46 ? 2397 ILE B CD1   1 
ATOM   7471  N N     . GLU B 1 367 ? 83.805  14.595  13.095 1.00 46.05 ? 2398 GLU B N     1 
ATOM   7472  C CA    . GLU B 1 367 ? 84.602  13.830  12.164 1.00 48.15 ? 2398 GLU B CA    1 
ATOM   7473  C C     . GLU B 1 367 ? 86.050  14.278  12.299 1.00 49.80 ? 2398 GLU B C     1 
ATOM   7474  O O     . GLU B 1 367 ? 86.633  14.223  13.382 1.00 50.77 ? 2398 GLU B O     1 
ATOM   7475  C CB    . GLU B 1 367 ? 84.113  14.065  10.745 1.00 48.52 ? 2398 GLU B CB    1 
ATOM   7476  C CG    . GLU B 1 367 ? 84.175  12.840  9.888  1.00 51.51 ? 2398 GLU B CG    1 
ATOM   7477  C CD    . GLU B 1 367 ? 82.803  12.394  9.449  1.00 53.19 ? 2398 GLU B CD    1 
ATOM   7478  O OE1   . GLU B 1 367 ? 82.252  13.039  8.524  1.00 53.32 ? 2398 GLU B OE1   1 
ATOM   7479  O OE2   . GLU B 1 367 ? 82.284  11.408  10.028 1.00 55.18 ? 2398 GLU B OE2   1 
ATOM   7480  N N     . ASP B 1 368 ? 86.628  14.736  11.200 1.00 51.59 ? 2399 ASP B N     1 
ATOM   7481  C CA    . ASP B 1 368 ? 88.012  15.177  11.217 1.00 53.15 ? 2399 ASP B CA    1 
ATOM   7482  C C     . ASP B 1 368 ? 88.125  16.666  11.401 1.00 53.01 ? 2399 ASP B C     1 
ATOM   7483  O O     . ASP B 1 368 ? 89.170  17.159  11.812 1.00 54.48 ? 2399 ASP B O     1 
ATOM   7484  C CB    . ASP B 1 368 ? 88.706  14.779  9.920  1.00 54.52 ? 2399 ASP B CB    1 
ATOM   7485  C CG    . ASP B 1 368 ? 88.553  13.303  9.614  1.00 55.92 ? 2399 ASP B CG    1 
ATOM   7486  O OD1   . ASP B 1 368 ? 89.116  12.481  10.380 1.00 55.78 ? 2399 ASP B OD1   1 
ATOM   7487  O OD2   . ASP B 1 368 ? 87.867  12.974  8.615  1.00 55.89 ? 2399 ASP B OD2   1 
ATOM   7488  N N     . GLN B 1 369 ? 87.053  17.383  11.082 1.00 52.94 ? 2400 GLN B N     1 
ATOM   7489  C CA    . GLN B 1 369 ? 87.047  18.833  11.221 1.00 52.20 ? 2400 GLN B CA    1 
ATOM   7490  C C     . GLN B 1 369 ? 86.927  19.228  12.673 1.00 49.61 ? 2400 GLN B C     1 
ATOM   7491  O O     . GLN B 1 369 ? 86.372  18.498  13.492 1.00 50.42 ? 2400 GLN B O     1 
ATOM   7492  C CB    . GLN B 1 369 ? 85.881  19.454  10.456 1.00 52.79 ? 2400 GLN B CB    1 
ATOM   7493  C CG    . GLN B 1 369 ? 85.643  18.848  9.099  1.00 54.58 ? 2400 GLN B CG    1 
ATOM   7494  C CD    . GLN B 1 369 ? 86.816  19.056  8.174  1.00 55.68 ? 2400 GLN B CD    1 
ATOM   7495  O OE1   . GLN B 1 369 ? 86.796  19.937  7.311  1.00 57.17 ? 2400 GLN B OE1   1 
ATOM   7496  N NE2   . GLN B 1 369 ? 87.854  18.242  8.348  1.00 57.37 ? 2400 GLN B NE2   1 
ATOM   7497  N N     . GLU B 1 370 ? 87.457  20.398  12.976 1.00 47.66 ? 2401 GLU B N     1 
ATOM   7498  C CA    . GLU B 1 370 ? 87.416  20.943  14.313 1.00 46.06 ? 2401 GLU B CA    1 
ATOM   7499  C C     . GLU B 1 370 ? 86.963  22.376  14.083 1.00 43.90 ? 2401 GLU B C     1 
ATOM   7500  O O     . GLU B 1 370 ? 87.619  23.129  13.364 1.00 44.20 ? 2401 GLU B O     1 
ATOM   7501  C CB    . GLU B 1 370 ? 88.808  20.890  14.932 1.00 46.10 ? 2401 GLU B CB    1 
ATOM   7502  C CG    . GLU B 1 370 ? 89.013  21.831  16.089 1.00 49.36 ? 2401 GLU B CG    1 
ATOM   7503  C CD    . GLU B 1 370 ? 90.443  21.809  16.598 1.00 50.88 ? 2401 GLU B CD    1 
ATOM   7504  O OE1   . GLU B 1 370 ? 90.940  20.707  16.963 1.00 51.22 ? 2401 GLU B OE1   1 
ATOM   7505  O OE2   . GLU B 1 370 ? 91.060  22.903  16.624 1.00 51.83 ? 2401 GLU B OE2   1 
ATOM   7506  N N     . TYR B 1 371 ? 85.833  22.745  14.674 1.00 41.43 ? 2402 TYR B N     1 
ATOM   7507  C CA    . TYR B 1 371 ? 85.299  24.082  14.484 1.00 37.20 ? 2402 TYR B CA    1 
ATOM   7508  C C     . TYR B 1 371 ? 85.346  24.977  15.708 1.00 36.55 ? 2402 TYR B C     1 
ATOM   7509  O O     . TYR B 1 371 ? 85.194  24.529  16.847 1.00 35.47 ? 2402 TYR B O     1 
ATOM   7510  C CB    . TYR B 1 371 ? 83.856  24.001  13.989 1.00 36.67 ? 2402 TYR B CB    1 
ATOM   7511  C CG    . TYR B 1 371 ? 83.640  23.087  12.805 1.00 34.35 ? 2402 TYR B CG    1 
ATOM   7512  C CD1   . TYR B 1 371 ? 83.636  23.591  11.510 1.00 33.07 ? 2402 TYR B CD1   1 
ATOM   7513  C CD2   . TYR B 1 371 ? 83.369  21.728  12.987 1.00 33.02 ? 2402 TYR B CD2   1 
ATOM   7514  C CE1   . TYR B 1 371 ? 83.359  22.771  10.418 1.00 32.46 ? 2402 TYR B CE1   1 
ATOM   7515  C CE2   . TYR B 1 371 ? 83.091  20.897  11.906 1.00 32.42 ? 2402 TYR B CE2   1 
ATOM   7516  C CZ    . TYR B 1 371 ? 83.084  21.425  10.622 1.00 33.03 ? 2402 TYR B CZ    1 
ATOM   7517  O OH    . TYR B 1 371 ? 82.782  20.612  9.551  1.00 32.09 ? 2402 TYR B OH    1 
ATOM   7518  N N     . SER B 1 372 ? 85.549  26.261  15.447 1.00 35.26 ? 2403 SER B N     1 
ATOM   7519  C CA    . SER B 1 372 ? 85.603  27.260  16.492 1.00 34.68 ? 2403 SER B CA    1 
ATOM   7520  C C     . SER B 1 372 ? 84.170  27.639  16.778 1.00 36.01 ? 2403 SER B C     1 
ATOM   7521  O O     . SER B 1 372 ? 83.261  27.258  16.037 1.00 36.39 ? 2403 SER B O     1 
ATOM   7522  C CB    . SER B 1 372 ? 86.350  28.489  16.000 1.00 33.51 ? 2403 SER B CB    1 
ATOM   7523  O OG    . SER B 1 372 ? 85.656  29.076  14.918 1.00 31.57 ? 2403 SER B OG    1 
ATOM   7524  N N     . PHE B 1 373 ? 83.961  28.383  17.852 1.00 37.80 ? 2404 PHE B N     1 
ATOM   7525  C CA    . PHE B 1 373 ? 82.622  28.822  18.200 1.00 39.74 ? 2404 PHE B CA    1 
ATOM   7526  C C     . PHE B 1 373 ? 82.035  29.608  17.048 1.00 41.81 ? 2404 PHE B C     1 
ATOM   7527  O O     . PHE B 1 373 ? 80.852  29.489  16.736 1.00 42.31 ? 2404 PHE B O     1 
ATOM   7528  C CB    . PHE B 1 373 ? 82.671  29.725  19.416 1.00 38.37 ? 2404 PHE B CB    1 
ATOM   7529  C CG    . PHE B 1 373 ? 82.489  29.005  20.693 1.00 37.16 ? 2404 PHE B CG    1 
ATOM   7530  C CD1   . PHE B 1 373 ? 83.447  28.100  21.133 1.00 36.44 ? 2404 PHE B CD1   1 
ATOM   7531  C CD2   . PHE B 1 373 ? 81.358  29.218  21.464 1.00 37.61 ? 2404 PHE B CD2   1 
ATOM   7532  C CE1   . PHE B 1 373 ? 83.283  27.408  22.340 1.00 38.20 ? 2404 PHE B CE1   1 
ATOM   7533  C CE2   . PHE B 1 373 ? 81.177  28.534  22.676 1.00 38.98 ? 2404 PHE B CE2   1 
ATOM   7534  C CZ    . PHE B 1 373 ? 82.144  27.627  23.112 1.00 38.47 ? 2404 PHE B CZ    1 
ATOM   7535  N N     . LYS B 1 374 ? 82.886  30.410  16.419 1.00 45.08 ? 2405 LYS B N     1 
ATOM   7536  C CA    . LYS B 1 374 ? 82.468  31.256  15.315 1.00 47.83 ? 2405 LYS B CA    1 
ATOM   7537  C C     . LYS B 1 374 ? 81.914  30.503  14.117 1.00 48.94 ? 2405 LYS B C     1 
ATOM   7538  O O     . LYS B 1 374 ? 80.873  30.886  13.586 1.00 49.29 ? 2405 LYS B O     1 
ATOM   7539  C CB    . LYS B 1 374 ? 83.625  32.159  14.867 1.00 51.11 ? 2405 LYS B CB    1 
ATOM   7540  C CG    . LYS B 1 374 ? 83.209  33.261  13.892 1.00 54.05 ? 2405 LYS B CG    1 
ATOM   7541  C CD    . LYS B 1 374 ? 84.313  33.560  12.867 1.00 56.59 ? 2405 LYS B CD    1 
ATOM   7542  C CE    . LYS B 1 374 ? 84.162  34.959  12.261 1.00 57.71 ? 2405 LYS B CE    1 
ATOM   7543  N NZ    . LYS B 1 374 ? 85.474  35.658  12.110 1.00 57.93 ? 2405 LYS B NZ    1 
ATOM   7544  N N     . GLN B 1 375 ? 82.582  29.436  13.688 1.00 48.79 ? 2406 GLN B N     1 
ATOM   7545  C CA    . GLN B 1 375 ? 82.082  28.687  12.537 1.00 49.06 ? 2406 GLN B CA    1 
ATOM   7546  C C     . GLN B 1 375 ? 81.117  27.571  12.941 1.00 48.81 ? 2406 GLN B C     1 
ATOM   7547  O O     . GLN B 1 375 ? 80.746  26.735  12.117 1.00 50.19 ? 2406 GLN B O     1 
ATOM   7548  C CB    . GLN B 1 375 ? 83.240  28.086  11.719 1.00 49.58 ? 2406 GLN B CB    1 
ATOM   7549  C CG    . GLN B 1 375 ? 84.653  28.386  12.228 1.00 52.04 ? 2406 GLN B CG    1 
ATOM   7550  C CD    . GLN B 1 375 ? 85.601  27.198  12.068 1.00 52.84 ? 2406 GLN B CD    1 
ATOM   7551  O OE1   . GLN B 1 375 ? 86.289  26.814  13.011 1.00 54.63 ? 2406 GLN B OE1   1 
ATOM   7552  N NE2   . GLN B 1 375 ? 85.636  26.614  10.872 1.00 53.26 ? 2406 GLN B NE2   1 
ATOM   7553  N N     . PHE B 1 376 ? 80.688  27.568  14.197 1.00 47.56 ? 2407 PHE B N     1 
ATOM   7554  C CA    . PHE B 1 376 ? 79.796  26.519  14.667 1.00 46.05 ? 2407 PHE B CA    1 
ATOM   7555  C C     . PHE B 1 376 ? 78.526  27.069  15.270 1.00 47.07 ? 2407 PHE B C     1 
ATOM   7556  O O     . PHE B 1 376 ? 77.884  26.418  16.092 1.00 46.63 ? 2407 PHE B O     1 
ATOM   7557  C CB    . PHE B 1 376 ? 80.511  25.655  15.699 1.00 42.83 ? 2407 PHE B CB    1 
ATOM   7558  C CG    . PHE B 1 376 ? 79.943  24.273  15.834 1.00 39.17 ? 2407 PHE B CG    1 
ATOM   7559  C CD1   . PHE B 1 376 ? 80.170  23.315  14.857 1.00 37.90 ? 2407 PHE B CD1   1 
ATOM   7560  C CD2   . PHE B 1 376 ? 79.234  23.908  16.970 1.00 37.88 ? 2407 PHE B CD2   1 
ATOM   7561  C CE1   . PHE B 1 376 ? 79.711  22.015  15.015 1.00 36.65 ? 2407 PHE B CE1   1 
ATOM   7562  C CE2   . PHE B 1 376 ? 78.771  22.608  17.135 1.00 36.13 ? 2407 PHE B CE2   1 
ATOM   7563  C CZ    . PHE B 1 376 ? 79.010  21.664  16.157 1.00 36.27 ? 2407 PHE B CZ    1 
ATOM   7564  N N     . LEU B 1 377 ? 78.178  28.284  14.876 1.00 48.89 ? 2408 LEU B N     1 
ATOM   7565  C CA    . LEU B 1 377 ? 76.960  28.912  15.361 1.00 49.77 ? 2408 LEU B CA    1 
ATOM   7566  C C     . LEU B 1 377 ? 76.443  29.721  14.198 1.00 51.04 ? 2408 LEU B C     1 
ATOM   7567  O O     . LEU B 1 377 ? 77.129  30.618  13.704 1.00 50.09 ? 2408 LEU B O     1 
ATOM   7568  C CB    . LEU B 1 377 ? 77.250  29.813  16.558 1.00 50.27 ? 2408 LEU B CB    1 
ATOM   7569  C CG    . LEU B 1 377 ? 77.971  29.096  17.697 1.00 50.49 ? 2408 LEU B CG    1 
ATOM   7570  C CD1   . LEU B 1 377 ? 78.519  30.110  18.679 1.00 50.79 ? 2408 LEU B CD1   1 
ATOM   7571  C CD2   . LEU B 1 377 ? 77.010  28.149  18.384 1.00 51.25 ? 2408 LEU B CD2   1 
ATOM   7572  N N     . TYR B 1 378 ? 75.238  29.371  13.758 1.00 53.99 ? 2409 TYR B N     1 
ATOM   7573  C CA    . TYR B 1 378 ? 74.577  30.021  12.629 1.00 55.98 ? 2409 TYR B CA    1 
ATOM   7574  C C     . TYR B 1 378 ? 74.859  29.230  11.339 1.00 55.60 ? 2409 TYR B C     1 
ATOM   7575  O O     . TYR B 1 378 ? 74.306  29.538  10.284 1.00 55.42 ? 2409 TYR B O     1 
ATOM   7576  C CB    . TYR B 1 378 ? 75.064  31.478  12.472 1.00 58.93 ? 2409 TYR B CB    1 
ATOM   7577  C CG    . TYR B 1 378 ? 74.086  32.581  12.878 1.00 62.13 ? 2409 TYR B CG    1 
ATOM   7578  C CD1   . TYR B 1 378 ? 74.538  33.901  13.031 1.00 63.47 ? 2409 TYR B CD1   1 
ATOM   7579  C CD2   . TYR B 1 378 ? 72.712  32.324  13.057 1.00 62.59 ? 2409 TYR B CD2   1 
ATOM   7580  C CE1   . TYR B 1 378 ? 73.659  34.946  13.346 1.00 64.68 ? 2409 TYR B CE1   1 
ATOM   7581  C CE2   . TYR B 1 378 ? 71.817  33.365  13.375 1.00 65.10 ? 2409 TYR B CE2   1 
ATOM   7582  C CZ    . TYR B 1 378 ? 72.300  34.681  13.515 1.00 65.90 ? 2409 TYR B CZ    1 
ATOM   7583  O OH    . TYR B 1 378 ? 71.441  35.736  13.807 1.00 66.39 ? 2409 TYR B OH    1 
ATOM   7584  N N     . ASN B 1 379 ? 75.703  28.206  11.419 1.00 55.43 ? 2410 ASN B N     1 
ATOM   7585  C CA    . ASN B 1 379 ? 76.008  27.417  10.232 1.00 55.57 ? 2410 ASN B CA    1 
ATOM   7586  C C     . ASN B 1 379 ? 75.370  26.036  10.149 1.00 54.06 ? 2410 ASN B C     1 
ATOM   7587  O O     . ASN B 1 379 ? 75.985  25.042  10.543 1.00 53.49 ? 2410 ASN B O     1 
ATOM   7588  C CB    . ASN B 1 379 ? 77.499  27.256  10.084 1.00 58.06 ? 2410 ASN B CB    1 
ATOM   7589  C CG    . ASN B 1 379 ? 77.892  26.964  8.677  1.00 60.68 ? 2410 ASN B CG    1 
ATOM   7590  O OD1   . ASN B 1 379 ? 77.133  26.418  7.881  1.00 63.29 ? 2410 ASN B OD1   1 
ATOM   7591  N ND2   . ASN B 1 379 ? 79.107  27.341  8.363  1.00 64.70 ? 2410 ASN B ND2   1 
ATOM   7592  N N     . ASN B 1 380 ? 74.158  25.974  9.597  1.00 51.94 ? 2411 ASN B N     1 
ATOM   7593  C CA    . ASN B 1 380 ? 73.433  24.708  9.470  1.00 49.95 ? 2411 ASN B CA    1 
ATOM   7594  C C     . ASN B 1 380 ? 74.078  23.748  8.482  1.00 48.95 ? 2411 ASN B C     1 
ATOM   7595  O O     . ASN B 1 380 ? 73.810  22.547  8.535  1.00 49.20 ? 2411 ASN B O     1 
ATOM   7596  C CB    . ASN B 1 380 ? 71.971  24.914  9.006  1.00 49.98 ? 2411 ASN B CB    1 
ATOM   7597  C CG    . ASN B 1 380 ? 71.333  26.185  9.544  1.00 50.03 ? 2411 ASN B CG    1 
ATOM   7598  O OD1   . ASN B 1 380 ? 71.135  27.158  8.810  1.00 47.04 ? 2411 ASN B OD1   1 
ATOM   7599  N ND2   . ASN B 1 380 ? 70.987  26.173  10.820 1.00 49.45 ? 2411 ASN B ND2   1 
ATOM   7600  N N     . SER B 1 381 ? 74.912  24.266  7.579  1.00 46.12 ? 2412 SER B N     1 
ATOM   7601  C CA    . SER B 1 381 ? 75.532  23.411  6.567  1.00 43.37 ? 2412 SER B CA    1 
ATOM   7602  C C     . SER B 1 381 ? 76.411  22.319  7.135  1.00 41.89 ? 2412 SER B C     1 
ATOM   7603  O O     . SER B 1 381 ? 76.559  21.262  6.529  1.00 42.83 ? 2412 SER B O     1 
ATOM   7604  C CB    . SER B 1 381 ? 76.353  24.226  5.556  1.00 44.18 ? 2412 SER B CB    1 
ATOM   7605  O OG    . SER B 1 381 ? 76.371  25.607  5.855  1.00 44.13 ? 2412 SER B OG    1 
ATOM   7606  N N     . ILE B 1 382 ? 77.003  22.572  8.292  1.00 39.34 ? 2413 ILE B N     1 
ATOM   7607  C CA    . ILE B 1 382 ? 77.856  21.580  8.918  1.00 37.39 ? 2413 ILE B CA    1 
ATOM   7608  C C     . ILE B 1 382 ? 77.039  20.321  9.189  1.00 35.95 ? 2413 ILE B C     1 
ATOM   7609  O O     . ILE B 1 382 ? 77.518  19.200  8.977  1.00 35.44 ? 2413 ILE B O     1 
ATOM   7610  C CB    . ILE B 1 382 ? 78.453  22.121  10.243 1.00 36.35 ? 2413 ILE B CB    1 
ATOM   7611  C CG1   . ILE B 1 382 ? 79.291  23.372  9.951  1.00 34.36 ? 2413 ILE B CG1   1 
ATOM   7612  C CG2   . ILE B 1 382 ? 79.321  21.051  10.911 1.00 36.38 ? 2413 ILE B CG2   1 
ATOM   7613  C CD1   . ILE B 1 382 ? 79.678  24.149  11.176 1.00 33.09 ? 2413 ILE B CD1   1 
ATOM   7614  N N     . LEU B 1 383 ? 75.798  20.512  9.636  1.00 35.07 ? 2414 LEU B N     1 
ATOM   7615  C CA    . LEU B 1 383 ? 74.920  19.384  9.934  1.00 35.19 ? 2414 LEU B CA    1 
ATOM   7616  C C     . LEU B 1 383 ? 74.581  18.609  8.670  1.00 35.74 ? 2414 LEU B C     1 
ATOM   7617  O O     . LEU B 1 383 ? 74.659  17.375  8.647  1.00 35.77 ? 2414 LEU B O     1 
ATOM   7618  C CB    . LEU B 1 383 ? 73.628  19.860  10.625 1.00 34.29 ? 2414 LEU B CB    1 
ATOM   7619  C CG    . LEU B 1 383 ? 72.576  18.779  10.953 1.00 33.94 ? 2414 LEU B CG    1 
ATOM   7620  C CD1   . LEU B 1 383 ? 73.137  17.779  11.940 1.00 35.06 ? 2414 LEU B CD1   1 
ATOM   7621  C CD2   . LEU B 1 383 ? 71.333  19.406  11.535 1.00 31.97 ? 2414 LEU B CD2   1 
ATOM   7622  N N     . LEU B 1 384 ? 74.209  19.330  7.617  1.00 36.87 ? 2415 LEU B N     1 
ATOM   7623  C CA    . LEU B 1 384 ? 73.872  18.685  6.351  1.00 39.46 ? 2415 LEU B CA    1 
ATOM   7624  C C     . LEU B 1 384 ? 75.121  18.066  5.733  1.00 39.32 ? 2415 LEU B C     1 
ATOM   7625  O O     . LEU B 1 384 ? 75.058  17.032  5.058  1.00 39.82 ? 2415 LEU B O     1 
ATOM   7626  C CB    . LEU B 1 384 ? 73.263  19.696  5.377  1.00 40.27 ? 2415 LEU B CB    1 
ATOM   7627  C CG    . LEU B 1 384 ? 71.781  20.006  5.581  1.00 41.68 ? 2415 LEU B CG    1 
ATOM   7628  C CD1   . LEU B 1 384 ? 71.306  20.948  4.503  1.00 44.11 ? 2415 LEU B CD1   1 
ATOM   7629  C CD2   . LEU B 1 384 ? 70.991  18.747  5.514  1.00 42.81 ? 2415 LEU B CD2   1 
ATOM   7630  N N     . GLU B 1 385 ? 76.257  18.705  5.984  1.00 39.58 ? 2416 GLU B N     1 
ATOM   7631  C CA    . GLU B 1 385 ? 77.532  18.245  5.468  1.00 39.80 ? 2416 GLU B CA    1 
ATOM   7632  C C     . GLU B 1 385 ? 77.948  16.911  6.067  1.00 38.48 ? 2416 GLU B C     1 
ATOM   7633  O O     . GLU B 1 385 ? 78.331  15.996  5.338  1.00 39.39 ? 2416 GLU B O     1 
ATOM   7634  C CB    . GLU B 1 385 ? 78.607  19.282  5.752  1.00 41.78 ? 2416 GLU B CB    1 
ATOM   7635  C CG    . GLU B 1 385 ? 79.379  19.686  4.529  1.00 48.17 ? 2416 GLU B CG    1 
ATOM   7636  C CD    . GLU B 1 385 ? 80.852  19.358  4.651  1.00 51.12 ? 2416 GLU B CD    1 
ATOM   7637  O OE1   . GLU B 1 385 ? 81.400  19.519  5.766  1.00 53.37 ? 2416 GLU B OE1   1 
ATOM   7638  O OE2   . GLU B 1 385 ? 81.457  18.939  3.636  1.00 54.01 ? 2416 GLU B OE2   1 
ATOM   7639  N N     . HIS B 1 386 ? 77.867  16.796  7.390  1.00 36.24 ? 2417 HIS B N     1 
ATOM   7640  C CA    . HIS B 1 386 ? 78.262  15.568  8.060  1.00 33.02 ? 2417 HIS B CA    1 
ATOM   7641  C C     . HIS B 1 386 ? 77.133  14.586  8.217  1.00 32.26 ? 2417 HIS B C     1 
ATOM   7642  O O     . HIS B 1 386 ? 77.343  13.384  8.119  1.00 30.48 ? 2417 HIS B O     1 
ATOM   7643  C CB    . HIS B 1 386 ? 78.868  15.884  9.425  1.00 33.78 ? 2417 HIS B CB    1 
ATOM   7644  C CG    . HIS B 1 386 ? 80.243  16.466  9.344  1.00 31.78 ? 2417 HIS B CG    1 
ATOM   7645  N ND1   . HIS B 1 386 ? 80.473  17.828  9.328  1.00 31.15 ? 2417 HIS B ND1   1 
ATOM   7646  C CD2   . HIS B 1 386 ? 81.457  15.881  9.229  1.00 30.49 ? 2417 HIS B CD2   1 
ATOM   7647  C CE1   . HIS B 1 386 ? 81.771  18.053  9.212  1.00 29.88 ? 2417 HIS B CE1   1 
ATOM   7648  N NE2   . HIS B 1 386 ? 82.386  16.889  9.149  1.00 30.91 ? 2417 HIS B NE2   1 
ATOM   7649  N N     . GLY B 1 387 ? 75.932  15.099  8.461  1.00 31.47 ? 2418 GLY B N     1 
ATOM   7650  C CA    . GLY B 1 387 ? 74.785  14.233  8.633  1.00 30.43 ? 2418 GLY B CA    1 
ATOM   7651  C C     . GLY B 1 387 ? 74.595  13.942  10.102 1.00 30.61 ? 2418 GLY B C     1 
ATOM   7652  O O     . GLY B 1 387 ? 75.535  14.071  10.890 1.00 29.89 ? 2418 GLY B O     1 
ATOM   7653  N N     . LEU B 1 388 ? 73.378  13.541  10.465 1.00 31.60 ? 2419 LEU B N     1 
ATOM   7654  C CA    . LEU B 1 388 ? 73.022  13.239  11.845 1.00 30.97 ? 2419 LEU B CA    1 
ATOM   7655  C C     . LEU B 1 388 ? 73.849  12.101  12.427 1.00 30.99 ? 2419 LEU B C     1 
ATOM   7656  O O     . LEU B 1 388 ? 74.235  12.147  13.604 1.00 32.58 ? 2419 LEU B O     1 
ATOM   7657  C CB    . LEU B 1 388 ? 71.533  12.884  11.935 1.00 30.74 ? 2419 LEU B CB    1 
ATOM   7658  C CG    . LEU B 1 388 ? 70.456  13.986  11.940 1.00 30.75 ? 2419 LEU B CG    1 
ATOM   7659  C CD1   . LEU B 1 388 ? 70.140  14.362  13.368 1.00 30.51 ? 2419 LEU B CD1   1 
ATOM   7660  C CD2   . LEU B 1 388 ? 70.903  15.205  11.173 1.00 30.54 ? 2419 LEU B CD2   1 
ATOM   7661  N N     . THR B 1 389 ? 74.121  11.079  11.619 1.00 30.96 ? 2420 THR B N     1 
ATOM   7662  C CA    . THR B 1 389 ? 74.900  9.940   12.100 1.00 31.41 ? 2420 THR B CA    1 
ATOM   7663  C C     . THR B 1 389 ? 76.289  10.342  12.582 1.00 31.50 ? 2420 THR B C     1 
ATOM   7664  O O     . THR B 1 389 ? 76.710  9.968   13.678 1.00 31.65 ? 2420 THR B O     1 
ATOM   7665  C CB    . THR B 1 389 ? 75.063  8.881   11.017 1.00 31.09 ? 2420 THR B CB    1 
ATOM   7666  O OG1   . THR B 1 389 ? 73.779  8.532   10.483 1.00 29.28 ? 2420 THR B OG1   1 
ATOM   7667  C CG2   . THR B 1 389 ? 75.709  7.653   11.602 1.00 29.70 ? 2420 THR B CG2   1 
ATOM   7668  N N     . GLN B 1 390 ? 76.993  11.104  11.755 1.00 32.59 ? 2421 GLN B N     1 
ATOM   7669  C CA    . GLN B 1 390 ? 78.323  11.565  12.097 1.00 33.55 ? 2421 GLN B CA    1 
ATOM   7670  C C     . GLN B 1 390 ? 78.243  12.510  13.280 1.00 32.28 ? 2421 GLN B C     1 
ATOM   7671  O O     . GLN B 1 390 ? 79.064  12.454  14.190 1.00 33.96 ? 2421 GLN B O     1 
ATOM   7672  C CB    . GLN B 1 390 ? 78.961  12.256  10.900 1.00 36.16 ? 2421 GLN B CB    1 
ATOM   7673  C CG    . GLN B 1 390 ? 79.543  11.263  9.910  1.00 44.40 ? 2421 GLN B CG    1 
ATOM   7674  C CD    . GLN B 1 390 ? 79.876  11.887  8.555  1.00 49.58 ? 2421 GLN B CD    1 
ATOM   7675  O OE1   . GLN B 1 390 ? 79.778  13.105  8.377  1.00 53.41 ? 2421 GLN B OE1   1 
ATOM   7676  N NE2   . GLN B 1 390 ? 80.275  11.048  7.592  1.00 50.90 ? 2421 GLN B NE2   1 
ATOM   7677  N N     . PHE B 1 391 ? 77.246  13.380  13.284 1.00 29.86 ? 2422 PHE B N     1 
ATOM   7678  C CA    . PHE B 1 391 ? 77.089  14.298  14.394 1.00 25.90 ? 2422 PHE B CA    1 
ATOM   7679  C C     . PHE B 1 391 ? 76.948  13.547  15.712 1.00 25.53 ? 2422 PHE B C     1 
ATOM   7680  O O     . PHE B 1 391 ? 77.551  13.929  16.713 1.00 26.98 ? 2422 PHE B O     1 
ATOM   7681  C CB    . PHE B 1 391 ? 75.872  15.172  14.179 1.00 24.29 ? 2422 PHE B CB    1 
ATOM   7682  C CG    . PHE B 1 391 ? 76.213  16.567  13.811 1.00 23.26 ? 2422 PHE B CG    1 
ATOM   7683  C CD1   . PHE B 1 391 ? 76.791  16.848  12.574 1.00 23.08 ? 2422 PHE B CD1   1 
ATOM   7684  C CD2   . PHE B 1 391 ? 75.973  17.604  14.697 1.00 22.59 ? 2422 PHE B CD2   1 
ATOM   7685  C CE1   . PHE B 1 391 ? 77.132  18.162  12.213 1.00 23.61 ? 2422 PHE B CE1   1 
ATOM   7686  C CE2   . PHE B 1 391 ? 76.304  18.925  14.358 1.00 24.74 ? 2422 PHE B CE2   1 
ATOM   7687  C CZ    . PHE B 1 391 ? 76.887  19.209  13.109 1.00 24.37 ? 2422 PHE B CZ    1 
ATOM   7688  N N     . VAL B 1 392 ? 76.155  12.475  15.711 1.00 24.56 ? 2423 VAL B N     1 
ATOM   7689  C CA    . VAL B 1 392 ? 75.929  11.664  16.912 1.00 24.40 ? 2423 VAL B CA    1 
ATOM   7690  C C     . VAL B 1 392 ? 77.192  10.937  17.367 1.00 24.90 ? 2423 VAL B C     1 
ATOM   7691  O O     . VAL B 1 392 ? 77.534  10.920  18.562 1.00 25.15 ? 2423 VAL B O     1 
ATOM   7692  C CB    . VAL B 1 392 ? 74.825  10.593  16.668 1.00 23.88 ? 2423 VAL B CB    1 
ATOM   7693  C CG1   . VAL B 1 392 ? 74.728  9.653   17.866 1.00 22.33 ? 2423 VAL B CG1   1 
ATOM   7694  C CG2   . VAL B 1 392 ? 73.482  11.271  16.405 1.00 22.16 ? 2423 VAL B CG2   1 
ATOM   7695  N N     . GLU B 1 393 ? 77.870  10.309  16.408 1.00 25.62 ? 2424 GLU B N     1 
ATOM   7696  C CA    . GLU B 1 393 ? 79.086  9.570   16.701 1.00 26.80 ? 2424 GLU B CA    1 
ATOM   7697  C C     . GLU B 1 393 ? 80.116  10.513  17.275 1.00 27.33 ? 2424 GLU B C     1 
ATOM   7698  O O     . GLU B 1 393 ? 80.780  10.191  18.259 1.00 28.36 ? 2424 GLU B O     1 
ATOM   7699  C CB    . GLU B 1 393 ? 79.618  8.904   15.436 1.00 27.64 ? 2424 GLU B CB    1 
ATOM   7700  C CG    . GLU B 1 393 ? 78.697  7.842   14.880 1.00 31.88 ? 2424 GLU B CG    1 
ATOM   7701  C CD    . GLU B 1 393 ? 79.139  7.332   13.517 1.00 35.49 ? 2424 GLU B CD    1 
ATOM   7702  O OE1   . GLU B 1 393 ? 79.756  8.101   12.741 1.00 34.72 ? 2424 GLU B OE1   1 
ATOM   7703  O OE2   . GLU B 1 393 ? 78.859  6.149   13.220 1.00 38.56 ? 2424 GLU B OE2   1 
ATOM   7704  N N     . SER B 1 394 ? 80.220  11.695  16.679 1.00 27.17 ? 2425 SER B N     1 
ATOM   7705  C CA    . SER B 1 394 ? 81.166  12.706  17.133 1.00 27.22 ? 2425 SER B CA    1 
ATOM   7706  C C     . SER B 1 394 ? 80.811  13.313  18.501 1.00 27.98 ? 2425 SER B C     1 
ATOM   7707  O O     . SER B 1 394 ? 81.665  13.455  19.380 1.00 27.55 ? 2425 SER B O     1 
ATOM   7708  C CB    . SER B 1 394 ? 81.257  13.830  16.101 1.00 27.00 ? 2425 SER B CB    1 
ATOM   7709  O OG    . SER B 1 394 ? 81.525  13.318  14.813 1.00 27.78 ? 2425 SER B OG    1 
ATOM   7710  N N     . PHE B 1 395 ? 79.551  13.691  18.673 1.00 28.41 ? 2426 PHE B N     1 
ATOM   7711  C CA    . PHE B 1 395 ? 79.112  14.284  19.927 1.00 28.09 ? 2426 PHE B CA    1 
ATOM   7712  C C     . PHE B 1 395 ? 79.151  13.283  21.055 1.00 27.74 ? 2426 PHE B C     1 
ATOM   7713  O O     . PHE B 1 395 ? 79.281  13.646  22.216 1.00 28.59 ? 2426 PHE B O     1 
ATOM   7714  C CB    . PHE B 1 395 ? 77.696  14.829  19.783 1.00 29.74 ? 2426 PHE B CB    1 
ATOM   7715  C CG    . PHE B 1 395 ? 77.639  16.207  19.194 1.00 30.62 ? 2426 PHE B CG    1 
ATOM   7716  C CD1   . PHE B 1 395 ? 78.806  16.857  18.795 1.00 31.21 ? 2426 PHE B CD1   1 
ATOM   7717  C CD2   . PHE B 1 395 ? 76.422  16.859  19.048 1.00 30.82 ? 2426 PHE B CD2   1 
ATOM   7718  C CE1   . PHE B 1 395 ? 78.761  18.137  18.259 1.00 31.35 ? 2426 PHE B CE1   1 
ATOM   7719  C CE2   . PHE B 1 395 ? 76.361  18.140  18.511 1.00 30.79 ? 2426 PHE B CE2   1 
ATOM   7720  C CZ    . PHE B 1 395 ? 77.536  18.783  18.114 1.00 31.57 ? 2426 PHE B CZ    1 
ATOM   7721  N N     . THR B 1 396 ? 79.019  12.013  20.722 1.00 27.72 ? 2427 THR B N     1 
ATOM   7722  C CA    . THR B 1 396 ? 79.071  10.996  21.753 1.00 28.80 ? 2427 THR B CA    1 
ATOM   7723  C C     . THR B 1 396 ? 80.509  10.846  22.266 1.00 29.91 ? 2427 THR B C     1 
ATOM   7724  O O     . THR B 1 396 ? 80.734  10.558  23.450 1.00 29.99 ? 2427 THR B O     1 
ATOM   7725  C CB    . THR B 1 396 ? 78.590  9.651   21.208 1.00 28.12 ? 2427 THR B CB    1 
ATOM   7726  O OG1   . THR B 1 396 ? 77.239  9.785   20.765 1.00 28.80 ? 2427 THR B OG1   1 
ATOM   7727  C CG2   . THR B 1 396 ? 78.652  8.585   22.274 1.00 27.51 ? 2427 THR B CG2   1 
ATOM   7728  N N     . ARG B 1 397 ? 81.470  11.052  21.373 1.00 31.59 ? 2428 ARG B N     1 
ATOM   7729  C CA    . ARG B 1 397 ? 82.901  10.938  21.696 1.00 31.83 ? 2428 ARG B CA    1 
ATOM   7730  C C     . ARG B 1 397 ? 83.487  12.152  22.415 1.00 30.89 ? 2428 ARG B C     1 
ATOM   7731  O O     . ARG B 1 397 ? 84.324  12.000  23.300 1.00 31.94 ? 2428 ARG B O     1 
ATOM   7732  C CB    . ARG B 1 397 ? 83.741  10.737  20.433 1.00 34.74 ? 2428 ARG B CB    1 
ATOM   7733  C CG    . ARG B 1 397 ? 83.375  9.572   19.542 1.00 38.79 ? 2428 ARG B CG    1 
ATOM   7734  C CD    . ARG B 1 397 ? 84.429  9.424   18.428 1.00 42.49 ? 2428 ARG B CD    1 
ATOM   7735  N NE    . ARG B 1 397 ? 83.936  9.850   17.118 1.00 46.60 ? 2428 ARG B NE    1 
ATOM   7736  C CZ    . ARG B 1 397 ? 83.556  9.012   16.154 1.00 48.86 ? 2428 ARG B CZ    1 
ATOM   7737  N NH1   . ARG B 1 397 ? 83.608  7.694   16.349 1.00 50.98 ? 2428 ARG B NH1   1 
ATOM   7738  N NH2   . ARG B 1 397 ? 83.118  9.489   14.996 1.00 49.02 ? 2428 ARG B NH2   1 
ATOM   7739  N N     . GLN B 1 398 ? 83.077  13.354  22.026 1.00 28.99 ? 2429 GLN B N     1 
ATOM   7740  C CA    . GLN B 1 398 ? 83.625  14.540  22.647 1.00 25.89 ? 2429 GLN B CA    1 
ATOM   7741  C C     . GLN B 1 398 ? 83.156  14.810  24.068 1.00 26.29 ? 2429 GLN B C     1 
ATOM   7742  O O     . GLN B 1 398 ? 81.953  14.912  24.328 1.00 27.22 ? 2429 GLN B O     1 
ATOM   7743  C CB    . GLN B 1 398 ? 83.335  15.756  21.790 1.00 26.30 ? 2429 GLN B CB    1 
ATOM   7744  C CG    . GLN B 1 398 ? 84.045  16.986  22.302 1.00 25.82 ? 2429 GLN B CG    1 
ATOM   7745  C CD    . GLN B 1 398 ? 84.158  18.075  21.262 1.00 27.84 ? 2429 GLN B CD    1 
ATOM   7746  O OE1   . GLN B 1 398 ? 84.882  19.056  21.454 1.00 29.83 ? 2429 GLN B OE1   1 
ATOM   7747  N NE2   . GLN B 1 398 ? 83.436  17.915  20.155 1.00 26.32 ? 2429 GLN B NE2   1 
ATOM   7748  N N     . ILE B 1 399 ? 84.125  14.949  24.978 1.00 27.02 ? 2430 ILE B N     1 
ATOM   7749  C CA    . ILE B 1 399 ? 83.859  15.216  26.391 1.00 25.82 ? 2430 ILE B CA    1 
ATOM   7750  C C     . ILE B 1 399 ? 83.523  16.677  26.629 1.00 26.43 ? 2430 ILE B C     1 
ATOM   7751  O O     . ILE B 1 399 ? 83.974  17.555  25.906 1.00 27.85 ? 2430 ILE B O     1 
ATOM   7752  C CB    . ILE B 1 399 ? 85.074  14.833  27.297 1.00 26.07 ? 2430 ILE B CB    1 
ATOM   7753  C CG1   . ILE B 1 399 ? 84.681  14.960  28.768 1.00 24.67 ? 2430 ILE B CG1   1 
ATOM   7754  C CG2   . ILE B 1 399 ? 86.277  15.732  26.999 1.00 24.49 ? 2430 ILE B CG2   1 
ATOM   7755  C CD1   . ILE B 1 399 ? 85.089  13.783  29.599 1.00 25.15 ? 2430 ILE B CD1   1 
ATOM   7756  N N     . ALA B 1 400 ? 82.723  16.926  27.659 1.00 27.65 ? 2431 ALA B N     1 
ATOM   7757  C CA    . ALA B 1 400 ? 82.305  18.277  28.023 1.00 26.67 ? 2431 ALA B CA    1 
ATOM   7758  C C     . ALA B 1 400 ? 83.146  18.753  29.205 1.00 26.31 ? 2431 ALA B C     1 
ATOM   7759  O O     . ALA B 1 400 ? 83.768  17.944  29.902 1.00 25.59 ? 2431 ALA B O     1 
ATOM   7760  C CB    . ALA B 1 400 ? 80.834  18.273  28.407 1.00 27.25 ? 2431 ALA B CB    1 
ATOM   7761  N N     . GLY B 1 401 ? 83.161  20.060  29.435 1.00 25.26 ? 2432 GLY B N     1 
ATOM   7762  C CA    . GLY B 1 401 ? 83.942  20.594  30.532 1.00 24.96 ? 2432 GLY B CA    1 
ATOM   7763  C C     . GLY B 1 401 ? 83.219  20.466  31.856 1.00 26.09 ? 2432 GLY B C     1 
ATOM   7764  O O     . GLY B 1 401 ? 81.993  20.310  31.892 1.00 25.59 ? 2432 GLY B O     1 
ATOM   7765  N N     . ARG B 1 402 ? 83.984  20.492  32.947 1.00 26.20 ? 2433 ARG B N     1 
ATOM   7766  C CA    . ARG B 1 402 ? 83.406  20.425  34.288 1.00 25.21 ? 2433 ARG B CA    1 
ATOM   7767  C C     . ARG B 1 402 ? 82.807  21.780  34.586 1.00 25.69 ? 2433 ARG B C     1 
ATOM   7768  O O     . ARG B 1 402 ? 83.285  22.828  34.150 1.00 26.68 ? 2433 ARG B O     1 
ATOM   7769  C CB    . ARG B 1 402 ? 84.488  20.086  35.309 1.00 25.66 ? 2433 ARG B CB    1 
ATOM   7770  C CG    . ARG B 1 402 ? 83.993  19.931  36.728 1.00 26.14 ? 2433 ARG B CG    1 
ATOM   7771  C CD    . ARG B 1 402 ? 85.173  19.754  37.639 1.00 28.39 ? 2433 ARG B CD    1 
ATOM   7772  N NE    . ARG B 1 402 ? 84.970  18.635  38.542 1.00 31.52 ? 2433 ARG B NE    1 
ATOM   7773  C CZ    . ARG B 1 402 ? 85.888  18.198  39.414 1.00 30.20 ? 2433 ARG B CZ    1 
ATOM   7774  N NH1   . ARG B 1 402 ? 87.072  18.798  39.457 1.00 29.00 ? 2433 ARG B NH1   1 
ATOM   7775  N NH2   . ARG B 1 402 ? 85.602  17.174  40.228 1.00 28.43 ? 2433 ARG B NH2   1 
ATOM   7776  N N     . VAL B 1 403 ? 81.707  21.751  35.367 1.00 24.98 ? 2434 VAL B N     1 
ATOM   7777  C CA    . VAL B 1 403 ? 80.976  22.933  35.714 1.00 23.99 ? 2434 VAL B CA    1 
ATOM   7778  C C     . VAL B 1 403 ? 81.418  23.517  37.029 1.00 23.58 ? 2434 VAL B C     1 
ATOM   7779  O O     . VAL B 1 403 ? 81.861  24.660  37.062 1.00 23.58 ? 2434 VAL B O     1 
ATOM   7780  C CB    . VAL B 1 403 ? 79.450  22.699  35.697 1.00 23.37 ? 2434 VAL B CB    1 
ATOM   7781  C CG1   . VAL B 1 403 ? 78.692  24.038  35.925 1.00 21.38 ? 2434 VAL B CG1   1 
ATOM   7782  C CG2   . VAL B 1 403 ? 79.074  22.151  34.331 1.00 21.14 ? 2434 VAL B CG2   1 
ATOM   7783  N N     . ALA B 1 404 ? 81.277  22.746  38.113 1.00 23.96 ? 2435 ALA B N     1 
ATOM   7784  C CA    . ALA B 1 404 ? 81.772  23.195  39.415 1.00 25.02 ? 2435 ALA B CA    1 
ATOM   7785  C C     . ALA B 1 404 ? 83.273  23.243  39.204 1.00 25.99 ? 2435 ALA B C     1 
ATOM   7786  O O     . ALA B 1 404 ? 83.748  23.125  38.079 1.00 28.33 ? 2435 ALA B O     1 
ATOM   7787  C CB    . ALA B 1 404 ? 81.453  22.177  40.447 1.00 23.82 ? 2435 ALA B CB    1 
ATOM   7788  N N     . GLY B 1 405 ? 84.044  23.406  40.271 1.00 26.75 ? 2436 GLY B N     1 
ATOM   7789  C CA    . GLY B 1 405 ? 85.483  23.452  40.091 1.00 27.92 ? 2436 GLY B CA    1 
ATOM   7790  C C     . GLY B 1 405 ? 86.155  24.798  39.986 1.00 27.85 ? 2436 GLY B C     1 
ATOM   7791  O O     . GLY B 1 405 ? 87.168  25.024  40.621 1.00 27.64 ? 2436 GLY B O     1 
ATOM   7792  N N     . GLY B 1 406 ? 85.621  25.696  39.154 1.00 27.85 ? 2437 GLY B N     1 
ATOM   7793  C CA    . GLY B 1 406 ? 86.210  27.003  39.024 1.00 26.87 ? 2437 GLY B CA    1 
ATOM   7794  C C     . GLY B 1 406 ? 86.973  27.178  37.722 1.00 27.10 ? 2437 GLY B C     1 
ATOM   7795  O O     . GLY B 1 406 ? 87.448  26.213  37.120 1.00 26.75 ? 2437 GLY B O     1 
ATOM   7796  N N     . ARG B 1 407 ? 87.083  28.423  37.286 1.00 27.04 ? 2438 ARG B N     1 
ATOM   7797  C CA    . ARG B 1 407 ? 87.790  28.743  36.053 1.00 27.20 ? 2438 ARG B CA    1 
ATOM   7798  C C     . ARG B 1 407 ? 87.641  27.721  34.921 1.00 26.57 ? 2438 ARG B C     1 
ATOM   7799  O O     . ARG B 1 407 ? 88.620  27.063  34.558 1.00 26.60 ? 2438 ARG B O     1 
ATOM   7800  C CB    . ARG B 1 407 ? 89.274  28.937  36.359 1.00 28.12 ? 2438 ARG B CB    1 
ATOM   7801  C CG    . ARG B 1 407 ? 89.550  29.746  37.613 1.00 28.53 ? 2438 ARG B CG    1 
ATOM   7802  C CD    . ARG B 1 407 ? 91.020  29.855  37.865 1.00 28.06 ? 2438 ARG B CD    1 
ATOM   7803  N NE    . ARG B 1 407 ? 91.311  30.924  38.801 1.00 30.04 ? 2438 ARG B NE    1 
ATOM   7804  C CZ    . ARG B 1 407 ? 92.396  30.962  39.557 1.00 30.47 ? 2438 ARG B CZ    1 
ATOM   7805  N NH1   . ARG B 1 407 ? 93.287  29.987  39.473 1.00 30.92 ? 2438 ARG B NH1   1 
ATOM   7806  N NH2   . ARG B 1 407 ? 92.581  31.960  40.409 1.00 30.97 ? 2438 ARG B NH2   1 
ATOM   7807  N N     . ASN B 1 408 ? 86.434  27.584  34.362 1.00 25.94 ? 2439 ASN B N     1 
ATOM   7808  C CA    . ASN B 1 408 ? 86.229  26.659  33.249 1.00 24.93 ? 2439 ASN B CA    1 
ATOM   7809  C C     . ASN B 1 408 ? 85.214  27.199  32.253 1.00 25.40 ? 2439 ASN B C     1 
ATOM   7810  O O     . ASN B 1 408 ? 84.697  26.465  31.406 1.00 26.41 ? 2439 ASN B O     1 
ATOM   7811  C CB    . ASN B 1 408 ? 85.805  25.272  33.729 1.00 23.55 ? 2439 ASN B CB    1 
ATOM   7812  C CG    . ASN B 1 408 ? 86.209  24.183  32.753 1.00 22.88 ? 2439 ASN B CG    1 
ATOM   7813  O OD1   . ASN B 1 408 ? 87.070  24.387  31.901 1.00 23.00 ? 2439 ASN B OD1   1 
ATOM   7814  N ND2   . ASN B 1 408 ? 85.589  23.028  32.866 1.00 23.89 ? 2439 ASN B ND2   1 
ATOM   7815  N N     . VAL B 1 409 ? 84.936  28.492  32.348 1.00 25.85 ? 2440 VAL B N     1 
ATOM   7816  C CA    . VAL B 1 409 ? 84.005  29.134  31.427 1.00 27.31 ? 2440 VAL B CA    1 
ATOM   7817  C C     . VAL B 1 409 ? 84.792  29.595  30.187 1.00 27.26 ? 2440 VAL B C     1 
ATOM   7818  O O     . VAL B 1 409 ? 85.666  30.466  30.276 1.00 26.72 ? 2440 VAL B O     1 
ATOM   7819  C CB    . VAL B 1 409 ? 83.335  30.379  32.065 1.00 26.46 ? 2440 VAL B CB    1 
ATOM   7820  C CG1   . VAL B 1 409 ? 82.473  31.079  31.040 1.00 26.46 ? 2440 VAL B CG1   1 
ATOM   7821  C CG2   . VAL B 1 409 ? 82.514  29.985  33.274 1.00 26.18 ? 2440 VAL B CG2   1 
ATOM   7822  N N     . PRO B 1 410 ? 84.479  29.023  29.012 1.00 28.56 ? 2441 PRO B N     1 
ATOM   7823  C CA    . PRO B 1 410 ? 85.170  29.393  27.771 1.00 28.84 ? 2441 PRO B CA    1 
ATOM   7824  C C     . PRO B 1 410 ? 85.130  30.903  27.557 1.00 29.47 ? 2441 PRO B C     1 
ATOM   7825  O O     . PRO B 1 410 ? 84.068  31.513  27.620 1.00 30.51 ? 2441 PRO B O     1 
ATOM   7826  C CB    . PRO B 1 410 ? 84.393  28.656  26.683 1.00 28.60 ? 2441 PRO B CB    1 
ATOM   7827  C CG    . PRO B 1 410 ? 83.660  27.566  27.378 1.00 27.57 ? 2441 PRO B CG    1 
ATOM   7828  C CD    . PRO B 1 410 ? 83.431  28.009  28.793 1.00 28.45 ? 2441 PRO B CD    1 
ATOM   7829  N N     . ILE B 1 411 ? 86.284  31.506  27.304 1.00 29.74 ? 2442 ILE B N     1 
ATOM   7830  C CA    . ILE B 1 411 ? 86.352  32.941  27.070 1.00 30.61 ? 2442 ILE B CA    1 
ATOM   7831  C C     . ILE B 1 411 ? 85.398  33.362  25.944 1.00 29.21 ? 2442 ILE B C     1 
ATOM   7832  O O     . ILE B 1 411 ? 84.853  34.465  25.948 1.00 29.27 ? 2442 ILE B O     1 
ATOM   7833  C CB    . ILE B 1 411 ? 87.798  33.369  26.687 1.00 31.66 ? 2442 ILE B CB    1 
ATOM   7834  C CG1   . ILE B 1 411 ? 88.629  33.610  27.941 1.00 33.43 ? 2442 ILE B CG1   1 
ATOM   7835  C CG2   . ILE B 1 411 ? 87.774  34.657  25.903 1.00 33.38 ? 2442 ILE B CG2   1 
ATOM   7836  C CD1   . ILE B 1 411 ? 88.687  32.407  28.861 1.00 36.14 ? 2442 ILE B CD1   1 
ATOM   7837  N N     . ALA B 1 412 ? 85.205  32.477  24.974 1.00 29.27 ? 2443 ALA B N     1 
ATOM   7838  C CA    . ALA B 1 412 ? 84.334  32.766  23.835 1.00 29.09 ? 2443 ALA B CA    1 
ATOM   7839  C C     . ALA B 1 412 ? 82.905  33.080  24.258 1.00 29.48 ? 2443 ALA B C     1 
ATOM   7840  O O     . ALA B 1 412 ? 82.131  33.653  23.492 1.00 29.64 ? 2443 ALA B O     1 
ATOM   7841  C CB    . ALA B 1 412 ? 84.330  31.587  22.876 1.00 27.84 ? 2443 ALA B CB    1 
ATOM   7842  N N     . VAL B 1 413 ? 82.559  32.729  25.489 1.00 29.34 ? 2444 VAL B N     1 
ATOM   7843  C CA    . VAL B 1 413 ? 81.208  32.949  25.966 1.00 29.49 ? 2444 VAL B CA    1 
ATOM   7844  C C     . VAL B 1 413 ? 81.176  33.724  27.284 1.00 28.45 ? 2444 VAL B C     1 
ATOM   7845  O O     . VAL B 1 413 ? 80.211  33.688  28.037 1.00 27.86 ? 2444 VAL B O     1 
ATOM   7846  C CB    . VAL B 1 413 ? 80.505  31.564  26.076 1.00 29.98 ? 2444 VAL B CB    1 
ATOM   7847  C CG1   . VAL B 1 413 ? 80.582  31.013  27.496 1.00 29.39 ? 2444 VAL B CG1   1 
ATOM   7848  C CG2   . VAL B 1 413 ? 79.097  31.669  25.572 1.00 30.72 ? 2444 VAL B CG2   1 
ATOM   7849  N N     . GLN B 1 414 ? 82.233  34.469  27.539 1.00 28.86 ? 2445 GLN B N     1 
ATOM   7850  C CA    . GLN B 1 414 ? 82.340  35.221  28.774 1.00 28.81 ? 2445 GLN B CA    1 
ATOM   7851  C C     . GLN B 1 414 ? 81.270  36.284  28.997 1.00 28.83 ? 2445 GLN B C     1 
ATOM   7852  O O     . GLN B 1 414 ? 80.890  36.553  30.141 1.00 29.26 ? 2445 GLN B O     1 
ATOM   7853  C CB    . GLN B 1 414 ? 83.730  35.854  28.866 1.00 29.05 ? 2445 GLN B CB    1 
ATOM   7854  C CG    . GLN B 1 414 ? 84.018  36.869  27.797 1.00 28.74 ? 2445 GLN B CG    1 
ATOM   7855  C CD    . GLN B 1 414 ? 85.324  37.601  28.036 1.00 31.00 ? 2445 GLN B CD    1 
ATOM   7856  O OE1   . GLN B 1 414 ? 85.806  37.690  29.172 1.00 31.36 ? 2445 GLN B OE1   1 
ATOM   7857  N NE2   . GLN B 1 414 ? 85.908  38.133  26.965 1.00 32.47 ? 2445 GLN B NE2   1 
ATOM   7858  N N     . ALA B 1 415 ? 80.785  36.904  27.929 1.00 27.68 ? 2446 ALA B N     1 
ATOM   7859  C CA    . ALA B 1 415 ? 79.758  37.930  28.091 1.00 27.46 ? 2446 ALA B CA    1 
ATOM   7860  C C     . ALA B 1 415 ? 78.502  37.289  28.677 1.00 27.86 ? 2446 ALA B C     1 
ATOM   7861  O O     . ALA B 1 415 ? 77.762  37.908  29.447 1.00 27.22 ? 2446 ALA B O     1 
ATOM   7862  C CB    . ALA B 1 415 ? 79.437  38.588  26.747 1.00 27.37 ? 2446 ALA B CB    1 
ATOM   7863  N N     . VAL B 1 416 ? 78.265  36.037  28.310 1.00 27.20 ? 2447 VAL B N     1 
ATOM   7864  C CA    . VAL B 1 416 ? 77.109  35.328  28.821 1.00 27.65 ? 2447 VAL B CA    1 
ATOM   7865  C C     . VAL B 1 416 ? 77.302  35.097  30.308 1.00 27.93 ? 2447 VAL B C     1 
ATOM   7866  O O     . VAL B 1 416 ? 76.367  35.250  31.084 1.00 29.55 ? 2447 VAL B O     1 
ATOM   7867  C CB    . VAL B 1 416 ? 76.930  33.979  28.130 1.00 27.35 ? 2447 VAL B CB    1 
ATOM   7868  C CG1   . VAL B 1 416 ? 75.930  33.124  28.890 1.00 26.32 ? 2447 VAL B CG1   1 
ATOM   7869  C CG2   . VAL B 1 416 ? 76.478  34.202  26.712 1.00 27.68 ? 2447 VAL B CG2   1 
ATOM   7870  N N     . ALA B 1 417 ? 78.512  34.737  30.717 1.00 26.63 ? 2448 ALA B N     1 
ATOM   7871  C CA    . ALA B 1 417 ? 78.764  34.503  32.130 1.00 26.00 ? 2448 ALA B CA    1 
ATOM   7872  C C     . ALA B 1 417 ? 78.688  35.805  32.935 1.00 26.28 ? 2448 ALA B C     1 
ATOM   7873  O O     . ALA B 1 417 ? 78.286  35.794  34.098 1.00 26.67 ? 2448 ALA B O     1 
ATOM   7874  C CB    . ALA B 1 417 ? 80.115  33.854  32.310 1.00 26.13 ? 2448 ALA B CB    1 
ATOM   7875  N N     . LYS B 1 418 ? 79.070  36.924  32.323 1.00 26.12 ? 2449 LYS B N     1 
ATOM   7876  C CA    . LYS B 1 418 ? 79.026  38.214  33.015 1.00 26.05 ? 2449 LYS B CA    1 
ATOM   7877  C C     . LYS B 1 418 ? 77.581  38.649  33.197 1.00 27.35 ? 2449 LYS B C     1 
ATOM   7878  O O     . LYS B 1 418 ? 77.222  39.246  34.212 1.00 28.30 ? 2449 LYS B O     1 
ATOM   7879  C CB    . LYS B 1 418 ? 79.767  39.287  32.221 1.00 26.08 ? 2449 LYS B CB    1 
