data_1CX2
# 
_entry.id   1CX2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CX2         
WWPDB D_1000172580 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CX2 
_pdbx_database_status.recvd_initial_deposition_date   1996-12-17 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kurumbail, R.' 1 
'Stallings, W.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural basis for selective inhibition of cyclooxygenase-2 by anti-inflammatory agents.'         Nature 384 644 648 
1996 NATUAS UK 0028-0836 0006 ? 8967954 10.1038/384644a0 
1       'Erratum. Structural Basis for Selective Inhibition of Cyclooxygenase-2 by Anti-Inflammatory Agents' Nature 385 555 ?   
1997 NATUAS UK 0028-0836 0006 ? ?       ?                
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kurumbail, R.G.' 1  ? 
primary 'Stevens, A.M.'   2  ? 
primary 'Gierse, J.K.'    3  ? 
primary 'McDonald, J.J.'  4  ? 
primary 'Stegeman, R.A.'  5  ? 
primary 'Pak, J.Y.'       6  ? 
primary 'Gildehaus, D.'   7  ? 
primary 'Miyashiro, J.M.' 8  ? 
primary 'Penning, T.D.'   9  ? 
primary 'Seibert, K.'     10 ? 
primary 'Isakson, P.C.'   11 ? 
primary 'Stallings, W.C.' 12 ? 
1       'Kurumbail, R.G.' 13 ? 
1       'Stevens, A.M.'   14 ? 
1       'Gierse, J.K.'    15 ? 
1       'Mcdonald, J.J.'  16 ? 
1       'Stegeman, R.A.'  17 ? 
1       'Pak, J.Y.'       18 ? 
1       'Gildehaus, D.'   19 ? 
1       'Miyashiro, J.M.' 20 ? 
1       'Penning, T.D.'   21 ? 
1       'Seibert, K.'     22 ? 
1       'Isakson, P.C.'   23 ? 
1       'Stallings, W.C.' 24 ? 
# 
_cell.entry_id           1CX2 
_cell.length_a           180.340 
_cell.length_b           133.920 
_cell.length_c           121.140 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CX2 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man CYCLOOXYGENASE-2                                                67318.719 4  1.14.99.1 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                        221.208   12 ?         ? ? ? 
3 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                               616.487   4  ?         ? ? ? 
4 non-polymer syn 1-PHENYLSULFONAMIDE-3-TRIFLUOROMETHYL-5-PARABROMOPHENYLPYRAZOLE 446.242   4  ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROSTAGLANDIN SYNTHASE-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQTSKLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTA
TINASASHSRLDDINPTVLIKRRSTEL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHQRVCDILKQEHPEWGDEQLFQTSKLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTA
TINASASHSRLDDINPTVLIKRRSTEL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASN n 
1 3   PRO n 
1 4   CYS n 
1 5   CYS n 
1 6   SER n 
1 7   ASN n 
1 8   PRO n 
1 9   CYS n 
1 10  GLN n 
1 11  ASN n 
1 12  ARG n 
1 13  GLY n 
1 14  GLU n 
1 15  CYS n 
1 16  MET n 
1 17  SER n 
1 18  THR n 
1 19  GLY n 
1 20  PHE n 
1 21  ASP n 
1 22  GLN n 
1 23  TYR n 
1 24  LYS n 
1 25  CYS n 
1 26  ASP n 
1 27  CYS n 
1 28  THR n 
1 29  ARG n 
1 30  THR n 
1 31  GLY n 
1 32  PHE n 
1 33  TYR n 
1 34  GLY n 
1 35  GLU n 
1 36  ASN n 
1 37  CYS n 
1 38  THR n 
1 39  THR n 
1 40  PRO n 
1 41  GLU n 
1 42  PHE n 
1 43  LEU n 
1 44  THR n 
1 45  ARG n 
1 46  ILE n 
1 47  LYS n 
1 48  LEU n 
1 49  LEU n 
1 50  LEU n 
1 51  LYS n 
1 52  PRO n 
1 53  THR n 
1 54  PRO n 
1 55  ASN n 
1 56  THR n 
1 57  VAL n 
1 58  HIS n 
1 59  TYR n 
1 60  ILE n 
1 61  LEU n 
1 62  THR n 
1 63  HIS n 
1 64  PHE n 
1 65  LYS n 
1 66  GLY n 
1 67  VAL n 
1 68  TRP n 
1 69  ASN n 
1 70  ILE n 
1 71  VAL n 
1 72  ASN n 
1 73  ASN n 
1 74  ILE n 
1 75  PRO n 
1 76  PHE n 
1 77  LEU n 
1 78  ARG n 
1 79  SER n 
1 80  LEU n 
1 81  ILE n 
1 82  MET n 
1 83  LYS n 
1 84  TYR n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  SER n 
1 89  ARG n 
1 90  SER n 
1 91  TYR n 
1 92  LEU n 
1 93  ILE n 
1 94  ASP n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  THR n 
1 99  TYR n 
1 100 ASN n 
1 101 VAL n 
1 102 HIS n 
1 103 TYR n 
1 104 GLY n 
1 105 TYR n 
1 106 LYS n 
1 107 SER n 
1 108 TRP n 
1 109 GLU n 
1 110 ALA n 
1 111 PHE n 
1 112 SER n 
1 113 ASN n 
1 114 LEU n 
1 115 SER n 
1 116 TYR n 
1 117 TYR n 
1 118 THR n 
1 119 ARG n 
1 120 ALA n 
1 121 LEU n 
1 122 PRO n 
1 123 PRO n 
1 124 VAL n 
1 125 ALA n 
1 126 ASP n 
1 127 ASP n 
1 128 CYS n 
1 129 PRO n 
1 130 THR n 
1 131 PRO n 
1 132 MET n 
1 133 GLY n 
1 134 VAL n 
1 135 LYS n 
1 136 GLY n 
1 137 ASN n 
1 138 LYS n 
1 139 GLU n 
1 140 LEU n 
1 141 PRO n 
1 142 ASP n 
1 143 SER n 
1 144 LYS n 
1 145 GLU n 
1 146 VAL n 
1 147 LEU n 
1 148 GLU n 
1 149 LYS n 
1 150 VAL n 
1 151 LEU n 
1 152 LEU n 
1 153 ARG n 
1 154 ARG n 
1 155 GLU n 
1 156 PHE n 
1 157 ILE n 
1 158 PRO n 
1 159 ASP n 
1 160 PRO n 
1 161 GLN n 
1 162 GLY n 
1 163 SER n 
1 164 ASN n 
1 165 MET n 
1 166 MET n 
1 167 PHE n 
1 168 ALA n 
1 169 PHE n 
1 170 PHE n 
1 171 ALA n 
1 172 GLN n 
1 173 HIS n 
1 174 PHE n 
1 175 THR n 
1 176 HIS n 
1 177 GLN n 
1 178 PHE n 
1 179 PHE n 
1 180 LYS n 
1 181 THR n 
1 182 ASP n 
1 183 HIS n 
1 184 LYS n 
1 185 ARG n 
1 186 GLY n 
1 187 PRO n 
1 188 GLY n 
1 189 PHE n 
1 190 THR n 
1 191 ARG n 
1 192 GLY n 
1 193 LEU n 
1 194 GLY n 
1 195 HIS n 
1 196 GLY n 
1 197 VAL n 
1 198 ASP n 
1 199 LEU n 
1 200 ASN n 
1 201 HIS n 
1 202 ILE n 
1 203 TYR n 
1 204 GLY n 
1 205 GLU n 
1 206 THR n 
1 207 LEU n 
1 208 ASP n 
1 209 ARG n 
1 210 GLN n 
1 211 HIS n 
1 212 LYS n 
1 213 LEU n 
1 214 ARG n 
1 215 LEU n 
1 216 PHE n 
1 217 LYS n 
1 218 ASP n 
1 219 GLY n 
1 220 LYS n 
1 221 LEU n 
1 222 LYS n 
1 223 TYR n 
1 224 GLN n 
1 225 VAL n 
1 226 ILE n 
1 227 GLY n 
1 228 GLY n 
1 229 GLU n 
1 230 VAL n 
1 231 TYR n 
1 232 PRO n 
1 233 PRO n 
1 234 THR n 
1 235 VAL n 
1 236 LYS n 
1 237 ASP n 
1 238 THR n 
1 239 GLN n 
1 240 VAL n 
1 241 GLU n 
1 242 MET n 
1 243 ILE n 
1 244 TYR n 
1 245 PRO n 
1 246 PRO n 
1 247 HIS n 
1 248 ILE n 
1 249 PRO n 
1 250 GLU n 
1 251 ASN n 
1 252 LEU n 
1 253 GLN n 
1 254 PHE n 
1 255 ALA n 
1 256 VAL n 
1 257 GLY n 
1 258 GLN n 
1 259 GLU n 
1 260 VAL n 
1 261 PHE n 
1 262 GLY n 
1 263 LEU n 
1 264 VAL n 
1 265 PRO n 
1 266 GLY n 
1 267 LEU n 
1 268 MET n 
1 269 MET n 
1 270 TYR n 
1 271 ALA n 
1 272 THR n 
1 273 ILE n 
1 274 TRP n 
1 275 LEU n 
1 276 ARG n 
1 277 GLU n 
1 278 HIS n 
1 279 GLN n 
1 280 ARG n 
1 281 VAL n 
1 282 CYS n 
1 283 ASP n 
1 284 ILE n 
1 285 LEU n 
1 286 LYS n 
1 287 GLN n 
1 288 GLU n 
1 289 HIS n 
1 290 PRO n 
1 291 GLU n 
1 292 TRP n 
1 293 GLY n 
1 294 ASP n 
1 295 GLU n 
1 296 GLN n 
1 297 LEU n 
1 298 PHE n 
1 299 GLN n 
1 300 THR n 
1 301 SER n 
1 302 LYS n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 ILE n 
1 307 GLY n 
1 308 GLU n 
1 309 THR n 
1 310 ILE n 
1 311 LYS n 
1 312 ILE n 
1 313 VAL n 
1 314 ILE n 
1 315 GLU n 
1 316 ASP n 
1 317 TYR n 
1 318 VAL n 
1 319 GLN n 
1 320 HIS n 
1 321 LEU n 
1 322 SER n 
1 323 GLY n 
1 324 TYR n 
1 325 HIS n 
1 326 PHE n 
1 327 LYS n 
1 328 LEU n 
1 329 LYS n 
1 330 PHE n 
1 331 ASP n 
1 332 PRO n 
1 333 GLU n 
1 334 LEU n 
1 335 LEU n 
1 336 PHE n 
1 337 ASN n 
1 338 GLN n 
1 339 GLN n 
1 340 PHE n 
1 341 GLN n 
1 342 TYR n 
1 343 GLN n 
1 344 ASN n 
1 345 ARG n 
1 346 ILE n 
1 347 ALA n 
1 348 SER n 
1 349 GLU n 
1 350 PHE n 
1 351 ASN n 
1 352 THR n 
1 353 LEU n 
1 354 TYR n 
1 355 HIS n 
1 356 TRP n 
1 357 HIS n 
1 358 PRO n 
1 359 LEU n 
1 360 LEU n 
1 361 PRO n 
1 362 ASP n 
1 363 THR n 
1 364 PHE n 
1 365 ASN n 
1 366 ILE n 
1 367 GLU n 
1 368 ASP n 
1 369 GLN n 
1 370 GLU n 
1 371 TYR n 
1 372 SER n 
1 373 PHE n 
1 374 LYS n 
1 375 GLN n 
1 376 PHE n 
1 377 LEU n 
1 378 TYR n 
1 379 ASN n 
1 380 ASN n 
1 381 SER n 
1 382 ILE n 
1 383 LEU n 
1 384 LEU n 
1 385 GLU n 
1 386 HIS n 
1 387 GLY n 
1 388 LEU n 
1 389 THR n 
1 390 GLN n 
1 391 PHE n 
1 392 VAL n 
1 393 GLU n 
1 394 SER n 
1 395 PHE n 
1 396 THR n 
1 397 ARG n 
1 398 GLN n 
1 399 ILE n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 VAL n 
1 404 ALA n 
1 405 GLY n 
1 406 GLY n 
1 407 ARG n 
1 408 ASN n 
1 409 VAL n 
1 410 PRO n 
1 411 ILE n 
1 412 ALA n 
1 413 VAL n 
1 414 GLN n 
1 415 ALA n 
1 416 VAL n 
1 417 ALA n 
1 418 LYS n 
1 419 ALA n 
1 420 SER n 
1 421 ILE n 
1 422 ASP n 
1 423 GLN n 
1 424 SER n 
1 425 ARG n 
1 426 GLU n 
1 427 MET n 
1 428 LYS n 
1 429 TYR n 
1 430 GLN n 
1 431 SER n 
1 432 LEU n 
1 433 ASN n 
1 434 GLU n 
1 435 TYR n 
1 436 ARG n 
1 437 LYS n 
1 438 ARG n 
1 439 PHE n 
1 440 SER n 
1 441 LEU n 
1 442 LYS n 
1 443 PRO n 
1 444 TYR n 
1 445 THR n 
1 446 SER n 
1 447 PHE n 
1 448 GLU n 
1 449 GLU n 
1 450 LEU n 
1 451 THR n 
1 452 GLY n 
1 453 GLU n 
1 454 LYS n 
1 455 GLU n 
1 456 MET n 
1 457 ALA n 
1 458 ALA n 
1 459 GLU n 
1 460 LEU n 
1 461 LYS n 
1 462 ALA n 
1 463 LEU n 
1 464 TYR n 
1 465 SER n 
1 466 ASP n 
1 467 ILE n 
1 468 ASP n 
1 469 VAL n 
1 470 MET n 
1 471 GLU n 
1 472 LEU n 
1 473 TYR n 
1 474 PRO n 
1 475 ALA n 
1 476 LEU n 
1 477 LEU n 
1 478 VAL n 
1 479 GLU n 
1 480 LYS n 
1 481 PRO n 
1 482 ARG n 
1 483 PRO n 
1 484 ASP n 
1 485 ALA n 
1 486 ILE n 
1 487 PHE n 
1 488 GLY n 
1 489 GLU n 
1 490 THR n 
1 491 MET n 
1 492 VAL n 
1 493 GLU n 
1 494 LEU n 
1 495 GLY n 
1 496 ALA n 
1 497 PRO n 
1 498 PHE n 
1 499 SER n 
1 500 LEU n 
1 501 LYS n 
1 502 GLY n 
1 503 LEU n 
1 504 MET n 
1 505 GLY n 
1 506 ASN n 
1 507 PRO n 
1 508 ILE n 
1 509 CYS n 
1 510 SER n 
1 511 PRO n 
1 512 GLN n 
1 513 TYR n 
1 514 TRP n 
1 515 LYS n 
1 516 PRO n 
1 517 SER n 
1 518 THR n 
1 519 PHE n 
1 520 GLY n 
1 521 GLY n 
1 522 GLU n 
1 523 VAL n 
1 524 GLY n 
1 525 PHE n 
1 526 LYS n 
1 527 ILE n 
1 528 ILE n 
1 529 ASN n 
1 530 THR n 
1 531 ALA n 
1 532 SER n 
1 533 ILE n 
1 534 GLN n 
1 535 SER n 
1 536 LEU n 
1 537 ILE n 
1 538 CYS n 
1 539 ASN n 
1 540 ASN n 
1 541 VAL n 
1 542 LYS n 
1 543 GLY n 
1 544 CYS n 
1 545 PRO n 
1 546 PHE n 
1 547 THR n 
1 548 SER n 
1 549 PHE n 
1 550 ASN n 
1 551 VAL n 
1 552 GLN n 
1 553 ASP n 
1 554 PRO n 
1 555 GLN n 
1 556 PRO n 
1 557 THR n 
1 558 LYS n 
1 559 THR n 
1 560 ALA n 
1 561 THR n 
1 562 ILE n 
1 563 ASN n 
1 564 ALA n 
1 565 SER n 
1 566 ALA n 
1 567 SER n 
1 568 HIS n 
1 569 SER n 
1 570 ARG n 
1 571 LEU n 
1 572 ASP n 
1 573 ASP n 
1 574 ILE n 
1 575 ASN n 
1 576 PRO n 
1 577 THR n 
1 578 VAL n 
1 579 LEU n 
1 580 ILE n 
1 581 LYS n 
1 582 ARG n 
1 583 ARG n 
1 584 SER n 
1 585 THR n 
1 586 GLU n 
1 587 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    DERMAL 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            'CULTURED SF21' 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 FIBROBLAST 
_entity_src_gen.pdbx_gene_src_cellular_location    'ENDOPLASMIC RETICULUM' 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'FALL ARMYWORM, SPODOPTERA FRUGIPERDA INSECT CELLS' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               'OVARIAN TISSUE' 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'CULTURED SF21' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               PVL1393 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PGH2_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q05769 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTH
FKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDS
KEVLEKVLLRREFIPDPQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRL
ILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSIL
LEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKG
CPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRRSTEL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1CX2 A 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
2 1 1CX2 B 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
3 1 1CX2 C 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
4 1 1CX2 D 1 ? 587 ? Q05769 18 ? 604 ? 33 618 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1CX2 GLN A 279 ? UNP Q05769 ASN 296 conflict 310 1 
1 1CX2 LYS A 302 ? UNP Q05769 ARG 319 conflict 333 2 
2 1CX2 GLN B 279 ? UNP Q05769 ASN 296 conflict 310 3 
2 1CX2 LYS B 302 ? UNP Q05769 ARG 319 conflict 333 4 
3 1CX2 GLN C 279 ? UNP Q05769 ASN 296 conflict 310 5 
3 1CX2 LYS C 302 ? UNP Q05769 ARG 319 conflict 333 6 
4 1CX2 GLN D 279 ? UNP Q05769 ASN 296 conflict 310 7 
4 1CX2 LYS D 302 ? UNP Q05769 ARG 319 conflict 333 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                         ?    'C3 H7 N O2'            
89.093  
ARG 'L-peptide linking'          y ARGININE                                                        ?    'C6 H15 N4 O2 1'        
175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                      ?    'C4 H8 N2 O3'           
132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                 ?    'C4 H7 N O4'            
133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                        ?    'C3 H7 N O2 S'          
121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                       ?    'C5 H10 N2 O3'          
146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                 ?    'C5 H9 N O4'            
147.129 
GLY 'peptide linking'            y GLYCINE                                                         ?    'C2 H5 N O2'            
75.067  
HEM non-polymer                  . 'PROTOPORPHYRIN IX CONTAINING FE'                               HEME 'C34 H32 Fe N4 O4'      
616.487 
HIS 'L-peptide linking'          y HISTIDINE                                                       ?    'C6 H10 N3 O2 1'        
156.162 
ILE 'L-peptide linking'          y ISOLEUCINE                                                      ?    'C6 H13 N O2'           
131.173 
LEU 'L-peptide linking'          y LEUCINE                                                         ?    'C6 H13 N O2'           
131.173 
LYS 'L-peptide linking'          y LYSINE                                                          ?    'C6 H15 N2 O2 1'        
147.195 
MET 'L-peptide linking'          y METHIONINE                                                      ?    'C5 H11 N O2 S'         
149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                        ?    'C8 H15 N O6'           
221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                                                   ?    'C9 H11 N O2'           
165.189 
PRO 'L-peptide linking'          y PROLINE                                                         ?    'C5 H9 N O2'            
115.130 
S58 non-polymer                  . 1-PHENYLSULFONAMIDE-3-TRIFLUOROMETHYL-5-PARABROMOPHENYLPYRAZOLE ?    'C16 H11 Br F3 N3 O2 S' 
446.242 
SER 'L-peptide linking'          y SERINE                                                          ?    'C3 H7 N O3'            
105.093 
THR 'L-peptide linking'          y THREONINE                                                       ?    'C4 H9 N O3'            
119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                      ?    'C11 H12 N2 O2'         
204.225 
TYR 'L-peptide linking'          y TYROSINE                                                        ?    'C9 H11 N O3'           
181.189 
VAL 'L-peptide linking'          y VALINE                                                          ?    'C5 H11 N O2'           
117.146 
# 
_exptl.entry_id          1CX2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.54 
_exptl_crystal.density_percent_sol   52. 
_exptl_crystal.description           'THE PGHS-1 DIMER WAS USED AS THE SEARCH MODEL.' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;20 MM SODIUM PHOSPHATE, 100 MM NACL, 0.6% BETA- OCTYLGLUCOSIDE, 10 MG/ML PROTEIN, 1MM INHIBITOR MIXED WITH A RESERVOIR SOLUTION CONTAINING 20-34% MONOMETHYL PEG 550, 10-240 MGCL2, 50 MM EPPS PH 8.0 IN THE RATIO OF 1:1
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           113 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 300 mm plate' 
_diffrn_detector.pdbx_collection_date   1995-07-15 
_diffrn_detector.details                'SUPPER MIRRORS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1CX2 
_reflns.observed_criterion_sigma_I   -0.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.0 
_reflns.d_resolution_high            3.0 
_reflns.number_obs                   36954 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         62.4 
_reflns.pdbx_Rmerge_I_obs            0.123 
_reflns.pdbx_Rsym_value              0.123 
_reflns.pdbx_netI_over_sigmaI        5.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.34 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.0 
_reflns_shell.d_res_low              3.11 
_reflns_shell.percent_possible_all   36.1 
_reflns_shell.Rmerge_I_obs           0.307 
_reflns_shell.pdbx_Rsym_value        0.307 
_reflns_shell.meanI_over_sigI_obs    1.54 
_reflns_shell.pdbx_redundancy        1.5 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1CX2 
_refine.ls_number_reflns_obs                     30300 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               100000. 
_refine.pdbx_data_cutoff_low_absF                0.1 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            3.0 
_refine.ls_percent_reflns_obs                    54.0 
_refine.ls_R_factor_obs                          0.216 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.218 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10. 
_refine.ls_number_reflns_R_free                  2987 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               7.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PROSTAGLANDIN SYNTHASE-1, PDB ENTRY 1PRH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17892 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         444 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               18336 
_refine_hist.d_res_high                       3.0 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.015 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.94  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.78  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.5   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_number 
1 RESTRAINED 300 ? 1.0 ? . . 1 'X-RAY DIFFRACTION' 1 ? 
2 ?          300 ? 1.0 ? . . 2 'X-RAY DIFFRACTION' 2 ? 
3 ?          300 ? 1.0 ? . . 3 'X-RAY DIFFRACTION' 3 ? 
4 ?          300 ? 1.0 ? . . 4 'X-RAY DIFFRACTION' 4 ? 
5 ?          300 ? 1.0 ? . . 5 'X-RAY DIFFRACTION' 5 ? 
6 ?          200 ? 2.0 ? . . 6 'X-RAY DIFFRACTION' 6 ? 
7 ?          50  ? 5.0 ? . . 7 'X-RAY DIFFRACTION' 7 ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.13 
_refine_ls_shell.number_reflns_R_work             1580 
_refine_ls_shell.R_factor_R_work                  0.249 
_refine_ls_shell.percent_reflns_obs               25.1 
_refine_ls_shell.R_factor_R_free                  0.374 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            2.3 
_refine_ls_shell.number_reflns_R_free             161 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARAM_ENGH.PRO    TOP_ENGH.PRO     'X-RAY DIFFRACTION' 
2 PARAM19X_MOD.HEME TOPH19X_MOD.HEME 'X-RAY DIFFRACTION' 
3 PARAM3_MOD.CHO    TOPH3.CHO        'X-RAY DIFFRACTION' 
4 PARAM.SC558       TOP.SC558        'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? -0.999900 -0.008700 0.009200 -0.009100 -0.010800 -0.999900 0.008800  -0.999900 0.010800  96.19230  32.00130 30.71820 
2 given ? -0.999200 -0.035700 0.019200 0.036400  -0.998700 0.036900  0.017900  0.037600  0.999100  85.45550  65.16640 58.45680 
3 given ? 0.999700  -0.011100 0.023900 -0.024100 -0.019000 0.999500  -0.010700 -0.999800 -0.019300 -11.21310 37.57270 92.31160 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.details 
1 1 ? 
2 2 ? 
3 3 ? 
4 4 ? 
5 5 ? 
6 6 ? 
7 7 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
4 ? 
5 ? 
6 ? 
7 ? 
# 
_struct.entry_id                  1CX2 
_struct.title                     'CYCLOOXYGENASE-2 (PROSTAGLANDIN SYNTHASE-2) COMPLEXED WITH A SELECTIVE INHIBITOR, SC-558' 
_struct.pdbx_descriptor           
'CYCLOOXYGENASE-2, PROTOPORPHYRIN IX CONTAINING FE, 1-PHENYLSULFONAMIDE-3-TRIFLUOROMETHYL-5-PARABROMOPHENYLPYRAZOLE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CX2 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
;PEROXIDASE, DIOXYGENASE, CYCLOOXYGENASE, NONSTEROIDAL ANTIINFLAMMATORY DRUGS, INFLAMMATION, ARTHRITIS, PROSTAGLANDIN, PROSTAGLANDIN SYNTHASE, OXIDOREDUCTASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 4 ? 
O N N 2 ? 
P N N 2 ? 
Q N N 2 ? 
R N N 3 ? 
S N N 4 ? 
T N N 2 ? 
U N N 2 ? 
V N N 2 ? 
W N N 3 ? 