ATOM   7880  C CG    . LYS B 1 418 ? 80.405  40.349  33.099 1.00 24.93 ? 2449 LYS B CG    1 
ATOM   7881  C CD    . LYS B 1 418 ? 80.707  41.610  32.321 1.00 24.04 ? 2449 LYS B CD    1 
ATOM   7882  C CE    . LYS B 1 418 ? 80.585  42.826  33.226 1.00 24.87 ? 2449 LYS B CE    1 
ATOM   7883  N NZ    . LYS B 1 418 ? 79.836  43.929  32.556 1.00 25.94 ? 2449 LYS B NZ    1 
ATOM   7884  N N     . ALA B 1 419 ? 76.760  38.358  32.192 1.00 27.42 ? 2450 ALA B N     1 
ATOM   7885  C CA    . ALA B 1 419 ? 75.338  38.691  32.220 1.00 26.69 ? 2450 ALA B CA    1 
ATOM   7886  C C     . ALA B 1 419 ? 74.653  37.952  33.363 1.00 27.21 ? 2450 ALA B C     1 
ATOM   7887  O O     . ALA B 1 419 ? 73.831  38.522  34.074 1.00 26.46 ? 2450 ALA B O     1 
ATOM   7888  C CB    . ALA B 1 419 ? 74.686  38.323  30.899 1.00 26.24 ? 2450 ALA B CB    1 
ATOM   7889  N N     . SER B 1 420 ? 74.989  36.680  33.545 1.00 26.01 ? 2451 SER B N     1 
ATOM   7890  C CA    . SER B 1 420 ? 74.388  35.927  34.626 1.00 26.45 ? 2451 SER B CA    1 
ATOM   7891  C C     . SER B 1 420 ? 74.644  36.661  35.928 1.00 27.34 ? 2451 SER B C     1 
ATOM   7892  O O     . SER B 1 420 ? 73.769  36.751  36.782 1.00 27.34 ? 2451 SER B O     1 
ATOM   7893  C CB    . SER B 1 420 ? 74.999  34.543  34.728 1.00 26.21 ? 2451 SER B CB    1 
ATOM   7894  O OG    . SER B 1 420 ? 74.843  33.840  33.515 1.00 30.61 ? 2451 SER B OG    1 
ATOM   7895  N N     . ILE B 1 421 ? 75.855  37.177  36.084 1.00 26.69 ? 2452 ILE B N     1 
ATOM   7896  C CA    . ILE B 1 421 ? 76.208  37.888  37.304 1.00 27.16 ? 2452 ILE B CA    1 
ATOM   7897  C C     . ILE B 1 421 ? 75.440  39.186  37.384 1.00 26.55 ? 2452 ILE B C     1 
ATOM   7898  O O     . ILE B 1 421 ? 74.750  39.461  38.367 1.00 25.32 ? 2452 ILE B O     1 
ATOM   7899  C CB    . ILE B 1 421 ? 77.705  38.220  37.359 1.00 26.86 ? 2452 ILE B CB    1 
ATOM   7900  C CG1   . ILE B 1 421 ? 78.534  36.937  37.254 1.00 27.36 ? 2452 ILE B CG1   1 
ATOM   7901  C CG2   . ILE B 1 421 ? 78.019  38.948  38.662 1.00 26.04 ? 2452 ILE B CG2   1 
ATOM   7902  C CD1   . ILE B 1 421 ? 80.040  37.163  37.458 1.00 29.31 ? 2452 ILE B CD1   1 
ATOM   7903  N N     . ASP B 1 422 ? 75.565  39.975  36.328 1.00 26.92 ? 2453 ASP B N     1 
ATOM   7904  C CA    . ASP B 1 422 ? 74.910  41.260  36.245 1.00 27.36 ? 2453 ASP B CA    1 
ATOM   7905  C C     . ASP B 1 422 ? 73.398  41.165  36.394 1.00 28.15 ? 2453 ASP B C     1 
ATOM   7906  O O     . ASP B 1 422 ? 72.787  41.912  37.165 1.00 28.73 ? 2453 ASP B O     1 
ATOM   7907  C CB    . ASP B 1 422 ? 75.276  41.916  34.921 1.00 27.09 ? 2453 ASP B CB    1 
ATOM   7908  C CG    . ASP B 1 422 ? 76.742  42.266  34.846 1.00 27.52 ? 2453 ASP B CG    1 
ATOM   7909  O OD1   . ASP B 1 422 ? 77.407  42.233  35.900 1.00 27.85 ? 2453 ASP B OD1   1 
ATOM   7910  O OD2   . ASP B 1 422 ? 77.235  42.571  33.744 1.00 27.08 ? 2453 ASP B OD2   1 
ATOM   7911  N N     . GLN B 1 423 ? 72.791  40.241  35.666 1.00 29.12 ? 2454 GLN B N     1 
ATOM   7912  C CA    . GLN B 1 423 ? 71.350  40.076  35.729 1.00 28.35 ? 2454 GLN B CA    1 
ATOM   7913  C C     . GLN B 1 423 ? 70.836  39.603  37.076 1.00 27.44 ? 2454 GLN B C     1 
ATOM   7914  O O     . GLN B 1 423 ? 69.774  40.035  37.505 1.00 26.80 ? 2454 GLN B O     1 
ATOM   7915  C CB    . GLN B 1 423 ? 70.899  39.134  34.631 1.00 30.05 ? 2454 GLN B CB    1 
ATOM   7916  C CG    . GLN B 1 423 ? 70.773  39.863  33.321 1.00 30.46 ? 2454 GLN B CG    1 
ATOM   7917  C CD    . GLN B 1 423 ? 70.651  38.928  32.144 1.00 32.24 ? 2454 GLN B CD    1 
ATOM   7918  O OE1   . GLN B 1 423 ? 70.444  39.377  31.019 1.00 35.16 ? 2454 GLN B OE1   1 
ATOM   7919  N NE2   . GLN B 1 423 ? 70.778  37.621  32.386 1.00 30.77 ? 2454 GLN B NE2   1 
ATOM   7920  N N     . SER B 1 424 ? 71.571  38.712  37.738 1.00 26.73 ? 2455 SER B N     1 
ATOM   7921  C CA    . SER B 1 424 ? 71.167  38.226  39.061 1.00 26.79 ? 2455 SER B CA    1 
ATOM   7922  C C     . SER B 1 424 ? 71.115  39.408  40.008 1.00 27.29 ? 2455 SER B C     1 
ATOM   7923  O O     . SER B 1 424 ? 70.245  39.488  40.874 1.00 27.36 ? 2455 SER B O     1 
ATOM   7924  C CB    . SER B 1 424 ? 72.177  37.227  39.605 1.00 26.95 ? 2455 SER B CB    1 
ATOM   7925  O OG    . SER B 1 424 ? 72.404  36.187  38.672 1.00 31.65 ? 2455 SER B OG    1 
ATOM   7926  N N     . ARG B 1 425 ? 72.069  40.319  39.842 1.00 27.00 ? 2456 ARG B N     1 
ATOM   7927  C CA    . ARG B 1 425 ? 72.142  41.506  40.673 1.00 27.54 ? 2456 ARG B CA    1 
ATOM   7928  C C     . ARG B 1 425 ? 70.949  42.396  40.373 1.00 27.88 ? 2456 ARG B C     1 
ATOM   7929  O O     . ARG B 1 425 ? 70.349  42.973  41.274 1.00 28.43 ? 2456 ARG B O     1 
ATOM   7930  C CB    . ARG B 1 425 ? 73.448  42.257  40.397 1.00 28.79 ? 2456 ARG B CB    1 
ATOM   7931  C CG    . ARG B 1 425 ? 74.695  41.457  40.793 1.00 29.78 ? 2456 ARG B CG    1 
ATOM   7932  C CD    . ARG B 1 425 ? 75.946  42.302  40.726 1.00 29.28 ? 2456 ARG B CD    1 
ATOM   7933  N NE    . ARG B 1 425 ? 77.053  41.660  41.421 1.00 30.64 ? 2456 ARG B NE    1 
ATOM   7934  C CZ    . ARG B 1 425 ? 78.325  41.780  41.054 1.00 30.59 ? 2456 ARG B CZ    1 
ATOM   7935  N NH1   . ARG B 1 425 ? 78.646  42.516  40.008 1.00 29.95 ? 2456 ARG B NH1   1 
ATOM   7936  N NH2   . ARG B 1 425 ? 79.278  41.144  41.714 1.00 33.09 ? 2456 ARG B NH2   1 
ATOM   7937  N N     . GLU B 1 426 ? 70.612  42.499  39.096 1.00 28.45 ? 2457 GLU B N     1 
ATOM   7938  C CA    . GLU B 1 426 ? 69.479  43.301  38.646 1.00 29.20 ? 2457 GLU B CA    1 
ATOM   7939  C C     . GLU B 1 426 ? 68.207  42.841  39.342 1.00 27.94 ? 2457 GLU B C     1 
ATOM   7940  O O     . GLU B 1 426 ? 67.465  43.646  39.894 1.00 28.03 ? 2457 GLU B O     1 
ATOM   7941  C CB    . GLU B 1 426 ? 69.273  43.119  37.156 1.00 30.68 ? 2457 GLU B CB    1 
ATOM   7942  C CG    . GLU B 1 426 ? 70.113  43.982  36.284 1.00 33.94 ? 2457 GLU B CG    1 
ATOM   7943  C CD    . GLU B 1 426 ? 69.621  43.927  34.859 1.00 37.87 ? 2457 GLU B CD    1 
ATOM   7944  O OE1   . GLU B 1 426 ? 68.386  44.098  34.663 1.00 35.30 ? 2457 GLU B OE1   1 
ATOM   7945  O OE2   . GLU B 1 426 ? 70.465  43.702  33.951 1.00 40.41 ? 2457 GLU B OE2   1 
ATOM   7946  N N     . MET B 1 427 ? 67.968  41.535  39.296 1.00 27.10 ? 2458 MET B N     1 
ATOM   7947  C CA    . MET B 1 427 ? 66.790  40.929  39.905 1.00 26.14 ? 2458 MET B CA    1 
ATOM   7948  C C     . MET B 1 427 ? 66.921  40.827  41.414 1.00 26.03 ? 2458 MET B C     1 
ATOM   7949  O O     . MET B 1 427 ? 66.185  40.084  42.063 1.00 26.31 ? 2458 MET B O     1 
ATOM   7950  C CB    . MET B 1 427 ? 66.556  39.546  39.306 1.00 24.86 ? 2458 MET B CB    1 
ATOM   7951  C CG    . MET B 1 427 ? 66.554  39.574  37.806 1.00 21.74 ? 2458 MET B CG    1 
ATOM   7952  S SD    . MET B 1 427 ? 66.176  37.971  37.176 1.00 25.02 ? 2458 MET B SD    1 
ATOM   7953  C CE    . MET B 1 427 ? 67.835  37.217  37.173 1.00 20.82 ? 2458 MET B CE    1 
ATOM   7954  N N     . LYS B 1 428 ? 67.879  41.571  41.957 1.00 26.89 ? 2459 LYS B N     1 
ATOM   7955  C CA    . LYS B 1 428 ? 68.136  41.629  43.393 1.00 27.30 ? 2459 LYS B CA    1 
ATOM   7956  C C     . LYS B 1 428 ? 68.081  40.297  44.138 1.00 27.10 ? 2459 LYS B C     1 
ATOM   7957  O O     . LYS B 1 428 ? 67.355  40.122  45.127 1.00 27.20 ? 2459 LYS B O     1 
ATOM   7958  C CB    . LYS B 1 428 ? 67.188  42.651  44.027 1.00 29.19 ? 2459 LYS B CB    1 
ATOM   7959  C CG    . LYS B 1 428 ? 67.237  44.004  43.307 1.00 31.09 ? 2459 LYS B CG    1 
ATOM   7960  C CD    . LYS B 1 428 ? 67.611  45.178  44.215 1.00 34.99 ? 2459 LYS B CD    1 
ATOM   7961  C CE    . LYS B 1 428 ? 68.598  44.796  45.308 1.00 36.48 ? 2459 LYS B CE    1 
ATOM   7962  N NZ    . LYS B 1 428 ? 68.436  45.730  46.466 1.00 39.22 ? 2459 LYS B NZ    1 
ATOM   7963  N N     . TYR B 1 429 ? 68.886  39.360  43.654 1.00 26.26 ? 2460 TYR B N     1 
ATOM   7964  C CA    . TYR B 1 429 ? 68.989  38.034  44.237 1.00 25.28 ? 2460 TYR B CA    1 
ATOM   7965  C C     . TYR B 1 429 ? 69.616  38.116  45.617 1.00 25.32 ? 2460 TYR B C     1 
ATOM   7966  O O     . TYR B 1 429 ? 70.459  38.970  45.871 1.00 25.74 ? 2460 TYR B O     1 
ATOM   7967  C CB    . TYR B 1 429 ? 69.887  37.166  43.365 1.00 23.10 ? 2460 TYR B CB    1 
ATOM   7968  C CG    . TYR B 1 429 ? 69.177  36.314  42.344 1.00 23.16 ? 2460 TYR B CG    1 
ATOM   7969  C CD1   . TYR B 1 429 ? 68.111  36.813  41.588 1.00 22.41 ? 2460 TYR B CD1   1 
ATOM   7970  C CD2   . TYR B 1 429 ? 69.612  35.023  42.092 1.00 21.48 ? 2460 TYR B CD2   1 
ATOM   7971  C CE1   . TYR B 1 429 ? 67.509  36.031  40.596 1.00 23.09 ? 2460 TYR B CE1   1 
ATOM   7972  C CE2   . TYR B 1 429 ? 69.021  34.242  41.112 1.00 22.88 ? 2460 TYR B CE2   1 
ATOM   7973  C CZ    . TYR B 1 429 ? 67.979  34.744  40.366 1.00 22.29 ? 2460 TYR B CZ    1 
ATOM   7974  O OH    . TYR B 1 429 ? 67.430  33.944  39.380 1.00 23.39 ? 2460 TYR B OH    1 
ATOM   7975  N N     . GLN B 1 430 ? 69.221  37.219  46.509 1.00 25.90 ? 2461 GLN B N     1 
ATOM   7976  C CA    . GLN B 1 430 ? 69.808  37.205  47.835 1.00 26.05 ? 2461 GLN B CA    1 
ATOM   7977  C C     . GLN B 1 430 ? 71.123  36.441  47.766 1.00 25.53 ? 2461 GLN B C     1 
ATOM   7978  O O     . GLN B 1 430 ? 71.400  35.790  46.780 1.00 25.17 ? 2461 GLN B O     1 
ATOM   7979  C CB    . GLN B 1 430 ? 68.863  36.548  48.829 1.00 26.87 ? 2461 GLN B CB    1 
ATOM   7980  C CG    . GLN B 1 430 ? 67.800  37.498  49.354 1.00 26.71 ? 2461 GLN B CG    1 
ATOM   7981  C CD    . GLN B 1 430 ? 66.793  36.779  50.215 1.00 29.34 ? 2461 GLN B CD    1 
ATOM   7982  O OE1   . GLN B 1 430 ? 67.163  36.063  51.149 1.00 30.99 ? 2461 GLN B OE1   1 
ATOM   7983  N NE2   . GLN B 1 430 ? 65.511  36.951  49.905 1.00 28.86 ? 2461 GLN B NE2   1 
ATOM   7984  N N     . SER B 1 431 ? 71.925  36.523  48.818 1.00 24.86 ? 2462 SER B N     1 
ATOM   7985  C CA    . SER B 1 431 ? 73.225  35.871  48.855 1.00 23.88 ? 2462 SER B CA    1 
ATOM   7986  C C     . SER B 1 431 ? 73.209  34.358  48.703 1.00 24.33 ? 2462 SER B C     1 
ATOM   7987  O O     . SER B 1 431 ? 72.172  33.704  48.813 1.00 25.73 ? 2462 SER B O     1 
ATOM   7988  C CB    . SER B 1 431 ? 73.930  36.224  50.151 1.00 23.21 ? 2462 SER B CB    1 
ATOM   7989  O OG    . SER B 1 431 ? 73.501  35.343  51.168 1.00 25.05 ? 2462 SER B OG    1 
ATOM   7990  N N     . LEU B 1 432 ? 74.388  33.801  48.459 1.00 24.51 ? 2463 LEU B N     1 
ATOM   7991  C CA    . LEU B 1 432 ? 74.521  32.367  48.290 1.00 24.26 ? 2463 LEU B CA    1 
ATOM   7992  C C     . LEU B 1 432 ? 74.083  31.661  49.561 1.00 24.22 ? 2463 LEU B C     1 
ATOM   7993  O O     . LEU B 1 432 ? 73.364  30.669  49.524 1.00 24.82 ? 2463 LEU B O     1 
ATOM   7994  C CB    . LEU B 1 432 ? 75.974  32.008  47.982 1.00 23.96 ? 2463 LEU B CB    1 
ATOM   7995  C CG    . LEU B 1 432 ? 76.453  30.620  48.439 1.00 23.20 ? 2463 LEU B CG    1 
ATOM   7996  C CD1   . LEU B 1 432 ? 76.035  29.574  47.414 1.00 22.63 ? 2463 LEU B CD1   1 
ATOM   7997  C CD2   . LEU B 1 432 ? 77.968  30.611  48.608 1.00 21.17 ? 2463 LEU B CD2   1 
ATOM   7998  N N     . ASN B 1 433 ? 74.511  32.189  50.696 1.00 25.86 ? 2464 ASN B N     1 
ATOM   7999  C CA    . ASN B 1 433 ? 74.178  31.583  51.976 1.00 26.76 ? 2464 ASN B CA    1 
ATOM   8000  C C     . ASN B 1 433 ? 72.687  31.617  52.305 1.00 26.09 ? 2464 ASN B C     1 
ATOM   8001  O O     . ASN B 1 433 ? 72.183  30.733  52.999 1.00 25.64 ? 2464 ASN B O     1 
ATOM   8002  C CB    . ASN B 1 433 ? 74.984  32.252  53.090 1.00 27.61 ? 2464 ASN B CB    1 
ATOM   8003  C CG    . ASN B 1 433 ? 76.324  31.576  53.315 1.00 28.67 ? 2464 ASN B CG    1 
ATOM   8004  O OD1   . ASN B 1 433 ? 77.224  32.138  53.944 1.00 30.53 ? 2464 ASN B OD1   1 
ATOM   8005  N ND2   . ASN B 1 433 ? 76.465  30.361  52.798 1.00 28.11 ? 2464 ASN B ND2   1 
ATOM   8006  N N     . GLU B 1 434 ? 71.985  32.635  51.817 1.00 25.31 ? 2465 GLU B N     1 
ATOM   8007  C CA    . GLU B 1 434 ? 70.560  32.725  52.072 1.00 24.56 ? 2465 GLU B CA    1 
ATOM   8008  C C     . GLU B 1 434 ? 69.875  31.620  51.293 1.00 24.66 ? 2465 GLU B C     1 
ATOM   8009  O O     . GLU B 1 434 ? 68.958  30.975  51.792 1.00 25.79 ? 2465 GLU B O     1 
ATOM   8010  C CB    . GLU B 1 434 ? 70.014  34.086  51.651 1.00 23.73 ? 2465 GLU B CB    1 
ATOM   8011  C CG    . GLU B 1 434 ? 70.362  35.205  52.618 1.00 23.32 ? 2465 GLU B CG    1 
ATOM   8012  C CD    . GLU B 1 434 ? 69.971  34.899  54.058 1.00 24.92 ? 2465 GLU B CD    1 
ATOM   8013  O OE1   . GLU B 1 434 ? 69.255  33.915  54.302 1.00 28.31 ? 2465 GLU B OE1   1 
ATOM   8014  O OE2   . GLU B 1 434 ? 70.375  35.644  54.966 1.00 26.48 ? 2465 GLU B OE2   1 
ATOM   8015  N N     . TYR B 1 435 ? 70.343  31.382  50.074 1.00 23.10 ? 2466 TYR B N     1 
ATOM   8016  C CA    . TYR B 1 435 ? 69.763  30.335  49.245 1.00 21.95 ? 2466 TYR B CA    1 
ATOM   8017  C C     . TYR B 1 435 ? 70.119  28.960  49.785 1.00 21.46 ? 2466 TYR B C     1 
ATOM   8018  O O     . TYR B 1 435 ? 69.337  28.007  49.680 1.00 21.83 ? 2466 TYR B O     1 
ATOM   8019  C CB    . TYR B 1 435 ? 70.244  30.478  47.798 1.00 22.49 ? 2466 TYR B CB    1 
ATOM   8020  C CG    . TYR B 1 435 ? 69.384  31.416  46.992 1.00 22.67 ? 2466 TYR B CG    1 
ATOM   8021  C CD1   . TYR B 1 435 ? 68.115  31.017  46.555 1.00 22.99 ? 2466 TYR B CD1   1 
ATOM   8022  C CD2   . TYR B 1 435 ? 69.800  32.718  46.715 1.00 21.54 ? 2466 TYR B CD2   1 
ATOM   8023  C CE1   . TYR B 1 435 ? 67.267  31.888  45.864 1.00 21.99 ? 2466 TYR B CE1   1 
ATOM   8024  C CE2   . TYR B 1 435 ? 68.958  33.604  46.021 1.00 22.24 ? 2466 TYR B CE2   1 
ATOM   8025  C CZ    . TYR B 1 435 ? 67.686  33.174  45.604 1.00 21.72 ? 2466 TYR B CZ    1 
ATOM   8026  O OH    . TYR B 1 435 ? 66.815  34.037  44.972 1.00 21.90 ? 2466 TYR B OH    1 
ATOM   8027  N N     . ARG B 1 436 ? 71.304  28.847  50.370 1.00 21.87 ? 2467 ARG B N     1 
ATOM   8028  C CA    . ARG B 1 436 ? 71.716  27.570  50.942 1.00 22.30 ? 2467 ARG B CA    1 
ATOM   8029  C C     . ARG B 1 436 ? 70.782  27.239  52.107 1.00 22.55 ? 2467 ARG B C     1 
ATOM   8030  O O     . ARG B 1 436 ? 70.296  26.117  52.225 1.00 24.87 ? 2467 ARG B O     1 
ATOM   8031  C CB    . ARG B 1 436 ? 73.173  27.635  51.405 1.00 21.37 ? 2467 ARG B CB    1 
ATOM   8032  C CG    . ARG B 1 436 ? 74.157  27.195  50.319 1.00 20.52 ? 2467 ARG B CG    1 
ATOM   8033  C CD    . ARG B 1 436 ? 75.594  27.244  50.783 1.00 19.97 ? 2467 ARG B CD    1 
ATOM   8034  N NE    . ARG B 1 436 ? 75.938  26.149  51.693 1.00 19.15 ? 2467 ARG B NE    1 
ATOM   8035  C CZ    . ARG B 1 436 ? 76.014  24.862  51.349 1.00 18.96 ? 2467 ARG B CZ    1 
ATOM   8036  N NH1   . ARG B 1 436 ? 75.773  24.484  50.100 1.00 19.04 ? 2467 ARG B NH1   1 
ATOM   8037  N NH2   . ARG B 1 436 ? 76.346  23.955  52.257 1.00 15.70 ? 2467 ARG B NH2   1 
ATOM   8038  N N     . LYS B 1 437 ? 70.520  28.217  52.964 1.00 23.17 ? 2468 LYS B N     1 
ATOM   8039  C CA    . LYS B 1 437 ? 69.613  28.002  54.079 1.00 23.69 ? 2468 LYS B CA    1 
ATOM   8040  C C     . LYS B 1 437 ? 68.238  27.683  53.498 1.00 24.52 ? 2468 LYS B C     1 
ATOM   8041  O O     . LYS B 1 437 ? 67.559  26.768  53.943 1.00 24.04 ? 2468 LYS B O     1 
ATOM   8042  C CB    . LYS B 1 437 ? 69.515  29.263  54.922 1.00 24.99 ? 2468 LYS B CB    1 
ATOM   8043  C CG    . LYS B 1 437 ? 70.597  29.406  55.956 1.00 24.22 ? 2468 LYS B CG    1 
ATOM   8044  C CD    . LYS B 1 437 ? 71.013  30.854  56.074 1.00 25.23 ? 2468 LYS B CD    1 
ATOM   8045  C CE    . LYS B 1 437 ? 70.399  31.497  57.291 1.00 25.62 ? 2468 LYS B CE    1 
ATOM   8046  N NZ    . LYS B 1 437 ? 70.600  32.964  57.272 1.00 25.56 ? 2468 LYS B NZ    1 
ATOM   8047  N N     . ARG B 1 438 ? 67.841  28.446  52.487 1.00 25.59 ? 2469 ARG B N     1 
ATOM   8048  C CA    . ARG B 1 438 ? 66.548  28.255  51.846 1.00 25.63 ? 2469 ARG B CA    1 
ATOM   8049  C C     . ARG B 1 438 ? 66.369  26.813  51.453 1.00 25.69 ? 2469 ARG B C     1 
ATOM   8050  O O     . ARG B 1 438 ? 65.244  26.315  51.402 1.00 25.65 ? 2469 ARG B O     1 
ATOM   8051  C CB    . ARG B 1 438 ? 66.435  29.140  50.597 1.00 26.05 ? 2469 ARG B CB    1 
ATOM   8052  C CG    . ARG B 1 438 ? 65.143  29.015  49.800 1.00 26.34 ? 2469 ARG B CG    1 
ATOM   8053  C CD    . ARG B 1 438 ? 63.962  28.791  50.737 1.00 30.65 ? 2469 ARG B CD    1 
ATOM   8054  N NE    . ARG B 1 438 ? 62.679  28.570  50.058 1.00 32.20 ? 2469 ARG B NE    1 
ATOM   8055  C CZ    . ARG B 1 438 ? 62.350  27.473  49.385 1.00 33.28 ? 2469 ARG B CZ    1 
ATOM   8056  N NH1   . ARG B 1 438 ? 63.207  26.460  49.294 1.00 34.55 ? 2469 ARG B NH1   1 
ATOM   8057  N NH2   . ARG B 1 438 ? 61.186  27.401  48.759 1.00 31.08 ? 2469 ARG B NH2   1 
ATOM   8058  N N     . PHE B 1 439 ? 67.465  26.127  51.177 1.00 24.74 ? 2470 PHE B N     1 
ATOM   8059  C CA    . PHE B 1 439 ? 67.335  24.737  50.777 1.00 24.59 ? 2470 PHE B CA    1 
ATOM   8060  C C     . PHE B 1 439 ? 67.872  23.735  51.785 1.00 24.40 ? 2470 PHE B C     1 
ATOM   8061  O O     . PHE B 1 439 ? 68.291  22.639  51.418 1.00 25.29 ? 2470 PHE B O     1 
ATOM   8062  C CB    . PHE B 1 439 ? 67.957  24.528  49.392 1.00 23.32 ? 2470 PHE B CB    1 
ATOM   8063  C CG    . PHE B 1 439 ? 67.095  25.050  48.275 1.00 21.27 ? 2470 PHE B CG    1 
ATOM   8064  C CD1   . PHE B 1 439 ? 66.201  24.208  47.612 1.00 20.11 ? 2470 PHE B CD1   1 
ATOM   8065  C CD2   . PHE B 1 439 ? 67.108  26.397  47.949 1.00 21.58 ? 2470 PHE B CD2   1 
ATOM   8066  C CE1   . PHE B 1 439 ? 65.320  24.699  46.637 1.00 20.26 ? 2470 PHE B CE1   1 
ATOM   8067  C CE2   . PHE B 1 439 ? 66.233  26.903  46.976 1.00 22.63 ? 2470 PHE B CE2   1 
ATOM   8068  C CZ    . PHE B 1 439 ? 65.335  26.046  46.323 1.00 21.20 ? 2470 PHE B CZ    1 
ATOM   8069  N N     . SER B 1 440 ? 67.834  24.120  53.059 1.00 24.74 ? 2471 SER B N     1 
ATOM   8070  C CA    . SER B 1 440 ? 68.265  23.259  54.163 1.00 25.89 ? 2471 SER B CA    1 
ATOM   8071  C C     . SER B 1 440 ? 69.727  22.855  54.136 1.00 26.20 ? 2471 SER B C     1 
ATOM   8072  O O     . SER B 1 440 ? 70.093  21.773  54.608 1.00 25.82 ? 2471 SER B O     1 
ATOM   8073  C CB    . SER B 1 440 ? 67.405  22.001  54.202 1.00 25.10 ? 2471 SER B CB    1 
ATOM   8074  O OG    . SER B 1 440 ? 66.092  22.325  54.614 1.00 27.01 ? 2471 SER B OG    1 
ATOM   8075  N N     . LEU B 1 441 ? 70.553  23.729  53.574 1.00 27.26 ? 2472 LEU B N     1 
ATOM   8076  C CA    . LEU B 1 441 ? 71.982  23.489  53.488 1.00 27.78 ? 2472 LEU B CA    1 
ATOM   8077  C C     . LEU B 1 441 ? 72.685  24.393  54.505 1.00 28.36 ? 2472 LEU B C     1 
ATOM   8078  O O     . LEU B 1 441 ? 72.204  25.484  54.824 1.00 28.47 ? 2472 LEU B O     1 
ATOM   8079  C CB    . LEU B 1 441 ? 72.477  23.783  52.068 1.00 26.78 ? 2472 LEU B CB    1 
ATOM   8080  C CG    . LEU B 1 441 ? 71.634  23.154  50.958 1.00 26.73 ? 2472 LEU B CG    1 
ATOM   8081  C CD1   . LEU B 1 441 ? 72.176  23.611  49.610 1.00 25.89 ? 2472 LEU B CD1   1 
ATOM   8082  C CD2   . LEU B 1 441 ? 71.661  21.627  51.067 1.00 26.08 ? 2472 LEU B CD2   1 
ATOM   8083  N N     . LYS B 1 442 ? 73.818  23.938  55.023 1.00 29.12 ? 2473 LYS B N     1 
ATOM   8084  C CA    . LYS B 1 442 ? 74.539  24.719  56.002 1.00 29.48 ? 2473 LYS B CA    1 
ATOM   8085  C C     . LYS B 1 442 ? 75.285  25.816  55.294 1.00 29.05 ? 2473 LYS B C     1 
ATOM   8086  O O     . LYS B 1 442 ? 75.971  25.579  54.298 1.00 27.69 ? 2473 LYS B O     1 
ATOM   8087  C CB    . LYS B 1 442 ? 75.532  23.855  56.760 1.00 33.34 ? 2473 LYS B CB    1 
ATOM   8088  C CG    . LYS B 1 442 ? 74.897  22.814  57.648 1.00 39.15 ? 2473 LYS B CG    1 
ATOM   8089  C CD    . LYS B 1 442 ? 75.946  22.139  58.526 1.00 43.07 ? 2473 LYS B CD    1 
ATOM   8090  C CE    . LYS B 1 442 ? 75.326  21.059  59.406 1.00 44.86 ? 2473 LYS B CE    1 
ATOM   8091  N NZ    . LYS B 1 442 ? 76.296  20.638  60.458 1.00 46.80 ? 2473 LYS B NZ    1 
ATOM   8092  N N     . PRO B 1 443 ? 75.127  27.050  55.776 1.00 28.69 ? 2474 PRO B N     1 
ATOM   8093  C CA    . PRO B 1 443 ? 75.840  28.153  55.134 1.00 28.79 ? 2474 PRO B CA    1 
ATOM   8094  C C     . PRO B 1 443 ? 77.357  27.950  55.234 1.00 28.20 ? 2474 PRO B C     1 
ATOM   8095  O O     . PRO B 1 443 ? 77.859  27.304  56.148 1.00 28.56 ? 2474 PRO B O     1 
ATOM   8096  C CB    . PRO B 1 443 ? 75.369  29.395  55.896 1.00 27.34 ? 2474 PRO B CB    1 
ATOM   8097  C CG    . PRO B 1 443 ? 74.652  28.906  57.098 1.00 27.40 ? 2474 PRO B CG    1 
ATOM   8098  C CD    . PRO B 1 443 ? 74.263  27.489  56.887 1.00 28.58 ? 2474 PRO B CD    1 
ATOM   8099  N N     . TYR B 1 444 ? 78.083  28.481  54.265 1.00 27.97 ? 2475 TYR B N     1 
ATOM   8100  C CA    . TYR B 1 444 ? 79.525  28.361  54.278 1.00 27.32 ? 2475 TYR B CA    1 
ATOM   8101  C C     . TYR B 1 444 ? 80.057  29.432  55.225 1.00 28.34 ? 2475 TYR B C     1 
ATOM   8102  O O     . TYR B 1 444 ? 79.525  30.545  55.270 1.00 28.85 ? 2475 TYR B O     1 
ATOM   8103  C CB    . TYR B 1 444 ? 80.068  28.570  52.870 1.00 25.35 ? 2475 TYR B CB    1 
ATOM   8104  C CG    . TYR B 1 444 ? 79.869  27.376  51.970 1.00 24.43 ? 2475 TYR B CG    1 
ATOM   8105  C CD1   . TYR B 1 444 ? 79.290  27.518  50.709 1.00 24.20 ? 2475 TYR B CD1   1 
ATOM   8106  C CD2   . TYR B 1 444 ? 80.286  26.099  52.360 1.00 23.30 ? 2475 TYR B CD2   1 
ATOM   8107  C CE1   . TYR B 1 444 ? 79.138  26.419  49.853 1.00 22.36 ? 2475 TYR B CE1   1 
ATOM   8108  C CE2   . TYR B 1 444 ? 80.135  24.996  51.508 1.00 21.25 ? 2475 TYR B CE2   1 
ATOM   8109  C CZ    . TYR B 1 444 ? 79.566  25.172  50.259 1.00 21.46 ? 2475 TYR B CZ    1 
ATOM   8110  O OH    . TYR B 1 444 ? 79.457  24.117  49.392 1.00 21.49 ? 2475 TYR B OH    1 
ATOM   8111  N N     . THR B 1 445 ? 81.111  29.095  55.970 1.00 29.73 ? 2476 THR B N     1 
ATOM   8112  C CA    . THR B 1 445 ? 81.722  30.009  56.936 1.00 30.03 ? 2476 THR B CA    1 
ATOM   8113  C C     . THR B 1 445 ? 82.991  30.656  56.413 1.00 29.78 ? 2476 THR B C     1 
ATOM   8114  O O     . THR B 1 445 ? 83.560  31.537  57.056 1.00 30.55 ? 2476 THR B O     1 
ATOM   8115  C CB    . THR B 1 445 ? 82.058  29.278  58.235 1.00 30.44 ? 2476 THR B CB    1 
ATOM   8116  O OG1   . THR B 1 445 ? 82.819  28.105  57.935 1.00 31.49 ? 2476 THR B OG1   1 
ATOM   8117  C CG2   . THR B 1 445 ? 80.778  28.846  58.933 1.00 33.26 ? 2476 THR B CG2   1 
ATOM   8118  N N     . SER B 1 446 ? 83.428  30.225  55.238 1.00 29.62 ? 2477 SER B N     1 
ATOM   8119  C CA    . SER B 1 446 ? 84.625  30.781  54.634 1.00 29.05 ? 2477 SER B CA    1 
ATOM   8120  C C     . SER B 1 446 ? 84.698  30.426  53.154 1.00 29.72 ? 2477 SER B C     1 
ATOM   8121  O O     . SER B 1 446 ? 84.185  29.386  52.727 1.00 29.33 ? 2477 SER B O     1 
ATOM   8122  C CB    . SER B 1 446 ? 85.860  30.234  55.348 1.00 29.20 ? 2477 SER B CB    1 
ATOM   8123  O OG    . SER B 1 446 ? 86.179  28.935  54.882 1.00 26.01 ? 2477 SER B OG    1 
ATOM   8124  N N     . PHE B 1 447 ? 85.346  31.290  52.376 1.00 29.92 ? 2478 PHE B N     1 
ATOM   8125  C CA    . PHE B 1 447 ? 85.494  31.050  50.952 1.00 29.67 ? 2478 PHE B CA    1 
ATOM   8126  C C     . PHE B 1 447 ? 86.294  29.778  50.689 1.00 31.04 ? 2478 PHE B C     1 
ATOM   8127  O O     . PHE B 1 447 ? 86.110  29.120  49.667 1.00 32.22 ? 2478 PHE B O     1 
ATOM   8128  C CB    . PHE B 1 447 ? 86.176  32.239  50.295 1.00 27.92 ? 2478 PHE B CB    1 
ATOM   8129  C CG    . PHE B 1 447 ? 85.344  33.473  50.309 1.00 28.71 ? 2478 PHE B CG    1 
ATOM   8130  C CD1   . PHE B 1 447 ? 85.450  34.381  51.357 1.00 28.66 ? 2478 PHE B CD1   1 
ATOM   8131  C CD2   . PHE B 1 447 ? 84.415  33.721  49.288 1.00 28.69 ? 2478 PHE B CD2   1 
ATOM   8132  C CE1   . PHE B 1 447 ? 84.639  35.523  51.394 1.00 29.11 ? 2478 PHE B CE1   1 
ATOM   8133  C CE2   . PHE B 1 447 ? 83.599  34.858  49.314 1.00 26.10 ? 2478 PHE B CE2   1 
ATOM   8134  C CZ    . PHE B 1 447 ? 83.712  35.757  50.367 1.00 27.81 ? 2478 PHE B CZ    1 
ATOM   8135  N N     . GLU B 1 448 ? 87.187  29.432  51.608 1.00 32.05 ? 2479 GLU B N     1 
ATOM   8136  C CA    . GLU B 1 448 ? 87.987  28.234  51.443 1.00 32.80 ? 2479 GLU B CA    1 
ATOM   8137  C C     . GLU B 1 448 ? 87.062  27.036  51.598 1.00 31.95 ? 2479 GLU B C     1 
ATOM   8138  O O     . GLU B 1 448 ? 87.227  26.004  50.946 1.00 32.42 ? 2479 GLU B O     1 
ATOM   8139  C CB    . GLU B 1 448 ? 89.105  28.196  52.492 1.00 34.04 ? 2479 GLU B CB    1 
ATOM   8140  C CG    . GLU B 1 448 ? 90.368  28.944  52.075 1.00 38.44 ? 2479 GLU B CG    1 
ATOM   8141  C CD    . GLU B 1 448 ? 91.587  28.582  52.921 1.00 40.65 ? 2479 GLU B CD    1 
ATOM   8142  O OE1   . GLU B 1 448 ? 91.411  27.935  53.970 1.00 42.14 ? 2479 GLU B OE1   1 
ATOM   8143  O OE2   . GLU B 1 448 ? 92.722  28.947  52.532 1.00 43.87 ? 2479 GLU B OE2   1 
ATOM   8144  N N     . GLU B 1 449 ? 86.070  27.175  52.463 1.00 32.15 ? 2480 GLU B N     1 
ATOM   8145  C CA    . GLU B 1 449 ? 85.135  26.080  52.668 1.00 30.55 ? 2480 GLU B CA    1 
ATOM   8146  C C     . GLU B 1 449 ? 84.330  25.864  51.404 1.00 28.98 ? 2480 GLU B C     1 
ATOM   8147  O O     . GLU B 1 449 ? 84.030  24.735  51.031 1.00 29.34 ? 2480 GLU B O     1 
ATOM   8148  C CB    . GLU B 1 449 ? 84.188  26.386  53.820 1.00 31.10 ? 2480 GLU B CB    1 
ATOM   8149  C CG    . GLU B 1 449 ? 83.577  25.143  54.415 1.00 31.48 ? 2480 GLU B CG    1 
ATOM   8150  C CD    . GLU B 1 449 ? 82.363  25.435  55.280 1.00 32.93 ? 2480 GLU B CD    1 
ATOM   8151  O OE1   . GLU B 1 449 ? 81.632  24.481  55.599 1.00 34.54 ? 2480 GLU B OE1   1 
ATOM   8152  O OE2   . GLU B 1 449 ? 82.131  26.607  55.639 1.00 34.95 ? 2480 GLU B OE2   1 
ATOM   8153  N N     . LEU B 1 450 ? 83.996  26.966  50.749 1.00 27.74 ? 2481 LEU B N     1 
ATOM   8154  C CA    . LEU B 1 450 ? 83.215  26.921  49.529 1.00 26.64 ? 2481 LEU B CA    1 
ATOM   8155  C C     . LEU B 1 450 ? 83.930  26.254  48.367 1.00 26.93 ? 2481 LEU B C     1 
ATOM   8156  O O     . LEU B 1 450 ? 83.399  25.334  47.752 1.00 25.71 ? 2481 LEU B O     1 
ATOM   8157  C CB    . LEU B 1 450 ? 82.805  28.342  49.126 1.00 26.81 ? 2481 LEU B CB    1 
ATOM   8158  C CG    . LEU B 1 450 ? 82.413  28.579  47.660 1.00 26.56 ? 2481 LEU B CG    1 
ATOM   8159  C CD1   . LEU B 1 450 ? 81.076  27.896  47.374 1.00 25.81 ? 2481 LEU B CD1   1 
ATOM   8160  C CD2   . LEU B 1 450 ? 82.331  30.068  47.365 1.00 24.29 ? 2481 LEU B CD2   1 
ATOM   8161  N N     . THR B 1 451 ? 85.138  26.720  48.070 1.00 29.35 ? 2482 THR B N     1 
ATOM   8162  C CA    . THR B 1 451 ? 85.915  26.200  46.950 1.00 29.69 ? 2482 THR B CA    1 
ATOM   8163  C C     . THR B 1 451 ? 86.672  24.923  47.252 1.00 30.89 ? 2482 THR B C     1 
ATOM   8164  O O     . THR B 1 451 ? 86.951  24.141  46.341 1.00 30.18 ? 2482 THR B O     1 
ATOM   8165  C CB    . THR B 1 451 ? 86.932  27.221  46.486 1.00 29.69 ? 2482 THR B CB    1 
ATOM   8166  O OG1   . THR B 1 451 ? 87.994  27.276  47.442 1.00 31.32 ? 2482 THR B OG1   1 
ATOM   8167  C CG2   . THR B 1 451 ? 86.300  28.591  46.380 1.00 30.44 ? 2482 THR B CG2   1 
ATOM   8168  N N     . GLY B 1 452 ? 86.999  24.708  48.523 1.00 31.53 ? 2483 GLY B N     1 
ATOM   8169  C CA    . GLY B 1 452 ? 87.762  23.531  48.893 1.00 32.81 ? 2483 GLY B CA    1 
ATOM   8170  C C     . GLY B 1 452 ? 89.242  23.698  48.542 1.00 33.99 ? 2483 GLY B C     1 
ATOM   8171  O O     . GLY B 1 452 ? 89.982  22.721  48.438 1.00 34.81 ? 2483 GLY B O     1 
ATOM   8172  N N     . GLU B 1 453 ? 89.680  24.940  48.347 1.00 35.10 ? 2484 GLU B N     1 
ATOM   8173  C CA    . GLU B 1 453 ? 91.074  25.227  48.012 1.00 35.24 ? 2484 GLU B CA    1 
ATOM   8174  C C     . GLU B 1 453 ? 91.444  26.614  48.532 1.00 35.70 ? 2484 GLU B C     1 
ATOM   8175  O O     . GLU B 1 453 ? 90.658  27.221  49.254 1.00 36.10 ? 2484 GLU B O     1 
ATOM   8176  C CB    . GLU B 1 453 ? 91.299  25.140  46.495 1.00 34.39 ? 2484 GLU B CB    1 
ATOM   8177  C CG    . GLU B 1 453 ? 90.294  25.896  45.654 1.00 33.90 ? 2484 GLU B CG    1 
ATOM   8178  C CD    . GLU B 1 453 ? 90.583  27.379  45.596 1.00 35.46 ? 2484 GLU B CD    1 
ATOM   8179  O OE1   . GLU B 1 453 ? 89.999  28.136  46.396 1.00 37.62 ? 2484 GLU B OE1   1 
ATOM   8180  O OE2   . GLU B 1 453 ? 91.394  27.797  44.749 1.00 34.61 ? 2484 GLU B OE2   1 
ATOM   8181  N N     . LYS B 1 454 ? 92.620  27.125  48.160 1.00 35.81 ? 2485 LYS B N     1 
ATOM   8182  C CA    . LYS B 1 454 ? 93.072  28.435  48.645 1.00 35.55 ? 2485 LYS B CA    1 
ATOM   8183  C C     . LYS B 1 454 ? 93.212  29.581  47.651 1.00 34.57 ? 2485 LYS B C     1 
ATOM   8184  O O     . LYS B 1 454 ? 92.866  30.712  47.971 1.00 35.02 ? 2485 LYS B O     1 
ATOM   8185  C CB    . LYS B 1 454 ? 94.413  28.298  49.368 1.00 36.90 ? 2485 LYS B CB    1 
ATOM   8186  C CG    . LYS B 1 454 ? 94.500  27.151  50.347 1.00 41.03 ? 2485 LYS B CG    1 
ATOM   8187  C CD    . LYS B 1 454 ? 95.273  27.553  51.604 1.00 43.77 ? 2485 LYS B CD    1 
ATOM   8188  C CE    . LYS B 1 454 ? 95.391  26.380  52.572 1.00 46.11 ? 2485 LYS B CE    1 
ATOM   8189  N NZ    . LYS B 1 454 ? 95.939  26.789  53.894 1.00 47.21 ? 2485 LYS B NZ    1 
ATOM   8190  N N     . GLU B 1 455 ? 93.730  29.314  46.460 1.00 33.34 ? 2486 GLU B N     1 
ATOM   8191  C CA    . GLU B 1 455 ? 93.928  30.391  45.497 1.00 33.84 ? 2486 GLU B CA    1 
ATOM   8192  C C     . GLU B 1 455 ? 92.668  31.173  45.148 1.00 33.60 ? 2486 GLU B C     1 
ATOM   8193  O O     . GLU B 1 455 ? 92.600  32.381  45.362 1.00 34.37 ? 2486 GLU B O     1 
ATOM   8194  C CB    . GLU B 1 455 ? 94.556  29.855  44.215 1.00 34.36 ? 2486 GLU B CB    1 
ATOM   8195  C CG    . GLU B 1 455 ? 94.832  30.938  43.195 1.00 37.22 ? 2486 GLU B CG    1 
ATOM   8196  C CD    . GLU B 1 455 ? 95.816  30.486  42.145 1.00 39.03 ? 2486 GLU B CD    1 
ATOM   8197  O OE1   . GLU B 1 455 ? 95.690  30.904  40.976 1.00 41.17 ? 2486 GLU B OE1   1 
ATOM   8198  O OE2   . GLU B 1 455 ? 96.722  29.703  42.491 1.00 41.87 ? 2486 GLU B OE2   1 
ATOM   8199  N N     . MET B 1 456 ? 91.675  30.490  44.594 1.00 32.58 ? 2487 MET B N     1 
ATOM   8200  C CA    . MET B 1 456 ? 90.433  31.145  44.228 1.00 30.68 ? 2487 MET B CA    1 
ATOM   8201  C C     . MET B 1 456 ? 89.731  31.693  45.462 1.00 29.18 ? 2487 MET B C     1 
ATOM   8202  O O     . MET B 1 456 ? 89.224  32.802  45.454 1.00 28.98 ? 2487 MET B O     1 
ATOM   8203  C CB    . MET B 1 456 ? 89.532  30.159  43.498 1.00 31.16 ? 2487 MET B CB    1 
ATOM   8204  C CG    . MET B 1 456 ? 89.976  29.863  42.085 1.00 30.64 ? 2487 MET B CG    1 
ATOM   8205  S SD    . MET B 1 456 ? 88.832  28.755  41.237 1.00 33.29 ? 2487 MET B SD    1 
ATOM   8206  C CE    . MET B 1 456 ? 88.663  27.468  42.434 1.00 30.20 ? 2487 MET B CE    1 
ATOM   8207  N N     . ALA B 1 457 ? 89.712  30.917  46.531 1.00 28.64 ? 2488 ALA B N     1 
ATOM   8208  C CA    . ALA B 1 457 ? 89.065  31.352  47.754 1.00 29.99 ? 2488 ALA B CA    1 
ATOM   8209  C C     . ALA B 1 457 ? 89.623  32.686  48.193 1.00 30.59 ? 2488 ALA B C     1 
ATOM   8210  O O     . ALA B 1 457 ? 88.883  33.587  48.578 1.00 32.37 ? 2488 ALA B O     1 
ATOM   8211  C CB    . ALA B 1 457 ? 89.279  30.325  48.845 1.00 29.06 ? 2488 ALA B CB    1 
ATOM   8212  N N     . ALA B 1 458 ? 90.941  32.810  48.135 1.00 31.81 ? 2489 ALA B N     1 
ATOM   8213  C CA    . ALA B 1 458 ? 91.601  34.038  48.537 1.00 32.21 ? 2489 ALA B CA    1 
ATOM   8214  C C     . ALA B 1 458 ? 91.229  35.188  47.627 1.00 32.32 ? 2489 ALA B C     1 
ATOM   8215  O O     . ALA B 1 458 ? 91.040  36.302  48.098 1.00 32.55 ? 2489 ALA B O     1 
ATOM   8216  C CB    . ALA B 1 458 ? 93.098  33.846  48.541 1.00 32.33 ? 2489 ALA B CB    1 
ATOM   8217  N N     . GLU B 1 459 ? 91.144  34.930  46.323 1.00 32.44 ? 2490 GLU B N     1 
ATOM   8218  C CA    . GLU B 1 459 ? 90.769  35.979  45.375 1.00 32.96 ? 2490 GLU B CA    1 
ATOM   8219  C C     . GLU B 1 459 ? 89.330  36.413  45.674 1.00 32.74 ? 2490 GLU B C     1 
ATOM   8220  O O     . GLU B 1 459 ? 89.002  37.604  45.622 1.00 31.24 ? 2490 GLU B O     1 
ATOM   8221  C CB    . GLU B 1 459 ? 90.872  35.477  43.926 1.00 35.16 ? 2490 GLU B CB    1 
ATOM   8222  C CG    . GLU B 1 459 ? 92.273  35.024  43.479 1.00 38.30 ? 2490 GLU B CG    1 
ATOM   8223  C CD    . GLU B 1 459 ? 93.205  36.188  43.136 1.00 40.61 ? 2490 GLU B CD    1 
ATOM   8224  O OE1   . GLU B 1 459 ? 94.439  36.000  43.138 1.00 43.02 ? 2490 GLU B OE1   1 
ATOM   8225  O OE2   . GLU B 1 459 ? 92.716  37.299  42.864 1.00 42.19 ? 2490 GLU B OE2   1 
ATOM   8226  N N     . LEU B 1 460 ? 88.478  35.443  46.006 1.00 32.36 ? 2491 LEU B N     1 
ATOM   8227  C CA    . LEU B 1 460 ? 87.085  35.730  46.321 1.00 32.19 ? 2491 LEU B CA    1 
ATOM   8228  C C     . LEU B 1 460 ? 87.025  36.543  47.608 1.00 33.41 ? 2491 LEU B C     1 
ATOM   8229  O O     . LEU B 1 460 ? 86.321  37.546  47.687 1.00 34.37 ? 2491 LEU B O     1 
ATOM   8230  C CB    . LEU B 1 460 ? 86.294  34.430  46.489 1.00 31.49 ? 2491 LEU B CB    1 
ATOM   8231  C CG    . LEU B 1 460 ? 86.013  33.661  45.194 1.00 30.37 ? 2491 LEU B CG    1 
ATOM   8232  C CD1   . LEU B 1 460 ? 85.597  32.240  45.495 1.00 29.56 ? 2491 LEU B CD1   1 
ATOM   8233  C CD2   . LEU B 1 460 ? 84.932  34.372  44.412 1.00 31.09 ? 2491 LEU B CD2   1 
ATOM   8234  N N     . LYS B 1 461 ? 87.766  36.112  48.619 1.00 34.46 ? 2492 LYS B N     1 
ATOM   8235  C CA    . LYS B 1 461 ? 87.776  36.833  49.885 1.00 35.03 ? 2492 LYS B CA    1 
ATOM   8236  C C     . LYS B 1 461 ? 88.175  38.278  49.641 1.00 34.95 ? 2492 LYS B C     1 
ATOM   8237  O O     . LYS B 1 461 ? 87.591  39.195  50.208 1.00 36.02 ? 2492 LYS B O     1 
ATOM   8238  C CB    . LYS B 1 461 ? 88.765  36.207  50.859 1.00 36.57 ? 2492 LYS B CB    1 
ATOM   8239  C CG    . LYS B 1 461 ? 88.858  36.953  52.180 1.00 37.40 ? 2492 LYS B CG    1 
ATOM   8240  C CD    . LYS B 1 461 ? 88.540  36.028  53.338 1.00 39.79 ? 2492 LYS B CD    1 
ATOM   8241  C CE    . LYS B 1 461 ? 88.651  36.731  54.684 1.00 39.74 ? 2492 LYS B CE    1 
ATOM   8242  N NZ    . LYS B 1 461 ? 87.532  37.691  54.928 1.00 40.47 ? 2492 LYS B NZ    1 
ATOM   8243  N N     . ALA B 1 462 ? 89.172  38.478  48.790 1.00 34.63 ? 2493 ALA B N     1 
ATOM   8244  C CA    . ALA B 1 462 ? 89.638  39.820  48.476 1.00 34.38 ? 2493 ALA B CA    1 
ATOM   8245  C C     . ALA B 1 462 ? 88.522  40.663  47.882 1.00 34.91 ? 2493 ALA B C     1 
ATOM   8246  O O     . ALA B 1 462 ? 88.336  41.817  48.265 1.00 34.85 ? 2493 ALA B O     1 
ATOM   8247  C CB    . ALA B 1 462 ? 90.803  39.757  47.496 1.00 33.99 ? 2493 ALA B CB    1 
ATOM   8248  N N     . LEU B 1 463 ? 87.774  40.082  46.947 1.00 34.82 ? 2494 LEU B N     1 
ATOM   8249  C CA    . LEU B 1 463 ? 86.684  40.798  46.274 1.00 33.80 ? 2494 LEU B CA    1 
ATOM   8250  C C     . LEU B 1 463 ? 85.406  41.006  47.091 1.00 34.59 ? 2494 LEU B C     1 
ATOM   8251  O O     . LEU B 1 463 ? 84.817  42.085  47.059 1.00 34.97 ? 2494 LEU B O     1 
ATOM   8252  C CB    . LEU B 1 463 ? 86.331  40.087  44.958 1.00 32.97 ? 2494 LEU B CB    1 
ATOM   8253  C CG    . LEU B 1 463 ? 87.321  40.217  43.787 1.00 31.88 ? 2494 LEU B CG    1 
ATOM   8254  C CD1   . LEU B 1 463 ? 87.157  39.042  42.839 1.00 30.11 ? 2494 LEU B CD1   1 
ATOM   8255  C CD2   . LEU B 1 463 ? 87.090  41.531  43.044 1.00 30.82 ? 2494 LEU B CD2   1 
ATOM   8256  N N     . TYR B 1 464 ? 84.991  39.982  47.830 1.00 34.86 ? 2495 TYR B N     1 
ATOM   8257  C CA    . TYR B 1 464 ? 83.759  40.045  48.612 1.00 35.08 ? 2495 TYR B CA    1 
ATOM   8258  C C     . TYR B 1 464 ? 83.911  40.379  50.086 1.00 35.44 ? 2495 TYR B C     1 
ATOM   8259  O O     . TYR B 1 464 ? 82.997  40.956  50.681 1.00 35.68 ? 2495 TYR B O     1 
ATOM   8260  C CB    . TYR B 1 464 ? 83.004  38.720  48.490 1.00 35.06 ? 2495 TYR B CB    1 
ATOM   8261  C CG    . TYR B 1 464 ? 82.412  38.477  47.118 1.00 35.41 ? 2495 TYR B CG    1 
ATOM   8262  C CD1   . TYR B 1 464 ? 83.124  37.773  46.147 1.00 34.09 ? 2495 TYR B CD1   1 
ATOM   8263  C CD2   . TYR B 1 464 ? 81.142  38.957  46.791 1.00 34.02 ? 2495 TYR B CD2   1 
ATOM   8264  C CE1   . TYR B 1 464 ? 82.588  37.549  44.885 1.00 35.16 ? 2495 TYR B CE1   1 
ATOM   8265  C CE2   . TYR B 1 464 ? 80.596  38.740  45.533 1.00 35.08 ? 2495 TYR B CE2   1 
ATOM   8266  C CZ    . TYR B 1 464 ? 81.324  38.035  44.584 1.00 33.73 ? 2495 TYR B CZ    1 
ATOM   8267  O OH    . TYR B 1 464 ? 80.786  37.813  43.336 1.00 34.89 ? 2495 TYR B OH    1 
ATOM   8268  N N     . SER B 1 465 ? 85.049  40.003  50.671 1.00 34.99 ? 2496 SER B N     1 
ATOM   8269  C CA    . SER B 1 465 ? 85.343  40.251  52.091 1.00 35.56 ? 2496 SER B CA    1 
ATOM   8270  C C     . SER B 1 465 ? 84.612  39.315  53.050 1.00 34.16 ? 2496 SER B C     1 
ATOM   8271  O O     . SER B 1 465 ? 85.224  38.701  53.926 1.00 34.37 ? 2496 SER B O     1 
ATOM   8272  C CB    . SER B 1 465 ? 85.011  41.702  52.474 1.00 35.70 ? 2496 SER B CB    1 
ATOM   8273  O OG    . SER B 1 465 ? 85.616  42.623  51.575 1.00 37.78 ? 2496 SER B OG    1 
ATOM   8274  N N     . ASP B 1 466 ? 83.301  39.209  52.871 1.00 33.70 ? 2497 ASP B N     1 
ATOM   8275  C CA    . ASP B 1 466 ? 82.461  38.383  53.726 1.00 32.59 ? 2497 ASP B CA    1 
ATOM   8276  C C     . ASP B 1 466 ? 81.853  37.254  52.902 1.00 31.56 ? 2497 ASP B C     1 
ATOM   8277  O O     . ASP B 1 466 ? 81.336  37.487  51.809 1.00 31.34 ? 2497 ASP B O     1 
ATOM   8278  C CB    . ASP B 1 466 ? 81.358  39.271  54.321 1.00 34.03 ? 2497 ASP B CB    1 
ATOM   8279  C CG    . ASP B 1 466 ? 80.592  38.605  55.446 1.00 34.48 ? 2497 ASP B CG    1 
ATOM   8280  O OD1   . ASP B 1 466 ? 79.762  39.305  56.073 1.00 35.64 ? 2497 ASP B OD1   1 
ATOM   8281  O OD2   . ASP B 1 466 ? 80.811  37.401  55.702 1.00 36.23 ? 2497 ASP B OD2   1 
ATOM   8282  N N     . ILE B 1 467 ? 81.912  36.033  53.422 1.00 31.15 ? 2498 ILE B N     1 
ATOM   8283  C CA    . ILE B 1 467 ? 81.349  34.882  52.721 1.00 29.40 ? 2498 ILE B CA    1 
ATOM   8284  C C     . ILE B 1 467 ? 79.826  35.037  52.608 1.00 29.63 ? 2498 ILE B C     1 
ATOM   8285  O O     . ILE B 1 467 ? 79.207  34.584  51.648 1.00 29.05 ? 2498 ILE B O     1 
ATOM   8286  C CB    . ILE B 1 467 ? 81.685  33.563  53.470 1.00 28.24 ? 2498 ILE B CB    1 
ATOM   8287  C CG1   . ILE B 1 467 ? 81.039  32.369  52.771 1.00 27.67 ? 2498 ILE B CG1   1 
ATOM   8288  C CG2   . ILE B 1 467 ? 81.193  33.639  54.890 1.00 28.17 ? 2498 ILE B CG2   1 
ATOM   8289  C CD1   . ILE B 1 467 ? 81.723  31.945  51.482 1.00 26.86 ? 2498 ILE B CD1   1 