X N N 4 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   PHE A 42  ? LEU A 50  ? PHE A 74  LEU A 82  1 ? 9  
HELX_P HELX_P2   2   PRO A 54  ? THR A 62  ? PRO A 86  THR A 94  1 ? 9  
HELX_P HELX_P3   3   LYS A 65  ? ASN A 73  ? LYS A 97  ASN A 105 1 ? 9  
HELX_P HELX_P4   4   PRO A 75  ? LEU A 92  ? PRO A 106 LEU A 123 1 ? 18 
HELX_P HELX_P5   5   TRP A 108 ? SER A 112 ? TRP A 139 SER A 143 1 ? 5  
HELX_P HELX_P6   6   LYS A 144 ? LEU A 147 ? LYS A 175 LEU A 178 1 ? 4  
HELX_P HELX_P7   7   MET A 165 ? PHE A 178 ? MET A 196 PHE A 209 1 ? 14 
HELX_P HELX_P8   8   ASN A 200 ? TYR A 203 ? ASN A 231 TYR A 234 1 ? 4  
HELX_P HELX_P9   9   ASP A 208 ? LEU A 213 ? ASP A 239 LEU A 244 1 ? 6  
HELX_P HELX_P10  10  PRO A 265 ? GLN A 287 ? PRO A 296 GLN A 318 1 ? 23 
HELX_P HELX_P11  11  ASP A 294 ? GLU A 315 ? ASP A 325 GLU A 346 1 ? 22 
HELX_P HELX_P12  12  TYR A 317 ? SER A 322 ? TYR A 348 SER A 353 1 ? 6  
HELX_P HELX_P13  13  PRO A 332 ? LEU A 334 ? PRO A 363 LEU A 365 5 ? 3  
HELX_P HELX_P14  14  SER A 348 ? TYR A 354 ? SER A 379 TYR A 385 1 ? 7  
HELX_P HELX_P15  15  HIS A 357 ? LEU A 359 ? HIS A 388 LEU A 390 5 ? 3  
HELX_P HELX_P16  16  PHE A 373 ? PHE A 376 ? PHE A 404 PHE A 407 1 ? 4  
HELX_P HELX_P17  17  ASN A 380 ? HIS A 386 ? ASN A 411 HIS A 417 1 ? 7  
HELX_P HELX_P18  18  THR A 389 ? THR A 396 ? THR A 420 THR A 427 1 ? 8  
HELX_P HELX_P19  19  GLN A 414 ? GLU A 426 ? GLN A 445 GLU A 457 1 ? 13 
HELX_P HELX_P20  20  LEU A 432 ? ARG A 438 ? LEU A 463 ARG A 469 1 ? 7  
HELX_P HELX_P21  21  PHE A 447 ? THR A 451 ? PHE A 478 THR A 482 1 ? 5  
HELX_P HELX_P22  22  GLU A 455 ? TYR A 464 ? GLU A 486 TYR A 495 1 ? 10 
HELX_P HELX_P23  23  ILE A 467 ? VAL A 469 ? ILE A 498 VAL A 500 5 ? 3  
HELX_P HELX_P24  24  LEU A 472 ? LEU A 477 ? LEU A 503 LEU A 508 1 ? 6  
HELX_P HELX_P25  25  GLU A 489 ? LYS A 501 ? GLU A 520 LYS A 532 1 ? 13 
HELX_P HELX_P26  26  PRO A 507 ? CYS A 509 ? PRO A 538 CYS A 540 5 ? 3  
HELX_P HELX_P27  27  GLU A 522 ? THR A 530 ? GLU A 553 THR A 561 1 ? 9  
HELX_P HELX_P28  28  ILE A 533 ? ASN A 540 ? ILE A 564 ASN A 571 1 ? 8  
HELX_P HELX_P29  29  PHE B 42  ? LEU B 50  ? PHE B 74  LEU B 82  1 ? 9  
HELX_P HELX_P30  30  PRO B 54  ? THR B 62  ? PRO B 86  THR B 94  1 ? 9  
HELX_P HELX_P31  31  LYS B 65  ? ASN B 73  ? LYS B 97  ASN B 105 1 ? 9  
HELX_P HELX_P32  32  PRO B 75  ? SER B 90  ? PRO B 106 SER B 121 1 ? 16 
HELX_P HELX_P33  33  TRP B 108 ? SER B 112 ? TRP B 139 SER B 143 1 ? 5  
HELX_P HELX_P34  34  LYS B 144 ? LEU B 147 ? LYS B 175 LEU B 178 1 ? 4  
HELX_P HELX_P35  35  MET B 165 ? PHE B 178 ? MET B 196 PHE B 209 1 ? 14 
HELX_P HELX_P36  36  ASN B 200 ? TYR B 203 ? ASN B 231 TYR B 234 1 ? 4  
HELX_P HELX_P37  37  ASP B 208 ? LEU B 213 ? ASP B 239 LEU B 244 1 ? 6  
HELX_P HELX_P38  38  PRO B 265 ? GLN B 287 ? PRO B 296 GLN B 318 1 ? 23 
HELX_P HELX_P39  39  ASP B 294 ? GLU B 315 ? ASP B 325 GLU B 346 1 ? 22 
HELX_P HELX_P40  40  TYR B 317 ? SER B 322 ? TYR B 348 SER B 353 1 ? 6  
HELX_P HELX_P41  41  PRO B 332 ? LEU B 334 ? PRO B 363 LEU B 365 5 ? 3  
HELX_P HELX_P42  42  SER B 348 ? TYR B 354 ? SER B 379 TYR B 385 1 ? 7  
HELX_P HELX_P43  43  HIS B 357 ? LEU B 359 ? HIS B 388 LEU B 390 5 ? 3  
HELX_P HELX_P44  44  PHE B 373 ? PHE B 376 ? PHE B 404 PHE B 407 1 ? 4  
HELX_P HELX_P45  45  SER B 381 ? HIS B 386 ? SER B 412 HIS B 417 1 ? 6  
HELX_P HELX_P46  46  THR B 389 ? THR B 396 ? THR B 420 THR B 427 1 ? 8  
HELX_P HELX_P47  47  GLN B 414 ? GLU B 426 ? GLN B 445 GLU B 457 1 ? 13 
HELX_P HELX_P48  48  LEU B 432 ? ARG B 438 ? LEU B 463 ARG B 469 1 ? 7  
HELX_P HELX_P49  49  PHE B 447 ? THR B 451 ? PHE B 478 THR B 482 1 ? 5  
HELX_P HELX_P50  50  GLU B 455 ? TYR B 464 ? GLU B 486 TYR B 495 1 ? 10 
HELX_P HELX_P51  51  ILE B 467 ? VAL B 469 ? ILE B 498 VAL B 500 5 ? 3  
HELX_P HELX_P52  52  LEU B 472 ? LEU B 477 ? LEU B 503 LEU B 508 1 ? 6  
HELX_P HELX_P53  53  GLU B 489 ? LYS B 501 ? GLU B 520 LYS B 532 1 ? 13 
HELX_P HELX_P54  54  PRO B 507 ? CYS B 509 ? PRO B 538 CYS B 540 5 ? 3  
HELX_P HELX_P55  55  GLU B 522 ? THR B 530 ? GLU B 553 THR B 561 1 ? 9  
HELX_P HELX_P56  56  ILE B 533 ? ASN B 540 ? ILE B 564 ASN B 571 1 ? 8  
HELX_P HELX_P57  57  PHE C 42  ? LEU C 50  ? PHE C 74  LEU C 82  1 ? 9  
HELX_P HELX_P58  58  PRO C 54  ? THR C 62  ? PRO C 86  THR C 94  1 ? 9  
HELX_P HELX_P59  59  LYS C 65  ? ASN C 73  ? LYS C 97  ASN C 105 1 ? 9  
HELX_P HELX_P60  60  PRO C 75  ? LEU C 92  ? PRO C 106 LEU C 123 1 ? 18 
HELX_P HELX_P61  61  TRP C 108 ? SER C 112 ? TRP C 139 SER C 143 1 ? 5  
HELX_P HELX_P62  62  LYS C 144 ? VAL C 150 ? LYS C 175 VAL C 181 1 ? 7  
HELX_P HELX_P63  63  MET C 165 ? PHE C 178 ? MET C 196 PHE C 209 1 ? 14 
HELX_P HELX_P64  64  ASN C 200 ? TYR C 203 ? ASN C 231 TYR C 234 1 ? 4  
HELX_P HELX_P65  65  ASP C 208 ? LEU C 213 ? ASP C 239 LEU C 244 1 ? 6  
HELX_P HELX_P66  66  PRO C 265 ? GLN C 287 ? PRO C 296 GLN C 318 1 ? 23 
HELX_P HELX_P67  67  ASP C 294 ? GLU C 315 ? ASP C 325 GLU C 346 1 ? 22 
HELX_P HELX_P68  68  TYR C 317 ? SER C 322 ? TYR C 348 SER C 353 1 ? 6  
HELX_P HELX_P69  69  PRO C 332 ? LEU C 334 ? PRO C 363 LEU C 365 5 ? 3  
HELX_P HELX_P70  70  SER C 348 ? TYR C 354 ? SER C 379 TYR C 385 1 ? 7  
HELX_P HELX_P71  71  HIS C 357 ? LEU C 359 ? HIS C 388 LEU C 390 5 ? 3  
HELX_P HELX_P72  72  PHE C 373 ? PHE C 376 ? PHE C 404 PHE C 407 1 ? 4  
HELX_P HELX_P73  73  SER C 381 ? HIS C 386 ? SER C 412 HIS C 417 1 ? 6  
HELX_P HELX_P74  74  THR C 389 ? THR C 396 ? THR C 420 THR C 427 1 ? 8  
HELX_P HELX_P75  75  GLN C 414 ? GLU C 426 ? GLN C 445 GLU C 457 1 ? 13 
HELX_P HELX_P76  76  LEU C 432 ? ARG C 438 ? LEU C 463 ARG C 469 1 ? 7  
HELX_P HELX_P77  77  PHE C 447 ? THR C 451 ? PHE C 478 THR C 482 1 ? 5  
HELX_P HELX_P78  78  GLU C 455 ? TYR C 464 ? GLU C 486 TYR C 495 1 ? 10 
HELX_P HELX_P79  79  ILE C 467 ? VAL C 469 ? ILE C 498 VAL C 500 5 ? 3  
HELX_P HELX_P80  80  LEU C 472 ? LEU C 477 ? LEU C 503 LEU C 508 1 ? 6  
HELX_P HELX_P81  81  GLU C 489 ? LYS C 501 ? GLU C 520 LYS C 532 1 ? 13 
HELX_P HELX_P82  82  PRO C 507 ? CYS C 509 ? PRO C 538 CYS C 540 5 ? 3  
HELX_P HELX_P83  83  GLU C 522 ? THR C 530 ? GLU C 553 THR C 561 1 ? 9  
HELX_P HELX_P84  84  ILE C 533 ? ASN C 540 ? ILE C 564 ASN C 571 1 ? 8  
HELX_P HELX_P85  85  PHE D 42  ? LEU D 50  ? PHE D 74  LEU D 82  1 ? 9  
HELX_P HELX_P86  86  PRO D 54  ? THR D 62  ? PRO D 86  THR D 94  1 ? 9  
HELX_P HELX_P87  87  LYS D 65  ? ASN D 73  ? LYS D 97  ASN D 105 1 ? 9  
HELX_P HELX_P88  88  PRO D 75  ? LEU D 92  ? PRO D 106 LEU D 123 1 ? 18 
HELX_P HELX_P89  89  TRP D 108 ? SER D 112 ? TRP D 139 SER D 143 1 ? 5  
HELX_P HELX_P90  90  LYS D 144 ? VAL D 150 ? LYS D 175 VAL D 181 1 ? 7  
HELX_P HELX_P91  91  MET D 165 ? PHE D 178 ? MET D 196 PHE D 209 1 ? 14 
HELX_P HELX_P92  92  ASN D 200 ? TYR D 203 ? ASN D 231 TYR D 234 1 ? 4  
HELX_P HELX_P93  93  ASP D 208 ? LEU D 213 ? ASP D 239 LEU D 244 1 ? 6  
HELX_P HELX_P94  94  PHE D 261 ? LEU D 263 ? PHE D 292 LEU D 294 5 ? 3  
HELX_P HELX_P95  95  PRO D 265 ? GLN D 287 ? PRO D 296 GLN D 318 1 ? 23 
HELX_P HELX_P96  96  ASP D 294 ? GLU D 315 ? ASP D 325 GLU D 346 1 ? 22 
HELX_P HELX_P97  97  TYR D 317 ? SER D 322 ? TYR D 348 SER D 353 1 ? 6  
HELX_P HELX_P98  98  PRO D 332 ? LEU D 334 ? PRO D 363 LEU D 365 5 ? 3  
HELX_P HELX_P99  99  SER D 348 ? TYR D 354 ? SER D 379 TYR D 385 1 ? 7  
HELX_P HELX_P100 100 HIS D 357 ? LEU D 359 ? HIS D 388 LEU D 390 5 ? 3  
HELX_P HELX_P101 101 PHE D 373 ? PHE D 376 ? PHE D 404 PHE D 407 1 ? 4  
HELX_P HELX_P102 102 ASN D 380 ? HIS D 386 ? ASN D 411 HIS D 417 1 ? 7  
HELX_P HELX_P103 103 THR D 389 ? THR D 396 ? THR D 420 THR D 427 1 ? 8  
HELX_P HELX_P104 104 GLN D 414 ? GLU D 426 ? GLN D 445 GLU D 457 1 ? 13 
HELX_P HELX_P105 105 LEU D 432 ? ARG D 438 ? LEU D 463 ARG D 469 1 ? 7  
HELX_P HELX_P106 106 PHE D 447 ? THR D 451 ? PHE D 478 THR D 482 1 ? 5  
HELX_P HELX_P107 107 GLU D 455 ? TYR D 464 ? GLU D 486 TYR D 495 1 ? 10 
HELX_P HELX_P108 108 ILE D 467 ? VAL D 469 ? ILE D 498 VAL D 500 5 ? 3  
HELX_P HELX_P109 109 LEU D 472 ? LEU D 477 ? LEU D 503 LEU D 508 1 ? 6  
HELX_P HELX_P110 110 GLU D 489 ? LYS D 501 ? GLU D 520 LYS D 532 1 ? 13 
HELX_P HELX_P111 111 PRO D 507 ? CYS D 509 ? PRO D 538 CYS D 540 5 ? 3  
HELX_P HELX_P112 112 GLU D 522 ? THR D 530 ? GLU D 553 THR D 561 1 ? 9  
HELX_P HELX_P113 113 ILE D 533 ? ASN D 540 ? ILE D 564 ASN D 571 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A CYS 4   SG  ? ? ? 1_555 A CYS 15  SG ? ? A CYS 36  A CYS 47  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf2  disulf ?   ? A CYS 5   SG  ? ? ? 1_555 A CYS 128 SG ? ? A CYS 37  A CYS 159 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf3  disulf ?   ? A CYS 9   SG  ? ? ? 1_555 A CYS 25  SG ? ? A CYS 41  A CYS 57  1_555 ? ? ? ? ? ? ? 2.010 ? ?               
disulf4  disulf ?   ? A CYS 27  SG  ? ? ? 1_555 A CYS 37  SG ? ? A CYS 59  A CYS 69  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf5  disulf ?   ? A CYS 538 SG  ? ? ? 1_555 A CYS 544 SG ? ? A CYS 569 A CYS 575 1_555 ? ? ? ? ? ? ? 2.010 ? ?               
disulf6  disulf ?   ? B CYS 4   SG  ? ? ? 1_555 B CYS 15  SG ? ? B CYS 36  B CYS 47  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf7  disulf ?   ? B CYS 5   SG  ? ? ? 1_555 B CYS 128 SG ? ? B CYS 37  B CYS 159 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf8  disulf ?   ? B CYS 9   SG  ? ? ? 1_555 B CYS 25  SG ? ? B CYS 41  B CYS 57  1_555 ? ? ? ? ? ? ? 2.012 ? ?               
disulf9  disulf ?   ? B CYS 27  SG  ? ? ? 1_555 B CYS 37  SG ? ? B CYS 59  B CYS 69  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf10 disulf ?   ? B CYS 538 SG  ? ? ? 1_555 B CYS 544 SG ? ? B CYS 569 B CYS 575 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf11 disulf ?   ? C CYS 4   SG  ? ? ? 1_555 C CYS 15  SG ? ? C CYS 36  C CYS 47  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf12 disulf ?   ? C CYS 5   SG  ? ? ? 1_555 C CYS 128 SG ? ? C CYS 37  C CYS 159 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf13 disulf ?   ? C CYS 9   SG  ? ? ? 1_555 C CYS 25  SG ? ? C CYS 41  C CYS 57  1_555 ? ? ? ? ? ? ? 2.015 ? ?               
disulf14 disulf ?   ? C CYS 27  SG  ? ? ? 1_555 C CYS 37  SG ? ? C CYS 59  C CYS 69  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf15 disulf ?   ? C CYS 538 SG  ? ? ? 1_555 C CYS 544 SG ? ? C CYS 569 C CYS 575 1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf16 disulf ?   ? D CYS 4   SG  ? ? ? 1_555 D CYS 15  SG ? ? D CYS 36  D CYS 47  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf17 disulf ?   ? D CYS 5   SG  ? ? ? 1_555 D CYS 128 SG ? ? D CYS 37  D CYS 159 1_555 ? ? ? ? ? ? ? 2.025 ? ?               
disulf18 disulf ?   ? D CYS 9   SG  ? ? ? 1_555 D CYS 25  SG ? ? D CYS 41  D CYS 57  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf19 disulf ?   ? D CYS 27  SG  ? ? ? 1_555 D CYS 37  SG ? ? D CYS 59  D CYS 69  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf20 disulf ?   ? D CYS 538 SG  ? ? ? 1_555 D CYS 544 SG ? ? D CYS 569 D CYS 575 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
covale1  covale one ? A ASN 36  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 68  A NAG 661 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation 
covale2  covale one ? A ASN 113 ND2 ? ? ? 1_555 F NAG .   C1 ? ? A ASN 144 A NAG 671 1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale3  covale one ? A ASN 379 ND2 ? ? ? 1_555 G NAG .   C1 ? ? A ASN 410 A NAG 681 1_555 ? ? ? ? ? ? ? 1.463 ? N-Glycosylation 
covale4  covale one ? B ASN 36  ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 68  B NAG 661 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale5  covale one ? B ASN 113 ND2 ? ? ? 1_555 K NAG .   C1 ? ? B ASN 144 B NAG 671 1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale6  covale one ? B ASN 379 ND2 ? ? ? 1_555 L NAG .   C1 ? ? B ASN 410 B NAG 681 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale7  covale one ? C ASN 36  ND2 ? ? ? 1_555 O NAG .   C1 ? ? C ASN 68  C NAG 661 1_555 ? ? ? ? ? ? ? 1.470 ? N-Glycosylation 
covale8  covale one ? C ASN 113 ND2 ? ? ? 1_555 P NAG .   C1 ? ? C ASN 144 C NAG 671 1_555 ? ? ? ? ? ? ? 1.477 ? N-Glycosylation 
covale9  covale one ? C ASN 379 ND2 ? ? ? 1_555 Q NAG .   C1 ? ? C ASN 410 C NAG 681 1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale10 covale one ? D ASN 36  ND2 ? ? ? 1_555 T NAG .   C1 ? ? D ASN 68  D NAG 661 1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale11 covale one ? D ASN 113 ND2 ? ? ? 1_555 U NAG .   C1 ? ? D ASN 144 D NAG 671 1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale12 covale one ? D ASN 379 ND2 ? ? ? 1_555 V NAG .   C1 ? ? D ASN 410 D NAG 681 1_555 ? ? ? ? ? ? ? 1.465 ? N-Glycosylation 
metalc1  metalc ?   ? A HIS 357 NE2 ? ? ? 1_555 H HEM .   FE ? ? A HIS 388 A HEM 682 1_555 ? ? ? ? ? ? ? 2.233 ? ?               
metalc2  metalc ?   ? B HIS 357 NE2 ? ? ? 1_555 M HEM .   FE ? ? B HIS 388 B HEM 682 1_555 ? ? ? ? ? ? ? 2.191 ? ?               
metalc3  metalc ?   ? C HIS 357 NE2 ? ? ? 1_555 R HEM .   FE ? ? C HIS 388 C HEM 682 1_555 ? ? ? ? ? ? ? 2.184 ? ?               
metalc4  metalc ?   ? D HIS 357 NE2 ? ? ? 1_555 W HEM .   FE ? ? D HIS 388 D HEM 682 1_555 ? ? ? ? ? ? ? 2.169 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 95 A . ? SER 126 A PRO 96 A ? PRO 127 A 1 -0.20 
2 SER 95 B . ? SER 126 B PRO 96 B ? PRO 127 B 1 0.12  
3 SER 95 C . ? SER 126 C PRO 96 C ? PRO 127 C 1 -0.03 
4 SER 95 D . ? SER 126 D PRO 96 D ? PRO 127 D 1 -0.50 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 14  ? MET A 16  ? GLU A 46  MET A 48  
A 2 LYS A 24  ? ASP A 26  ? LYS A 56  ASP A 58  
B 1 TYR A 223 ? ILE A 226 ? TYR A 254 ILE A 257 
B 2 GLU A 229 ? PRO A 232 ? GLU A 260 PRO A 263 
C 1 GLU B 14  ? MET B 16  ? GLU B 46  MET B 48  
C 2 LYS B 24  ? ASP B 26  ? LYS B 56  ASP B 58  
D 1 TYR B 223 ? ILE B 226 ? TYR B 254 ILE B 257 
D 2 GLU B 229 ? PRO B 232 ? GLU B 260 PRO B 263 
E 1 GLU C 14  ? MET C 16  ? GLU C 46  MET C 48  
E 2 LYS C 24  ? ASP C 26  ? LYS C 56  ASP C 58  
F 1 TYR C 223 ? ILE C 226 ? TYR C 254 ILE C 257 
F 2 GLU C 229 ? PRO C 232 ? GLU C 260 PRO C 263 
G 1 GLU D 14  ? MET D 16  ? GLU D 46  MET D 48  
G 2 LYS D 24  ? ASP D 26  ? LYS D 56  ASP D 58  
H 1 TYR D 223 ? ILE D 226 ? TYR D 254 ILE D 257 
H 2 GLU D 229 ? PRO D 232 ? GLU D 260 PRO D 263 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLU A 14  ? O GLU A 46  N ASP A 26  ? N ASP A 58  
B 1 2 O GLN A 224 ? O GLN A 255 N TYR A 231 ? N TYR A 262 
C 1 2 O GLU B 14  ? O GLU B 46  N ASP B 26  ? N ASP B 58  
D 1 2 O GLN B 224 ? O GLN B 255 N TYR B 231 ? N TYR B 262 
E 1 2 O GLU C 14  ? O GLU C 46  N ASP C 26  ? N ASP C 58  
F 1 2 O GLN C 224 ? O GLN C 255 N TYR C 231 ? N TYR C 262 
G 1 2 O GLU D 14  ? O GLU D 46  N ASP D 26  ? N ASP D 58  
H 1 2 O GLN D 224 ? O GLN D 255 N TYR D 231 ? N TYR D 262 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CAT Unknown ? ? ? ? 1 
;TYR 385 IS BELIEVED TO BE THE AMINO ACID THAT ABSTRACTS A HYDROGEN ATOM FROM THE SUBSTRATE. IT IS LOCATED CLOSE TO THE HEME. A TYROSINE RADICAL IS FORMED DURING THE COURSE OF THE REACTION.
;
ACE Unknown ? ? ? ? 1 
;SER 530 IS ACETYLATED BY ASPIRIN (AN ACETYL GROUP IS COVALENTLY ATTACHED TO THE PROTEIN WHEN INHIBITED WITH ASPIRIN). THE ACETYLATED SER PREVENTS THE PROPER BINDING OF THE SUBSTRATE IN THE CYCLOOXYGENASE ACTIVE SITE. IT HAS BEEN RECENTLY SHOWN, HOWEVER, THAT ACETYLATION OF CYCLOOXYGENASE-2 RESULTS IN THE FORMATION OF A DIFFERENT PRODUCT (15-HETE).
;
HEM Unknown ? ? ? ? 1 'HIS 388 IS THE AXIAL LIGAND TO THE HEME.' 
SUB Unknown ? ? ? ? 1 'ARGININE 120 IS BELIEVED TO ANCHOR THE CARBOXYLATE OF THE SUBSTRATE BY FORMING AN ION-PAIR.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 1 TYR A 354 ? TYR A 385 . ? 1_555 ? 