ATOM   8290  N N     . ASP B 1 468 ? 79.241  35.702  53.595 1.00 30.75 ? 2499 ASP B N     1 
ATOM   8291  C CA    . ASP B 1 468 ? 77.798  35.923  53.652 1.00 30.22 ? 2499 ASP B CA    1 
ATOM   8292  C C     . ASP B 1 468 ? 77.295  36.897  52.596 1.00 30.21 ? 2499 ASP B C     1 
ATOM   8293  O O     . ASP B 1 468 ? 76.101  37.148  52.490 1.00 30.75 ? 2499 ASP B O     1 
ATOM   8294  C CB    . ASP B 1 468 ? 77.411  36.426  55.044 1.00 29.59 ? 2499 ASP B CB    1 
ATOM   8295  C CG    . ASP B 1 468 ? 77.519  35.343  56.103 1.00 29.13 ? 2499 ASP B CG    1 
ATOM   8296  O OD1   . ASP B 1 468 ? 77.428  34.150  55.744 1.00 30.88 ? 2499 ASP B OD1   1 
ATOM   8297  O OD2   . ASP B 1 468 ? 77.692  35.669  57.298 1.00 29.37 ? 2499 ASP B OD2   1 
ATOM   8298  N N     . VAL B 1 469 ? 78.213  37.435  51.808 1.00 31.48 ? 2500 VAL B N     1 
ATOM   8299  C CA    . VAL B 1 469 ? 77.852  38.369  50.755 1.00 30.06 ? 2500 VAL B CA    1 
ATOM   8300  C C     . VAL B 1 469 ? 78.171  37.737  49.404 1.00 29.55 ? 2500 VAL B C     1 
ATOM   8301  O O     . VAL B 1 469 ? 77.919  38.324  48.344 1.00 29.05 ? 2500 VAL B O     1 
ATOM   8302  C CB    . VAL B 1 469 ? 78.625  39.668  50.934 1.00 31.59 ? 2500 VAL B CB    1 
ATOM   8303  C CG1   . VAL B 1 469 ? 78.478  40.552  49.718 1.00 31.68 ? 2500 VAL B CG1   1 
ATOM   8304  C CG2   . VAL B 1 469 ? 78.110  40.371  52.174 1.00 32.51 ? 2500 VAL B CG2   1 
ATOM   8305  N N     . MET B 1 470 ? 78.723  36.524  49.454 1.00 28.64 ? 2501 MET B N     1 
ATOM   8306  C CA    . MET B 1 470 ? 79.065  35.798  48.241 1.00 27.28 ? 2501 MET B CA    1 
ATOM   8307  C C     . MET B 1 470 ? 77.781  35.562  47.436 1.00 27.31 ? 2501 MET B C     1 
ATOM   8308  O O     . MET B 1 470 ? 76.709  35.307  48.008 1.00 27.85 ? 2501 MET B O     1 
ATOM   8309  C CB    . MET B 1 470 ? 79.737  34.465  48.588 1.00 25.27 ? 2501 MET B CB    1 
ATOM   8310  C CG    . MET B 1 470 ? 80.160  33.651  47.371 1.00 23.35 ? 2501 MET B CG    1 
ATOM   8311  S SD    . MET B 1 470 ? 81.146  34.595  46.178 1.00 25.20 ? 2501 MET B SD    1 
ATOM   8312  C CE    . MET B 1 470 ? 81.444  33.336  44.936 1.00 24.66 ? 2501 MET B CE    1 
ATOM   8313  N N     . GLU B 1 471 ? 77.903  35.647  46.111 1.00 27.34 ? 2502 GLU B N     1 
ATOM   8314  C CA    . GLU B 1 471 ? 76.777  35.464  45.196 1.00 26.72 ? 2502 GLU B CA    1 
ATOM   8315  C C     . GLU B 1 471 ? 76.578  34.016  44.750 1.00 26.70 ? 2502 GLU B C     1 
ATOM   8316  O O     . GLU B 1 471 ? 77.533  33.260  44.595 1.00 27.81 ? 2502 GLU B O     1 
ATOM   8317  C CB    . GLU B 1 471 ? 76.954  36.367  43.977 1.00 26.55 ? 2502 GLU B CB    1 
ATOM   8318  C CG    . GLU B 1 471 ? 76.911  37.842  44.320 1.00 28.42 ? 2502 GLU B CG    1 
ATOM   8319  C CD    . GLU B 1 471 ? 77.289  38.710  43.153 1.00 30.37 ? 2502 GLU B CD    1 
ATOM   8320  O OE1   . GLU B 1 471 ? 76.391  39.080  42.360 1.00 30.13 ? 2502 GLU B OE1   1 
ATOM   8321  O OE2   . GLU B 1 471 ? 78.492  39.020  43.032 1.00 31.36 ? 2502 GLU B OE2   1 
ATOM   8322  N N     . LEU B 1 472 ? 75.320  33.648  44.530 1.00 26.24 ? 2503 LEU B N     1 
ATOM   8323  C CA    . LEU B 1 472 ? 74.937  32.298  44.142 1.00 23.95 ? 2503 LEU B CA    1 
ATOM   8324  C C     . LEU B 1 472 ? 75.527  31.775  42.842 1.00 24.68 ? 2503 LEU B C     1 
ATOM   8325  O O     . LEU B 1 472 ? 76.159  30.714  42.829 1.00 24.63 ? 2503 LEU B O     1 
ATOM   8326  C CB    . LEU B 1 472 ? 73.405  32.220  44.085 1.00 22.08 ? 2503 LEU B CB    1 
ATOM   8327  C CG    . LEU B 1 472 ? 72.742  30.948  43.551 1.00 19.24 ? 2503 LEU B CG    1 
ATOM   8328  C CD1   . LEU B 1 472 ? 72.931  29.845  44.560 1.00 18.16 ? 2503 LEU B CD1   1 
ATOM   8329  C CD2   . LEU B 1 472 ? 71.252  31.190  43.280 1.00 17.85 ? 2503 LEU B CD2   1 
ATOM   8330  N N     . TYR B 1 473 ? 75.328  32.507  41.747 1.00 25.39 ? 2504 TYR B N     1 
ATOM   8331  C CA    . TYR B 1 473 ? 75.826  32.051  40.451 1.00 26.42 ? 2504 TYR B CA    1 
ATOM   8332  C C     . TYR B 1 473 ? 77.332  31.769  40.382 1.00 26.56 ? 2504 TYR B C     1 
ATOM   8333  O O     . TYR B 1 473 ? 77.747  30.673  39.991 1.00 26.74 ? 2504 TYR B O     1 
ATOM   8334  C CB    . TYR B 1 473 ? 75.448  33.032  39.334 1.00 25.81 ? 2504 TYR B CB    1 
ATOM   8335  C CG    . TYR B 1 473 ? 76.046  32.624  38.012 1.00 25.62 ? 2504 TYR B CG    1 
ATOM   8336  C CD1   . TYR B 1 473 ? 75.693  31.419  37.419 1.00 24.81 ? 2504 TYR B CD1   1 
ATOM   8337  C CD2   . TYR B 1 473 ? 77.002  33.416  37.380 1.00 25.92 ? 2504 TYR B CD2   1 
ATOM   8338  C CE1   . TYR B 1 473 ? 76.276  31.001  36.227 1.00 26.39 ? 2504 TYR B CE1   1 
ATOM   8339  C CE2   . TYR B 1 473 ? 77.595  33.010  36.184 1.00 26.53 ? 2504 TYR B CE2   1 
ATOM   8340  C CZ    . TYR B 1 473 ? 77.222  31.796  35.615 1.00 26.64 ? 2504 TYR B CZ    1 
ATOM   8341  O OH    . TYR B 1 473 ? 77.777  31.368  34.429 1.00 29.18 ? 2504 TYR B OH    1 
ATOM   8342  N N     . PRO B 1 474 ? 78.164  32.750  40.769 1.00 26.02 ? 2505 PRO B N     1 
ATOM   8343  C CA    . PRO B 1 474 ? 79.612  32.541  40.720 1.00 25.81 ? 2505 PRO B CA    1 
ATOM   8344  C C     . PRO B 1 474 ? 79.997  31.390  41.633 1.00 25.80 ? 2505 PRO B C     1 
ATOM   8345  O O     . PRO B 1 474 ? 80.818  30.532  41.286 1.00 25.35 ? 2505 PRO B O     1 
ATOM   8346  C CB    . PRO B 1 474 ? 80.192  33.865  41.214 1.00 25.99 ? 2505 PRO B CB    1 
ATOM   8347  C CG    . PRO B 1 474 ? 79.072  34.841  41.180 1.00 25.80 ? 2505 PRO B CG    1 
ATOM   8348  C CD    . PRO B 1 474 ? 77.812  34.070  41.319 1.00 26.75 ? 2505 PRO B CD    1 
ATOM   8349  N N     . ALA B 1 475 ? 79.386  31.377  42.813 1.00 23.89 ? 2506 ALA B N     1 
ATOM   8350  C CA    . ALA B 1 475 ? 79.659  30.337  43.779 1.00 22.15 ? 2506 ALA B CA    1 
ATOM   8351  C C     . ALA B 1 475 ? 79.407  28.959  43.179 1.00 23.13 ? 2506 ALA B C     1 
ATOM   8352  O O     . ALA B 1 475 ? 80.184  28.035  43.407 1.00 24.50 ? 2506 ALA B O     1 
ATOM   8353  C CB    . ALA B 1 475 ? 78.802  30.537  45.011 1.00 20.95 ? 2506 ALA B CB    1 
ATOM   8354  N N     . LEU B 1 476 ? 78.341  28.816  42.395 1.00 23.47 ? 2507 LEU B N     1 
ATOM   8355  C CA    . LEU B 1 476 ? 78.027  27.512  41.810 1.00 22.85 ? 2507 LEU B CA    1 
ATOM   8356  C C     . LEU B 1 476 ? 79.118  27.005  40.866 1.00 23.46 ? 2507 LEU B C     1 
ATOM   8357  O O     . LEU B 1 476 ? 79.370  25.801  40.797 1.00 23.43 ? 2507 LEU B O     1 
ATOM   8358  C CB    . LEU B 1 476 ? 76.682  27.568  41.068 1.00 23.09 ? 2507 LEU B CB    1 
ATOM   8359  C CG    . LEU B 1 476 ? 75.385  27.686  41.889 1.00 21.25 ? 2507 LEU B CG    1 
ATOM   8360  C CD1   . LEU B 1 476 ? 74.242  28.120  40.975 1.00 19.83 ? 2507 LEU B CD1   1 
ATOM   8361  C CD2   . LEU B 1 476 ? 75.057  26.356  42.535 1.00 20.77 ? 2507 LEU B CD2   1 
ATOM   8362  N N     . LEU B 1 477 ? 79.766  27.924  40.150 1.00 24.93 ? 2508 LEU B N     1 
ATOM   8363  C CA    . LEU B 1 477 ? 80.822  27.571  39.193 1.00 25.84 ? 2508 LEU B CA    1 
ATOM   8364  C C     . LEU B 1 477 ? 82.213  27.445  39.827 1.00 26.62 ? 2508 LEU B C     1 
ATOM   8365  O O     . LEU B 1 477 ? 83.172  27.034  39.181 1.00 26.25 ? 2508 LEU B O     1 
ATOM   8366  C CB    . LEU B 1 477 ? 80.878  28.621  38.084 1.00 25.10 ? 2508 LEU B CB    1 
ATOM   8367  C CG    . LEU B 1 477 ? 79.685  28.759  37.134 1.00 24.75 ? 2508 LEU B CG    1 
ATOM   8368  C CD1   . LEU B 1 477 ? 80.150  29.412  35.821 1.00 24.26 ? 2508 LEU B CD1   1 
ATOM   8369  C CD2   . LEU B 1 477 ? 79.076  27.398  36.857 1.00 24.51 ? 2508 LEU B CD2   1 
ATOM   8370  N N     . VAL B 1 478 ? 82.309  27.785  41.099 1.00 26.67 ? 2509 VAL B N     1 
ATOM   8371  C CA    . VAL B 1 478 ? 83.577  27.751  41.804 1.00 26.58 ? 2509 VAL B CA    1 
ATOM   8372  C C     . VAL B 1 478 ? 83.541  26.757  42.968 1.00 26.78 ? 2509 VAL B C     1 
ATOM   8373  O O     . VAL B 1 478 ? 84.567  26.387  43.532 1.00 26.05 ? 2509 VAL B O     1 
ATOM   8374  C CB    . VAL B 1 478 ? 83.893  29.190  42.317 1.00 26.90 ? 2509 VAL B CB    1 
ATOM   8375  C CG1   . VAL B 1 478 ? 84.084  29.202  43.806 1.00 27.32 ? 2509 VAL B CG1   1 
ATOM   8376  C CG2   . VAL B 1 478 ? 85.094  29.744  41.602 1.00 27.44 ? 2509 VAL B CG2   1 
ATOM   8377  N N     . GLU B 1 479 ? 82.341  26.328  43.322 1.00 26.74 ? 2510 GLU B N     1 
ATOM   8378  C CA    . GLU B 1 479 ? 82.164  25.407  44.427 1.00 25.90 ? 2510 GLU B CA    1 
ATOM   8379  C C     . GLU B 1 479 ? 82.965  24.119  44.308 1.00 25.70 ? 2510 GLU B C     1 
ATOM   8380  O O     . GLU B 1 479 ? 83.153  23.569  43.221 1.00 24.56 ? 2510 GLU B O     1 
ATOM   8381  C CB    . GLU B 1 479 ? 80.684  25.079  44.580 1.00 26.80 ? 2510 GLU B CB    1 
ATOM   8382  C CG    . GLU B 1 479 ? 80.319  24.458  45.910 1.00 25.99 ? 2510 GLU B CG    1 
ATOM   8383  C CD    . GLU B 1 479 ? 78.853  24.086  45.981 1.00 27.63 ? 2510 GLU B CD    1 
ATOM   8384  O OE1   . GLU B 1 479 ? 78.254  23.816  44.916 1.00 26.69 ? 2510 GLU B OE1   1 
ATOM   8385  O OE2   . GLU B 1 479 ? 78.300  24.073  47.101 1.00 26.47 ? 2510 GLU B OE2   1 
ATOM   8386  N N     . LYS B 1 480 ? 83.433  23.643  45.450 1.00 26.45 ? 2511 LYS B N     1 
ATOM   8387  C CA    . LYS B 1 480 ? 84.199  22.417  45.491 1.00 27.52 ? 2511 LYS B CA    1 
ATOM   8388  C C     . LYS B 1 480 ? 83.291  21.318  44.965 1.00 26.82 ? 2511 LYS B C     1 
ATOM   8389  O O     . LYS B 1 480 ? 82.253  21.020  45.552 1.00 27.77 ? 2511 LYS B O     1 
ATOM   8390  C CB    . LYS B 1 480 ? 84.612  22.118  46.929 1.00 27.66 ? 2511 LYS B CB    1 
ATOM   8391  C CG    . LYS B 1 480 ? 85.147  20.723  47.159 1.00 29.29 ? 2511 LYS B CG    1 
ATOM   8392  C CD    . LYS B 1 480 ? 85.180  20.431  48.646 1.00 31.79 ? 2511 LYS B CD    1 
ATOM   8393  C CE    . LYS B 1 480 ? 85.853  19.098  48.944 1.00 36.53 ? 2511 LYS B CE    1 
ATOM   8394  N NZ    . LYS B 1 480 ? 85.770  18.720  50.400 1.00 36.46 ? 2511 LYS B NZ    1 
ATOM   8395  N N     . PRO B 1 481 ? 83.661  20.702  43.838 1.00 27.11 ? 2512 PRO B N     1 
ATOM   8396  C CA    . PRO B 1 481 ? 82.787  19.644  43.332 1.00 27.78 ? 2512 PRO B CA    1 
ATOM   8397  C C     . PRO B 1 481 ? 82.754  18.501  44.323 1.00 27.63 ? 2512 PRO B C     1 
ATOM   8398  O O     . PRO B 1 481 ? 83.474  18.511  45.323 1.00 28.53 ? 2512 PRO B O     1 
ATOM   8399  C CB    . PRO B 1 481 ? 83.437  19.226  42.008 1.00 26.26 ? 2512 PRO B CB    1 
ATOM   8400  C CG    . PRO B 1 481 ? 84.381  20.321  41.674 1.00 25.66 ? 2512 PRO B CG    1 
ATOM   8401  C CD    . PRO B 1 481 ? 84.836  20.902  42.977 1.00 25.56 ? 2512 PRO B CD    1 
ATOM   8402  N N     . ARG B 1 482 ? 81.903  17.521  44.063 1.00 27.25 ? 2513 ARG B N     1 
ATOM   8403  C CA    . ARG B 1 482 ? 81.844  16.363  44.930 1.00 27.64 ? 2513 ARG B CA    1 
ATOM   8404  C C     . ARG B 1 482 ? 82.886  15.416  44.366 1.00 26.84 ? 2513 ARG B C     1 
ATOM   8405  O O     . ARG B 1 482 ? 83.390  15.632  43.262 1.00 27.17 ? 2513 ARG B O     1 
ATOM   8406  C CB    . ARG B 1 482 ? 80.450  15.758  44.901 1.00 27.93 ? 2513 ARG B CB    1 
ATOM   8407  C CG    . ARG B 1 482 ? 79.451  16.715  45.510 1.00 30.03 ? 2513 ARG B CG    1 
ATOM   8408  C CD    . ARG B 1 482 ? 78.254  15.993  46.005 1.00 30.73 ? 2513 ARG B CD    1 
ATOM   8409  N NE    . ARG B 1 482 ? 77.528  16.712  47.047 1.00 31.62 ? 2513 ARG B NE    1 
ATOM   8410  C CZ    . ARG B 1 482 ? 76.202  16.813  47.077 1.00 31.44 ? 2513 ARG B CZ    1 
ATOM   8411  N NH1   . ARG B 1 482 ? 75.466  16.249  46.125 1.00 28.71 ? 2513 ARG B NH1   1 
ATOM   8412  N NH2   . ARG B 1 482 ? 75.602  17.414  48.093 1.00 31.67 ? 2513 ARG B NH2   1 
ATOM   8413  N N     . PRO B 1 483 ? 83.240  14.365  45.113 1.00 26.45 ? 2514 PRO B N     1 
ATOM   8414  C CA    . PRO B 1 483 ? 84.248  13.416  44.636 1.00 26.02 ? 2514 PRO B CA    1 
ATOM   8415  C C     . PRO B 1 483 ? 84.118  13.029  43.183 1.00 25.37 ? 2514 PRO B C     1 
ATOM   8416  O O     . PRO B 1 483 ? 83.263  12.227  42.822 1.00 24.85 ? 2514 PRO B O     1 
ATOM   8417  C CB    . PRO B 1 483 ? 84.078  12.222  45.559 1.00 24.93 ? 2514 PRO B CB    1 
ATOM   8418  C CG    . PRO B 1 483 ? 83.586  12.838  46.849 1.00 25.74 ? 2514 PRO B CG    1 
ATOM   8419  C CD    . PRO B 1 483 ? 82.716  13.999  46.441 1.00 26.72 ? 2514 PRO B CD    1 
ATOM   8420  N N     . ASP B 1 484 ? 84.983  13.609  42.359 1.00 26.03 ? 2515 ASP B N     1 
ATOM   8421  C CA    . ASP B 1 484 ? 85.024  13.328  40.928 1.00 27.82 ? 2515 ASP B CA    1 
ATOM   8422  C C     . ASP B 1 484 ? 83.701  13.585  40.230 1.00 27.36 ? 2515 ASP B C     1 
ATOM   8423  O O     . ASP B 1 484 ? 83.369  12.917  39.245 1.00 27.34 ? 2515 ASP B O     1 
ATOM   8424  C CB    . ASP B 1 484 ? 85.444  11.876  40.693 1.00 29.11 ? 2515 ASP B CB    1 
ATOM   8425  C CG    . ASP B 1 484 ? 86.857  11.584  41.187 1.00 30.93 ? 2515 ASP B CG    1 
ATOM   8426  O OD1   . ASP B 1 484 ? 87.797  12.300  40.772 1.00 32.26 ? 2515 ASP B OD1   1 
ATOM   8427  O OD2   . ASP B 1 484 ? 87.021  10.634  41.991 1.00 32.58 ? 2515 ASP B OD2   1 
ATOM   8428  N N     . ALA B 1 485 ? 82.959  14.564  40.741 1.00 26.43 ? 2516 ALA B N     1 
ATOM   8429  C CA    . ALA B 1 485 ? 81.663  14.916  40.193 1.00 25.46 ? 2516 ALA B CA    1 
ATOM   8430  C C     . ALA B 1 485 ? 81.750  16.203  39.404 1.00 24.69 ? 2516 ALA B C     1 
ATOM   8431  O O     . ALA B 1 485 ? 82.719  16.949  39.519 1.00 24.84 ? 2516 ALA B O     1 
ATOM   8432  C CB    . ALA B 1 485 ? 80.659  15.066  41.316 1.00 23.39 ? 2516 ALA B CB    1 
ATOM   8433  N N     . ILE B 1 486 ? 80.718  16.460  38.607 1.00 24.64 ? 2517 ILE B N     1 
ATOM   8434  C CA    . ILE B 1 486 ? 80.650  17.673  37.797 1.00 23.58 ? 2517 ILE B CA    1 
ATOM   8435  C C     . ILE B 1 486 ? 80.125  18.858  38.622 1.00 23.14 ? 2517 ILE B C     1 
ATOM   8436  O O     . ILE B 1 486 ? 80.471  20.013  38.354 1.00 23.55 ? 2517 ILE B O     1 
ATOM   8437  C CB    . ILE B 1 486 ? 79.731  17.440  36.555 1.00 23.60 ? 2517 ILE B CB    1 
ATOM   8438  C CG1   . ILE B 1 486 ? 79.748  18.672  35.641 1.00 22.96 ? 2517 ILE B CG1   1 
ATOM   8439  C CG2   . ILE B 1 486 ? 78.319  17.068  37.009 1.00 22.24 ? 2517 ILE B CG2   1 
ATOM   8440  C CD1   . ILE B 1 486 ? 79.052  18.454  34.320 1.00 21.87 ? 2517 ILE B CD1   1 
ATOM   8441  N N     . PHE B 1 487 ? 79.310  18.570  39.641 1.00 23.09 ? 2518 PHE B N     1 
ATOM   8442  C CA    . PHE B 1 487 ? 78.728  19.621  40.482 1.00 22.99 ? 2518 PHE B CA    1 
ATOM   8443  C C     . PHE B 1 487 ? 79.061  19.526  41.956 1.00 24.18 ? 2518 PHE B C     1 
ATOM   8444  O O     . PHE B 1 487 ? 79.528  18.500  42.435 1.00 24.28 ? 2518 PHE B O     1 
ATOM   8445  C CB    . PHE B 1 487 ? 77.195  19.615  40.409 1.00 22.39 ? 2518 PHE B CB    1 
ATOM   8446  C CG    . PHE B 1 487 ? 76.630  19.769  39.023 1.00 21.83 ? 2518 PHE B CG    1 
ATOM   8447  C CD1   . PHE B 1 487 ? 77.181  20.671  38.121 1.00 20.61 ? 2518 PHE B CD1   1 
ATOM   8448  C CD2   . PHE B 1 487 ? 75.500  19.041  38.645 1.00 19.81 ? 2518 PHE B CD2   1 
ATOM   8449  C CE1   . PHE B 1 487 ? 76.620  20.852  36.868 1.00 19.61 ? 2518 PHE B CE1   1 
ATOM   8450  C CE2   . PHE B 1 487 ? 74.934  19.219  37.394 1.00 19.61 ? 2518 PHE B CE2   1 
ATOM   8451  C CZ    . PHE B 1 487 ? 75.495  20.128  36.503 1.00 19.23 ? 2518 PHE B CZ    1 
ATOM   8452  N N     . GLY B 1 488 ? 78.773  20.616  42.667 1.00 25.08 ? 2519 GLY B N     1 
ATOM   8453  C CA    . GLY B 1 488 ? 78.983  20.672  44.100 1.00 26.56 ? 2519 GLY B CA    1 
ATOM   8454  C C     . GLY B 1 488 ? 77.623  20.563  44.771 1.00 27.51 ? 2519 GLY B C     1 
ATOM   8455  O O     . GLY B 1 488 ? 76.602  20.549  44.091 1.00 28.88 ? 2519 GLY B O     1 
ATOM   8456  N N     . GLU B 1 489 ? 77.592  20.506  46.096 1.00 28.12 ? 2520 GLU B N     1 
ATOM   8457  C CA    . GLU B 1 489 ? 76.330  20.366  46.819 1.00 28.06 ? 2520 GLU B CA    1 
ATOM   8458  C C     . GLU B 1 489 ? 75.204  21.338  46.450 1.00 28.10 ? 2520 GLU B C     1 
ATOM   8459  O O     . GLU B 1 489 ? 74.076  20.918  46.181 1.00 28.08 ? 2520 GLU B O     1 
ATOM   8460  C CB    . GLU B 1 489 ? 76.580  20.451  48.333 1.00 28.11 ? 2520 GLU B CB    1 
ATOM   8461  C CG    . GLU B 1 489 ? 75.316  20.305  49.171 1.00 28.30 ? 2520 GLU B CG    1 
ATOM   8462  C CD    . GLU B 1 489 ? 75.510  20.710  50.615 1.00 28.56 ? 2520 GLU B CD    1 
ATOM   8463  O OE1   . GLU B 1 489 ? 74.917  20.060  51.497 1.00 28.76 ? 2520 GLU B OE1   1 
ATOM   8464  O OE2   . GLU B 1 489 ? 76.251  21.680  50.864 1.00 30.77 ? 2520 GLU B OE2   1 
ATOM   8465  N N     . THR B 1 490 ? 75.513  22.632  46.445 1.00 28.13 ? 2521 THR B N     1 
ATOM   8466  C CA    . THR B 1 490 ? 74.518  23.651  46.164 1.00 26.95 ? 2521 THR B CA    1 
ATOM   8467  C C     . THR B 1 490 ? 73.788  23.474  44.844 1.00 27.16 ? 2521 THR B C     1 
ATOM   8468  O O     . THR B 1 490 ? 72.575  23.650  44.767 1.00 26.47 ? 2521 THR B O     1 
ATOM   8469  C CB    . THR B 1 490 ? 75.148  25.045  46.209 1.00 28.27 ? 2521 THR B CB    1 
ATOM   8470  O OG1   . THR B 1 490 ? 75.745  25.246  47.501 1.00 29.71 ? 2521 THR B OG1   1 
ATOM   8471  C CG2   . THR B 1 490 ? 74.097  26.115  45.972 1.00 24.73 ? 2521 THR B CG2   1 
ATOM   8472  N N     . MET B 1 491 ? 74.519  23.115  43.799 1.00 26.99 ? 2522 MET B N     1 
ATOM   8473  C CA    . MET B 1 491 ? 73.899  22.943  42.496 1.00 25.76 ? 2522 MET B CA    1 
ATOM   8474  C C     . MET B 1 491 ? 72.874  21.807  42.509 1.00 25.63 ? 2522 MET B C     1 
ATOM   8475  O O     . MET B 1 491 ? 71.750  21.954  42.016 1.00 25.39 ? 2522 MET B O     1 
ATOM   8476  C CB    . MET B 1 491 ? 74.978  22.669  41.436 1.00 25.08 ? 2522 MET B CB    1 
ATOM   8477  C CG    . MET B 1 491 ? 74.453  22.473  40.013 1.00 23.34 ? 2522 MET B CG    1 
ATOM   8478  S SD    . MET B 1 491 ? 74.070  24.025  39.205 1.00 23.94 ? 2522 MET B SD    1 
ATOM   8479  C CE    . MET B 1 491 ? 75.554  24.412  38.436 1.00 23.44 ? 2522 MET B CE    1 
ATOM   8480  N N     . VAL B 1 492 ? 73.254  20.672  43.078 1.00 24.61 ? 2523 VAL B N     1 
ATOM   8481  C CA    . VAL B 1 492 ? 72.356  19.530  43.107 1.00 23.13 ? 2523 VAL B CA    1 
ATOM   8482  C C     . VAL B 1 492 ? 71.138  19.759  43.979 1.00 24.54 ? 2523 VAL B C     1 
ATOM   8483  O O     . VAL B 1 492 ? 70.011  19.471  43.573 1.00 24.58 ? 2523 VAL B O     1 
ATOM   8484  C CB    . VAL B 1 492 ? 73.080  18.264  43.600 1.00 22.99 ? 2523 VAL B CB    1 
ATOM   8485  C CG1   . VAL B 1 492 ? 72.098  17.091  43.677 1.00 21.75 ? 2523 VAL B CG1   1 
ATOM   8486  C CG2   . VAL B 1 492 ? 74.238  17.937  42.662 1.00 22.98 ? 2523 VAL B CG2   1 
ATOM   8487  N N     . GLU B 1 493 ? 71.366  20.302  45.166 1.00 24.19 ? 2524 GLU B N     1 
ATOM   8488  C CA    . GLU B 1 493 ? 70.284  20.529  46.103 1.00 24.32 ? 2524 GLU B CA    1 
ATOM   8489  C C     . GLU B 1 493 ? 69.272  21.618  45.719 1.00 23.96 ? 2524 GLU B C     1 
ATOM   8490  O O     . GLU B 1 493 ? 68.120  21.577  46.159 1.00 24.33 ? 2524 GLU B O     1 
ATOM   8491  C CB    . GLU B 1 493 ? 70.866  20.792  47.493 1.00 25.46 ? 2524 GLU B CB    1 
ATOM   8492  C CG    . GLU B 1 493 ? 71.559  19.573  48.086 1.00 27.82 ? 2524 GLU B CG    1 
ATOM   8493  C CD    . GLU B 1 493 ? 70.669  18.332  48.078 1.00 30.33 ? 2524 GLU B CD    1 
ATOM   8494  O OE1   . GLU B 1 493 ? 69.694  18.301  48.865 1.00 33.88 ? 2524 GLU B OE1   1 
ATOM   8495  O OE2   . GLU B 1 493 ? 70.938  17.389  47.294 1.00 31.62 ? 2524 GLU B OE2   1 
ATOM   8496  N N     . LEU B 1 494 ? 69.675  22.594  44.919 1.00 22.30 ? 2525 LEU B N     1 
ATOM   8497  C CA    . LEU B 1 494 ? 68.722  23.618  44.512 1.00 21.97 ? 2525 LEU B CA    1 
ATOM   8498  C C     . LEU B 1 494 ? 68.019  23.149  43.241 1.00 22.63 ? 2525 LEU B C     1 
ATOM   8499  O O     . LEU B 1 494 ? 66.814  23.310  43.088 1.00 23.24 ? 2525 LEU B O     1 
ATOM   8500  C CB    . LEU B 1 494 ? 69.423  24.945  44.216 1.00 22.24 ? 2525 LEU B CB    1 
ATOM   8501  C CG    . LEU B 1 494 ? 70.166  25.786  45.264 1.00 21.89 ? 2525 LEU B CG    1 
ATOM   8502  C CD1   . LEU B 1 494 ? 69.628  27.187  45.173 1.00 19.97 ? 2525 LEU B CD1   1 
ATOM   8503  C CD2   . LEU B 1 494 ? 70.040  25.230  46.686 1.00 22.24 ? 2525 LEU B CD2   1 
ATOM   8504  N N     . GLY B 1 495 ? 68.778  22.555  42.329 1.00 22.41 ? 2526 GLY B N     1 
ATOM   8505  C CA    . GLY B 1 495 ? 68.206  22.110  41.071 1.00 23.10 ? 2526 GLY B CA    1 
ATOM   8506  C C     . GLY B 1 495 ? 67.278  20.909  41.094 1.00 23.79 ? 2526 GLY B C     1 
ATOM   8507  O O     . GLY B 1 495 ? 66.309  20.855  40.326 1.00 24.62 ? 2526 GLY B O     1 
ATOM   8508  N N     . ALA B 1 496 ? 67.578  19.941  41.957 1.00 23.67 ? 2527 ALA B N     1 
ATOM   8509  C CA    . ALA B 1 496 ? 66.770  18.731  42.064 1.00 23.44 ? 2527 ALA B CA    1 
ATOM   8510  C C     . ALA B 1 496 ? 65.286  19.041  42.325 1.00 22.74 ? 2527 ALA B C     1 
ATOM   8511  O O     . ALA B 1 496 ? 64.418  18.548  41.616 1.00 22.85 ? 2527 ALA B O     1 
ATOM   8512  C CB    . ALA B 1 496 ? 67.339  17.821  43.153 1.00 24.07 ? 2527 ALA B CB    1 
ATOM   8513  N N     . PRO B 1 497 ? 64.978  19.848  43.352 1.00 22.38 ? 2528 PRO B N     1 
ATOM   8514  C CA    . PRO B 1 497 ? 63.577  20.187  43.640 1.00 21.75 ? 2528 PRO B CA    1 
ATOM   8515  C C     . PRO B 1 497 ? 62.875  20.900  42.476 1.00 22.83 ? 2528 PRO B C     1 
ATOM   8516  O O     . PRO B 1 497 ? 61.698  20.656  42.213 1.00 23.36 ? 2528 PRO B O     1 
ATOM   8517  C CB    . PRO B 1 497 ? 63.654  21.090  44.877 1.00 22.20 ? 2528 PRO B CB    1 
ATOM   8518  C CG    . PRO B 1 497 ? 65.009  20.881  45.440 1.00 21.91 ? 2528 PRO B CG    1 
ATOM   8519  C CD    . PRO B 1 497 ? 65.908  20.457  44.318 1.00 22.12 ? 2528 PRO B CD    1 
ATOM   8520  N N     . PHE B 1 498 ? 63.589  21.790  41.788 1.00 22.56 ? 2529 PHE B N     1 
ATOM   8521  C CA    . PHE B 1 498 ? 63.012  22.520  40.664 1.00 20.25 ? 2529 PHE B CA    1 
ATOM   8522  C C     . PHE B 1 498 ? 62.708  21.566  39.537 1.00 21.72 ? 2529 PHE B C     1 
ATOM   8523  O O     . PHE B 1 498 ? 61.685  21.688  38.860 1.00 21.90 ? 2529 PHE B O     1 
ATOM   8524  C CB    . PHE B 1 498 ? 63.984  23.557  40.148 1.00 20.08 ? 2529 PHE B CB    1 
ATOM   8525  C CG    . PHE B 1 498 ? 64.172  24.717  41.062 1.00 21.41 ? 2529 PHE B CG    1 
ATOM   8526  C CD1   . PHE B 1 498 ? 65.457  25.156  41.375 1.00 21.19 ? 2529 PHE B CD1   1 
ATOM   8527  C CD2   . PHE B 1 498 ? 63.076  25.405  41.581 1.00 21.24 ? 2529 PHE B CD2   1 
ATOM   8528  C CE1   . PHE B 1 498 ? 65.660  26.271  42.193 1.00 21.80 ? 2529 PHE B CE1   1 
ATOM   8529  C CE2   . PHE B 1 498 ? 63.261  26.524  42.402 1.00 22.38 ? 2529 PHE B CE2   1 
ATOM   8530  C CZ    . PHE B 1 498 ? 64.564  26.960  42.708 1.00 21.85 ? 2529 PHE B CZ    1 
ATOM   8531  N N     . SER B 1 499 ? 63.620  20.625  39.328 1.00 21.68 ? 2530 SER B N     1 
ATOM   8532  C CA    . SER B 1 499 ? 63.480  19.621  38.281 1.00 22.64 ? 2530 SER B CA    1 
ATOM   8533  C C     . SER B 1 499 ? 62.319  18.651  38.525 1.00 22.75 ? 2530 SER B C     1 
ATOM   8534  O O     . SER B 1 499 ? 61.520  18.380  37.629 1.00 24.68 ? 2530 SER B O     1 
ATOM   8535  C CB    . SER B 1 499 ? 64.776  18.833  38.161 1.00 21.47 ? 2530 SER B CB    1 
ATOM   8536  O OG    . SER B 1 499 ? 64.541  17.618  37.489 1.00 23.35 ? 2530 SER B OG    1 
ATOM   8537  N N     . LEU B 1 500 ? 62.239  18.113  39.732 1.00 23.07 ? 2531 LEU B N     1 
ATOM   8538  C CA    . LEU B 1 500 ? 61.172  17.188  40.067 1.00 24.16 ? 2531 LEU B CA    1 
ATOM   8539  C C     . LEU B 1 500 ? 59.798  17.815  39.799 1.00 23.89 ? 2531 LEU B C     1 
ATOM   8540  O O     . LEU B 1 500 ? 58.908  17.163  39.258 1.00 22.49 ? 2531 LEU B O     1 
ATOM   8541  C CB    . LEU B 1 500 ? 61.302  16.778  41.533 1.00 26.12 ? 2531 LEU B CB    1 
ATOM   8542  C CG    . LEU B 1 500 ? 60.036  16.400  42.296 1.00 27.46 ? 2531 LEU B CG    1 
ATOM   8543  C CD1   . LEU B 1 500 ? 59.438  15.167  41.692 1.00 29.79 ? 2531 LEU B CD1   1 
ATOM   8544  C CD2   . LEU B 1 500 ? 60.380  16.155  43.738 1.00 28.44 ? 2531 LEU B CD2   1 
ATOM   8545  N N     . LYS B 1 501 ? 59.640  19.081  40.177 1.00 23.82 ? 2532 LYS B N     1 
ATOM   8546  C CA    . LYS B 1 501 ? 58.380  19.792  39.978 1.00 23.15 ? 2532 LYS B CA    1 
ATOM   8547  C C     . LYS B 1 501 ? 58.077  19.982  38.502 1.00 22.90 ? 2532 LYS B C     1 
ATOM   8548  O O     . LYS B 1 501 ? 56.930  19.873  38.073 1.00 22.05 ? 2532 LYS B O     1 
ATOM   8549  C CB    . LYS B 1 501 ? 58.415  21.158  40.668 1.00 23.48 ? 2532 LYS B CB    1 
ATOM   8550  C CG    . LYS B 1 501 ? 58.223  21.072  42.170 1.00 26.38 ? 2532 LYS B CG    1 
ATOM   8551  C CD    . LYS B 1 501 ? 56.835  21.552  42.589 1.00 28.92 ? 2532 LYS B CD    1 
ATOM   8552  C CE    . LYS B 1 501 ? 55.732  20.774  41.894 1.00 27.05 ? 2532 LYS B CE    1 
ATOM   8553  N NZ    . LYS B 1 501 ? 54.430  21.190  42.441 1.00 29.03 ? 2532 LYS B NZ    1 
ATOM   8554  N N     . GLY B 1 502 ? 59.120  20.261  37.727 1.00 21.76 ? 2533 GLY B N     1 
ATOM   8555  C CA    . GLY B 1 502 ? 58.949  20.462  36.303 1.00 20.10 ? 2533 GLY B CA    1 
ATOM   8556  C C     . GLY B 1 502 ? 58.677  19.165  35.578 1.00 20.26 ? 2533 GLY B C     1 
ATOM   8557  O O     . GLY B 1 502 ? 57.988  19.145  34.570 1.00 20.22 ? 2533 GLY B O     1 
ATOM   8558  N N     . LEU B 1 503 ? 59.204  18.067  36.103 1.00 21.04 ? 2534 LEU B N     1 
ATOM   8559  C CA    . LEU B 1 503 ? 59.032  16.757  35.478 1.00 21.20 ? 2534 LEU B CA    1 
ATOM   8560  C C     . LEU B 1 503 ? 57.776  16.026  35.961 1.00 21.41 ? 2534 LEU B C     1 
ATOM   8561  O O     . LEU B 1 503 ? 56.905  15.688  35.156 1.00 21.07 ? 2534 LEU B O     1 
ATOM   8562  C CB    . LEU B 1 503 ? 60.271  15.900  35.749 1.00 20.71 ? 2534 LEU B CB    1 
ATOM   8563  C CG    . LEU B 1 503 ? 61.425  15.800  34.725 1.00 22.24 ? 2534 LEU B CG    1 
ATOM   8564  C CD1   . LEU B 1 503 ? 61.168  16.619  33.459 1.00 20.42 ? 2534 LEU B CD1   1 
ATOM   8565  C CD2   . LEU B 1 503 ? 62.709  16.237  35.394 1.00 21.15 ? 2534 LEU B CD2   1 
ATOM   8566  N N     . MET B 1 504 ? 57.688  15.780  37.269 1.00 22.05 ? 2535 MET B N     1 
ATOM   8567  C CA    . MET B 1 504 ? 56.535  15.082  37.835 1.00 23.63 ? 2535 MET B CA    1 
ATOM   8568  C C     . MET B 1 504 ? 55.277  15.946  37.930 1.00 23.15 ? 2535 MET B C     1 
ATOM   8569  O O     . MET B 1 504 ? 54.162  15.422  37.986 1.00 23.73 ? 2535 MET B O     1 
ATOM   8570  C CB    . MET B 1 504 ? 56.873  14.522  39.221 1.00 24.65 ? 2535 MET B CB    1 
ATOM   8571  C CG    . MET B 1 504 ? 58.094  13.606  39.257 1.00 27.61 ? 2535 MET B CG    1 
ATOM   8572  S SD    . MET B 1 504 ? 58.060  12.232  38.105 1.00 29.93 ? 2535 MET B SD    1 
ATOM   8573  C CE    . MET B 1 504 ? 56.632  11.283  38.726 1.00 29.64 ? 2535 MET B CE    1 
ATOM   8574  N N     . GLY B 1 505 ? 55.456  17.263  37.944 1.00 22.72 ? 2536 GLY B N     1 
ATOM   8575  C CA    . GLY B 1 505 ? 54.323  18.166  38.032 1.00 22.15 ? 2536 GLY B CA    1 
ATOM   8576  C C     . GLY B 1 505 ? 53.556  18.313  36.735 1.00 21.51 ? 2536 GLY B C     1 
ATOM   8577  O O     . GLY B 1 505 ? 52.587  19.057  36.681 1.00 23.21 ? 2536 GLY B O     1 
ATOM   8578  N N     . ASN B 1 506 ? 53.985  17.620  35.683 1.00 22.20 ? 2537 ASN B N     1 
ATOM   8579  C CA    . ASN B 1 506 ? 53.311  17.681  34.381 1.00 20.68 ? 2537 ASN B CA    1 
ATOM   8580  C C     . ASN B 1 506 ? 51.955  16.970  34.487 1.00 20.11 ? 2537 ASN B C     1 
ATOM   8581  O O     . ASN B 1 506 ? 51.834  15.930  35.140 1.00 22.44 ? 2537 ASN B O     1 
ATOM   8582  C CB    . ASN B 1 506 ? 54.194  17.004  33.324 1.00 19.93 ? 2537 ASN B CB    1 
ATOM   8583  C CG    . ASN B 1 506 ? 53.721  17.254  31.896 1.00 18.53 ? 2537 ASN B CG    1 
ATOM   8584  O OD1   . ASN B 1 506 ? 52.778  16.620  31.428 1.00 18.77 ? 2537 ASN B OD1   1 
ATOM   8585  N ND2   . ASN B 1 506 ? 54.387  18.170  31.197 1.00 17.06 ? 2537 ASN B ND2   1 
ATOM   8586  N N     . PRO B 1 507 ? 50.912  17.527  33.856 1.00 20.03 ? 2538 PRO B N     1 
ATOM   8587  C CA    . PRO B 1 507 ? 49.578  16.914  33.905 1.00 19.55 ? 2538 PRO B CA    1 
ATOM   8588  C C     . PRO B 1 507 ? 49.527  15.427  33.535 1.00 19.90 ? 2538 PRO B C     1 
ATOM   8589  O O     . PRO B 1 507 ? 48.759  14.651  34.123 1.00 21.19 ? 2538 PRO B O     1 
ATOM   8590  C CB    . PRO B 1 507 ? 48.745  17.771  32.946 1.00 17.57 ? 2538 PRO B CB    1 
ATOM   8591  C CG    . PRO B 1 507 ? 49.720  18.593  32.194 1.00 18.14 ? 2538 PRO B CG    1 
ATOM   8592  C CD    . PRO B 1 507 ? 50.915  18.764  33.059 1.00 19.43 ? 2538 PRO B CD    1 
ATOM   8593  N N     . ILE B 1 508 ? 50.331  15.018  32.561 1.00 19.94 ? 2539 ILE B N     1 
ATOM   8594  C CA    . ILE B 1 508 ? 50.314  13.624  32.161 1.00 19.87 ? 2539 ILE B CA    1 
ATOM   8595  C C     . ILE B 1 508 ? 50.798  12.699  33.271 1.00 20.92 ? 2539 ILE B C     1 
ATOM   8596  O O     . ILE B 1 508 ? 50.678  11.474  33.161 1.00 22.26 ? 2539 ILE B O     1 
ATOM   8597  C CB    . ILE B 1 508 ? 51.157  13.391  30.900 1.00 20.69 ? 2539 ILE B CB    1 
ATOM   8598  C CG1   . ILE B 1 508 ? 52.637  13.303  31.253 1.00 18.54 ? 2539 ILE B CG1   1 
ATOM   8599  C CG2   . ILE B 1 508 ? 50.912  14.512  29.900 1.00 19.14 ? 2539 ILE B CG2   1 
ATOM   8600  C CD1   . ILE B 1 508 ? 53.403  12.448  30.281 1.00 19.07 ? 2539 ILE B CD1   1 
ATOM   8601  N N     . CYS B 1 509 ? 51.325  13.275  34.349 1.00 20.27 ? 2540 CYS B N     1 
ATOM   8602  C CA    . CYS B 1 509 ? 51.827  12.471  35.456 1.00 21.45 ? 2540 CYS B CA    1 
ATOM   8603  C C     . CYS B 1 509 ? 50.741  12.276  36.501 1.00 21.47 ? 2540 CYS B C     1 
ATOM   8604  O O     . CYS B 1 509 ? 50.894  11.471  37.424 1.00 21.74 ? 2540 CYS B O     1 
ATOM   8605  C CB    . CYS B 1 509 ? 53.047  13.147  36.092 1.00 21.53 ? 2540 CYS B CB    1 
ATOM   8606  S SG    . CYS B 1 509 ? 54.521  13.026  35.060 1.00 21.81 ? 2540 CYS B SG    1 
ATOM   8607  N N     . SER B 1 510 ? 49.654  13.039  36.363 1.00 21.34 ? 2541 SER B N     1 
ATOM   8608  C CA    . SER B 1 510 ? 48.523  12.964  37.289 1.00 19.65 ? 2541 SER B CA    1 
ATOM   8609  C C     . SER B 1 510 ? 47.691  11.723  37.017 1.00 19.96 ? 2541 SER B C     1 
ATOM   8610  O O     . SER B 1 510 ? 47.630  11.220  35.890 1.00 20.49 ? 2541 SER B O     1 
ATOM   8611  C CB    . SER B 1 510 ? 47.653  14.219  37.184 1.00 18.48 ? 2541 SER B CB    1 
ATOM   8612  O OG    . SER B 1 510 ? 47.073  14.327  35.898 1.00 21.35 ? 2541 SER B OG    1 
ATOM   8613  N N     . PRO B 1 511 ? 47.012  11.219  38.049 1.00 20.53 ? 2542 PRO B N     1 
ATOM   8614  C CA    . PRO B 1 511 ? 46.189  10.013  37.896 1.00 21.10 ? 2542 PRO B CA    1 
ATOM   8615  C C     . PRO B 1 511 ? 45.215  10.004  36.717 1.00 21.53 ? 2542 PRO B C     1 
ATOM   8616  O O     . PRO B 1 511 ? 45.179  9.034   35.956 1.00 23.23 ? 2542 PRO B O     1 
ATOM   8617  C CB    . PRO B 1 511 ? 45.484  9.885   39.239 1.00 20.24 ? 2542 PRO B CB    1 
ATOM   8618  C CG    . PRO B 1 511 ? 46.363  10.631  40.198 1.00 20.62 ? 2542 PRO B CG    1 
ATOM   8619  C CD    . PRO B 1 511 ? 46.955  11.764  39.416 1.00 20.89 ? 2542 PRO B CD    1 
ATOM   8620  N N     . GLN B 1 512 ? 44.443  11.077  36.540 1.00 22.33 ? 2543 GLN B N     1 
ATOM   8621  C CA    . GLN B 1 512 ? 43.476  11.114  35.442 1.00 22.95 ? 2543 GLN B CA    1 
ATOM   8622  C C     . GLN B 1 512 ? 44.117  10.988  34.063 1.00 22.20 ? 2543 GLN B C     1 
ATOM   8623  O O     . GLN B 1 512 ? 43.472  10.532  33.108 1.00 23.68 ? 2543 GLN B O     1 
ATOM   8624  C CB    . GLN B 1 512 ? 42.615  12.389  35.500 1.00 25.20 ? 2543 GLN B CB    1 
ATOM   8625  C CG    . GLN B 1 512 ? 41.289  12.279  36.285 1.00 29.51 ? 2543 GLN B CG    1 
ATOM   8626  C CD    . GLN B 1 512 ? 40.633  10.887  36.256 1.00 31.93 ? 2543 GLN B CD    1 
ATOM   8627  O OE1   . GLN B 1 512 ? 41.215  9.895   35.799 1.00 34.45 ? 2543 GLN B OE1   1 
ATOM   8628  N NE2   . GLN B 1 512 ? 39.405  10.819  36.755 1.00 33.86 ? 2543 GLN B NE2   1 
ATOM   8629  N N     . TYR B 1 513 ? 45.388  11.369  33.954 1.00 20.86 ? 2544 TYR B N     1 
ATOM   8630  C CA    . TYR B 1 513 ? 46.075  11.288  32.667 1.00 19.16 ? 2544 TYR B CA    1 
ATOM   8631  C C     . TYR B 1 513 ? 46.928  10.044  32.530 1.00 19.31 ? 2544 TYR B C     1 
ATOM   8632  O O     . TYR B 1 513 ? 46.977  9.441   31.461 1.00 20.32 ? 2544 TYR B O     1 
ATOM   8633  C CB    . TYR B 1 513 ? 46.973  12.498  32.449 1.00 17.45 ? 2544 TYR B CB    1 
ATOM   8634  C CG    . TYR B 1 513 ? 46.268  13.731  31.936 1.00 16.09 ? 2544 TYR B CG    1 
ATOM   8635  C CD1   . TYR B 1 513 ? 46.474  14.178  30.639 1.00 14.41 ? 2544 TYR B CD1   1 
ATOM   8636  C CD2   . TYR B 1 513 ? 45.426  14.480  32.765 1.00 16.21 ? 2544 TYR B CD2   1 
ATOM   8637  C CE1   . TYR B 1 513 ? 45.868  15.342  30.174 1.00 14.27 ? 2544 TYR B CE1   1 
ATOM   8638  C CE2   . TYR B 1 513 ? 44.812  15.655  32.306 1.00 15.77 ? 2544 TYR B CE2   1 
ATOM   8639  C CZ    . TYR B 1 513 ? 45.041  16.077  31.016 1.00 15.69 ? 2544 TYR B CZ    1 
ATOM   8640  O OH    . TYR B 1 513 ? 44.468  17.253  30.571 1.00 17.16 ? 2544 TYR B OH    1 
ATOM   8641  N N     . TRP B 1 514 ? 47.585  9.647   33.614 1.00 19.55 ? 2545 TRP B N     1 
ATOM   8642  C CA    . TRP B 1 514 ? 48.474  8.490   33.581 1.00 19.64 ? 2545 TRP B CA    1 
ATOM   8643  C C     . TRP B 1 514 ? 47.787  7.149   33.381 1.00 20.20 ? 2545 TRP B C     1 
ATOM   8644  O O     . TRP B 1 514 ? 47.723  6.333   34.303 1.00 21.78 ? 2545 TRP B O     1 
ATOM   8645  C CB    . TRP B 1 514 ? 49.327  8.435   34.858 1.00 19.24 ? 2545 TRP B CB    1 
ATOM   8646  C CG    . TRP B 1 514 ? 50.563  7.557   34.709 1.00 18.28 ? 2545 TRP B CG    1 
ATOM   8647  C CD1   . TRP B 1 514 ? 50.848  6.432   35.420 1.00 17.50 ? 2545 TRP B CD1   1 
ATOM   8648  C CD2   . TRP B 1 514 ? 51.622  7.692   33.737 1.00 17.96 ? 2545 TRP B CD2   1 
ATOM   8649  N NE1   . TRP B 1 514 ? 52.000  5.857   34.957 1.00 17.75 ? 2545 TRP B NE1   1 
ATOM   8650  C CE2   . TRP B 1 514 ? 52.500  6.606   33.925 1.00 17.72 ? 2545 TRP B CE2   1 
ATOM   8651  C CE3   . TRP B 1 514 ? 51.908  8.628   32.728 1.00 18.40 ? 2545 TRP B CE3   1 
ATOM   8652  C CZ2   . TRP B 1 514 ? 53.651  6.417   33.142 1.00 17.65 ? 2545 TRP B CZ2   1 
ATOM   8653  C CZ3   . TRP B 1 514 ? 53.056  8.438   31.945 1.00 18.69 ? 2545 TRP B CZ3   1 
ATOM   8654  C CH2   . TRP B 1 514 ? 53.910  7.340   32.161 1.00 17.84 ? 2545 TRP B CH2   1 
ATOM   8655  N N     . LYS B 1 515 ? 47.272  6.922   32.177 1.00 20.46 ? 2546 LYS B N     1 
ATOM   8656  C CA    . LYS B 1 515 ? 46.611  5.664   31.853 1.00 19.41 ? 2546 LYS B CA    1 
ATOM   8657  C C     . LYS B 1 515 ? 46.772  5.428   30.361 1.00 19.06 ? 2546 LYS B C     1 
ATOM   8658  O O     . LYS B 1 515 ? 46.869  6.375   29.581 1.00 20.71 ? 2546 LYS B O     1 
ATOM   8659  C CB    . LYS B 1 515 ? 45.133  5.715   32.238 1.00 19.87 ? 2546 LYS B CB    1 
ATOM   8660  C CG    . LYS B 1 515 ? 44.405  6.952   31.787 1.00 19.46 ? 2546 LYS B CG    1 
ATOM   8661  C CD    . LYS B 1 515 ? 42.936  6.874   32.152 1.00 19.87 ? 2546 LYS B CD    1 
ATOM   8662  C CE    . LYS B 1 515 ? 42.703  7.068   33.643 1.00 22.03 ? 2546 LYS B CE    1 
ATOM   8663  N NZ    . LYS B 1 515 ? 41.302  7.548   33.916 1.00 19.32 ? 2546 LYS B NZ    1 
ATOM   8664  N N     . PRO B 1 516 ? 46.810  4.160   29.944 1.00 18.86 ? 2547 PRO B N     1 
ATOM   8665  C CA    . PRO B 1 516 ? 46.975  3.799   28.535 1.00 19.10 ? 2547 PRO B CA    1 
ATOM   8666  C C     . PRO B 1 516 ? 46.113  4.569   27.540 1.00 19.24 ? 2547 PRO B C     1 
ATOM   8667  O O     . PRO B 1 516 ? 46.626  5.090   26.548 1.00 22.31 ? 2547 PRO B O     1 
ATOM   8668  C CB    . PRO B 1 516 ? 46.662  2.314   28.512 1.00 18.15 ? 2547 PRO B CB    1 
ATOM   8669  C CG    . PRO B 1 516 ? 46.941  1.846   29.896 1.00 15.69 ? 2547 PRO B CG    1 
ATOM   8670  C CD    . PRO B 1 516 ? 46.682  2.975   30.810 1.00 17.30 ? 2547 PRO B CD    1 
ATOM   8671  N N     . SER B 1 517 ? 44.809  4.648   27.799 1.00 19.60 ? 2548 SER B N     1 
ATOM   8672  C CA    . SER B 1 517 ? 43.916  5.328   26.877 1.00 19.02 ? 2548 SER B CA    1 
ATOM   8673  C C     . SER B 1 517 ? 44.333  6.750   26.547 1.00 18.41 ? 2548 SER B C     1 
ATOM   8674  O O     . SER B 1 517 ? 43.998  7.252   25.478 1.00 18.87 ? 2548 SER B O     1 
ATOM   8675  C CB    . SER B 1 517 ? 42.480  5.323   27.406 1.00 18.47 ? 2548 SER B CB    1 
ATOM   8676  O OG    . SER B 1 517 ? 42.426  5.828   28.723 1.00 20.39 ? 2548 SER B OG    1 
ATOM   8677  N N     . THR B 1 518 ? 45.061  7.408   27.443 1.00 18.69 ? 2549 THR B N     1 
ATOM   8678  C CA    . THR B 1 518 ? 45.488  8.789   27.187 1.00 19.00 ? 2549 THR B CA    1 
ATOM   8679  C C     . THR B 1 518 ? 46.503  8.870   26.043 1.00 20.12 ? 2549 THR B C     1 
ATOM   8680  O O     . THR B 1 518 ? 46.623  9.899   25.375 1.00 19.84 ? 2549 THR B O     1 
ATOM   8681  C CB    . THR B 1 518 ? 46.147  9.422   28.431 1.00 19.36 ? 2549 THR B CB    1 
ATOM   8682  O OG1   . THR B 1 518 ? 45.232  9.397   29.531 1.00 19.14 ? 2549 THR B OG1   1 
ATOM   8683  C CG2   . THR B 1 518 ? 46.553  10.865  28.141 1.00 19.24 ? 2549 THR B CG2   1 
ATOM   8684  N N     . PHE B 1 519 ? 47.232  7.782   25.825 1.00 19.77 ? 2550 PHE B N     1 
ATOM   8685  C CA    . PHE B 1 519 ? 48.244  7.760   24.787 1.00 20.19 ? 2550 PHE B CA    1 
ATOM   8686  C C     . PHE B 1 519 ? 47.915  6.826   23.653 1.00 22.04 ? 2550 PHE B C     1 
ATOM   8687  O O     . PHE B 1 519 ? 48.815  6.296   23.010 1.00 22.04 ? 2550 PHE B O     1 
ATOM   8688  C CB    . PHE B 1 519 ? 49.583  7.379   25.393 1.00 17.98 ? 2550 PHE B CB    1 
ATOM   8689  C CG    . PHE B 1 519 ? 49.863  8.080   26.677 1.00 16.05 ? 2550 PHE B CG    1 
ATOM   8690  C CD1   . PHE B 1 519 ? 49.593  7.460   27.895 1.00 14.86 ? 2550 PHE B CD1   1 
ATOM   8691  C CD2   . PHE B 1 519 ? 50.356  9.386   26.676 1.00 15.30 ? 2550 PHE B CD2   1 
ATOM   8692  C CE1   . PHE B 1 519 ? 49.808  8.133   29.113 1.00 14.40 ? 2550 PHE B CE1   1 
ATOM   8693  C CE2   . PHE B 1 519 ? 50.577  10.077  27.888 1.00 14.00 ? 2550 PHE B CE2   1 
ATOM   8694  C CZ    . PHE B 1 519 ? 50.302  9.449   29.109 1.00 14.16 ? 2550 PHE B CZ    1 
ATOM   8695  N N     . GLY B 1 520 ? 46.620  6.628   23.418 1.00 22.84 ? 2551 GLY B N     1 
ATOM   8696  C CA    . GLY B 1 520 ? 46.173  5.775   22.330 1.00 23.43 ? 2551 GLY B CA    1 
ATOM   8697  C C     . GLY B 1 520 ? 46.249  4.285   22.590 1.00 23.50 ? 2551 GLY B C     1 
ATOM   8698  O O     . GLY B 1 520 ? 46.156  3.486   21.656 1.00 23.34 ? 2551 GLY B O     1 
ATOM   8699  N N     . GLY B 1 521 ? 46.429  3.906   23.849 1.00 24.09 ? 2552 GLY B N     1 
ATOM   8700  C CA    . GLY B 1 521 ? 46.498  2.499   24.181 1.00 24.74 ? 2552 GLY B CA    1 
ATOM   8701  C C     . GLY B 1 521 ? 47.835  2.017   24.708 1.00 25.68 ? 2552 GLY B C     1 
ATOM   8702  O O     . GLY B 1 521 ? 48.776  2.795   24.889 1.00 25.30 ? 2552 GLY B O     1 
ATOM   8703  N N     . GLU B 1 522 ? 47.900  0.712   24.949 1.00 26.37 ? 2553 GLU B N     1 
ATOM   8704  C CA    . GLU B 1 522 ? 49.080  0.051   25.463 1.00 26.87 ? 2553 GLU B CA    1 
ATOM   8705  C C     . GLU B 1 522 ? 50.304  0.293   24.605 1.00 26.53 ? 2553 GLU B C     1 
ATOM   8706  O O     . GLU B 1 522 ? 51.403  0.458   25.132 1.00 28.12 ? 2553 GLU B O     1 
ATOM   8707  C CB    . GLU B 1 522 ? 48.820  -1.446  25.577 1.00 30.18 ? 2553 GLU B CB    1 
ATOM   8708  C CG    . GLU B 1 522 ? 48.128  -1.856  26.867 1.00 34.14 ? 2553 GLU B CG    1 
ATOM   8709  C CD    . GLU B 1 522 ? 48.678  -1.125  28.084 1.00 37.60 ? 2553 GLU B CD    1 
ATOM   8710  O OE1   . GLU B 1 522 ? 48.341  0.052   28.280 1.00 42.34 ? 2553 GLU B OE1   1 
ATOM   8711  O OE2   . GLU B 1 522 ? 49.455  -1.718  28.851 1.00 40.67 ? 2553 GLU B OE2   1 
ATOM   8712  N N     . VAL B 1 523 ? 50.121  0.307   23.288 1.00 24.94 ? 2554 VAL B N     1 
ATOM   8713  C CA    . VAL B 1 523 ? 51.231  0.544   22.371 1.00 22.96 ? 2554 VAL B CA    1 
ATOM   8714  C C     . VAL B 1 523 ? 51.863  1.900   22.644 1.00 23.51 ? 2554 VAL B C     1 
ATOM   8715  O O     . VAL B 1 523 ? 53.053  1.983   22.929 1.00 24.38 ? 2554 VAL B O     1 
ATOM   8716  C CB    . VAL B 1 523 ? 50.760  0.491   20.910 1.00 22.44 ? 2554 VAL B CB    1 
ATOM   8717  C CG1   . VAL B 1 523 ? 51.852  0.940   19.976 1.00 20.55 ? 2554 VAL B CG1   1 
ATOM   8718  C CG2   . VAL B 1 523 ? 50.357  -0.913  20.565 1.00 22.18 ? 2554 VAL B CG2   1 
ATOM   8719  N N     . GLY B 1 524 ? 51.060  2.960   22.572 1.00 23.71 ? 2555 GLY B N     1 
ATOM   8720  C CA    . GLY B 1 524 ? 51.563  4.306   22.803 1.00 22.36 ? 2555 GLY B CA    1 
ATOM   8721  C C     . GLY B 1 524 ? 52.124  4.481   24.197 1.00 21.17 ? 2555 GLY B C     1 
ATOM   8722  O O     . GLY B 1 524 ? 53.100  5.190   24.424 1.00 21.53 ? 2555 GLY B O     1 
ATOM   8723  N N     . PHE B 1 525 ? 51.507  3.814   25.151 1.00 20.95 ? 2556 PHE B N     1 
ATOM   8724  C CA    . PHE B 1 525 ? 51.959  3.894   26.532 1.00 20.28 ? 2556 PHE B CA    1 
ATOM   8725  C C     . PHE B 1 525 ? 53.349  3.255   26.671 1.00 20.52 ? 2556 PHE B C     1 
ATOM   8726  O O     . PHE B 1 525 ? 54.182  3.698   27.462 1.00 20.73 ? 2556 PHE B O     1 
ATOM   8727  C CB    . PHE B 1 525 ? 50.956  3.168   27.430 1.00 18.84 ? 2556 PHE B CB    1 
ATOM   8728  C CG    . PHE B 1 525 ? 50.997  3.591   28.867 1.00 16.56 ? 2556 PHE B CG    1 
ATOM   8729  C CD1   . PHE B 1 525 ? 51.209  4.915   29.213 1.00 16.07 ? 2556 PHE B CD1   1 
ATOM   8730  C CD2   . PHE B 1 525 ? 50.759  2.672   29.875 1.00 16.44 ? 2556 PHE B CD2   1 
ATOM   8731  C CE1   . PHE B 1 525 ? 51.176  5.328   30.541 1.00 14.68 ? 2556 PHE B CE1   1 
ATOM   8732  C CE2   . PHE B 1 525 ? 50.721  3.072   31.216 1.00 15.92 ? 2556 PHE B CE2   1 
ATOM   8733  C CZ    . PHE B 1 525 ? 50.928  4.402   31.546 1.00 15.30 ? 2556 PHE B CZ    1 
ATOM   8734  N N     . LYS B 1 526 ? 53.594  2.210   25.895 1.00 21.05 ? 2557 LYS B N     1 
ATOM   8735  C CA    . LYS B 1 526 ? 54.877  1.527   25.953 1.00 21.28 ? 2557 LYS B CA    1 
ATOM   8736  C C     . LYS B 1 526 ? 55.978  2.396   25.398 1.00 21.34 ? 2557 LYS B C     1 
ATOM   8737  O O     . LYS B 1 526 ? 57.114  2.327   25.848 1.00 22.56 ? 2557 LYS B O     1 
ATOM   8738  C CB    . LYS B 1 526 ? 54.844  0.219   25.172 1.00 22.31 ? 2557 LYS B CB    1 
ATOM   8739  C CG    . LYS B 1 526 ? 55.886  -0.777  25.649 1.00 24.42 ? 2557 LYS B CG    1 
ATOM   8740  C CD    . LYS B 1 526 ? 56.059  -1.907  24.661 1.00 23.32 ? 2557 LYS B CD    1 
ATOM   8741  C CE    . LYS B 1 526 ? 57.005  -2.957  25.207 1.00 24.74 ? 2557 LYS B CE    1 
ATOM   8742  N NZ    . LYS B 1 526 ? 57.219  -4.063  24.233 1.00 22.18 ? 2557 LYS B NZ    1 
ATOM   8743  N N     . ILE B 1 527 ? 55.654  3.209   24.404 1.00 20.52 ? 2558 ILE B N     1 
ATOM   8744  C CA    . ILE B 1 527 ? 56.657  4.097   23.824 1.00 18.71 ? 2558 ILE B CA    1 
ATOM   8745  C C     . ILE B 1 527 ? 57.241  4.964   24.937 1.00 18.96 ? 2558 ILE B C     1 
ATOM   8746  O O     . ILE B 1 527 ? 58.452  5.148   25.053 1.00 18.88 ? 2558 ILE B O     1 
ATOM   8747  C CB    . ILE B 1 527 ? 56.039  5.004   22.745 1.00 17.86 ? 2558 ILE B CB    1 
ATOM   8748  C CG1   . ILE B 1 527 ? 55.680  4.173   21.506 1.00 17.20 ? 2558 ILE B CG1   1 
ATOM   8749  C CG2   . ILE B 1 527 ? 57.008  6.087   22.353 1.00 17.05 ? 2558 ILE B CG2   1 
ATOM   8750  C CD1   . ILE B 1 527 ? 54.740  4.902   20.524 1.00 16.49 ? 2558 ILE B CD1   1 
ATOM   8751  N N     . ILE B 1 528 ? 56.363  5.482   25.775 1.00 19.92 ? 2559 ILE B N     1 
ATOM   8752  C CA    . ILE B 1 528 ? 56.794  6.325   26.873 1.00 18.76 ? 2559 ILE B CA    1 
ATOM   8753  C C     . ILE B 1 528 ? 57.622  5.558   27.895 1.00 20.15 ? 2559 ILE B C     1 
ATOM   8754  O O     . ILE B 1 528 ? 58.689  6.000   28.315 1.00 21.07 ? 2559 ILE B O     1 
ATOM   8755  C CB    . ILE B 1 528 ? 55.598  6.902   27.630 1.00 18.97 ? 2559 ILE B CB    1 
ATOM   8756  C CG1   . ILE B 1 528 ? 54.795  7.828   26.726 1.00 17.96 ? 2559 ILE B CG1   1 
ATOM   8757  C CG2   . ILE B 1 528 ? 56.083  7.649   28.871 1.00 17.48 ? 2559 ILE B CG2   1 
ATOM   8758  C CD1   . ILE B 1 528 ? 53.645  8.474   27.452 1.00 17.13 ? 2559 ILE B CD1   1 
ATOM   8759  N N     . ASN B 1 529 ? 57.117  4.401   28.289 1.00 19.74 ? 2560 ASN B N     1 
ATOM   8760  C CA    . ASN B 1 529 ? 57.765  3.605   29.300 1.00 19.78 ? 2560 ASN B CA    1 
ATOM   8761  C C     . ASN B 1 529 ? 59.015  2.835   28.917 1.00 20.30 ? 2560 ASN B C     1 
ATOM   8762  O O     . ASN B 1 529 ? 59.669  2.269   29.782 1.00 20.60 ? 2560 ASN B O     1 
ATOM   8763  C CB    . ASN B 1 529 ? 56.729  2.680   29.932 1.00 21.22 ? 2560 ASN B CB    1 
ATOM   8764  C CG    . ASN B 1 529 ? 55.638  3.456   30.665 1.00 22.53 ? 2560 ASN B CG    1 
ATOM   8765  O OD1   . ASN B 1 529 ? 55.932  4.266   31.550 1.00 20.60 ? 2560 ASN B OD1   1 
ATOM   8766  N ND2   . ASN B 1 529 ? 54.375  3.220   30.293 1.00 23.40 ? 2560 ASN B ND2   1 
ATOM   8767  N N     . THR B 1 530 ? 59.365  2.810   27.642 1.00 19.79 ? 2561 THR B N     1 
ATOM   8768  C CA    . THR B 1 530 ? 60.581  2.119   27.240 1.00 20.94 ? 2561 THR B CA    1 
ATOM   8769  C C     . THR B 1 530 ? 61.539  3.108   26.584 1.00 22.21 ? 2561 THR B C     1 
ATOM   8770  O O     . THR B 1 530 ? 62.590  2.727   26.079 1.00 23.49 ? 2561 THR B O     1 
ATOM   8771  C CB    . THR B 1 530 ? 60.288  0.984   26.249 1.00 20.42 ? 2561 THR B CB    1 
ATOM   8772  O OG1   . THR B 1 530 ? 59.614  1.507   25.103 1.00 22.40 ? 2561 THR B OG1   1 
ATOM   8773  C CG2   . THR B 1 530 ? 59.422  -0.059  26.889 1.00 19.76 ? 2561 THR B CG2   1 
ATOM   8774  N N     . ALA B 1 531 ? 61.171  4.384   26.605 1.00 22.56 ? 2562 ALA B N     1 
ATOM   8775  C CA    . ALA B 1 531 ? 61.984  5.437   25.999 1.00 22.38 ? 2562 ALA B CA    1 
ATOM   8776  C C     . ALA B 1 531 ? 63.367  5.644   26.638 1.00 21.89 ? 2562 ALA B C     1 
ATOM   8777  O O     . ALA B 1 531 ? 63.526  5.591   27.858 1.00 21.01 ? 2562 ALA B O     1 
ATOM   8778  C CB    . ALA B 1 531 ? 61.215  6.735   26.030 1.00 23.65 ? 2562 ALA B CB    1 
ATOM   8779  N N     . SER B 1 532 ? 64.369  5.882   25.797 1.00 21.96 ? 2563 SER B N     1 
ATOM   8780  C CA    . SER B 1 532 ? 65.730  6.126   26.265 1.00 21.67 ? 2563 SER B CA    1 
ATOM   8781  C C     . SER B 1 532 ? 66.447  6.960   25.214 1.00 21.78 ? 2563 SER B C     1 
ATOM   8782  O O     . SER B 1 532 ? 66.018  7.024   24.065 1.00 21.24 ? 2563 SER B O     1 
ATOM   8783  C CB    . SER B 1 532 ? 66.479  4.810   26.464 1.00 21.73 ? 2563 SER B CB    1 
ATOM   8784  O OG    . SER B 1 532 ? 66.854  4.261   25.216 1.00 23.72 ? 2563 SER B OG    1 
ATOM   8785  N N     . ILE B 1 533 ? 67.548  7.595   25.594 1.00 22.68 ? 2564 ILE B N     1 
ATOM   8786  C CA    . ILE B 1 533 ? 68.271  8.412   24.632 1.00 23.25 ? 2564 ILE B CA    1 
ATOM   8787  C C     . ILE B 1 533 ? 68.836  7.547   23.494 1.00 24.13 ? 2564 ILE B C     1 
ATOM   8788  O O     . ILE B 1 533 ? 68.982  8.012   22.354 1.00 25.26 ? 2564 ILE B O     1 
ATOM   8789  C CB    . ILE B 1 533 ? 69.396  9.234   25.335 1.00 22.90 ? 2564 ILE B CB    1 
ATOM   8790  C CG1   . ILE B 1 533 ? 70.013  10.220  24.347 1.00 21.62 ? 2564 ILE B CG1   1 
ATOM   8791  C CG2   . ILE B 1 533 ? 70.445  8.309   25.941 1.00 21.74 ? 2564 ILE B CG2   1 
ATOM   8792  C CD1   . ILE B 1 533 ? 69.069  11.312  23.918 1.00 20.41 ? 2564 ILE B CD1   1 
ATOM   8793  N N     . GLN B 1 534 ? 69.134  6.282   23.782 1.00 25.06 ? 2565 GLN B N     1 
ATOM   8794  C CA    . GLN B 1 534 ? 69.660  5.400   22.747 1.00 24.97 ? 2565 GLN B CA    1 
ATOM   8795  C C     . GLN B 1 534 ? 68.571  5.031   21.745 1.00 25.37 ? 2565 GLN B C     1 
ATOM   8796  O O     . GLN B 1 534 ? 68.829  4.982   20.534 1.00 26.25 ? 2565 GLN B O     1 
ATOM   8797  C CB    . GLN B 1 534 ? 70.253  4.128   23.367 1.00 27.72 ? 2565 GLN B CB    1 
ATOM   8798  C CG    . GLN B 1 534 ? 70.683  3.063   22.337 1.00 32.92 ? 2565 GLN B CG    1 
ATOM   8799  C CD    . GLN B 1 534 ? 71.811  3.537   21.406 1.00 34.93 ? 2565 GLN B CD    1 
ATOM   8800  O OE1   . GLN B 1 534 ? 72.996  3.342   21.706 1.00 39.43 ? 2565 GLN B OE1   1 
ATOM   8801  N NE2   . GLN B 1 534 ? 71.448  4.158   20.279 1.00 33.57 ? 2565 GLN B NE2   1 
ATOM   8802  N N     . SER B 1 535 ? 67.361  4.768   22.241 1.00 24.39 ? 2566 SER B N     1 
ATOM   8803  C CA    . SER B 1 535 ? 66.239  4.416   21.365 1.00 23.40 ? 2566 SER B CA    1 
ATOM   8804  C C     . SER B 1 535 ? 65.874  5.584   20.470 1.00 22.12 ? 2566 SER B C     1 
ATOM   8805  O O     . SER B 1 535 ? 65.638  5.425   19.278 1.00 23.54 ? 2566 SER B O     1 
ATOM   8806  C CB    . SER B 1 535 ? 65.005  4.052   22.179 1.00 23.82 ? 2566 SER B CB    1 
ATOM   8807  O OG    . SER B 1 535 ? 65.275  2.980   23.055 1.00 26.16 ? 2566 SER B OG    1 
ATOM   8808  N N     . LEU B 1 536 ? 65.812  6.762   21.065 1.00 20.97 ? 2567 LEU B N     1 
ATOM   8809  C CA    . LEU B 1 536 ? 65.457  7.959   20.334 1.00 20.65 ? 2567 LEU B CA    1 
ATOM   8810  C C     . LEU B 1 536 ? 66.366  8.140   19.140 1.00 19.73 ? 2567 LEU B C     1 
ATOM   8811  O O     . LEU B 1 536 ? 65.914  8.426   18.044 1.00 21.74 ? 2567 LEU B O     1 
ATOM   8812  C CB    . LEU B 1 536 ? 65.549  9.163   21.265 1.00 20.04 ? 2567 LEU B CB    1 
ATOM   8813  C CG    . LEU B 1 536 ? 65.249  10.526  20.650 1.00 21.41 ? 2567 LEU B CG    1 
ATOM   8814  C CD1   . LEU B 1 536 ? 63.749  10.694  20.446 1.00 20.40 ? 2567 LEU B CD1   1 
ATOM   8815  C CD2   . LEU B 1 536 ? 65.797  11.602  21.558 1.00 21.32 ? 2567 LEU B CD2   1 
ATOM   8816  N N     . ILE B 1 537 ? 67.658  7.962   19.354 1.00 19.61 ? 2568 ILE B N     1 
ATOM   8817  C CA    . ILE B 1 537 ? 68.632  8.118   18.286 1.00 21.40 ? 2568 ILE B CA    1 
ATOM   8818  C C     . ILE B 1 537 ? 68.576  6.922   17.353 1.00 20.99 ? 2568 ILE B C     1 
ATOM   8819  O O     . ILE B 1 537 ? 68.525  7.071   16.141 1.00 21.91 ? 2568 ILE B O     1 
ATOM   8820  C CB    . ILE B 1 537 ? 70.066  8.263   18.877 1.00 21.86 ? 2568 ILE B CB    1 
ATOM   8821  C CG1   . ILE B 1 537 ? 70.374  9.738   19.105 1.00 22.36 ? 2568 ILE B CG1   1 
ATOM   8822  C CG2   . ILE B 1 537 ? 71.118  7.651   17.949 1.00 21.62 ? 2568 ILE B CG2   1 
ATOM   8823  C CD1   . ILE B 1 537 ? 69.481  10.398  20.150 1.00 25.08 ? 2568 ILE B CD1   1 
ATOM   8824  N N     . CYS B 1 538 ? 68.578  5.729   17.920 1.00 20.73 ? 2569 CYS B N     1 
ATOM   8825  C CA    . CYS B 1 538 ? 68.539  4.527   17.117 1.00 22.42 ? 2569 CYS B CA    1 
ATOM   8826  C C     . CYS B 1 538 ? 67.386  4.528   16.126 1.00 22.66 ? 2569 CYS B C     1 
ATOM   8827  O O     . CYS B 1 538 ? 67.563  4.226   14.948 1.00 22.58 ? 2569 CYS B O     1 
ATOM   8828  C CB    . CYS B 1 538 ? 68.412  3.310   18.016 1.00 23.31 ? 2569 CYS B CB    1 
ATOM   8829  S SG    . CYS B 1 538 ? 68.556  1.765   17.075 1.00 27.31 ? 2569 CYS B SG    1 
ATOM   8830  N N     . ASN B 1 539 ? 66.202  4.863   16.620 1.00 22.31 ? 2570 ASN B N     1 
ATOM   8831  C CA    . ASN B 1 539 ? 65.001  4.877   15.802 1.00 23.06 ? 2570 ASN B CA    1 
ATOM   8832  C C     . ASN B 1 539 ? 64.983  5.983   14.789 1.00 23.04 ? 2570 ASN B C     1 
ATOM   8833  O O     . ASN B 1 539 ? 64.295  5.865   13.777 1.00 24.23 ? 2570 ASN B O     1 
ATOM   8834  C CB    . ASN B 1 539 ? 63.755  5.065   16.661 1.00 21.90 ? 2570 ASN B CB    1 
ATOM   8835  C CG    . ASN B 1 539 ? 63.403  3.849   17.442 1.00 22.34 ? 2570 ASN B CG    1 
ATOM   8836  O OD1   . ASN B 1 539 ? 63.585  2.724   16.976 1.00 23.57 ? 2570 ASN B OD1   1 
ATOM   8837  N ND2   . ASN B 1 539 ? 62.895  4.055   18.647 1.00 22.00 ? 2570 ASN B ND2   1 
ATOM   8838  N N     . ASN B 1 540 ? 65.722  7.058   15.045 1.00 23.00 ? 2571 ASN B N     1 
ATOM   8839  C CA    . ASN B 1 540 ? 65.666  8.200   14.142 1.00 23.98 ? 2571 ASN B CA    1 
ATOM   8840  C C     . ASN B 1 540 ? 66.930  8.646   13.451 1.00 24.12 ? 2571 ASN B C     1 
ATOM   8841  O O     . ASN B 1 540 ? 66.917  9.643   12.734 1.00 24.56 ? 2571 ASN B O     1 
ATOM   8842  C CB    . ASN B 1 540 ? 65.048  9.388   14.890 1.00 22.74 ? 2571 ASN B CB    1 
ATOM   8843  C CG    . ASN B 1 540 ? 63.654  9.077   15.415 1.00 21.17 ? 2571 ASN B CG    1 
ATOM   8844  O OD1   . ASN B 1 540 ? 62.710  8.936   14.641 1.00 20.64 ? 2571 ASN B OD1   1 
ATOM   8845  N ND2   . ASN B 1 540 ? 63.521  8.958   16.730 1.00 18.87 ? 2571 ASN B ND2   1 
ATOM   8846  N N     . VAL B 1 541 ? 68.020  7.924   13.661 1.00 25.99 ? 2572 VAL B N     1 
ATOM   8847  C CA    . VAL B 1 541 ? 69.279  8.293   13.035 1.00 26.57 ? 2572 VAL B CA    1 
ATOM   8848  C C     . VAL B 1 541 ? 69.742  7.112   12.206 1.00 27.30 ? 2572 VAL B C     1 
ATOM   8849  O O     . VAL B 1 541 ? 69.876  6.002   12.710 1.00 27.32 ? 2572 VAL B O     1 
ATOM   8850  C CB    . VAL B 1 541 ? 70.340  8.677   14.102 1.00 26.29 ? 2572 VAL B CB    1 
ATOM   8851  C CG1   . VAL B 1 541 ? 71.625  9.165   13.438 1.00 24.71 ? 2572 VAL B CG1   1 
ATOM   8852  C CG2   . VAL B 1 541 ? 69.785  9.774   14.990 1.00 24.40 ? 2572 VAL B CG2   1 
ATOM   8853  N N     . LYS B 1 542 ? 69.957  7.354   10.921 1.00 28.61 ? 2573 LYS B N     1 
ATOM   8854  C CA    . LYS B 1 542 ? 70.391  6.299   10.022 1.00 30.03 ? 2573 LYS B CA    1 
ATOM   8855  C C     . LYS B 1 542 ? 71.584  5.556   10.607 1.00 29.75 ? 2573 LYS B C     1 
ATOM   8856  O O     . LYS B 1 542 ? 72.572  6.170   11.015 1.00 29.39 ? 2573 LYS B O     1 
ATOM   8857  C CB    . LYS B 1 542 ? 70.765  6.895   8.668  1.00 32.53 ? 2573 LYS B CB    1 
ATOM   8858  C CG    . LYS B 1 542 ? 71.210  5.866   7.653  1.00 35.30 ? 2573 LYS B CG    1 
ATOM   8859  C CD    . LYS B 1 542 ? 71.113  6.400   6.234  1.00 38.01 ? 2573 LYS B CD    1 
ATOM   8860  C CE    . LYS B 1 542 ? 71.002  5.247   5.240  1.00 42.02 ? 2573 LYS B CE    1 
ATOM   8861  N NZ    . LYS B 1 542 ? 71.620  5.568   3.911  1.00 42.92 ? 2573 LYS B NZ    1 
ATOM   8862  N N     . GLY B 1 543 ? 71.483  4.233   10.658 1.00 29.57 ? 2574 GLY B N     1 
ATOM   8863  C CA    . GLY B 1 543 ? 72.567  3.431   11.192 1.00 28.20 ? 2574 GLY B CA    1 
ATOM   8864  C C     . GLY B 1 543 ? 72.439  3.090   12.661 1.00 28.72 ? 2574 GLY B C     1 
ATOM   8865  O O     . GLY B 1 543 ? 73.148  2.224   13.181 1.00 29.70 ? 2574 GLY B O     1 
ATOM   8866  N N     . CYS B 1 544 ? 71.534  3.762   13.349 1.00 28.20 ? 2575 CYS B N     1 
ATOM   8867  C CA    . CYS B 1 544 ? 71.358  3.501   14.760 1.00 28.41 ? 2575 CYS B CA    1 
ATOM   8868  C C     . CYS B 1 544 ? 72.712  3.537   15.465 1.00 28.32 ? 2575 CYS B C     1 
ATOM   8869  O O     . CYS B 1 544 ? 73.156  2.525   16.003 1.00 29.74 ? 2575 CYS B O     1 
ATOM   8870  C CB    . CYS B 1 544 ? 70.704  2.139   14.970 1.00 27.06 ? 2575 CYS B CB    1 
ATOM   8871  S SG    . CYS B 1 544 ? 70.554  1.673   16.722 1.00 28.40 ? 2575 CYS B SG    1 
ATOM   8872  N N     . PRO B 1 545 ? 73.389  4.706   15.468 1.00 28.50 ? 2576 PRO B N     1 
ATOM   8873  C CA    . PRO B 1 545 ? 74.691  4.803   16.130 1.00 29.56 ? 2576 PRO B CA    1 
ATOM   8874  C C     . PRO B 1 545 ? 74.538  4.633   17.619 1.00 29.57 ? 2576 PRO B C     1 
ATOM   8875  O O     . PRO B 1 545 ? 73.496  4.971   18.196 1.00 29.86 ? 2576 PRO B O     1 
ATOM   8876  C CB    . PRO B 1 545 ? 75.192  6.208   15.806 1.00 28.58 ? 2576 PRO B CB    1 
ATOM   8877  C CG    . PRO B 1 545 ? 74.180  6.839   14.959 1.00 28.67 ? 2576 PRO B CG    1 
ATOM   8878  C CD    . PRO B 1 545 ? 72.965  5.988   14.884 1.00 27.84 ? 2576 PRO B CD    1 
ATOM   8879  N N     . PHE B 1 546 ? 75.579  4.111   18.248 1.00 30.67 ? 2577 PHE B N     1 
ATOM   8880  C CA    . PHE B 1 546 ? 75.503  3.944   19.677 1.00 32.05 ? 2577 PHE B CA    1 
ATOM   8881  C C     . PHE B 1 546 ? 75.565  5.344   20.264 1.00 29.77 ? 2577 PHE B C     1 
ATOM   8882  O O     . PHE B 1 546 ? 76.166  6.248   19.674 1.00 30.53 ? 2577 PHE B O     1 
ATOM   8883  C CB    . PHE B 1 546 ? 76.673  3.113   20.213 1.00 32.98 ? 2577 PHE B CB    1 
ATOM   8884  C CG    . PHE B 1 546 ? 76.800  3.179   21.707 1.00 34.88 ? 2577 PHE B CG    1 
ATOM   8885  C CD1   . PHE B 1 546 ? 75.995  2.376   22.519 1.00 34.96 ? 2577 PHE B CD1   1 
ATOM   8886  C CD2   . PHE B 1 546 ? 77.656  4.108   22.305 1.00 34.98 ? 2577 PHE B CD2   1 
ATOM   8887  C CE1   . PHE B 1 546 ? 76.033  2.500   23.901 1.00 35.34 ? 2577 PHE B CE1   1 
ATOM   8888  C CE2   . PHE B 1 546 ? 77.705  4.245   23.691 1.00 36.37 ? 2577 PHE B CE2   1 
ATOM   8889  C CZ    . PHE B 1 546 ? 76.889  3.438   24.490 1.00 36.62 ? 2577 PHE B CZ    1 
ATOM   8890  N N     . THR B 1 547 ? 74.927  5.536   21.412 1.00 28.21 ? 2578 THR B N     1 
ATOM   8891  C CA    . THR B 1 547 ? 74.983  6.835   22.037 1.00 27.73 ? 2578 THR B CA    1 
ATOM   8892  C C     . THR B 1 547 ? 74.657  6.784   23.511 1.00 26.62 ? 2578 THR B C     1 
ATOM   8893  O O     . THR B 1 547 ? 74.075  5.827   23.991 1.00 26.09 ? 2578 THR B O     1 
ATOM   8894  C CB    . THR B 1 547 ? 74.058  7.835   21.329 1.00 27.88 ? 2578 THR B CB    1 
ATOM   8895  O OG1   . THR B 1 547 ? 74.576  9.156   21.505 1.00 26.52 ? 2578 THR B OG1   1 
ATOM   8896  C CG2   . THR B 1 547 ? 72.664  7.792   21.909 1.00 27.72 ? 2578 THR B CG2   1 
ATOM   8897  N N     . SER B 1 548 ? 75.071  7.823   24.223 1.00 26.84 ? 2579 SER B N     1 
ATOM   8898  C CA    . SER B 1 548 ? 74.831  7.934   25.652 1.00 27.60 ? 2579 SER B CA    1 
ATOM   8899  C C     . SER B 1 548 ? 75.240  9.342   26.062 1.00 27.39 ? 2579 SER B C     1 
ATOM   8900  O O     . SER B 1 548 ? 75.777  10.090  25.246 1.00 29.41 ? 2579 SER B O     1 
ATOM   8901  C CB    . SER B 1 548 ? 75.666  6.901   26.397 1.00 26.80 ? 2579 SER B CB    1 
ATOM   8902  O OG    . SER B 1 548 ? 76.838  7.487   26.915 1.00 26.60 ? 2579 SER B OG    1 
ATOM   8903  N N     . PHE B 1 549 ? 75.004  9.707   27.317 1.00 28.88 ? 2580 PHE B N     1 
ATOM   8904  C CA    . PHE B 1 549 ? 75.351  11.044  27.777 1.00 28.42 ? 2580 PHE B CA    1 
ATOM   8905  C C     . PHE B 1 549 ? 76.766  11.134  28.317 1.00 29.45 ? 2580 PHE B C     1 
ATOM   8906  O O     . PHE B 1 549 ? 77.237  12.215  28.666 1.00 29.01 ? 2580 PHE B O     1 
ATOM   8907  C CB    . PHE B 1 549 ? 74.346  11.507  28.837 1.00 27.72 ? 2580 PHE B CB    1 
ATOM   8908  C CG    . PHE B 1 549 ? 73.015  11.913  28.270 1.00 24.74 ? 2580 PHE B CG    1 
ATOM   8909  C CD1   . PHE B 1 549 ? 71.836  11.608  28.934 1.00 24.93 ? 2580 PHE B CD1   1 
ATOM   8910  C CD2   . PHE B 1 549 ? 72.942  12.595  27.066 1.00 23.19 ? 2580 PHE B CD2   1 
ATOM   8911  C CE1   . PHE B 1 549 ? 70.596  11.984  28.397 1.00 23.60 ? 2580 PHE B CE1   1 
ATOM   8912  C CE2   . PHE B 1 549 ? 71.719  12.971  26.526 1.00 21.08 ? 2580 PHE B CE2   1 
ATOM   8913  C CZ    . PHE B 1 549 ? 70.547  12.666  27.190 1.00 21.60 ? 2580 PHE B CZ    1 
ATOM   8914  N N     . ASN B 1 550 ? 77.442  9.994   28.405 1.00 33.01 ? 2581 ASN B N     1 
ATOM   8915  C CA    . ASN B 1 550 ? 78.818  9.984   28.882 1.00 36.71 ? 2581 ASN B CA    1 
ATOM   8916  C C     . ASN B 1 550 ? 79.744  9.470   27.800 1.00 38.98 ? 2581 ASN B C     1 
ATOM   8917  O O     . ASN B 1 550 ? 79.341  8.743   26.894 1.00 38.16 ? 2581 ASN B O     1 
ATOM   8918  C CB    . ASN B 1 550 ? 78.980  9.133   30.147 1.00 37.02 ? 2581 ASN B CB    1 
ATOM   8919  C CG    . ASN B 1 550 ? 78.386  7.752   30.004 1.00 39.74 ? 2581 ASN B CG    1 
ATOM   8920  O OD1   . ASN B 1 550 ? 79.014  6.847   29.455 1.00 39.96 ? 2581 ASN B OD1   1 
ATOM   8921  N ND2   . ASN B 1 550 ? 77.163  7.575   30.515 1.00 41.72 ? 2581 ASN B ND2   1 
ATOM   8922  N N     . VAL B 1 551 ? 80.999  9.872   27.901 1.00 42.66 ? 2582 VAL B N     1 
ATOM   8923  C CA    . VAL B 1 551 ? 82.002  9.475   26.939 1.00 46.25 ? 2582 VAL B CA    1 
ATOM   8924  C C     . VAL B 1 551 ? 82.455  8.069   27.324 1.00 49.21 ? 2582 VAL B C     1 
ATOM   8925  O O     . VAL B 1 551 ? 83.354  7.915   28.131 1.00 51.59 ? 2582 VAL B O     1 
ATOM   8926  C CB    . VAL B 1 551 ? 83.182  10.476  26.984 1.00 45.13 ? 2582 VAL B CB    1 
ATOM   8927  C CG1   . VAL B 1 551 ? 84.426  9.853   26.424 1.00 45.31 ? 2582 VAL B CG1   1 
ATOM   8928  C CG2   . VAL B 1 551 ? 82.821  11.730  26.204 1.00 42.61 ? 2582 VAL B CG2   1 
ATOM   8929  N N     . GLN B 1 552 ? 81.807  7.050   26.764 1.00 52.90 ? 2583 GLN B N     1 
ATOM   8930  C CA    . GLN B 1 552 ? 82.128  5.636   27.034 1.00 56.55 ? 2583 GLN B CA    1 
ATOM   8931  C C     . GLN B 1 552 ? 82.857  5.363   28.362 1.00 58.23 ? 2583 GLN B C     1 
ATOM   8932  O O     . GLN B 1 552 ? 84.009  4.848   28.313 1.00 59.38 ? 2583 GLN B O     1 
ATOM   8933  C CB    . GLN B 1 552 ? 82.958  5.050   25.886 1.00 57.40 ? 2583 GLN B CB    1 
ATOM   8934  C CG    . GLN B 1 552 ? 83.975  6.013   25.305 1.00 61.94 ? 2583 GLN B CG    1 
ATOM   8935  C CD    . GLN B 1 552 ? 83.330  7.105   24.448 1.00 64.51 ? 2583 GLN B CD    1 
ATOM   8936  O OE1   . GLN B 1 552 ? 83.896  8.184   24.270 1.00 67.97 ? 2583 GLN B OE1   1 
ATOM   8937  N NE2   . GLN B 1 552 ? 82.140  6.824   23.913 1.00 66.24 ? 2583 GLN B NE2   1 
ATOM   8938  O OXT   . GLN B 1 552 ? 82.268  5.657   29.436 1.00 59.43 ? 2583 GLN B OXT   1 
ATOM   8939  N N     . THR C 2 1   ? 68.942  -0.853  24.175 1.00 55.66 ? 2595 THR F N     1 
ATOM   8940  C CA    . THR C 2 1   ? 69.866  -2.001  23.919 1.00 55.96 ? 2595 THR F CA    1 
ATOM   8941  C C     . THR C 2 1   ? 69.311  -2.908  22.822 1.00 55.82 ? 2595 THR F C     1 
ATOM   8942  O O     . THR C 2 1   ? 69.872  -2.984  21.729 1.00 54.70 ? 2595 THR F O     1 
ATOM   8943  C CB    . THR C 2 1   ? 70.046  -2.847  25.195 1.00 57.39 ? 2595 THR F CB    1 
ATOM   8944  O OG1   . THR C 2 1   ? 70.594  -2.029  26.244 1.00 59.30 ? 2595 THR F OG1   1 
ATOM   8945  C CG2   . THR C 2 1   ? 70.956  -4.046  24.942 1.00 56.98 ? 2595 THR F CG2   1 
ATOM   8946  N N     . LYS C 2 2   ? 68.211  -3.596  23.125 1.00 55.85 ? 2596 LYS F N     1 
ATOM   8947  C CA    . LYS C 2 2   ? 67.599  -4.519  22.166 1.00 55.93 ? 2596 LYS F CA    1 
ATOM   8948  C C     . LYS C 2 2   ? 67.426  -3.949  20.755 1.00 54.89 ? 2596 LYS F C     1 
ATOM   8949  O O     . LYS C 2 2   ? 67.686  -4.632  19.761 1.00 53.88 ? 2596 LYS F O     1 
ATOM   8950  C CB    . LYS C 2 2   ? 66.237  -5.000  22.679 1.00 58.77 ? 2596 LYS F CB    1 
ATOM   8951  C CG    . LYS C 2 2   ? 65.659  -4.200  23.816 1.00 61.51 ? 2596 LYS F CG    1 
ATOM   8952  C CD    . LYS C 2 2   ? 65.317  -2.808  23.436 1.00 65.28 ? 2596 LYS F CD    1 
ATOM   8953  C CE    . LYS C 2 2   ? 65.053  -1.956  24.648 1.00 67.60 ? 2596 LYS F CE    1 
ATOM   8954  N NZ    . LYS C 2 2   ? 64.162  -0.747  24.134 1.00 69.17 ? 2596 LYS F NZ    1 
ATOM   8955  N N     . THR C 2 3   ? 66.971  -2.698  20.681 1.00 53.89 ? 2597 THR F N     1 
ATOM   8956  C CA    . THR C 2 3   ? 66.754  -2.012  19.404 1.00 53.37 ? 2597 THR F CA    1 
ATOM   8957  C C     . THR C 2 3   ? 68.097  -1.737  18.708 1.00 52.86 ? 2597 THR F C     1 
ATOM   8958  O O     . THR C 2 3   ? 68.245  -1.959  17.498 1.00 51.96 ? 2597 THR F O     1 
ATOM   8959  C CB    . THR C 2 3   ? 65.986  -0.657  19.653 1.00 53.00 ? 2597 THR F CB    1 
ATOM   8960  O OG1   . THR C 2 3   ? 64.692  -0.932  20.197 1.00 53.93 ? 2597 THR F OG1   1 
ATOM   8961  C CG2   . THR C 2 3   ? 65.785  0.128   18.386 1.00 52.06 ? 2597 THR F CG2   1 
ATOM   8962  N N     . ALA C 2 4   ? 69.071  -1.269  19.479 1.00 52.59 ? 2598 ALA F N     1 
ATOM   8963  C CA    . ALA C 2 4   ? 70.381  -0.952  18.940 1.00 52.40 ? 2598 ALA F CA    1 
ATOM   8964  C C     . ALA C 2 4   ? 70.999  -2.188  18.304 1.00 52.31 ? 2598 ALA F C     1 
ATOM   8965  O O     . ALA C 2 4   ? 71.562  -2.125  17.207 1.00 51.70 ? 2598 ALA F O     1 
ATOM   8966  C CB    . ALA C 2 4   ? 71.277  -0.409  20.047 1.00 51.59 ? 2598 ALA F CB    1 
ATOM   8967  N N     . THR C 2 5   ? 70.880  -3.316  18.995 1.00 53.30 ? 2599 THR F N     1 
ATOM   8968  C CA    . THR C 2 5   ? 71.434  -4.573  18.522 1.00 53.96 ? 2599 THR F CA    1 
ATOM   8969  C C     . THR C 2 5   ? 70.912  -5.061  17.173 1.00 54.17 ? 2599 THR F C     1 
ATOM   8970  O O     . THR C 2 5   ? 71.695  -5.431  16.297 1.00 53.87 ? 2599 THR F O     1 
ATOM   8971  C CB    . THR C 2 5   ? 71.215  -5.691  19.558 1.00 53.82 ? 2599 THR F CB    1 
ATOM   8972  O OG1   . THR C 2 5   ? 71.867  -5.365  20.788 1.00 54.68 ? 2599 THR F OG1   1 
ATOM   8973  C CG2   . THR C 2 5   ? 71.829  -6.932  19.088 1.00 54.90 ? 2599 THR F CG2   1 
ATOM   8974  N N     . ILE C 2 6   ? 69.591  -5.062  17.015 1.00 54.90 ? 2600 ILE F N     1 
ATOM   8975  C CA    . ILE C 2 6   ? 68.999  -5.519  15.764 1.00 56.09 ? 2600 ILE F CA    1 
ATOM   8976  C C     . ILE C 2 6   ? 69.073  -4.496  14.642 1.00 56.21 ? 2600 ILE F C     1 
ATOM   8977  O O     . ILE C 2 6   ? 69.262  -4.843  13.477 1.00 55.04 ? 2600 ILE F O     1 
ATOM   8978  C CB    . ILE C 2 6   ? 67.513  -5.925  15.962 1.00 55.77 ? 2600 ILE F CB    1 
ATOM   8979  C CG1   . ILE C 2 6   ? 67.423  -7.065  16.969 1.00 55.55 ? 2600 ILE F CG1   1 
ATOM   8980  C CG2   . ILE C 2 6   ? 66.901  -6.396  14.640 1.00 54.69 ? 2600 ILE F CG2   1 
ATOM   8981  C CD1   . ILE C 2 6   ? 66.042  -7.362  17.342 1.00 55.55 ? 2600 ILE F CD1   1 
ATOM   8982  N N     . ASN C 2 7   ? 68.924  -3.225  15.002 1.00 57.86 ? 2601 ASN F N     1 
ATOM   8983  C CA    . ASN C 2 7   ? 68.944  -2.157  14.016 1.00 59.45 ? 2601 ASN F CA    1 
ATOM   8984  C C     . ASN C 2 7   ? 70.325  -1.891  13.492 1.00 62.02 ? 2601 ASN F C     1 
ATOM   8985  O O     . ASN C 2 7   ? 70.510  -1.492  12.343 1.00 63.17 ? 2601 ASN F O     1 
ATOM   8986  C CB    . ASN C 2 7   ? 68.366  -0.892  14.629 1.00 58.89 ? 2601 ASN F CB    1 
ATOM   8987  C CG    . ASN C 2 7   ? 66.905  -1.039  14.926 1.00 59.66 ? 2601 ASN F CG    1 
ATOM   8988  O OD1   . ASN C 2 7   ? 66.165  -1.549  14.104 1.00 61.32 ? 2601 ASN F OD1   1 
ATOM   8989  N ND2   . ASN C 2 7   ? 66.475  -0.611  16.089 1.00 58.63 ? 2601 ASN F ND2   1 
ATOM   8990  N N     . ALA C 2 8   ? 71.319  -2.097  14.346 1.00 64.22 ? 2602 ALA F N     1 
ATOM   8991  C CA    . ALA C 2 8   ? 72.714  -1.896  13.950 1.00 65.63 ? 2602 ALA F CA    1 
ATOM   8992  C C     . ALA C 2 8   ? 73.184  -3.032  13.079 1.00 67.58 ? 2602 ALA F C     1 
ATOM   8993  O O     . ALA C 2 8   ? 74.019  -2.759  12.161 1.00 68.27 ? 2602 ALA F O     1 
ATOM   8994  C CB    . ALA C 2 8   ? 73.575  -1.760  15.146 1.00 65.47 ? 2602 ALA F CB    1 
ATOM   8995  N N     . SER C 2 9   ? 72.664  -4.239  13.190 1.00 68.88 ? 2603 SER F N     1 
ATOM   8996  C CA    . SER C 2 9   ? 73.117  -5.335  12.376 1.00 69.76 ? 2603 SER F CA    1 
ATOM   8997  C C     . SER C 2 9   ? 73.334  -5.403  10.864 1.00 70.34 ? 2603 SER F C     1 
ATOM   8998  O O     . SER C 2 9   ? 72.866  -4.959  9.608  1.00 70.66 ? 2603 SER F O     1 
ATOM   8999  C CB    . SER C 2 9   ? 72.482  -6.722  12.824 1.00 69.91 ? 2603 SER F CB    1 
ATOM   9000  O OG    . SER C 2 9   ? 71.178  -6.537  13.226 1.00 72.89 ? 2603 SER F OG    1 
ATOM   9001  O OXT   . SER C 2 9   ? 74.284  -5.294  11.395 1.00 71.80 ? 2603 SER F OXT   1 
HETATM 9002  C C1    . NAG D 3 .   ? 29.477  -3.891  27.159 1.00 46.18 ? 1    NAG C C1    1 
HETATM 9003  C C2    . NAG D 3 .   ? 28.625  -5.179  27.191 1.00 47.09 ? 1    NAG C C2    1 
HETATM 9004  C C3    . NAG D 3 .   ? 28.034  -5.476  25.789 1.00 50.94 ? 1    NAG C C3    1 
HETATM 9005  C C4    . NAG D 3 .   ? 27.398  -4.222  25.136 1.00 53.56 ? 1    NAG C C4    1 
HETATM 9006  C C5    . NAG D 3 .   ? 28.397  -3.063  25.188 1.00 52.38 ? 1    NAG C C5    1 
HETATM 9007  C C6    . NAG D 3 .   ? 27.897  -1.742  24.601 1.00 51.91 ? 1    NAG C C6    1 
HETATM 9008  C C7    . NAG D 3 .   ? 29.416  -6.862  28.766 1.00 44.95 ? 1    NAG C C7    1 
HETATM 9009  C C8    . NAG D 3 .   ? 30.394  -7.976  29.063 1.00 44.07 ? 1    NAG C C8    1 
HETATM 9010  N N2    . NAG D 3 .   ? 29.497  -6.280  27.570 1.00 46.13 ? 1    NAG C N2    1 
HETATM 9011  O O3    . NAG D 3 .   ? 27.063  -6.507  25.890 1.00 52.04 ? 1    NAG C O3    1 
HETATM 9012  O O4    . NAG D 3 .   ? 27.063  -4.493  23.748 1.00 58.80 ? 1    NAG C O4    1 
HETATM 9013  O O5    . NAG D 3 .   ? 28.755  -2.812  26.560 1.00 50.16 ? 1    NAG C O5    1 
HETATM 9014  O O6    . NAG D 3 .   ? 26.787  -1.239  25.329 1.00 51.08 ? 1    NAG C O6    1 
HETATM 9015  O O7    . NAG D 3 .   ? 28.587  -6.539  29.601 1.00 44.04 ? 1    NAG C O7    1 
HETATM 9016  C C1    . NAG D 3 .   ? 25.714  -4.618  23.408 1.00 64.04 ? 2    NAG C C1    1 
HETATM 9017  C C2    . NAG D 3 .   ? 25.529  -4.410  21.895 1.00 66.06 ? 2    NAG C C2    1 
HETATM 9018  C C3    . NAG D 3 .   ? 24.023  -4.496  21.590 1.00 67.88 ? 2    NAG C C3    1 
HETATM 9019  C C4    . NAG D 3 .   ? 23.500  -5.887  22.028 1.00 67.52 ? 2    NAG C C4    1 
HETATM 9020  C C5    . NAG D 3 .   ? 23.904  -6.249  23.493 1.00 66.10 ? 2    NAG C C5    1 
HETATM 9021  C C6    . NAG D 3 .   ? 23.745  -7.742  23.758 1.00 66.04 ? 2    NAG C C6    1 
HETATM 9022  C C7    . NAG D 3 .   ? 25.719  -1.966  21.818 1.00 70.01 ? 2    NAG C C7    1 
HETATM 9023  C C8    . NAG D 3 .   ? 26.438  -0.770  21.184 1.00 69.82 ? 2    NAG C C8    1 
HETATM 9024  N N2    . NAG D 3 .   ? 26.120  -3.169  21.398 1.00 69.00 ? 2    NAG C N2    1 
HETATM 9025  O O3    . NAG D 3 .   ? 23.789  -4.288  20.198 1.00 67.82 ? 2    NAG C O3    1 
HETATM 9026  O O4    . NAG D 3 .   ? 22.082  -5.924  21.918 1.00 66.54 ? 2    NAG C O4    1 
HETATM 9027  O O5    . NAG D 3 .   ? 25.306  -5.954  23.763 1.00 64.36 ? 2    NAG C O5    1 
HETATM 9028  O O6    . NAG D 3 .   ? 24.722  -8.488  23.037 1.00 67.34 ? 2    NAG C O6    1 
HETATM 9029  O O7    . NAG D 3 .   ? 24.833  -1.804  22.666 1.00 72.15 ? 2    NAG C O7    1 
HETATM 9030  C C1    . NAG E 4 .   ? 42.572  28.290  22.235 1.00 28.31 ? 1    NAG D C1    1 
HETATM 9031  C C2    . NAG E 4 .   ? 43.611  29.153  21.530 1.00 30.03 ? 1    NAG D C2    1 
HETATM 9032  C C3    . NAG E 4 .   ? 42.950  30.092  20.544 1.00 31.81 ? 1    NAG D C3    1 
HETATM 9033  C C4    . NAG E 4 .   ? 42.024  29.303  19.634 1.00 33.29 ? 1    NAG D C4    1 
HETATM 9034  C C5    . NAG E 4 .   ? 41.027  28.507  20.436 1.00 31.70 ? 1    NAG D C5    1 
HETATM 9035  C C6    . NAG E 4 .   ? 40.100  27.664  19.576 1.00 30.51 ? 1    NAG D C6    1 
HETATM 9036  C C7    . NAG E 4 .   ? 45.640  29.837  22.643 1.00 30.07 ? 1    NAG D C7    1 
HETATM 9037  C C8    . NAG E 4 .   ? 46.275  30.683  23.720 1.00 29.07 ? 1    NAG D C8    1 
HETATM 9038  N N2    . NAG E 4 .   ? 44.321  29.929  22.525 1.00 31.03 ? 1    NAG D N2    1 
HETATM 9039  O O3    . NAG E 4 .   ? 43.949  30.742  19.774 1.00 31.16 ? 1    NAG D O3    1 
HETATM 9040  O O4    . NAG E 4 .   ? 41.299  30.205  18.819 1.00 39.82 ? 1    NAG D O4    1 
HETATM 9041  O O5    . NAG E 4 .   ? 41.737  27.612  21.294 1.00 29.50 ? 1    NAG D O5    1 
HETATM 9042  O O6    . NAG E 4 .   ? 40.834  26.848  18.677 1.00 29.20 ? 1    NAG D O6    1 
HETATM 9043  O O7    . NAG E 4 .   ? 46.324  29.121  21.924 1.00 30.87 ? 1    NAG D O7    1 
HETATM 9044  C C1    . NAG E 4 .   ? 41.272  29.884  17.496 1.00 46.95 ? 2    NAG D C1    1 
HETATM 9045  C C2    . NAG E 4 .   ? 40.414  30.844  16.812 1.00 50.54 ? 2    NAG D C2    1 
HETATM 9046  C C3    . NAG E 4 .   ? 40.508  30.805  15.290 1.00 53.48 ? 2    NAG D C3    1 
HETATM 9047  C C4    . NAG E 4 .   ? 41.951  30.940  14.857 1.00 54.18 ? 2    NAG D C4    1 
HETATM 9048  C C5    . NAG E 4 .   ? 42.827  29.942  15.604 1.00 52.38 ? 2    NAG D C5    1 
HETATM 9049  C C6    . NAG E 4 .   ? 44.322  30.140  15.313 1.00 52.07 ? 2    NAG D C6    1 
HETATM 9050  C C7    . NAG E 4 .   ? 38.717  31.826  18.172 1.00 53.75 ? 2    NAG D C7    1 
HETATM 9051  C C8    . NAG E 4 .   ? 38.870  33.335  17.599 1.00 54.90 ? 2    NAG D C8    1 
HETATM 9052  N N2    . NAG E 4 .   ? 39.035  31.174  17.066 1.00 52.86 ? 2    NAG D N2    1 
HETATM 9053  O O3    . NAG E 4 .   ? 39.675  31.808  14.688 1.00 54.10 ? 2    NAG D O3    1 
HETATM 9054  O O4    . NAG E 4 .   ? 42.118  30.723  13.432 1.00 57.93 ? 2    NAG D O4    1 
HETATM 9055  O O5    . NAG E 4 .   ? 42.643  30.088  17.042 1.00 49.30 ? 2    NAG D O5    1 
HETATM 9056  O O6    . NAG E 4 .   ? 44.786  31.386  15.806 1.00 52.02 ? 2    NAG D O6    1 
HETATM 9057  O O7    . NAG E 4 .   ? 37.622  31.618  18.716 1.00 55.61 ? 2    NAG D O7    1 
HETATM 9058  C C1    . MAN E 4 .   ? 43.218  31.421  12.886 1.00 60.87 ? 3    MAN D C1    1 
HETATM 9059  C C2    . MAN E 4 .   ? 42.978  32.970  12.848 1.00 62.02 ? 3    MAN D C2    1 
HETATM 9060  C C3    . MAN E 4 .   ? 42.199  33.375  11.629 1.00 63.43 ? 3    MAN D C3    1 
HETATM 9061  C C4    . MAN E 4 .   ? 42.911  32.858  10.380 1.00 63.93 ? 3    MAN D C4    1 
HETATM 9062  C C5    . MAN E 4 .   ? 43.100  31.341  10.391 1.00 64.13 ? 3    MAN D C5    1 
HETATM 9063  C C6    . MAN E 4 .   ? 43.999  30.794  9.185  1.00 65.05 ? 3    MAN D C6    1 
HETATM 9064  O O2    . MAN E 4 .   ? 44.210  33.688  12.904 1.00 62.89 ? 3    MAN D O2    1 
HETATM 9065  O O3    . MAN E 4 .   ? 42.111  34.802  11.569 1.00 62.80 ? 3    MAN D O3    1 
HETATM 9066  O O4    . MAN E 4 .   ? 42.146  33.191  9.236  1.00 62.59 ? 3    MAN D O4    1 
HETATM 9067  O O5    . MAN E 4 .   ? 43.686  30.844  11.629 1.00 62.46 ? 3    MAN D O5    1 
HETATM 9068  O O6    . MAN E 4 .   ? 45.471  30.774  9.275  1.00 67.40 ? 3    MAN D O6    1 
HETATM 9069  C C1    . MAN E 4 .   ? 45.943  31.708  8.200  1.00 70.63 ? 4    MAN D C1    1 
HETATM 9070  C C2    . MAN E 4 .   ? 46.600  31.159  6.915  1.00 72.08 ? 4    MAN D C2    1 
HETATM 9071  C C3    . MAN E 4 .   ? 48.030  31.806  6.666  1.00 72.90 ? 4    MAN D C3    1 
HETATM 9072  C C4    . MAN E 4 .   ? 48.052  33.343  6.872  1.00 72.19 ? 4    MAN D C4    1 
HETATM 9073  C C5    . MAN E 4 .   ? 47.264  33.727  8.221  1.00 71.53 ? 4    MAN D C5    1 
HETATM 9074  C C6    . MAN E 4 .   ? 47.163  35.229  8.523  1.00 71.07 ? 4    MAN D C6    1 
HETATM 9075  O O2    . MAN E 4 .   ? 45.723  31.576  5.864  1.00 72.00 ? 4    MAN D O2    1 
HETATM 9076  O O3    . MAN E 4 .   ? 48.465  31.479  5.346  1.00 72.76 ? 4    MAN D O3    1 
HETATM 9077  O O4    . MAN E 4 .   ? 49.449  33.773  6.961  1.00 70.26 ? 4    MAN D O4    1 
HETATM 9078  O O5    . MAN E 4 .   ? 45.898  33.116  8.302  1.00 70.84 ? 4    MAN D O5    1 
HETATM 9079  O O6    . MAN E 4 .   ? 48.455  35.812  8.784  1.00 72.22 ? 4    MAN D O6    1 
HETATM 9080  C C1    . NAG F 3 .   ? 66.335  38.045  65.977 1.00 52.24 ? 1    NAG E C1    1 
HETATM 9081  C C2    . NAG F 3 .   ? 67.216  38.109  67.238 1.00 53.98 ? 1    NAG E C2    1 
HETATM 9082  C C3    . NAG F 3 .   ? 67.784  39.529  67.427 1.00 56.78 ? 1    NAG E C3    1 
HETATM 9083  C C4    . NAG F 3 .   ? 68.390  40.089  66.118 1.00 58.69 ? 1    NAG E C4    1 
HETATM 9084  C C5    . NAG F 3 .   ? 67.370  39.949  64.975 1.00 55.66 ? 1    NAG E C5    1 
HETATM 9085  C C6    . NAG F 3 .   ? 67.831  40.455  63.612 1.00 52.89 ? 1    NAG E C6    1 
HETATM 9086  C C7    . NAG F 3 .   ? 66.529  36.627  69.036 1.00 54.88 ? 1    NAG E C7    1 
HETATM 9087  C C8    . NAG F 3 .   ? 65.574  36.460  70.221 1.00 52.71 ? 1    NAG E C8    1 
HETATM 9088  N N2    . NAG F 3 .   ? 66.399  37.788  68.394 1.00 54.24 ? 1    NAG E N2    1 
HETATM 9089  O O3    . NAG F 3 .   ? 68.772  39.504  68.446 1.00 57.05 ? 1    NAG E O3    1 
HETATM 9090  O O4    . NAG F 3 .   ? 68.743  41.490  66.288 1.00 64.77 ? 1    NAG E O4    1 
HETATM 9091  O O5    . NAG F 3 .   ? 67.030  38.558  64.825 1.00 53.20 ? 1    NAG E O5    1 
HETATM 9092  O O6    . NAG F 3 .   ? 68.929  39.697  63.124 1.00 52.81 ? 1    NAG E O6    1 
HETATM 9093  O O7    . NAG F 3 .   ? 67.356  35.749  68.722 1.00 57.33 ? 1    NAG E O7    1 
HETATM 9094  C C1    . NAG F 3 .   ? 70.094  41.840  66.351 1.00 68.12 ? 2    NAG E C1    1 
HETATM 9095  C C2    . NAG F 3 .   ? 70.272  43.337  66.041 1.00 69.78 ? 2    NAG E C2    1 
HETATM 9096  C C3    . NAG F 3 .   ? 71.773  43.635  66.039 1.00 71.04 ? 2    NAG E C3    1 
HETATM 9097  C C4    . NAG F 3 .   ? 72.347  43.303  67.428 1.00 71.26 ? 2    NAG E C4    1 
HETATM 9098  C C5    . NAG F 3 .   ? 71.956  41.869  67.918 1.00 70.68 ? 2    NAG E C5    1 
HETATM 9099  C C6    . NAG F 3 .   ? 72.168  41.708  69.423 1.00 70.51 ? 2    NAG E C6    1 
HETATM 9100  C C7    . NAG F 3 .   ? 70.001  43.243  63.612 1.00 73.70 ? 2    NAG E C7    1 
HETATM 9101  C C8    . NAG F 3 .   ? 69.221  43.777  62.407 1.00 74.01 ? 2    NAG E C8    1 
HETATM 9102  N N2    . NAG F 3 .   ? 69.633  43.741  64.794 1.00 71.94 ? 2    NAG E N2    1 
HETATM 9103  O O3    . NAG F 3 .   ? 71.998  45.005  65.725 1.00 71.35 ? 2    NAG E O3    1 
HETATM 9104  O O4    . NAG F 3 .   ? 73.764  43.408  67.383 1.00 71.56 ? 2    NAG E O4    1 
HETATM 9105  O O5    . NAG F 3 .   ? 70.549  41.572  67.689 1.00 68.41 ? 2    NAG E O5    1 
HETATM 9106  O O6    . NAG F 3 .   ? 71.218  42.478  70.153 1.00 71.94 ? 2    NAG E O6    1 
HETATM 9107  O O7    . NAG F 3 .   ? 70.901  42.402  63.477 1.00 75.35 ? 2    NAG E O7    1 
HETATM 9108  C C1    . NAG G 4 .   ? 52.358  40.914  33.908 1.00 27.13 ? 1    NAG G C1    1 