2 ACE 1 SER A 499 ? SER A 530 . ? 1_555 ? 
3 HEM 1 HIS A 357 ? HIS A 388 . ? 1_555 ? 
4 SUB 1 ARG A 89  ? ARG A 120 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1CX2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CX2 
_atom_sites.fract_transf_matrix[1][1]   0.005545 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007467 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008255 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
F  
FE 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . ALA A 1 1   ? 29.975  7.470   -18.728 1.00 9.61  ? 33  ALA A N    1 
ATOM   2     C  CA   . ALA A 1 1   ? 30.901  6.321   -18.947 1.00 8.42  ? 33  ALA A CA   1 
ATOM   3     C  C    . ALA A 1 1   ? 31.609  5.973   -17.643 1.00 8.11  ? 33  ALA A C    1 
ATOM   4     O  O    . ALA A 1 1   ? 31.541  4.834   -17.172 1.00 10.86 ? 33  ALA A O    1 
ATOM   5     C  CB   . ALA A 1 1   ? 31.935  6.649   -20.022 1.00 7.43  ? 33  ALA A CB   1 
ATOM   6     H  H1   . ALA A 1 1   ? 30.399  8.350   -18.387 1.00 17.00 ? 33  ALA A H1   1 
ATOM   7     H  H2   . ALA A 1 1   ? 29.474  7.704   -19.607 1.00 17.00 ? 33  ALA A H2   1 
ATOM   8     H  H3   . ALA A 1 1   ? 29.265  7.169   -18.033 1.00 17.00 ? 33  ALA A H3   1 
ATOM   9     N  N    . ASN A 1 2   ? 32.330  6.947   -17.102 1.00 5.71  ? 34  ASN A N    1 
ATOM   10    C  CA   . ASN A 1 2   ? 33.058  6.780   -15.855 1.00 5.89  ? 34  ASN A CA   1 
ATOM   11    C  C    . ASN A 1 2   ? 32.388  5.779   -14.907 1.00 4.46  ? 34  ASN A C    1 
ATOM   12    O  O    . ASN A 1 2   ? 31.319  6.049   -14.373 1.00 5.37  ? 34  ASN A O    1 
ATOM   13    C  CB   . ASN A 1 2   ? 33.253  8.149   -15.173 1.00 3.63  ? 34  ASN A CB   1 
ATOM   14    C  CG   . ASN A 1 2   ? 33.841  8.035   -13.778 1.00 2.65  ? 34  ASN A CG   1 
ATOM   15    O  OD1  . ASN A 1 2   ? 34.331  6.986   -13.367 1.00 3.58  ? 34  ASN A OD1  1 
ATOM   16    N  ND2  . ASN A 1 2   ? 33.782  9.113   -13.038 1.00 2.00  ? 34  ASN A ND2  1 
ATOM   17    H  H    . ASN A 1 2   ? 32.490  7.762   -17.591 1.00 17.00 ? 34  ASN A H    1 
ATOM   18    H  HD21 . ASN A 1 2   ? 34.118  9.109   -12.119 1.00 17.00 ? 34  ASN A HD21 1 
ATOM   19    H  HD22 . ASN A 1 2   ? 33.394  9.875   -13.476 1.00 17.00 ? 34  ASN A HD22 1 
ATOM   20    N  N    . PRO A 1 3   ? 32.990  4.591   -14.746 1.00 3.98  ? 35  PRO A N    1 
ATOM   21    C  CA   . PRO A 1 3   ? 32.554  3.472   -13.901 1.00 5.55  ? 35  PRO A CA   1 
ATOM   22    C  C    . PRO A 1 3   ? 32.331  3.837   -12.429 1.00 4.88  ? 35  PRO A C    1 
ATOM   23    O  O    . PRO A 1 3   ? 31.693  3.090   -11.691 1.00 3.73  ? 35  PRO A O    1 
ATOM   24    C  CB   . PRO A 1 3   ? 33.683  2.450   -14.081 1.00 5.62  ? 35  PRO A CB   1 
ATOM   25    C  CG   . PRO A 1 3   ? 34.833  3.268   -14.464 1.00 5.70  ? 35  PRO A CG   1 
ATOM   26    C  CD   . PRO A 1 3   ? 34.233  4.230   -15.432 1.00 4.83  ? 35  PRO A CD   1 
ATOM   27    N  N    . CYS A 1 4   ? 32.878  4.966   -11.996 1.00 4.80  ? 36  CYS A N    1 
ATOM   28    C  CA   . CYS A 1 4   ? 32.662  5.408   -10.628 1.00 5.41  ? 36  CYS A CA   1 
ATOM   29    C  C    . CYS A 1 4   ? 31.443  6.306   -10.494 1.00 4.96  ? 36  CYS A C    1 
ATOM   30    O  O    . CYS A 1 4   ? 31.154  6.785   -9.399  1.00 4.71  ? 36  CYS A O    1 
ATOM   31    C  CB   . CYS A 1 4   ? 33.889  6.115   -10.071 1.00 6.44  ? 36  CYS A CB   1 
ATOM   32    S  SG   . CYS A 1 4   ? 35.219  4.955   -9.673  1.00 5.08  ? 36  CYS A SG   1 
ATOM   33    H  H    . CYS A 1 4   ? 33.465  5.489   -12.575 1.00 17.00 ? 36  CYS A H    1 
ATOM   34    N  N    . CYS A 1 5   ? 30.741  6.530   -11.613 1.00 6.70  ? 37  CYS A N    1 
ATOM   35    C  CA   . CYS A 1 5   ? 29.521  7.347   -11.670 1.00 4.48  ? 37  CYS A CA   1 
ATOM   36    C  C    . CYS A 1 5   ? 28.561  6.902   -10.590 1.00 3.46  ? 37  CYS A C    1 
ATOM   37    O  O    . CYS A 1 5   ? 28.118  7.704   -9.775  1.00 2.05  ? 37  CYS A O    1 
ATOM   38    C  CB   . CYS A 1 5   ? 28.819  7.178   -13.010 1.00 2.00  ? 37  CYS A CB   1 
ATOM   39    S  SG   . CYS A 1 5   ? 29.398  8.305   -14.276 1.00 3.53  ? 37  CYS A SG   1 
ATOM   40    H  H    . CYS A 1 5   ? 31.049  6.127   -12.451 1.00 17.00 ? 37  CYS A H    1 
ATOM   41    N  N    . SER A 1 6   ? 28.291  5.600   -10.561 1.00 2.62  ? 38  SER A N    1 
ATOM   42    C  CA   . SER A 1 6   ? 27.359  5.034   -9.605  1.00 2.32  ? 38  SER A CA   1 
ATOM   43    C  C    . SER A 1 6   ? 27.803  5.010   -8.161  1.00 2.00  ? 38  SER A C    1 
ATOM   44    O  O    . SER A 1 6   ? 27.178  4.324   -7.369  1.00 3.98  ? 38  SER A O    1 
ATOM   45    C  CB   . SER A 1 6   ? 26.859  3.645   -10.045 1.00 2.90  ? 38  SER A CB   1 
ATOM   46    O  OG   . SER A 1 6   ? 27.894  2.804   -10.537 1.00 7.81  ? 38  SER A OG   1 
ATOM   47    H  H    . SER A 1 6   ? 28.726  4.970   -11.173 1.00 17.00 ? 38  SER A H    1 
ATOM   48    H  HG   . SER A 1 6   ? 27.522  1.958   -10.817 1.00 17.00 ? 38  SER A HG   1 
ATOM   49    N  N    . ASN A 1 7   ? 28.860  5.746   -7.811  1.00 2.00  ? 39  ASN A N    1 
ATOM   50    C  CA   . ASN A 1 7   ? 29.358  5.790   -6.426  1.00 2.70  ? 39  ASN A CA   1 
ATOM   51    C  C    . ASN A 1 7   ? 29.421  4.423   -5.710  1.00 3.19  ? 39  ASN A C    1 
ATOM   52    O  O    . ASN A 1 7   ? 29.138  4.341   -4.517  1.00 4.20  ? 39  ASN A O    1 
ATOM   53    C  CB   . ASN A 1 7   ? 28.466  6.709   -5.594  1.00 5.38  ? 39  ASN A CB   1 
ATOM   54    C  CG   . ASN A 1 7   ? 28.396  8.112   -6.145  1.00 10.22 ? 39  ASN A CG   1 
ATOM   55    O  OD1  . ASN A 1 7   ? 28.579  9.103   -5.409  1.00 10.55 ? 39  ASN A OD1  1 
ATOM   56    N  ND2  . ASN A 1 7   ? 28.105  8.221   -7.442  1.00 8.98  ? 39  ASN A ND2  1 
ATOM   57    H  H    . ASN A 1 7   ? 29.357  6.269   -8.475  1.00 17.00 ? 39  ASN A H    1 
ATOM   58    H  HD21 . ASN A 1 7   ? 28.114  9.117   -7.829  1.00 17.00 ? 39  ASN A HD21 1 
ATOM   59    H  HD22 . ASN A 1 7   ? 27.895  7.435   -7.960  1.00 17.00 ? 39  ASN A HD22 1 
ATOM   60    N  N    . PRO A 1 8   ? 29.891  3.363   -6.392  1.00 3.05  ? 40  PRO A N    1 
ATOM   61    C  CA   . PRO A 1 8   ? 29.988  2.005   -5.847  1.00 2.75  ? 40  PRO A CA   1 
ATOM   62    C  C    . PRO A 1 8   ? 30.607  1.806   -4.458  1.00 4.16  ? 40  PRO A C    1 
ATOM   63    O  O    . PRO A 1 8   ? 30.063  1.115   -3.591  1.00 2.00  ? 40  PRO A O    1 
ATOM   64    C  CB   . PRO A 1 8   ? 30.824  1.294   -6.896  1.00 2.00  ? 40  PRO A CB   1 
ATOM   65    C  CG   . PRO A 1 8   ? 30.528  2.019   -8.144  1.00 2.00  ? 40  PRO A CG   1 
ATOM   66    C  CD   . PRO A 1 8   ? 30.595  3.423   -7.688  1.00 3.73  ? 40  PRO A CD   1 
ATOM   67    N  N    . CYS A 1 9   ? 31.779  2.393   -4.273  1.00 7.64  ? 41  CYS A N    1 
ATOM   68    C  CA   . CYS A 1 9   ? 32.528  2.271   -3.031  1.00 6.57  ? 41  CYS A CA   1 
ATOM   69    C  C    . CYS A 1 9   ? 31.850  2.900   -1.824  1.00 5.60  ? 41  CYS A C    1 
ATOM   70    O  O    . CYS A 1 9   ? 31.640  4.114   -1.761  1.00 4.99  ? 41  CYS A O    1 
ATOM   71    C  CB   . CYS A 1 9   ? 33.904  2.876   -3.240  1.00 7.09  ? 41  CYS A CB   1 
ATOM   72    S  SG   . CYS A 1 9   ? 34.644  2.306   -4.792  1.00 7.53  ? 41  CYS A SG   1 
ATOM   73    H  H    . CYS A 1 9   ? 32.170  2.932   -4.977  1.00 17.00 ? 41  CYS A H    1 
ATOM   74    N  N    . GLN A 1 10  ? 31.503  2.064   -0.870  1.00 2.26  ? 42  GLN A N    1 
ATOM   75    C  CA   . GLN A 1 10  ? 30.862  2.545   0.326   1.00 2.00  ? 42  GLN A CA   1 
ATOM   76    C  C    . GLN A 1 10  ? 31.862  2.668   1.441   1.00 2.00  ? 42  GLN A C    1 
ATOM   77    O  O    . GLN A 1 10  ? 33.038  2.431   1.265   1.00 2.00  ? 42  GLN A O    1 
ATOM   78    C  CB   . GLN A 1 10  ? 29.743  1.584   0.727   1.00 3.67  ? 42  GLN A CB   1 
ATOM   79    C  CG   . GLN A 1 10  ? 28.711  1.270   -0.398  1.00 4.37  ? 42  GLN A CG   1 
ATOM   80    C  CD   . GLN A 1 10  ? 27.933  2.490   -0.872  1.00 3.29  ? 42  GLN A CD   1 
ATOM   81    O  OE1  . GLN A 1 10  ? 27.162  3.071   -0.112  1.00 6.11  ? 42  GLN A OE1  1 
ATOM   82    N  NE2  . GLN A 1 10  ? 28.119  2.870   -2.127  1.00 2.03  ? 42  GLN A NE2  1 
ATOM   83    H  H    . GLN A 1 10  ? 31.633  1.127   -1.002  1.00 17.00 ? 42  GLN A H    1 
ATOM   84    H  HE21 . GLN A 1 10  ? 27.670  3.676   -2.451  1.00 17.00 ? 42  GLN A HE21 1 
ATOM   85    H  HE22 . GLN A 1 10  ? 28.720  2.333   -2.683  1.00 17.00 ? 42  GLN A HE22 1 
ATOM   86    N  N    . ASN A 1 11  ? 31.384  3.087   2.596   1.00 3.52  ? 43  ASN A N    1 
ATOM   87    C  CA   . ASN A 1 11  ? 32.216  3.237   3.795   1.00 5.37  ? 43  ASN A CA   1 
ATOM   88    C  C    . ASN A 1 11  ? 33.478  4.106   3.704   1.00 3.57  ? 43  ASN A C    1 
ATOM   89    O  O    . ASN A 1 11  ? 34.354  4.032   4.570   1.00 2.00  ? 43  ASN A O    1 
ATOM   90    C  CB   . ASN A 1 11  ? 32.552  1.854   4.370   1.00 5.11  ? 43  ASN A CB   1 
ATOM   91    C  CG   . ASN A 1 11  ? 31.349  1.179   4.986   1.00 3.41  ? 43  ASN A CG   1 
ATOM   92    O  OD1  . ASN A 1 11  ? 30.577  1.804   5.709   1.00 4.12  ? 43  ASN A OD1  1 
ATOM   93    N  ND2  . ASN A 1 11  ? 31.198  -0.097  4.728   1.00 2.02  ? 43  ASN A ND2  1 
ATOM   94    H  H    . ASN A 1 11  ? 30.431  3.298   2.652   1.00 17.00 ? 43  ASN A H    1 
ATOM   95    H  HD21 . ASN A 1 11  ? 30.423  -0.561  5.102   1.00 17.00 ? 43  ASN A HD21 1 
ATOM   96    H  HD22 . ASN A 1 11  ? 31.880  -0.506  4.176   1.00 17.00 ? 43  ASN A HD22 1 
ATOM   97    N  N    . ARG A 1 12  ? 33.522  4.951   2.674   1.00 4.49  ? 44  ARG A N    1 
ATOM   98    C  CA   . ARG A 1 12  ? 34.598  5.903   2.406   1.00 2.00  ? 44  ARG A CA   1 
ATOM   99    C  C    . ARG A 1 12  ? 35.619  5.461   1.397   1.00 2.00  ? 44  ARG A C    1 
ATOM   100   O  O    . ARG A 1 12  ? 36.392  6.265   0.911   1.00 3.19  ? 44  ARG A O    1 
ATOM   101   C  CB   . ARG A 1 12  ? 35.289  6.348   3.691   1.00 2.01  ? 44  ARG A CB   1 
ATOM   102   C  CG   . ARG A 1 12  ? 34.382  7.014   4.707   1.00 2.00  ? 44  ARG A CG   1 
ATOM   103   C  CD   . ARG A 1 12  ? 33.912  8.337   4.211   1.00 2.73  ? 44  ARG A CD   1 
ATOM   104   N  NE   . ARG A 1 12  ? 34.833  9.402   4.583   1.00 4.31  ? 44  ARG A NE   1 
ATOM   105   C  CZ   . ARG A 1 12  ? 35.101  10.447  3.816   1.00 5.41  ? 44  ARG A CZ   1 
ATOM   106   N  NH1  . ARG A 1 12  ? 34.532  10.584  2.626   1.00 7.57  ? 44  ARG A NH1  1 
ATOM   107   N  NH2  . ARG A 1 12  ? 35.912  11.374  4.262   1.00 6.66  ? 44  ARG A NH2  1 
ATOM   108   H  H    . ARG A 1 12  ? 32.791  4.920   2.034   1.00 17.00 ? 44  ARG A H    1 
ATOM   109   H  HE   . ARG A 1 12  ? 35.275  9.338   5.454   1.00 17.00 ? 44  ARG A HE   1 
ATOM   110   H  HH11 . ARG A 1 12  ? 33.882  9.903   2.290   1.00 17.00 ? 44  ARG A HH11 1 
ATOM   111   H  HH12 . ARG A 1 12  ? 34.747  11.380  2.061   1.00 17.00 ? 44  ARG A HH12 1 
ATOM   112   H  HH21 . ARG A 1 12  ? 36.315  11.291  5.173   1.00 17.00 ? 44  ARG A HH21 1 
ATOM   113   H  HH22 . ARG A 1 12  ? 36.125  12.167  3.690   1.00 17.00 ? 44  ARG A HH22 1 
ATOM   114   N  N    . GLY A 1 13  ? 35.615  4.194   1.039   1.00 3.32  ? 45  GLY A N    1 
ATOM   115   C  CA   . GLY A 1 13  ? 36.595  3.718   0.075   1.00 4.54  ? 45  GLY A CA   1 
ATOM   116   C  C    . GLY A 1 13  ? 36.596  4.572   -1.173  1.00 3.81  ? 45  GLY A C    1 
ATOM   117   O  O    . GLY A 1 13  ? 35.538  4.829   -1.693  1.00 5.29  ? 45  GLY A O    1 
ATOM   118   H  H    . GLY A 1 13  ? 34.931  3.586   1.389   1.00 17.00 ? 45  GLY A H    1 
ATOM   119   N  N    . GLU A 1 14  ? 37.737  5.105   -1.596  1.00 4.73  ? 46  GLU A N    1 
ATOM   120   C  CA   . GLU A 1 14  ? 37.771  5.910   -2.827  1.00 6.84  ? 46  GLU A CA   1 
ATOM   121   C  C    . GLU A 1 14  ? 37.637  5.003   -4.066  1.00 4.97  ? 46  GLU A C    1 
ATOM   122   O  O    . GLU A 1 14  ? 38.319  3.992   -4.190  1.00 5.11  ? 46  GLU A O    1 
ATOM   123   C  CB   . GLU A 1 14  ? 39.072  6.702   -2.934  1.00 9.16  ? 46  GLU A CB   1 
ATOM   124   C  CG   . GLU A 1 14  ? 39.004  8.134   -2.491  1.00 12.69 ? 46  GLU A CG   1 
ATOM   125   C  CD   . GLU A 1 14  ? 39.570  8.366   -1.092  1.00 17.07 ? 46  GLU A CD   1 
ATOM   126   O  OE1  . GLU A 1 14  ? 40.204  7.430   -0.529  1.00 17.09 ? 46  GLU A OE1  1 
ATOM   127   O  OE2  . GLU A 1 14  ? 39.383  9.504   -0.565  1.00 17.52 ? 46  GLU A OE2  1 
ATOM   128   H  H    . GLU A 1 14  ? 38.550  4.959   -1.069  1.00 17.00 ? 46  GLU A H    1 
ATOM   129   N  N    . CYS A 1 15  ? 36.804  5.404   -5.007  1.00 3.26  ? 47  CYS A N    1 
ATOM   130   C  CA   . CYS A 1 15  ? 36.559  4.609   -6.202  1.00 3.53  ? 47  CYS A CA   1 
ATOM   131   C  C    . CYS A 1 15  ? 37.477  5.007   -7.331  1.00 2.00  ? 47  CYS A C    1 
ATOM   132   O  O    . CYS A 1 15  ? 37.730  6.184   -7.502  1.00 3.61  ? 47  CYS A O    1 
ATOM   133   C  CB   . CYS A 1 15  ? 35.088  4.772   -6.633  1.00 6.39  ? 47  CYS A CB   1 
ATOM   134   S  SG   . CYS A 1 15  ? 34.536  3.830   -8.107  1.00 9.41  ? 47  CYS A SG   1 
ATOM   135   H  H    . CYS A 1 15  ? 36.365  6.271   -4.921  1.00 17.00 ? 47  CYS A H    1 
ATOM   136   N  N    . MET A 1 16  ? 37.985  4.036   -8.096  1.00 3.11  ? 48  MET A N    1 
ATOM   137   C  CA   . MET A 1 16  ? 38.859  4.362   -9.209  1.00 2.19  ? 48  MET A CA   1 
ATOM   138   C  C    . MET A 1 16  ? 38.652  3.637   -10.513 1.00 2.00  ? 48  MET A C    1 
ATOM   139   O  O    . MET A 1 16  ? 38.631  2.429   -10.546 1.00 2.00  ? 48  MET A O    1 
ATOM   140   C  CB   . MET A 1 16  ? 40.329  4.325   -8.810  1.00 4.82  ? 48  MET A CB   1 
ATOM   141   C  CG   . MET A 1 16  ? 40.987  5.502   -9.420  1.00 8.48  ? 48  MET A CG   1 
ATOM   142   S  SD   . MET A 1 16  ? 39.662  6.766   -9.547  1.00 13.79 ? 48  MET A SD   1 
ATOM   143   C  CE   . MET A 1 16  ? 39.959  7.565   -11.163 1.00 18.11 ? 48  MET A CE   1 
ATOM   144   H  H    . MET A 1 16  ? 37.755  3.106   -7.894  1.00 17.00 ? 48  MET A H    1 
ATOM   145   N  N    . SER A 1 17  ? 38.608  4.407   -11.595 1.00 2.00  ? 49  SER A N    1 
ATOM   146   C  CA   . SER A 1 17  ? 38.388  3.892   -12.939 1.00 2.41  ? 49  SER A CA   1 
ATOM   147   C  C    . SER A 1 17  ? 39.492  3.023   -13.505 1.00 4.27  ? 49  SER A C    1 
ATOM   148   O  O    . SER A 1 17  ? 40.385  3.523   -14.219 1.00 7.42  ? 49  SER A O    1 
ATOM   149   C  CB   . SER A 1 17  ? 38.101  5.042   -13.903 1.00 3.24  ? 49  SER A CB   1 
ATOM   150   O  OG   . SER A 1 17  ? 38.655  6.267   -13.436 1.00 8.00  ? 49  SER A OG   1 
ATOM   151   H  H    . SER A 1 17  ? 38.704  5.379   -11.514 1.00 17.00 ? 49  SER A H    1 
ATOM   152   H  HG   . SER A 1 17  ? 38.606  6.912   -14.154 1.00 17.00 ? 49  SER A HG   1 
ATOM   153   N  N    . THR A 1 18  ? 39.393  1.713   -13.270 1.00 3.76  ? 50  THR A N    1 
ATOM   154   C  CA   . THR A 1 18  ? 40.406  0.777   -13.754 1.00 2.90  ? 50  THR A CA   1 
ATOM   155   C  C    . THR A 1 18  ? 40.208  0.198   -15.149 1.00 2.00  ? 50  THR A C    1 
ATOM   156   O  O    . THR A 1 18  ? 40.483  -0.972  -15.352 1.00 2.00  ? 50  THR A O    1 
ATOM   157   C  CB   . THR A 1 18  ? 40.693  -0.354  -12.721 1.00 2.00  ? 50  THR A CB   1 
ATOM   158   O  OG1  . THR A 1 18  ? 39.635  -1.312  -12.696 1.00 2.66  ? 50  THR A OG1  1 
ATOM   159   C  CG2  . THR A 1 18  ? 40.817  0.240   -11.342 1.00 2.00  ? 50  THR A CG2  1 
ATOM   160   H  H    . THR A 1 18  ? 38.638  1.370   -12.742 1.00 17.00 ? 50  THR A H    1 
ATOM   161   H  HG1  . THR A 1 18  ? 39.734  -1.816  -13.518 1.00 17.00 ? 50  THR A HG1  1 
ATOM   162   N  N    . GLY A 1 19  ? 39.717  0.997   -16.099 1.00 2.00  ? 51  GLY A N    1 
ATOM   163   C  CA   . GLY A 1 19  ? 39.568  0.486   -17.454 1.00 2.90  ? 51  GLY A CA   1 
ATOM   164   C  C    . GLY A 1 19  ? 38.315  0.746   -18.266 1.00 5.38  ? 51  GLY A C    1 
ATOM   165   O  O    . GLY A 1 19  ? 37.883  -0.151  -18.993 1.00 6.05  ? 51  GLY A O    1 
ATOM   166   H  H    . GLY A 1 19  ? 39.493  1.919   -15.862 1.00 17.00 ? 51  GLY A H    1 
ATOM   167   N  N    . PHE A 1 20  ? 37.790  1.973   -18.198 1.00 6.97  ? 52  PHE A N    1 
ATOM   168   C  CA   . PHE A 1 20  ? 36.589  2.420   -18.923 1.00 8.27  ? 52  PHE A CA   1 
ATOM   169   C  C    . PHE A 1 20  ? 35.338  1.876   -18.263 1.00 11.28 ? 52  PHE A C    1 
ATOM   170   O  O    . PHE A 1 20  ? 34.504  2.626   -17.744 1.00 10.98 ? 52  PHE A O    1 
ATOM   171   C  CB   . PHE A 1 20  ? 36.555  1.916   -20.367 1.00 10.71 ? 52  PHE A CB   1 
ATOM   172   C  CG   . PHE A 1 20  ? 37.499  2.598   -21.297 1.00 11.35 ? 52  PHE A CG   1 
ATOM   173   C  CD1  . PHE A 1 20  ? 37.195  3.869   -21.810 1.00 13.26 ? 52  PHE A CD1  1 
ATOM   174   C  CD2  . PHE A 1 20  ? 38.646  1.941   -21.741 1.00 10.93 ? 52  PHE A CD2  1 
ATOM   175   C  CE1  . PHE A 1 20  ? 38.019  4.482   -22.760 1.00 12.41 ? 52  PHE A CE1  1 
ATOM   176   C  CE2  . PHE A 1 20  ? 39.478  2.535   -22.687 1.00 13.17 ? 52  PHE A CE2  1 
ATOM   177   C  CZ   . PHE A 1 20  ? 39.165  3.814   -23.202 1.00 13.43 ? 52  PHE A CZ   1 
ATOM   178   H  H    . PHE A 1 20  ? 38.210  2.625   -17.607 1.00 17.00 ? 52  PHE A H    1 
ATOM   179   N  N    . ASP A 1 21  ? 35.223  0.551   -18.336 1.00 12.16 ? 53  ASP A N    1 
ATOM   180   C  CA   . ASP A 1 21  ? 34.109  -0.224  -17.833 1.00 12.59 ? 53  ASP A CA   1 
ATOM   181   C  C    . ASP A 1 21  ? 34.269  -0.664  -16.379 1.00 12.51 ? 53  ASP A C    1 
ATOM   182   O  O    . ASP A 1 21  ? 33.272  -1.026  -15.731 1.00 14.57 ? 53  ASP A O    1 
ATOM   183   C  CB   . ASP A 1 21  ? 34.004  -1.456  -18.705 1.00 18.00 ? 53  ASP A CB   1 
ATOM   184   C  CG   . ASP A 1 21  ? 35.382  -2.178  -18.880 1.00 25.32 ? 53  ASP A CG   1 
ATOM   185   O  OD1  . ASP A 1 21  ? 35.979  -2.643  -17.866 1.00 25.25 ? 53  ASP A OD1  1 
ATOM   186   O  OD2  . ASP A 1 21  ? 35.883  -2.266  -20.036 1.00 24.56 ? 53  ASP A OD2  1 
ATOM   187   H  H    . ASP A 1 21  ? 35.955  0.064   -18.767 1.00 17.00 ? 53  ASP A H    1 
ATOM   188   N  N    . GLN A 1 22  ? 35.500  -0.629  -15.858 1.00 10.28 ? 54  GLN A N    1 
ATOM   189   C  CA   . GLN A 1 22  ? 35.745  -1.090  -14.490 1.00 8.14  ? 54  GLN A CA   1 
ATOM   190   C  C    . GLN A 1 22  ? 36.102  -0.035  -13.449 1.00 6.16  ? 54  GLN A C    1 
ATOM   191   O  O    . GLN A 1 22  ? 36.293  1.123   -13.776 1.00 2.04  ? 54  GLN A O    1 
ATOM   192   C  CB   . GLN A 1 22  ? 36.819  -2.179  -14.499 1.00 9.09  ? 54  GLN A CB   1 
ATOM   193   C  CG   . GLN A 1 22  ? 36.492  -3.388  -13.611 1.00 8.10  ? 54  GLN A CG   1 
ATOM   194   C  CD   . GLN A 1 22  ? 35.682  -4.470  -14.339 1.00 9.85  ? 54  GLN A CD   1 
ATOM   195   O  OE1  . GLN A 1 22  ? 35.243  -4.297  -15.490 1.00 9.63  ? 54  GLN A OE1  1 
ATOM   196   N  NE2  . GLN A 1 22  ? 35.520  -5.606  -13.685 1.00 3.53  ? 54  GLN A NE2  1 
ATOM   197   H  H    . GLN A 1 22  ? 36.234  -0.284  -16.395 1.00 17.00 ? 54  GLN A H    1 
ATOM   198   H  HE21 . GLN A 1 22  ? 34.989  -6.292  -14.138 1.00 17.00 ? 54  GLN A HE21 1 
ATOM   199   H  HE22 . GLN A 1 22  ? 35.925  -5.701  -12.800 1.00 17.00 ? 54  GLN A HE22 1 
ATOM   200   N  N    . TYR A 1 23  ? 36.209  -0.476  -12.195 1.00 6.11  ? 55  TYR A N    1 
ATOM   201   C  CA   . TYR A 1 23  ? 36.558  0.376   -11.054 1.00 8.13  ? 55  TYR A CA   1 
ATOM   202   C  C    . TYR A 1 23  ? 37.015  -0.506  -9.872  1.00 8.29  ? 55  TYR A C    1 
ATOM   203   O  O    . TYR A 1 23  ? 36.765  -1.705  -9.847  1.00 6.65  ? 55  TYR A O    1 
ATOM   204   C  CB   . TYR A 1 23  ? 35.363  1.262   -10.599 1.00 6.61  ? 55  TYR A CB   1 
ATOM   205   C  CG   . TYR A 1 23  ? 34.371  0.541   -9.673  1.00 7.38  ? 55  TYR A CG   1 