HETATM 9109  C C2    . NAG G 4 .   ? 51.259  41.560  33.040 1.00 29.59 ? 1    NAG G C2    1 
HETATM 9110  C C3    . NAG G 4 .   ? 51.877  42.540  32.023 1.00 31.99 ? 1    NAG G C3    1 
HETATM 9111  C C4    . NAG G 4 .   ? 52.800  43.497  32.755 1.00 34.02 ? 1    NAG G C4    1 
HETATM 9112  C C5    . NAG G 4 .   ? 53.851  42.761  33.563 1.00 31.20 ? 1    NAG G C5    1 
HETATM 9113  C C6    . NAG G 4 .   ? 54.776  43.691  34.342 1.00 29.23 ? 1    NAG G C6    1 
HETATM 9114  C C7    . NAG G 4 .   ? 49.233  40.377  32.489 1.00 29.51 ? 1    NAG G C7    1 
HETATM 9115  C C8    . NAG G 4 .   ? 48.667  39.218  31.695 1.00 29.31 ? 1    NAG G C8    1 
HETATM 9116  N N2    . NAG G 4 .   ? 50.546  40.515  32.348 1.00 27.83 ? 1    NAG G N2    1 
HETATM 9117  O O3    . NAG G 4 .   ? 50.858  43.297  31.375 1.00 32.62 ? 1    NAG G O3    1 
HETATM 9118  O O4    . NAG G 4 .   ? 53.467  44.308  31.804 1.00 41.80 ? 1    NAG G O4    1 
HETATM 9119  O O5    . NAG G 4 .   ? 53.188  41.916  34.520 1.00 30.70 ? 1    NAG G O5    1 
HETATM 9120  O O6    . NAG G 4 .   ? 54.040  44.591  35.156 1.00 28.41 ? 1    NAG G O6    1 
HETATM 9121  O O7    . NAG G 4 .   ? 48.518  41.118  33.186 1.00 30.04 ? 1    NAG G O7    1 
HETATM 9122  C C1    . NAG G 4 .   ? 53.490  45.615  32.087 1.00 49.49 ? 2    NAG G C1    1 
HETATM 9123  C C2    . NAG G 4 .   ? 54.353  46.322  31.102 1.00 52.68 ? 2    NAG G C2    1 
HETATM 9124  C C3    . NAG G 4 .   ? 54.224  47.823  31.078 1.00 55.84 ? 2    NAG G C3    1 
HETATM 9125  C C4    . NAG G 4 .   ? 52.769  48.200  30.917 1.00 57.52 ? 2    NAG G C4    1 
HETATM 9126  C C5    . NAG G 4 .   ? 51.920  47.506  31.992 1.00 55.39 ? 2    NAG G C5    1 
HETATM 9127  C C6    . NAG G 4 .   ? 50.416  47.774  31.824 1.00 55.47 ? 2    NAG G C6    1 
HETATM 9128  C C7    . NAG G 4 .   ? 56.016  44.922  30.108 1.00 55.13 ? 2    NAG G C7    1 
HETATM 9129  C C8    . NAG G 4 .   ? 55.761  45.291  28.602 1.00 54.37 ? 2    NAG G C8    1 
HETATM 9130  N N2    . NAG G 4 .   ? 55.716  46.057  30.696 1.00 54.02 ? 2    NAG G N2    1 
HETATM 9131  O O3    . NAG G 4 .   ? 55.034  48.375  30.013 1.00 55.67 ? 2    NAG G O3    1 
HETATM 9132  O O4    . NAG G 4 .   ? 52.589  49.618  30.980 1.00 62.00 ? 2    NAG G O4    1 
HETATM 9133  O O5    . NAG G 4 .   ? 52.115  46.075  31.894 1.00 52.34 ? 2    NAG G O5    1 
HETATM 9134  O O6    . NAG G 4 .   ? 49.941  47.190  30.613 1.00 54.78 ? 2    NAG G O6    1 
HETATM 9135  O O7    . NAG G 4 .   ? 57.131  44.404  30.300 1.00 57.10 ? 2    NAG G O7    1 
HETATM 9136  C C1    . MAN G 4 .   ? 51.468  50.037  30.258 1.00 66.22 ? 3    MAN G C1    1 
HETATM 9137  C C2    . MAN G 4 .   ? 51.723  49.933  28.722 1.00 67.30 ? 3    MAN G C2    1 
HETATM 9138  C C3    . MAN G 4 .   ? 52.460  51.140  28.209 1.00 69.30 ? 3    MAN G C3    1 
HETATM 9139  C C4    . MAN G 4 .   ? 51.724  52.413  28.638 1.00 69.53 ? 3    MAN G C4    1 
HETATM 9140  C C5    . MAN G 4 .   ? 51.554  52.505  30.157 1.00 69.55 ? 3    MAN G C5    1 
HETATM 9141  C C6    . MAN G 4 .   ? 50.648  53.722  30.640 1.00 72.38 ? 3    MAN G C6    1 
HETATM 9142  O O2    . MAN G 4 .   ? 50.502  49.757  28.012 1.00 67.82 ? 3    MAN G O2    1 
HETATM 9143  O O3    . MAN G 4 .   ? 52.516  51.072  26.787 1.00 67.96 ? 3    MAN G O3    1 
HETATM 9144  O O4    . MAN G 4 .   ? 52.474  53.558  28.220 1.00 68.63 ? 3    MAN G O4    1 
HETATM 9145  O O5    . MAN G 4 .   ? 50.949  51.312  30.719 1.00 67.35 ? 3    MAN G O5    1 
HETATM 9146  O O6    . MAN G 4 .   ? 49.184  53.600  30.708 1.00 76.10 ? 3    MAN G O6    1 
HETATM 9147  C C1    . MAN G 4 .   ? 48.668  54.595  29.720 1.00 78.72 ? 4    MAN G C1    1 
HETATM 9148  C C2    . MAN G 4 .   ? 47.994  55.893  30.206 1.00 81.08 ? 4    MAN G C2    1 
HETATM 9149  C C3    . MAN G 4 .   ? 46.543  56.064  29.588 1.00 82.35 ? 4    MAN G C3    1 
HETATM 9150  C C4    . MAN G 4 .   ? 46.491  55.754  28.060 1.00 81.60 ? 4    MAN G C4    1 
HETATM 9151  C C5    . MAN G 4 .   ? 47.305  54.404  27.738 1.00 80.47 ? 4    MAN G C5    1 
HETATM 9152  C C6    . MAN G 4 .   ? 47.369  54.008  26.254 1.00 79.47 ? 4    MAN G C6    1 
HETATM 9153  O O2    . MAN G 4 .   ? 48.830  56.945  29.695 1.00 81.36 ? 4    MAN G O2    1 
HETATM 9154  O O3    . MAN G 4 .   ? 46.099  57.399  29.846 1.00 82.46 ? 4    MAN G O3    1 
HETATM 9155  O O4    . MAN G 4 .   ? 45.090  55.599  27.667 1.00 82.09 ? 4    MAN G O4    1 
HETATM 9156  O O5    . MAN G 4 .   ? 48.694  54.399  28.320 1.00 78.89 ? 4    MAN G O5    1 
HETATM 9157  O O6    . MAN G 4 .   ? 46.066  53.683  25.728 1.00 79.76 ? 4    MAN G O6    1 
HETATM 9158  C C1    . NAG H 5 .   ? 14.614  54.865  35.173 1.00 58.46 ? 681  NAG A C1    1 
HETATM 9159  C C2    . NAG H 5 .   ? 13.223  54.717  34.501 1.00 60.58 ? 681  NAG A C2    1 
HETATM 9160  C C3    . NAG H 5 .   ? 12.120  55.623  35.096 1.00 62.53 ? 681  NAG A C3    1 
HETATM 9161  C C4    . NAG H 5 .   ? 12.195  55.719  36.631 1.00 63.39 ? 681  NAG A C4    1 
HETATM 9162  C C5    . NAG H 5 .   ? 13.634  56.069  37.039 1.00 62.54 ? 681  NAG A C5    1 
HETATM 9163  C C6    . NAG H 5 .   ? 13.836  56.253  38.548 1.00 61.81 ? 681  NAG A C6    1 
HETATM 9164  C C7    . NAG H 5 .   ? 13.159  54.176  32.137 1.00 61.44 ? 681  NAG A C7    1 
HETATM 9165  C C8    . NAG H 5 .   ? 13.363  54.567  30.687 1.00 60.88 ? 681  NAG A C8    1 
HETATM 9166  N N2    . NAG H 5 .   ? 13.380  55.067  33.098 1.00 61.02 ? 681  NAG A N2    1 
HETATM 9167  O O3    . NAG H 5 .   ? 10.851  55.105  34.725 1.00 63.10 ? 681  NAG A O3    1 
HETATM 9168  O O4    . NAG H 5 .   ? 11.290  56.717  37.104 1.00 66.22 ? 681  NAG A O4    1 
HETATM 9169  O O5    . NAG H 5 .   ? 14.519  55.003  36.610 1.00 60.38 ? 681  NAG A O5    1 
HETATM 9170  O O6    . NAG H 5 .   ? 13.310  55.158  39.292 1.00 64.19 ? 681  NAG A O6    1 
HETATM 9171  O O7    . NAG H 5 .   ? 12.780  53.051  32.387 1.00 61.15 ? 681  NAG A O7    1 
HETATM 9172  C C1    . BOG I 6 .   ? 15.503  9.445   52.686 1.00 50.59 ? 702  BOG A C1    1 
HETATM 9173  O O1    . BOG I 6 .   ? 15.905  8.502   53.685 1.00 47.84 ? 702  BOG A O1    1 
HETATM 9174  C C2    . BOG I 6 .   ? 15.461  8.771   51.301 1.00 52.81 ? 702  BOG A C2    1 
HETATM 9175  O O2    . BOG I 6 .   ? 16.750  8.230   50.990 1.00 52.47 ? 702  BOG A O2    1 
HETATM 9176  C C3    . BOG I 6 .   ? 15.000  9.808   50.231 1.00 53.91 ? 702  BOG A C3    1 
HETATM 9177  O O3    . BOG I 6 .   ? 14.928  9.208   48.941 1.00 54.43 ? 702  BOG A O3    1 
HETATM 9178  C C4    . BOG I 6 .   ? 13.619  10.356  50.612 1.00 53.63 ? 702  BOG A C4    1 
HETATM 9179  O O4    . BOG I 6 .   ? 13.167  11.308  49.648 1.00 53.74 ? 702  BOG A O4    1 
HETATM 9180  C C5    . BOG I 6 .   ? 13.708  11.001  52.017 1.00 53.13 ? 702  BOG A C5    1 
HETATM 9181  O O5    . BOG I 6 .   ? 14.185  10.011  52.988 1.00 51.90 ? 702  BOG A O5    1 
HETATM 9182  C C6    . BOG I 6 .   ? 12.351  11.539  52.443 1.00 54.72 ? 702  BOG A C6    1 
HETATM 9183  O O6    . BOG I 6 .   ? 12.503  12.825  53.028 1.00 54.68 ? 702  BOG A O6    1 
HETATM 9184  C "C1'" . BOG I 6 .   ? 16.503  9.122   54.821 1.00 44.43 ? 702  BOG A "C1'" 1 
HETATM 9185  C "C2'" . BOG I 6 .   ? 16.762  8.069   55.883 1.00 42.45 ? 702  BOG A "C2'" 1 
HETATM 9186  C "C3'" . BOG I 6 .   ? 17.758  8.613   56.889 1.00 41.17 ? 702  BOG A "C3'" 1 
HETATM 9187  C "C4'" . BOG I 6 .   ? 18.084  7.640   57.998 1.00 38.70 ? 702  BOG A "C4'" 1 
HETATM 9188  C "C5'" . BOG I 6 .   ? 19.085  8.274   58.947 1.00 38.55 ? 702  BOG A "C5'" 1 
HETATM 9189  C "C6'" . BOG I 6 .   ? 19.350  7.396   60.154 1.00 38.88 ? 702  BOG A "C6'" 1 
HETATM 9190  C "C7'" . BOG I 6 .   ? 20.358  8.039   61.104 1.00 40.69 ? 702  BOG A "C7'" 1 
HETATM 9191  C "C8'" . BOG I 6 .   ? 20.611  7.150   62.310 1.00 39.09 ? 702  BOG A "C8'" 1 
HETATM 9192  C C1    . BOG J 6 .   ? 3.928   31.393  24.570 1.00 44.97 ? 703  BOG A C1    1 
HETATM 9193  O O1    . BOG J 6 .   ? 2.820   30.626  25.051 1.00 44.16 ? 703  BOG A O1    1 
HETATM 9194  C C2    . BOG J 6 .   ? 3.613   31.992  23.171 1.00 44.91 ? 703  BOG A C2    1 
HETATM 9195  O O2    . BOG J 6 .   ? 3.314   30.965  22.252 1.00 43.01 ? 703  BOG A O2    1 
HETATM 9196  C C3    . BOG J 6 .   ? 4.818   32.828  22.683 1.00 46.28 ? 703  BOG A C3    1 
HETATM 9197  O O3    . BOG J 6 .   ? 4.545   33.392  21.397 1.00 45.01 ? 703  BOG A O3    1 
HETATM 9198  C C4    . BOG J 6 .   ? 5.095   33.949  23.718 1.00 46.44 ? 703  BOG A C4    1 
HETATM 9199  O O4    . BOG J 6 .   ? 6.188   34.756  23.310 1.00 46.59 ? 703  BOG A O4    1 
HETATM 9200  C C5    . BOG J 6 .   ? 5.381   33.306  25.114 1.00 46.27 ? 703  BOG A C5    1 
HETATM 9201  O O5    . BOG J 6 .   ? 4.251   32.465  25.511 1.00 46.05 ? 703  BOG A O5    1 
HETATM 9202  C C6    . BOG J 6 .   ? 5.651   34.381  26.178 1.00 46.35 ? 703  BOG A C6    1 
HETATM 9203  O O6    . BOG J 6 .   ? 4.538   35.223  26.377 1.00 47.00 ? 703  BOG A O6    1 
HETATM 9204  C "C1'" . BOG J 6 .   ? 3.192   29.361  25.596 1.00 41.63 ? 703  BOG A "C1'" 1 
HETATM 9205  C "C2'" . BOG J 6 .   ? 2.481   29.199  26.918 1.00 39.63 ? 703  BOG A "C2'" 1 
HETATM 9206  C "C3'" . BOG J 6 .   ? 2.966   30.249  27.884 1.00 39.05 ? 703  BOG A "C3'" 1 
HETATM 9207  C "C4'" . BOG J 6 .   ? 2.287   30.142  29.221 1.00 38.07 ? 703  BOG A "C4'" 1 
HETATM 9208  C "C5'" . BOG J 6 .   ? 2.794   31.228  30.129 1.00 35.94 ? 703  BOG A "C5'" 1 
HETATM 9209  C "C6'" . BOG J 6 .   ? 1.663   32.131  30.570 1.00 34.04 ? 703  BOG A "C6'" 1 
HETATM 9210  C "C7'" . BOG J 6 .   ? 2.210   33.203  31.465 1.00 33.67 ? 703  BOG A "C7'" 1 
HETATM 9211  C "C8'" . BOG J 6 .   ? 1.128   34.130  31.935 1.00 33.92 ? 703  BOG A "C8'" 1 
HETATM 9212  C C1    . BOG K 6 .   ? 25.719  33.496  32.635 1.00 63.38 ? 704  BOG A C1    1 
HETATM 9213  O O1    . BOG K 6 .   ? 25.828  33.117  34.018 1.00 60.60 ? 704  BOG A O1    1 
HETATM 9214  C C2    . BOG K 6 .   ? 26.635  34.718  32.358 1.00 64.79 ? 704  BOG A C2    1 
HETATM 9215  O O2    . BOG K 6 .   ? 26.282  35.798  33.217 1.00 64.61 ? 704  BOG A O2    1 
HETATM 9216  C C3    . BOG K 6 .   ? 26.512  35.118  30.856 1.00 65.98 ? 704  BOG A C3    1 
HETATM 9217  O O3    . BOG K 6 .   ? 27.355  36.220  30.557 1.00 65.21 ? 704  BOG A O3    1 
HETATM 9218  C C4    . BOG K 6 .   ? 26.910  33.928  29.973 1.00 65.75 ? 704  BOG A C4    1 
HETATM 9219  O O4    . BOG K 6 .   ? 26.794  34.266  28.587 1.00 64.91 ? 704  BOG A O4    1 
HETATM 9220  C C5    . BOG K 6 .   ? 26.009  32.719  30.308 1.00 65.57 ? 704  BOG A C5    1 
HETATM 9221  O O5    . BOG K 6 .   ? 26.108  32.400  31.730 1.00 63.77 ? 704  BOG A O5    1 
HETATM 9222  C C6    . BOG K 6 .   ? 26.426  31.517  29.472 1.00 65.28 ? 704  BOG A C6    1 
HETATM 9223  O O6    . BOG K 6 .   ? 25.314  30.999  28.781 1.00 67.76 ? 704  BOG A O6    1 
HETATM 9224  C "C1'" . BOG K 6 .   ? 25.379  31.796  34.292 1.00 57.17 ? 704  BOG A "C1'" 1 
HETATM 9225  C "C2'" . BOG K 6 .   ? 24.535  31.777  35.550 1.00 54.70 ? 704  BOG A "C2'" 1 
HETATM 9226  C "C3'" . BOG K 6 .   ? 23.936  33.120  35.968 1.00 50.47 ? 704  BOG A "C3'" 1 
HETATM 9227  C "C4'" . BOG K 6 .   ? 23.118  32.911  37.235 1.00 48.32 ? 704  BOG A "C4'" 1 
HETATM 9228  C "C5'" . BOG K 6 .   ? 22.476  34.166  37.745 1.00 45.15 ? 704  BOG A "C5'" 1 
HETATM 9229  C "C6'" . BOG K 6 .   ? 21.034  33.901  38.136 1.00 43.75 ? 704  BOG A "C6'" 1 
HETATM 9230  C "C7'" . BOG K 6 .   ? 20.390  35.164  38.658 1.00 42.89 ? 704  BOG A "C7'" 1 
HETATM 9231  C "C8'" . BOG K 6 .   ? 18.963  34.912  39.053 1.00 42.83 ? 704  BOG A "C8'" 1 
HETATM 9232  C C1    . ACD L 7 .   ? 29.407  28.560  44.437 1.00 20.97 ? 701  ACD A C1    1 
HETATM 9233  C C2    . ACD L 7 .   ? 28.350  27.938  45.368 1.00 22.06 ? 701  ACD A C2    1 
HETATM 9234  C C3    . ACD L 7 .   ? 27.102  27.372  44.646 1.00 21.74 ? 701  ACD A C3    1 
HETATM 9235  C C4    . ACD L 7 .   ? 27.360  26.027  43.935 1.00 21.41 ? 701  ACD A C4    1 
HETATM 9236  C C5    . ACD L 7 .   ? 26.246  25.665  42.944 1.00 20.35 ? 701  ACD A C5    1 
HETATM 9237  C C6    . ACD L 7 .   ? 25.322  24.678  43.088 1.00 21.35 ? 701  ACD A C6    1 
HETATM 9238  C C7    . ACD L 7 .   ? 25.237  23.698  44.258 1.00 19.64 ? 701  ACD A C7    1 
HETATM 9239  C C8    . ACD L 7 .   ? 23.951  23.865  45.088 1.00 20.96 ? 701  ACD A C8    1 
HETATM 9240  C C9    . ACD L 7 .   ? 23.833  24.041  46.418 1.00 21.27 ? 701  ACD A C9    1 
HETATM 9241  C C10   . ACD L 7 .   ? 24.952  24.116  47.464 1.00 21.79 ? 701  ACD A C10   1 
HETATM 9242  C C11   . ACD L 7 .   ? 24.560  23.300  48.666 1.00 22.75 ? 701  ACD A C11   1 
HETATM 9243  C C12   . ACD L 7 .   ? 25.277  22.358  49.308 1.00 22.98 ? 701  ACD A C12   1 
HETATM 9244  C C13   . ACD L 7 .   ? 26.645  21.816  49.088 1.00 24.57 ? 701  ACD A C13   1 
HETATM 9245  C C14   . ACD L 7 .   ? 27.348  21.653  50.480 1.00 26.51 ? 701  ACD A C14   1 
HETATM 9246  C C15   . ACD L 7 .   ? 28.661  21.587  50.816 1.00 27.57 ? 701  ACD A C15   1 
HETATM 9247  C C16   . ACD L 7 .   ? 29.928  21.637  49.883 1.00 28.07 ? 701  ACD A C16   1 
HETATM 9248  C C17   . ACD L 7 .   ? 30.122  23.072  49.329 1.00 28.72 ? 701  ACD A C17   1 
HETATM 9249  C C18   . ACD L 7 .   ? 31.603  23.456  49.251 1.00 28.90 ? 701  ACD A C18   1 
HETATM 9250  C C19   . ACD L 7 .   ? 32.004  24.333  50.460 1.00 31.17 ? 701  ACD A C19   1 
HETATM 9251  C C20   . ACD L 7 .   ? 33.491  24.764  50.425 1.00 30.74 ? 701  ACD A C20   1 
HETATM 9252  O O1    . ACD L 7 .   ? 30.583  28.285  44.655 1.00 22.41 ? 701  ACD A O1    1 
HETATM 9253  O O2    . ACD L 7 .   ? 29.064  29.320  43.500 1.00 18.90 ? 701  ACD A O2    1 
HETATM 9254  C C1    . NAG M 5 .   ? 79.696  26.936  7.122  1.00 68.06 ? 2681 NAG B C1    1 
HETATM 9255  C C2    . NAG M 5 .   ? 81.051  27.658  7.089  1.00 69.96 ? 2681 NAG B C2    1 
HETATM 9256  C C3    . NAG M 5 .   ? 82.105  27.029  6.163  1.00 71.10 ? 2681 NAG B C3    1 
HETATM 9257  C C4    . NAG M 5 .   ? 82.095  25.507  6.266  1.00 70.85 ? 2681 NAG B C4    1 
HETATM 9258  C C5    . NAG M 5 .   ? 80.660  25.001  6.042  1.00 70.13 ? 2681 NAG B C5    1 
HETATM 9259  C C6    . NAG M 5 .   ? 80.548  23.475  6.023  1.00 68.90 ? 2681 NAG B C6    1 
HETATM 9260  C C7    . NAG M 5 .   ? 81.040  30.052  7.531  1.00 71.04 ? 2681 NAG B C7    1 
HETATM 9261  C C8    . NAG M 5 .   ? 80.715  31.404  6.882  1.00 68.27 ? 2681 NAG B C8    1 
HETATM 9262  N N2    . NAG M 5 .   ? 80.815  29.034  6.688  1.00 70.57 ? 2681 NAG B N2    1 
HETATM 9263  O O3    . NAG M 5 .   ? 83.398  27.509  6.528  1.00 72.34 ? 2681 NAG B O3    1 
HETATM 9264  O O4    . NAG M 5 .   ? 82.974  24.968  5.288  1.00 71.90 ? 2681 NAG B O4    1 
HETATM 9265  O O5    . NAG M 5 .   ? 79.817  25.499  7.107  1.00 68.73 ? 2681 NAG B O5    1 
HETATM 9266  O O6    . NAG M 5 .   ? 81.171  22.909  7.168  1.00 71.88 ? 2681 NAG B O6    1 
HETATM 9267  O O7    . NAG M 5 .   ? 81.472  29.929  8.715  1.00 70.86 ? 2681 NAG B O7    1 
HETATM 9268  C C1    . BOG N 6 .   ? 80.500  12.182  53.784 1.00 45.30 ? 2702 BOG B C1    1 
HETATM 9269  O O1    . BOG N 6 .   ? 80.204  11.146  54.723 1.00 43.43 ? 2702 BOG B O1    1 
HETATM 9270  C C2    . BOG N 6 .   ? 80.593  13.538  54.510 1.00 45.83 ? 2702 BOG B C2    1 
HETATM 9271  O O2    . BOG N 6 .   ? 79.356  13.833  55.160 1.00 46.52 ? 2702 BOG B O2    1 
HETATM 9272  C C3    . BOG N 6 .   ? 80.950  14.640  53.500 1.00 47.27 ? 2702 BOG B C3    1 
HETATM 9273  O O3    . BOG N 6 .   ? 81.066  15.886  54.158 1.00 47.49 ? 2702 BOG B O3    1 
HETATM 9274  C C4    . BOG N 6 .   ? 82.275  14.294  52.823 1.00 46.24 ? 2702 BOG B C4    1 
HETATM 9275  O O4    . BOG N 6 .   ? 82.633  15.300  51.880 1.00 46.31 ? 2702 BOG B O4    1 
HETATM 9276  C C5    . BOG N 6 .   ? 82.130  12.921  52.123 1.00 46.39 ? 2702 BOG B C5    1 
HETATM 9277  O O5    . BOG N 6 .   ? 81.753  11.910  53.101 1.00 45.73 ? 2702 BOG B O5    1 
HETATM 9278  C C6    . BOG N 6 .   ? 83.429  12.524  51.455 1.00 45.56 ? 2702 BOG B C6    1 
HETATM 9279  O O6    . BOG N 6 .   ? 83.143  11.727  50.329 1.00 45.62 ? 2702 BOG B O6    1 
HETATM 9280  C "C1'" . BOG N 6 .   ? 79.435  10.091  54.177 1.00 43.26 ? 2702 BOG B "C1'" 1 
HETATM 9281  C "C2'" . BOG N 6 .   ? 79.705  8.845   54.990 1.00 41.84 ? 2702 BOG B "C2'" 1 
HETATM 9282  C "C3'" . BOG N 6 .   ? 78.433  8.041   55.109 1.00 41.38 ? 2702 BOG B "C3'" 1 
HETATM 9283  C "C4'" . BOG N 6 .   ? 78.624  6.776   55.902 1.00 40.60 ? 2702 BOG B "C4'" 1 
HETATM 9284  C "C5'" . BOG N 6 .   ? 77.311  6.034   55.981 1.00 41.08 ? 2702 BOG B "C5'" 1 
HETATM 9285  C "C6'" . BOG N 6 .   ? 77.447  4.581   55.545 1.00 41.64 ? 2702 BOG B "C6'" 1 
HETATM 9286  C "C7'" . BOG N 6 .   ? 76.097  3.867   55.636 1.00 42.34 ? 2702 BOG B "C7'" 1 
HETATM 9287  C "C8'" . BOG N 6 .   ? 76.191  2.409   55.211 1.00 40.59 ? 2702 BOG B "C8'" 1 
HETATM 9288  C C1    . BOG O 6 .   ? 69.266  30.563  28.935 1.00 61.82 ? 2704 BOG B C1    1 
HETATM 9289  O O1    . BOG O 6 .   ? 69.347  29.265  29.541 1.00 59.82 ? 2704 BOG B O1    1 
HETATM 9290  C C2    . BOG O 6 .   ? 68.195  30.546  27.817 1.00 63.10 ? 2704 BOG B C2    1 
HETATM 9291  O O2    . BOG O 6 .   ? 68.509  29.552  26.846 1.00 62.46 ? 2704 BOG B O2    1 
HETATM 9292  C C3    . BOG O 6 .   ? 68.115  31.955  27.175 1.00 64.08 ? 2704 BOG B C3    1 
HETATM 9293  O O3    . BOG O 6 .   ? 67.125  31.979  26.159 1.00 62.84 ? 2704 BOG B O3    1 
HETATM 9294  C C4    . BOG O 6 .   ? 67.761  32.977  28.255 1.00 63.53 ? 2704 BOG B C4    1 
HETATM 9295  O O4    . BOG O 6 .   ? 67.684  34.276  27.697 1.00 63.44 ? 2704 BOG B O4    1 
HETATM 9296  C C5    . BOG O 6 .   ? 68.822  32.946  29.373 1.00 63.34 ? 2704 BOG B C5    1 
HETATM 9297  O O5    . BOG O 6 .   ? 68.910  31.598  29.917 1.00 62.11 ? 2704 BOG B O5    1 
HETATM 9298  C C6    . BOG O 6 .   ? 68.444  33.938  30.478 1.00 62.96 ? 2704 BOG B C6    1 
HETATM 9299  O O6    . BOG O 6 .   ? 69.572  34.340  31.223 1.00 65.35 ? 2704 BOG B O6    1 
HETATM 9300  C "C1'" . BOG O 6 .   ? 70.134  29.257  30.722 1.00 56.21 ? 2704 BOG B "C1'" 1 
HETATM 9301  C "C2'" . BOG O 6 .   ? 70.963  27.987  30.834 1.00 52.94 ? 2704 BOG B "C2'" 1 
HETATM 9302  C "C3'" . BOG O 6 .   ? 71.479  27.391  29.533 1.00 46.48 ? 2704 BOG B "C3'" 1 
HETATM 9303  C "C4'" . BOG O 6 .   ? 72.290  26.146  29.869 1.00 42.69 ? 2704 BOG B "C4'" 1 
HETATM 9304  C "C5'" . BOG O 6 .   ? 72.855  25.453  28.653 1.00 38.27 ? 2704 BOG B "C5'" 1 
HETATM 9305  C "C6'" . BOG O 6 .   ? 74.346  25.170  28.754 1.00 34.72 ? 2704 BOG B "C6'" 1 
HETATM 9306  C "C7'" . BOG O 6 .   ? 74.829  24.479  27.498 1.00 32.53 ? 2704 BOG B "C7'" 1 
HETATM 9307  C "C8'" . BOG O 6 .   ? 76.302  24.198  27.560 1.00 33.65 ? 2704 BOG B "C8'" 1 
HETATM 9308  C C1    . ACD P 7 .   ? 66.383  18.968  34.731 1.00 27.73 ? 2701 ACD B C1    1 
HETATM 9309  C C2    . ACD P 7 .   ? 67.527  18.085  35.218 1.00 26.26 ? 2701 ACD B C2    1 
HETATM 9310  C C3    . ACD P 7 .   ? 68.684  18.892  35.823 1.00 24.19 ? 2701 ACD B C3    1 
HETATM 9311  C C4    . ACD P 7 .   ? 68.263  19.576  37.125 1.00 25.25 ? 2701 ACD B C4    1 
HETATM 9312  C C5    . ACD P 7 .   ? 69.251  20.632  37.571 1.00 25.04 ? 2701 ACD B C5    1 
HETATM 9313  C C6    . ACD P 7 .   ? 70.129  20.540  38.590 1.00 23.49 ? 2701 ACD B C6    1 
HETATM 9314  C C7    . ACD P 7 .   ? 70.303  19.346  39.523 1.00 21.95 ? 2701 ACD B C7    1 
HETATM 9315  C C8    . ACD P 7 .   ? 71.617  18.606  39.297 1.00 19.65 ? 2701 ACD B C8    1 
HETATM 9316  C C9    . ACD P 7 .   ? 71.806  17.277  39.235 1.00 20.49 ? 2701 ACD B C9    1 
HETATM 9317  C C10   . ACD P 7 .   ? 70.757  16.181  39.344 1.00 19.73 ? 2701 ACD B C10   1 
HETATM 9318  C C11   . ACD P 7 .   ? 71.251  15.053  40.226 1.00 20.35 ? 2701 ACD B C11   1 
HETATM 9319  C C12   . ACD P 7 .   ? 70.586  14.432  41.218 1.00 22.44 ? 2701 ACD B C12   1 
HETATM 9320  C C13   . ACD P 7 .   ? 69.193  14.610  41.731 1.00 23.28 ? 2701 ACD B C13   1 
HETATM 9321  C C14   . ACD P 7 .   ? 68.465  13.254  41.897 1.00 24.98 ? 2701 ACD B C14   1 
HETATM 9322  C C15   . ACD P 7 .   ? 67.145  13.009  42.121 1.00 27.37 ? 2701 ACD B C15   1 
HETATM 9323  C C16   . ACD P 7 .   ? 65.977  14.028  42.279 1.00 28.24 ? 2701 ACD B C16   1 
HETATM 9324  C C17   . ACD P 7 .   ? 65.335  14.207  40.891 1.00 28.91 ? 2701 ACD B C17   1 
HETATM 9325  C C18   . ACD P 7 .   ? 63.995  13.474  40.706 1.00 29.85 ? 2701 ACD B C18   1 
HETATM 9326  C C19   . ACD P 7 .   ? 63.396  13.723  39.293 1.00 30.48 ? 2701 ACD B C19   1 
HETATM 9327  C C20   . ACD P 7 .   ? 62.047  12.999  39.141 1.00 32.72 ? 2701 ACD B C20   1 
HETATM 9328  O O1    . ACD P 7 .   ? 65.247  18.807  35.247 1.00 25.00 ? 2701 ACD B O1    1 
HETATM 9329  O O2    . ACD P 7 .   ? 66.622  19.824  33.843 1.00 27.08 ? 2701 ACD B O2    1 
HETATM 9330  O O     . HOH Q 8 .   ? 40.368  -0.253  39.404 1.00 51.82 ? 3001 HOH A O     1 
HETATM 9331  O O     . HOH Q 8 .   ? 43.920  -0.882  29.044 1.00 37.23 ? 3002 HOH A O     1 
HETATM 9332  O O     . HOH Q 8 .   ? 48.556  3.850   35.241 1.00 19.66 ? 3003 HOH A O     1 
HETATM 9333  O O     . HOH Q 8 .   ? 14.543  7.867   46.260 1.00 65.46 ? 3004 HOH A O     1 
HETATM 9334  O O     . HOH Q 8 .   ? 42.159  18.223  60.127 1.00 67.18 ? 3005 HOH A O     1 
HETATM 9335  O O     . HOH Q 8 .   ? 41.689  18.198  43.599 1.00 16.68 ? 3006 HOH A O     1 
HETATM 9336  O O     . HOH Q 8 .   ? 41.635  14.613  38.824 1.00 24.38 ? 3007 HOH A O     1 
HETATM 9337  O O     . HOH Q 8 .   ? 47.346  22.556  35.944 1.00 25.64 ? 3009 HOH A O     1 
HETATM 9338  O O     . HOH Q 8 .   ? 31.695  26.504  21.788 1.00 20.47 ? 3010 HOH A O     1 
HETATM 9339  O O     . HOH Q 8 .   ? 38.856  33.938  25.644 1.00 48.68 ? 3011 HOH A O     1 
HETATM 9340  O O     . HOH Q 8 .   ? 23.642  15.262  16.038 1.00 52.04 ? 3012 HOH A O     1 
HETATM 9341  O O     . HOH Q 8 .   ? 25.433  13.030  17.392 1.00 56.19 ? 3013 HOH A O     1 
HETATM 9342  O O     . HOH Q 8 .   ? 21.907  18.522  18.982 1.00 62.61 ? 3014 HOH A O     1 
HETATM 9343  O O     . HOH Q 8 .   ? 21.399  19.524  14.149 1.00 73.81 ? 3015 HOH A O     1 
HETATM 9344  O O     . HOH Q 8 .   ? 19.779  17.023  14.844 1.00 52.65 ? 3016 HOH A O     1 
HETATM 9345  O O     . HOH Q 8 .   ? 2.667   26.085  37.625 1.00 64.23 ? 3017 HOH A O     1 
HETATM 9346  O O     . HOH Q 8 .   ? 4.199   29.050  37.336 1.00 17.68 ? 3018 HOH A O     1 
HETATM 9347  O O     . HOH Q 8 .   ? 2.270   25.966  42.218 1.00 94.58 ? 3019 HOH A O     1 
HETATM 9348  O O     . HOH Q 8 .   ? 53.673  51.816  45.852 1.00 47.42 ? 3020 HOH A O     1 
HETATM 9349  O O     . HOH Q 8 .   ? 30.664  62.409  36.943 1.00 51.18 ? 3021 HOH A O     1 
HETATM 9350  O O     . HOH Q 8 .   ? 37.400  52.508  40.909 1.00 20.55 ? 3022 HOH A O     1 
HETATM 9351  O O     . HOH Q 8 .   ? 35.110  47.947  40.436 1.00 20.17 ? 3023 HOH A O     1 
HETATM 9352  O O     . HOH Q 8 .   ? 33.363  51.611  54.175 1.00 33.66 ? 3024 HOH A O     1 
HETATM 9353  O O     . HOH Q 8 .   ? 33.979  54.464  50.690 1.00 28.39 ? 3025 HOH A O     1 
HETATM 9354  O O     . HOH Q 8 .   ? 35.167  52.770  52.461 1.00 14.48 ? 3026 HOH A O     1 
HETATM 9355  O O     . HOH Q 8 .   ? 36.167  55.546  48.998 1.00 42.28 ? 3027 HOH A O     1 
HETATM 9356  O O     . HOH Q 8 .   ? 34.619  56.486  53.926 1.00 56.26 ? 3028 HOH A O     1 
HETATM 9357  O O     . HOH Q 8 .   ? 31.127  54.710  51.833 1.00 59.07 ? 3029 HOH A O     1 
HETATM 9358  O O     . HOH Q 8 .   ? 41.728  47.298  62.697 1.00 33.52 ? 3030 HOH A O     1 
HETATM 9359  O O     . HOH Q 8 .   ? 39.995  45.537  60.826 1.00 67.38 ? 3031 HOH A O     1 
HETATM 9360  O O     . HOH Q 8 .   ? 41.569  43.018  64.297 1.00 32.39 ? 3032 HOH A O     1 
HETATM 9361  O O     . HOH Q 8 .   ? 40.842  42.493  61.981 1.00 47.83 ? 3033 HOH A O     1 
HETATM 9362  O O     . HOH Q 8 .   ? 39.776  49.503  63.713 1.00 72.90 ? 3034 HOH A O     1 
HETATM 9363  O O     . HOH Q 8 .   ? 21.076  33.765  55.226 1.00 61.81 ? 3035 HOH A O     1 
HETATM 9364  O O     . HOH Q 8 .   ? 51.746  52.186  43.001 1.00 42.80 ? 3036 HOH A O     1 
HETATM 9365  O O     . HOH Q 8 .   ? 37.362  31.465  58.362 1.00 38.87 ? 3037 HOH A O     1 
HETATM 9366  O O     . HOH Q 8 .   ? 20.677  23.161  48.097 1.00 44.13 ? 3038 HOH A O     1 
HETATM 9367  O O     . HOH Q 8 .   ? 18.314  26.702  57.869 1.00 58.27 ? 3039 HOH A O     1 
HETATM 9368  O O     . HOH Q 8 .   ? 16.301  22.938  56.116 1.00 58.94 ? 3040 HOH A O     1 
HETATM 9369  O O     . HOH Q 8 .   ? 14.871  19.434  52.520 1.00 44.00 ? 3041 HOH A O     1 
HETATM 9370  O O     . HOH Q 8 .   ? 15.126  22.749  53.705 1.00 53.64 ? 3042 HOH A O     1 
HETATM 9371  O O     . HOH Q 8 .   ? 29.945  26.844  28.860 1.00 59.83 ? 3044 HOH A O     1 
HETATM 9372  O O     . HOH Q 8 .   ? 10.903  44.316  48.469 1.00 36.06 ? 3045 HOH A O     1 
HETATM 9373  O O     . HOH Q 8 .   ? 15.656  51.285  32.258 1.00 62.07 ? 3046 HOH A O     1 
HETATM 9374  O O     . HOH Q 8 .   ? 14.960  64.418  53.224 1.00 78.79 ? 3047 HOH A O     1 
HETATM 9375  O O     . HOH Q 8 .   ? 18.881  54.432  51.030 1.00 24.69 ? 3048 HOH A O     1 
HETATM 9376  O O     . HOH Q 8 .   ? 21.779  54.789  51.237 1.00 36.96 ? 3049 HOH A O     1 
HETATM 9377  O O     . HOH Q 8 .   ? 14.919  67.620  46.821 1.00 58.11 ? 3050 HOH A O     1 
HETATM 9378  O O     . HOH Q 8 .   ? 7.101   36.921  50.697 1.00 67.81 ? 3051 HOH A O     1 
HETATM 9379  O O     . HOH Q 8 .   ? 6.203   40.866  42.335 1.00 85.79 ? 3052 HOH A O     1 
HETATM 9380  O O     . HOH Q 8 .   ? 8.591   39.278  48.496 1.00 58.70 ? 3053 HOH A O     1 
HETATM 9381  O O     . HOH Q 8 .   ? 5.159   37.119  45.181 1.00 79.71 ? 3054 HOH A O     1 
HETATM 9382  O O     . HOH Q 8 .   ? 7.194   17.416  44.396 1.00 66.84 ? 3055 HOH A O     1 
HETATM 9383  O O     . HOH Q 8 .   ? 12.708  32.909  22.882 1.00 28.33 ? 3056 HOH A O     1 
HETATM 9384  O O     . HOH Q 8 .   ? 13.367  36.627  26.792 1.00 26.60 ? 3057 HOH A O     1 
HETATM 9385  O O     . HOH Q 8 .   ? 9.897   32.435  18.759 1.00 78.72 ? 3058 HOH A O     1 
HETATM 9386  O O     . HOH Q 8 .   ? 19.543  35.350  25.053 1.00 55.38 ? 3059 HOH A O     1 
HETATM 9387  O O     . HOH Q 8 .   ? 13.427  11.942  42.832 1.00 81.84 ? 3060 HOH A O     1 
HETATM 9388  O O     . HOH Q 8 .   ? 4.070   10.226  25.146 1.00 46.02 ? 3061 HOH A O     1 
HETATM 9389  O O     . HOH Q 8 .   ? 12.088  4.437   23.807 1.00 61.38 ? 3062 HOH A O     1 
HETATM 9390  O O     . HOH Q 8 .   ? 10.719  7.014   29.418 1.00 72.29 ? 3064 HOH A O     1 
HETATM 9391  O O     . HOH Q 8 .   ? 43.949  37.017  62.956 1.00 40.94 ? 3065 HOH A O     1 
HETATM 9392  O O     . HOH Q 8 .   ? 36.430  -2.849  26.557 1.00 52.30 ? 3066 HOH A O     1 
HETATM 9393  O O     . HOH Q 8 .   ? 39.566  35.432  35.774 1.00 19.05 ? 3067 HOH A O     1 
HETATM 9394  O O     . HOH Q 8 .   ? 39.674  6.947   20.312 1.00 28.40 ? 3068 HOH A O     1 
HETATM 9395  O O     . HOH Q 8 .   ? 31.772  38.344  44.641 1.00 23.28 ? 3069 HOH A O     1 
HETATM 9396  O O     . HOH Q 8 .   ? 39.395  49.103  29.917 1.00 21.43 ? 3070 HOH A O     1 
HETATM 9397  O O     . HOH Q 8 .   ? 35.274  -3.494  24.233 1.00 62.25 ? 3071 HOH A O     1 
HETATM 9398  O O     . HOH Q 8 .   ? 21.903  32.118  28.115 1.00 49.08 ? 3072 HOH A O     1 
HETATM 9399  O O     . HOH Q 8 .   ? 34.370  10.535  15.963 1.00 83.95 ? 3073 HOH A O     1 
HETATM 9400  O O     . HOH Q 8 .   ? 45.809  19.872  50.753 1.00 62.75 ? 3074 HOH A O     1 
HETATM 9401  O O     . HOH Q 8 .   ? 15.645  18.605  62.941 1.00 82.46 ? 3075 HOH A O     1 
HETATM 9402  O O     . HOH Q 8 .   ? 30.053  34.492  57.792 1.00 32.55 ? 3076 HOH A O     1 
HETATM 9403  O O     . HOH Q 8 .   ? 41.491  24.546  15.264 1.00 58.49 ? 3077 HOH A O     1 
HETATM 9404  O O     . HOH Q 8 .   ? 45.110  32.875  64.000 1.00 66.50 ? 3079 HOH A O     1 
HETATM 9405  O O     . HOH Q 8 .   ? 47.154  26.198  22.157 1.00 27.84 ? 3080 HOH A O     1 
HETATM 9406  O O     . HOH Q 8 .   ? 27.724  47.640  32.175 1.00 50.50 ? 3082 HOH A O     1 
HETATM 9407  O O     . HOH Q 8 .   ? 17.130  31.884  22.764 1.00 38.97 ? 3083 HOH A O     1 
HETATM 9408  O O     . HOH Q 8 .   ? 45.823  29.599  27.329 1.00 29.52 ? 3084 HOH A O     1 
HETATM 9409  O O     . HOH Q 8 .   ? 36.810  39.837  30.628 1.00 32.61 ? 3085 HOH A O     1 
HETATM 9410  O O     . HOH Q 8 .   ? 6.741   35.743  34.162 1.00 43.56 ? 3086 HOH A O     1 
HETATM 9411  O O     . HOH Q 8 .   ? 7.676   30.776  51.082 1.00 71.21 ? 3087 HOH A O     1 
HETATM 9412  O O     . HOH Q 8 .   ? 34.697  4.381   39.234 1.00 35.36 ? 3088 HOH A O     1 
HETATM 9413  O O     . HOH Q 8 .   ? 43.558  39.874  65.666 1.00 66.96 ? 3089 HOH A O     1 
HETATM 9414  O O     . HOH Q 8 .   ? 10.415  34.706  62.793 1.00 79.68 ? 3090 HOH A O     1 
HETATM 9415  O O     . HOH Q 8 .   ? 32.585  52.593  27.799 1.00 57.17 ? 3091 HOH A O     1 
HETATM 9416  O O     . HOH Q 8 .   ? 43.325  24.383  52.051 1.00 13.10 ? 3092 HOH A O     1 
HETATM 9417  O O     . HOH Q 8 .   ? 2.066   24.862  26.676 1.00 46.16 ? 3093 HOH A O     1 
HETATM 9418  O O     . HOH Q 8 .   ? 45.840  52.192  43.883 1.00 19.82 ? 3094 HOH A O     1 
HETATM 9419  O O     . HOH Q 8 .   ? 36.244  31.662  33.347 1.00 18.91 ? 3095 HOH A O     1 
HETATM 9420  O O     . HOH Q 8 .   ? 25.638  37.135  57.902 1.00 20.10 ? 3096 HOH A O     1 
HETATM 9421  O O     . HOH Q 8 .   ? 24.936  53.870  51.647 1.00 13.38 ? 3097 HOH A O     1 
HETATM 9422  O O     . HOH Q 8 .   ? 52.308  41.446  54.685 1.00 41.23 ? 3098 HOH A O     1 
HETATM 9423  O O     . HOH Q 8 .   ? 38.052  18.516  33.006 1.00 21.39 ? 3099 HOH A O     1 
HETATM 9424  O O     . HOH Q 8 .   ? 21.388  5.553   51.922 1.00 37.27 ? 3100 HOH A O     1 
HETATM 9425  O O     . HOH Q 8 .   ? 14.886  20.888  17.452 1.00 68.06 ? 3101 HOH A O     1 
HETATM 9426  O O     . HOH Q 8 .   ? 22.738  16.331  48.456 1.00 27.66 ? 3102 HOH A O     1 
HETATM 9427  O O     . HOH Q 8 .   ? 13.585  51.312  51.499 1.00 28.34 ? 3103 HOH A O     1 
HETATM 9428  O O     . HOH Q 8 .   ? 16.079  5.432   22.048 1.00 44.59 ? 3104 HOH A O     1 
HETATM 9429  O O     . HOH Q 8 .   ? 51.415  37.877  61.606 1.00 28.14 ? 3105 HOH A O     1 
HETATM 9430  O O     . HOH Q 8 .   ? 44.239  14.939  35.527 1.00 30.44 ? 3106 HOH A O     1 
HETATM 9431  O O     . HOH Q 8 .   ? 33.769  13.834  21.495 1.00 35.58 ? 3107 HOH A O     1 
HETATM 9432  O O     . HOH Q 8 .   ? 18.932  11.552  30.416 1.00 37.11 ? 3108 HOH A O     1 
HETATM 9433  O O     . HOH Q 8 .   ? 29.438  39.548  45.602 1.00 20.18 ? 3109 HOH A O     1 
HETATM 9434  O O     . HOH Q 8 .   ? 19.725  57.900  48.308 1.00 30.24 ? 3110 HOH A O     1 
HETATM 9435  O O     . HOH Q 8 .   ? 32.988  44.241  55.745 1.00 18.27 ? 3111 HOH A O     1 
HETATM 9436  O O     . HOH Q 8 .   ? 35.940  16.841  35.764 1.00 44.08 ? 3112 HOH A O     1 
HETATM 9437  O O     . HOH Q 8 .   ? 24.715  38.360  30.255 1.00 77.03 ? 3113 HOH A O     1 
HETATM 9438  O O     . HOH Q 8 .   ? 37.942  10.224  26.399 1.00 29.63 ? 3114 HOH A O     1 
HETATM 9439  O O     . HOH Q 8 .   ? 31.466  17.674  19.955 1.00 71.44 ? 3115 HOH A O     1 
HETATM 9440  O O     . HOH Q 8 .   ? 46.124  42.006  41.874 1.00 28.11 ? 3116 HOH A O     1 
HETATM 9441  O O     . HOH Q 8 .   ? 29.092  9.225   29.954 1.00 23.65 ? 3117 HOH A O     1 
HETATM 9442  O O     . HOH Q 8 .   ? 17.289  65.700  39.573 1.00 54.43 ? 3118 HOH A O     1 
HETATM 9443  O O     . HOH Q 8 .   ? 51.496  26.477  49.315 1.00 49.03 ? 3119 HOH A O     1 
HETATM 9444  O O     . HOH Q 8 .   ? 48.611  43.933  40.009 1.00 19.20 ? 3120 HOH A O     1 
HETATM 9445  O O     . HOH Q 8 .   ? 17.411  16.783  67.812 1.00 61.79 ? 3121 HOH A O     1 
HETATM 9446  O O     . HOH Q 8 .   ? 28.506  9.079   32.591 1.00 19.10 ? 3122 HOH A O     1 
HETATM 9447  O O     . HOH Q 8 .   ? 37.873  20.037  35.801 1.00 58.22 ? 3123 HOH A O     1 
HETATM 9448  O O     . HOH Q 8 .   ? 32.092  44.715  41.006 1.00 19.94 ? 3124 HOH A O     1 
HETATM 9449  O O     . HOH Q 8 .   ? 7.034   20.340  41.015 1.00 37.55 ? 3125 HOH A O     1 
HETATM 9450  O O     . HOH Q 8 .   ? 36.955  12.151  17.472 1.00 49.07 ? 3126 HOH A O     1 
HETATM 9451  O O     . HOH Q 8 .   ? 37.916  53.408  56.837 1.00 48.67 ? 3127 HOH A O     1 
HETATM 9452  O O     . HOH Q 8 .   ? 48.183  26.579  30.219 1.00 47.02 ? 3128 HOH A O     1 
HETATM 9453  O O     . HOH Q 8 .   ? 20.966  26.508  56.413 1.00 42.52 ? 3129 HOH A O     1 
HETATM 9454  O O     . HOH Q 8 .   ? 29.035  16.331  27.408 1.00 25.84 ? 3130 HOH A O     1 
HETATM 9455  O O     . HOH Q 8 .   ? 50.523  55.555  49.098 1.00 34.60 ? 3131 HOH A O     1 
HETATM 9456  O O     . HOH Q 8 .   ? 45.993  24.942  34.673 1.00 39.01 ? 3132 HOH A O     1 
HETATM 9457  O O     . HOH Q 8 .   ? 54.875  55.022  53.171 1.00 66.65 ? 3133 HOH A O     1 
HETATM 9458  O O     . HOH Q 8 .   ? 43.917  48.997  61.645 1.00 41.26 ? 3134 HOH A O     1 
HETATM 9459  O O     . HOH Q 8 .   ? 54.671  48.440  50.952 1.00 44.47 ? 3135 HOH A O     1 
HETATM 9460  O O     . HOH Q 8 .   ? 41.036  52.893  59.896 1.00 43.64 ? 3136 HOH A O     1 
HETATM 9461  O O     . HOH Q 8 .   ? 28.492  -3.783  30.974 1.00 45.63 ? 3137 HOH A O     1 
HETATM 9462  O O     . HOH Q 8 .   ? 31.270  62.132  33.966 1.00 18.47 ? 3138 HOH A O     1 
HETATM 9463  O O     . HOH Q 8 .   ? 23.280  17.797  23.902 1.00 25.28 ? 3139 HOH A O     1 
HETATM 9464  O O     . HOH Q 8 .   ? 2.427   35.508  39.929 1.00 69.64 ? 3140 HOH A O     1 
HETATM 9465  O O     . HOH Q 8 .   ? 19.952  55.654  34.094 1.00 67.37 ? 3141 HOH A O     1 
HETATM 9466  O O     . HOH Q 8 .   ? 37.405  54.025  53.256 1.00 15.14 ? 3142 HOH A O     1 
HETATM 9467  O O     . HOH Q 8 .   ? 34.177  42.054  32.271 1.00 70.67 ? 3144 HOH A O     1 
HETATM 9468  O O     . HOH Q 8 .   ? 40.556  23.478  27.653 1.00 23.34 ? 3145 HOH A O     1 
HETATM 9469  O O     . HOH Q 8 .   ? 33.864  14.874  17.304 1.00 36.67 ? 3146 HOH A O     1 
HETATM 9470  O O     . HOH Q 8 .   ? 21.065  21.171  50.104 1.00 33.58 ? 3147 HOH A O     1 
HETATM 9471  O O     . HOH Q 8 .   ? 22.967  37.487  58.150 1.00 25.13 ? 3148 HOH A O     1 
HETATM 9472  O O     . HOH Q 8 .   ? 2.083   22.907  29.627 1.00 44.17 ? 3149 HOH A O     1 
HETATM 9473  O O     . HOH Q 8 .   ? 34.402  26.038  39.935 1.00 44.12 ? 3150 HOH A O     1 
HETATM 9474  O O     . HOH Q 8 .   ? 22.695  34.838  33.014 1.00 60.81 ? 3151 HOH A O     1 
HETATM 9475  O O     . HOH Q 8 .   ? 40.286  4.809   33.768 1.00 27.40 ? 3152 HOH A O     1 
HETATM 9476  O O     . HOH Q 8 .   ? 25.831  3.383   28.379 1.00 55.77 ? 3153 HOH A O     1 
HETATM 9477  O O     . HOH Q 8 .   ? 31.949  11.155  24.391 1.00 34.35 ? 3154 HOH A O     1 
HETATM 9478  O O     . HOH Q 8 .   ? 26.113  62.816  29.247 1.00 44.34 ? 3155 HOH A O     1 
HETATM 9479  O O     . HOH Q 8 .   ? 14.642  47.362  61.228 1.00 58.64 ? 3156 HOH A O     1 
HETATM 9480  O O     . HOH Q 8 .   ? 29.306  56.440  51.165 1.00 32.77 ? 3157 HOH A O     1 
HETATM 9481  O O     . HOH Q 8 .   ? 14.671  14.783  53.673 1.00 54.52 ? 3158 HOH A O     1 
HETATM 9482  O O     . HOH Q 8 .   ? 15.378  15.902  43.852 1.00 33.17 ? 3159 HOH A O     1 
HETATM 9483  O O     . HOH Q 8 .   ? 23.213  31.582  55.560 1.00 58.34 ? 3160 HOH A O     1 
HETATM 9484  O O     . HOH Q 8 .   ? 39.278  30.382  43.129 1.00 22.43 ? 3161 HOH A O     1 
HETATM 9485  O O     . HOH Q 8 .   ? 3.622   37.355  35.204 1.00 62.21 ? 3162 HOH A O     1 
HETATM 9486  O O     . HOH Q 8 .   ? 48.917  33.212  64.802 1.00 72.56 ? 3163 HOH A O     1 
HETATM 9487  O O     . HOH Q 8 .   ? 22.055  17.451  28.374 1.00 20.67 ? 3165 HOH A O     1 
HETATM 9488  O O     . HOH Q 8 .   ? 8.799   25.517  40.630 1.00 31.65 ? 3167 HOH A O     1 
HETATM 9489  O O     . HOH Q 8 .   ? 53.974  49.221  48.218 1.00 19.15 ? 3168 HOH A O     1 
HETATM 9490  O O     . HOH Q 8 .   ? 48.247  22.350  22.051 1.00 43.39 ? 3169 HOH A O     1 
HETATM 9491  O O     . HOH Q 8 .   ? 0.403   17.037  30.802 1.00 67.28 ? 3170 HOH A O     1 
HETATM 9492  O O     . HOH Q 8 .   ? 24.311  11.045  26.174 1.00 27.94 ? 3171 HOH A O     1 
HETATM 9493  O O     . HOH Q 8 .   ? 22.158  13.616  14.367 1.00 43.69 ? 3172 HOH A O     1 
HETATM 9494  O O     . HOH Q 8 .   ? 27.419  -0.032  27.985 1.00 73.67 ? 3173 HOH A O     1 
HETATM 9495  O O     . HOH Q 8 .   ? 47.694  43.006  60.646 1.00 66.69 ? 3174 HOH A O     1 
HETATM 9496  O O     . HOH Q 8 .   ? 39.493  21.978  38.434 1.00 37.25 ? 3175 HOH A O     1 
HETATM 9497  O O     . HOH Q 8 .   ? 14.451  44.343  55.029 1.00 31.55 ? 3176 HOH A O     1 
HETATM 9498  O O     . HOH Q 8 .   ? 7.077   39.039  46.104 1.00 34.68 ? 3177 HOH A O     1 
HETATM 9499  O O     . HOH Q 8 .   ? 31.307  9.151   40.316 1.00 39.36 ? 3178 HOH A O     1 
HETATM 9500  O O     . HOH Q 8 .   ? 18.299  23.089  19.624 1.00 49.83 ? 3179 HOH A O     1 
HETATM 9501  O O     . HOH Q 8 .   ? 23.478  17.999  21.126 1.00 33.67 ? 3180 HOH A O     1 
HETATM 9502  O O     . HOH Q 8 .   ? 42.103  10.554  26.406 1.00 31.02 ? 3181 HOH A O     1 
HETATM 9503  O O     . HOH Q 8 .   ? 9.105   18.726  39.536 1.00 50.53 ? 3182 HOH A O     1 
HETATM 9504  O O     . HOH Q 8 .   ? 39.262  18.116  64.179 1.00 70.62 ? 3183 HOH A O     1 
HETATM 9505  O O     . HOH Q 8 .   ? 21.187  5.410   16.697 1.00 46.58 ? 3184 HOH A O     1 
HETATM 9506  O O     . HOH Q 8 .   ? 8.605   30.934  16.357 1.00 50.61 ? 3185 HOH A O     1 
HETATM 9507  O O     . HOH Q 8 .   ? 35.619  17.135  16.444 1.00 58.49 ? 3186 HOH A O     1 
HETATM 9508  O O     . HOH Q 8 .   ? 39.173  12.157  46.803 1.00 59.68 ? 3187 HOH A O     1 
HETATM 9509  O O     . HOH Q 8 .   ? 38.496  39.651  28.257 1.00 47.32 ? 3188 HOH A O     1 
HETATM 9510  O O     . HOH Q 8 .   ? 25.294  6.096   39.207 1.00 64.11 ? 3189 HOH A O     1 
HETATM 9511  O O     . HOH Q 8 .   ? 35.568  22.883  38.430 1.00 18.16 ? 3190 HOH A O     1 
HETATM 9512  O O     . HOH Q 8 .   ? 14.525  12.461  21.085 1.00 43.78 ? 3191 HOH A O     1 
HETATM 9513  O O     . HOH Q 8 .   ? 43.200  26.380  35.481 1.00 35.93 ? 3192 HOH A O     1 
HETATM 9514  O O     . HOH Q 8 .   ? 39.883  21.079  29.750 1.00 21.20 ? 3193 HOH A O     1 
HETATM 9515  O O     . HOH Q 8 .   ? 42.956  37.377  34.843 1.00 73.48 ? 3195 HOH A O     1 
HETATM 9516  O O     . HOH Q 8 .   ? 28.232  58.472  25.870 1.00 68.78 ? 3196 HOH A O     1 
HETATM 9517  O O     . HOH Q 8 .   ? 27.586  28.795  58.143 1.00 54.28 ? 3197 HOH A O     1 