ATOM   206   C  CD1  . TYR A 1 23  ? 33.348  -0.259  -10.208 1.00 4.07  ? 55  TYR A CD1  1 
ATOM   207   C  CD2  . TYR A 1 23  ? 34.494  0.610   -8.264  1.00 7.34  ? 55  TYR A CD2  1 
ATOM   208   C  CE1  . TYR A 1 23  ? 32.484  -0.969  -9.392  1.00 5.42  ? 55  TYR A CE1  1 
ATOM   209   C  CE2  . TYR A 1 23  ? 33.625  -0.119  -7.426  1.00 7.67  ? 55  TYR A CE2  1 
ATOM   210   C  CZ   . TYR A 1 23  ? 32.619  -0.908  -8.002  1.00 7.52  ? 55  TYR A CZ   1 
ATOM   211   O  OH   . TYR A 1 23  ? 31.733  -1.620  -7.206  1.00 6.08  ? 55  TYR A OH   1 
ATOM   212   H  H    . TYR A 1 23  ? 36.061  -1.418  -11.982 1.00 17.00 ? 55  TYR A H    1 
ATOM   213   H  HH   . TYR A 1 23  ? 32.079  -1.598  -6.303  1.00 17.00 ? 55  TYR A HH   1 
ATOM   214   N  N    . LYS A 1 24  ? 37.676  0.114   -8.897  1.00 10.71 ? 56  LYS A N    1 
ATOM   215   C  CA   . LYS A 1 24  ? 38.125  -0.557  -7.673  1.00 7.71  ? 56  LYS A CA   1 
ATOM   216   C  C    . LYS A 1 24  ? 37.912  0.421   -6.526  1.00 7.18  ? 56  LYS A C    1 
ATOM   217   O  O    . LYS A 1 24  ? 37.988  1.639   -6.692  1.00 2.00  ? 56  LYS A O    1 
ATOM   218   C  CB   . LYS A 1 24  ? 39.610  -0.945  -7.707  1.00 7.69  ? 56  LYS A CB   1 
ATOM   219   C  CG   . LYS A 1 24  ? 39.950  -1.982  -8.697  1.00 3.96  ? 56  LYS A CG   1 
ATOM   220   C  CD   . LYS A 1 24  ? 41.381  -2.385  -8.599  1.00 6.81  ? 56  LYS A CD   1 
ATOM   221   C  CE   . LYS A 1 24  ? 41.583  -3.636  -9.446  1.00 12.61 ? 56  LYS A CE   1 
ATOM   222   N  NZ   . LYS A 1 24  ? 40.790  -4.828  -8.917  1.00 18.71 ? 56  LYS A NZ   1 
ATOM   223   H  H    . LYS A 1 24  ? 37.883  1.067   -9.016  1.00 17.00 ? 56  LYS A H    1 
ATOM   224   H  HZ1  . LYS A 1 24  ? 41.050  -5.005  -7.925  1.00 17.00 ? 56  LYS A HZ1  1 
ATOM   225   H  HZ2  . LYS A 1 24  ? 39.774  -4.608  -8.970  1.00 17.00 ? 56  LYS A HZ2  1 
ATOM   226   H  HZ3  . LYS A 1 24  ? 40.990  -5.671  -9.492  1.00 17.00 ? 56  LYS A HZ3  1 
ATOM   227   N  N    . CYS A 1 25  ? 37.689  -0.140  -5.349  1.00 10.36 ? 57  CYS A N    1 
ATOM   228   C  CA   . CYS A 1 25  ? 37.459  0.656   -4.148  1.00 10.55 ? 57  CYS A CA   1 
ATOM   229   C  C    . CYS A 1 25  ? 38.651  0.645   -3.210  1.00 7.98  ? 57  CYS A C    1 
ATOM   230   O  O    . CYS A 1 25  ? 39.093  -0.418  -2.752  1.00 9.16  ? 57  CYS A O    1 
ATOM   231   C  CB   . CYS A 1 25  ? 36.206  0.165   -3.409  1.00 10.02 ? 57  CYS A CB   1 
ATOM   232   S  SG   . CYS A 1 25  ? 34.719  0.330   -4.434  1.00 7.23  ? 57  CYS A SG   1 
ATOM   233   H  H    . CYS A 1 25  ? 37.692  -1.113  -5.254  1.00 17.00 ? 57  CYS A H    1 
ATOM   234   N  N    . ASP A 1 26  ? 39.149  1.835   -2.905  1.00 2.00  ? 58  ASP A N    1 
ATOM   235   C  CA   . ASP A 1 26  ? 40.272  1.939   -2.032  1.00 2.00  ? 58  ASP A CA   1 
ATOM   236   C  C    . ASP A 1 26  ? 39.785  1.942   -0.603  1.00 2.72  ? 58  ASP A C    1 
ATOM   237   O  O    . ASP A 1 26  ? 39.731  2.971   0.055   1.00 2.00  ? 58  ASP A O    1 
ATOM   238   C  CB   . ASP A 1 26  ? 41.067  3.186   -2.361  1.00 3.36  ? 58  ASP A CB   1 
ATOM   239   C  CG   . ASP A 1 26  ? 42.536  3.060   -2.007  1.00 2.18  ? 58  ASP A CG   1 
ATOM   240   O  OD1  . ASP A 1 26  ? 43.060  1.930   -2.011  1.00 3.19  ? 58  ASP A OD1  1 
ATOM   241   O  OD2  . ASP A 1 26  ? 43.156  4.095   -1.722  1.00 2.00  ? 58  ASP A OD2  1 
ATOM   242   H  H    . ASP A 1 26  ? 38.753  2.639   -3.239  1.00 17.00 ? 58  ASP A H    1 
ATOM   243   N  N    . CYS A 1 27  ? 39.445  0.752   -0.128  1.00 3.63  ? 59  CYS A N    1 
ATOM   244   C  CA   . CYS A 1 27  ? 38.945  0.551   1.217   1.00 5.57  ? 59  CYS A CA   1 
ATOM   245   C  C    . CYS A 1 27  ? 40.005  0.791   2.255   1.00 6.95  ? 59  CYS A C    1 
ATOM   246   O  O    . CYS A 1 27  ? 39.744  0.582   3.447   1.00 6.92  ? 59  CYS A O    1 
ATOM   247   C  CB   . CYS A 1 27  ? 38.442  -0.883  1.369   1.00 9.55  ? 59  CYS A CB   1 
ATOM   248   S  SG   . CYS A 1 27  ? 37.298  -1.404  0.050   1.00 11.92 ? 59  CYS A SG   1 
ATOM   249   H  H    . CYS A 1 27  ? 39.504  -0.035  -0.721  1.00 17.00 ? 59  CYS A H    1 
ATOM   250   N  N    . THR A 1 28  ? 41.205  1.187   1.811   1.00 7.59  ? 60  THR A N    1 
ATOM   251   C  CA   . THR A 1 28  ? 42.320  1.442   2.720   1.00 4.80  ? 60  THR A CA   1 
ATOM   252   C  C    . THR A 1 28  ? 41.937  2.426   3.832   1.00 4.35  ? 60  THR A C    1 
ATOM   253   O  O    . THR A 1 28  ? 41.294  3.471   3.590   1.00 2.00  ? 60  THR A O    1 
ATOM   254   C  CB   . THR A 1 28  ? 43.565  1.950   1.965   1.00 2.00  ? 60  THR A CB   1 
ATOM   255   O  OG1  . THR A 1 28  ? 43.164  2.808   0.907   1.00 2.00  ? 60  THR A OG1  1 
ATOM   256   C  CG2  . THR A 1 28  ? 44.324  0.810   1.374   1.00 5.51  ? 60  THR A CG2  1 
ATOM   257   H  H    . THR A 1 28  ? 41.386  1.363   0.871   1.00 17.00 ? 60  THR A H    1 
ATOM   258   H  HG1  . THR A 1 28  ? 42.670  3.559   1.275   1.00 17.00 ? 60  THR A HG1  1 
ATOM   259   N  N    . ARG A 1 29  ? 42.245  2.030   5.061   1.00 3.71  ? 61  ARG A N    1 
ATOM   260   C  CA   . ARG A 1 29  ? 41.970  2.871   6.208   1.00 7.10  ? 61  ARG A CA   1 
ATOM   261   C  C    . ARG A 1 29  ? 40.476  3.128   6.426   1.00 7.93  ? 61  ARG A C    1 
ATOM   262   O  O    . ARG A 1 29  ? 40.080  4.225   6.803   1.00 7.29  ? 61  ARG A O    1 
ATOM   263   C  CB   . ARG A 1 29  ? 42.728  4.205   6.062   1.00 12.76 ? 61  ARG A CB   1 
ATOM   264   C  CG   . ARG A 1 29  ? 43.376  4.795   7.360   1.00 13.62 ? 61  ARG A CG   1 
ATOM   265   C  CD   . ARG A 1 29  ? 44.712  5.524   7.048   1.00 10.84 ? 61  ARG A CD   1 
ATOM   266   N  NE   . ARG A 1 29  ? 45.626  4.569   6.412   1.00 13.47 ? 61  ARG A NE   1 
ATOM   267   C  CZ   . ARG A 1 29  ? 46.374  4.831   5.344   1.00 12.38 ? 61  ARG A CZ   1 
ATOM   268   N  NH1  . ARG A 1 29  ? 46.334  6.044   4.796   1.00 11.48 ? 61  ARG A NH1  1 
ATOM   269   N  NH2  . ARG A 1 29  ? 47.106  3.866   4.793   1.00 6.52  ? 61  ARG A NH2  1 
ATOM   270   H  H    . ARG A 1 29  ? 42.640  1.148   5.196   1.00 17.00 ? 61  ARG A H    1 
ATOM   271   H  HE   . ARG A 1 29  ? 45.689  3.672   6.802   1.00 17.00 ? 61  ARG A HE   1 
ATOM   272   H  HH11 . ARG A 1 29  ? 45.752  6.758   5.183   1.00 17.00 ? 61  ARG A HH11 1 
ATOM   273   H  HH12 . ARG A 1 29  ? 46.892  6.240   3.991   1.00 17.00 ? 61  ARG A HH12 1 
ATOM   274   H  HH21 . ARG A 1 29  ? 47.095  2.947   5.184   1.00 17.00 ? 61  ARG A HH21 1 
ATOM   275   H  HH22 . ARG A 1 29  ? 47.664  4.057   3.985   1.00 17.00 ? 61  ARG A HH22 1 
ATOM   276   N  N    . THR A 1 30  ? 39.642  2.167   6.055   1.00 9.29  ? 62  THR A N    1 
ATOM   277   C  CA   . THR A 1 30  ? 38.205  2.264   6.316   1.00 8.93  ? 62  THR A CA   1 
ATOM   278   C  C    . THR A 1 30  ? 38.105  1.149   7.355   1.00 11.05 ? 62  THR A C    1 
ATOM   279   O  O    . THR A 1 30  ? 39.150  0.565   7.737   1.00 11.82 ? 62  THR A O    1 
ATOM   280   C  CB   . THR A 1 30  ? 37.291  1.859   5.067   1.00 10.31 ? 62  THR A CB   1 
ATOM   281   O  OG1  . THR A 1 30  ? 37.477  0.475   4.703   1.00 5.06  ? 62  THR A OG1  1 
ATOM   282   C  CG2  . THR A 1 30  ? 37.549  2.756   3.857   1.00 8.35  ? 62  THR A CG2  1 
ATOM   283   H  H    . THR A 1 30  ? 39.968  1.362   5.607   1.00 17.00 ? 62  THR A H    1 
ATOM   284   H  HG1  . THR A 1 30  ? 38.385  0.225   4.519   1.00 17.00 ? 62  THR A HG1  1 
ATOM   285   N  N    . GLY A 1 31  ? 36.888  0.843   7.817   1.00 9.87  ? 63  GLY A N    1 
ATOM   286   C  CA   . GLY A 1 31  ? 36.729  -0.274  8.746   1.00 7.93  ? 63  GLY A CA   1 
ATOM   287   C  C    . GLY A 1 31  ? 36.183  -1.497  8.004   1.00 6.23  ? 63  GLY A C    1 
ATOM   288   O  O    . GLY A 1 31  ? 35.931  -2.560  8.591   1.00 2.72  ? 63  GLY A O    1 
ATOM   289   H  H    . GLY A 1 31  ? 36.112  1.363   7.534   1.00 17.00 ? 63  GLY A H    1 
ATOM   290   N  N    . PHE A 1 32  ? 36.045  -1.345  6.686   1.00 7.51  ? 64  PHE A N    1 
ATOM   291   C  CA   . PHE A 1 32  ? 35.479  -2.379  5.829   1.00 7.17  ? 64  PHE A CA   1 
ATOM   292   C  C    . PHE A 1 32  ? 36.336  -2.763  4.623   1.00 7.08  ? 64  PHE A C    1 
ATOM   293   O  O    . PHE A 1 32  ? 37.175  -1.988  4.151   1.00 6.56  ? 64  PHE A O    1 
ATOM   294   C  CB   . PHE A 1 32  ? 34.111  -1.924  5.330   1.00 6.00  ? 64  PHE A CB   1 
ATOM   295   C  CG   . PHE A 1 32  ? 33.208  -1.435  6.413   1.00 3.67  ? 64  PHE A CG   1 
ATOM   296   C  CD1  . PHE A 1 32  ? 33.332  -0.154  6.922   1.00 3.63  ? 64  PHE A CD1  1 
ATOM   297   C  CD2  . PHE A 1 32  ? 32.221  -2.245  6.907   1.00 2.65  ? 64  PHE A CD2  1 
ATOM   298   C  CE1  . PHE A 1 32  ? 32.470  0.299   7.911   1.00 5.14  ? 64  PHE A CE1  1 
ATOM   299   C  CE2  . PHE A 1 32  ? 31.357  -1.802  7.894   1.00 4.55  ? 64  PHE A CE2  1 
ATOM   300   C  CZ   . PHE A 1 32  ? 31.480  -0.528  8.398   1.00 3.80  ? 64  PHE A CZ   1 
ATOM   301   H  H    . PHE A 1 32  ? 36.384  -0.551  6.220   1.00 17.00 ? 64  PHE A H    1 
ATOM   302   N  N    . TYR A 1 33  ? 36.060  -3.958  4.116   1.00 5.66  ? 65  TYR A N    1 
ATOM   303   C  CA   . TYR A 1 33  ? 36.753  -4.502  2.977   1.00 5.90  ? 65  TYR A CA   1 
ATOM   304   C  C    . TYR A 1 33  ? 35.750  -5.135  2.015   1.00 6.44  ? 65  TYR A C    1 
ATOM   305   O  O    . TYR A 1 33  ? 34.529  -5.007  2.197   1.00 9.37  ? 65  TYR A O    1 
ATOM   306   C  CB   . TYR A 1 33  ? 37.775  -5.536  3.443   1.00 7.91  ? 65  TYR A CB   1 
ATOM   307   C  CG   . TYR A 1 33  ? 37.244  -6.612  4.364   1.00 7.84  ? 65  TYR A CG   1 
ATOM   308   C  CD1  . TYR A 1 33  ? 36.799  -6.297  5.634   1.00 7.53  ? 65  TYR A CD1  1 
ATOM   309   C  CD2  . TYR A 1 33  ? 37.241  -7.960  3.982   1.00 7.76  ? 65  TYR A CD2  1 
ATOM   310   C  CE1  . TYR A 1 33  ? 36.365  -7.299  6.517   1.00 9.42  ? 65  TYR A CE1  1 
ATOM   311   C  CE2  . TYR A 1 33  ? 36.807  -8.971  4.864   1.00 7.17  ? 65  TYR A CE2  1 
ATOM   312   C  CZ   . TYR A 1 33  ? 36.373  -8.627  6.134   1.00 7.65  ? 65  TYR A CZ   1 
ATOM   313   O  OH   . TYR A 1 33  ? 35.945  -9.594  7.024   1.00 7.08  ? 65  TYR A OH   1 
ATOM   314   H  H    . TYR A 1 33  ? 35.342  -4.498  4.500   1.00 17.00 ? 65  TYR A H    1 
ATOM   315   H  HH   . TYR A 1 33  ? 35.516  -9.144  7.768   1.00 17.00 ? 65  TYR A HH   1 
ATOM   316   N  N    . GLY A 1 34  ? 36.263  -5.826  1.000   1.00 4.74  ? 66  GLY A N    1 
ATOM   317   C  CA   . GLY A 1 34  ? 35.406  -6.462  0.016   1.00 4.38  ? 66  GLY A CA   1 
ATOM   318   C  C    . GLY A 1 34  ? 35.083  -5.434  -1.040  1.00 3.70  ? 66  GLY A C    1 
ATOM   319   O  O    . GLY A 1 34  ? 34.781  -4.317  -0.694  1.00 3.59  ? 66  GLY A O    1 
ATOM   320   H  H    . GLY A 1 34  ? 37.231  -5.890  0.905   1.00 17.00 ? 66  GLY A H    1 
ATOM   321   N  N    . GLU A 1 35  ? 35.062  -5.841  -2.305  1.00 5.73  ? 67  GLU A N    1 
ATOM   322   C  CA   . GLU A 1 35  ? 34.808  -4.956  -3.459  1.00 7.27  ? 67  GLU A CA   1 
ATOM   323   C  C    . GLU A 1 35  ? 34.267  -3.544  -3.249  1.00 5.93  ? 67  GLU A C    1 
ATOM   324   O  O    . GLU A 1 35  ? 34.718  -2.613  -3.901  1.00 4.28  ? 67  GLU A O    1 
ATOM   325   C  CB   . GLU A 1 35  ? 33.948  -5.655  -4.526  1.00 6.89  ? 67  GLU A CB   1 
ATOM   326   C  CG   . GLU A 1 35  ? 33.772  -4.807  -5.806  1.00 8.18  ? 67  GLU A CG   1 
ATOM   327   C  CD   . GLU A 1 35  ? 32.871  -5.437  -6.868  1.00 10.59 ? 67  GLU A CD   1 
ATOM   328   O  OE1  . GLU A 1 35  ? 32.221  -6.475  -6.582  1.00 11.54 ? 67  GLU A OE1  1 
ATOM   329   O  OE2  . GLU A 1 35  ? 32.820  -4.878  -7.994  1.00 8.85  ? 67  GLU A OE2  1 
ATOM   330   H  H    . GLU A 1 35  ? 35.223  -6.787  -2.487  1.00 17.00 ? 67  GLU A H    1 
ATOM   331   N  N    . ASN A 1 36  ? 33.307  -3.389  -2.352  1.00 6.68  ? 68  ASN A N    1 
ATOM   332   C  CA   . ASN A 1 36  ? 32.721  -2.081  -2.137  1.00 9.17  ? 68  ASN A CA   1 
ATOM   333   C  C    . ASN A 1 36  ? 33.006  -1.395  -0.806  1.00 8.78  ? 68  ASN A C    1 
ATOM   334   O  O    . ASN A 1 36  ? 32.449  -0.326  -0.553  1.00 7.78  ? 68  ASN A O    1 
ATOM   335   C  CB   . ASN A 1 36  ? 31.200  -2.152  -2.355  1.00 10.73 ? 68  ASN A CB   1 
ATOM   336   C  CG   . ASN A 1 36  ? 30.835  -2.374  -3.794  1.00 9.81  ? 68  ASN A CG   1 
ATOM   337   O  OD1  . ASN A 1 36  ? 31.694  -2.340  -4.680  1.00 5.45  ? 68  ASN A OD1  1 
ATOM   338   N  ND2  . ASN A 1 36  ? 29.550  -2.616  -4.023  1.00 13.90 ? 68  ASN A ND2  1 
ATOM   339   H  H    . ASN A 1 36  ? 33.021  -4.135  -1.793  1.00 17.00 ? 68  ASN A H    1 
ATOM   340   H  HD21 . ASN A 1 36  ? 28.934  -2.801  -3.285  1.00 17.00 ? 68  ASN A HD21 1 
ATOM   341   N  N    . CYS A 1 37  ? 33.898  -1.973  0.001   1.00 9.32  ? 69  CYS A N    1 
ATOM   342   C  CA   . CYS A 1 37  ? 34.255  -1.457  1.326   1.00 9.84  ? 69  CYS A CA   1 
ATOM   343   C  C    . CYS A 1 37  ? 32.966  -1.468  2.139   1.00 9.73  ? 69  CYS A C    1 
ATOM   344   O  O    . CYS A 1 37  ? 32.391  -0.426  2.460   1.00 11.75 ? 69  CYS A O    1 
ATOM   345   C  CB   . CYS A 1 37  ? 34.843  -0.037  1.208   1.00 12.96 ? 69  CYS A CB   1 
ATOM   346   S  SG   . CYS A 1 37  ? 36.067  0.203   -0.148  1.00 13.42 ? 69  CYS A SG   1 
ATOM   347   H  H    . CYS A 1 37  ? 34.404  -2.692  -0.354  1.00 17.00 ? 69  CYS A H    1 
ATOM   348   N  N    . THR A 1 38  ? 32.505  -2.664  2.462   1.00 10.66 ? 70  THR A N    1 
ATOM   349   C  CA   . THR A 1 38  ? 31.241  -2.823  3.184   1.00 12.38 ? 70  THR A CA   1 
ATOM   350   C  C    . THR A 1 38  ? 31.244  -3.899  4.294   1.00 10.60 ? 70  THR A C    1 
ATOM   351   O  O    . THR A 1 38  ? 30.547  -3.768  5.308   1.00 9.76  ? 70  THR A O    1 
ATOM   352   C  CB   . THR A 1 38  ? 30.106  -3.130  2.177   1.00 14.52 ? 70  THR A CB   1 
ATOM   353   O  OG1  . THR A 1 38  ? 30.618  -4.023  1.170   1.00 21.06 ? 70  THR A OG1  1 
ATOM   354   C  CG2  . THR A 1 38  ? 29.587  -1.857  1.513   1.00 11.82 ? 70  THR A CG2  1 
ATOM   355   H  H    . THR A 1 38  ? 33.003  -3.468  2.193   1.00 17.00 ? 70  THR A H    1 
ATOM   356   H  HG1  . THR A 1 38  ? 29.888  -4.278  0.595   1.00 17.00 ? 70  THR A HG1  1 
ATOM   357   N  N    . THR A 1 39  ? 32.006  -4.963  4.093   1.00 6.73  ? 71  THR A N    1 
ATOM   358   C  CA   . THR A 1 39  ? 32.089  -6.030  5.080   1.00 5.10  ? 71  THR A CA   1 
ATOM   359   C  C    . THR A 1 39  ? 33.107  -5.564  6.141   1.00 5.13  ? 71  THR A C    1 
ATOM   360   O  O    . THR A 1 39  ? 34.232  -5.174  5.824   1.00 6.51  ? 71  THR A O    1 
ATOM   361   C  CB   . THR A 1 39  ? 32.477  -7.376  4.385   1.00 5.90  ? 71  THR A CB   1 
ATOM   362   O  OG1  . THR A 1 39  ? 33.894  -7.576  4.437   1.00 8.56  ? 71  THR A OG1  1 
ATOM   363   C  CG2  . THR A 1 39  ? 32.072  -7.337  2.904   1.00 3.97  ? 71  THR A CG2  1 
ATOM   364   H  H    . THR A 1 39  ? 32.566  -5.016  3.291   1.00 17.00 ? 71  THR A H    1 
ATOM   365   H  HG1  . THR A 1 39  ? 34.102  -8.434  4.057   1.00 17.00 ? 71  THR A HG1  1 
ATOM   366   N  N    . PRO A 1 40  ? 32.736  -5.596  7.415   1.00 3.79  ? 72  PRO A N    1 
ATOM   367   C  CA   . PRO A 1 40  ? 33.647  -5.150  8.463   1.00 5.38  ? 72  PRO A CA   1 
ATOM   368   C  C    . PRO A 1 40  ? 34.675  -6.111  9.041   1.00 6.20  ? 72  PRO A C    1 
ATOM   369   O  O    . PRO A 1 40  ? 34.593  -7.356  8.919   1.00 6.97  ? 72  PRO A O    1 
ATOM   370   C  CB   . PRO A 1 40  ? 32.684  -4.739  9.557   1.00 3.77  ? 72  PRO A CB   1 
ATOM   371   C  CG   . PRO A 1 40  ? 31.700  -5.819  9.476   1.00 3.86  ? 72  PRO A CG   1 
ATOM   372   C  CD   . PRO A 1 40  ? 31.456  -6.000  7.994   1.00 4.17  ? 72  PRO A CD   1 
ATOM   373   N  N    . GLU A 1 41  ? 35.649  -5.504  9.692   1.00 5.56  ? 73  GLU A N    1 
ATOM   374   C  CA   . GLU A 1 41  ? 36.668  -6.267  10.378  1.00 8.73  ? 73  GLU A CA   1 
ATOM   375   C  C    . GLU A 1 41  ? 35.938  -6.388  11.713  1.00 8.37  ? 73  GLU A C    1 
ATOM   376   O  O    . GLU A 1 41  ? 35.121  -5.515  12.044  1.00 5.60  ? 73  GLU A O    1 
ATOM   377   C  CB   . GLU A 1 41  ? 37.967  -5.437  10.549  1.00 12.38 ? 73  GLU A CB   1 
ATOM   378   C  CG   . GLU A 1 41  ? 38.572  -4.838  9.252   1.00 15.63 ? 73  GLU A CG   1 
ATOM   379   C  CD   . GLU A 1 41  ? 39.291  -3.486  9.457   1.00 19.85 ? 73  GLU A CD   1 
ATOM   380   O  OE1  . GLU A 1 41  ? 39.189  -2.888  10.556  1.00 22.03 ? 73  GLU A OE1  1 
ATOM   381   O  OE2  . GLU A 1 41  ? 39.946  -2.996  8.505   1.00 21.55 ? 73  GLU A OE2  1 
ATOM   382   H  H    . GLU A 1 41  ? 35.689  -4.525  9.723   1.00 17.00 ? 73  GLU A H    1 
ATOM   383   N  N    . PHE A 1 42  ? 36.212  -7.441  12.482  1.00 10.12 ? 74  PHE A N    1 
ATOM   384   C  CA   . PHE A 1 42  ? 35.539  -7.607  13.766  1.00 11.90 ? 74  PHE A CA   1 
ATOM   385   C  C    . PHE A 1 42  ? 35.515  -6.323  14.590  1.00 10.05 ? 74  PHE A C    1 
ATOM   386   O  O    . PHE A 1 42  ? 34.441  -5.865  14.960  1.00 12.69 ? 74  PHE A O    1 
ATOM   387   C  CB   . PHE A 1 42  ? 36.085  -8.794  14.587  1.00 13.17 ? 74  PHE A CB   1 
ATOM   388   C  CG   . PHE A 1 42  ? 35.027  -9.831  14.940  1.00 15.16 ? 74  PHE A CG   1 
ATOM   389   C  CD1  . PHE A 1 42  ? 33.770  -9.444  15.383  1.00 18.36 ? 74  PHE A CD1  1 
ATOM   390   C  CD2  . PHE A 1 42  ? 35.277  -11.189 14.774  1.00 20.17 ? 74  PHE A CD2  1 
ATOM   391   C  CE1  . PHE A 1 42  ? 32.771  -10.385 15.650  1.00 21.87 ? 74  PHE A CE1  1 
ATOM   392   C  CE2  . PHE A 1 42  ? 34.289  -12.156 15.036  1.00 21.63 ? 74  PHE A CE2  1 
ATOM   393   C  CZ   . PHE A 1 42  ? 33.033  -11.754 15.474  1.00 22.81 ? 74  PHE A CZ   1 
ATOM   394   H  H    . PHE A 1 42  ? 36.846  -8.114  12.164  1.00 17.00 ? 74  PHE A H    1 
ATOM   395   N  N    . LEU A 1 43  ? 36.662  -5.705  14.826  1.00 8.65  ? 75  LEU A N    1 
ATOM   396   C  CA   . LEU A 1 43  ? 36.696  -4.468  15.618  1.00 10.40 ? 75  LEU A CA   1 
ATOM   397   C  C    . LEU A 1 43  ? 35.578  -3.486  15.216  1.00 9.99  ? 75  LEU A C    1 
ATOM   398   O  O    . LEU A 1 43  ? 34.918  -2.874  16.081  1.00 2.67  ? 75  LEU A O    1 
ATOM   399   C  CB   . LEU A 1 43  ? 38.062  -3.786  15.488  1.00 12.86 ? 75  LEU A CB   1 
ATOM   400   C  CG   . LEU A 1 43  ? 38.187  -2.333  16.002  1.00 13.18 ? 75  LEU A CG   1 
ATOM   401   C  CD1  . LEU A 1 43  ? 38.016  -2.263  17.537  1.00 9.43  ? 75  LEU A CD1  1 
ATOM   402   C  CD2  . LEU A 1 43  ? 39.532  -1.711  15.540  1.00 12.30 ? 75  LEU A CD2  1 
ATOM   403   H  H    . LEU A 1 43  ? 37.493  -6.074  14.476  1.00 17.00 ? 75  LEU A H    1 
ATOM   404   N  N    . THR A 1 44  ? 35.392  -3.354  13.899  1.00 9.68  ? 76  THR A N    1 
ATOM   405   C  CA   . THR A 1 44  ? 34.353  -2.501  13.324  1.00 11.34 ? 76  THR A CA   1 
ATOM   406   C  C    . THR A 1 44  ? 33.014  -2.945  13.920  1.00 10.19 ? 76  THR A C    1 
ATOM   407   O  O    . THR A 1 44  ? 32.333  -2.177  14.616  1.00 9.00  ? 76  THR A O    1 
ATOM   408   C  CB   . THR A 1 44  ? 34.266  -2.706  11.791  1.00 12.11 ? 76  THR A CB   1 
ATOM   409   O  OG1  . THR A 1 44  ? 35.583  -2.653  11.232  1.00 12.73 ? 76  THR A OG1  1 
ATOM   410   C  CG2  . THR A 1 44  ? 33.365  -1.645  11.142  1.00 10.45 ? 76  THR A CG2  1 
ATOM   411   H  H    . THR A 1 44  ? 35.949  -3.834  13.257  1.00 17.00 ? 76  THR A H    1 
ATOM   412   H  HG1  . THR A 1 44  ? 35.481  -2.656  10.286  1.00 17.00 ? 76  THR A HG1  1 
ATOM   413   N  N    . ARG A 1 45  ? 32.672  -4.201  13.643  1.00 7.60  ? 77  ARG A N    1 
ATOM   414   C  CA   . ARG A 1 45  ? 31.459  -4.815  14.127  1.00 4.57  ? 77  ARG A CA   1 
ATOM   415   C  C    . ARG A 1 45  ? 31.223  -4.358  15.538  1.00 4.93  ? 77  ARG A C    1 
ATOM   416   O  O    . ARG A 1 45  ? 30.235  -3.699  15.807  1.00 7.95  ? 77  ARG A O    1 
ATOM   417   C  CB   . ARG A 1 45  ? 31.606  -6.328  14.092  1.00 6.64  ? 77  ARG A CB   1 
ATOM   418   C  CG   . ARG A 1 45  ? 31.991  -6.851  12.737  1.00 5.63  ? 77  ARG A CG   1 
ATOM   419   C  CD   . ARG A 1 45  ? 32.193  -8.339  12.734  1.00 8.76  ? 77  ARG A CD   1 
ATOM   420   N  NE   . ARG A 1 45  ? 33.344  -8.682  11.896  1.00 16.97 ? 77  ARG A NE   1 
ATOM   421   C  CZ   . ARG A 1 45  ? 33.627  -9.906  11.445  1.00 20.57 ? 77  ARG A CZ   1 
ATOM   422   N  NH1  . ARG A 1 45  ? 32.844  -10.940 11.743  1.00 22.40 ? 77  ARG A NH1  1 
ATOM   423   N  NH2  . ARG A 1 45  ? 34.702  -10.103 10.686  1.00 22.21 ? 77  ARG A NH2  1 
ATOM   424   H  H    . ARG A 1 45  ? 33.304  -4.745  13.125  1.00 17.00 ? 77  ARG A H    1 
ATOM   425   H  HE   . ARG A 1 45  ? 33.950  -7.961  11.632  1.00 17.00 ? 77  ARG A HE   1 
ATOM   426   H  HH11 . ARG A 1 45  ? 32.036  -10.802 12.317  1.00 17.00 ? 77  ARG A HH11 1 
ATOM   427   H  HH12 . ARG A 1 45  ? 33.061  -11.854 11.402  1.00 17.00 ? 77  ARG A HH12 1 
ATOM   428   H  HH21 . ARG A 1 45  ? 35.304  -9.340  10.454  1.00 17.00 ? 77  ARG A HH21 1 
ATOM   429   H  HH22 . ARG A 1 45  ? 34.907  -11.023 10.354  1.00 17.00 ? 77  ARG A HH22 1 
ATOM   430   N  N    . ILE A 1 46  ? 32.199  -4.602  16.398  1.00 7.10  ? 78  ILE A N    1 
ATOM   431   C  CA   . ILE A 1 46  ? 32.141  -4.211  17.803  1.00 10.44 ? 78  ILE A CA   1 
ATOM   432   C  C    . ILE A 1 46  ? 31.789  -2.717  18.012  1.00 11.89 ? 78  ILE A C    1 
ATOM   433   O  O    . ILE A 1 46  ? 30.936  -2.372  18.840  1.00 10.15 ? 78  ILE A O    1 
ATOM   434   C  CB   . ILE A 1 46  ? 33.485  -4.548  18.471  1.00 11.88 ? 78  ILE A CB   1 
ATOM   435   C  CG1  . ILE A 1 46  ? 33.745  -6.039  18.311  1.00 13.60 ? 78  ILE A CG1  1 
ATOM   436   C  CG2  . ILE A 1 46  ? 33.509  -4.148  19.970  1.00 12.63 ? 78  ILE A CG2  1 
ATOM   437   C  CD1  . ILE A 1 46  ? 35.181  -6.413  18.551  1.00 17.06 ? 78  ILE A CD1  1 
ATOM   438   H  H    . ILE A 1 46  ? 33.002  -5.038  16.047  1.00 17.00 ? 78  ILE A H    1 
ATOM   439   N  N    . LYS A 1 47  ? 32.454  -1.830  17.275  1.00 13.42 ? 79  LYS A N    1 
ATOM   440   C  CA   . LYS A 1 47  ? 32.172  -0.395  17.408  1.00 13.95 ? 79  LYS A CA   1 
ATOM   441   C  C    . LYS A 1 47  ? 30.730  -0.204  16.990  1.00 13.70 ? 79  LYS A C    1 
ATOM   442   O  O    . LYS A 1 47  ? 29.880  0.101   17.819  1.00 15.82 ? 79  LYS A O    1 
ATOM   443   C  CB   . LYS A 1 47  ? 33.060  0.479   16.501  1.00 13.97 ? 79  LYS A CB   1 
ATOM   444   C  CG   . LYS A 1 47  ? 34.548  0.469   16.785  1.00 14.17 ? 79  LYS A CG   1 
ATOM   445   C  CD   . LYS A 1 47  ? 35.266  1.385   15.788  1.00 15.93 ? 79  LYS A CD   1 
ATOM   446   C  CE   . LYS A 1 47  ? 36.813  1.249   15.791  1.00 18.07 ? 79  LYS A CE   1 
ATOM   447   N  NZ   . LYS A 1 47  ? 37.500  1.543   17.098  1.00 16.09 ? 79  LYS A NZ   1 
ATOM   448   H  H    . LYS A 1 47  ? 33.121  -2.149  16.632  1.00 17.00 ? 79  LYS A H    1 
ATOM   449   H  HZ1  . LYS A 1 47  ? 37.292  2.518   17.394  1.00 17.00 ? 79  LYS A HZ1  1 
ATOM   450   H  HZ2  . LYS A 1 47  ? 37.133  0.882   17.813  1.00 17.00 ? 79  LYS A HZ2  1 
ATOM   451   H  HZ3  . LYS A 1 47  ? 38.526  1.414   16.997  1.00 17.00 ? 79  LYS A HZ3  1 
ATOM   452   N  N    . LEU A 1 48  ? 30.457  -0.456  15.712  1.00 12.20 ? 80  LEU A N    1 
ATOM   453   C  CA   . LEU A 1 48  ? 29.115  -0.299  15.143  1.00 10.81 ? 80  LEU A CA   1 
ATOM   454   C  C    . LEU A 1 48  ? 28.023  -0.771  16.085  1.00 9.85  ? 80  LEU A C    1 
ATOM   455   O  O    . LEU A 1 48  ? 27.178  0.025   16.520  1.00 7.00  ? 80  LEU A O    1 
ATOM   456   C  CB   . LEU A 1 48  ? 28.972  -1.063  13.819  1.00 7.18  ? 80  LEU A CB   1 
ATOM   457   C  CG   . LEU A 1 48  ? 29.976  -0.866  12.694  1.00 5.77  ? 80  LEU A CG   1 
ATOM   458   C  CD1  . LEU A 1 48  ? 29.291  -1.261  11.413  1.00 4.62  ? 80  LEU A CD1  1 
ATOM   459   C  CD2  . LEU A 1 48  ? 30.465  0.570   12.622  1.00 7.39  ? 80  LEU A CD2  1 
ATOM   460   H  H    . LEU A 1 48  ? 31.186  -0.786  15.155  1.00 17.00 ? 80  LEU A H    1 
ATOM   461   N  N    . LEU A 1 49  ? 28.098  -2.052  16.443  1.00 9.05  ? 81  LEU A N    1 
ATOM   462   C  CA   . LEU A 1 49  ? 27.118  -2.679  17.323  1.00 10.71 ? 81  LEU A CA   1 
ATOM   463   C  C    . LEU A 1 49  ? 27.185  -2.153  18.746  1.00 9.51  ? 81  LEU A C    1 
ATOM   464   O  O    . LEU A 1 49  ? 26.772  -2.834  19.685  1.00 10.21 ? 81  LEU A O    1 
ATOM   465   C  CB   . LEU A 1 49  ? 27.277  -4.203  17.334  1.00 11.32 ? 81  LEU A CB   1 
ATOM   466   C  CG   . LEU A 1 49  ? 27.289  -4.955  15.998  1.00 11.98 ? 81  LEU A CG   1 
ATOM   467   C  CD1  . LEU A 1 49  ? 27.526  -6.454  16.255  1.00 14.46 ? 81  LEU A CD1  1 
ATOM   468   C  CD2  . LEU A 1 49  ? 26.012  -4.746  15.232  1.00 11.05 ? 81  LEU A CD2  1 
ATOM   469   H  H    . LEU A 1 49  ? 28.854  -2.573  16.125  1.00 17.00 ? 81  LEU A H    1 
ATOM   470   N  N    . LEU A 1 50  ? 27.709  -0.944  18.897  1.00 9.83  ? 82  LEU A N    1 
ATOM   471   C  CA   . LEU A 1 50  ? 27.833  -0.316  20.197  1.00 9.95  ? 82  LEU A CA   1 
ATOM   472   C  C    . LEU A 1 50  ? 27.858  1.209   20.015  1.00 9.73  ? 82  LEU A C    1 
ATOM   473   O  O    . LEU A 1 50  ? 28.312  1.945   20.892  1.00 11.63 ? 82  LEU A O    1 
ATOM   474   C  CB   . LEU A 1 50  ? 29.118  -0.796  20.890  1.00 7.27  ? 82  LEU A CB   1 
ATOM   475   C  CG   . LEU A 1 50  ? 28.953  -1.143  22.367  1.00 4.60  ? 82  LEU A CG   1 
ATOM   476   C  CD1  . LEU A 1 50  ? 28.721  -2.624  22.474  1.00 4.86  ? 82  LEU A CD1  1 
ATOM   477   C  CD2  . LEU A 1 50  ? 30.161  -0.708  23.189  1.00 3.61  ? 82  LEU A CD2  1 
ATOM   478   H  H    . LEU A 1 50  ? 28.083  -0.417  18.181  1.00 17.00 ? 82  LEU A H    1 
ATOM   479   N  N    . LYS A 1 51  ? 27.427  1.699   18.860  1.00 9.23  ? 83  LYS A N    1 
ATOM   480   C  CA   . LYS A 1 51  ? 27.422  3.140   18.684  1.00 9.56  ? 83  LYS A CA   1 
ATOM   481   C  C    . LYS A 1 51  ? 26.011  3.683   18.682  1.00 9.55  ? 83  LYS A C    1 
ATOM   482   O  O    . LYS A 1 51  ? 25.095  3.122   18.062  1.00 11.26 ? 83  LYS A O    1 
ATOM   483   C  CB   . LYS A 1 51  ? 28.169  3.581   17.435  1.00 11.77 ? 83  LYS A CB   1 
ATOM   484   C  CG   . LYS A 1 51  ? 27.356  3.588   16.168  1.00 14.07 ? 83  LYS A CG   1 
ATOM   485   C  CD   . LYS A 1 51  ? 27.619  4.863   15.409  1.00 18.13 ? 83  LYS A CD   1 
ATOM   486   C  CE   . LYS A 1 51  ? 27.249  6.085   16.244  1.00 20.72 ? 83  LYS A CE   1 
ATOM   487   N  NZ   . LYS A 1 51  ? 27.690  7.360   15.607  1.00 21.81 ? 83  LYS A NZ   1 
ATOM   488   H  H    . LYS A 1 51  ? 27.095  1.119   18.143  1.00 17.00 ? 83  LYS A H    1 
ATOM   489   H  HZ1  . LYS A 1 51  ? 27.265  7.442   14.662  1.00 17.00 ? 83  LYS A HZ1  1 
ATOM   490   H  HZ2  . LYS A 1 51  ? 27.369  8.152   16.199  1.00 17.00 ? 83  LYS A HZ2  1 
ATOM   491   H  HZ3  . LYS A 1 51  ? 28.727  7.381   15.533  1.00 17.00 ? 83  LYS A HZ3  1 
ATOM   492   N  N    . PRO A 1 52  ? 25.795  4.749   19.449  1.00 10.55 ? 84  PRO A N    1 
ATOM   493   C  CA   . PRO A 1 52  ? 24.484  5.397   19.562  1.00 10.07 ? 84  PRO A CA   1 
ATOM   494   C  C    . PRO A 1 52  ? 24.178  6.482   18.523  1.00 8.69  ? 84  PRO A C    1 
ATOM   495   O  O    . PRO A 1 52  ? 24.979  7.388   18.270  1.00 5.00  ? 84  PRO A O    1 
ATOM   496   C  CB   . PRO A 1 52  ? 24.529  5.965   20.974  1.00 10.99 ? 84  PRO A CB   1 
ATOM   497   C  CG   . PRO A 1 52  ? 25.957  6.377   21.099  1.00 10.15 ? 84  PRO A CG   1 
ATOM   498   C  CD   . PRO A 1 52  ? 26.707  5.203   20.511  1.00 7.98  ? 84  PRO A CD   1 
ATOM   499   N  N    . THR A 1 53  ? 22.986  6.364   17.952  1.00 9.58  ? 85  THR A N    1 
ATOM   500   C  CA   . THR A 1 53  ? 22.432  7.287   16.952  1.00 10.67 ? 85  THR A CA   1 
ATOM   501   C  C    . THR A 1 53  ? 22.583  8.763   17.378  1.00 8.67  ? 85  THR A C    1 
ATOM   502   O  O    . THR A 1 53  ? 22.345  9.113   18.537  1.00 4.70  ? 85  THR A O    1 
ATOM   503   C  CB   . THR A 1 53  ? 20.897  7.016   16.808  1.00 12.19 ? 85  THR A CB   1 
ATOM   504   O  OG1  . THR A 1 53  ? 20.663  5.609   16.687  1.00 12.53 ? 85  THR A OG1  1 
ATOM   505   C  CG2  . THR A 1 53  ? 20.290  7.737   15.622  1.00 12.72 ? 85  THR A CG2  1 
ATOM   506   H  H    . THR A 1 53  ? 22.405  5.626   18.231  1.00 17.00 ? 85  THR A H    1 
ATOM   507   H  HG1  . THR A 1 53  ? 21.156  5.242   15.947  1.00 17.00 ? 85  THR A HG1  1 
ATOM   508   N  N    . PRO A 1 54  ? 22.852  9.662   16.410  1.00 10.37 ? 86  PRO A N    1 
ATOM   509   C  CA   . PRO A 1 54  ? 23.005  11.081  16.725  1.00 10.68 ? 86  PRO A CA   1 
ATOM   510   C  C    . PRO A 1 54  ? 21.780  11.591  17.494  1.00 12.30 ? 86  PRO A C    1 
ATOM   511   O  O    . PRO A 1 54  ? 21.831  12.581  18.221  1.00 14.17 ? 86  PRO A O    1 
ATOM   512   C  CB   . PRO A 1 54  ? 23.107  11.721  15.329  1.00 10.95 ? 86  PRO A CB   1 
ATOM   513   C  CG   . PRO A 1 54  ? 22.320  10.810  14.461  1.00 11.52 ? 86  PRO A CG   1 
ATOM   514   C  CD   . PRO A 1 54  ? 22.840  9.477   14.943  1.00 11.91 ? 86  PRO A CD   1 
ATOM   515   N  N    . ASN A 1 55  ? 20.669  10.891  17.331  1.00 12.26 ? 87  ASN A N    1 
ATOM   516   C  CA   . ASN A 1 55  ? 19.435  11.256  18.003  1.00 9.07  ? 87  ASN A CA   1 
ATOM   517   C  C    . ASN A 1 55  ? 19.488  10.692  19.419  1.00 7.17  ? 87  ASN A C    1 
ATOM   518   O  O    . ASN A 1 55  ? 19.237  11.400  20.385  1.00 4.00  ? 87  ASN A O    1 
ATOM   519   C  CB   . ASN A 1 55  ? 18.225  10.680  17.252  1.00 10.72 ? 87  ASN A CB   1 
ATOM   520   C  CG   . ASN A 1 55  ? 18.221  11.031  15.766  1.00 9.51  ? 87  ASN A CG   1 
ATOM   521   O  OD1  . ASN A 1 55  ? 18.013  12.173  15.375  1.00 7.60  ? 87  ASN A OD1  1 
ATOM   522   N  ND2  . ASN A 1 55  ? 18.412  10.022  14.934  1.00 9.31  ? 87  ASN A ND2  1 
ATOM   523   H  H    . ASN A 1 55  ? 20.692  10.137  16.720  1.00 17.00 ? 87  ASN A H    1 
ATOM   524   H  HD21 . ASN A 1 55  ? 18.478  10.277  13.989  1.00 17.00 ? 87  ASN A HD21 1 
ATOM   525   H  HD22 . ASN A 1 55  ? 18.472  9.111   15.265  1.00 17.00 ? 87  ASN A HD22 1 
ATOM   526   N  N    . THR A 1 56  ? 19.897  9.432   19.537  1.00 8.10  ? 88  THR A N    1 
ATOM   527   C  CA   . THR A 1 56  ? 19.969  8.775   20.844  1.00 10.16 ? 88  THR A CA   1 
ATOM   528   C  C    . THR A 1 56  ? 21.036  9.486   21.649  1.00 10.36 ? 88  THR A C    1 
ATOM   529   O  O    . THR A 1 56  ? 21.104  9.386   22.886  1.00 10.69 ? 88  THR A O    1 
ATOM   530   C  CB   . THR A 1 56  ? 20.286  7.263   20.733  1.00 7.47  ? 88  THR A CB   1 
ATOM   531   O  OG1  . THR A 1 56  ? 21.574  7.086   20.151  1.00 8.50  ? 88  THR A OG1  1 
ATOM   532   C  CG2  . THR A 1 56  ? 19.247  6.556   19.864  1.00 7.66  ? 88  THR A CG2  1 
ATOM   533   H  H    . THR A 1 56  ? 20.209  8.916   18.771  1.00 17.00 ? 88  THR A H    1 
ATOM   534   H  HG1  . THR A 1 56  ? 22.249  7.521   20.687  1.00 17.00 ? 88  THR A HG1  1 
ATOM   535   N  N    . VAL A 1 57  ? 21.853  10.220  20.905  1.00 11.04 ? 89  VAL A N    1 
ATOM   536   C  CA   . VAL A 1 57  ? 22.928  11.008  21.446  1.00 11.66 ? 89  VAL A CA   1 
ATOM   537   C  C    . VAL A 1 57  ? 22.332  12.347  21.857  1.00 13.29 ? 89  VAL A C    1 
ATOM   538   O  O    . VAL A 1 57  ? 22.527  12.808  23.008  1.00 12.47 ? 89  VAL A O    1 
ATOM   539   C  CB   . VAL A 1 57  ? 24.007  11.172  20.371  1.00 9.95  ? 89  VAL A CB   1 
ATOM   540   C  CG1  . VAL A 1 57  ? 24.841  12.397  20.614  1.00 10.43 ? 89  VAL A CG1  1 
ATOM   541   C  CG2  . VAL A 1 57  ? 24.880  9.925   20.342  1.00 10.01 ? 89  VAL A CG2  1 
ATOM   542   H  H    . VAL A 1 57  ? 21.768  10.213  19.939  1.00 17.00 ? 89  VAL A H    1 
ATOM   543   N  N    . HIS A 1 58  ? 21.532  12.909  20.938  1.00 13.63 ? 90  HIS A N    1 
ATOM   544   C  CA   . HIS A 1 58  ? 20.867  14.201  21.130  1.00 12.86 ? 90  HIS A CA   1 
ATOM   545   C  C    . HIS A 1 58  ? 19.914  14.181  22.312  1.00 12.66 ? 90  HIS A C    1 
ATOM   546   O  O    . HIS A 1 58  ? 19.886  15.117  23.111  1.00 12.32 ? 90  HIS A O    1 
ATOM   547   C  CB   . HIS A 1 58  ? 20.093  14.626  19.874  1.00 10.25 ? 90  HIS A CB   1 
ATOM   548   C  CG   . HIS A 1 58  ? 19.718  16.084  19.856  1.00 12.74 ? 90  HIS A CG   1 
ATOM   549   N  ND1  . HIS A 1 58  ? 18.777  16.634  20.703  1.00 12.18 ? 90  HIS A ND1  1 
ATOM   550   C  CD2  . HIS A 1 58  ? 20.193  17.116  19.113  1.00 14.18 ? 90  HIS A CD2  1 
ATOM   551   C  CE1  . HIS A 1 58  ? 18.691  17.935  20.483  1.00 12.41 ? 90  HIS A CE1  1 
ATOM   552   N  NE2  . HIS A 1 58  ? 19.540  18.255  19.524  1.00 10.89 ? 90  HIS A NE2  1 
ATOM   553   H  H    . HIS A 1 58  ? 21.396  12.435  20.097  1.00 17.00 ? 90  HIS A H    1 
ATOM   554   H  HD1  . HIS A 1 58  ? 18.314  16.205  21.460  1.00 17.00 ? 90  HIS A HD1  1 
ATOM   555   H  HE2  . HIS A 1 58  ? 19.705  19.177  19.218  1.00 17.00 ? 90  HIS A HE2  1 
ATOM   556   N  N    . TYR A 1 59  ? 19.138  13.110  22.430  1.00 11.83 ? 91  TYR A N    1 
ATOM   557   C  CA   . TYR A 1 59  ? 18.173  13.002  23.516  1.00 13.34 ? 91  TYR A CA   1 
ATOM   558   C  C    . TYR A 1 59  ? 18.844  13.226  24.858  1.00 11.80 ? 91  TYR A C    1 
ATOM   559   O  O    . TYR A 1 59  ? 18.508  14.184  25.564  1.00 13.65 ? 91  TYR A O    1 
ATOM   560   C  CB   . TYR A 1 59  ? 17.483  11.636  23.525  1.00 16.41 ? 91  TYR A CB   1 
ATOM   561   C  CG   . TYR A 1 59  ? 16.414  11.514  24.593  1.00 17.37 ? 91  TYR A CG   1 
ATOM   562   C  CD1  . TYR A 1 59  ? 15.089  11.913  24.333  1.00 17.52 ? 91  TYR A CD1  1 
ATOM   563   C  CD2  . TYR A 1 59  ? 16.715  11.005  25.865  1.00 17.81 ? 91  TYR A CD2  1 
ATOM   564   C  CE1  . TYR A 1 59  ? 14.086  11.807  25.310  1.00 13.96 ? 91  TYR A CE1  1 
ATOM   565   C  CE2  . TYR A 1 59  ? 15.715  10.903  26.851  1.00 17.19 ? 91  TYR A CE2  1 
ATOM   566   C  CZ   . TYR A 1 59  ? 14.407  11.308  26.558  1.00 14.20 ? 91  TYR A CZ   1 
ATOM   567   O  OH   . TYR A 1 59  ? 13.431  11.249  27.517  1.00 13.57 ? 91  TYR A OH   1 
ATOM   568   H  H    . TYR A 1 59  ? 19.260  12.367  21.834  1.00 17.00 ? 91  TYR A H    1 
ATOM   569   H  HH   . TYR A 1 59  ? 12.555  11.320  27.125  1.00 17.00 ? 91  TYR A HH   1 
ATOM   570   N  N    . ILE A 1 60  ? 19.773  12.340  25.206  1.00 8.50  ? 92  ILE A N    1 
ATOM   571   C  CA   . ILE A 1 60  ? 20.494  12.445  26.462  1.00 7.84  ? 92  ILE A CA   1 
ATOM   572   C  C    . ILE A 1 60  ? 20.967  13.874  26.675  1.00 9.67  ? 92  ILE A C    1 
ATOM   573   O  O    . ILE A 1 60  ? 20.635  14.517  27.685  1.00 8.53  ? 92  ILE A O    1 
ATOM   574   C  CB   . ILE A 1 60  ? 21.730  11.589  26.438  1.00 8.31  ? 92  ILE A CB   1 
ATOM   575   C  CG1  . ILE A 1 60  ? 21.357  10.191  25.965  1.00 8.36  ? 92  ILE A CG1  1 
ATOM   576   C  CG2  . ILE A 1 60  ? 22.377  11.592  27.826  1.00 6.64  ? 92  ILE A CG2  1 
ATOM   577   C  CD1  . ILE A 1 60  ? 22.531  9.334   25.665  1.00 6.88  ? 92  ILE A CD1  1 
ATOM   578   H  H    . ILE A 1 60  ? 19.985  11.619  24.578  1.00 17.00 ? 92  ILE A H    1 
ATOM   579   N  N    . LEU A 1 61  ? 21.667  14.373  25.656  1.00 9.41  ? 93  LEU A N    1 
ATOM   580   C  CA   . LEU A 1 61  ? 22.233  15.706  25.637  1.00 8.45  ? 93  LEU A CA   1 
ATOM   581   C  C    . LEU A 1 61  ? 21.239  16.836  25.846  1.00 8.12  ? 93  LEU A C    1 
ATOM   582   O  O    . LEU A 1 61  ? 21.643  17.895  26.341  1.00 11.33 ? 93  LEU A O    1 
ATOM   583   C  CB   . LEU A 1 61  ? 23.000  15.905  24.326  1.00 9.69  ? 93  LEU A CB   1 
ATOM   584   C  CG   . LEU A 1 61  ? 24.323  16.702  24.291  1.00 10.50 ? 93  LEU A CG   1 
ATOM   585   C  CD1  . LEU A 1 61  ? 25.139  16.634  25.619  1.00 4.09  ? 93  LEU A CD1  1 
ATOM   586   C  CD2  . LEU A 1 61  ? 25.124  16.139  23.109  1.00 6.07  ? 93  LEU A CD2  1 
ATOM   587   H  H    . LEU A 1 61  ? 21.809  13.818  24.860  1.00 17.00 ? 93  LEU A H    1 
ATOM   588   N  N    . THR A 1 62  ? 19.969  16.638  25.474  1.00 7.21  ? 94  THR A N    1 
ATOM   589   C  CA   . THR A 1 62  ? 18.984  17.697  25.654  1.00 7.03  ? 94  THR A CA   1 
ATOM   590   C  C    . THR A 1 62  ? 18.130  17.471  26.881  1.00 5.31  ? 94  THR A C    1 
ATOM   591   O  O    . THR A 1 62  ? 17.515  18.403  27.400  1.00 6.47  ? 94  THR A O    1 
ATOM   592   C  CB   . THR A 1 62  ? 18.094  17.915  24.412  1.00 6.03  ? 94  THR A CB   1 
ATOM   593   O  OG1  . THR A 1 62  ? 18.842  17.677  23.220  1.00 2.00  ? 94  THR A OG1  1 
ATOM   594   C  CG2  . THR A 1 62  ? 17.640  19.356  24.366  1.00 5.24  ? 94  THR A CG2  1 
ATOM   595   H  H    . THR A 1 62  ? 19.700  15.798  25.050  1.00 17.00 ? 94  THR A H    1 
ATOM   596   H  HG1  . THR A 1 62  ? 19.577  18.303  23.344  1.00 17.00 ? 94  THR A HG1  1 
ATOM   597   N  N    . HIS A 1 63  ? 18.161  16.256  27.396  1.00 3.85  ? 95  HIS A N    1 
ATOM   598   C  CA   . HIS A 1 63  ? 17.387  15.934  28.579  1.00 6.30  ? 95  HIS A CA   1 
ATOM   599   C  C    . HIS A 1 63  ? 18.212  15.963  29.872  1.00 7.34  ? 95  HIS A C    1 
ATOM   600   O  O    . HIS A 1 63  ? 19.273  16.583  29.920  1.00 4.17  ? 95  HIS A O    1 
ATOM   601   C  CB   . HIS A 1 63  ? 16.706  14.598  28.363  1.00 3.10  ? 95  HIS A CB   1 
ATOM   602   C  CG   . HIS A 1 63  ? 15.687  14.645  27.273  1.00 3.24  ? 95  HIS A CG   1 
ATOM   603   N  ND1  . HIS A 1 63  ? 14.356  14.891  27.510  1.00 3.98  ? 95  HIS A ND1  1 
ATOM   604   C  CD2  . HIS A 1 63  ? 15.811  14.540  25.932  1.00 4.01  ? 95  HIS A CD2  1 
ATOM   605   C  CE1  . HIS A 1 63  ? 13.704  14.935  26.363  1.00 2.41  ? 95  HIS A CE1  1 
ATOM   606   N  NE2  . HIS A 1 63  ? 14.564  14.723  25.389  1.00 2.00  ? 95  HIS A NE2  1 
ATOM   607   H  H    . HIS A 1 63  ? 18.769  15.586  27.007  1.00 17.00 ? 95  HIS A H    1 
ATOM   608   H  HD1  . HIS A 1 63  ? 13.925  14.992  28.387  1.00 17.00 ? 95  HIS A HD1  1 
ATOM   609   H  HE2  . HIS A 1 63  ? 14.362  14.714  24.429  1.00 17.00 ? 95  HIS A HE2  1 
ATOM   610   N  N    . PHE A 1 64  ? 17.631  15.433  30.950  1.00 8.30  ? 96  PHE A N    1 
ATOM   611   C  CA   . PHE A 1 64  ? 18.285  15.328  32.264  1.00 7.34  ? 96  PHE A CA   1 
ATOM   612   C  C    . PHE A 1 64  ? 18.927  16.570  32.863  1.00 7.00  ? 96  PHE A C    1 
ATOM   613   O  O    . PHE A 1 64  ? 19.949  16.438  33.551  1.00 5.17  ? 96  PHE A O    1 
ATOM   614   C  CB   . PHE A 1 64  ? 19.321  14.211  32.207  1.00 4.33  ? 96  PHE A CB   1 
ATOM   615   C  CG   . PHE A 1 64  ? 18.859  13.034  31.446  1.00 2.81  ? 96  PHE A CG   1 
ATOM   616   C  CD1  . PHE A 1 64  ? 19.049  12.970  30.070  1.00 4.54  ? 96  PHE A CD1  1 
ATOM   617   C  CD2  . PHE A 1 64  ? 18.242  11.984  32.097  1.00 5.05  ? 96  PHE A CD2  1 
ATOM   618   C  CE1  . PHE A 1 64  ? 18.631  11.863  29.346  1.00 8.27  ? 96  PHE A CE1  1 
ATOM   619   C  CE2  . PHE A 1 64  ? 17.814  10.858  31.396  1.00 7.04  ? 96  PHE A CE2  1 
ATOM   620   C  CZ   . PHE A 1 64  ? 18.008  10.791  30.016  1.00 8.39  ? 96  PHE A CZ   1 
ATOM   621   H  H    . PHE A 1 64  ? 16.727  15.074  30.884  1.00 17.00 ? 96  PHE A H    1 
ATOM   622   N  N    . LYS A 1 65  ? 18.275  17.729  32.702  1.00 8.50  ? 97  LYS A N    1 
ATOM   623   C  CA   . LYS A 1 65  ? 18.785  19.026  33.203  1.00 10.72 ? 97  LYS A CA   1 
ATOM   624   C  C    . LYS A 1 65  ? 19.659  18.995  34.457  1.00 10.60 ? 97  LYS A C    1 
ATOM   625   O  O    . LYS A 1 65  ? 20.798  19.468  34.424  1.00 10.95 ? 97  LYS A O    1 