HETATM 9518  O O     . HOH Q 8 .   ? 3.350   11.163  27.820 1.00 43.25 ? 3198 HOH A O     1 
HETATM 9519  O O     . HOH Q 8 .   ? 28.899  60.429  38.032 1.00 35.37 ? 3199 HOH A O     1 
HETATM 9520  O O     . HOH Q 8 .   ? 55.394  30.790  57.822 1.00 17.18 ? 3200 HOH A O     1 
HETATM 9521  O O     . HOH Q 8 .   ? 35.356  40.877  58.419 1.00 25.00 ? 3201 HOH A O     1 
HETATM 9522  O O     . HOH Q 8 .   ? 41.539  28.950  38.782 1.00 21.68 ? 3202 HOH A O     1 
HETATM 9523  O O     . HOH Q 8 .   ? 36.413  25.129  54.110 1.00 20.45 ? 3203 HOH A O     1 
HETATM 9524  O O     . HOH Q 8 .   ? 19.533  11.768  21.420 1.00 43.67 ? 3204 HOH A O     1 
HETATM 9525  O O     . HOH Q 8 .   ? 33.184  -7.913  21.215 1.00 64.80 ? 3205 HOH A O     1 
HETATM 9526  O O     . HOH Q 8 .   ? 42.914  23.397  36.807 1.00 57.33 ? 3206 HOH A O     1 
HETATM 9527  O O     . HOH Q 8 .   ? 19.906  21.639  27.129 1.00 58.73 ? 3207 HOH A O     1 
HETATM 9528  O O     . HOH Q 8 .   ? 17.616  46.952  59.055 1.00 49.68 ? 3208 HOH A O     1 
HETATM 9529  O O     . HOH Q 8 .   ? 6.634   39.345  30.971 1.00 68.16 ? 3209 HOH A O     1 
HETATM 9530  O O     . HOH Q 8 .   ? 46.270  53.596  34.220 1.00 48.02 ? 3210 HOH A O     1 
HETATM 9531  O O     . HOH Q 8 .   ? 45.452  14.606  39.960 1.00 37.80 ? 3211 HOH A O     1 
HETATM 9532  O O     . HOH Q 8 .   ? 33.357  25.877  65.380 1.00 44.20 ? 3212 HOH A O     1 
HETATM 9533  O O     . HOH Q 8 .   ? 2.932   19.455  37.873 1.00 34.18 ? 3213 HOH A O     1 
HETATM 9534  O O     . HOH Q 8 .   ? 36.746  7.953   22.516 1.00 49.38 ? 3214 HOH A O     1 
HETATM 9535  O O     . HOH Q 8 .   ? 30.446  7.022   36.581 1.00 59.22 ? 3215 HOH A O     1 
HETATM 9536  O O     . HOH Q 8 .   ? 27.737  65.430  48.615 1.00 55.39 ? 3216 HOH A O     1 
HETATM 9537  O O     . HOH Q 8 .   ? 9.504   38.540  44.487 1.00 36.56 ? 3217 HOH A O     1 
HETATM 9538  O O     . HOH Q 8 .   ? 55.417  43.953  55.075 1.00 55.97 ? 3267 HOH A O     1 
HETATM 9539  O O     . HOH Q 8 .   ? 37.040  15.688  20.046 1.00 26.58 ? 3275 HOH A O     1 
HETATM 9540  O O     . HOH Q 8 .   ? 39.157  21.963  17.118 1.00 33.30 ? 3278 HOH A O     1 
HETATM 9541  O O     . HOH Q 8 .   ? 58.344  46.300  49.599 1.00 45.57 ? 3313 HOH A O     1 
HETATM 9542  O O     . HOH Q 8 .   ? 7.063   8.865   32.753 1.00 25.79 ? 3399 HOH A O     1 
HETATM 9543  O O     . HOH Q 8 .   ? 34.518  24.040  26.491 1.00 17.84 ? 3400 HOH A O     1 
HETATM 9544  O O     . HOH Q 8 .   ? 33.805  24.695  37.726 1.00 14.12 ? 3402 HOH A O     1 
HETATM 9545  O O     . HOH Q 8 .   ? 51.332  42.323  52.183 1.00 23.16 ? 3403 HOH A O     1 
HETATM 9546  O O     . HOH Q 8 .   ? 11.351  26.261  37.010 1.00 19.81 ? 3404 HOH A O     1 
HETATM 9547  O O     . HOH Q 8 .   ? 17.199  20.593  40.424 1.00 25.02 ? 3406 HOH A O     1 
HETATM 9548  O O     . HOH Q 8 .   ? 31.746  23.202  26.584 1.00 33.88 ? 3407 HOH A O     1 
HETATM 9549  O O     . HOH Q 8 .   ? 35.228  51.049  40.213 1.00 27.61 ? 3409 HOH A O     1 
HETATM 9550  O O     . HOH Q 8 .   ? 30.972  10.169  21.154 1.00 42.73 ? 3412 HOH A O     1 
HETATM 9551  O O     . HOH Q 8 .   ? 23.942  14.518  50.245 1.00 39.00 ? 3413 HOH A O     1 
HETATM 9552  O O     . HOH Q 8 .   ? 34.815  12.545  32.683 1.00 46.50 ? 3416 HOH A O     1 
HETATM 9553  O O     . HOH Q 8 .   ? 33.387  46.702  42.361 1.00 15.42 ? 3417 HOH A O     1 
HETATM 9554  O O     . HOH Q 8 .   ? 39.091  59.948  37.580 1.00 66.39 ? 3419 HOH A O     1 
HETATM 9555  O O     . HOH Q 8 .   ? 18.916  50.275  60.262 1.00 42.71 ? 3421 HOH A O     1 
HETATM 9556  O O     . HOH Q 8 .   ? 55.054  41.388  53.964 1.00 29.08 ? 3422 HOH A O     1 
HETATM 9557  O O     . HOH Q 8 .   ? 27.944  43.066  60.937 1.00 54.08 ? 3423 HOH A O     1 
HETATM 9558  O O     . HOH Q 8 .   ? 18.668  30.028  21.626 1.00 28.18 ? 3425 HOH A O     1 
HETATM 9559  O O     . HOH Q 8 .   ? 9.478   18.350  47.029 1.00 35.88 ? 3427 HOH A O     1 
HETATM 9560  O O     . HOH Q 8 .   ? 30.413  38.503  30.921 1.00 30.51 ? 3428 HOH A O     1 
HETATM 9561  O O     . HOH Q 8 .   ? 33.926  28.489  41.101 1.00 22.51 ? 3430 HOH A O     1 
HETATM 9562  O O     . HOH Q 8 .   ? 34.979  5.001   13.484 1.00 60.48 ? 3433 HOH A O     1 
HETATM 9563  O O     . HOH Q 8 .   ? 15.033  26.638  18.176 1.00 45.83 ? 3435 HOH A O     1 
HETATM 9564  O O     . HOH Q 8 .   ? 43.534  42.909  37.984 1.00 24.38 ? 3436 HOH A O     1 
HETATM 9565  O O     . HOH Q 8 .   ? 37.820  10.356  21.769 1.00 20.34 ? 3438 HOH A O     1 
HETATM 9566  O O     . HOH Q 8 .   ? 17.242  12.797  20.199 1.00 52.02 ? 3439 HOH A O     1 
HETATM 9567  O O     . HOH Q 8 .   ? 32.158  4.361   51.199 1.00 67.96 ? 3440 HOH A O     1 
HETATM 9568  O O     . HOH Q 8 .   ? 42.195  28.467  59.462 1.00 40.07 ? 3441 HOH A O     1 
HETATM 9569  O O     . HOH Q 8 .   ? 51.450  24.843  27.414 1.00 33.17 ? 3442 HOH A O     1 
HETATM 9570  O O     . HOH Q 8 .   ? 37.698  41.081  69.284 1.00 33.16 ? 3444 HOH A O     1 
HETATM 9571  O O     . HOH Q 8 .   ? 37.623  33.848  36.798 1.00 35.93 ? 3445 HOH A O     1 
HETATM 9572  O O     . HOH Q 8 .   ? 22.291  45.356  61.596 1.00 43.89 ? 3446 HOH A O     1 
HETATM 9573  O O     . HOH Q 8 .   ? 30.888  64.162  32.323 1.00 34.97 ? 3447 HOH A O     1 
HETATM 9574  O O     . HOH Q 8 .   ? 30.930  58.581  31.984 1.00 60.33 ? 3448 HOH A O     1 
HETATM 9575  O O     . HOH Q 8 .   ? 37.714  41.926  61.660 1.00 32.37 ? 3449 HOH A O     1 
HETATM 9576  O O     . HOH Q 8 .   ? 18.298  20.396  47.737 1.00 31.77 ? 3450 HOH A O     1 
HETATM 9577  O O     . HOH Q 8 .   ? 21.181  9.137   43.319 1.00 56.46 ? 3451 HOH A O     1 
HETATM 9578  O O     . HOH Q 8 .   ? 30.962  8.908   34.092 1.00 56.29 ? 3453 HOH A O     1 
HETATM 9579  O O     . HOH Q 8 .   ? 32.080  6.346   32.696 1.00 40.17 ? 3456 HOH A O     1 
HETATM 9580  O O     . HOH Q 8 .   ? 8.149   24.448  42.532 1.00 52.22 ? 3458 HOH A O     1 
HETATM 9581  O O     . HOH Q 8 .   ? 44.293  29.904  37.823 1.00 47.91 ? 3459 HOH A O     1 
HETATM 9582  O O     . HOH Q 8 .   ? 47.095  26.298  24.512 1.00 25.96 ? 3462 HOH A O     1 
HETATM 9583  O O     . HOH Q 8 .   ? 28.852  32.203  20.723 1.00 53.53 ? 3463 HOH A O     1 
HETATM 9584  O O     . HOH Q 8 .   ? 43.428  29.607  34.901 1.00 65.03 ? 3464 HOH A O     1 
HETATM 9585  O O     . HOH Q 8 .   ? 40.108  24.998  29.601 1.00 29.62 ? 3466 HOH A O     1 
HETATM 9586  O O     . HOH Q 8 .   ? 4.182   17.621  25.680 1.00 40.15 ? 3467 HOH A O     1 
HETATM 9587  O O     . HOH Q 8 .   ? 32.264  5.043   27.238 1.00 56.87 ? 3468 HOH A O     1 
HETATM 9588  O O     . HOH Q 8 .   ? 26.140  63.495  31.903 1.00 47.46 ? 3470 HOH A O     1 
HETATM 9589  O O     . HOH Q 8 .   ? 31.990  27.144  69.569 1.00 58.28 ? 3471 HOH A O     1 
HETATM 9590  O O     . HOH Q 8 .   ? 45.106  41.842  36.237 1.00 37.19 ? 3473 HOH A O     1 
HETATM 9591  O O     . HOH Q 8 .   ? 41.901  30.083  41.590 1.00 44.31 ? 3475 HOH A O     1 
HETATM 9592  O O     . HOH Q 8 .   ? 0.009   28.790  38.056 1.00 41.32 ? 3476 HOH A O     1 
HETATM 9593  O O     . HOH Q 8 .   ? 30.856  20.786  19.142 1.00 50.55 ? 3477 HOH A O     1 
HETATM 9594  O O     . HOH Q 8 .   ? 50.890  40.035  63.031 1.00 32.78 ? 3479 HOH A O     1 
HETATM 9595  O O     . HOH Q 8 .   ? 27.912  5.262   30.319 1.00 31.87 ? 3480 HOH A O     1 
HETATM 9596  O O     . HOH Q 8 .   ? 36.485  41.893  34.747 1.00 53.88 ? 3484 HOH A O     1 
HETATM 9597  O O     . HOH Q 8 .   ? 41.953  39.932  37.749 1.00 48.16 ? 3485 HOH A O     1 
HETATM 9598  O O     . HOH Q 8 .   ? 17.608  22.121  51.593 1.00 49.11 ? 3486 HOH A O     1 
HETATM 9599  O O     . HOH Q 8 .   ? 32.144  39.997  61.576 1.00 31.83 ? 3487 HOH A O     1 
HETATM 9600  O O     . HOH Q 8 .   ? 38.778  58.749  43.787 1.00 40.01 ? 3489 HOH A O     1 
HETATM 9601  O O     . HOH Q 8 .   ? 37.416  17.181  42.480 1.00 57.14 ? 3495 HOH A O     1 
HETATM 9602  O O     . HOH Q 8 .   ? 11.080  30.540  22.341 1.00 53.57 ? 3497 HOH A O     1 
HETATM 9603  O O     . HOH Q 8 .   ? 39.990  37.244  28.482 1.00 41.09 ? 3498 HOH A O     1 
HETATM 9604  O O     . HOH Q 8 .   ? 42.004  35.120  62.290 1.00 34.43 ? 3500 HOH A O     1 
HETATM 9605  O O     . HOH Q 8 .   ? 34.831  10.891  24.159 1.00 55.86 ? 3502 HOH A O     1 
HETATM 9606  O O     . HOH Q 8 .   ? 27.714  12.599  44.477 1.00 35.39 ? 3503 HOH A O     1 
HETATM 9607  O O     . HOH Q 8 .   ? 32.246  7.008   25.645 1.00 57.11 ? 3506 HOH A O     1 
HETATM 9608  O O     . HOH Q 8 .   ? 16.856  3.615   26.911 1.00 41.41 ? 3508 HOH A O     1 
HETATM 9609  O O     . HOH Q 8 .   ? 33.645  41.803  56.417 1.00 28.44 ? 3509 HOH A O     1 
HETATM 9610  O O     . HOH Q 8 .   ? 33.867  39.663  45.989 1.00 49.45 ? 3511 HOH A O     1 
HETATM 9611  O O     . HOH Q 8 .   ? 3.134   11.435  33.731 1.00 42.33 ? 3513 HOH A O     1 
HETATM 9612  O O     . HOH Q 8 .   ? 17.572  40.823  57.796 1.00 82.99 ? 3514 HOH A O     1 
HETATM 9613  O O     . HOH Q 8 .   ? 16.602  13.838  52.093 1.00 49.89 ? 3515 HOH A O     1 
HETATM 9614  O O     . HOH Q 8 .   ? 19.398  39.147  60.039 1.00 63.98 ? 3517 HOH A O     1 
HETATM 9615  O O     . HOH Q 8 .   ? 20.929  5.932   32.115 1.00 51.75 ? 3518 HOH A O     1 
HETATM 9616  O O     . HOH Q 8 .   ? 15.350  13.355  49.002 1.00 50.68 ? 3519 HOH A O     1 
HETATM 9617  O O     . HOH Q 8 .   ? 14.692  23.561  18.420 1.00 55.20 ? 3522 HOH A O     1 
HETATM 9618  O O     . HOH Q 8 .   ? 27.809  6.155   39.056 1.00 45.76 ? 3524 HOH A O     1 
HETATM 9619  O O     . HOH Q 8 .   ? 57.054  45.451  52.144 1.00 63.10 ? 3527 HOH A O     1 
HETATM 9620  O O     . HOH Q 8 .   ? 43.974  27.396  39.217 1.00 33.63 ? 3529 HOH A O     1 
HETATM 9621  O O     . HOH Q 8 .   ? 19.120  2.105   30.441 1.00 71.98 ? 3530 HOH A O     1 
HETATM 9622  O O     . HOH Q 8 .   ? 57.155  49.380  52.630 1.00 51.57 ? 3531 HOH A O     1 
HETATM 9623  O O     . HOH Q 8 .   ? 12.057  17.978  16.318 1.00 76.11 ? 3532 HOH A O     1 
HETATM 9624  O O     . HOH Q 8 .   ? 2.551   28.989  44.018 1.00 72.38 ? 3536 HOH A O     1 
HETATM 9625  O O     . HOH Q 8 .   ? 5.290   34.814  46.983 1.00 47.43 ? 3542 HOH A O     1 
HETATM 9626  O O     . HOH Q 8 .   ? 30.037  63.013  41.554 1.00 65.43 ? 3545 HOH A O     1 
HETATM 9627  O O     . HOH Q 8 .   ? 18.906  17.821  17.836 1.00 43.18 ? 3546 HOH A O     1 
HETATM 9628  O O     . HOH Q 8 .   ? 8.960   43.129  47.721 1.00 43.85 ? 3547 HOH A O     1 
HETATM 9629  O O     . HOH Q 8 .   ? 16.836  45.412  56.507 1.00 55.30 ? 3552 HOH A O     1 
HETATM 9630  O O     . HOH Q 8 .   ? 38.133  55.816  51.252 1.00 33.90 ? 3553 HOH A O     1 
HETATM 9631  O O     . HOH Q 8 .   ? 47.902  28.685  25.787 1.00 33.07 ? 3554 HOH A O     1 
HETATM 9632  O O     . HOH Q 8 .   ? 40.173  44.033  30.374 1.00 51.79 ? 3555 HOH A O     1 
HETATM 9633  O O     . HOH Q 8 .   ? 4.208   41.388  35.107 1.00 59.34 ? 3556 HOH A O     1 
HETATM 9634  O O     . HOH Q 8 .   ? 12.704  7.040   22.047 1.00 43.22 ? 3558 HOH A O     1 
HETATM 9635  O O     . HOH Q 8 .   ? 50.201  24.966  29.546 1.00 23.87 ? 3559 HOH A O     1 
HETATM 9636  O O     . HOH Q 8 .   ? 42.631  23.269  17.824 1.00 41.05 ? 3561 HOH A O     1 
HETATM 9637  O O     . HOH Q 8 .   ? 42.007  56.414  34.404 1.00 45.44 ? 3562 HOH A O     1 
HETATM 9638  O O     . HOH Q 8 .   ? 14.844  4.076   29.341 1.00 57.74 ? 3564 HOH A O     1 
HETATM 9639  O O     . HOH Q 8 .   ? 14.574  43.942  61.362 1.00 76.89 ? 3565 HOH A O     1 
HETATM 9640  O O     . HOH Q 8 .   ? 33.252  29.837  61.360 1.00 44.97 ? 3567 HOH A O     1 
HETATM 9641  O O     . HOH Q 8 .   ? 38.537  51.501  58.595 1.00 62.66 ? 3568 HOH A O     1 
HETATM 9642  O O     . HOH Q 8 .   ? 29.861  65.005  47.795 1.00 61.60 ? 3572 HOH A O     1 
HETATM 9643  O O     . HOH Q 8 .   ? 16.438  12.658  43.800 1.00 62.62 ? 3573 HOH A O     1 
HETATM 9644  O O     . HOH Q 8 .   ? 42.741  38.108  29.553 1.00 42.56 ? 3575 HOH A O     1 
HETATM 9645  O O     . HOH Q 8 .   ? 0.035   25.073  31.744 1.00 59.22 ? 3577 HOH A O     1 
HETATM 9646  O O     . HOH Q 8 .   ? 33.896  -8.596  30.292 1.00 54.11 ? 3581 HOH A O     1 
HETATM 9647  O O     . HOH Q 8 .   ? 40.103  15.636  17.121 1.00 29.58 ? 3582 HOH A O     1 
HETATM 9648  O O     . HOH Q 8 .   ? 18.500  57.852  30.351 1.00 73.74 ? 3583 HOH A O     1 
HETATM 9649  O O     . HOH Q 8 .   ? 48.739  55.187  59.429 1.00 48.67 ? 3586 HOH A O     1 
HETATM 9650  O O     . HOH Q 8 .   ? 39.241  -1.460  12.148 1.00 67.62 ? 3587 HOH A O     1 
HETATM 9651  O O     . HOH Q 8 .   ? 28.431  6.232   32.622 1.00 32.61 ? 3588 HOH A O     1 
HETATM 9652  O O     . HOH Q 8 .   ? 23.496  62.596  52.476 1.00 84.00 ? 3589 HOH A O     1 
HETATM 9653  O O     . HOH Q 8 .   ? 15.903  1.871   21.166 1.00 65.21 ? 3590 HOH A O     1 
HETATM 9654  O O     . HOH Q 8 .   ? 16.301  61.165  46.043 1.00 53.04 ? 3593 HOH A O     1 
HETATM 9655  O O     . HOH Q 8 .   ? 30.719  6.497   29.652 1.00 62.92 ? 3594 HOH A O     1 
HETATM 9656  O O     . HOH Q 8 .   ? 13.401  58.396  47.618 1.00 54.83 ? 3596 HOH A O     1 
HETATM 9657  O O     . HOH Q 8 .   ? 18.994  34.769  22.009 1.00 54.90 ? 3597 HOH A O     1 
HETATM 9658  O O     . HOH Q 8 .   ? 28.406  5.110   34.635 1.00 33.16 ? 3599 HOH A O     1 
HETATM 9659  O O     . HOH Q 8 .   ? 2.706   33.533  43.738 1.00 49.37 ? 3601 HOH A O     1 
HETATM 9660  O O     . HOH Q 8 .   ? 3.050   9.803   29.864 1.00 49.47 ? 3603 HOH A O     1 
HETATM 9661  O O     . HOH Q 8 .   ? 47.221  44.747  30.650 1.00 47.69 ? 3604 HOH A O     1 
HETATM 9662  O O     . HOH Q 8 .   ? 20.329  10.416  46.785 1.00 47.56 ? 3606 HOH A O     1 
HETATM 9663  O O     . HOH Q 8 .   ? 22.159  40.581  61.736 1.00 25.70 ? 3609 HOH A O     1 
HETATM 9664  O O     . HOH Q 8 .   ? 21.675  30.197  21.356 1.00 33.38 ? 3613 HOH A O     1 
HETATM 9665  O O     . HOH Q 8 .   ? 18.053  8.160   43.674 1.00 53.60 ? 3615 HOH A O     1 
HETATM 9666  O O     . HOH Q 8 .   ? 9.534   18.319  19.006 1.00 27.41 ? 3616 HOH A O     1 
HETATM 9667  O O     . HOH Q 8 .   ? 14.944  44.065  64.351 1.00 58.30 ? 3617 HOH A O     1 
HETATM 9668  O O     . HOH Q 8 .   ? 17.981  22.739  47.810 1.00 40.63 ? 3618 HOH A O     1 
HETATM 9669  O O     . HOH Q 8 .   ? 39.924  59.913  40.990 1.00 54.43 ? 3621 HOH A O     1 
HETATM 9670  O O     . HOH Q 8 .   ? 29.125  52.590  25.995 1.00 62.36 ? 3622 HOH A O     1 
HETATM 9671  O O     . HOH Q 8 .   ? 28.679  24.826  17.049 1.00 77.86 ? 3623 HOH A O     1 
HETATM 9672  O O     . HOH Q 8 .   ? 29.415  11.279  45.125 1.00 59.56 ? 3624 HOH A O     1 
HETATM 9673  O O     . HOH Q 8 .   ? -1.511  23.301  35.815 1.00 79.64 ? 3626 HOH A O     1 
HETATM 9674  O O     . HOH Q 8 .   ? 0.797   6.986   41.212 1.00 71.21 ? 3627 HOH A O     1 
HETATM 9675  O O     . HOH Q 8 .   ? 21.287  25.150  19.359 1.00 54.58 ? 3628 HOH A O     1 
HETATM 9676  O O     . HOH Q 8 .   ? 9.327   55.310  46.564 1.00 51.80 ? 3629 HOH A O     1 
HETATM 9677  O O     . HOH Q 8 .   ? 33.749  63.008  43.658 1.00 64.77 ? 3636 HOH A O     1 
HETATM 9678  O O     . HOH Q 8 .   ? 17.704  5.827   18.736 1.00 55.03 ? 3637 HOH A O     1 
HETATM 9679  O O     . HOH Q 8 .   ? 31.681  10.177  28.713 1.00 48.75 ? 3639 HOH A O     1 
HETATM 9680  O O     . HOH Q 8 .   ? 28.494  67.455  45.126 1.00 66.58 ? 3640 HOH A O     1 
HETATM 9681  O O     . HOH Q 8 .   ? 46.374  55.971  58.643 1.00 48.43 ? 3641 HOH A O     1 
HETATM 9682  O O     . HOH Q 8 .   ? 12.246  40.832  27.435 1.00 59.68 ? 3643 HOH A O     1 
HETATM 9683  O O     . HOH Q 8 .   ? -0.024  8.478   35.143 1.00 68.78 ? 3644 HOH A O     1 
HETATM 9684  O O     . HOH Q 8 .   ? 41.781  24.937  20.013 1.00 29.76 ? 3648 HOH A O     1 
HETATM 9685  O O     . HOH Q 8 .   ? 22.214  18.308  50.286 1.00 26.65 ? 3649 HOH A O     1 
HETATM 9686  O O     . HOH Q 8 .   ? 32.845  28.221  43.333 1.00 35.76 ? 3651 HOH A O     1 
HETATM 9687  O O     . HOH Q 8 .   ? 26.586  10.196  49.541 1.00 65.35 ? 3657 HOH A O     1 
HETATM 9688  O O     . HOH Q 8 .   ? 28.143  65.145  33.385 1.00 44.59 ? 3658 HOH A O     1 
HETATM 9689  O O     . HOH Q 8 .   ? 24.252  25.668  28.366 1.00 68.09 ? 3663 HOH A O     1 
HETATM 9690  O O     . HOH Q 8 .   ? 6.361   27.510  47.253 1.00 57.96 ? 3665 HOH A O     1 
HETATM 9691  O O     . HOH Q 8 .   ? 45.263  33.500  20.701 1.00 60.64 ? 3666 HOH A O     1 
HETATM 9692  O O     . HOH Q 8 .   ? 9.092   57.242  38.273 1.00 61.16 ? 3667 HOH A O     1 
HETATM 9693  O O     . HOH Q 8 .   ? 28.008  51.589  57.648 1.00 63.73 ? 3670 HOH A O     1 
HETATM 9694  O O     . HOH Q 8 .   ? 42.664  16.058  41.661 1.00 40.83 ? 3673 HOH A O     1 
HETATM 9695  O O     . HOH Q 8 .   ? 35.783  67.319  41.002 1.00 33.05 ? 3674 HOH A O     1 
HETATM 9696  O O     . HOH Q 8 .   ? 17.693  19.689  11.126 1.00 62.25 ? 3678 HOH A O     1 
HETATM 9697  O O     . HOH Q 8 .   ? 47.188  30.329  37.086 1.00 54.33 ? 3679 HOH A O     1 
HETATM 9698  O O     . HOH Q 8 .   ? 9.087   15.726  48.783 1.00 44.78 ? 3681 HOH A O     1 
HETATM 9699  O O     . HOH Q 8 .   ? 41.646  23.973  61.763 1.00 57.25 ? 3682 HOH A O     1 
HETATM 9700  O O     . HOH Q 8 .   ? 38.904  12.238  32.395 1.00 52.36 ? 3683 HOH A O     1 
HETATM 9701  O O     . HOH Q 8 .   ? 7.536   23.795  49.237 1.00 59.38 ? 3684 HOH A O     1 
HETATM 9702  O O     . HOH Q 8 .   ? 26.921  21.483  17.547 1.00 63.13 ? 3685 HOH A O     1 
HETATM 9703  O O     . HOH Q 8 .   ? 10.133  11.124  42.228 1.00 69.13 ? 3686 HOH A O     1 
HETATM 9704  O O     . HOH Q 8 .   ? 18.219  3.533   37.892 1.00 63.61 ? 3691 HOH A O     1 
HETATM 9705  O O     . HOH Q 8 .   ? 45.023  55.221  37.753 1.00 68.69 ? 3696 HOH A O     1 
HETATM 9706  O O     . HOH Q 8 .   ? 22.550  3.207   32.608 1.00 74.49 ? 3699 HOH A O     1 
HETATM 9707  O O     . HOH Q 8 .   ? 23.558  36.012  29.406 1.00 74.71 ? 3700 HOH A O     1 
HETATM 9708  O O     . HOH Q 8 .   ? 39.593  13.578  40.987 1.00 57.34 ? 3702 HOH A O     1 
HETATM 9709  O O     . HOH Q 8 .   ? 23.917  7.951   26.537 1.00 74.61 ? 3705 HOH A O     1 
HETATM 9710  O O     . HOH Q 8 .   ? 21.372  2.946   50.829 1.00 67.33 ? 3706 HOH A O     1 
HETATM 9711  O O     . HOH Q 8 .   ? 21.832  37.468  60.892 1.00 61.78 ? 3708 HOH A O     1 
HETATM 9712  O O     . HOH Q 8 .   ? 41.436  10.654  40.605 1.00 77.23 ? 3715 HOH A O     1 
HETATM 9713  O O     . HOH Q 8 .   ? 41.855  59.903  32.962 1.00 76.42 ? 3720 HOH A O     1 
HETATM 9714  O O     . HOH Q 8 .   ? 37.565  7.544   16.891 1.00 61.72 ? 3722 HOH A O     1 
HETATM 9715  O O     . HOH Q 8 .   ? 50.255  56.633  57.862 1.00 60.73 ? 3727 HOH A O     1 
HETATM 9716  O O     . HOH Q 8 .   ? 32.535  24.507  18.129 1.00 82.21 ? 3729 HOH A O     1 
HETATM 9717  O O     . HOH Q 8 .   ? 17.425  5.014   32.844 1.00 71.77 ? 3730 HOH A O     1 
HETATM 9718  O O     . HOH Q 8 .   ? 41.087  59.012  49.242 1.00 61.69 ? 3731 HOH A O     1 
HETATM 9719  O O     . HOH Q 8 .   ? 33.196  20.863  17.058 1.00 69.64 ? 3739 HOH A O     1 
HETATM 9720  O O     . HOH Q 8 .   ? 5.197   23.508  38.976 1.00 60.83 ? 3741 HOH A O     1 
HETATM 9721  O O     . HOH Q 8 .   ? 26.616  35.326  60.969 1.00 82.86 ? 3743 HOH A O     1 
HETATM 9722  O O     . HOH Q 8 .   ? 41.754  60.610  47.865 1.00 67.85 ? 3745 HOH A O     1 
HETATM 9723  O O     . HOH Q 8 .   ? 11.575  30.322  19.158 1.00 70.46 ? 3747 HOH A O     1 
HETATM 9724  O O     . HOH Q 8 .   ? 46.346  30.102  12.256 1.00 61.97 ? 3748 HOH A O     1 
HETATM 9725  O O     . HOH Q 8 .   ? 21.290  49.387  36.366 1.00 85.41 ? 3749 HOH A O     1 
HETATM 9726  O O     . HOH Q 8 .   ? 21.659  19.032  25.890 1.00 69.90 ? 3752 HOH A O     1 
HETATM 9727  O O     . HOH Q 8 .   ? 26.455  36.091  36.568 1.00 82.89 ? 3755 HOH A O     1 
HETATM 9728  O O     . HOH Q 8 .   ? 28.382  9.871   22.962 1.00 41.33 ? 3756 HOH A O     1 
HETATM 9729  O O     . HOH Q 8 .   ? 26.663  13.695  49.940 1.00 64.37 ? 3763 HOH A O     1 
HETATM 9730  O O     . HOH Q 8 .   ? 24.208  2.470   53.447 1.00 61.01 ? 3764 HOH A O     1 
HETATM 9731  O O     . HOH Q 8 .   ? 4.216   34.593  33.413 1.00 72.24 ? 3765 HOH A O     1 
HETATM 9732  O O     . HOH Q 8 .   ? 15.846  47.946  63.843 1.00 73.18 ? 3766 HOH A O     1 
HETATM 9733  O O     . HOH Q 8 .   ? 48.636  20.502  51.569 1.00 60.97 ? 3767 HOH A O     1 
HETATM 9734  O O     . HOH Q 8 .   ? 6.010   51.215  41.052 1.00 76.64 ? 3768 HOH A O     1 
HETATM 9735  O O     . HOH Q 8 .   ? 41.930  11.162  43.563 1.00 83.10 ? 3771 HOH A O     1 
HETATM 9736  O O     . HOH Q 8 .   ? 14.731  42.516  58.570 1.00 79.08 ? 3774 HOH A O     1 
HETATM 9737  O O     . HOH Q 8 .   ? 42.826  57.825  51.207 1.00 48.69 ? 3779 HOH A O     1 
HETATM 9738  O O     . HOH Q 8 .   ? 31.825  66.782  46.337 1.00 63.56 ? 3781 HOH A O     1 
HETATM 9739  O O     . HOH Q 8 .   ? 22.266  63.881  35.400 1.00 58.42 ? 3782 HOH A O     1 
HETATM 9740  O O     . HOH R 8 .   ? 44.462  13.596  38.033 1.00 61.61 ? 3008 HOH B O     1 
HETATM 9741  O O     . HOH R 8 .   ? 48.069  21.378  42.097 1.00 22.91 ? 3043 HOH B O     1 
HETATM 9742  O O     . HOH R 8 .   ? 50.698  40.039  66.419 1.00 60.17 ? 3063 HOH B O     1 
HETATM 9743  O O     . HOH R 8 .   ? 58.262  44.022  46.340 1.00 41.98 ? 3078 HOH B O     1 
HETATM 9744  O O     . HOH R 8 .   ? 55.690  46.344  40.513 1.00 24.51 ? 3081 HOH B O     1 
HETATM 9745  O O     . HOH R 8 .   ? 51.098  39.386  51.032 1.00 20.34 ? 3143 HOH B O     1 
HETATM 9746  O O     . HOH R 8 .   ? 43.749  1.164   26.976 1.00 24.01 ? 3164 HOH B O     1 
HETATM 9747  O O     . HOH R 8 .   ? 47.198  40.933  39.504 1.00 40.31 ? 3166 HOH B O     1 
HETATM 9748  O O     . HOH R 8 .   ? 48.754  16.987  22.716 1.00 16.78 ? 3194 HOH B O     1 
HETATM 9749  O O     . HOH R 8 .   ? 42.253  7.441   37.459 1.00 50.57 ? 3218 HOH B O     1 
HETATM 9750  O O     . HOH R 8 .   ? 47.194  2.666   40.493 1.00 62.40 ? 3219 HOH B O     1 
HETATM 9751  O O     . HOH R 8 .   ? 52.061  26.928  63.148 1.00 40.00 ? 3220 HOH B O     1 
HETATM 9752  O O     . HOH R 8 .   ? 58.802  24.738  56.368 1.00 60.96 ? 3221 HOH B O     1 
HETATM 9753  O O     . HOH R 8 .   ? 54.522  1.947   41.894 1.00 52.71 ? 3222 HOH B O     1 
HETATM 9754  O O     . HOH R 8 .   ? 53.907  20.003  45.224 1.00 15.61 ? 3223 HOH B O     1 
HETATM 9755  O O     . HOH R 8 .   ? 63.660  41.440  35.137 1.00 15.05 ? 3224 HOH B O     1 
HETATM 9756  O O     . HOH R 8 .   ? 62.340  44.222  34.197 1.00 42.81 ? 3225 HOH B O     1 
HETATM 9757  O O     . HOH R 8 .   ? 59.856  37.143  53.870 1.00 54.22 ? 3226 HOH B O     1 
HETATM 9758  O O     . HOH R 8 .   ? 50.525  40.379  27.427 1.00 54.59 ? 3227 HOH B O     1 
HETATM 9759  O O     . HOH R 8 .   ? 72.156  47.980  45.787 1.00 83.75 ? 3228 HOH B O     1 
HETATM 9760  O O     . HOH R 8 .   ? 73.247  44.986  43.128 1.00 47.05 ? 3229 HOH B O     1 
HETATM 9761  O O     . HOH R 8 .   ? 75.758  46.187  39.357 1.00 69.22 ? 3230 HOH B O     1 
HETATM 9762  O O     . HOH R 8 .   ? 76.690  46.498  42.764 1.00 62.54 ? 3231 HOH B O     1 
HETATM 9763  O O     . HOH R 8 .   ? 90.980  26.437  33.469 1.00 18.68 ? 3232 HOH B O     1 
HETATM 9764  O O     . HOH R 8 .   ? 64.863  36.680  22.652 1.00 75.04 ? 3233 HOH B O     1 
HETATM 9765  O O     . HOH R 8 .   ? 41.271  15.499  11.805 1.00 18.54 ? 3234 HOH B O     1 
HETATM 9766  O O     . HOH R 8 .   ? 49.786  21.335  5.695  1.00 57.34 ? 3235 HOH B O     1 
HETATM 9767  O O     . HOH R 8 .   ? 59.339  19.893  1.672  1.00 68.56 ? 3236 HOH B O     1 
HETATM 9768  O O     . HOH R 8 .   ? 57.202  20.510  10.777 1.00 29.53 ? 3237 HOH B O     1 
HETATM 9769  O O     . HOH R 8 .   ? 60.185  21.740  15.104 1.00 25.33 ? 3238 HOH B O     1 
HETATM 9770  O O     . HOH R 8 .   ? 62.234  7.906   12.294 1.00 38.72 ? 3239 HOH B O     1 
HETATM 9771  O O     . HOH R 8 .   ? 59.933  9.488   11.362 1.00 25.31 ? 3240 HOH B O     1 
HETATM 9772  O O     . HOH R 8 .   ? 58.721  12.717  8.526  1.00 33.27 ? 3241 HOH B O     1 
HETATM 9773  O O     . HOH R 8 .   ? 57.024  10.534  8.148  1.00 37.02 ? 3242 HOH B O     1 
HETATM 9774  O O     . HOH R 8 .   ? 55.336  0.389   19.081 1.00 27.57 ? 3243 HOH B O     1 
HETATM 9775  O O     . HOH R 8 .   ? 59.177  3.179   20.878 1.00 32.91 ? 3244 HOH B O     1 
HETATM 9776  O O     . HOH R 8 .   ? 74.028  8.004   29.510 1.00 38.59 ? 3245 HOH B O     1 
HETATM 9777  O O     . HOH R 8 .   ? 39.349  17.568  12.792 1.00 65.02 ? 3246 HOH B O     1 
HETATM 9778  O O     . HOH R 8 .   ? 53.669  0.803   29.260 1.00 26.69 ? 3247 HOH B O     1 
HETATM 9779  O O     . HOH R 8 .   ? 83.104  7.907   45.349 1.00 62.34 ? 3248 HOH B O     1 
HETATM 9780  O O     . HOH R 8 .   ? 77.065  16.033  43.158 1.00 50.85 ? 3249 HOH B O     1 
HETATM 9781  O O     . HOH R 8 .   ? 79.733  10.768  41.487 1.00 35.32 ? 3250 HOH B O     1 
HETATM 9782  O O     . HOH R 8 .   ? 65.376  34.764  35.541 1.00 44.95 ? 3251 HOH B O     1 
HETATM 9783  O O     . HOH R 8 .   ? 76.820  37.393  13.476 1.00 70.40 ? 3252 HOH B O     1 
HETATM 9784  O O     . HOH R 8 .   ? 88.003  21.137  24.120 1.00 54.99 ? 3253 HOH B O     1 
HETATM 9785  O O     . HOH R 8 .   ? 87.260  14.293  24.042 1.00 73.17 ? 3254 HOH B O     1 
HETATM 9786  O O     . HOH R 8 .   ? 90.269  16.992  25.325 1.00 48.66 ? 3255 HOH B O     1 
HETATM 9787  O O     . HOH R 8 .   ? 88.503  22.101  45.374 1.00 30.78 ? 3256 HOH B O     1 
HETATM 9788  O O     . HOH R 8 .   ? 80.935  36.217  24.985 1.00 25.40 ? 3257 HOH B O     1 
HETATM 9789  O O     . HOH R 8 .   ? 63.490  36.909  39.219 1.00 20.52 ? 3258 HOH B O     1 
HETATM 9790  O O     . HOH R 8 .   ? 72.548  40.661  29.207 1.00 74.15 ? 3259 HOH B O     1 
HETATM 9791  O O     . HOH R 8 .   ? 71.372  38.166  54.468 1.00 61.16 ? 3260 HOH B O     1 
HETATM 9792  O O     . HOH R 8 .   ? 66.515  30.199  57.039 1.00 47.13 ? 3261 HOH B O     1 
HETATM 9793  O O     . HOH R 8 .   ? 45.166  -0.905  24.371 1.00 51.60 ? 3262 HOH B O     1 
HETATM 9794  O O     . HOH R 8 .   ? 83.971  35.530  55.457 1.00 58.46 ? 3263 HOH B O     1 
HETATM 9795  O O     . HOH R 8 .   ? 51.678  -0.240  27.682 1.00 48.09 ? 3264 HOH B O     1 
HETATM 9796  O O     . HOH R 8 .   ? 58.805  38.616  65.235 1.00 59.25 ? 3265 HOH B O     1 
HETATM 9797  O O     . HOH R 8 .   ? 55.842  26.989  27.572 1.00 24.07 ? 3266 HOH B O     1 
HETATM 9798  O O     . HOH R 8 .   ? 63.446  18.288  24.675 1.00 27.67 ? 3268 HOH B O     1 
HETATM 9799  O O     . HOH R 8 .   ? 55.087  31.802  13.503 1.00 10.12 ? 3269 HOH B O     1 
HETATM 9800  O O     . HOH R 8 .   ? 61.116  45.379  65.775 1.00 52.31 ? 3270 HOH B O     1 
HETATM 9801  O O     . HOH R 8 .   ? 83.854  26.624  36.398 1.00 32.45 ? 3271 HOH B O     1 
HETATM 9802  O O     . HOH R 8 .   ? 60.445  43.569  50.643 1.00 60.85 ? 3272 HOH B O     1 
HETATM 9803  O O     . HOH R 8 .   ? 81.056  0.771   45.134 1.00 49.69 ? 3273 HOH B O     1 
HETATM 9804  O O     . HOH R 8 .   ? 64.590  2.606   30.199 1.00 74.21 ? 3274 HOH B O     1 
HETATM 9805  O O     . HOH R 8 .   ? 50.375  -0.658  31.189 1.00 65.66 ? 3276 HOH B O     1 
HETATM 9806  O O     . HOH R 8 .   ? 45.585  36.979  31.446 1.00 42.03 ? 3277 HOH B O     1 
HETATM 9807  O O     . HOH R 8 .   ? 63.037  29.302  3.438  1.00 25.63 ? 3279 HOH B O     1 
HETATM 9808  O O     . HOH R 8 .   ? 47.361  -5.448  16.580 1.00 53.19 ? 3280 HOH B O     1 
HETATM 9809  O O     . HOH R 8 .   ? 77.716  40.355  29.645 1.00 43.37 ? 3281 HOH B O     1 
HETATM 9810  O O     . HOH R 8 .   ? 61.444  22.306  34.534 1.00 34.50 ? 3282 HOH B O     1 
HETATM 9811  O O     . HOH R 8 .   ? 49.309  35.550  32.794 1.00 57.30 ? 3283 HOH B O     1 
HETATM 9812  O O     . HOH R 8 .   ? 56.439  32.205  2.055  1.00 62.02 ? 3284 HOH B O     1 
HETATM 9813  O O     . HOH R 8 .   ? 58.184  31.737  22.692 1.00 55.53 ? 3285 HOH B O     1 
HETATM 9814  O O     . HOH R 8 .   ? 91.410  26.348  26.786 1.00 44.53 ? 3286 HOH B O     1 
HETATM 9815  O O     . HOH R 8 .   ? 61.047  25.481  58.601 1.00 32.82 ? 3287 HOH B O     1 
HETATM 9816  O O     . HOH R 8 .   ? 52.222  -3.232  24.060 1.00 46.50 ? 3288 HOH B O     1 
HETATM 9817  O O     . HOH R 8 .   ? 57.059  37.345  22.969 1.00 69.54 ? 3289 HOH B O     1 
HETATM 9818  O O     . HOH R 8 .   ? 52.370  11.227  39.687 1.00 20.24 ? 3290 HOH B O     1 
HETATM 9819  O O     . HOH R 8 .   ? 88.488  37.917  29.360 1.00 51.53 ? 3291 HOH B O     1 
HETATM 9820  O O     . HOH R 8 .   ? 49.187  17.355  11.439 1.00 17.89 ? 3292 HOH B O     1 
HETATM 9821  O O     . HOH R 8 .   ? 58.939  29.624  31.191 1.00 21.01 ? 3293 HOH B O     1 
HETATM 9822  O O     . HOH R 8 .   ? 69.733  5.053   26.365 1.00 33.87 ? 3294 HOH B O     1 
HETATM 9823  O O     . HOH R 8 .   ? 70.367  10.180  9.824  1.00 20.37 ? 3295 HOH B O     1 
HETATM 9824  O O     . HOH R 8 .   ? 70.847  18.197  55.974 1.00 41.17 ? 3296 HOH B O     1 
HETATM 9825  O O     . HOH R 8 .   ? 79.992  45.027  38.624 1.00 45.81 ? 3297 HOH B O     1 
HETATM 9826  O O     . HOH R 8 .   ? 73.537  14.056  44.970 1.00 31.53 ? 3298 HOH B O     1 
HETATM 9827  O O     . HOH R 8 .   ? 82.393  43.478  54.509 1.00 37.50 ? 3299 HOH B O     1 
HETATM 9828  O O     . HOH R 8 .   ? 61.476  43.061  47.749 1.00 60.76 ? 3300 HOH B O     1 
HETATM 9829  O O     . HOH R 8 .   ? 76.559  34.324  50.403 1.00 28.37 ? 3301 HOH B O     1 
HETATM 9830  O O     . HOH R 8 .   ? 65.793  17.232  23.663 1.00 21.37 ? 3302 HOH B O     1 
HETATM 9831  O O     . HOH R 8 .   ? 62.328  5.889   22.289 1.00 42.44 ? 3303 HOH B O     1 
HETATM 9832  O O     . HOH R 8 .   ? 59.488  28.728  46.357 1.00 75.73 ? 3304 HOH B O     1 
HETATM 9833  O O     . HOH R 8 .   ? 63.270  44.343  45.006 1.00 32.67 ? 3305 HOH B O     1 
HETATM 9834  O O     . HOH R 8 .   ? 48.981  20.455  21.161 1.00 22.70 ? 3306 HOH B O     1 
HETATM 9835  O O     . HOH R 8 .   ? 63.477  36.088  52.658 1.00 53.47 ? 3307 HOH B O     1 
HETATM 9836  O O     . HOH R 8 .   ? 46.543  22.105  19.361 1.00 24.99 ? 3308 HOH B O     1 
HETATM 9837  O O     . HOH R 8 .   ? 67.072  31.825  53.453 1.00 22.08 ? 3309 HOH B O     1 
HETATM 9838  O O     . HOH R 8 .   ? 57.675  28.272  43.225 1.00 56.92 ? 3310 HOH B O     1 
HETATM 9839  O O     . HOH R 8 .   ? 62.854  21.474  18.362 1.00 31.29 ? 3311 HOH B O     1 
HETATM 9840  O O     . HOH R 8 .   ? 88.527  23.359  42.693 1.00 45.18 ? 3312 HOH B O     1 
HETATM 9841  O O     . HOH R 8 .   ? 46.960  33.928  31.601 1.00 23.67 ? 3314 HOH B O     1 
HETATM 9842  O O     . HOH R 8 .   ? 74.620  7.453   37.152 1.00 31.14 ? 3315 HOH B O     1 
HETATM 9843  O O     . HOH R 8 .   ? 66.388  36.552  46.042 1.00 42.27 ? 3316 HOH B O     1 
HETATM 9844  O O     . HOH R 8 .   ? 44.897  11.994  8.232  1.00 28.01 ? 3317 HOH B O     1 
HETATM 9845  O O     . HOH R 8 .   ? 38.309  6.873   6.144  1.00 64.77 ? 3318 HOH B O     1 
HETATM 9846  O O     . HOH R 8 .   ? 51.295  0.183   15.461 1.00 58.43 ? 3319 HOH B O     1 
HETATM 9847  O O     . HOH R 8 .   ? 38.422  9.324   18.829 1.00 41.85 ? 3320 HOH B O     1 
HETATM 9848  O O     . HOH R 8 .   ? 54.579  1.623   11.175 1.00 58.07 ? 3321 HOH B O     1 
HETATM 9849  O O     . HOH R 8 .   ? 61.027  33.279  2.905  1.00 37.94 ? 3322 HOH B O     1 
HETATM 9850  O O     . HOH R 8 .   ? 72.132  40.067  44.159 1.00 43.49 ? 3323 HOH B O     1 
HETATM 9851  O O     . HOH R 8 .   ? 69.379  30.234  62.756 1.00 63.85 ? 3324 HOH B O     1 
HETATM 9852  O O     . HOH R 8 .   ? 75.502  32.991  9.501  1.00 69.65 ? 3325 HOH B O     1 
HETATM 9853  O O     . HOH R 8 .   ? 58.007  8.464   9.696  1.00 21.03 ? 3326 HOH B O     1 
HETATM 9854  O O     . HOH R 8 .   ? 43.894  9.935   21.977 1.00 45.62 ? 3327 HOH B O     1 
HETATM 9855  O O     . HOH R 8 .   ? 52.965  24.995  23.078 1.00 26.02 ? 3328 HOH B O     1 
HETATM 9856  O O     . HOH R 8 .   ? 54.810  35.447  39.094 1.00 16.79 ? 3329 HOH B O     1 
HETATM 9857  O O     . HOH R 8 .   ? 72.952  5.138   26.362 1.00 51.44 ? 3330 HOH B O     1 
HETATM 9858  O O     . HOH R 8 .   ? 68.566  26.359  27.007 1.00 29.46 ? 3331 HOH B O     1 
HETATM 9859  O O     . HOH R 8 .   ? 50.194  26.013  21.582 1.00 53.79 ? 3332 HOH B O     1 
HETATM 9860  O O     . HOH R 8 .   ? 63.186  40.256  50.494 1.00 40.25 ? 3333 HOH B O     1 
HETATM 9861  O O     . HOH R 8 .   ? 66.018  10.612  7.237  1.00 56.97 ? 3334 HOH B O     1 
HETATM 9862  O O     . HOH R 8 .   ? 80.885  10.957  48.326 1.00 39.99 ? 3335 HOH B O     1 
HETATM 9863  O O     . HOH R 8 .   ? 80.404  20.418  47.179 1.00 28.52 ? 3336 HOH B O     1 
HETATM 9864  O O     . HOH R 8 .   ? 72.355  7.261   32.223 1.00 74.43 ? 3337 HOH B O     1 
HETATM 9865  O O     . HOH R 8 .   ? 55.967  20.012  32.863 1.00 24.19 ? 3338 HOH B O     1 
HETATM 9866  O O     . HOH R 8 .   ? 49.064  30.507  61.076 1.00 59.99 ? 3339 HOH B O     1 
HETATM 9867  O O     . HOH R 8 .   ? 73.428  35.903  44.747 1.00 17.71 ? 3340 HOH B O     1 
HETATM 9868  O O     . HOH R 8 .   ? 51.430  24.108  20.047 1.00 24.01 ? 3341 HOH B O     1 
HETATM 9869  O O     . HOH R 8 .   ? 86.366  23.351  37.014 1.00 25.36 ? 3342 HOH B O     1 
HETATM 9870  O O     . HOH R 8 .   ? 41.008  13.581  14.807 1.00 15.22 ? 3343 HOH B O     1 
HETATM 9871  O O     . HOH R 8 .   ? 95.127  33.596  45.467 1.00 60.78 ? 3344 HOH B O     1 
HETATM 9872  O O     . HOH R 8 .   ? 71.397  38.341  50.976 1.00 45.80 ? 3345 HOH B O     1 
HETATM 9873  O O     . HOH R 8 .   ? 47.977  1.298   21.621 1.00 79.99 ? 3346 HOH B O     1 
HETATM 9874  O O     . HOH R 8 .   ? 81.165  7.168   19.544 1.00 58.63 ? 3347 HOH B O     1 
HETATM 9875  O O     . HOH R 8 .   ? 86.517  15.130  19.746 1.00 52.48 ? 3348 HOH B O     1 
HETATM 9876  O O     . HOH R 8 .   ? 64.456  24.775  53.448 1.00 53.42 ? 3349 HOH B O     1 
HETATM 9877  O O     . HOH R 8 .   ? 77.256  44.070  37.766 1.00 39.21 ? 3350 HOH B O     1 
HETATM 9878  O O     . HOH R 8 .   ? 71.576  43.209  43.987 1.00 45.38 ? 3351 HOH B O     1 
HETATM 9879  O O     . HOH R 8 .   ? 53.480  37.867  51.828 1.00 20.77 ? 3352 HOH B O     1 
HETATM 9880  O O     . HOH R 8 .   ? 87.584  21.268  38.788 1.00 32.95 ? 3353 HOH B O     1 
HETATM 9881  O O     . HOH R 8 .   ? 57.031  17.156  51.620 1.00 65.86 ? 3354 HOH B O     1 
HETATM 9882  O O     . HOH R 8 .   ? 52.503  22.899  31.231 1.00 46.82 ? 3355 HOH B O     1 
HETATM 9883  O O     . HOH R 8 .   ? 55.791  33.644  22.317 1.00 35.13 ? 3356 HOH B O     1 
HETATM 9884  O O     . HOH R 8 .   ? 61.479  25.651  37.960 1.00 27.26 ? 3357 HOH B O     1 
HETATM 9885  O O     . HOH R 8 .   ? 52.376  27.710  36.736 1.00 27.76 ? 3358 HOH B O     1 
HETATM 9886  O O     . HOH R 8 .   ? 79.625  8.328   34.173 1.00 64.75 ? 3359 HOH B O     1 
HETATM 9887  O O     . HOH R 8 .   ? 55.222  33.775  41.537 1.00 17.09 ? 3360 HOH B O     1 
HETATM 9888  O O     . HOH R 8 .   ? 46.553  40.907  45.233 1.00 36.95 ? 3361 HOH B O     1 
HETATM 9889  O O     . HOH R 8 .   ? 63.943  34.306  7.081  1.00 32.29 ? 3362 HOH B O     1 
HETATM 9890  O O     . HOH R 8 .   ? 92.304  35.644  54.006 1.00 75.52 ? 3363 HOH B O     1 
HETATM 9891  O O     . HOH R 8 .   ? 62.097  22.157  0.846  1.00 33.86 ? 3364 HOH B O     1 
HETATM 9892  O O     . HOH R 8 .   ? 62.575  1.478   22.232 1.00 74.42 ? 3365 HOH B O     1 
HETATM 9893  O O     . HOH R 8 .   ? 53.961  24.139  34.607 1.00 27.30 ? 3366 HOH B O     1 
HETATM 9894  O O     . HOH R 8 .   ? 52.487  45.301  38.638 1.00 40.21 ? 3367 HOH B O     1 
HETATM 9895  O O     . HOH R 8 .   ? 59.381  9.013   39.158 1.00 36.26 ? 3368 HOH B O     1 
HETATM 9896  O O     . HOH R 8 .   ? 72.538  41.351  54.582 1.00 51.10 ? 3369 HOH B O     1 
HETATM 9897  O O     . HOH R 8 .   ? 52.124  26.736  39.444 1.00 36.81 ? 3370 HOH B O     1 
HETATM 9898  O O     . HOH R 8 .   ? 74.206  35.238  41.514 1.00 49.92 ? 3371 HOH B O     1 
HETATM 9899  O O     . HOH R 8 .   ? 78.370  5.077   17.058 1.00 90.35 ? 3372 HOH B O     1 
HETATM 9900  O O     . HOH R 8 .   ? 50.628  19.906  48.467 1.00 54.38 ? 3373 HOH B O     1 
HETATM 9901  O O     . HOH R 8 .   ? 92.202  25.608  42.603 1.00 60.97 ? 3374 HOH B O     1 
HETATM 9902  O O     . HOH R 8 .   ? 50.504  25.265  33.052 1.00 58.29 ? 3375 HOH B O     1 
HETATM 9903  O O     . HOH R 8 .   ? 58.601  41.806  53.832 1.00 47.91 ? 3376 HOH B O     1 
HETATM 9904  O O     . HOH R 8 .   ? 64.798  27.133  55.691 1.00 51.84 ? 3377 HOH B O     1 
HETATM 9905  O O     . HOH R 8 .   ? 86.062  18.847  24.473 1.00 41.06 ? 3378 HOH B O     1 
HETATM 9906  O O     . HOH R 8 .   ? 72.393  -2.530  39.012 1.00 52.27 ? 3379 HOH B O     1 
HETATM 9907  O O     . HOH R 8 .   ? 52.975  26.040  55.393 1.00 25.06 ? 3380 HOH B O     1 
HETATM 9908  O O     . HOH R 8 .   ? 64.662  42.875  51.414 1.00 26.42 ? 3381 HOH B O     1 
HETATM 9909  O O     . HOH R 8 .   ? 63.431  37.664  57.009 1.00 27.62 ? 3382 HOH B O     1 
HETATM 9910  O O     . HOH R 8 .   ? 55.435  25.904  63.215 1.00 53.51 ? 3383 HOH B O     1 
HETATM 9911  O O     . HOH R 8 .   ? 67.794  47.804  57.614 1.00 61.80 ? 3384 HOH B O     1 
HETATM 9912  O O     . HOH R 8 .   ? 64.072  45.861  63.078 1.00 82.09 ? 3385 HOH B O     1 
HETATM 9913  O O     . HOH R 8 .   ? 67.552  26.677  64.246 1.00 80.08 ? 3386 HOH B O     1 
HETATM 9914  O O     . HOH R 8 .   ? 67.666  34.096  56.701 1.00 58.74 ? 3387 HOH B O     1 
HETATM 9915  O O     . HOH R 8 .   ? 61.680  23.868  53.377 1.00 64.21 ? 3388 HOH B O     1 
HETATM 9916  O O     . HOH R 8 .   ? 74.699  21.304  54.157 1.00 33.72 ? 3389 HOH B O     1 
HETATM 9917  O O     . HOH R 8 .   ? 62.168  34.528  55.463 1.00 46.03 ? 3390 HOH B O     1 
HETATM 9918  O O     . HOH R 8 .   ? 75.612  17.785  52.873 1.00 16.56 ? 3391 HOH B O     1 
HETATM 9919  O O     . HOH R 8 .   ? 72.013  13.441  48.872 1.00 52.05 ? 3392 HOH B O     1 
HETATM 9920  O O     . HOH R 8 .   ? 60.722  37.057  38.219 1.00 24.53 ? 3393 HOH B O     1 
HETATM 9921  O O     . HOH R 8 .   ? 62.603  38.942  24.145 1.00 66.56 ? 3394 HOH B O     1 
HETATM 9922  O O     . HOH R 8 .   ? 40.242  10.982  15.508 1.00 24.85 ? 3395 HOH B O     1 
HETATM 9923  O O     . HOH R 8 .   ? 40.229  7.966   9.207  1.00 52.64 ? 3396 HOH B O     1 
HETATM 9924  O O     . HOH R 8 .   ? 41.798  14.101  9.561  1.00 51.62 ? 3397 HOH B O     1 
HETATM 9925  O O     . HOH R 8 .   ? 44.271  11.128  24.787 1.00 26.22 ? 3398 HOH B O     1 
HETATM 9926  O O     . HOH R 8 .   ? 78.172  23.355  42.390 1.00 18.24 ? 3401 HOH B O     1 
HETATM 9927  O O     . HOH R 8 .   ? 88.609  31.935  53.397 1.00 21.19 ? 3405 HOH B O     1 
HETATM 9928  O O     . HOH R 8 .   ? 43.226  17.857  11.212 1.00 35.91 ? 3408 HOH B O     1 
HETATM 9929  O O     . HOH R 8 .   ? 59.900  22.667  3.707  1.00 23.00 ? 3410 HOH B O     1 
HETATM 9930  O O     . HOH R 8 .   ? 62.841  20.103  34.974 1.00 20.92 ? 3411 HOH B O     1 
HETATM 9931  O O     . HOH R 8 .   ? 60.474  8.834   6.582  1.00 55.21 ? 3414 HOH B O     1 
HETATM 9932  O O     . HOH R 8 .   ? 52.108  34.497  63.430 1.00 41.74 ? 3415 HOH B O     1 
HETATM 9933  O O     . HOH R 8 .   ? 57.590  26.224  29.208 1.00 38.94 ? 3418 HOH B O     1 
HETATM 9934  O O     . HOH R 8 .   ? 47.896  41.305  35.861 1.00 27.06 ? 3420 HOH B O     1 
HETATM 9935  O O     . HOH R 8 .   ? 60.393  4.037   23.193 1.00 23.39 ? 3424 HOH B O     1 
HETATM 9936  O O     . HOH R 8 .   ? 61.419  16.841  23.726 1.00 17.07 ? 3426 HOH B O     1 
HETATM 9937  O O     . HOH R 8 .   ? 54.292  11.999  4.715  1.00 43.78 ? 3429 HOH B O     1 
HETATM 9938  O O     . HOH R 8 .   ? 61.711  19.972  16.390 1.00 19.79 ? 3431 HOH B O     1 
HETATM 9939  O O     . HOH R 8 .   ? 76.390  11.221  8.934  1.00 56.91 ? 3432 HOH B O     1 
HETATM 9940  O O     . HOH R 8 .   ? 45.084  22.262  16.763 1.00 54.03 ? 3434 HOH B O     1 
HETATM 9941  O O     . HOH R 8 .   ? 78.307  38.145  57.803 1.00 50.60 ? 3437 HOH B O     1 
HETATM 9942  O O     . HOH R 8 .   ? 61.234  47.244  46.863 1.00 51.58 ? 3443 HOH B O     1 
HETATM 9943  O O     . HOH R 8 .   ? 100.027 22.628  31.204 1.00 47.56 ? 3452 HOH B O     1 
HETATM 9944  O O     . HOH R 8 .   ? 73.156  10.998  8.932  1.00 55.58 ? 3454 HOH B O     1 
HETATM 9945  O O     . HOH R 8 .   ? 43.499  7.499   22.736 1.00 32.09 ? 3455 HOH B O     1 
HETATM 9946  O O     . HOH R 8 .   ? 49.692  29.115  29.678 1.00 54.19 ? 3457 HOH B O     1 
HETATM 9947  O O     . HOH R 8 .   ? 80.965  17.226  48.941 1.00 53.47 ? 3460 HOH B O     1 
HETATM 9948  O O     . HOH R 8 .   ? 60.945  26.498  0.350  1.00 38.22 ? 3461 HOH B O     1 
HETATM 9949  O O     . HOH R 8 .   ? 49.636  27.040  36.430 1.00 47.91 ? 3465 HOH B O     1 
HETATM 9950  O O     . HOH R 8 .   ? 54.598  32.863  64.635 1.00 62.10 ? 3469 HOH B O     1 
HETATM 9951  O O     . HOH R 8 .   ? 43.565  35.997  37.820 1.00 40.98 ? 3472 HOH B O     1 
HETATM 9952  O O     . HOH R 8 .   ? 77.972  44.394  48.627 1.00 51.93 ? 3474 HOH B O     1 
HETATM 9953  O O     . HOH R 8 .   ? 55.059  47.053  46.482 1.00 42.52 ? 3478 HOH B O     1 
HETATM 9954  O O     . HOH R 8 .   ? 75.136  16.215  40.199 1.00 51.38 ? 3481 HOH B O     1 
HETATM 9955  O O     . HOH R 8 .   ? 51.448  24.197  36.026 1.00 25.91 ? 3482 HOH B O     1 
HETATM 9956  O O     . HOH R 8 .   ? 90.703  38.718  43.852 1.00 43.74 ? 3483 HOH B O     1 
HETATM 9957  O O     . HOH R 8 .   ? 92.592  31.101  50.545 1.00 42.64 ? 3488 HOH B O     1 
HETATM 9958  O O     . HOH R 8 .   ? 47.934  38.642  35.839 1.00 45.21 ? 3490 HOH B O     1 
HETATM 9959  O O     . HOH R 8 .   ? 51.630  5.659   45.222 1.00 43.06 ? 3491 HOH B O     1 
HETATM 9960  O O     . HOH R 8 .   ? 51.314  20.172  3.573  1.00 54.18 ? 3492 HOH B O     1 
HETATM 9961  O O     . HOH R 8 .   ? 67.775  5.055   35.348 1.00 63.29 ? 3493 HOH B O     1 
HETATM 9962  O O     . HOH R 8 .   ? 49.627  -4.018  23.982 1.00 54.10 ? 3494 HOH B O     1 
HETATM 9963  O O     . HOH R 8 .   ? 56.119  17.588  4.617  1.00 45.00 ? 3496 HOH B O     1 
HETATM 9964  O O     . HOH R 8 .   ? 56.163  52.990  62.467 1.00 74.74 ? 3499 HOH B O     1 
HETATM 9965  O O     . HOH R 8 .   ? 40.320  8.191   22.687 1.00 29.96 ? 3501 HOH B O     1 
HETATM 9966  O O     . HOH R 8 .   ? 64.794  29.743  54.814 1.00 55.79 ? 3504 HOH B O     1 
HETATM 9967  O O     . HOH R 8 .   ? 50.660  0.247   33.997 1.00 47.22 ? 3505 HOH B O     1 
HETATM 9968  O O     . HOH R 8 .   ? 58.128  1.063   18.471 1.00 59.83 ? 3507 HOH B O     1 
HETATM 9969  O O     . HOH R 8 .   ? 87.719  45.129  35.401 1.00 70.75 ? 3510 HOH B O     1 
HETATM 9970  O O     . HOH R 8 .   ? 79.302  25.064  56.510 1.00 49.69 ? 3512 HOH B O     1 
HETATM 9971  O O     . HOH R 8 .   ? 57.361  3.795   13.161 1.00 62.63 ? 3516 HOH B O     1 
HETATM 9972  O O     . HOH R 8 .   ? 61.025  -0.302  40.138 1.00 77.06 ? 3520 HOH B O     1 
HETATM 9973  O O     . HOH R 8 .   ? 61.088  34.513  51.898 1.00 73.94 ? 3521 HOH B O     1 
HETATM 9974  O O     . HOH R 8 .   ? 62.049  1.343   31.235 1.00 49.30 ? 3523 HOH B O     1 
HETATM 9975  O O     . HOH R 8 .   ? 66.366  34.667  53.405 1.00 41.34 ? 3525 HOH B O     1 
HETATM 9976  O O     . HOH R 8 .   ? 61.507  48.663  49.500 1.00 65.66 ? 3526 HOH B O     1 
HETATM 9977  O O     . HOH R 8 .   ? 47.484  25.195  37.746 1.00 48.94 ? 3528 HOH B O     1 
HETATM 9978  O O     . HOH R 8 .   ? 74.233  48.147  56.536 1.00 46.23 ? 3533 HOH B O     1 
HETATM 9979  O O     . HOH R 8 .   ? 62.079  35.426  70.828 1.00 50.31 ? 3534 HOH B O     1 
HETATM 9980  O O     . HOH R 8 .   ? 82.566  48.002  43.703 1.00 68.88 ? 3535 HOH B O     1 
HETATM 9981  O O     . HOH R 8 .   ? 71.741  13.699  8.223  1.00 63.07 ? 3537 HOH B O     1 
HETATM 9982  O O     . HOH R 8 .   ? 63.366  43.551  42.385 1.00 40.60 ? 3538 HOH B O     1 
HETATM 9983  O O     . HOH R 8 .   ? 81.842  1.100   49.041 1.00 68.12 ? 3539 HOH B O     1 
HETATM 9984  O O     . HOH R 8 .   ? 70.644  25.452  56.876 1.00 42.59 ? 3540 HOH B O     1 
HETATM 9985  O O     . HOH R 8 .   ? 56.521  18.732  46.442 1.00 64.73 ? 3541 HOH B O     1 
HETATM 9986  O O     . HOH R 8 .   ? 86.205  9.452   23.343 1.00 62.28 ? 3543 HOH B O     1 
HETATM 9987  O O     . HOH R 8 .   ? 55.942  6.754   6.930  1.00 49.96 ? 3544 HOH B O     1 
HETATM 9988  O O     . HOH R 8 .   ? 60.729  17.422  0.458  1.00 68.64 ? 3548 HOH B O     1 
HETATM 9989  O O     . HOH R 8 .   ? 59.645  -0.813  23.009 1.00 42.50 ? 3549 HOH B O     1 
HETATM 9990  O O     . HOH R 8 .   ? 79.159  13.198  49.682 1.00 35.33 ? 3550 HOH B O     1 
HETATM 9991  O O     . HOH R 8 .   ? 58.584  5.282   32.829 1.00 39.57 ? 3551 HOH B O     1 
HETATM 9992  O O     . HOH R 8 .   ? 74.390  14.296  42.518 1.00 34.86 ? 3557 HOH B O     1 
HETATM 9993  O O     . HOH R 8 .   ? 60.548  40.117  51.127 1.00 80.03 ? 3560 HOH B O     1 
HETATM 9994  O O     . HOH R 8 .   ? 49.481  28.711  38.726 1.00 41.18 ? 3563 HOH B O     1 
HETATM 9995  O O     . HOH R 8 .   ? 44.427  7.062   11.161 1.00 30.76 ? 3566 HOH B O     1 
HETATM 9996  O O     . HOH R 8 .   ? 55.478  14.376  48.249 1.00 53.84 ? 3569 HOH B O     1 
HETATM 9997  O O     . HOH R 8 .   ? 86.933  10.515  12.154 1.00 68.53 ? 3570 HOH B O     1 
HETATM 9998  O O     . HOH R 8 .   ? 75.519  49.464  43.894 1.00 72.38 ? 3571 HOH B O     1 
HETATM 9999  O O     . HOH R 8 .   ? 71.118  34.808  36.546 1.00 48.67 ? 3574 HOH B O     1 
HETATM 10000 O O     . HOH R 8 .   ? 55.147  27.533  56.552 1.00 59.20 ? 3576 HOH B O     1 
HETATM 10001 O O     . HOH R 8 .   ? 86.595  16.014  42.837 1.00 51.68 ? 3578 HOH B O     1 
HETATM 10002 O O     . HOH R 8 .   ? 85.272  10.566  53.847 1.00 65.11 ? 3579 HOH B O     1 
HETATM 10003 O O     . HOH R 8 .   ? 76.706  4.480   13.139 1.00 40.12 ? 3580 HOH B O     1 
HETATM 10004 O O     . HOH R 8 .   ? 81.371  35.974  57.885 1.00 75.12 ? 3584 HOH B O     1 
HETATM 10005 O O     . HOH R 8 .   ? 56.924  37.960  51.756 1.00 86.97 ? 3585 HOH B O     1 
HETATM 10006 O O     . HOH R 8 .   ? 90.004  25.250  38.324 1.00 49.63 ? 3591 HOH B O     1 
HETATM 10007 O O     . HOH R 8 .   ? 72.859  31.979  59.354 1.00 72.02 ? 3592 HOH B O     1 
HETATM 10008 O O     . HOH R 8 .   ? 82.284  7.387   13.184 1.00 77.25 ? 3595 HOH B O     1 
HETATM 10009 O O     . HOH R 8 .   ? 94.639  26.293  46.402 1.00 62.44 ? 3598 HOH B O     1 
HETATM 10010 O O     . HOH R 8 .   ? 88.734  16.400  35.281 1.00 62.30 ? 3600 HOH B O     1 
HETATM 10011 O O     . HOH R 8 .   ? 46.835  17.712  4.332  1.00 46.46 ? 3602 HOH B O     1 
HETATM 10012 O O     . HOH R 8 .   ? 38.893  7.682   35.094 1.00 53.17 ? 3605 HOH B O     1 
HETATM 10013 O O     . HOH R 8 .   ? 52.357  35.619  45.409 1.00 20.73 ? 3607 HOH B O     1 
HETATM 10014 O O     . HOH R 8 .   ? 43.238  17.162  27.953 1.00 38.45 ? 3608 HOH B O     1 
HETATM 10015 O O     . HOH R 8 .   ? 57.420  30.791  44.138 1.00 17.88 ? 3610 HOH B O     1 
HETATM 10016 O O     . HOH R 8 .   ? 61.522  45.996  41.589 1.00 58.66 ? 3611 HOH B O     1 
HETATM 10017 O O     . HOH R 8 .   ? 48.846  28.043  33.832 1.00 30.38 ? 3612 HOH B O     1 
HETATM 10018 O O     . HOH R 8 .   ? 44.925  33.703  37.710 1.00 24.65 ? 3614 HOH B O     1 
HETATM 10019 O O     . HOH R 8 .   ? 71.662  27.393  59.048 1.00 69.16 ? 3619 HOH B O     1 
HETATM 10020 O O     . HOH R 8 .   ? 90.759  41.881  43.796 1.00 70.12 ? 3620 HOH B O     1 
HETATM 10021 O O     . HOH R 8 .   ? 85.956  17.384  45.345 1.00 33.78 ? 3625 HOH B O     1 
HETATM 10022 O O     . HOH R 8 .   ? 45.950  20.057  2.903  1.00 57.50 ? 3630 HOH B O     1 
HETATM 10023 O O     . HOH R 8 .   ? 79.277  36.074  11.872 1.00 69.15 ? 3631 HOH B O     1 
HETATM 10024 O O     . HOH R 8 .   ? 63.274  31.105  53.422 1.00 69.80 ? 3632 HOH B O     1 
HETATM 10025 O O     . HOH R 8 .   ? 60.502  41.059  65.549 1.00 51.84 ? 3633 HOH B O     1 
HETATM 10026 O O     . HOH R 8 .   ? 61.069  5.286   11.303 1.00 37.76 ? 3634 HOH B O     1 
HETATM 10027 O O     . HOH R 8 .   ? 88.115  20.158  51.288 1.00 52.04 ? 3635 HOH B O     1 
HETATM 10028 O O     . HOH R 8 .   ? 51.298  21.138  35.037 1.00 50.53 ? 3638 HOH B O     1 
HETATM 10029 O O     . HOH R 8 .   ? 73.135  47.346  66.237 1.00 64.83 ? 3642 HOH B O     1 
HETATM 10030 O O     . HOH R 8 .   ? 65.279  10.984  58.747 1.00 61.07 ? 3645 HOH B O     1 
HETATM 10031 O O     . HOH R 8 .   ? 74.498  32.501  56.691 1.00 46.19 ? 3646 HOH B O     1 
HETATM 10032 O O     . HOH R 8 .   ? 50.895  4.036   9.654  1.00 50.43 ? 3647 HOH B O     1 
HETATM 10033 O O     . HOH R 8 .   ? 56.046  -4.399  21.871 1.00 48.47 ? 3650 HOH B O     1 
HETATM 10034 O O     . HOH R 8 .   ? 67.726  36.349  63.152 1.00 58.92 ? 3652 HOH B O     1 
HETATM 10035 O O     . HOH R 8 .   ? 76.323  42.290  31.313 1.00 34.25 ? 3653 HOH B O     1 
HETATM 10036 O O     . HOH R 8 .   ? 46.644  2.188   9.831  1.00 41.76 ? 3654 HOH B O     1 
HETATM 10037 O O     . HOH R 8 .   ? 82.475  44.747  47.450 1.00 67.88 ? 3655 HOH B O     1 
HETATM 10038 O O     . HOH R 8 .   ? 53.975  -2.389  21.297 1.00 92.72 ? 3656 HOH B O     1 
HETATM 10039 O O     . HOH R 8 .   ? 53.024  -3.109  18.870 1.00 47.35 ? 3660 HOH B O     1 
HETATM 10040 O O     . HOH R 8 .   ? 69.253  15.753  53.708 1.00 52.32 ? 3661 HOH B O     1 
HETATM 10041 O O     . HOH R 8 .   ? 43.615  -0.740  17.864 1.00 59.25 ? 3662 HOH B O     1 
HETATM 10042 O O     . HOH R 8 .   ? 51.134  31.665  65.563 1.00 58.45 ? 3664 HOH B O     1 
HETATM 10043 O O     . HOH R 8 .   ? 52.612  32.320  67.560 1.00 66.06 ? 3669 HOH B O     1 
HETATM 10044 O O     . HOH R 8 .   ? 80.402  11.719  43.735 1.00 67.64 ? 3671 HOH B O     1 
HETATM 10045 O O     . HOH R 8 .   ? 57.800  4.878   10.592 1.00 51.04 ? 3672 HOH B O     1 
HETATM 10046 O O     . HOH R 8 .   ? 76.707  44.173  67.369 1.00 68.02 ? 3676 HOH B O     1 
HETATM 10047 O O     . HOH R 8 .   ? 47.103  36.641  34.027 1.00 57.53 ? 3677 HOH B O     1 
HETATM 10048 O O     . HOH R 8 .   ? 48.906  2.114   8.500  1.00 46.84 ? 3680 HOH B O     1 
HETATM 10049 O O     . HOH R 8 .   ? 68.239  19.839  51.040 1.00 44.52 ? 3687 HOH B O     1 
HETATM 10050 O O     . HOH R 8 .   ? 81.673  11.662  12.499 1.00 71.44 ? 3689 HOH B O     1 
HETATM 10051 O O     . HOH R 8 .   ? 51.425  27.744  33.155 1.00 38.15 ? 3690 HOH B O     1 
HETATM 10052 O O     . HOH R 8 .   ? 86.388  31.689  13.446 1.00 65.79 ? 3692 HOH B O     1 
HETATM 10053 O O     . HOH R 8 .   ? 56.578  24.995  -0.873 1.00 48.49 ? 3693 HOH B O     1 
HETATM 10054 O O     . HOH R 8 .   ? 58.875  -0.430  30.763 1.00 64.52 ? 3694 HOH B O     1 
HETATM 10055 O O     . HOH R 8 .   ? 84.690  10.030  48.497 1.00 53.50 ? 3695 HOH B O     1 
HETATM 10056 O O     . HOH R 8 .   ? 53.139  -0.130  31.976 1.00 57.72 ? 3697 HOH B O     1 
HETATM 10057 O O     . HOH R 8 .   ? 58.099  16.330  1.366  1.00 61.96 ? 3698 HOH B O     1 
HETATM 10058 O O     . HOH R 8 .   ? 57.250  33.499  -0.619 1.00 46.32 ? 3701 HOH B O     1 
HETATM 10059 O O     . HOH R 8 .   ? 64.265  44.789  39.620 1.00 67.38 ? 3703 HOH B O     1 
HETATM 10060 O O     . HOH R 8 .   ? 96.010  20.869  29.979 1.00 68.31 ? 3704 HOH B O     1 
HETATM 10061 O O     . HOH R 8 .   ? 53.430  21.843  33.484 1.00 45.72 ? 3707 HOH B O     1 
HETATM 10062 O O     . HOH R 8 .   ? 82.794  35.357  21.332 1.00 70.23 ? 3710 HOH B O     1 
HETATM 10063 O O     . HOH R 8 .   ? 56.878  43.949  65.981 1.00 58.73 ? 3711 HOH B O     1 
HETATM 10064 O O     . HOH R 8 .   ? 52.895  2.899   45.966 1.00 71.45 ? 3712 HOH B O     1 
HETATM 10065 O O     . HOH R 8 .   ? 61.057  11.102  9.745  1.00 68.39 ? 3713 HOH B O     1 
HETATM 10066 O O     . HOH R 8 .   ? 48.760  29.538  11.371 1.00 65.86 ? 3714 HOH B O     1 
HETATM 10067 O O     . HOH R 8 .   ? 63.770  9.753   8.974  1.00 62.73 ? 3716 HOH B O     1 
HETATM 10068 O O     . HOH R 8 .   ? 60.044  24.647  40.191 1.00 64.03 ? 3718 HOH B O     1 
HETATM 10069 O O     . HOH R 8 .   ? 78.162  9.880   36.015 1.00 54.21 ? 3719 HOH B O     1 
HETATM 10070 O O     . HOH R 8 .   ? 58.635  27.842  20.888 1.00 58.73 ? 3721 HOH B O     1 
HETATM 10071 O O     . HOH R 8 .   ? 81.134  43.025  49.528 1.00 79.56 ? 3723 HOH B O     1 
HETATM 10072 O O     . HOH R 8 .   ? 83.877  9.056   11.069 1.00 79.54 ? 3726 HOH B O     1 
HETATM 10073 O O     . HOH R 8 .   ? 48.429  27.281  8.236  1.00 66.91 ? 3728 HOH B O     1 
HETATM 10074 O O     . HOH R 8 .   ? 75.744  50.129  54.774 1.00 59.79 ? 3732 HOH B O     1 
HETATM 10075 O O     . HOH R 8 .   ? 94.024  28.116  37.453 1.00 76.94 ? 3733 HOH B O     1 
HETATM 10076 O O     . HOH R 8 .   ? 53.251  3.381   36.306 1.00 33.45 ? 3734 HOH B O     1 
HETATM 10077 O O     . HOH R 8 .   ? 62.712  6.740   19.483 1.00 28.06 ? 3735 HOH B O     1 
HETATM 10078 O O     . HOH R 8 .   ? 79.392  15.704  2.418  1.00 73.29 ? 3736 HOH B O     1 
HETATM 10079 O O     . HOH R 8 .   ? 57.652  -0.246  47.136 1.00 78.07 ? 3737 HOH B O     1 
HETATM 10080 O O     . HOH R 8 .   ? 85.400  7.789   52.300 1.00 80.47 ? 3738 HOH B O     1 
HETATM 10081 O O     . HOH R 8 .   ? 84.757  36.469  23.415 1.00 78.59 ? 3740 HOH B O     1 
HETATM 10082 O O     . HOH R 8 .   ? 82.274  -1.648  44.519 1.00 68.00 ? 3746 HOH B O     1 
HETATM 10083 O O     . HOH R 8 .   ? 54.178  49.176  24.868 1.00 68.40 ? 3750 HOH B O     1 
HETATM 10084 O O     . HOH R 8 .   ? 88.509  12.309  26.442 1.00 64.83 ? 3751 HOH B O     1 
HETATM 10085 O O     . HOH R 8 .   ? 69.754  36.976  58.503 1.00 72.21 ? 3753 HOH B O     1 
HETATM 10086 O O     . HOH R 8 .   ? 49.541  12.160  43.962 1.00 69.39 ? 3754 HOH B O     1 
HETATM 10087 O O     . HOH R 8 .   ? 96.727  17.806  29.318 1.00 59.85 ? 3757 HOH B O     1 
HETATM 10088 O O     . HOH R 8 .   ? 69.345  14.302  49.975 1.00 68.93 ? 3758 HOH B O     1 
HETATM 10089 O O     . HOH R 8 .   ? 86.714  34.175  54.755 1.00 61.70 ? 3759 HOH B O     1 
HETATM 10090 O O     . HOH R 8 .   ? 69.762  47.058  48.257 1.00 63.10 ? 3760 HOH B O     1 
HETATM 10091 O O     . HOH R 8 .   ? 67.653  13.299  51.565 1.00 76.82 ? 3761 HOH B O     1 
HETATM 10092 O O     . HOH R 8 .   ? 54.533  21.885  0.712  1.00 77.33 ? 3762 HOH B O     1 
HETATM 10093 O O     . HOH R 8 .   ? 51.185  6.429   8.730  1.00 46.75 ? 3769 HOH B O     1 
HETATM 10094 O O     . HOH R 8 .   ? 59.472  -6.828  43.128 1.00 53.65 ? 3770 HOH B O     1 
HETATM 10095 O O     . HOH R 8 .   ? 59.371  2.198   14.261 1.00 64.93 ? 3773 HOH B O     1 
HETATM 10096 O O     . HOH R 8 .   ? 86.082  15.296  7.874  1.00 64.43 ? 3775 HOH B O     1 
HETATM 10097 O O     . HOH R 8 .   ? 67.446  4.084   11.975 1.00 85.73 ? 3776 HOH B O     1 
HETATM 10098 O O     . HOH R 8 .   ? 79.050  17.871  54.597 1.00 66.31 ? 3777 HOH B O     1 
HETATM 10099 O O     . HOH R 8 .   ? 77.924  8.699   8.711  1.00 74.95 ? 3778 HOH B O     1 
HETATM 10100 O O     . HOH R 8 .   ? 73.410  34.798  30.846 1.00 79.25 ? 3780 HOH B O     1 
# 
loop_
_database_PDB_caveat.id 
_database_PDB_caveat.text 
1 'MAN D 4 HAS WRONG CHIRALITY AT ATOM C1' 
2 'MAN G 4 HAS WRONG CHIRALITY AT ATOM C1' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   33   33   ALA ALA A . n 
A 1 2   ASN 2   34   34   ASN ASN A . n 
A 1 3   PRO 3   35   35   PRO PRO A . n 
A 1 4   CYS 4   36   36   CYS CYS A . n 
A 1 5   CYS 5   37   37   CYS CYS A . n 
A 1 6   SER 6   38   38   SER SER A . n 
A 1 7   ASN 7   39   39   ASN ASN A . n 
A 1 8   PRO 8   40   40   PRO PRO A . n 
A 1 9   CYS 9   41   41   CYS CYS A . n 
A 1 10  GLN 10  42   42   GLN GLN A . n 
A 1 11  ASN 11  43   43   ASN ASN A . n 
A 1 12  ARG 12  44   44   ARG ARG A . n 
A 1 13  GLY 13  45   45   GLY GLY A . n 
A 1 14  GLU 14  46   46   GLU GLU A . n 
A 1 15  CYS 15  47   47   CYS CYS A . n 
A 1 16  MET 16  48   48   MET MET A . n 
A 1 17  SER 17  49   49   SER SER A . n 
A 1 18  THR 18  50   50   THR THR A . n 
A 1 19  GLY 19  51   51   GLY GLY A . n 
A 1 20  PHE 20  52   52   PHE PHE A . n 
A 1 21  ASP 21  53   53   ASP ASP A . n 
A 1 22  GLN 22  54   54   GLN GLN A . n 
A 1 23  TYR 23  55   55   TYR TYR A . n 
A 1 24  LYS 24  56   56   LYS LYS A . n 
A 1 25  CYS 25  57   57   CYS CYS A . n 
A 1 26  ASP 26  58   58   ASP ASP A . n 
A 1 27  CYS 27  59   59   CYS CYS A . n 
A 1 28  THR 28  60   60   THR THR A . n 
A 1 29  ARG 29  61   61   ARG ARG A . n 
A 1 30  THR 30  62   62   THR THR A . n 
A 1 31  GLY 31  63   63   GLY GLY A . n 
A 1 32  PHE 32  64   64   PHE PHE A . n 
A 1 33  TYR 33  65   65   TYR TYR A . n 
A 1 34  GLY 34  66   66   GLY GLY A . n 
A 1 35  GLU 35  67   67   GLU GLU A . n 
A 1 36  ASN 36  68   68   ASN ASN A . n 
A 1 37  CYS 37  69   69   CYS CYS A . n 
A 1 38  THR 38  70   70   THR THR A . n 
A 1 39  THR 39  71   71   THR THR A . n 
A 1 40  PRO 40  72   72   PRO PRO A . n 
A 1 41  GLU 41  73   73   GLU GLU A . n 
A 1 42  PHE 42  74   74   PHE PHE A . n 
A 1 43  LEU 43  75   75   LEU LEU A . n 
A 1 44  THR 44  76   76   THR THR A . n 
A 1 45  ARG 45  77   77   ARG ARG A . n 
A 1 46  ILE 46  78   78   ILE ILE A . n 
A 1 47  LYS 47  79   79   LYS LYS A . n 
A 1 48  LEU 48  80   80   LEU LEU A . n 
A 1 49  LEU 49  81   81   LEU LEU A . n 
A 1 50  LEU 50  82   82   LEU LEU A . n 
A 1 51  LYS 51  83   83   LYS LYS A . n 
A 1 52  PRO 52  84   84   PRO PRO A . n 
A 1 53  THR 53  85   85   THR THR A . n 
A 1 54  PRO 54  86   86   PRO PRO A . n 
A 1 55  ASN 55  87   87   ASN ASN A . n 
A 1 56  THR 56  88   88   THR THR A . n 
A 1 57  VAL 57  89   89   VAL VAL A . n 
A 1 58  HIS 58  90   90   HIS HIS A . n 
A 1 59  TYR 59  91   91   TYR TYR A . n 
A 1 60  ILE 60  92   92   ILE ILE A . n 
A 1 61  LEU 61  93   93   LEU LEU A . n 
A 1 62  THR 62  94   94   THR THR A . n 
A 1 63  HIS 63  95   95   HIS HIS A . n 
A 1 64  PHE 64  96   96   PHE PHE A . n 
A 1 65  LYS 65  97   97   LYS LYS A . n 
A 1 66  GLY 66  98   98   GLY GLY A . n 
A 1 67  VAL 67  99   99   VAL VAL A . n 
A 1 68  TRP 68  100  100  TRP TRP A . n 
A 1 69  ASN 69  101  101  ASN ASN A . n 
A 1 70  ILE 70  102  102  ILE ILE A . n 
A 1 71  VAL 71  103  103  VAL VAL A . n 
A 1 72  ASN 72  104  104  ASN ASN A . n 
A 1 73  ASN 73  105  105  ASN ASN A . n 
A 1 74  ILE 74  105  105  ILE ILE A A n 
A 1 75  PRO 75  106  106  PRO PRO A . n 
A 1 76  PHE 76  107  107  PHE PHE A . n 
A 1 77  LEU 77  108  108  LEU LEU A . n 
A 1 78  ARG 78  109  109  ARG ARG A . n 
A 1 79  SER 79  110  110  SER SER A . n 
A 1 80  LEU 80  111  111  LEU LEU A . n 
A 1 81  ILE 81  112  112  ILE ILE A . n 
A 1 82  MET 82  113  113  MET MET A . n 
A 1 83  LYS 83  114  114  LYS LYS A . n 
A 1 84  TYR 84  115  115  TYR TYR A . n 
A 1 85  VAL 85  116  116  VAL VAL A . n 
A 1 86  LEU 86  117  117  LEU LEU A . n 
A 1 87  THR 87  118  118  THR THR A . n 
A 1 88  SER 88  119  119  SER SER A . n 
A 1 89  ARG 89  120  120  ARG ARG A . n 
A 1 90  SER 90  121  121  SER SER A . n 
A 1 91  TYR 91  122  122  TYR TYR A . n 
A 1 92  LEU 92  123  123  LEU LEU A . n 
A 1 93  ILE 93  124  124  ILE ILE A . n 
A 1 94  ASP 94  125  125  ASP ASP A . n 
A 1 95  SER 95  126  126  SER SER A . n 
A 1 96  PRO 96  127  127  PRO PRO A . n 
A 1 97  PRO 97  128  128  PRO PRO A . n 
A 1 98  THR 98  129  129  THR THR A . n 
A 1 99  TYR 99  130  130  TYR TYR A . n 
A 1 100 ASN 100 131  131  ASN ASN A . n 
A 1 101 VAL 101 132  132  VAL VAL A . n 
A 1 102 HIS 102 133  133  HIS HIS A . n 
A 1 103 TYR 103 134  134  TYR TYR A . n 
A 1 104 GLY 104 135  135  GLY GLY A . n 
A 1 105 TYR 105 136  136  TYR TYR A . n 
A 1 106 LYS 106 137  137  LYS LYS A . n 
A 1 107 SER 107 138  138  SER SER A . n 
A 1 108 TRP 108 139  139  TRP TRP A . n 
A 1 109 GLU 109 140  140  GLU GLU A . n 
A 1 110 ALA 110 141  141  ALA ALA A . n 
A 1 111 PHE 111 142  142  PHE PHE A . n 
A 1 112 SER 112 143  143  SER SER A . n 
A 1 113 ASN 113 144  144  ASN ASN A . n 
A 1 114 LEU 114 145  145  LEU LEU A . n 
A 1 115 SER 115 146  146  SER SER A . n 
A 1 116 TYR 116 147  147  TYR TYR A . n 
A 1 117 TYR 117 148  148  TYR TYR A . n 
A 1 118 THR 118 149  149  THR THR A . n 
A 1 119 ARG 119 150  150  ARG ARG A . n 
A 1 120 ALA 120 151  151  ALA ALA A . n 
A 1 121 LEU 121 152  152  LEU LEU A . n 
A 1 122 PRO 122 153  153  PRO PRO A . n 
A 1 123 PRO 123 154  154  PRO PRO A . n 
A 1 124 VAL 124 155  155  VAL VAL A . n 
A 1 125 ALA 125 156  156  ALA ALA A . n 
A 1 126 ASP 126 157  157  ASP ASP A . n 
A 1 127 ASP 127 158  158  ASP ASP A . n 
A 1 128 CYS 128 159  159  CYS CYS A . n 
A 1 129 PRO 129 160  160  PRO PRO A . n 
A 1 130 THR 130 161  161  THR THR A . n 
A 1 131 PRO 131 162  162  PRO PRO A . n 
A 1 132 MET 132 163  163  MET MET A . n 
A 1 133 GLY 133 164  164  GLY GLY A . n 
A 1 134 VAL 134 165  165  VAL VAL A . n 
A 1 135 LYS 135 166  166  LYS LYS A . n 
A 1 136 GLY 136 167  167  GLY GLY A . n 
A 1 137 ASN 137 168  168  ASN ASN A . n 
A 1 138 LYS 138 169  169  LYS LYS A . n 
A 1 139 GLU 139 170  170  GLU GLU A . n 
A 1 140 LEU 140 171  171  LEU LEU A . n 
A 1 141 PRO 141 172  172  PRO PRO A . n 
A 1 142 ASP 142 173  173  ASP ASP A . n 
A 1 143 SER 143 174  174  SER SER A . n 
A 1 144 LYS 144 175  175  LYS LYS A . n 
A 1 145 GLU 145 176  176  GLU GLU A . n 
A 1 146 VAL 146 177  177  VAL VAL A . n 
A 1 147 LEU 147 178  178  LEU LEU A . n 
A 1 148 GLU 148 179  179  GLU GLU A . n 
A 1 149 LYS 149 180  180  LYS LYS A . n 
A 1 150 VAL 150 181  181  VAL VAL A . n 
A 1 151 LEU 151 182  182  LEU LEU A . n 
A 1 152 LEU 152 183  183  LEU LEU A . n 
A 1 153 ARG 153 184  184  ARG ARG A . n 
A 1 154 ARG 154 185  185  ARG ARG A . n 
A 1 155 GLU 155 186  186  GLU GLU A . n 
A 1 156 PHE 156 187  187  PHE PHE A . n 
A 1 157 ILE 157 188  188  ILE ILE A . n 
A 1 158 PRO 158 189  189  PRO PRO A . n 
A 1 159 ASP 159 190  190  ASP ASP A . n 
A 1 160 PRO 160 191  191  PRO PRO A . n 
A 1 161 GLN 161 192  192  GLN GLN A . n 
A 1 162 GLY 162 193  193  GLY GLY A . n 
A 1 163 SER 163 194  194  SER SER A . n 
A 1 164 ASN 164 195  195  ASN ASN A . n 
A 1 165 MET 165 196  196  MET MET A . n 
A 1 166 MET 166 197  197  MET MET A . n 
A 1 167 PHE 167 198  198  PHE PHE A . n 
A 1 168 ALA 168 199  199  ALA ALA A . n 
A 1 169 PHE 169 200  200  PHE PHE A . n 
A 1 170 PHE 170 201  201  PHE PHE A . n 
A 1 171 ALA 171 202  202  ALA ALA A . n 
A 1 172 GLN 172 203  203  GLN GLN A . n 
A 1 173 HIS 173 204  204  HIS HIS A . n 
A 1 174 PHE 174 205  205  PHE PHE A . n 
A 1 175 THR 175 206  206  THR THR A . n 
A 1 176 ALA 176 207  207  ALA ALA A . n 
A 1 177 GLN 177 208  208  GLN GLN A . n 
A 1 178 PHE 178 209  209  PHE PHE A . n 
A 1 179 PHE 179 210  210  PHE PHE A . n 
A 1 180 LYS 180 211  211  LYS LYS A . n 
A 1 181 THR 181 212  212  THR THR A . n 
A 1 182 ASP 182 213  213  ASP ASP A . n 
A 1 183 HIS 183 214  214  HIS HIS A . n 
A 1 184 LYS 184 215  215  LYS LYS A . n 
A 1 185 ARG 185 216  216  ARG ARG A . n 
A 1 186 GLY 186 217  217  GLY GLY A . n 
A 1 187 PRO 187 218  218  PRO PRO A . n 
A 1 188 GLY 188 219  219  GLY GLY A . n 
A 1 189 PHE 189 220  220  PHE PHE A . n 
A 1 190 THR 190 221  221  THR THR A . n 
A 1 191 ARG 191 222  222  ARG ARG A . n 
A 1 192 GLY 192 223  223  GLY GLY A . n 
A 1 193 LEU 193 224  224  LEU LEU A . n 
A 1 194 GLY 194 225  225  GLY GLY A . n 
A 1 195 HIS 195 226  226  HIS HIS A . n 
A 1 196 GLY 196 227  227  GLY GLY A . n 
A 1 197 VAL 197 228  228  VAL VAL A . n 
A 1 198 ASP 198 229  229  ASP ASP A . n 
A 1 199 LEU 199 230  230  LEU LEU A . n 
A 1 200 ASN 200 231  231  ASN ASN A . n 
A 1 201 HIS 201 232  232  HIS HIS A . n 
A 1 202 ILE 202 233  233  ILE ILE A . n 
A 1 203 TYR 203 234  234  TYR TYR A . n 
A 1 204 GLY 204 235  235  GLY GLY A . n 
A 1 205 GLU 205 236  236  GLU GLU A . n 
A 1 206 THR 206 237  237  THR THR A . n 
A 1 207 LEU 207 238  238  LEU LEU A . n 
A 1 208 ASP 208 239  239  ASP ASP A . n 
A 1 209 ARG 209 240  240  ARG ARG A . n 
A 1 210 GLN 210 241  241  GLN GLN A . n 
A 1 211 HIS 211 242  242  HIS HIS A . n 
A 1 212 LYS 212 243  243  LYS LYS A . n 
A 1 213 LEU 213 244  244  LEU LEU A . n 
A 1 214 ARG 214 245  245  ARG ARG A . n 
A 1 215 LEU 215 246  246  LEU LEU A . n 
A 1 216 PHE 216 247  247  PHE PHE A . n 
A 1 217 LYS 217 248  248  LYS LYS A . n 
A 1 218 ASP 218 249  249  ASP ASP A . n 
A 1 219 GLY 219 250  250  GLY GLY A . n 
A 1 220 LYS 220 251  251  LYS LYS A . n 
A 1 221 LEU 221 252  252  LEU LEU A . n 
A 1 222 LYS 222 253  253  LYS LYS A . n 
A 1 223 TYR 223 254  254  TYR TYR A . n 
A 1 224 GLN 224 255  255  GLN GLN A . n 
A 1 225 VAL 225 256  256  VAL VAL A . n 
A 1 226 ILE 226 257  257  ILE ILE A . n 
A 1 227 GLY 227 258  258  GLY GLY A . n 
A 1 228 GLY 228 259  259  GLY GLY A . n 
A 1 229 GLU 229 260  260  GLU GLU A . n 
A 1 230 VAL 230 261  261  VAL VAL A . n 
A 1 231 TYR 231 262  262  TYR TYR A . n 
A 1 232 PRO 232 263  263  PRO PRO A . n 
A 1 233 PRO 233 264  264  PRO PRO A . n 
A 1 234 THR 234 265  265  THR THR A . n 
A 1 235 VAL 235 266  266  VAL VAL A . n 
A 1 236 LYS 236 267  267  LYS LYS A . n 
A 1 237 ASP 237 268  268  ASP ASP A . n 
A 1 238 THR 238 269  269  THR THR A . n 
A 1 239 GLN 239 270  270  GLN GLN A . n 
A 1 240 VAL 240 271  271  VAL VAL A . n 
A 1 241 GLU 241 272  272  GLU GLU A . n 
A 1 242 MET 242 273  273  MET MET A . n 
A 1 243 ILE 243 274  274  ILE ILE A . n 
A 1 244 TYR 244 275  275  TYR TYR A . n 
A 1 245 PRO 245 276  276  PRO PRO A . n 
A 1 246 PRO 246 277  277  PRO PRO A . n 
A 1 247 HIS 247 278  278  HIS HIS A . n 
A 1 248 ILE 248 279  279  ILE ILE A . n 
A 1 249 PRO 249 280  280  PRO PRO A . n 
A 1 250 GLU 250 281  281  GLU GLU A . n 
A 1 251 ASN 251 282  282  ASN ASN A . n 
A 1 252 LEU 252 283  283  LEU LEU A . n 
A 1 253 GLN 253 284  284  GLN GLN A . n 
A 1 254 PHE 254 285  285  PHE PHE A . n 
A 1 255 ALA 255 286  286  ALA ALA A . n 
A 1 256 VAL 256 287  287  VAL VAL A . n 
A 1 257 GLY 257 288  288  GLY GLY A . n 
A 1 258 GLN 258 289  289  GLN GLN A . n 
A 1 259 GLU 259 290  290  GLU GLU A . n 
A 1 260 VAL 260 291  291  VAL VAL A . n 
A 1 261 PHE 261 292  292  PHE PHE A . n 
A 1 262 GLY 262 293  293  GLY GLY A . n 
A 1 263 LEU 263 294  294  LEU LEU A . n 
A 1 264 VAL 264 295  295  VAL VAL A . n 
A 1 265 PRO 265 296  296  PRO PRO A . n 
A 1 266 GLY 266 297  297  GLY GLY A . n 
A 1 267 LEU 267 298  298  LEU LEU A . n 
A 1 268 MET 268 299  299  MET MET A . n 
A 1 269 MET 269 300  300  MET MET A . n 
A 1 270 TYR 270 301  301  TYR TYR A . n 
A 1 271 ALA 271 302  302  ALA ALA A . n 
A 1 272 THR 272 303  303  THR THR A . n 
A 1 273 ILE 273 304  304  ILE ILE A . n 
A 1 274 TRP 274 305  305  TRP TRP A . n 
A 1 275 LEU 275 306  306  LEU LEU A . n 
A 1 276 ARG 276 307  307  ARG ARG A . n 
A 1 277 GLU 277 308  308  GLU GLU A . n 
A 1 278 HIS 278 309  309  HIS HIS A . n 
A 1 279 GLN 279 310  310  GLN GLN A . n 
A 1 280 ARG 280 311  311  ARG ARG A . n 
A 1 281 VAL 281 312  312  VAL VAL A . n 
A 1 282 CYS 282 313  313  CYS CYS A . n 
A 1 283 ASP 283 314  314  ASP ASP A . n 
A 1 284 ILE 284 315  315  ILE ILE A . n 
A 1 285 LEU 285 316  316  LEU LEU A . n 
A 1 286 LYS 286 317  317  LYS LYS A . n 
A 1 287 GLN 287 318  318  GLN GLN A . n 
A 1 288 GLU 288 319  319  GLU GLU A . n 
A 1 289 HIS 289 320  320  HIS HIS A . n 
A 1 290 PRO 290 321  321  PRO PRO A . n 
A 1 291 GLU 291 322  322  GLU GLU A . n 
A 1 292 TRP 292 323  323  TRP TRP A . n 
A 1 293 GLY 293 324  324  GLY GLY A . n 
A 1 294 ASP 294 325  325  ASP ASP A . n 
A 1 295 GLU 295 326  326  GLU GLU A . n 
A 1 296 GLN 296 327  327  GLN GLN A . n 
A 1 297 LEU 297 328  328  LEU LEU A . n 
A 1 298 PHE 298 329  329  PHE PHE A . n 
A 1 299 GLN 299 330  330  GLN GLN A . n 
A 1 300 THR 300 331  331  THR THR A . n 
A 1 301 SER 301 332  332  SER SER A . n 
A 1 302 LYS 302 333  333  LYS LYS A . n 
A 1 303 LEU 303 334  334  LEU LEU A . n 
A 1 304 ILE 304 335  335  ILE ILE A . n 
A 1 305 LEU 305 336  336  LEU LEU A . n 
A 1 306 ILE 306 337  337  ILE ILE A . n 
A 1 307 GLY 307 338  338  GLY GLY A . n 
A 1 308 GLU 308 339  339  GLU GLU A . n 
A 1 309 THR 309 340  340  THR THR A . n 
A 1 310 ILE 310 341  341  ILE ILE A . n 
A 1 311 LYS 311 342  342  LYS LYS A . n 
A 1 312 ILE 312 343  343  ILE ILE A . n 
A 1 313 VAL 313 344  344  VAL VAL A . n 
A 1 314 ILE 314 345  345  ILE ILE A . n 
A 1 315 GLU 315 346  346  GLU GLU A . n 
A 1 316 ASP 316 347  347  ASP ASP A . n 
A 1 317 TYR 317 348  348  TYR TYR A . n 
A 1 318 VAL 318 349  349  VAL VAL A . n 
A 1 319 GLN 319 350  350  GLN GLN A . n 
A 1 320 HIS 320 351  351  HIS HIS A . n 
A 1 321 LEU 321 352  352  LEU LEU A . n 
A 1 322 SER 322 353  353  SER SER A . n 
A 1 323 GLY 323 354  354  GLY GLY A . n 
A 1 324 TYR 324 355  355  TYR TYR A . n 
A 1 325 HIS 325 356  356  HIS HIS A . n 
A 1 326 PHE 326 357  357  PHE PHE A . n 
A 1 327 LYS 327 358  358  LYS LYS A . n 
A 1 328 LEU 328 359  359  LEU LEU A . n 
A 1 329 LYS 329 360  360  LYS LYS A . n 
A 1 330 PHE 330 361  361  PHE PHE A . n 
A 1 331 ASP 331 362  362  ASP ASP A . n 
A 1 332 PRO 332 363  363  PRO PRO A . n 
A 1 333 GLU 333 364  364  GLU GLU A . n 
A 1 334 LEU 334 365  365  LEU LEU A . n 
A 1 335 LEU 335 366  366  LEU LEU A . n 
A 1 336 PHE 336 367  367  PHE PHE A . n 
A 1 337 ASN 337 368  368  ASN ASN A . n 
A 1 338 GLN 338 369  369  GLN GLN A . n 
A 1 339 GLN 339 370  370  GLN GLN A . n 
A 1 340 PHE 340 371  371  PHE PHE A . n 
A 1 341 GLN 341 372  372  GLN GLN A . n 
A 1 342 TYR 342 373  373  TYR TYR A . n 
A 1 343 GLN 343 374  374  GLN GLN A . n 
A 1 344 ASN 344 375  375  ASN ASN A . n 
A 1 345 ARG 345 376  376  ARG ARG A . n 
A 1 346 ILE 346 377  377  ILE ILE A . n 
A 1 347 ALA 347 378  378  ALA ALA A . n 
A 1 348 SER 348 379  379  SER SER A . n 
A 1 349 GLU 349 380  380  GLU GLU A . n 
A 1 350 PHE 350 381  381  PHE PHE A . n 
A 1 351 ASN 351 382  382  ASN ASN A . n 
A 1 352 THR 352 383  383  THR THR A . n 
A 1 353 LEU 353 384  384  LEU LEU A . n 
A 1 354 TYR 354 385  385  TYR TYR A . n 
A 1 355 HIS 355 386  386  HIS HIS A . n 
A 1 356 TRP 356 387  387  TRP TRP A . n 
A 1 357 HIS 357 388  388  HIS HIS A . n 
A 1 358 PRO 358 389  389  PRO PRO A . n 
A 1 359 LEU 359 390  390  LEU LEU A . n 
A 1 360 LEU 360 391  391  LEU LEU A . n 
A 1 361 PRO 361 392  392  PRO PRO A . n 
A 1 362 ASP 362 393  393  ASP ASP A . n 
A 1 363 THR 363 394  394  THR THR A . n 
A 1 364 PHE 364 395  395  PHE PHE A . n 
A 1 365 ASN 365 396  396  ASN ASN A . n 
A 1 366 ILE 366 397  397  ILE ILE A . n 
A 1 367 GLU 367 398  398  GLU GLU A . n 
A 1 368 ASP 368 399  399  ASP ASP A . n 
A 1 369 GLN 369 400  400  GLN GLN A . n 
A 1 370 GLU 370 401  401  GLU GLU A . n 
A 1 371 TYR 371 402  402  TYR TYR A . n 
A 1 372 SER 372 403  403  SER SER A . n 
A 1 373 PHE 373 404  404  PHE PHE A . n 
A 1 374 LYS 374 405  405  LYS LYS A . n 
A 1 375 GLN 375 406  406  GLN GLN A . n 
A 1 376 PHE 376 407  407  PHE PHE A . n 
A 1 377 LEU 377 408  408  LEU LEU A . n 
A 1 378 TYR 378 409  409  TYR TYR A . n 
A 1 379 ASN 379 410  410  ASN ASN A . n 
A 1 380 ASN 380 411  411  ASN ASN A . n 
A 1 381 SER 381 412  412  SER SER A . n 
A 1 382 ILE 382 413  413  ILE ILE A . n 
A 1 383 LEU 383 414  414  LEU LEU A . n 
A 1 384 LEU 384 415  415  LEU LEU A . n 
A 1 385 GLU 385 416  416  GLU GLU A . n 
A 1 386 HIS 386 417  417  HIS HIS A . n 
A 1 387 GLY 387 418  418  GLY GLY A . n 
A 1 388 LEU 388 419  419  LEU LEU A . n 
A 1 389 THR 389 420  420  THR THR A . n 
A 1 390 GLN 390 421  421  GLN GLN A . n 
A 1 391 PHE 391 422  422  PHE PHE A . n 
A 1 392 VAL 392 423  423  VAL VAL A . n 
A 1 393 GLU 393 424  424  GLU GLU A . n 
A 1 394 SER 394 425  425  SER SER A . n 
A 1 395 PHE 395 426  426  PHE PHE A . n 
A 1 396 THR 396 427  427  THR THR A . n 
A 1 397 ARG 397 428  428  ARG ARG A . n 
A 1 398 GLN 398 429  429  GLN GLN A . n 
A 1 399 ILE 399 430  430  ILE ILE A . n 
A 1 400 ALA 400 431  431  ALA ALA A . n 
A 1 401 GLY 401 432  432  GLY GLY A . n 
A 1 402 ARG 402 433  433  ARG ARG A . n 
A 1 403 VAL 403 434  434  VAL VAL A . n 
A 1 404 ALA 404 435  435  ALA ALA A . n 
A 1 405 GLY 405 436  436  GLY GLY A . n 
A 1 406 GLY 406 437  437  GLY GLY A . n 
A 1 407 ARG 407 438  438  ARG ARG A . n 
A 1 408 ASN 408 439  439  ASN ASN A . n 
A 1 409 VAL 409 440  440  VAL VAL A . n 
A 1 410 PRO 410 441  441  PRO PRO A . n 
A 1 411 ILE 411 442  442  ILE ILE A . n 
A 1 412 ALA 412 443  443  ALA ALA A . n 
A 1 413 VAL 413 444  444  VAL VAL A . n 
A 1 414 GLN 414 445  445  GLN GLN A . n 
A 1 415 ALA 415 446  446  ALA ALA A . n 
A 1 416 VAL 416 447  447  VAL VAL A . n 
A 1 417 ALA 417 448  448  ALA ALA A . n 
A 1 418 LYS 418 449  449  LYS LYS A . n 
A 1 419 ALA 419 450  450  ALA ALA A . n 
A 1 420 SER 420 451  451  SER SER A . n 
A 1 421 ILE 421 452  452  ILE ILE A . n 
A 1 422 ASP 422 453  453  ASP ASP A . n 
A 1 423 GLN 423 454  454  GLN GLN A . n 
A 1 424 SER 424 455  455  SER SER A . n 
A 1 425 ARG 425 456  456  ARG ARG A . n 
A 1 426 GLU 426 457  457  GLU GLU A . n 
A 1 427 MET 427 458  458  MET MET A . n 
A 1 428 LYS 428 459  459  LYS LYS A . n 
A 1 429 TYR 429 460  460  TYR TYR A . n 
A 1 430 GLN 430 461  461  GLN GLN A . n 
A 1 431 SER 431 462  462  SER SER A . n 
A 1 432 LEU 432 463  463  LEU LEU A . n 
A 1 433 ASN 433 464  464  ASN ASN A . n 
A 1 434 GLU 434 465  465  GLU GLU A . n 
A 1 435 TYR 435 466  466  TYR TYR A . n 
A 1 436 ARG 436 467  467  ARG ARG A . n 
A 1 437 LYS 437 468  468  LYS LYS A . n 
A 1 438 ARG 438 469  469  ARG ARG A . n 
A 1 439 PHE 439 470  470  PHE PHE A . n 
A 1 440 SER 440 471  471  SER SER A . n 
A 1 441 LEU 441 472  472  LEU LEU A . n 
A 1 442 LYS 442 473  473  LYS LYS A . n 
A 1 443 PRO 443 474  474  PRO PRO A . n 
A 1 444 TYR 444 475  475  TYR TYR A . n 
A 1 445 THR 445 476  476  THR THR A . n 
A 1 446 SER 446 477  477  SER SER A . n 
A 1 447 PHE 447 478  478  PHE PHE A . n 
A 1 448 GLU 448 479  479  GLU GLU A . n 
A 1 449 GLU 449 480  480  GLU GLU A . n 
A 1 450 LEU 450 481  481  LEU LEU A . n 
A 1 451 THR 451 482  482  THR THR A . n 
A 1 452 GLY 452 483  483  GLY GLY A . n 
A 1 453 GLU 453 484  484  GLU GLU A . n 
A 1 454 LYS 454 485  485  LYS LYS A . n 
A 1 455 GLU 455 486  486  GLU GLU A . n 
A 1 456 MET 456 487  487  MET MET A . n 
A 1 457 ALA 457 488  488  ALA ALA A . n 
A 1 458 ALA 458 489  489  ALA ALA A . n 
A 1 459 GLU 459 490  490  GLU GLU A . n 
A 1 460 LEU 460 491  491  LEU LEU A . n 
A 1 461 LYS 461 492  492  LYS LYS A . n 
A 1 462 ALA 462 493  493  ALA ALA A . n 
A 1 463 LEU 463 494  494  LEU LEU A . n 
A 1 464 TYR 464 495  495  TYR TYR A . n 
A 1 465 SER 465 496  496  SER SER A . n 
A 1 466 ASP 466 497  497  ASP ASP A . n 
A 1 467 ILE 467 498  498  ILE ILE A . n 
A 1 468 ASP 468 499  499  ASP ASP A . n 
A 1 469 VAL 469 500  500  VAL VAL A . n 
A 1 470 MET 470 501  501  MET MET A . n 
A 1 471 GLU 471 502  502  GLU GLU A . n 
A 1 472 LEU 472 503  503  LEU LEU A . n 
A 1 473 TYR 473 504  504  TYR TYR A . n 
A 1 474 PRO 474 505  505  PRO PRO A . n 
A 1 475 ALA 475 506  506  ALA ALA A . n 
A 1 476 LEU 476 507  507  LEU LEU A . n 
A 1 477 LEU 477 508  508  LEU LEU A . n 
A 1 478 VAL 478 509  509  VAL VAL A . n 
A 1 479 GLU 479 510  510  GLU GLU A . n 
A 1 480 LYS 480 511  511  LYS LYS A . n 
A 1 481 PRO 481 512  512  PRO PRO A . n 
A 1 482 ARG 482 513  513  ARG ARG A . n 
A 1 483 PRO 483 514  514  PRO PRO A . n 
A 1 484 ASP 484 515  515  ASP ASP A . n 
A 1 485 ALA 485 516  516  ALA ALA A . n 
A 1 486 ILE 486 517  517  ILE ILE A . n 
A 1 487 PHE 487 518  518  PHE PHE A . n 
A 1 488 GLY 488 519  519  GLY GLY A . n 
A 1 489 GLU 489 520  520  GLU GLU A . n 
A 1 490 THR 490 521  521  THR THR A . n 
A 1 491 MET 491 522  522  MET MET A . n 
A 1 492 VAL 492 523  523  VAL VAL A . n 
A 1 493 GLU 493 524  524  GLU GLU A . n 
A 1 494 LEU 494 525  525  LEU LEU A . n 
A 1 495 GLY 495 526  526  GLY GLY A . n 
A 1 496 ALA 496 527  527  ALA ALA A . n 
A 1 497 PRO 497 528  528  PRO PRO A . n 
A 1 498 PHE 498 529  529  PHE PHE A . n 
A 1 499 SER 499 530  530  SER SER A . n 
A 1 500 LEU 500 531  531  LEU LEU A . n 
A 1 501 LYS 501 532  532  LYS LYS A . n 
A 1 502 GLY 502 533  533  GLY GLY A . n 
A 1 503 LEU 503 534  534  LEU LEU A . n 
A 1 504 MET 504 535  535  MET MET A . n 
A 1 505 GLY 505 536  536  GLY GLY A . n 
A 1 506 ASN 506 537  537  ASN ASN A . n 
A 1 507 PRO 507 538  538  PRO PRO A . n 
A 1 508 ILE 508 539  539  ILE ILE A . n 
A 1 509 CYS 509 540  540  CYS CYS A . n 
A 1 510 SER 510 541  541  SER SER A . n 
A 1 511 PRO 511 542  542  PRO PRO A . n 
A 1 512 GLN 512 543  543  GLN GLN A . n 
A 1 513 TYR 513 544  544  TYR TYR A . n 
A 1 514 TRP 514 545  545  TRP TRP A . n 
A 1 515 LYS 515 546  546  LYS LYS A . n 
A 1 516 PRO 516 547  547  PRO PRO A . n 
A 1 517 SER 517 548  548  SER SER A . n 
A 1 518 THR 518 549  549  THR THR A . n 
A 1 519 PHE 519 550  550  PHE PHE A . n 
A 1 520 GLY 520 551  551  GLY GLY A . n 
A 1 521 GLY 521 552  552  GLY GLY A . n 
A 1 522 GLU 522 553  553  GLU GLU A . n 
A 1 523 VAL 523 554  554  VAL VAL A . n 
A 1 524 GLY 524 555  555  GLY GLY A . n 
A 1 525 PHE 525 556  556  PHE PHE A . n 
A 1 526 LYS 526 557  557  LYS LYS A . n 
A 1 527 ILE 527 558  558  ILE ILE A . n 
A 1 528 ILE 528 559  559  ILE ILE A . n 
A 1 529 ASN 529 560  560  ASN ASN A . n 
A 1 530 THR 530 561  561  THR THR A . n 
A 1 531 ALA 531 562  562  ALA ALA A . n 