ATOM   626   C  CB   . LYS A 1 65  ? 17.632  20.013  33.429  1.00 10.65 ? 97  LYS A CB   1 
ATOM   627   C  CG   . LYS A 1 65  ? 17.997  21.200  34.311  1.00 11.42 ? 97  LYS A CG   1 
ATOM   628   C  CD   . LYS A 1 65  ? 16.989  22.330  34.203  1.00 11.89 ? 97  LYS A CD   1 
ATOM   629   C  CE   . LYS A 1 65  ? 17.143  23.090  32.878  1.00 13.56 ? 97  LYS A CE   1 
ATOM   630   N  NZ   . LYS A 1 65  ? 16.139  24.185  32.682  1.00 11.58 ? 97  LYS A NZ   1 
ATOM   631   H  H    . LYS A 1 65  ? 17.418  17.693  32.240  1.00 17.00 ? 97  LYS A H    1 
ATOM   632   H  HZ1  . LYS A 1 65  ? 15.181  23.784  32.710  1.00 17.00 ? 97  LYS A HZ1  1 
ATOM   633   H  HZ2  . LYS A 1 65  ? 16.247  24.876  33.453  1.00 17.00 ? 97  LYS A HZ2  1 
ATOM   634   H  HZ3  . LYS A 1 65  ? 16.297  24.658  31.770  1.00 17.00 ? 97  LYS A HZ3  1 
ATOM   635   N  N    . GLY A 1 66  ? 19.107  18.444  35.542  1.00 11.63 ? 98  GLY A N    1 
ATOM   636   C  CA   . GLY A 1 66  ? 19.807  18.340  36.817  1.00 12.07 ? 98  GLY A CA   1 
ATOM   637   C  C    . GLY A 1 66  ? 21.172  17.669  36.762  1.00 12.30 ? 98  GLY A C    1 
ATOM   638   O  O    . GLY A 1 66  ? 22.142  18.164  37.360  1.00 10.80 ? 98  GLY A O    1 
ATOM   639   H  H    . GLY A 1 66  ? 18.199  18.087  35.478  1.00 17.00 ? 98  GLY A H    1 
ATOM   640   N  N    . VAL A 1 67  ? 21.240  16.531  36.071  1.00 10.97 ? 99  VAL A N    1 
ATOM   641   C  CA   . VAL A 1 67  ? 22.497  15.805  35.925  1.00 10.78 ? 99  VAL A CA   1 
ATOM   642   C  C    . VAL A 1 67  ? 23.489  16.742  35.260  1.00 9.16  ? 99  VAL A C    1 
ATOM   643   O  O    . VAL A 1 67  ? 24.503  17.099  35.838  1.00 9.29  ? 99  VAL A O    1 
ATOM   644   C  CB   . VAL A 1 67  ? 22.306  14.543  35.057  1.00 10.58 ? 99  VAL A CB   1 
ATOM   645   C  CG1  . VAL A 1 67  ? 23.640  14.139  34.401  1.00 7.05  ? 99  VAL A CG1  1 
ATOM   646   C  CG2  . VAL A 1 67  ? 21.687  13.408  35.915  1.00 7.39  ? 99  VAL A CG2  1 
ATOM   647   H  H    . VAL A 1 67  ? 20.443  16.186  35.618  1.00 17.00 ? 99  VAL A H    1 
ATOM   648   N  N    . TRP A 1 68  ? 23.134  17.210  34.074  1.00 9.94  ? 100 TRP A N    1 
ATOM   649   C  CA   . TRP A 1 68  ? 23.983  18.118  33.334  1.00 11.52 ? 100 TRP A CA   1 
ATOM   650   C  C    . TRP A 1 68  ? 24.371  19.283  34.203  1.00 10.58 ? 100 TRP A C    1 
ATOM   651   O  O    . TRP A 1 68  ? 25.426  19.864  34.028  1.00 10.37 ? 100 TRP A O    1 
ATOM   652   C  CB   . TRP A 1 68  ? 23.281  18.583  32.058  1.00 11.49 ? 100 TRP A CB   1 
ATOM   653   C  CG   . TRP A 1 68  ? 23.158  17.471  31.077  1.00 13.21 ? 100 TRP A CG   1 
ATOM   654   C  CD1  . TRP A 1 68  ? 22.019  16.849  30.703  1.00 12.91 ? 100 TRP A CD1  1 
ATOM   655   C  CD2  . TRP A 1 68  ? 24.227  16.803  30.394  1.00 13.62 ? 100 TRP A CD2  1 
ATOM   656   N  NE1  . TRP A 1 68  ? 22.295  15.836  29.833  1.00 14.30 ? 100 TRP A NE1  1 
ATOM   657   C  CE2  . TRP A 1 68  ? 23.645  15.781  29.624  1.00 13.62 ? 100 TRP A CE2  1 
ATOM   658   C  CE3  . TRP A 1 68  ? 25.621  16.965  30.366  1.00 15.18 ? 100 TRP A CE3  1 
ATOM   659   C  CZ2  . TRP A 1 68  ? 24.400  14.920  28.828  1.00 15.04 ? 100 TRP A CZ2  1 
ATOM   660   C  CZ3  . TRP A 1 68  ? 26.376  16.109  29.575  1.00 14.45 ? 100 TRP A CZ3  1 
ATOM   661   C  CH2  . TRP A 1 68  ? 25.763  15.100  28.817  1.00 15.54 ? 100 TRP A CH2  1 
ATOM   662   H  H    . TRP A 1 68  ? 22.271  16.939  33.694  1.00 17.00 ? 100 TRP A H    1 
ATOM   663   H  HE1  . TRP A 1 68  ? 21.609  15.273  29.401  1.00 17.00 ? 100 TRP A HE1  1 
ATOM   664   N  N    . ASN A 1 69  ? 23.510  19.621  35.146  1.00 12.73 ? 101 ASN A N    1 
ATOM   665   C  CA   . ASN A 1 69  ? 23.801  20.705  36.050  1.00 13.47 ? 101 ASN A CA   1 
ATOM   666   C  C    . ASN A 1 69  ? 24.993  20.247  36.872  1.00 12.64 ? 101 ASN A C    1 
ATOM   667   O  O    . ASN A 1 69  ? 26.013  20.931  36.964  1.00 13.53 ? 101 ASN A O    1 
ATOM   668   C  CB   . ASN A 1 69  ? 22.604  20.980  36.945  1.00 15.54 ? 101 ASN A CB   1 
ATOM   669   C  CG   . ASN A 1 69  ? 21.611  21.912  36.299  1.00 21.56 ? 101 ASN A CG   1 
ATOM   670   O  OD1  . ASN A 1 69  ? 21.971  22.976  35.753  1.00 25.99 ? 101 ASN A OD1  1 
ATOM   671   N  ND2  . ASN A 1 69  ? 20.343  21.533  36.358  1.00 26.55 ? 101 ASN A ND2  1 
ATOM   672   H  H    . ASN A 1 69  ? 22.653  19.160  35.214  1.00 17.00 ? 101 ASN A H    1 
ATOM   673   H  HD21 . ASN A 1 69  ? 19.705  22.147  35.946  1.00 17.00 ? 101 ASN A HD21 1 
ATOM   674   H  HD22 . ASN A 1 69  ? 20.127  20.699  36.801  1.00 17.00 ? 101 ASN A HD22 1 
ATOM   675   N  N    . ILE A 1 70  ? 24.884  19.054  37.424  1.00 11.08 ? 102 ILE A N    1 
ATOM   676   C  CA   . ILE A 1 70  ? 25.946  18.510  38.219  1.00 9.96  ? 102 ILE A CA   1 
ATOM   677   C  C    . ILE A 1 70  ? 27.218  18.489  37.395  1.00 10.32 ? 102 ILE A C    1 
ATOM   678   O  O    . ILE A 1 70  ? 28.262  18.943  37.872  1.00 11.40 ? 102 ILE A O    1 
ATOM   679   C  CB   . ILE A 1 70  ? 25.556  17.123  38.745  1.00 11.31 ? 102 ILE A CB   1 
ATOM   680   C  CG1  . ILE A 1 70  ? 24.419  17.283  39.776  1.00 12.98 ? 102 ILE A CG1  1 
ATOM   681   C  CG2  . ILE A 1 70  ? 26.767  16.406  39.333  1.00 12.29 ? 102 ILE A CG2  1 
ATOM   682   C  CD1  . ILE A 1 70  ? 23.846  15.988  40.340  1.00 11.59 ? 102 ILE A CD1  1 
ATOM   683   H  H    . ILE A 1 70  ? 24.073  18.526  37.274  1.00 17.00 ? 102 ILE A H    1 
ATOM   684   N  N    . VAL A 1 71  ? 27.122  18.054  36.136  1.00 10.45 ? 103 VAL A N    1 
ATOM   685   C  CA   . VAL A 1 71  ? 28.297  18.010  35.252  1.00 9.13  ? 103 VAL A CA   1 
ATOM   686   C  C    . VAL A 1 71  ? 28.899  19.409  35.089  1.00 8.78  ? 103 VAL A C    1 
ATOM   687   O  O    . VAL A 1 71  ? 30.064  19.631  35.387  1.00 8.66  ? 103 VAL A O    1 
ATOM   688   C  CB   . VAL A 1 71  ? 27.949  17.423  33.873  1.00 7.80  ? 103 VAL A CB   1 
ATOM   689   C  CG1  . VAL A 1 71  ? 28.816  18.070  32.784  1.00 8.06  ? 103 VAL A CG1  1 
ATOM   690   C  CG2  . VAL A 1 71  ? 28.164  15.902  33.892  1.00 4.85  ? 103 VAL A CG2  1 
ATOM   691   H  H    . VAL A 1 71  ? 26.251  17.770  35.807  1.00 17.00 ? 103 VAL A H    1 
ATOM   692   N  N    . ASN A 1 72  ? 28.071  20.356  34.679  1.00 10.06 ? 104 ASN A N    1 
ATOM   693   C  CA   . ASN A 1 72  ? 28.511  21.733  34.496  1.00 12.50 ? 104 ASN A CA   1 
ATOM   694   C  C    . ASN A 1 72  ? 29.133  22.332  35.757  1.00 14.36 ? 104 ASN A C    1 
ATOM   695   O  O    . ASN A 1 72  ? 29.831  23.352  35.686  1.00 14.70 ? 104 ASN A O    1 
ATOM   696   C  CB   . ASN A 1 72  ? 27.367  22.605  33.960  1.00 8.23  ? 104 ASN A CB   1 
ATOM   697   C  CG   . ASN A 1 72  ? 26.982  22.232  32.545  1.00 4.35  ? 104 ASN A CG   1 
ATOM   698   O  OD1  . ASN A 1 72  ? 27.467  21.246  32.003  1.00 5.33  ? 104 ASN A OD1  1 
ATOM   699   N  ND2  . ASN A 1 72  ? 26.130  23.019  31.938  1.00 3.38  ? 104 ASN A ND2  1 
ATOM   700   H  H    . ASN A 1 72  ? 27.150  20.124  34.488  1.00 17.00 ? 104 ASN A H    1 
ATOM   701   H  HD21 . ASN A 1 72  ? 25.794  22.811  31.043  1.00 17.00 ? 104 ASN A HD21 1 
ATOM   702   H  HD22 . ASN A 1 72  ? 25.818  23.795  32.446  1.00 17.00 ? 104 ASN A HD22 1 
ATOM   703   N  N    . ASN A 1 73  ? 28.863  21.726  36.909  1.00 16.58 ? 105 ASN A N    1 
ATOM   704   C  CA   . ASN A 1 73  ? 29.487  22.213  38.127  1.00 21.06 ? 105 ASN A CA   1 
ATOM   705   C  C    . ASN A 1 73  ? 30.902  21.598  38.148  1.00 21.97 ? 105 ASN A C    1 
ATOM   706   O  O    . ASN A 1 73  ? 31.900  22.352  38.122  1.00 24.41 ? 105 ASN A O    1 
ATOM   707   C  CB   . ASN A 1 73  ? 28.649  21.885  39.393  1.00 24.32 ? 105 ASN A CB   1 
ATOM   708   C  CG   . ASN A 1 73  ? 29.323  20.865  40.352  1.00 25.66 ? 105 ASN A CG   1 
ATOM   709   O  OD1  . ASN A 1 73  ? 30.464  21.047  40.777  1.00 27.17 ? 105 ASN A OD1  1 
ATOM   710   N  ND2  . ASN A 1 73  ? 28.582  19.818  40.726  1.00 25.42 ? 105 ASN A ND2  1 
ATOM   711   H  H    . ASN A 1 73  ? 28.252  20.964  36.937  1.00 17.00 ? 105 ASN A H    1 
ATOM   712   H  HD21 . ASN A 1 73  ? 29.002  19.180  41.336  1.00 17.00 ? 105 ASN A HD21 1 
ATOM   713   H  HD22 . ASN A 1 73  ? 27.675  19.738  40.376  1.00 17.00 ? 105 ASN A HD22 1 
ATOM   714   N  N    . ILE A 1 74  A 30.985  20.259  38.089  1.00 18.40 ? 105 ILE A N    1 
ATOM   715   C  CA   . ILE A 1 74  A 32.269  19.552  38.110  1.00 16.11 ? 105 ILE A CA   1 
ATOM   716   C  C    . ILE A 1 74  A 33.136  19.930  36.910  1.00 17.16 ? 105 ILE A C    1 
ATOM   717   O  O    . ILE A 1 74  A 32.991  19.368  35.813  1.00 16.30 ? 105 ILE A O    1 
ATOM   718   C  CB   . ILE A 1 74  A 32.088  18.004  38.135  1.00 17.14 ? 105 ILE A CB   1 
ATOM   719   C  CG1  . ILE A 1 74  A 31.525  17.558  39.484  1.00 16.95 ? 105 ILE A CG1  1 
ATOM   720   C  CG2  . ILE A 1 74  A 33.409  17.301  37.878  1.00 13.31 ? 105 ILE A CG2  1 
ATOM   721   C  CD1  . ILE A 1 74  A 31.716  16.075  39.776  1.00 17.76 ? 105 ILE A CD1  1 
ATOM   722   H  H    . ILE A 1 74  A 30.156  19.749  37.982  1.00 17.00 ? 105 ILE A H    1 
ATOM   723   N  N    . PRO A 1 75  ? 34.107  20.839  37.120  1.00 17.47 ? 106 PRO A N    1 
ATOM   724   C  CA   . PRO A 1 75  ? 34.975  21.247  36.006  1.00 16.68 ? 106 PRO A CA   1 
ATOM   725   C  C    . PRO A 1 75  ? 35.766  20.071  35.411  1.00 12.32 ? 106 PRO A C    1 
ATOM   726   O  O    . PRO A 1 75  ? 35.839  19.912  34.195  1.00 11.35 ? 106 PRO A O    1 
ATOM   727   C  CB   . PRO A 1 75  ? 35.877  22.328  36.652  1.00 17.74 ? 106 PRO A CB   1 
ATOM   728   C  CG   . PRO A 1 75  ? 35.004  22.879  37.801  1.00 15.53 ? 106 PRO A CG   1 
ATOM   729   C  CD   . PRO A 1 75  ? 34.475  21.562  38.355  1.00 17.38 ? 106 PRO A CD   1 
ATOM   730   N  N    . PHE A 1 76  ? 36.266  19.200  36.271  1.00 10.57 ? 107 PHE A N    1 
ATOM   731   C  CA   . PHE A 1 76  ? 37.017  18.048  35.808  1.00 12.65 ? 107 PHE A CA   1 
ATOM   732   C  C    . PHE A 1 76  ? 36.141  17.016  35.098  1.00 12.57 ? 107 PHE A C    1 
ATOM   733   O  O    . PHE A 1 76  ? 36.538  15.852  34.941  1.00 14.08 ? 107 PHE A O    1 
ATOM   734   C  CB   . PHE A 1 76  ? 37.815  17.401  36.964  1.00 16.68 ? 107 PHE A CB   1 
ATOM   735   C  CG   . PHE A 1 76  ? 36.965  16.863  38.119  1.00 21.47 ? 107 PHE A CG   1 
ATOM   736   C  CD1  . PHE A 1 76  ? 36.443  17.736  39.108  1.00 22.77 ? 107 PHE A CD1  1 
ATOM   737   C  CD2  . PHE A 1 76  ? 36.759  15.470  38.272  1.00 21.29 ? 107 PHE A CD2  1 
ATOM   738   C  CE1  . PHE A 1 76  ? 35.731  17.221  40.243  1.00 23.47 ? 107 PHE A CE1  1 
ATOM   739   C  CE2  . PHE A 1 76  ? 36.053  14.943  39.401  1.00 22.07 ? 107 PHE A CE2  1 
ATOM   740   C  CZ   . PHE A 1 76  ? 35.539  15.823  40.388  1.00 22.51 ? 107 PHE A CZ   1 
ATOM   741   H  H    . PHE A 1 76  ? 36.130  19.333  37.227  1.00 17.00 ? 107 PHE A H    1 
ATOM   742   N  N    . LEU A 1 77  ? 34.939  17.443  34.703  1.00 11.10 ? 108 LEU A N    1 
ATOM   743   C  CA   . LEU A 1 77  ? 33.966  16.585  34.010  1.00 9.46  ? 108 LEU A CA   1 
ATOM   744   C  C    . LEU A 1 77  ? 33.452  17.258  32.743  1.00 7.62  ? 108 LEU A C    1 
ATOM   745   O  O    . LEU A 1 77  ? 33.348  16.637  31.669  1.00 2.93  ? 108 LEU A O    1 
ATOM   746   C  CB   . LEU A 1 77  ? 32.774  16.295  34.918  1.00 5.94  ? 108 LEU A CB   1 
ATOM   747   C  CG   . LEU A 1 77  ? 32.756  14.938  35.589  1.00 5.57  ? 108 LEU A CG   1 
ATOM   748   C  CD1  . LEU A 1 77  ? 31.484  14.844  36.394  1.00 6.04  ? 108 LEU A CD1  1 
ATOM   749   C  CD2  . LEU A 1 77  ? 32.830  13.828  34.537  1.00 5.21  ? 108 LEU A CD2  1 
ATOM   750   H  H    . LEU A 1 77  ? 34.618  18.342  34.857  1.00 17.00 ? 108 LEU A H    1 
ATOM   751   N  N    . ARG A 1 78  ? 33.079  18.528  32.911  1.00 7.43  ? 109 ARG A N    1 
ATOM   752   C  CA   . ARG A 1 78  ? 32.573  19.351  31.817  1.00 8.83  ? 109 ARG A CA   1 
ATOM   753   C  C    . ARG A 1 78  ? 33.577  19.267  30.657  1.00 10.36 ? 109 ARG A C    1 
ATOM   754   O  O    . ARG A 1 78  ? 33.218  18.894  29.518  1.00 6.92  ? 109 ARG A O    1 
ATOM   755   C  CB   . ARG A 1 78  ? 32.395  20.798  32.286  1.00 8.59  ? 109 ARG A CB   1 
ATOM   756   C  CG   . ARG A 1 78  ? 31.926  21.721  31.174  1.00 11.44 ? 109 ARG A CG   1 
ATOM   757   C  CD   . ARG A 1 78  ? 31.716  23.163  31.622  1.00 9.19  ? 109 ARG A CD   1 
ATOM   758   N  NE   . ARG A 1 78  ? 31.783  24.063  30.470  1.00 8.19  ? 109 ARG A NE   1 
ATOM   759   C  CZ   . ARG A 1 78  ? 31.917  25.380  30.560  1.00 11.63 ? 109 ARG A CZ   1 
ATOM   760   N  NH1  . ARG A 1 78  ? 32.006  25.981  31.749  1.00 15.78 ? 109 ARG A NH1  1 
ATOM   761   N  NH2  . ARG A 1 78  ? 31.951  26.122  29.463  1.00 13.54 ? 109 ARG A NH2  1 
ATOM   762   H  H    . ARG A 1 78  ? 33.123  18.920  33.809  1.00 17.00 ? 109 ARG A H    1 
ATOM   763   H  HE   . ARG A 1 78  ? 31.781  23.671  29.576  1.00 17.00 ? 109 ARG A HE   1 
ATOM   764   H  HH11 . ARG A 1 78  ? 31.975  25.446  32.593  1.00 17.00 ? 109 ARG A HH11 1 
ATOM   765   H  HH12 . ARG A 1 78  ? 32.111  26.974  31.795  1.00 17.00 ? 109 ARG A HH12 1 
ATOM   766   H  HH21 . ARG A 1 78  ? 31.902  25.672  28.581  1.00 17.00 ? 109 ARG A HH21 1 
ATOM   767   H  HH22 . ARG A 1 78  ? 32.051  27.114  29.526  1.00 17.00 ? 109 ARG A HH22 1 
ATOM   768   N  N    . SER A 1 79  ? 34.843  19.519  31.017  1.00 11.16 ? 110 SER A N    1 
ATOM   769   C  CA   . SER A 1 79  ? 36.014  19.467  30.135  1.00 11.51 ? 110 SER A CA   1 
ATOM   770   C  C    . SER A 1 79  ? 36.125  18.086  29.446  1.00 11.86 ? 110 SER A C    1 
ATOM   771   O  O    . SER A 1 79  ? 36.429  17.996  28.253  1.00 9.89  ? 110 SER A O    1 
ATOM   772   C  CB   . SER A 1 79  ? 37.222  19.660  31.015  1.00 9.27  ? 110 SER A CB   1 
ATOM   773   O  OG   . SER A 1 79  ? 37.046  18.781  32.127  1.00 10.71 ? 110 SER A OG   1 
ATOM   774   H  H    . SER A 1 79  ? 35.024  19.733  31.959  1.00 17.00 ? 110 SER A H    1 
ATOM   775   H  HG   . SER A 1 79  ? 37.695  18.999  32.807  1.00 17.00 ? 110 SER A HG   1 
ATOM   776   N  N    . LEU A 1 80  ? 35.944  17.020  30.226  1.00 10.51 ? 111 LEU A N    1 
ATOM   777   C  CA   . LEU A 1 80  ? 36.012  15.678  29.685  1.00 12.48 ? 111 LEU A CA   1 
ATOM   778   C  C    . LEU A 1 80  ? 34.984  15.558  28.559  1.00 13.73 ? 111 LEU A C    1 
ATOM   779   O  O    . LEU A 1 80  ? 35.260  15.041  27.449  1.00 12.86 ? 111 LEU A O    1 
ATOM   780   C  CB   . LEU A 1 80  ? 35.675  14.668  30.775  1.00 12.16 ? 111 LEU A CB   1 
ATOM   781   C  CG   . LEU A 1 80  ? 36.847  14.010  31.479  1.00 12.21 ? 111 LEU A CG   1 
ATOM   782   C  CD1  . LEU A 1 80  ? 36.301  12.815  32.235  1.00 11.77 ? 111 LEU A CD1  1 
ATOM   783   C  CD2  . LEU A 1 80  ? 37.900  13.542  30.457  1.00 11.10 ? 111 LEU A CD2  1 
ATOM   784   H  H    . LEU A 1 80  ? 35.788  17.161  31.184  1.00 17.00 ? 111 LEU A H    1 
ATOM   785   N  N    . ILE A 1 81  ? 33.793  16.064  28.871  1.00 12.73 ? 112 ILE A N    1 
ATOM   786   C  CA   . ILE A 1 81  ? 32.666  16.033  27.951  1.00 10.45 ? 112 ILE A CA   1 
ATOM   787   C  C    . ILE A 1 81  ? 33.020  16.889  26.725  1.00 9.24  ? 112 ILE A C    1 
ATOM   788   O  O    . ILE A 1 81  ? 33.053  16.366  25.594  1.00 9.07  ? 112 ILE A O    1 
ATOM   789   C  CB   . ILE A 1 81  ? 31.360  16.519  28.673  1.00 5.64  ? 112 ILE A CB   1 
ATOM   790   C  CG1  . ILE A 1 81  ? 31.038  15.626  29.874  1.00 2.76  ? 112 ILE A CG1  1 
ATOM   791   C  CG2  . ILE A 1 81  ? 30.184  16.467  27.739  1.00 5.89  ? 112 ILE A CG2  1 
ATOM   792   C  CD1  . ILE A 1 81  ? 30.527  14.283  29.500  1.00 2.00  ? 112 ILE A CD1  1 
ATOM   793   H  H    . ILE A 1 81  ? 33.660  16.471  29.752  1.00 17.00 ? 112 ILE A H    1 
ATOM   794   N  N    . MET A 1 82  ? 33.412  18.146  26.970  1.00 6.87  ? 113 MET A N    1 
ATOM   795   C  CA   . MET A 1 82  ? 33.741  19.087  25.899  1.00 7.52  ? 113 MET A CA   1 
ATOM   796   C  C    . MET A 1 82  ? 34.790  18.518  24.963  1.00 9.40  ? 113 MET A C    1 
ATOM   797   O  O    . MET A 1 82  ? 34.659  18.548  23.728  1.00 6.72  ? 113 MET A O    1 
ATOM   798   C  CB   . MET A 1 82  ? 34.265  20.384  26.482  1.00 5.24  ? 113 MET A CB   1 
ATOM   799   C  CG   . MET A 1 82  ? 34.522  21.438  25.424  1.00 5.64  ? 113 MET A CG   1 
ATOM   800   S  SD   . MET A 1 82  ? 32.967  22.097  24.751  1.00 6.36  ? 113 MET A SD   1 
ATOM   801   C  CE   . MET A 1 82  ? 33.236  22.070  23.009  1.00 2.56  ? 113 MET A CE   1 
ATOM   802   H  H    . MET A 1 82  ? 33.519  18.418  27.881  1.00 17.00 ? 113 MET A H    1 
ATOM   803   N  N    . LYS A 1 83  ? 35.826  17.973  25.587  1.00 12.63 ? 114 LYS A N    1 
ATOM   804   C  CA   . LYS A 1 83  ? 36.948  17.378  24.878  1.00 13.34 ? 114 LYS A CA   1 
ATOM   805   C  C    . LYS A 1 83  ? 36.379  16.334  23.923  1.00 13.68 ? 114 LYS A C    1 
ATOM   806   O  O    . LYS A 1 83  ? 36.735  16.292  22.734  1.00 16.04 ? 114 LYS A O    1 
ATOM   807   C  CB   . LYS A 1 83  ? 37.919  16.717  25.867  1.00 12.00 ? 114 LYS A CB   1 
ATOM   808   C  CG   . LYS A 1 83  ? 39.365  16.711  25.396  1.00 10.99 ? 114 LYS A CG   1 
ATOM   809   C  CD   . LYS A 1 83  ? 40.239  15.787  26.216  1.00 9.05  ? 114 LYS A CD   1 
ATOM   810   C  CE   . LYS A 1 83  ? 39.783  14.354  26.067  1.00 10.23 ? 114 LYS A CE   1 
ATOM   811   N  NZ   . LYS A 1 83  ? 40.681  13.410  26.794  1.00 15.71 ? 114 LYS A NZ   1 
ATOM   812   H  H    . LYS A 1 83  ? 35.817  17.952  26.557  1.00 17.00 ? 114 LYS A H    1 
ATOM   813   H  HZ1  . LYS A 1 83  ? 41.646  13.490  26.414  1.00 17.00 ? 114 LYS A HZ1  1 
ATOM   814   H  HZ2  . LYS A 1 83  ? 40.690  13.639  27.808  1.00 17.00 ? 114 LYS A HZ2  1 
ATOM   815   H  HZ3  . LYS A 1 83  ? 40.335  12.440  26.656  1.00 17.00 ? 114 LYS A HZ3  1 
ATOM   816   N  N    . TYR A 1 84  ? 35.426  15.553  24.410  1.00 11.99 ? 115 TYR A N    1 
ATOM   817   C  CA   . TYR A 1 84  ? 34.856  14.549  23.555  1.00 12.53 ? 115 TYR A CA   1 
ATOM   818   C  C    . TYR A 1 84  ? 34.054  15.084  22.412  1.00 11.91 ? 115 TYR A C    1 
ATOM   819   O  O    . TYR A 1 84  ? 34.233  14.614  21.295  1.00 13.07 ? 115 TYR A O    1 
ATOM   820   C  CB   . TYR A 1 84  ? 33.972  13.602  24.301  1.00 20.53 ? 115 TYR A CB   1 
ATOM   821   C  CG   . TYR A 1 84  ? 33.565  12.482  23.379  1.00 27.60 ? 115 TYR A CG   1 
ATOM   822   C  CD1  . TYR A 1 84  ? 34.382  11.338  23.240  1.00 28.92 ? 115 TYR A CD1  1 
ATOM   823   C  CD2  . TYR A 1 84  ? 32.399  12.577  22.588  1.00 26.80 ? 115 TYR A CD2  1 
ATOM   824   C  CE1  . TYR A 1 84  ? 34.053  10.325  22.339  1.00 28.00 ? 115 TYR A CE1  1 
ATOM   825   C  CE2  . TYR A 1 84  ? 32.068  11.560  21.683  1.00 27.24 ? 115 TYR A CE2  1 
ATOM   826   C  CZ   . TYR A 1 84  ? 32.904  10.448  21.568  1.00 26.98 ? 115 TYR A CZ   1 
ATOM   827   O  OH   . TYR A 1 84  ? 32.619  9.470   20.651  1.00 31.31 ? 115 TYR A OH   1 
ATOM   828   H  H    . TYR A 1 84  ? 35.112  15.650  25.338  1.00 17.00 ? 115 TYR A H    1 
ATOM   829   H  HH   . TYR A 1 84  ? 31.810  9.703   20.188  1.00 17.00 ? 115 TYR A HH   1 
ATOM   830   N  N    . VAL A 1 85  ? 33.123  16.000  22.690  1.00 11.48 ? 116 VAL A N    1 
ATOM   831   C  CA   . VAL A 1 85  ? 32.290  16.555  21.618  1.00 11.46 ? 116 VAL A CA   1 
ATOM   832   C  C    . VAL A 1 85  ? 33.217  17.002  20.517  1.00 12.60 ? 116 VAL A C    1 
ATOM   833   O  O    . VAL A 1 85  ? 33.023  16.651  19.344  1.00 13.85 ? 116 VAL A O    1 
ATOM   834   C  CB   . VAL A 1 85  ? 31.372  17.785  22.037  1.00 12.48 ? 116 VAL A CB   1 
ATOM   835   C  CG1  . VAL A 1 85  ? 30.409  17.423  23.153  1.00 12.75 ? 116 VAL A CG1  1 
ATOM   836   C  CG2  . VAL A 1 85  ? 32.182  18.965  22.445  1.00 14.62 ? 116 VAL A CG2  1 
ATOM   837   H  H    . VAL A 1 85  ? 33.013  16.301  23.616  1.00 17.00 ? 116 VAL A H    1 
ATOM   838   N  N    . LEU A 1 86  ? 34.299  17.646  20.949  1.00 11.73 ? 117 LEU A N    1 
ATOM   839   C  CA   . LEU A 1 86  ? 35.315  18.190  20.065  1.00 12.16 ? 117 LEU A CA   1 
ATOM   840   C  C    . LEU A 1 86  ? 35.959  17.119  19.189  1.00 13.69 ? 117 LEU A C    1 
ATOM   841   O  O    . LEU A 1 86  ? 35.737  17.058  17.951  1.00 13.00 ? 117 LEU A O    1 
ATOM   842   C  CB   . LEU A 1 86  ? 36.372  18.923  20.907  1.00 10.05 ? 117 LEU A CB   1 
ATOM   843   C  CG   . LEU A 1 86  ? 36.376  20.455  20.750  1.00 12.26 ? 117 LEU A CG   1 
ATOM   844   C  CD1  . LEU A 1 86  ? 34.952  21.024  20.491  1.00 12.04 ? 117 LEU A CD1  1 
ATOM   845   C  CD2  . LEU A 1 86  ? 36.989  21.119  21.985  1.00 13.24 ? 117 LEU A CD2  1 
ATOM   846   H  H    . LEU A 1 86  ? 34.421  17.759  21.914  1.00 17.00 ? 117 LEU A H    1 
ATOM   847   N  N    . THR A 1 87  ? 36.711  16.253  19.862  1.00 13.88 ? 118 THR A N    1 
ATOM   848   C  CA   . THR A 1 87  ? 37.440  15.160  19.243  1.00 14.63 ? 118 THR A CA   1 
ATOM   849   C  C    . THR A 1 87  ? 36.645  14.345  18.189  1.00 14.66 ? 118 THR A C    1 
ATOM   850   O  O    . THR A 1 87  ? 36.917  14.418  16.973  1.00 15.35 ? 118 THR A O    1 
ATOM   851   C  CB   . THR A 1 87  ? 38.046  14.245  20.366  1.00 15.11 ? 118 THR A CB   1 
ATOM   852   O  OG1  . THR A 1 87  ? 37.017  13.842  21.295  1.00 13.80 ? 118 THR A OG1  1 
ATOM   853   C  CG2  . THR A 1 87  ? 39.126  15.020  21.148  1.00 13.39 ? 118 THR A CG2  1 
ATOM   854   H  H    . THR A 1 87  ? 36.765  16.352  20.831  1.00 17.00 ? 118 THR A H    1 
ATOM   855   H  HG1  . THR A 1 87  ? 36.783  14.617  21.821  1.00 17.00 ? 118 THR A HG1  1 
ATOM   856   N  N    . SER A 1 88  ? 35.626  13.631  18.639  1.00 14.16 ? 119 SER A N    1 
ATOM   857   C  CA   . SER A 1 88  ? 34.836  12.809  17.742  1.00 16.40 ? 119 SER A CA   1 
ATOM   858   C  C    . SER A 1 88  ? 34.172  13.555  16.578  1.00 18.18 ? 119 SER A C    1 
ATOM   859   O  O    . SER A 1 88  ? 34.335  13.175  15.393  1.00 19.43 ? 119 SER A O    1 
ATOM   860   C  CB   . SER A 1 88  ? 33.770  12.112  18.546  1.00 15.90 ? 119 SER A CB   1 
ATOM   861   O  OG   . SER A 1 88  ? 33.133  13.088  19.336  1.00 15.00 ? 119 SER A OG   1 
ATOM   862   H  H    . SER A 1 88  ? 35.410  13.679  19.593  1.00 17.00 ? 119 SER A H    1 
ATOM   863   H  HG   . SER A 1 88  ? 33.733  13.435  20.002  1.00 17.00 ? 119 SER A HG   1 
ATOM   864   N  N    . ARG A 1 89  ? 33.428  14.609  16.918  1.00 18.36 ? 120 ARG A N    1 
ATOM   865   C  CA   . ARG A 1 89  ? 32.701  15.403  15.925  1.00 18.97 ? 120 ARG A CA   1 
ATOM   866   C  C    . ARG A 1 89  ? 33.477  15.648  14.610  1.00 18.54 ? 120 ARG A C    1 
ATOM   867   O  O    . ARG A 1 89  ? 32.923  15.507  13.495  1.00 15.76 ? 120 ARG A O    1 
ATOM   868   C  CB   . ARG A 1 89  ? 32.267  16.755  16.535  1.00 18.64 ? 120 ARG A CB   1 
ATOM   869   C  CG   . ARG A 1 89  ? 31.172  17.474  15.748  1.00 22.13 ? 120 ARG A CG   1 
ATOM   870   C  CD   . ARG A 1 89  ? 29.840  17.578  16.525  1.00 26.37 ? 120 ARG A CD   1 
ATOM   871   N  NE   . ARG A 1 89  ? 29.253  16.286  16.907  1.00 29.22 ? 120 ARG A NE   1 
ATOM   872   C  CZ   . ARG A 1 89  ? 28.507  16.090  17.999  1.00 29.89 ? 120 ARG A CZ   1 
ATOM   873   N  NH1  . ARG A 1 89  ? 28.239  17.097  18.820  1.00 31.92 ? 120 ARG A NH1  1 
ATOM   874   N  NH2  . ARG A 1 89  ? 28.095  14.873  18.326  1.00 30.51 ? 120 ARG A NH2  1 
ATOM   875   H  H    . ARG A 1 89  ? 33.360  14.861  17.867  1.00 17.00 ? 120 ARG A H    1 
ATOM   876   H  HE   . ARG A 1 89  ? 29.421  15.517  16.322  1.00 17.00 ? 120 ARG A HE   1 
ATOM   877   H  HH11 . ARG A 1 89  ? 28.593  18.012  18.627  1.00 17.00 ? 120 ARG A HH11 1 
ATOM   878   H  HH12 . ARG A 1 89  ? 27.681  16.941  19.635  1.00 17.00 ? 120 ARG A HH12 1 
ATOM   879   H  HH21 . ARG A 1 89  ? 28.343  14.094  17.751  1.00 17.00 ? 120 ARG A HH21 1 
ATOM   880   H  HH22 . ARG A 1 89  ? 27.539  14.734  19.145  1.00 17.00 ? 120 ARG A HH22 1 
ATOM   881   N  N    . SER A 1 90  ? 34.776  15.916  14.739  1.00 16.73 ? 121 SER A N    1 
ATOM   882   C  CA   . SER A 1 90  ? 35.555  16.254  13.561  1.00 14.23 ? 121 SER A CA   1 
ATOM   883   C  C    . SER A 1 90  ? 36.406  15.192  12.891  1.00 12.21 ? 121 SER A C    1 
ATOM   884   O  O    . SER A 1 90  ? 37.184  15.480  11.979  1.00 12.90 ? 121 SER A O    1 
ATOM   885   C  CB   . SER A 1 90  ? 36.324  17.578  13.794  1.00 15.14 ? 121 SER A CB   1 
ATOM   886   O  OG   . SER A 1 90  ? 35.438  18.696  13.954  1.00 5.29  ? 121 SER A OG   1 
ATOM   887   H  H    . SER A 1 90  ? 35.210  15.887  15.618  1.00 17.00 ? 121 SER A H    1 
ATOM   888   H  HG   . SER A 1 90  ? 34.898  18.531  14.731  1.00 17.00 ? 121 SER A HG   1 
ATOM   889   N  N    . TYR A 1 91  ? 36.227  13.948  13.272  1.00 10.35 ? 122 TYR A N    1 
ATOM   890   C  CA   . TYR A 1 91  ? 36.996  12.936  12.584  1.00 11.02 ? 122 TYR A CA   1 
ATOM   891   C  C    . TYR A 1 91  ? 36.534  12.927  11.102  1.00 9.97  ? 122 TYR A C    1 
ATOM   892   O  O    . TYR A 1 91  ? 37.226  12.457  10.212  1.00 7.23  ? 122 TYR A O    1 
ATOM   893   C  CB   . TYR A 1 91  ? 36.765  11.575  13.249  1.00 14.90 ? 122 TYR A CB   1 
ATOM   894   C  CG   . TYR A 1 91  ? 35.571  10.776  12.726  1.00 19.33 ? 122 TYR A CG   1 
ATOM   895   C  CD1  . TYR A 1 91  ? 35.622  10.144  11.460  1.00 20.41 ? 122 TYR A CD1  1 
ATOM   896   C  CD2  . TYR A 1 91  ? 34.389  10.652  13.483  1.00 18.34 ? 122 TYR A CD2  1 
ATOM   897   C  CE1  . TYR A 1 91  ? 34.527  9.414   10.956  1.00 21.72 ? 122 TYR A CE1  1 
ATOM   898   C  CE2  . TYR A 1 91  ? 33.282  9.918   12.986  1.00 20.60 ? 122 TYR A CE2  1 
ATOM   899   C  CZ   . TYR A 1 91  ? 33.367  9.307   11.719  1.00 21.24 ? 122 TYR A CZ   1 
ATOM   900   O  OH   . TYR A 1 91  ? 32.310  8.609   11.192  1.00 19.38 ? 122 TYR A OH   1 
ATOM   901   H  H    . TYR A 1 91  ? 35.615  13.711  14.001  1.00 17.00 ? 122 TYR A H    1 
ATOM   902   H  HH   . TYR A 1 91  ? 32.505  8.358   10.277  1.00 17.00 ? 122 TYR A HH   1 
ATOM   903   N  N    . LEU A 1 92  ? 35.339  13.455  10.863  1.00 10.83 ? 123 LEU A N    1 
ATOM   904   C  CA   . LEU A 1 92  ? 34.735  13.504  9.527   1.00 11.63 ? 123 LEU A CA   1 
ATOM   905   C  C    . LEU A 1 92  ? 35.347  14.481  8.509   1.00 13.29 ? 123 LEU A C    1 
ATOM   906   O  O    . LEU A 1 92  ? 34.804  14.623  7.406   1.00 13.22 ? 123 LEU A O    1 
ATOM   907   C  CB   . LEU A 1 92  ? 33.246  13.873  9.631   1.00 9.14  ? 123 LEU A CB   1 
ATOM   908   C  CG   . LEU A 1 92  ? 32.216  13.022  10.356  1.00 9.83  ? 123 LEU A CG   1 
ATOM   909   C  CD1  . LEU A 1 92  ? 32.156  11.587  9.786   1.00 9.45  ? 123 LEU A CD1  1 
ATOM   910   C  CD2  . LEU A 1 92  ? 32.570  13.032  11.812  1.00 12.40 ? 123 LEU A CD2  1 
ATOM   911   H  H    . LEU A 1 92  ? 34.848  13.838  11.615  1.00 17.00 ? 123 LEU A H    1 
ATOM   912   N  N    . ILE A 1 93  ? 36.415  15.197  8.861   1.00 13.13 ? 124 ILE A N    1 
ATOM   913   C  CA   . ILE A 1 93  ? 36.963  16.162  7.914   1.00 9.92  ? 124 ILE A CA   1 
ATOM   914   C  C    . ILE A 1 93  ? 38.323  15.827  7.315   1.00 11.89 ? 124 ILE A C    1 
ATOM   915   O  O    . ILE A 1 93  ? 39.275  15.420  8.015   1.00 10.63 ? 124 ILE A O    1 
ATOM   916   C  CB   . ILE A 1 93  ? 36.992  17.556  8.491   1.00 7.25  ? 124 ILE A CB   1 
ATOM   917   C  CG1  . ILE A 1 93  ? 35.600  17.932  8.972   1.00 5.19  ? 124 ILE A CG1  1 
ATOM   918   C  CG2  . ILE A 1 93  ? 37.427  18.534  7.431   1.00 7.69  ? 124 ILE A CG2  1 
ATOM   919   C  CD1  . ILE A 1 93  ? 35.294  17.487  10.346  1.00 2.13  ? 124 ILE A CD1  1 
ATOM   920   H  H    . ILE A 1 93  ? 36.866  15.067  9.722   1.00 17.00 ? 124 ILE A H    1 
ATOM   921   N  N    . ASP A 1 94  ? 38.383  15.994  5.994   1.00 11.96 ? 125 ASP A N    1 
ATOM   922   C  CA   . ASP A 1 94  ? 39.581  15.723  5.216   1.00 10.52 ? 125 ASP A CA   1 
ATOM   923   C  C    . ASP A 1 94  ? 40.488  16.941  5.212   1.00 10.25 ? 125 ASP A C    1 
ATOM   924   O  O    . ASP A 1 94  ? 40.463  17.724  4.264   1.00 10.50 ? 125 ASP A O    1 
ATOM   925   C  CB   . ASP A 1 94  ? 39.207  15.320  3.775   1.00 9.81  ? 125 ASP A CB   1 
ATOM   926   C  CG   . ASP A 1 94  ? 38.994  13.791  3.616   1.00 10.43 ? 125 ASP A CG   1 
ATOM   927   O  OD1  . ASP A 1 94  ? 39.025  13.038  4.625   1.00 6.63  ? 125 ASP A OD1  1 
ATOM   928   O  OD2  . ASP A 1 94  ? 38.825  13.334  2.462   1.00 9.75  ? 125 ASP A OD2  1 
ATOM   929   H  H    . ASP A 1 94  ? 37.590  16.316  5.522   1.00 17.00 ? 125 ASP A H    1 
ATOM   930   N  N    . SER A 1 95  ? 41.248  17.112  6.292   1.00 6.37  ? 126 SER A N    1 
ATOM   931   C  CA   . SER A 1 95  ? 42.166  18.219  6.417   1.00 3.20  ? 126 SER A CA   1 
ATOM   932   C  C    . SER A 1 95  ? 43.492  17.578  6.723   1.00 3.72  ? 126 SER A C    1 
ATOM   933   O  O    . SER A 1 95  ? 43.606  16.869  7.713   1.00 3.26  ? 126 SER A O    1 
ATOM   934   C  CB   . SER A 1 95  ? 41.762  19.126  7.570   1.00 2.14  ? 126 SER A CB   1 
ATOM   935   O  OG   . SER A 1 95  ? 42.167  20.460  7.337   1.00 5.13  ? 126 SER A OG   1 
ATOM   936   H  H    . SER A 1 95  ? 41.217  16.464  7.033   1.00 17.00 ? 126 SER A H    1 
ATOM   937   H  HG   . SER A 1 95  ? 41.830  21.013  8.059   1.00 17.00 ? 126 SER A HG   1 
ATOM   938   N  N    . PRO A 1 96  ? 44.491  17.738  5.835   1.00 3.74  ? 127 PRO A N    1 
ATOM   939   C  CA   . PRO A 1 96  ? 44.517  18.456  4.562   1.00 3.33  ? 127 PRO A CA   1 
ATOM   940   C  C    . PRO A 1 96  ? 43.408  18.151  3.560   1.00 2.70  ? 127 PRO A C    1 
ATOM   941   O  O    . PRO A 1 96  ? 43.094  16.987  3.273   1.00 2.00  ? 127 PRO A O    1 
ATOM   942   C  CB   . PRO A 1 96  ? 45.879  18.107  4.019   1.00 2.00  ? 127 PRO A CB   1 
ATOM   943   C  CG   . PRO A 1 96  ? 46.661  18.231  5.219   1.00 4.86  ? 127 PRO A CG   1 
ATOM   944   C  CD   . PRO A 1 96  ? 45.865  17.418  6.222   1.00 3.47  ? 127 PRO A CD   1 
ATOM   945   N  N    . PRO A 1 97  ? 42.800  19.219  3.017   1.00 2.00  ? 128 PRO A N    1 
ATOM   946   C  CA   . PRO A 1 97  ? 41.722  19.217  2.046   1.00 2.59  ? 128 PRO A CA   1 
ATOM   947   C  C    . PRO A 1 97  ? 41.944  18.414  0.796   1.00 3.23  ? 128 PRO A C    1 
ATOM   948   O  O    . PRO A 1 97  ? 43.020  18.468  0.217   1.00 3.83  ? 128 PRO A O    1 
ATOM   949   C  CB   . PRO A 1 97  ? 41.592  20.683  1.699   1.00 2.00  ? 128 PRO A CB   1 
ATOM   950   C  CG   . PRO A 1 97  ? 42.871  21.244  2.057   1.00 2.00  ? 128 PRO A CG   1 
ATOM   951   C  CD   . PRO A 1 97  ? 43.167  20.606  3.323   1.00 2.00  ? 128 PRO A CD   1 
ATOM   952   N  N    . THR A 1 98  ? 40.914  17.657  0.405   1.00 5.45  ? 129 THR A N    1 
ATOM   953   C  CA   . THR A 1 98  ? 40.913  16.842  -0.809  1.00 4.43  ? 129 THR A CA   1 
ATOM   954   C  C    . THR A 1 98  ? 39.706  17.352  -1.537  1.00 3.41  ? 129 THR A C    1 
ATOM   955   O  O    . THR A 1 98  ? 38.733  17.725  -0.894  1.00 3.72  ? 129 THR A O    1 
ATOM   956   C  CB   . THR A 1 98  ? 40.682  15.315  -0.536  1.00 3.02  ? 129 THR A CB   1 
ATOM   957   O  OG1  . THR A 1 98  ? 39.517  15.128  0.252   1.00 2.00  ? 129 THR A OG1  1 
ATOM   958   C  CG2  . THR A 1 98  ? 41.810  14.715  0.223   1.00 5.38  ? 129 THR A CG2  1 
ATOM   959   H  H    . THR A 1 98  ? 40.093  17.647  0.945   1.00 17.00 ? 129 THR A H    1 
ATOM   960   H  HG1  . THR A 1 98  ? 38.744  15.615  -0.067  1.00 17.00 ? 129 THR A HG1  1 
ATOM   961   N  N    . TYR A 1 99  ? 39.787  17.403  -2.861  1.00 3.61  ? 130 TYR A N    1 
ATOM   962   C  CA   . TYR A 1 99  ? 38.678  17.831  -3.730  1.00 3.79  ? 130 TYR A CA   1 
ATOM   963   C  C    . TYR A 1 99  ? 38.161  19.290  -3.708  1.00 5.95  ? 130 TYR A C    1 
ATOM   964   O  O    . TYR A 1 99  ? 38.385  20.108  -2.779  1.00 5.83  ? 130 TYR A O    1 
ATOM   965   C  CB   . TYR A 1 99  ? 37.453  16.901  -3.610  1.00 2.62  ? 130 TYR A CB   1 
ATOM   966   C  CG   . TYR A 1 99  ? 37.722  15.410  -3.418  1.00 3.33  ? 130 TYR A CG   1 
ATOM   967   C  CD1  . TYR A 1 99  ? 38.066  14.584  -4.499  1.00 3.46  ? 130 TYR A CD1  1 
ATOM   968   C  CD2  . TYR A 1 99  ? 37.647  14.827  -2.149  1.00 2.95  ? 130 TYR A CD2  1 
ATOM   969   C  CE1  . TYR A 1 99  ? 38.334  13.233  -4.319  1.00 2.00  ? 130 TYR A CE1  1 
ATOM   970   C  CE2  . TYR A 1 99  ? 37.919  13.490  -1.966  1.00 3.71  ? 130 TYR A CE2  1 
ATOM   971   C  CZ   . TYR A 1 99  ? 38.268  12.702  -3.060  1.00 2.00  ? 130 TYR A CZ   1 
ATOM   972   O  OH   . TYR A 1 99  ? 38.615  11.394  -2.867  1.00 2.07  ? 130 TYR A OH   1 
ATOM   973   H  H    . TYR A 1 99  ? 40.643  17.182  -3.289  1.00 17.00 ? 130 TYR A H    1 
ATOM   974   H  HH   . TYR A 1 99  ? 38.489  11.162  -1.942  1.00 17.00 ? 130 TYR A HH   1 
ATOM   975   N  N    . ASN A 1 100 ? 37.436  19.584  -4.777  1.00 5.62  ? 131 ASN A N    1 
ATOM   976   C  CA   . ASN A 1 100 ? 36.825  20.869  -5.014  1.00 4.33  ? 131 ASN A CA   1 
ATOM   977   C  C    . ASN A 1 100 ? 36.023  20.652  -6.286  1.00 2.19  ? 131 ASN A C    1 
ATOM   978   O  O    . ASN A 1 100 ? 36.079  19.596  -6.867  1.00 2.00  ? 131 ASN A O    1 
ATOM   979   C  CB   . ASN A 1 100 ? 37.891  21.938  -5.201  1.00 5.10  ? 131 ASN A CB   1 
ATOM   980   C  CG   . ASN A 1 100 ? 38.803  21.655  -6.382  1.00 8.70  ? 131 ASN A CG   1 
ATOM   981   O  OD1  . ASN A 1 100 ? 38.369  21.159  -7.419  1.00 9.78  ? 131 ASN A OD1  1 
ATOM   982   N  ND2  . ASN A 1 100 ? 40.075  21.994  -6.236  1.00 11.15 ? 131 ASN A ND2  1 
ATOM   983   H  H    . ASN A 1 100 ? 37.286  18.886  -5.457  1.00 17.00 ? 131 ASN A H    1 
ATOM   984   H  HD21 . ASN A 1 100 ? 40.690  21.854  -6.981  1.00 17.00 ? 131 ASN A HD21 1 
ATOM   985   H  HD22 . ASN A 1 100 ? 40.348  22.386  -5.374  1.00 17.00 ? 131 ASN A HD22 1 
ATOM   986   N  N    . VAL A 1 101 ? 35.377  21.691  -6.775  1.00 5.27  ? 132 VAL A N    1 
ATOM   987   C  CA   . VAL A 1 101 ? 34.526  21.594  -7.958  1.00 5.65  ? 132 VAL A CA   1 
ATOM   988   C  C    . VAL A 1 101 ? 35.104  20.921  -9.183  1.00 5.78  ? 132 VAL A C    1 
ATOM   989   O  O    . VAL A 1 101 ? 34.382  20.214  -9.876  1.00 7.59  ? 132 VAL A O    1 
ATOM   990   C  CB   . VAL A 1 101 ? 33.982  22.961  -8.390  1.00 4.68  ? 132 VAL A CB   1 
ATOM   991   C  CG1  . VAL A 1 101 ? 32.919  22.763  -9.463  1.00 2.64  ? 132 VAL A CG1  1 
ATOM   992   C  CG2  . VAL A 1 101 ? 33.426  23.731  -7.171  1.00 6.57  ? 132 VAL A CG2  1 
ATOM   993   H  H    . VAL A 1 101 ? 35.468  22.539  -6.294  1.00 17.00 ? 132 VAL A H    1 
ATOM   994   N  N    . HIS A 1 102 ? 36.372  21.176  -9.482  1.00 5.29  ? 133 HIS A N    1 
ATOM   995   C  CA   . HIS A 1 102 ? 37.016  20.574  -10.655 1.00 5.11  ? 133 HIS A CA   1 
ATOM   996   C  C    . HIS A 1 102 ? 37.796  19.291  -10.388 1.00 2.72  ? 133 HIS A C    1 
ATOM   997   O  O    . HIS A 1 102 ? 38.279  18.679  -11.332 1.00 2.05  ? 133 HIS A O    1 
ATOM   998   C  CB   . HIS A 1 102 ? 37.964  21.569  -11.347 1.00 4.56  ? 133 HIS A CB   1 
ATOM   999   C  CG   . HIS A 1 102 ? 37.291  22.810  -11.837 1.00 6.62  ? 133 HIS A CG   1 
ATOM   1000  N  ND1  . HIS A 1 102 ? 37.697  24.072  -11.465 1.00 5.51  ? 133 HIS A ND1  1 
ATOM   1001  C  CD2  . HIS A 1 102 ? 36.238  22.986  -12.669 1.00 8.19  ? 133 HIS A CD2  1 
ATOM   1002  C  CE1  . HIS A 1 102 ? 36.925  24.973  -12.043 1.00 4.63  ? 133 HIS A CE1  1 
ATOM   1003  N  NE2  . HIS A 1 102 ? 36.029  24.341  -12.780 1.00 7.16  ? 133 HIS A NE2  1 
ATOM   1004  H  H    . HIS A 1 102 ? 36.909  21.710  -8.866  1.00 17.00 ? 133 HIS A H    1 
ATOM   1005  H  HD1  . HIS A 1 102 ? 38.458  24.286  -10.902 1.00 17.00 ? 133 HIS A HD1  1 
ATOM   1006  H  HE2  . HIS A 1 102 ? 35.332  24.768  -13.319 1.00 17.00 ? 133 HIS A HE2  1 
ATOM   1007  N  N    . TYR A 1 103 ? 37.962  18.908  -9.125  1.00 2.00  ? 134 TYR A N    1 
ATOM   1008  C  CA   . TYR A 1 103 ? 38.724  17.711  -8.823  1.00 2.21  ? 134 TYR A CA   1 
ATOM   1009  C  C    . TYR A 1 103 ? 37.985  16.604  -8.083  1.00 2.78  ? 134 TYR A C    1 
ATOM   1010  O  O    . TYR A 1 103 ? 37.612  16.742  -6.913  1.00 2.00  ? 134 TYR A O    1 
ATOM   1011  C  CB   . TYR A 1 103 ? 40.072  18.065  -8.162  1.00 2.04  ? 134 TYR A CB   1 
ATOM   1012  C  CG   . TYR A 1 103 ? 40.976  18.837  -9.119  1.00 3.98  ? 134 TYR A CG   1 
ATOM   1013  C  CD1  . TYR A 1 103 ? 41.802  18.171  -10.032 1.00 2.40  ? 134 TYR A CD1  1 
ATOM   1014  C  CD2  . TYR A 1 103 ? 40.878  20.221  -9.235  1.00 4.98  ? 134 TYR A CD2  1 
ATOM   1015  C  CE1  . TYR A 1 103 ? 42.485  18.841  -11.037 1.00 2.00  ? 134 TYR A CE1  1 
ATOM   1016  C  CE2  . TYR A 1 103 ? 41.560  20.909  -10.244 1.00 4.70  ? 134 TYR A CE2  1 
ATOM   1017  C  CZ   . TYR A 1 103 ? 42.359  20.212  -11.146 1.00 2.82  ? 134 TYR A CZ   1 
ATOM   1018  O  OH   . TYR A 1 103 ? 42.996  20.893  -12.168 1.00 2.98  ? 134 TYR A OH   1 
ATOM   1019  H  H    . TYR A 1 103 ? 37.551  19.414  -8.390  1.00 17.00 ? 134 TYR A H    1 
ATOM   1020  H  HH   . TYR A 1 103 ? 43.350  20.245  -12.789 1.00 17.00 ? 134 TYR A HH   1 
ATOM   1021  N  N    . GLY A 1 104 ? 37.710  15.534  -8.825  1.00 2.00  ? 135 GLY A N    1 
ATOM   1022  C  CA   . GLY A 1 104 ? 37.054  14.385  -8.255  1.00 2.00  ? 135 GLY A CA   1 
ATOM   1023  C  C    . GLY A 1 104 ? 38.130  13.459  -7.736  1.00 2.00  ? 135 GLY A C    1 
ATOM   1024  O  O    . GLY A 1 104 ? 37.878  12.521  -6.999  1.00 2.00  ? 135 GLY A O    1 
ATOM   1025  H  H    . GLY A 1 104 ? 37.954  15.556  -9.774  1.00 17.00 ? 135 GLY A H    1 
ATOM   1026  N  N    . TYR A 1 105 ? 39.359  13.715  -8.149  1.00 4.22  ? 136 TYR A N    1 
ATOM   1027  C  CA   . TYR A 1 105 ? 40.489  12.910  -7.709  1.00 3.33  ? 136 TYR A CA   1 
ATOM   1028  C  C    . TYR A 1 105 ? 41.396  13.810  -6.875  1.00 2.00  ? 136 TYR A C    1 
ATOM   1029  O  O    . TYR A 1 105 ? 41.439  15.024  -7.075  1.00 2.00  ? 136 TYR A O    1 
ATOM   1030  C  CB   . TYR A 1 105 ? 41.195  12.298  -8.914  1.00 2.32  ? 136 TYR A CB   1 
ATOM   1031  C  CG   . TYR A 1 105 ? 41.415  13.244  -10.070 1.00 2.02  ? 136 TYR A CG   1 
ATOM   1032  C  CD1  . TYR A 1 105 ? 41.839  14.557  -9.853  1.00 3.78  ? 136 TYR A CD1  1 
ATOM   1033  C  CD2  . TYR A 1 105 ? 41.279  12.805  -11.377 1.00 2.12  ? 136 TYR A CD2  1 
ATOM   1034  C  CE1  . TYR A 1 105 ? 42.135  15.411  -10.925 1.00 3.86  ? 136 TYR A CE1  1 
ATOM   1035  C  CE2  . TYR A 1 105 ? 41.561  13.633  -12.438 1.00 2.05  ? 136 TYR A CE2  1 
ATOM   1036  C  CZ   . TYR A 1 105 ? 41.993  14.944  -12.215 1.00 4.53  ? 136 TYR A CZ   1 
ATOM   1037  O  OH   . TYR A 1 105 ? 42.267  15.784  -13.266 1.00 2.01  ? 136 TYR A OH   1 
ATOM   1038  H  H    . TYR A 1 105 ? 39.529  14.497  -8.703  1.00 17.00 ? 136 TYR A H    1 
ATOM   1039  H  HH   . TYR A 1 105 ? 42.077  15.327  -14.088 1.00 17.00 ? 136 TYR A HH   1 
ATOM   1040  N  N    . LYS A 1 106 ? 42.090  13.209  -5.926  1.00 2.00  ? 137 LYS A N    1 
ATOM   1041  C  CA   . LYS A 1 106 ? 42.950  13.943  -5.014  1.00 2.10  ? 137 LYS A CA   1 
ATOM   1042  C  C    . LYS A 1 106 ? 43.699  15.178  -5.540  1.00 2.47  ? 137 LYS A C    1 
ATOM   1043  O  O    . LYS A 1 106 ? 43.587  16.228  -4.931  1.00 5.27  ? 137 LYS A O    1 
ATOM   1044  C  CB   . LYS A 1 106 ? 43.863  12.973  -4.278  1.00 2.00  ? 137 LYS A CB   1 
ATOM   1045  C  CG   . LYS A 1 106 ? 43.088  11.891  -3.516  1.00 2.25  ? 137 LYS A CG   1 