A 1 532 SER 532 563  563  SER SER A . n 
A 1 533 ILE 533 564  564  ILE ILE A . n 
A 1 534 GLN 534 565  565  GLN GLN A . n 
A 1 535 SER 535 566  566  SER SER A . n 
A 1 536 LEU 536 567  567  LEU LEU A . n 
A 1 537 ILE 537 568  568  ILE ILE A . n 
A 1 538 CYS 538 569  569  CYS CYS A . n 
A 1 539 ASN 539 570  570  ASN ASN A . n 
A 1 540 ASN 540 571  571  ASN ASN A . n 
A 1 541 VAL 541 572  572  VAL VAL A . n 
A 1 542 LYS 542 573  573  LYS LYS A . n 
A 1 543 GLY 543 574  574  GLY GLY A . n 
A 1 544 CYS 544 575  575  CYS CYS A . n 
A 1 545 PRO 545 576  576  PRO PRO A . n 
A 1 546 PHE 546 577  577  PHE PHE A . n 
A 1 547 THR 547 578  578  THR THR A . n 
A 1 548 SER 548 579  579  SER SER A . n 
A 1 549 PHE 549 580  580  PHE PHE A . n 
A 1 550 ASN 550 581  581  ASN ASN A . n 
A 1 551 VAL 551 582  582  VAL VAL A . n 
A 1 552 GLN 552 583  583  GLN GLN A . n 
B 1 1   ALA 1   2033 2033 ALA ALA B . n 
B 1 2   ASN 2   2034 2034 ASN ASN B . n 
B 1 3   PRO 3   2035 2035 PRO PRO B . n 
B 1 4   CYS 4   2036 2036 CYS CYS B . n 
B 1 5   CYS 5   2037 2037 CYS CYS B . n 
B 1 6   SER 6   2038 2038 SER SER B . n 
B 1 7   ASN 7   2039 2039 ASN ASN B . n 
B 1 8   PRO 8   2040 2040 PRO PRO B . n 
B 1 9   CYS 9   2041 2041 CYS CYS B . n 
B 1 10  GLN 10  2042 2042 GLN GLN B . n 
B 1 11  ASN 11  2043 2043 ASN ASN B . n 
B 1 12  ARG 12  2044 2044 ARG ARG B . n 
B 1 13  GLY 13  2045 2045 GLY GLY B . n 
B 1 14  GLU 14  2046 2046 GLU GLU B . n 
B 1 15  CYS 15  2047 2047 CYS CYS B . n 
B 1 16  MET 16  2048 2048 MET MET B . n 
B 1 17  SER 17  2049 2049 SER SER B . n 
B 1 18  THR 18  2050 2050 THR THR B . n 
B 1 19  GLY 19  2051 2051 GLY GLY B . n 
B 1 20  PHE 20  2052 2052 PHE PHE B . n 
B 1 21  ASP 21  2053 2053 ASP ASP B . n 
B 1 22  GLN 22  2054 2054 GLN GLN B . n 
B 1 23  TYR 23  2055 2055 TYR TYR B . n 
B 1 24  LYS 24  2056 2056 LYS LYS B . n 
B 1 25  CYS 25  2057 2057 CYS CYS B . n 
B 1 26  ASP 26  2058 2058 ASP ASP B . n 
B 1 27  CYS 27  2059 2059 CYS CYS B . n 
B 1 28  THR 28  2060 2060 THR THR B . n 
B 1 29  ARG 29  2061 2061 ARG ARG B . n 
B 1 30  THR 30  2062 2062 THR THR B . n 
B 1 31  GLY 31  2063 2063 GLY GLY B . n 
B 1 32  PHE 32  2064 2064 PHE PHE B . n 
B 1 33  TYR 33  2065 2065 TYR TYR B . n 
B 1 34  GLY 34  2066 2066 GLY GLY B . n 
B 1 35  GLU 35  2067 2067 GLU GLU B . n 
B 1 36  ASN 36  2068 2068 ASN ASN B . n 
B 1 37  CYS 37  2069 2069 CYS CYS B . n 
B 1 38  THR 38  2070 2070 THR THR B . n 
B 1 39  THR 39  2071 2071 THR THR B . n 
B 1 40  PRO 40  2072 2072 PRO PRO B . n 
B 1 41  GLU 41  2073 2073 GLU GLU B . n 
B 1 42  PHE 42  2074 2074 PHE PHE B . n 
B 1 43  LEU 43  2075 2075 LEU LEU B . n 
B 1 44  THR 44  2076 2076 THR THR B . n 
B 1 45  ARG 45  2077 2077 ARG ARG B . n 
B 1 46  ILE 46  2078 2078 ILE ILE B . n 
B 1 47  LYS 47  2079 2079 LYS LYS B . n 
B 1 48  LEU 48  2080 2080 LEU LEU B . n 
B 1 49  LEU 49  2081 2081 LEU LEU B . n 
B 1 50  LEU 50  2082 2082 LEU LEU B . n 
B 1 51  LYS 51  2083 2083 LYS LYS B . n 
B 1 52  PRO 52  2084 2084 PRO PRO B . n 
B 1 53  THR 53  2085 2085 THR THR B . n 
B 1 54  PRO 54  2086 2086 PRO PRO B . n 
B 1 55  ASN 55  2087 2087 ASN ASN B . n 
B 1 56  THR 56  2088 2088 THR THR B . n 
B 1 57  VAL 57  2089 2089 VAL VAL B . n 
B 1 58  HIS 58  2090 2090 HIS HIS B . n 
B 1 59  TYR 59  2091 2091 TYR TYR B . n 
B 1 60  ILE 60  2092 2092 ILE ILE B . n 
B 1 61  LEU 61  2093 2093 LEU LEU B . n 
B 1 62  THR 62  2094 2094 THR THR B . n 
B 1 63  HIS 63  2095 2095 HIS HIS B . n 
B 1 64  PHE 64  2096 2096 PHE PHE B . n 
B 1 65  LYS 65  2097 2097 LYS LYS B . n 
B 1 66  GLY 66  2098 2098 GLY GLY B . n 
B 1 67  VAL 67  2099 2099 VAL VAL B . n 
B 1 68  TRP 68  2100 2100 TRP TRP B . n 
B 1 69  ASN 69  2101 2101 ASN ASN B . n 
B 1 70  ILE 70  2102 2102 ILE ILE B . n 
B 1 71  VAL 71  2103 2103 VAL VAL B . n 
B 1 72  ASN 72  2104 2104 ASN ASN B . n 
B 1 73  ASN 73  2105 2105 ASN ASN B . n 
B 1 74  ILE 74  105  105  ILE ILE B B n 
B 1 75  PRO 75  2106 2106 PRO PRO B . n 
B 1 76  PHE 76  2107 2107 PHE PHE B . n 
B 1 77  LEU 77  2108 2108 LEU LEU B . n 
B 1 78  ARG 78  2109 2109 ARG ARG B . n 
B 1 79  SER 79  2110 2110 SER SER B . n 
B 1 80  LEU 80  2111 2111 LEU LEU B . n 
B 1 81  ILE 81  2112 2112 ILE ILE B . n 
B 1 82  MET 82  2113 2113 MET MET B . n 
B 1 83  LYS 83  2114 2114 LYS LYS B . n 
B 1 84  TYR 84  2115 2115 TYR TYR B . n 
B 1 85  VAL 85  2116 2116 VAL VAL B . n 
B 1 86  LEU 86  2117 2117 LEU LEU B . n 
B 1 87  THR 87  2118 2118 THR THR B . n 
B 1 88  SER 88  2119 2119 SER SER B . n 
B 1 89  ARG 89  2120 2120 ARG ARG B . n 
B 1 90  SER 90  2121 2121 SER SER B . n 
B 1 91  TYR 91  2122 2122 TYR TYR B . n 
B 1 92  LEU 92  2123 2123 LEU LEU B . n 
B 1 93  ILE 93  2124 2124 ILE ILE B . n 
B 1 94  ASP 94  2125 2125 ASP ASP B . n 
B 1 95  SER 95  2126 2126 SER SER B . n 
B 1 96  PRO 96  2127 2127 PRO PRO B . n 
B 1 97  PRO 97  2128 2128 PRO PRO B . n 
B 1 98  THR 98  2129 2129 THR THR B . n 
B 1 99  TYR 99  2130 2130 TYR TYR B . n 
B 1 100 ASN 100 2131 2131 ASN ASN B . n 
B 1 101 VAL 101 2132 2132 VAL VAL B . n 
B 1 102 HIS 102 2133 2133 HIS HIS B . n 
B 1 103 TYR 103 2134 2134 TYR TYR B . n 
B 1 104 GLY 104 2135 2135 GLY GLY B . n 
B 1 105 TYR 105 2136 2136 TYR TYR B . n 
B 1 106 LYS 106 2137 2137 LYS LYS B . n 
B 1 107 SER 107 2138 2138 SER SER B . n 
B 1 108 TRP 108 2139 2139 TRP TRP B . n 
B 1 109 GLU 109 2140 2140 GLU GLU B . n 
B 1 110 ALA 110 2141 2141 ALA ALA B . n 
B 1 111 PHE 111 2142 2142 PHE PHE B . n 
B 1 112 SER 112 2143 2143 SER SER B . n 
B 1 113 ASN 113 2144 2144 ASN ASN B . n 
B 1 114 LEU 114 2145 2145 LEU LEU B . n 
B 1 115 SER 115 2146 2146 SER SER B . n 
B 1 116 TYR 116 2147 2147 TYR TYR B . n 
B 1 117 TYR 117 2148 2148 TYR TYR B . n 
B 1 118 THR 118 2149 2149 THR THR B . n 
B 1 119 ARG 119 2150 2150 ARG ARG B . n 
B 1 120 ALA 120 2151 2151 ALA ALA B . n 
B 1 121 LEU 121 2152 2152 LEU LEU B . n 
B 1 122 PRO 122 2153 2153 PRO PRO B . n 
B 1 123 PRO 123 2154 2154 PRO PRO B . n 
B 1 124 VAL 124 2155 2155 VAL VAL B . n 
B 1 125 ALA 125 2156 2156 ALA ALA B . n 
B 1 126 ASP 126 2157 2157 ASP ASP B . n 
B 1 127 ASP 127 2158 2158 ASP ASP B . n 
B 1 128 CYS 128 2159 2159 CYS CYS B . n 
B 1 129 PRO 129 2160 2160 PRO PRO B . n 
B 1 130 THR 130 2161 2161 THR THR B . n 
B 1 131 PRO 131 2162 2162 PRO PRO B . n 
B 1 132 MET 132 2163 2163 MET MET B . n 
B 1 133 GLY 133 2164 2164 GLY GLY B . n 
B 1 134 VAL 134 2165 2165 VAL VAL B . n 
B 1 135 LYS 135 2166 2166 LYS LYS B . n 
B 1 136 GLY 136 2167 2167 GLY GLY B . n 
B 1 137 ASN 137 2168 2168 ASN ASN B . n 
B 1 138 LYS 138 2169 2169 LYS LYS B . n 
B 1 139 GLU 139 2170 2170 GLU GLU B . n 
B 1 140 LEU 140 2171 2171 LEU LEU B . n 
B 1 141 PRO 141 2172 2172 PRO PRO B . n 
B 1 142 ASP 142 2173 2173 ASP ASP B . n 
B 1 143 SER 143 2174 2174 SER SER B . n 
B 1 144 LYS 144 2175 2175 LYS LYS B . n 
B 1 145 GLU 145 2176 2176 GLU GLU B . n 
B 1 146 VAL 146 2177 2177 VAL VAL B . n 
B 1 147 LEU 147 2178 2178 LEU LEU B . n 
B 1 148 GLU 148 2179 2179 GLU GLU B . n 
B 1 149 LYS 149 2180 2180 LYS LYS B . n 
B 1 150 VAL 150 2181 2181 VAL VAL B . n 
B 1 151 LEU 151 2182 2182 LEU LEU B . n 
B 1 152 LEU 152 2183 2183 LEU LEU B . n 
B 1 153 ARG 153 2184 2184 ARG ARG B . n 
B 1 154 ARG 154 2185 2185 ARG ARG B . n 
B 1 155 GLU 155 2186 2186 GLU GLU B . n 
B 1 156 PHE 156 2187 2187 PHE PHE B . n 
B 1 157 ILE 157 2188 2188 ILE ILE B . n 
B 1 158 PRO 158 2189 2189 PRO PRO B . n 
B 1 159 ASP 159 2190 2190 ASP ASP B . n 
B 1 160 PRO 160 2191 2191 PRO PRO B . n 
B 1 161 GLN 161 2192 2192 GLN GLN B . n 
B 1 162 GLY 162 2193 2193 GLY GLY B . n 
B 1 163 SER 163 2194 2194 SER SER B . n 
B 1 164 ASN 164 2195 2195 ASN ASN B . n 
B 1 165 MET 165 2196 2196 MET MET B . n 
B 1 166 MET 166 2197 2197 MET MET B . n 
B 1 167 PHE 167 2198 2198 PHE PHE B . n 
B 1 168 ALA 168 2199 2199 ALA ALA B . n 
B 1 169 PHE 169 2200 2200 PHE PHE B . n 
B 1 170 PHE 170 2201 2201 PHE PHE B . n 
B 1 171 ALA 171 2202 2202 ALA ALA B . n 
B 1 172 GLN 172 2203 2203 GLN GLN B . n 
B 1 173 HIS 173 2204 2204 HIS HIS B . n 
B 1 174 PHE 174 2205 2205 PHE PHE B . n 
B 1 175 THR 175 2206 2206 THR THR B . n 
B 1 176 ALA 176 2207 2207 ALA ALA B . n 
B 1 177 GLN 177 2208 2208 GLN GLN B . n 
B 1 178 PHE 178 2209 2209 PHE PHE B . n 
B 1 179 PHE 179 2210 2210 PHE PHE B . n 
B 1 180 LYS 180 2211 2211 LYS LYS B . n 
B 1 181 THR 181 2212 2212 THR THR B . n 
B 1 182 ASP 182 2213 2213 ASP ASP B . n 
B 1 183 HIS 183 2214 2214 HIS HIS B . n 
B 1 184 LYS 184 2215 2215 LYS LYS B . n 
B 1 185 ARG 185 2216 2216 ARG ARG B . n 
B 1 186 GLY 186 2217 2217 GLY GLY B . n 
B 1 187 PRO 187 2218 2218 PRO PRO B . n 
B 1 188 GLY 188 2219 2219 GLY GLY B . n 
B 1 189 PHE 189 2220 2220 PHE PHE B . n 
B 1 190 THR 190 2221 2221 THR THR B . n 
B 1 191 ARG 191 2222 2222 ARG ARG B . n 
B 1 192 GLY 192 2223 2223 GLY GLY B . n 
B 1 193 LEU 193 2224 2224 LEU LEU B . n 
B 1 194 GLY 194 2225 2225 GLY GLY B . n 
B 1 195 HIS 195 2226 2226 HIS HIS B . n 
B 1 196 GLY 196 2227 2227 GLY GLY B . n 
B 1 197 VAL 197 2228 2228 VAL VAL B . n 
B 1 198 ASP 198 2229 2229 ASP ASP B . n 
B 1 199 LEU 199 2230 2230 LEU LEU B . n 
B 1 200 ASN 200 2231 2231 ASN ASN B . n 
B 1 201 HIS 201 2232 2232 HIS HIS B . n 
B 1 202 ILE 202 2233 2233 ILE ILE B . n 
B 1 203 TYR 203 2234 2234 TYR TYR B . n 
B 1 204 GLY 204 2235 2235 GLY GLY B . n 
B 1 205 GLU 205 2236 2236 GLU GLU B . n 
B 1 206 THR 206 2237 2237 THR THR B . n 
B 1 207 LEU 207 2238 2238 LEU LEU B . n 
B 1 208 ASP 208 2239 2239 ASP ASP B . n 
B 1 209 ARG 209 2240 2240 ARG ARG B . n 
B 1 210 GLN 210 2241 2241 GLN GLN B . n 
B 1 211 HIS 211 2242 2242 HIS HIS B . n 
B 1 212 LYS 212 2243 2243 LYS LYS B . n 
B 1 213 LEU 213 2244 2244 LEU LEU B . n 
B 1 214 ARG 214 2245 2245 ARG ARG B . n 
B 1 215 LEU 215 2246 2246 LEU LEU B . n 
B 1 216 PHE 216 2247 2247 PHE PHE B . n 
B 1 217 LYS 217 2248 2248 LYS LYS B . n 
B 1 218 ASP 218 2249 2249 ASP ASP B . n 
B 1 219 GLY 219 2250 2250 GLY GLY B . n 
B 1 220 LYS 220 2251 2251 LYS LYS B . n 
B 1 221 LEU 221 2252 2252 LEU LEU B . n 
B 1 222 LYS 222 2253 2253 LYS LYS B . n 
B 1 223 TYR 223 2254 2254 TYR TYR B . n 
B 1 224 GLN 224 2255 2255 GLN GLN B . n 
B 1 225 VAL 225 2256 2256 VAL VAL B . n 
B 1 226 ILE 226 2257 2257 ILE ILE B . n 
B 1 227 GLY 227 2258 2258 GLY GLY B . n 
B 1 228 GLY 228 2259 2259 GLY GLY B . n 
B 1 229 GLU 229 2260 2260 GLU GLU B . n 
B 1 230 VAL 230 2261 2261 VAL VAL B . n 
B 1 231 TYR 231 2262 2262 TYR TYR B . n 
B 1 232 PRO 232 2263 2263 PRO PRO B . n 
B 1 233 PRO 233 2264 2264 PRO PRO B . n 
B 1 234 THR 234 2265 2265 THR THR B . n 
B 1 235 VAL 235 2266 2266 VAL VAL B . n 
B 1 236 LYS 236 2267 2267 LYS LYS B . n 
B 1 237 ASP 237 2268 2268 ASP ASP B . n 
B 1 238 THR 238 2269 2269 THR THR B . n 
B 1 239 GLN 239 2270 2270 GLN GLN B . n 
B 1 240 VAL 240 2271 2271 VAL VAL B . n 
B 1 241 GLU 241 2272 2272 GLU GLU B . n 
B 1 242 MET 242 2273 2273 MET MET B . n 
B 1 243 ILE 243 2274 2274 ILE ILE B . n 
B 1 244 TYR 244 2275 2275 TYR TYR B . n 
B 1 245 PRO 245 2276 2276 PRO PRO B . n 
B 1 246 PRO 246 2277 2277 PRO PRO B . n 
B 1 247 HIS 247 2278 2278 HIS HIS B . n 
B 1 248 ILE 248 2279 2279 ILE ILE B . n 
B 1 249 PRO 249 2280 2280 PRO PRO B . n 
B 1 250 GLU 250 2281 2281 GLU GLU B . n 
B 1 251 ASN 251 2282 2282 ASN ASN B . n 
B 1 252 LEU 252 2283 2283 LEU LEU B . n 
B 1 253 GLN 253 2284 2284 GLN GLN B . n 
B 1 254 PHE 254 2285 2285 PHE PHE B . n 
B 1 255 ALA 255 2286 2286 ALA ALA B . n 
B 1 256 VAL 256 2287 2287 VAL VAL B . n 
B 1 257 GLY 257 2288 2288 GLY GLY B . n 
B 1 258 GLN 258 2289 2289 GLN GLN B . n 
B 1 259 GLU 259 2290 2290 GLU GLU B . n 
B 1 260 VAL 260 2291 2291 VAL VAL B . n 
B 1 261 PHE 261 2292 2292 PHE PHE B . n 
B 1 262 GLY 262 2293 2293 GLY GLY B . n 
B 1 263 LEU 263 2294 2294 LEU LEU B . n 
B 1 264 VAL 264 2295 2295 VAL VAL B . n 
B 1 265 PRO 265 2296 2296 PRO PRO B . n 
B 1 266 GLY 266 2297 2297 GLY GLY B . n 
B 1 267 LEU 267 2298 2298 LEU LEU B . n 
B 1 268 MET 268 2299 2299 MET MET B . n 
B 1 269 MET 269 2300 2300 MET MET B . n 
B 1 270 TYR 270 2301 2301 TYR TYR B . n 
B 1 271 ALA 271 2302 2302 ALA ALA B . n 
B 1 272 THR 272 2303 2303 THR THR B . n 
B 1 273 ILE 273 2304 2304 ILE ILE B . n 
B 1 274 TRP 274 2305 2305 TRP TRP B . n 
B 1 275 LEU 275 2306 2306 LEU LEU B . n 
B 1 276 ARG 276 2307 2307 ARG ARG B . n 
B 1 277 GLU 277 2308 2308 GLU GLU B . n 
B 1 278 HIS 278 2309 2309 HIS HIS B . n 
B 1 279 GLN 279 2310 2310 GLN GLN B . n 
B 1 280 ARG 280 2311 2311 ARG ARG B . n 
B 1 281 VAL 281 2312 2312 VAL VAL B . n 
B 1 282 CYS 282 2313 2313 CYS CYS B . n 
B 1 283 ASP 283 2314 2314 ASP ASP B . n 
B 1 284 ILE 284 2315 2315 ILE ILE B . n 
B 1 285 LEU 285 2316 2316 LEU LEU B . n 
B 1 286 LYS 286 2317 2317 LYS LYS B . n 
B 1 287 GLN 287 2318 2318 GLN GLN B . n 
B 1 288 GLU 288 2319 2319 GLU GLU B . n 
B 1 289 HIS 289 2320 2320 HIS HIS B . n 
B 1 290 PRO 290 2321 2321 PRO PRO B . n 
B 1 291 GLU 291 2322 2322 GLU GLU B . n 
B 1 292 TRP 292 2323 2323 TRP TRP B . n 
B 1 293 GLY 293 2324 2324 GLY GLY B . n 
B 1 294 ASP 294 2325 2325 ASP ASP B . n 
B 1 295 GLU 295 2326 2326 GLU GLU B . n 
B 1 296 GLN 296 2327 2327 GLN GLN B . n 
B 1 297 LEU 297 2328 2328 LEU LEU B . n 
B 1 298 PHE 298 2329 2329 PHE PHE B . n 
B 1 299 GLN 299 2330 2330 GLN GLN B . n 
B 1 300 THR 300 2331 2331 THR THR B . n 
B 1 301 SER 301 2332 2332 SER SER B . n 
B 1 302 LYS 302 2333 2333 LYS LYS B . n 
B 1 303 LEU 303 2334 2334 LEU LEU B . n 
B 1 304 ILE 304 2335 2335 ILE ILE B . n 
B 1 305 LEU 305 2336 2336 LEU LEU B . n 
B 1 306 ILE 306 2337 2337 ILE ILE B . n 
B 1 307 GLY 307 2338 2338 GLY GLY B . n 
B 1 308 GLU 308 2339 2339 GLU GLU B . n 
B 1 309 THR 309 2340 2340 THR THR B . n 
B 1 310 ILE 310 2341 2341 ILE ILE B . n 
B 1 311 LYS 311 2342 2342 LYS LYS B . n 
B 1 312 ILE 312 2343 2343 ILE ILE B . n 
B 1 313 VAL 313 2344 2344 VAL VAL B . n 
B 1 314 ILE 314 2345 2345 ILE ILE B . n 
B 1 315 GLU 315 2346 2346 GLU GLU B . n 
B 1 316 ASP 316 2347 2347 ASP ASP B . n 
B 1 317 TYR 317 2348 2348 TYR TYR B . n 
B 1 318 VAL 318 2349 2349 VAL VAL B . n 
B 1 319 GLN 319 2350 2350 GLN GLN B . n 
B 1 320 HIS 320 2351 2351 HIS HIS B . n 
B 1 321 LEU 321 2352 2352 LEU LEU B . n 
B 1 322 SER 322 2353 2353 SER SER B . n 
B 1 323 GLY 323 2354 2354 GLY GLY B . n 
B 1 324 TYR 324 2355 2355 TYR TYR B . n 
B 1 325 HIS 325 2356 2356 HIS HIS B . n 
B 1 326 PHE 326 2357 2357 PHE PHE B . n 
B 1 327 LYS 327 2358 2358 LYS LYS B . n 
B 1 328 LEU 328 2359 2359 LEU LEU B . n 
B 1 329 LYS 329 2360 2360 LYS LYS B . n 
B 1 330 PHE 330 2361 2361 PHE PHE B . n 
B 1 331 ASP 331 2362 2362 ASP ASP B . n 
B 1 332 PRO 332 2363 2363 PRO PRO B . n 
B 1 333 GLU 333 2364 2364 GLU GLU B . n 
B 1 334 LEU 334 2365 2365 LEU LEU B . n 
B 1 335 LEU 335 2366 2366 LEU LEU B . n 
B 1 336 PHE 336 2367 2367 PHE PHE B . n 
B 1 337 ASN 337 2368 2368 ASN ASN B . n 
B 1 338 GLN 338 2369 2369 GLN GLN B . n 
B 1 339 GLN 339 2370 2370 GLN GLN B . n 
B 1 340 PHE 340 2371 2371 PHE PHE B . n 
B 1 341 GLN 341 2372 2372 GLN GLN B . n 
B 1 342 TYR 342 2373 2373 TYR TYR B . n 
B 1 343 GLN 343 2374 2374 GLN GLN B . n 
B 1 344 ASN 344 2375 2375 ASN ASN B . n 
B 1 345 ARG 345 2376 2376 ARG ARG B . n 
B 1 346 ILE 346 2377 2377 ILE ILE B . n 
B 1 347 ALA 347 2378 2378 ALA ALA B . n 
B 1 348 SER 348 2379 2379 SER SER B . n 
B 1 349 GLU 349 2380 2380 GLU GLU B . n 
B 1 350 PHE 350 2381 2381 PHE PHE B . n 
B 1 351 ASN 351 2382 2382 ASN ASN B . n 
B 1 352 THR 352 2383 2383 THR THR B . n 
B 1 353 LEU 353 2384 2384 LEU LEU B . n 
B 1 354 TYR 354 2385 2385 TYR TYR B . n 
B 1 355 HIS 355 2386 2386 HIS HIS B . n 
B 1 356 TRP 356 2387 2387 TRP TRP B . n 
B 1 357 HIS 357 2388 2388 HIS HIS B . n 
B 1 358 PRO 358 2389 2389 PRO PRO B . n 
B 1 359 LEU 359 2390 2390 LEU LEU B . n 
B 1 360 LEU 360 2391 2391 LEU LEU B . n 
B 1 361 PRO 361 2392 2392 PRO PRO B . n 
B 1 362 ASP 362 2393 2393 ASP ASP B . n 
B 1 363 THR 363 2394 2394 THR THR B . n 
B 1 364 PHE 364 2395 2395 PHE PHE B . n 
B 1 365 ASN 365 2396 2396 ASN ASN B . n 
B 1 366 ILE 366 2397 2397 ILE ILE B . n 
B 1 367 GLU 367 2398 2398 GLU GLU B . n 
B 1 368 ASP 368 2399 2399 ASP ASP B . n 
B 1 369 GLN 369 2400 2400 GLN GLN B . n 
B 1 370 GLU 370 2401 2401 GLU GLU B . n 
B 1 371 TYR 371 2402 2402 TYR TYR B . n 
B 1 372 SER 372 2403 2403 SER SER B . n 
B 1 373 PHE 373 2404 2404 PHE PHE B . n 
B 1 374 LYS 374 2405 2405 LYS LYS B . n 
B 1 375 GLN 375 2406 2406 GLN GLN B . n 
B 1 376 PHE 376 2407 2407 PHE PHE B . n 
B 1 377 LEU 377 2408 2408 LEU LEU B . n 
B 1 378 TYR 378 2409 2409 TYR TYR B . n 
B 1 379 ASN 379 2410 2410 ASN ASN B . n 
B 1 380 ASN 380 2411 2411 ASN ASN B . n 
B 1 381 SER 381 2412 2412 SER SER B . n 
B 1 382 ILE 382 2413 2413 ILE ILE B . n 
B 1 383 LEU 383 2414 2414 LEU LEU B . n 
B 1 384 LEU 384 2415 2415 LEU LEU B . n 
B 1 385 GLU 385 2416 2416 GLU GLU B . n 
B 1 386 HIS 386 2417 2417 HIS HIS B . n 
B 1 387 GLY 387 2418 2418 GLY GLY B . n 
B 1 388 LEU 388 2419 2419 LEU LEU B . n 
B 1 389 THR 389 2420 2420 THR THR B . n 
B 1 390 GLN 390 2421 2421 GLN GLN B . n 
B 1 391 PHE 391 2422 2422 PHE PHE B . n 
B 1 392 VAL 392 2423 2423 VAL VAL B . n 
B 1 393 GLU 393 2424 2424 GLU GLU B . n 
B 1 394 SER 394 2425 2425 SER SER B . n 
B 1 395 PHE 395 2426 2426 PHE PHE B . n 
B 1 396 THR 396 2427 2427 THR THR B . n 
B 1 397 ARG 397 2428 2428 ARG ARG B . n 
B 1 398 GLN 398 2429 2429 GLN GLN B . n 
B 1 399 ILE 399 2430 2430 ILE ILE B . n 
B 1 400 ALA 400 2431 2431 ALA ALA B . n 
B 1 401 GLY 401 2432 2432 GLY GLY B . n 
B 1 402 ARG 402 2433 2433 ARG ARG B . n 
B 1 403 VAL 403 2434 2434 VAL VAL B . n 
B 1 404 ALA 404 2435 2435 ALA ALA B . n 
B 1 405 GLY 405 2436 2436 GLY GLY B . n 
B 1 406 GLY 406 2437 2437 GLY GLY B . n 
B 1 407 ARG 407 2438 2438 ARG ARG B . n 
B 1 408 ASN 408 2439 2439 ASN ASN B . n 
B 1 409 VAL 409 2440 2440 VAL VAL B . n 
B 1 410 PRO 410 2441 2441 PRO PRO B . n 
B 1 411 ILE 411 2442 2442 ILE ILE B . n 
B 1 412 ALA 412 2443 2443 ALA ALA B . n 
B 1 413 VAL 413 2444 2444 VAL VAL B . n 
B 1 414 GLN 414 2445 2445 GLN GLN B . n 
B 1 415 ALA 415 2446 2446 ALA ALA B . n 
B 1 416 VAL 416 2447 2447 VAL VAL B . n 
B 1 417 ALA 417 2448 2448 ALA ALA B . n 
B 1 418 LYS 418 2449 2449 LYS LYS B . n 
B 1 419 ALA 419 2450 2450 ALA ALA B . n 
B 1 420 SER 420 2451 2451 SER SER B . n 
B 1 421 ILE 421 2452 2452 ILE ILE B . n 
B 1 422 ASP 422 2453 2453 ASP ASP B . n 
B 1 423 GLN 423 2454 2454 GLN GLN B . n 
B 1 424 SER 424 2455 2455 SER SER B . n 
B 1 425 ARG 425 2456 2456 ARG ARG B . n 
B 1 426 GLU 426 2457 2457 GLU GLU B . n 
B 1 427 MET 427 2458 2458 MET MET B . n 
B 1 428 LYS 428 2459 2459 LYS LYS B . n 
B 1 429 TYR 429 2460 2460 TYR TYR B . n 
B 1 430 GLN 430 2461 2461 GLN GLN B . n 
B 1 431 SER 431 2462 2462 SER SER B . n 
B 1 432 LEU 432 2463 2463 LEU LEU B . n 
B 1 433 ASN 433 2464 2464 ASN ASN B . n 
B 1 434 GLU 434 2465 2465 GLU GLU B . n 
B 1 435 TYR 435 2466 2466 TYR TYR B . n 
B 1 436 ARG 436 2467 2467 ARG ARG B . n 
B 1 437 LYS 437 2468 2468 LYS LYS B . n 
B 1 438 ARG 438 2469 2469 ARG ARG B . n 
B 1 439 PHE 439 2470 2470 PHE PHE B . n 
B 1 440 SER 440 2471 2471 SER SER B . n 
B 1 441 LEU 441 2472 2472 LEU LEU B . n 
B 1 442 LYS 442 2473 2473 LYS LYS B . n 
B 1 443 PRO 443 2474 2474 PRO PRO B . n 
B 1 444 TYR 444 2475 2475 TYR TYR B . n 
B 1 445 THR 445 2476 2476 THR THR B . n 
B 1 446 SER 446 2477 2477 SER SER B . n 
B 1 447 PHE 447 2478 2478 PHE PHE B . n 
B 1 448 GLU 448 2479 2479 GLU GLU B . n 
B 1 449 GLU 449 2480 2480 GLU GLU B . n 
B 1 450 LEU 450 2481 2481 LEU LEU B . n 
B 1 451 THR 451 2482 2482 THR THR B . n 
B 1 452 GLY 452 2483 2483 GLY GLY B . n 
B 1 453 GLU 453 2484 2484 GLU GLU B . n 
B 1 454 LYS 454 2485 2485 LYS LYS B . n 
B 1 455 GLU 455 2486 2486 GLU GLU B . n 
B 1 456 MET 456 2487 2487 MET MET B . n 
B 1 457 ALA 457 2488 2488 ALA ALA B . n 
B 1 458 ALA 458 2489 2489 ALA ALA B . n 
B 1 459 GLU 459 2490 2490 GLU GLU B . n 
B 1 460 LEU 460 2491 2491 LEU LEU B . n 
B 1 461 LYS 461 2492 2492 LYS LYS B . n 
B 1 462 ALA 462 2493 2493 ALA ALA B . n 
B 1 463 LEU 463 2494 2494 LEU LEU B . n 
B 1 464 TYR 464 2495 2495 TYR TYR B . n 
B 1 465 SER 465 2496 2496 SER SER B . n 
B 1 466 ASP 466 2497 2497 ASP ASP B . n 
B 1 467 ILE 467 2498 2498 ILE ILE B . n 
B 1 468 ASP 468 2499 2499 ASP ASP B . n 
B 1 469 VAL 469 2500 2500 VAL VAL B . n 
B 1 470 MET 470 2501 2501 MET MET B . n 
B 1 471 GLU 471 2502 2502 GLU GLU B . n 
B 1 472 LEU 472 2503 2503 LEU LEU B . n 
B 1 473 TYR 473 2504 2504 TYR TYR B . n 
B 1 474 PRO 474 2505 2505 PRO PRO B . n 
B 1 475 ALA 475 2506 2506 ALA ALA B . n 
B 1 476 LEU 476 2507 2507 LEU LEU B . n 
B 1 477 LEU 477 2508 2508 LEU LEU B . n 
B 1 478 VAL 478 2509 2509 VAL VAL B . n 
B 1 479 GLU 479 2510 2510 GLU GLU B . n 
B 1 480 LYS 480 2511 2511 LYS LYS B . n 
B 1 481 PRO 481 2512 2512 PRO PRO B . n 
B 1 482 ARG 482 2513 2513 ARG ARG B . n 
B 1 483 PRO 483 2514 2514 PRO PRO B . n 
B 1 484 ASP 484 2515 2515 ASP ASP B . n 
B 1 485 ALA 485 2516 2516 ALA ALA B . n 
B 1 486 ILE 486 2517 2517 ILE ILE B . n 
B 1 487 PHE 487 2518 2518 PHE PHE B . n 
B 1 488 GLY 488 2519 2519 GLY GLY B . n 
B 1 489 GLU 489 2520 2520 GLU GLU B . n 
B 1 490 THR 490 2521 2521 THR THR B . n 
B 1 491 MET 491 2522 2522 MET MET B . n 
B 1 492 VAL 492 2523 2523 VAL VAL B . n 
B 1 493 GLU 493 2524 2524 GLU GLU B . n 
B 1 494 LEU 494 2525 2525 LEU LEU B . n 
B 1 495 GLY 495 2526 2526 GLY GLY B . n 
B 1 496 ALA 496 2527 2527 ALA ALA B . n 
B 1 497 PRO 497 2528 2528 PRO PRO B . n 
B 1 498 PHE 498 2529 2529 PHE PHE B . n 
B 1 499 SER 499 2530 2530 SER SER B . n 
B 1 500 LEU 500 2531 2531 LEU LEU B . n 
B 1 501 LYS 501 2532 2532 LYS LYS B . n 
B 1 502 GLY 502 2533 2533 GLY GLY B . n 
B 1 503 LEU 503 2534 2534 LEU LEU B . n 
B 1 504 MET 504 2535 2535 MET MET B . n 
B 1 505 GLY 505 2536 2536 GLY GLY B . n 
B 1 506 ASN 506 2537 2537 ASN ASN B . n 
B 1 507 PRO 507 2538 2538 PRO PRO B . n 
B 1 508 ILE 508 2539 2539 ILE ILE B . n 
B 1 509 CYS 509 2540 2540 CYS CYS B . n 
B 1 510 SER 510 2541 2541 SER SER B . n 
B 1 511 PRO 511 2542 2542 PRO PRO B . n 
B 1 512 GLN 512 2543 2543 GLN GLN B . n 
B 1 513 TYR 513 2544 2544 TYR TYR B . n 
B 1 514 TRP 514 2545 2545 TRP TRP B . n 
B 1 515 LYS 515 2546 2546 LYS LYS B . n 
B 1 516 PRO 516 2547 2547 PRO PRO B . n 
B 1 517 SER 517 2548 2548 SER SER B . n 
B 1 518 THR 518 2549 2549 THR THR B . n 
B 1 519 PHE 519 2550 2550 PHE PHE B . n 
B 1 520 GLY 520 2551 2551 GLY GLY B . n 
B 1 521 GLY 521 2552 2552 GLY GLY B . n 
B 1 522 GLU 522 2553 2553 GLU GLU B . n 
B 1 523 VAL 523 2554 2554 VAL VAL B . n 
B 1 524 GLY 524 2555 2555 GLY GLY B . n 
B 1 525 PHE 525 2556 2556 PHE PHE B . n 
B 1 526 LYS 526 2557 2557 LYS LYS B . n 
B 1 527 ILE 527 2558 2558 ILE ILE B . n 
B 1 528 ILE 528 2559 2559 ILE ILE B . n 
B 1 529 ASN 529 2560 2560 ASN ASN B . n 
B 1 530 THR 530 2561 2561 THR THR B . n 
B 1 531 ALA 531 2562 2562 ALA ALA B . n 
B 1 532 SER 532 2563 2563 SER SER B . n 
B 1 533 ILE 533 2564 2564 ILE ILE B . n 
B 1 534 GLN 534 2565 2565 GLN GLN B . n 
B 1 535 SER 535 2566 2566 SER SER B . n 
B 1 536 LEU 536 2567 2567 LEU LEU B . n 
B 1 537 ILE 537 2568 2568 ILE ILE B . n 
B 1 538 CYS 538 2569 2569 CYS CYS B . n 
B 1 539 ASN 539 2570 2570 ASN ASN B . n 
B 1 540 ASN 540 2571 2571 ASN ASN B . n 
B 1 541 VAL 541 2572 2572 VAL VAL B . n 
B 1 542 LYS 542 2573 2573 LYS LYS B . n 
B 1 543 GLY 543 2574 2574 GLY GLY B . n 
B 1 544 CYS 544 2575 2575 CYS CYS B . n 
B 1 545 PRO 545 2576 2576 PRO PRO B . n 
B 1 546 PHE 546 2577 2577 PHE PHE B . n 
B 1 547 THR 547 2578 2578 THR THR B . n 
B 1 548 SER 548 2579 2579 SER SER B . n 
B 1 549 PHE 549 2580 2580 PHE PHE B . n 
B 1 550 ASN 550 2581 2581 ASN ASN B . n 
B 1 551 VAL 551 2582 2582 VAL VAL B . n 
B 1 552 GLN 552 2583 2583 GLN GLN B . n 
C 2 1   THR 1   2595 2595 THR THR F . n 
C 2 2   LYS 2   2596 2596 LYS LYS F . n 
C 2 3   THR 3   2597 2597 THR THR F . n 
C 2 4   ALA 4   2598 2598 ALA ALA F . n 
C 2 5   THR 5   2599 2599 THR THR F . n 
C 2 6   ILE 6   2600 2600 ILE ILE F . n 
C 2 7   ASN 7   2601 2601 ASN ASN F . n 
C 2 8   ALA 8   2602 2602 ALA ALA F . n 
C 2 9   SER 9   2603 2603 SER SER F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
H 5 NAG 1   681  681  NAG NAG A . 
I 6 BOG 1   702  702  BOG BOG A . 
J 6 BOG 1   703  703  BOG BOG A . 
K 6 BOG 1   704  704  BOG BOG A . 
L 7 ACD 1   701  701  ACD ACD A . 
M 5 NAG 1   2681 2681 NAG NAG B . 
N 6 BOG 1   2702 2702 BOG BOG B . 
O 6 BOG 1   2704 2704 BOG BOG B . 
P 7 ACD 1   2701 2701 ACD ACD B . 
Q 8 HOH 1   3001 3001 HOH HOH A . 
Q 8 HOH 2   3002 3002 HOH HOH A . 
Q 8 HOH 3   3003 3003 HOH HOH A . 
Q 8 HOH 4   3004 3004 HOH HOH A . 
Q 8 HOH 5   3005 3005 HOH HOH A . 
Q 8 HOH 6   3006 3006 HOH HOH A . 
Q 8 HOH 7   3007 3007 HOH HOH A . 
Q 8 HOH 8   3009 3009 HOH HOH A . 
Q 8 HOH 9   3010 3010 HOH HOH A . 
Q 8 HOH 10  3011 3011 HOH HOH A . 
Q 8 HOH 11  3012 3012 HOH HOH A . 
Q 8 HOH 12  3013 3013 HOH HOH A . 
Q 8 HOH 13  3014 3014 HOH HOH A . 
Q 8 HOH 14  3015 3015 HOH HOH A . 
Q 8 HOH 15  3016 3016 HOH HOH A . 
Q 8 HOH 16  3017 3017 HOH HOH A . 
Q 8 HOH 17  3018 3018 HOH HOH A . 
Q 8 HOH 18  3019 3019 HOH HOH A . 
Q 8 HOH 19  3020 3020 HOH HOH A . 
Q 8 HOH 20  3021 3021 HOH HOH A . 
Q 8 HOH 21  3022 3022 HOH HOH A . 
Q 8 HOH 22  3023 3023 HOH HOH A . 
Q 8 HOH 23  3024 3024 HOH HOH A . 
Q 8 HOH 24  3025 3025 HOH HOH A . 
Q 8 HOH 25  3026 3026 HOH HOH A . 
Q 8 HOH 26  3027 3027 HOH HOH A . 
Q 8 HOH 27  3028 3028 HOH HOH A . 
Q 8 HOH 28  3029 3029 HOH HOH A . 
Q 8 HOH 29  3030 3030 HOH HOH A . 
Q 8 HOH 30  3031 3031 HOH HOH A . 
Q 8 HOH 31  3032 3032 HOH HOH A . 
Q 8 HOH 32  3033 3033 HOH HOH A . 
Q 8 HOH 33  3034 3034 HOH HOH A . 
Q 8 HOH 34  3035 3035 HOH HOH A . 
Q 8 HOH 35  3036 3036 HOH HOH A . 
Q 8 HOH 36  3037 3037 HOH HOH A . 
Q 8 HOH 37  3038 3038 HOH HOH A . 
Q 8 HOH 38  3039 3039 HOH HOH A . 
Q 8 HOH 39  3040 3040 HOH HOH A . 
Q 8 HOH 40  3041 3041 HOH HOH A . 
Q 8 HOH 41  3042 3042 HOH HOH A . 
Q 8 HOH 42  3044 3044 HOH HOH A . 
Q 8 HOH 43  3045 3045 HOH HOH A . 
Q 8 HOH 44  3046 3046 HOH HOH A . 
Q 8 HOH 45  3047 3047 HOH HOH A . 
Q 8 HOH 46  3048 3048 HOH HOH A . 
Q 8 HOH 47  3049 3049 HOH HOH A . 
Q 8 HOH 48  3050 3050 HOH HOH A . 
Q 8 HOH 49  3051 3051 HOH HOH A . 
Q 8 HOH 50  3052 3052 HOH HOH A . 
Q 8 HOH 51  3053 3053 HOH HOH A . 
Q 8 HOH 52  3054 3054 HOH HOH A . 
Q 8 HOH 53  3055 3055 HOH HOH A . 
Q 8 HOH 54  3056 3056 HOH HOH A . 
Q 8 HOH 55  3057 3057 HOH HOH A . 
Q 8 HOH 56  3058 3058 HOH HOH A . 
Q 8 HOH 57  3059 3059 HOH HOH A . 
Q 8 HOH 58  3060 3060 HOH HOH A . 
Q 8 HOH 59  3061 3061 HOH HOH A . 
Q 8 HOH 60  3062 3062 HOH HOH A . 
Q 8 HOH 61  3064 3064 HOH HOH A . 
Q 8 HOH 62  3065 3065 HOH HOH A . 
Q 8 HOH 63  3066 3066 HOH HOH A . 
Q 8 HOH 64  3067 3067 HOH HOH A . 
Q 8 HOH 65  3068 3068 HOH HOH A . 
Q 8 HOH 66  3069 3069 HOH HOH A . 
Q 8 HOH 67  3070 3070 HOH HOH A . 
Q 8 HOH 68  3071 3071 HOH HOH A . 
Q 8 HOH 69  3072 3072 HOH HOH A . 
Q 8 HOH 70  3073 3073 HOH HOH A . 
Q 8 HOH 71  3074 3074 HOH HOH A . 
Q 8 HOH 72  3075 3075 HOH HOH A . 
Q 8 HOH 73  3076 3076 HOH HOH A . 
Q 8 HOH 74  3077 3077 HOH HOH A . 
Q 8 HOH 75  3079 3079 HOH HOH A . 
Q 8 HOH 76  3080 3080 HOH HOH A . 
Q 8 HOH 77  3082 3082 HOH HOH A . 
Q 8 HOH 78  3083 3083 HOH HOH A . 
Q 8 HOH 79  3084 3084 HOH HOH A . 
Q 8 HOH 80  3085 3085 HOH HOH A . 
Q 8 HOH 81  3086 3086 HOH HOH A . 
Q 8 HOH 82  3087 3087 HOH HOH A . 
Q 8 HOH 83  3088 3088 HOH HOH A . 
Q 8 HOH 84  3089 3089 HOH HOH A . 
Q 8 HOH 85  3090 3090 HOH HOH A . 
Q 8 HOH 86  3091 3091 HOH HOH A . 
Q 8 HOH 87  3092 3092 HOH HOH A . 
Q 8 HOH 88  3093 3093 HOH HOH A . 
Q 8 HOH 89  3094 3094 HOH HOH A . 
Q 8 HOH 90  3095 3095 HOH HOH A . 
Q 8 HOH 91  3096 3096 HOH HOH A . 
Q 8 HOH 92  3097 3097 HOH HOH A . 
Q 8 HOH 93  3098 3098 HOH HOH A . 
Q 8 HOH 94  3099 3099 HOH HOH A . 
Q 8 HOH 95  3100 3100 HOH HOH A . 
Q 8 HOH 96  3101 3101 HOH HOH A . 
Q 8 HOH 97  3102 3102 HOH HOH A . 
Q 8 HOH 98  3103 3103 HOH HOH A . 
Q 8 HOH 99  3104 3104 HOH HOH A . 
Q 8 HOH 100 3105 3105 HOH HOH A . 
Q 8 HOH 101 3106 3106 HOH HOH A . 
Q 8 HOH 102 3107 3107 HOH HOH A . 
Q 8 HOH 103 3108 3108 HOH HOH A . 
Q 8 HOH 104 3109 3109 HOH HOH A . 
Q 8 HOH 105 3110 3110 HOH HOH A . 
Q 8 HOH 106 3111 3111 HOH HOH A . 
Q 8 HOH 107 3112 3112 HOH HOH A . 
Q 8 HOH 108 3113 3113 HOH HOH A . 
Q 8 HOH 109 3114 3114 HOH HOH A . 
Q 8 HOH 110 3115 3115 HOH HOH A . 
Q 8 HOH 111 3116 3116 HOH HOH A . 
Q 8 HOH 112 3117 3117 HOH HOH A . 
Q 8 HOH 113 3118 3118 HOH HOH A . 
Q 8 HOH 114 3119 3119 HOH HOH A . 
Q 8 HOH 115 3120 3120 HOH HOH A . 
Q 8 HOH 116 3121 3121 HOH HOH A . 
Q 8 HOH 117 3122 3122 HOH HOH A . 
Q 8 HOH 118 3123 3123 HOH HOH A . 
Q 8 HOH 119 3124 3124 HOH HOH A . 
Q 8 HOH 120 3125 3125 HOH HOH A . 
Q 8 HOH 121 3126 3126 HOH HOH A . 
Q 8 HOH 122 3127 3127 HOH HOH A . 
Q 8 HOH 123 3128 3128 HOH HOH A . 
Q 8 HOH 124 3129 3129 HOH HOH A . 
Q 8 HOH 125 3130 3130 HOH HOH A . 
Q 8 HOH 126 3131 3131 HOH HOH A . 
Q 8 HOH 127 3132 3132 HOH HOH A . 
Q 8 HOH 128 3133 3133 HOH HOH A . 
Q 8 HOH 129 3134 3134 HOH HOH A . 
Q 8 HOH 130 3135 3135 HOH HOH A . 
Q 8 HOH 131 3136 3136 HOH HOH A . 
Q 8 HOH 132 3137 3137 HOH HOH A . 
Q 8 HOH 133 3138 3138 HOH HOH A . 
Q 8 HOH 134 3139 3139 HOH HOH A . 
Q 8 HOH 135 3140 3140 HOH HOH A . 
Q 8 HOH 136 3141 3141 HOH HOH A . 
Q 8 HOH 137 3142 3142 HOH HOH A . 
Q 8 HOH 138 3144 3144 HOH HOH A . 
Q 8 HOH 139 3145 3145 HOH HOH A . 
Q 8 HOH 140 3146 3146 HOH HOH A . 
Q 8 HOH 141 3147 3147 HOH HOH A . 
Q 8 HOH 142 3148 3148 HOH HOH A . 
Q 8 HOH 143 3149 3149 HOH HOH A . 
Q 8 HOH 144 3150 3150 HOH HOH A . 
Q 8 HOH 145 3151 3151 HOH HOH A . 
Q 8 HOH 146 3152 3152 HOH HOH A . 
Q 8 HOH 147 3153 3153 HOH HOH A . 
Q 8 HOH 148 3154 3154 HOH HOH A . 
Q 8 HOH 149 3155 3155 HOH HOH A . 
Q 8 HOH 150 3156 3156 HOH HOH A . 
Q 8 HOH 151 3157 3157 HOH HOH A . 
Q 8 HOH 152 3158 3158 HOH HOH A . 
Q 8 HOH 153 3159 3159 HOH HOH A . 
Q 8 HOH 154 3160 3160 HOH HOH A . 
Q 8 HOH 155 3161 3161 HOH HOH A . 
Q 8 HOH 156 3162 3162 HOH HOH A . 
Q 8 HOH 157 3163 3163 HOH HOH A . 
Q 8 HOH 158 3165 3165 HOH HOH A . 
Q 8 HOH 159 3167 3167 HOH HOH A . 
Q 8 HOH 160 3168 3168 HOH HOH A . 
Q 8 HOH 161 3169 3169 HOH HOH A . 
Q 8 HOH 162 3170 3170 HOH HOH A . 
Q 8 HOH 163 3171 3171 HOH HOH A . 
Q 8 HOH 164 3172 3172 HOH HOH A . 
Q 8 HOH 165 3173 3173 HOH HOH A . 
Q 8 HOH 166 3174 3174 HOH HOH A . 
Q 8 HOH 167 3175 3175 HOH HOH A . 
Q 8 HOH 168 3176 3176 HOH HOH A . 
Q 8 HOH 169 3177 3177 HOH HOH A . 
Q 8 HOH 170 3178 3178 HOH HOH A . 
Q 8 HOH 171 3179 3179 HOH HOH A . 
Q 8 HOH 172 3180 3180 HOH HOH A . 
Q 8 HOH 173 3181 3181 HOH HOH A . 
Q 8 HOH 174 3182 3182 HOH HOH A . 
Q 8 HOH 175 3183 3183 HOH HOH A . 
Q 8 HOH 176 3184 3184 HOH HOH A . 
Q 8 HOH 177 3185 3185 HOH HOH A . 
Q 8 HOH 178 3186 3186 HOH HOH A . 
Q 8 HOH 179 3187 3187 HOH HOH A . 
Q 8 HOH 180 3188 3188 HOH HOH A . 
Q 8 HOH 181 3189 3189 HOH HOH A . 
Q 8 HOH 182 3190 3190 HOH HOH A . 
Q 8 HOH 183 3191 3191 HOH HOH A . 
Q 8 HOH 184 3192 3192 HOH HOH A . 
Q 8 HOH 185 3193 3193 HOH HOH A . 
Q 8 HOH 186 3195 3195 HOH HOH A . 
Q 8 HOH 187 3196 3196 HOH HOH A . 
Q 8 HOH 188 3197 3197 HOH HOH A . 
Q 8 HOH 189 3198 3198 HOH HOH A . 
Q 8 HOH 190 3199 3199 HOH HOH A . 
Q 8 HOH 191 3200 3200 HOH HOH A . 
Q 8 HOH 192 3201 3201 HOH HOH A . 
Q 8 HOH 193 3202 3202 HOH HOH A . 
Q 8 HOH 194 3203 3203 HOH HOH A . 
Q 8 HOH 195 3204 3204 HOH HOH A . 
Q 8 HOH 196 3205 3205 HOH HOH A . 
Q 8 HOH 197 3206 3206 HOH HOH A . 
Q 8 HOH 198 3207 3207 HOH HOH A . 
Q 8 HOH 199 3208 3208 HOH HOH A . 
Q 8 HOH 200 3209 3209 HOH HOH A . 
Q 8 HOH 201 3210 3210 HOH HOH A . 
Q 8 HOH 202 3211 3211 HOH HOH A . 
Q 8 HOH 203 3212 3212 HOH HOH A . 
Q 8 HOH 204 3213 3213 HOH HOH A . 
Q 8 HOH 205 3214 3214 HOH HOH A . 
Q 8 HOH 206 3215 3215 HOH HOH A . 
Q 8 HOH 207 3216 3216 HOH HOH A . 
Q 8 HOH 208 3217 3217 HOH HOH A . 
Q 8 HOH 209 3267 3267 HOH HOH A . 
Q 8 HOH 210 3275 3275 HOH HOH A . 
Q 8 HOH 211 3278 3278 HOH HOH A . 
Q 8 HOH 212 3313 3313 HOH HOH A . 
Q 8 HOH 213 3399 3399 HOH HOH A . 
Q 8 HOH 214 3400 3400 HOH HOH A . 
Q 8 HOH 215 3402 3402 HOH HOH A . 
Q 8 HOH 216 3403 3403 HOH HOH A . 
Q 8 HOH 217 3404 3404 HOH HOH A . 
Q 8 HOH 218 3406 3406 HOH HOH A . 
Q 8 HOH 219 3407 3407 HOH HOH A . 
Q 8 HOH 220 3409 3409 HOH HOH A . 
Q 8 HOH 221 3412 3412 HOH HOH A . 
Q 8 HOH 222 3413 3413 HOH HOH A . 
Q 8 HOH 223 3416 3416 HOH HOH A . 
Q 8 HOH 224 3417 3417 HOH HOH A . 
Q 8 HOH 225 3419 3419 HOH HOH A . 
Q 8 HOH 226 3421 3421 HOH HOH A . 
Q 8 HOH 227 3422 3422 HOH HOH A . 
Q 8 HOH 228 3423 3423 HOH HOH A . 
Q 8 HOH 229 3425 3425 HOH HOH A . 
Q 8 HOH 230 3427 3427 HOH HOH A . 
Q 8 HOH 231 3428 3428 HOH HOH A . 
Q 8 HOH 232 3430 3430 HOH HOH A . 
Q 8 HOH 233 3433 3433 HOH HOH A . 
Q 8 HOH 234 3435 3435 HOH HOH A . 
Q 8 HOH 235 3436 3436 HOH HOH A . 
Q 8 HOH 236 3438 3438 HOH HOH A . 
Q 8 HOH 237 3439 3439 HOH HOH A . 
Q 8 HOH 238 3440 3440 HOH HOH A . 
Q 8 HOH 239 3441 3441 HOH HOH A . 
Q 8 HOH 240 3442 3442 HOH HOH A . 
Q 8 HOH 241 3444 3444 HOH HOH A . 
Q 8 HOH 242 3445 3445 HOH HOH A . 
Q 8 HOH 243 3446 3446 HOH HOH A . 
Q 8 HOH 244 3447 3447 HOH HOH A . 
Q 8 HOH 245 3448 3448 HOH HOH A . 
Q 8 HOH 246 3449 3449 HOH HOH A . 
Q 8 HOH 247 3450 3450 HOH HOH A . 
Q 8 HOH 248 3451 3451 HOH HOH A . 
Q 8 HOH 249 3453 3453 HOH HOH A . 
Q 8 HOH 250 3456 3456 HOH HOH A . 
Q 8 HOH 251 3458 3458 HOH HOH A . 
Q 8 HOH 252 3459 3459 HOH HOH A . 
Q 8 HOH 253 3462 3462 HOH HOH A . 
Q 8 HOH 254 3463 3463 HOH HOH A . 
Q 8 HOH 255 3464 3464 HOH HOH A . 
Q 8 HOH 256 3466 3466 HOH HOH A . 
Q 8 HOH 257 3467 3467 HOH HOH A . 
Q 8 HOH 258 3468 3468 HOH HOH A . 
Q 8 HOH 259 3470 3470 HOH HOH A . 
Q 8 HOH 260 3471 3471 HOH HOH A . 
Q 8 HOH 261 3473 3473 HOH HOH A . 
Q 8 HOH 262 3475 3475 HOH HOH A . 
Q 8 HOH 263 3476 3476 HOH HOH A . 
Q 8 HOH 264 3477 3477 HOH HOH A . 
Q 8 HOH 265 3479 3479 HOH HOH A . 
Q 8 HOH 266 3480 3480 HOH HOH A . 
Q 8 HOH 267 3484 3484 HOH HOH A . 
Q 8 HOH 268 3485 3485 HOH HOH A . 
Q 8 HOH 269 3486 3486 HOH HOH A . 
Q 8 HOH 270 3487 3487 HOH HOH A . 
Q 8 HOH 271 3489 3489 HOH HOH A . 
Q 8 HOH 272 3495 3495 HOH HOH A . 
Q 8 HOH 273 3497 3497 HOH HOH A . 
Q 8 HOH 274 3498 3498 HOH HOH A . 
Q 8 HOH 275 3500 3500 HOH HOH A . 
Q 8 HOH 276 3502 3502 HOH HOH A . 
Q 8 HOH 277 3503 3503 HOH HOH A . 
Q 8 HOH 278 3506 3506 HOH HOH A . 
Q 8 HOH 279 3508 3508 HOH HOH A . 
Q 8 HOH 280 3509 3509 HOH HOH A . 
Q 8 HOH 281 3511 3511 HOH HOH A . 
Q 8 HOH 282 3513 3513 HOH HOH A . 
Q 8 HOH 283 3514 3514 HOH HOH A . 
Q 8 HOH 284 3515 3515 HOH HOH A . 
Q 8 HOH 285 3517 3517 HOH HOH A . 
Q 8 HOH 286 3518 3518 HOH HOH A . 
Q 8 HOH 287 3519 3519 HOH HOH A . 
Q 8 HOH 288 3522 3522 HOH HOH A . 
Q 8 HOH 289 3524 3524 HOH HOH A . 
Q 8 HOH 290 3527 3527 HOH HOH A . 
Q 8 HOH 291 3529 3529 HOH HOH A . 
Q 8 HOH 292 3530 3530 HOH HOH A . 
Q 8 HOH 293 3531 3531 HOH HOH A . 
Q 8 HOH 294 3532 3532 HOH HOH A . 
Q 8 HOH 295 3536 3536 HOH HOH A . 
Q 8 HOH 296 3542 3542 HOH HOH A . 
Q 8 HOH 297 3545 3545 HOH HOH A . 
Q 8 HOH 298 3546 3546 HOH HOH A . 
Q 8 HOH 299 3547 3547 HOH HOH A . 
Q 8 HOH 300 3552 3552 HOH HOH A . 
Q 8 HOH 301 3553 3553 HOH HOH A . 
Q 8 HOH 302 3554 3554 HOH HOH A . 
Q 8 HOH 303 3555 3555 HOH HOH A . 
Q 8 HOH 304 3556 3556 HOH HOH A . 
Q 8 HOH 305 3558 3558 HOH HOH A . 
Q 8 HOH 306 3559 3559 HOH HOH A . 
Q 8 HOH 307 3561 3561 HOH HOH A . 
Q 8 HOH 308 3562 3562 HOH HOH A . 
Q 8 HOH 309 3564 3564 HOH HOH A . 
Q 8 HOH 310 3565 3565 HOH HOH A . 
Q 8 HOH 311 3567 3567 HOH HOH A . 
Q 8 HOH 312 3568 3568 HOH HOH A . 
Q 8 HOH 313 3572 3572 HOH HOH A . 
Q 8 HOH 314 3573 3573 HOH HOH A . 
Q 8 HOH 315 3575 3575 HOH HOH A . 
Q 8 HOH 316 3577 3577 HOH HOH A . 
Q 8 HOH 317 3581 3581 HOH HOH A . 
Q 8 HOH 318 3582 3582 HOH HOH A . 
Q 8 HOH 319 3583 3583 HOH HOH A . 
Q 8 HOH 320 3586 3586 HOH HOH A . 
Q 8 HOH 321 3587 3587 HOH HOH A . 
Q 8 HOH 322 3588 3588 HOH HOH A . 
Q 8 HOH 323 3589 3589 HOH HOH A . 
Q 8 HOH 324 3590 3590 HOH HOH A . 
Q 8 HOH 325 3593 3593 HOH HOH A . 
Q 8 HOH 326 3594 3594 HOH HOH A . 
Q 8 HOH 327 3596 3596 HOH HOH A . 
Q 8 HOH 328 3597 3597 HOH HOH A . 
Q 8 HOH 329 3599 3599 HOH HOH A . 
Q 8 HOH 330 3601 3601 HOH HOH A . 
Q 8 HOH 331 3603 3603 HOH HOH A . 
Q 8 HOH 332 3604 3604 HOH HOH A . 
Q 8 HOH 333 3606 3606 HOH HOH A . 
Q 8 HOH 334 3609 3609 HOH HOH A . 
Q 8 HOH 335 3613 3613 HOH HOH A . 
Q 8 HOH 336 3615 3615 HOH HOH A . 
Q 8 HOH 337 3616 3616 HOH HOH A . 
Q 8 HOH 338 3617 3617 HOH HOH A . 
Q 8 HOH 339 3618 3618 HOH HOH A . 
Q 8 HOH 340 3621 3621 HOH HOH A . 
Q 8 HOH 341 3622 3622 HOH HOH A . 
Q 8 HOH 342 3623 3623 HOH HOH A . 
Q 8 HOH 343 3624 3624 HOH HOH A . 
Q 8 HOH 344 3626 3626 HOH HOH A . 
Q 8 HOH 345 3627 3627 HOH HOH A . 
Q 8 HOH 346 3628 3628 HOH HOH A . 
Q 8 HOH 347 3629 3629 HOH HOH A . 
Q 8 HOH 348 3636 3636 HOH HOH A . 
Q 8 HOH 349 3637 3637 HOH HOH A . 
Q 8 HOH 350 3639 3639 HOH HOH A . 
Q 8 HOH 351 3640 3640 HOH HOH A . 
Q 8 HOH 352 3641 3641 HOH HOH A . 
Q 8 HOH 353 3643 3643 HOH HOH A . 
Q 8 HOH 354 3644 3644 HOH HOH A . 
Q 8 HOH 355 3648 3648 HOH HOH A . 
Q 8 HOH 356 3649 3649 HOH HOH A . 
Q 8 HOH 357 3651 3651 HOH HOH A . 
Q 8 HOH 358 3657 3657 HOH HOH A . 
Q 8 HOH 359 3658 3658 HOH HOH A . 
Q 8 HOH 360 3663 3663 HOH HOH A . 
Q 8 HOH 361 3665 3665 HOH HOH A . 
Q 8 HOH 362 3666 3666 HOH HOH A . 
Q 8 HOH 363 3667 3667 HOH HOH A . 
Q 8 HOH 364 3670 3670 HOH HOH A . 
Q 8 HOH 365 3673 3673 HOH HOH A . 
Q 8 HOH 366 3674 3674 HOH HOH A . 
Q 8 HOH 367 3678 3678 HOH HOH A . 
Q 8 HOH 368 3679 3679 HOH HOH A . 
Q 8 HOH 369 3681 3681 HOH HOH A . 
Q 8 HOH 370 3682 3682 HOH HOH A . 
Q 8 HOH 371 3683 3683 HOH HOH A . 
Q 8 HOH 372 3684 3684 HOH HOH A . 
Q 8 HOH 373 3685 3685 HOH HOH A . 
Q 8 HOH 374 3686 3686 HOH HOH A . 
Q 8 HOH 375 3691 3691 HOH HOH A . 
Q 8 HOH 376 3696 3696 HOH HOH A . 
Q 8 HOH 377 3699 3699 HOH HOH A . 
Q 8 HOH 378 3700 3700 HOH HOH A . 
Q 8 HOH 379 3702 3702 HOH HOH A . 
Q 8 HOH 380 3705 3705 HOH HOH A . 
Q 8 HOH 381 3706 3706 HOH HOH A . 
Q 8 HOH 382 3708 3708 HOH HOH A . 
Q 8 HOH 383 3715 3715 HOH HOH A . 
Q 8 HOH 384 3720 3720 HOH HOH A . 
Q 8 HOH 385 3722 3722 HOH HOH A . 
Q 8 HOH 386 3727 3727 HOH HOH A . 
Q 8 HOH 387 3729 3729 HOH HOH A . 
Q 8 HOH 388 3730 3730 HOH HOH A . 
Q 8 HOH 389 3731 3731 HOH HOH A . 
Q 8 HOH 390 3739 3739 HOH HOH A . 
Q 8 HOH 391 3741 3741 HOH HOH A . 
Q 8 HOH 392 3743 3743 HOH HOH A . 
Q 8 HOH 393 3745 3745 HOH HOH A . 
Q 8 HOH 394 3747 3747 HOH HOH A . 
Q 8 HOH 395 3748 3748 HOH HOH A . 
Q 8 HOH 396 3749 3749 HOH HOH A .