ATOM   1046  C  CD   . LYS A 1 106 ? 42.669  12.406  -2.156  1.00 2.62  ? 137 LYS A CD   1 
ATOM   1047  C  CE   . LYS A 1 106 ? 41.913  11.383  -1.349  1.00 2.00  ? 137 LYS A CE   1 
ATOM   1048  N  NZ   . LYS A 1 106 ? 42.755  10.230  -1.060  1.00 4.70  ? 137 LYS A NZ   1 
ATOM   1049  H  H    . LYS A 1 106 ? 42.017  12.236  -5.839  1.00 17.00 ? 137 LYS A H    1 
ATOM   1050  H  HZ1  . LYS A 1 106 ? 43.600  10.536  -0.538  1.00 17.00 ? 137 LYS A HZ1  1 
ATOM   1051  H  HZ2  . LYS A 1 106 ? 42.232  9.526   -0.502  1.00 17.00 ? 137 LYS A HZ2  1 
ATOM   1052  H  HZ3  . LYS A 1 106 ? 43.048  9.809   -1.964  1.00 17.00 ? 137 LYS A HZ3  1 
ATOM   1053  N  N    . SER A 1 107 ? 44.442  15.066  -6.642  1.00 2.00  ? 138 SER A N    1 
ATOM   1054  C  CA   . SER A 1 107 ? 45.167  16.198  -7.238  1.00 2.00  ? 138 SER A CA   1 
ATOM   1055  C  C    . SER A 1 107 ? 45.905  17.238  -6.390  1.00 2.00  ? 138 SER A C    1 
ATOM   1056  O  O    . SER A 1 107 ? 45.413  17.684  -5.363  1.00 2.00  ? 138 SER A O    1 
ATOM   1057  C  CB   . SER A 1 107 ? 44.224  16.930  -8.173  1.00 4.92  ? 138 SER A CB   1 
ATOM   1058  O  OG   . SER A 1 107 ? 44.400  18.350  -8.172  1.00 4.47  ? 138 SER A OG   1 
ATOM   1059  H  H    . SER A 1 107 ? 44.529  14.192  -7.062  1.00 17.00 ? 138 SER A H    1 
ATOM   1060  H  HG   . SER A 1 107 ? 43.721  18.677  -8.767  1.00 17.00 ? 138 SER A HG   1 
ATOM   1061  N  N    . TRP A 1 108 ? 47.051  17.711  -6.886  1.00 3.36  ? 139 TRP A N    1 
ATOM   1062  C  CA   . TRP A 1 108 ? 47.800  18.742  -6.154  1.00 3.27  ? 139 TRP A CA   1 
ATOM   1063  C  C    . TRP A 1 108 ? 47.188  20.121  -6.394  1.00 2.69  ? 139 TRP A C    1 
ATOM   1064  O  O    . TRP A 1 108 ? 47.331  20.999  -5.555  1.00 2.00  ? 139 TRP A O    1 
ATOM   1065  C  CB   . TRP A 1 108 ? 49.301  18.745  -6.493  1.00 3.14  ? 139 TRP A CB   1 
ATOM   1066  C  CG   . TRP A 1 108 ? 50.109  19.772  -5.704  1.00 2.00  ? 139 TRP A CG   1 
ATOM   1067  C  CD1  . TRP A 1 108 ? 50.285  21.077  -6.027  1.00 2.00  ? 139 TRP A CD1  1 
ATOM   1068  C  CD2  . TRP A 1 108 ? 50.713  19.600  -4.411  1.00 2.00  ? 139 TRP A CD2  1 
ATOM   1069  N  NE1  . TRP A 1 108 ? 50.924  21.735  -5.007  1.00 3.41  ? 139 TRP A NE1  1 
ATOM   1070  C  CE2  . TRP A 1 108 ? 51.195  20.848  -4.002  1.00 2.00  ? 139 TRP A CE2  1 
ATOM   1071  C  CE3  . TRP A 1 108 ? 50.878  18.517  -3.562  1.00 2.00  ? 139 TRP A CE3  1 
ATOM   1072  C  CZ2  . TRP A 1 108 ? 51.817  21.043  -2.789  1.00 2.00  ? 139 TRP A CZ2  1 
ATOM   1073  C  CZ3  . TRP A 1 108 ? 51.493  18.714  -2.366  1.00 2.00  ? 139 TRP A CZ3  1 
ATOM   1074  C  CH2  . TRP A 1 108 ? 51.953  19.963  -1.987  1.00 2.00  ? 139 TRP A CH2  1 
ATOM   1075  H  H    . TRP A 1 108 ? 47.397  17.368  -7.735  1.00 17.00 ? 139 TRP A H    1 
ATOM   1076  H  HE1  . TRP A 1 108 ? 51.172  22.681  -5.028  1.00 17.00 ? 139 TRP A HE1  1 
ATOM   1077  N  N    . GLU A 1 109 ? 46.489  20.300  -7.520  1.00 2.88  ? 140 GLU A N    1 
ATOM   1078  C  CA   . GLU A 1 109 ? 45.836  21.584  -7.835  1.00 3.18  ? 140 GLU A CA   1 
ATOM   1079  C  C    . GLU A 1 109 ? 44.677  21.786  -6.893  1.00 3.17  ? 140 GLU A C    1 
ATOM   1080  O  O    . GLU A 1 109 ? 44.362  22.917  -6.482  1.00 2.00  ? 140 GLU A O    1 
ATOM   1081  C  CB   . GLU A 1 109 ? 45.356  21.607  -9.289  1.00 2.48  ? 140 GLU A CB   1 
ATOM   1082  C  CG   . GLU A 1 109 ? 44.353  22.703  -9.682  1.00 2.00  ? 140 GLU A CG   1 
ATOM   1083  C  CD   . GLU A 1 109 ? 44.881  24.110  -9.605  1.00 3.30  ? 140 GLU A CD   1 
ATOM   1084  O  OE1  . GLU A 1 109 ? 46.108  24.324  -9.734  1.00 4.61  ? 140 GLU A OE1  1 
ATOM   1085  O  OE2  . GLU A 1 109 ? 44.047  25.018  -9.428  1.00 3.18  ? 140 GLU A OE2  1 
ATOM   1086  H  H    . GLU A 1 109 ? 46.402  19.545  -8.146  1.00 17.00 ? 140 GLU A H    1 
ATOM   1087  N  N    . ALA A 1 110 ? 44.049  20.666  -6.555  1.00 3.08  ? 141 ALA A N    1 
ATOM   1088  C  CA   . ALA A 1 110 ? 42.934  20.655  -5.625  1.00 3.84  ? 141 ALA A CA   1 
ATOM   1089  C  C    . ALA A 1 110 ? 43.449  20.985  -4.234  1.00 3.64  ? 141 ALA A C    1 
ATOM   1090  O  O    . ALA A 1 110 ? 42.703  21.419  -3.374  1.00 3.61  ? 141 ALA A O    1 
ATOM   1091  C  CB   . ALA A 1 110 ? 42.296  19.300  -5.613  1.00 7.34  ? 141 ALA A CB   1 
ATOM   1092  H  H    . ALA A 1 110 ? 44.361  19.808  -6.912  1.00 17.00 ? 141 ALA A H    1 
ATOM   1093  N  N    . PHE A 1 111 ? 44.725  20.704  -4.006  1.00 4.28  ? 142 PHE A N    1 
ATOM   1094  C  CA   . PHE A 1 111 ? 45.335  20.980  -2.726  1.00 2.00  ? 142 PHE A CA   1 
ATOM   1095  C  C    . PHE A 1 111 ? 45.947  22.363  -2.649  1.00 2.11  ? 142 PHE A C    1 
ATOM   1096  O  O    . PHE A 1 111 ? 45.920  22.993  -1.617  1.00 2.00  ? 142 PHE A O    1 
ATOM   1097  C  CB   . PHE A 1 111 ? 46.416  19.972  -2.410  1.00 2.00  ? 142 PHE A CB   1 
ATOM   1098  C  CG   . PHE A 1 111 ? 47.110  20.273  -1.145  1.00 2.00  ? 142 PHE A CG   1 
ATOM   1099  C  CD1  . PHE A 1 111 ? 46.526  19.935  0.057   1.00 2.00  ? 142 PHE A CD1  1 
ATOM   1100  C  CD2  . PHE A 1 111 ? 48.283  20.999  -1.139  1.00 2.00  ? 142 PHE A CD2  1 
ATOM   1101  C  CE1  . PHE A 1 111 ? 47.100  20.329  1.259   1.00 2.46  ? 142 PHE A CE1  1 
ATOM   1102  C  CE2  . PHE A 1 111 ? 48.854  21.392  0.046   1.00 2.21  ? 142 PHE A CE2  1 
ATOM   1103  C  CZ   . PHE A 1 111 ? 48.265  21.061  1.254   1.00 2.02  ? 142 PHE A CZ   1 
ATOM   1104  H  H    . PHE A 1 111 ? 45.248  20.248  -4.689  1.00 17.00 ? 142 PHE A H    1 
ATOM   1105  N  N    . SER A 1 112 ? 46.579  22.795  -3.728  1.00 3.60  ? 143 SER A N    1 
ATOM   1106  C  CA   . SER A 1 112 ? 47.242  24.093  -3.777  1.00 3.99  ? 143 SER A CA   1 
ATOM   1107  C  C    . SER A 1 112 ? 46.336  25.317  -3.940  1.00 4.87  ? 143 SER A C    1 
ATOM   1108  O  O    . SER A 1 112 ? 46.330  26.212  -3.079  1.00 5.75  ? 143 SER A O    1 
ATOM   1109  C  CB   . SER A 1 112 ? 48.315  24.105  -4.880  1.00 4.89  ? 143 SER A CB   1 
ATOM   1110  O  OG   . SER A 1 112 ? 47.829  23.703  -6.163  1.00 2.91  ? 143 SER A OG   1 
ATOM   1111  H  H    . SER A 1 112 ? 46.556  22.245  -4.519  1.00 17.00 ? 143 SER A H    1 
ATOM   1112  H  HG   . SER A 1 112 ? 47.623  22.767  -6.097  1.00 17.00 ? 143 SER A HG   1 
ATOM   1113  N  N    . ASN A 1 113 ? 45.575  25.349  -5.037  1.00 4.21  ? 144 ASN A N    1 
ATOM   1114  C  CA   . ASN A 1 113 ? 44.698  26.473  -5.344  1.00 2.00  ? 144 ASN A CA   1 
ATOM   1115  C  C    . ASN A 1 113 ? 43.778  26.848  -4.225  1.00 2.07  ? 144 ASN A C    1 
ATOM   1116  O  O    . ASN A 1 113 ? 42.736  26.245  -4.040  1.00 5.01  ? 144 ASN A O    1 
ATOM   1117  C  CB   . ASN A 1 113 ? 43.874  26.188  -6.575  1.00 2.06  ? 144 ASN A CB   1 
ATOM   1118  C  CG   . ASN A 1 113 ? 43.400  27.435  -7.202  1.00 2.76  ? 144 ASN A CG   1 
ATOM   1119  O  OD1  . ASN A 1 113 ? 43.002  28.329  -6.484  1.00 2.00  ? 144 ASN A OD1  1 
ATOM   1120  N  ND2  . ASN A 1 113 ? 43.573  27.563  -8.515  1.00 4.47  ? 144 ASN A ND2  1 
ATOM   1121  H  H    . ASN A 1 113 ? 45.588  24.578  -5.641  1.00 17.00 ? 144 ASN A H    1 
ATOM   1122  H  HD21 . ASN A 1 113 ? 44.234  27.006  -8.971  1.00 17.00 ? 144 ASN A HD21 1 
ATOM   1123  N  N    . LEU A 1 114 ? 44.160  27.855  -3.467  1.00 3.02  ? 145 LEU A N    1 
ATOM   1124  C  CA   . LEU A 1 114 ? 43.342  28.280  -2.339  1.00 4.12  ? 145 LEU A CA   1 
ATOM   1125  C  C    . LEU A 1 114 ? 42.096  29.055  -2.727  1.00 2.31  ? 145 LEU A C    1 
ATOM   1126  O  O    . LEU A 1 114 ? 41.300  29.417  -1.854  1.00 2.00  ? 145 LEU A O    1 
ATOM   1127  C  CB   . LEU A 1 114 ? 44.178  29.105  -1.357  1.00 4.61  ? 145 LEU A CB   1 
ATOM   1128  C  CG   . LEU A 1 114 ? 45.232  28.373  -0.521  1.00 3.09  ? 145 LEU A CG   1 
ATOM   1129  C  CD1  . LEU A 1 114 ? 45.776  29.370  0.485   1.00 2.00  ? 145 LEU A CD1  1 
ATOM   1130  C  CD2  . LEU A 1 114 ? 44.658  27.181  0.208   1.00 2.00  ? 145 LEU A CD2  1 
ATOM   1131  H  H    . LEU A 1 114 ? 45.035  28.263  -3.627  1.00 17.00 ? 145 LEU A H    1 
ATOM   1132  N  N    . SER A 1 115 ? 41.941  29.313  -4.026  1.00 2.29  ? 146 SER A N    1 
ATOM   1133  C  CA   . SER A 1 115 ? 40.811  30.082  -4.536  1.00 2.14  ? 146 SER A CA   1 
ATOM   1134  C  C    . SER A 1 115 ? 39.528  29.284  -4.564  1.00 2.00  ? 146 SER A C    1 
ATOM   1135  O  O    . SER A 1 115 ? 38.464  29.850  -4.748  1.00 3.31  ? 146 SER A O    1 
ATOM   1136  C  CB   . SER A 1 115 ? 41.106  30.641  -5.938  1.00 2.00  ? 146 SER A CB   1 
ATOM   1137  O  OG   . SER A 1 115 ? 42.268  31.454  -5.972  1.00 2.24  ? 146 SER A OG   1 
ATOM   1138  H  H    . SER A 1 115 ? 42.596  28.990  -4.674  1.00 17.00 ? 146 SER A H    1 
ATOM   1139  H  HG   . SER A 1 115 ? 42.114  32.162  -5.333  1.00 17.00 ? 146 SER A HG   1 
ATOM   1140  N  N    . TYR A 1 116 ? 39.640  27.979  -4.363  1.00 2.00  ? 147 TYR A N    1 
ATOM   1141  C  CA   . TYR A 1 116 ? 38.501  27.049  -4.362  1.00 3.39  ? 147 TYR A CA   1 
ATOM   1142  C  C    . TYR A 1 116 ? 37.883  26.847  -2.977  1.00 2.05  ? 147 TYR A C    1 
ATOM   1143  O  O    . TYR A 1 116 ? 38.340  27.382  -1.986  1.00 2.84  ? 147 TYR A O    1 
ATOM   1144  C  CB   . TYR A 1 116 ? 38.954  25.655  -4.843  1.00 4.14  ? 147 TYR A CB   1 
ATOM   1145  C  CG   . TYR A 1 116 ? 39.284  25.472  -6.317  1.00 3.21  ? 147 TYR A CG   1 
ATOM   1146  C  CD1  . TYR A 1 116 ? 38.329  25.694  -7.314  1.00 5.15  ? 147 TYR A CD1  1 
ATOM   1147  C  CD2  . TYR A 1 116 ? 40.495  24.949  -6.694  1.00 2.89  ? 147 TYR A CD2  1 
ATOM   1148  C  CE1  . TYR A 1 116 ? 38.587  25.373  -8.638  1.00 5.65  ? 147 TYR A CE1  1 
ATOM   1149  C  CE2  . TYR A 1 116 ? 40.758  24.633  -8.015  1.00 5.24  ? 147 TYR A CE2  1 
ATOM   1150  C  CZ   . TYR A 1 116 ? 39.804  24.841  -8.974  1.00 5.32  ? 147 TYR A CZ   1 
ATOM   1151  O  OH   . TYR A 1 116 ? 40.061  24.487  -10.266 1.00 5.37  ? 147 TYR A OH   1 
ATOM   1152  H  H    . TYR A 1 116 ? 40.523  27.597  -4.188  1.00 17.00 ? 147 TYR A H    1 
ATOM   1153  H  HH   . TYR A 1 116 ? 40.991  24.217  -10.363 1.00 17.00 ? 147 TYR A HH   1 
ATOM   1154  N  N    . TYR A 1 117 ? 36.827  26.069  -2.927  1.00 2.00  ? 148 TYR A N    1 
ATOM   1155  C  CA   . TYR A 1 117 ? 36.174  25.740  -1.668  1.00 3.43  ? 148 TYR A CA   1 
ATOM   1156  C  C    . TYR A 1 117 ? 36.427  24.247  -1.644  1.00 3.83  ? 148 TYR A C    1 
ATOM   1157  O  O    . TYR A 1 117 ? 36.221  23.561  -2.672  1.00 2.58  ? 148 TYR A O    1 
ATOM   1158  C  CB   . TYR A 1 117 ? 34.648  25.904  -1.745  1.00 5.44  ? 148 TYR A CB   1 
ATOM   1159  C  CG   . TYR A 1 117 ? 34.073  27.257  -1.488  1.00 2.00  ? 148 TYR A CG   1 
ATOM   1160  C  CD1  . TYR A 1 117 ? 34.114  27.806  -0.220  1.00 2.66  ? 148 TYR A CD1  1 
ATOM   1161  C  CD2  . TYR A 1 117 ? 33.413  27.960  -2.501  1.00 2.00  ? 148 TYR A CD2  1 
ATOM   1162  C  CE1  . TYR A 1 117 ? 33.497  29.051  0.052   1.00 4.94  ? 148 TYR A CE1  1 
ATOM   1163  C  CE2  . TYR A 1 117 ? 32.791  29.201  -2.253  1.00 4.20  ? 148 TYR A CE2  1 
ATOM   1164  C  CZ   . TYR A 1 117 ? 32.838  29.745  -0.970  1.00 3.66  ? 148 TYR A CZ   1 
ATOM   1165  O  OH   . TYR A 1 117 ? 32.240  30.959  -0.712  1.00 2.00  ? 148 TYR A OH   1 
ATOM   1166  H  H    . TYR A 1 117 ? 36.461  25.684  -3.751  1.00 17.00 ? 148 TYR A H    1 
ATOM   1167  H  HH   . TYR A 1 117 ? 31.742  31.187  -1.500  1.00 17.00 ? 148 TYR A HH   1 
ATOM   1168  N  N    . THR A 1 118 ? 36.837  23.706  -0.502  1.00 4.36  ? 149 THR A N    1 
ATOM   1169  C  CA   . THR A 1 118 ? 37.082  22.263  -0.468  1.00 7.01  ? 149 THR A CA   1 
ATOM   1170  C  C    . THR A 1 118 ? 35.690  21.641  -0.643  1.00 8.86  ? 149 THR A C    1 
ATOM   1171  O  O    . THR A 1 118 ? 34.690  22.378  -0.700  1.00 12.43 ? 149 THR A O    1 
ATOM   1172  C  CB   . THR A 1 118 ? 37.820  21.803  0.842   1.00 5.52  ? 149 THR A CB   1 
ATOM   1173  O  OG1  . THR A 1 118 ? 38.375  20.495  0.650   1.00 4.02  ? 149 THR A OG1  1 
ATOM   1174  C  CG2  . THR A 1 118 ? 36.885  21.766  2.051   1.00 3.92  ? 149 THR A CG2  1 
ATOM   1175  H  H    . THR A 1 118 ? 36.902  24.258  0.300   1.00 17.00 ? 149 THR A H    1 
ATOM   1176  H  HG1  . THR A 1 118 ? 38.760  20.419  -0.236  1.00 17.00 ? 149 THR A HG1  1 
ATOM   1177  N  N    . ARG A 1 119 ? 35.590  20.323  -0.753  1.00 7.51  ? 150 ARG A N    1 
ATOM   1178  C  CA   . ARG A 1 119 ? 34.282  19.713  -0.935  1.00 5.35  ? 150 ARG A CA   1 
ATOM   1179  C  C    . ARG A 1 119 ? 34.252  18.337  -0.262  1.00 5.34  ? 150 ARG A C    1 
ATOM   1180  O  O    . ARG A 1 119 ? 34.993  17.447  -0.645  1.00 4.15  ? 150 ARG A O    1 
ATOM   1181  C  CB   . ARG A 1 119 ? 34.004  19.605  -2.444  1.00 4.95  ? 150 ARG A CB   1 
ATOM   1182  C  CG   . ARG A 1 119 ? 32.609  19.189  -2.802  1.00 3.48  ? 150 ARG A CG   1 
ATOM   1183  C  CD   . ARG A 1 119 ? 31.775  20.326  -3.279  1.00 2.00  ? 150 ARG A CD   1 
ATOM   1184  N  NE   . ARG A 1 119 ? 31.610  20.324  -4.722  1.00 2.00  ? 150 ARG A NE   1 
ATOM   1185  C  CZ   . ARG A 1 119 ? 31.167  19.288  -5.441  1.00 3.69  ? 150 ARG A CZ   1 
ATOM   1186  N  NH1  . ARG A 1 119 ? 30.834  18.142  -4.854  1.00 6.03  ? 150 ARG A NH1  1 
ATOM   1187  N  NH2  . ARG A 1 119 ? 31.074  19.378  -6.767  1.00 2.19  ? 150 ARG A NH2  1 
ATOM   1188  H  H    . ARG A 1 119 ? 36.391  19.751  -0.704  1.00 17.00 ? 150 ARG A H    1 
ATOM   1189  H  HE   . ARG A 1 119 ? 31.843  21.142  -5.207  1.00 17.00 ? 150 ARG A HE   1 
ATOM   1190  H  HH11 . ARG A 1 119 ? 30.895  18.024  -3.864  1.00 17.00 ? 150 ARG A HH11 1 
ATOM   1191  H  HH12 . ARG A 1 119 ? 30.501  17.381  -5.411  1.00 17.00 ? 150 ARG A HH12 1 
ATOM   1192  H  HH21 . ARG A 1 119 ? 31.342  20.216  -7.240  1.00 17.00 ? 150 ARG A HH21 1 
ATOM   1193  H  HH22 . ARG A 1 119 ? 30.711  18.607  -7.287  1.00 17.00 ? 150 ARG A HH22 1 
ATOM   1194  N  N    . ALA A 1 120 ? 33.407  18.174  0.753   1.00 5.57  ? 151 ALA A N    1 
ATOM   1195  C  CA   . ALA A 1 120 ? 33.290  16.900  1.473   1.00 4.08  ? 151 ALA A CA   1 
ATOM   1196  C  C    . ALA A 1 120 ? 33.047  15.709  0.560   1.00 3.32  ? 151 ALA A C    1 
ATOM   1197  O  O    . ALA A 1 120 ? 33.462  14.600  0.889   1.00 5.93  ? 151 ALA A O    1 
ATOM   1198  C  CB   . ALA A 1 120 ? 32.199  16.971  2.506   1.00 6.44  ? 151 ALA A CB   1 
ATOM   1199  H  H    . ALA A 1 120 ? 32.834  18.918  1.014   1.00 17.00 ? 151 ALA A H    1 
ATOM   1200  N  N    . LEU A 1 121 ? 32.299  15.895  -0.522  1.00 2.00  ? 152 LEU A N    1 
ATOM   1201  C  CA   . LEU A 1 121 ? 32.094  14.802  -1.470  1.00 2.00  ? 152 LEU A CA   1 
ATOM   1202  C  C    . LEU A 1 121 ? 32.470  15.267  -2.850  1.00 2.00  ? 152 LEU A C    1 
ATOM   1203  O  O    . LEU A 1 121 ? 32.159  16.382  -3.245  1.00 2.00  ? 152 LEU A O    1 
ATOM   1204  C  CB   . LEU A 1 121 ? 30.672  14.263  -1.456  1.00 2.49  ? 152 LEU A CB   1 
ATOM   1205  C  CG   . LEU A 1 121 ? 30.346  13.382  -0.265  1.00 2.00  ? 152 LEU A CG   1 
ATOM   1206  C  CD1  . LEU A 1 121 ? 29.024  12.750  -0.446  1.00 2.00  ? 152 LEU A CD1  1 
ATOM   1207  C  CD2  . LEU A 1 121 ? 31.375  12.325  -0.148  1.00 2.64  ? 152 LEU A CD2  1 
ATOM   1208  H  H    . LEU A 1 121 ? 31.893  16.756  -0.735  1.00 17.00 ? 152 LEU A H    1 
ATOM   1209  N  N    . PRO A 1 122 ? 33.212  14.441  -3.579  1.00 2.00  ? 153 PRO A N    1 
ATOM   1210  C  CA   . PRO A 1 122 ? 33.635  14.792  -4.921  1.00 2.46  ? 153 PRO A CA   1 
ATOM   1211  C  C    . PRO A 1 122 ? 32.436  15.008  -5.820  1.00 3.14  ? 153 PRO A C    1 
ATOM   1212  O  O    . PRO A 1 122 ? 31.377  14.389  -5.641  1.00 2.00  ? 153 PRO A O    1 
ATOM   1213  C  CB   . PRO A 1 122 ? 34.410  13.574  -5.348  1.00 2.00  ? 153 PRO A CB   1 
ATOM   1214  C  CG   . PRO A 1 122 ? 33.672  12.525  -4.709  1.00 2.72  ? 153 PRO A CG   1 
ATOM   1215  C  CD   . PRO A 1 122 ? 33.501  13.038  -3.321  1.00 2.59  ? 153 PRO A CD   1 
ATOM   1216  N  N    . PRO A 1 123 ? 32.576  15.925  -6.783  1.00 3.50  ? 154 PRO A N    1 
ATOM   1217  C  CA   . PRO A 1 123 ? 31.494  16.209  -7.710  1.00 5.29  ? 154 PRO A CA   1 
ATOM   1218  C  C    . PRO A 1 123 ? 31.178  14.960  -8.503  1.00 5.08  ? 154 PRO A C    1 
ATOM   1219  O  O    . PRO A 1 123 ? 31.882  13.966  -8.399  1.00 7.10  ? 154 PRO A O    1 
ATOM   1220  C  CB   . PRO A 1 123 ? 32.093  17.301  -8.601  1.00 3.22  ? 154 PRO A CB   1 
ATOM   1221  C  CG   . PRO A 1 123 ? 33.507  16.995  -8.597  1.00 2.81  ? 154 PRO A CG   1 
ATOM   1222  C  CD   . PRO A 1 123 ? 33.757  16.720  -7.133  1.00 3.57  ? 154 PRO A CD   1 
ATOM   1223  N  N    . VAL A 1 124 ? 30.081  15.007  -9.242  1.00 5.52  ? 155 VAL A N    1 
ATOM   1224  C  CA   . VAL A 1 124 ? 29.660  13.910  -10.074 1.00 6.05  ? 155 VAL A CA   1 
ATOM   1225  C  C    . VAL A 1 124 ? 30.343  14.098  -11.432 1.00 8.07  ? 155 VAL A C    1 
ATOM   1226  O  O    . VAL A 1 124 ? 30.309  15.193  -12.019 1.00 6.04  ? 155 VAL A O    1 
ATOM   1227  C  CB   . VAL A 1 124 ? 28.132  13.903  -10.239 1.00 6.46  ? 155 VAL A CB   1 
ATOM   1228  C  CG1  . VAL A 1 124 ? 27.707  12.792  -11.232 1.00 8.13  ? 155 VAL A CG1  1 
ATOM   1229  C  CG2  . VAL A 1 124 ? 27.448  13.740  -8.872  1.00 3.21  ? 155 VAL A CG2  1 
ATOM   1230  H  H    . VAL A 1 124 ? 29.526  15.821  -9.219  1.00 17.00 ? 155 VAL A H    1 
ATOM   1231  N  N    . ALA A 1 125 ? 30.989  13.030  -11.912 1.00 10.66 ? 156 ALA A N    1 
ATOM   1232  C  CA   . ALA A 1 125 ? 31.686  13.065  -13.201 1.00 11.28 ? 156 ALA A CA   1 
ATOM   1233  C  C    . ALA A 1 125 ? 30.777  13.591  -14.332 1.00 13.33 ? 156 ALA A C    1 
ATOM   1234  O  O    . ALA A 1 125 ? 29.678  13.056  -14.614 1.00 11.60 ? 156 ALA A O    1 
ATOM   1235  C  CB   . ALA A 1 125 ? 32.207  11.707  -13.553 1.00 11.07 ? 156 ALA A CB   1 
ATOM   1236  H  H    . ALA A 1 125 ? 30.963  12.208  -11.386 1.00 17.00 ? 156 ALA A H    1 
ATOM   1237  N  N    . ASP A 1 126 ? 31.286  14.615  -15.003 1.00 12.07 ? 157 ASP A N    1 
ATOM   1238  C  CA   . ASP A 1 126 ? 30.591  15.257  -16.095 1.00 10.43 ? 157 ASP A CA   1 
ATOM   1239  C  C    . ASP A 1 126 ? 30.188  14.277  -17.210 1.00 6.69  ? 157 ASP A C    1 
ATOM   1240  O  O    . ASP A 1 126 ? 29.472  14.655  -18.112 1.00 6.52  ? 157 ASP A O    1 
ATOM   1241  C  CB   . ASP A 1 126 ? 31.468  16.429  -16.622 1.00 11.88 ? 157 ASP A CB   1 
ATOM   1242  C  CG   . ASP A 1 126 ? 31.770  17.507  -15.522 1.00 12.07 ? 157 ASP A CG   1 
ATOM   1243  O  OD1  . ASP A 1 126 ? 32.086  17.142  -14.357 1.00 9.68  ? 157 ASP A OD1  1 
ATOM   1244  O  OD2  . ASP A 1 126 ? 31.670  18.729  -15.808 1.00 12.05 ? 157 ASP A OD2  1 
ATOM   1245  H  H    . ASP A 1 126 ? 32.157  14.958  -14.724 1.00 17.00 ? 157 ASP A H    1 
ATOM   1246  N  N    . ASP A 1 127 ? 30.632  13.028  -17.144 1.00 6.89  ? 158 ASP A N    1 
ATOM   1247  C  CA   . ASP A 1 127 ? 30.276  12.062  -18.185 1.00 10.99 ? 158 ASP A CA   1 
ATOM   1248  C  C    . ASP A 1 127 ? 29.258  11.017  -17.711 1.00 10.95 ? 158 ASP A C    1 
ATOM   1249  O  O    . ASP A 1 127 ? 29.081  9.956   -18.332 1.00 7.23  ? 158 ASP A O    1 
ATOM   1250  C  CB   . ASP A 1 127 ? 31.543  11.363  -18.757 1.00 14.87 ? 158 ASP A CB   1 
ATOM   1251  C  CG   . ASP A 1 127 ? 32.229  10.397  -17.756 1.00 17.56 ? 158 ASP A CG   1 
ATOM   1252  O  OD1  . ASP A 1 127 ? 31.574  9.434   -17.287 1.00 18.88 ? 158 ASP A OD1  1 
ATOM   1253  O  OD2  . ASP A 1 127 ? 33.439  10.572  -17.465 1.00 17.18 ? 158 ASP A OD2  1 
ATOM   1254  H  H    . ASP A 1 127 ? 31.190  12.730  -16.409 1.00 17.00 ? 158 ASP A H    1 
ATOM   1255  N  N    . CYS A 1 128 ? 28.639  11.283  -16.571 1.00 10.35 ? 159 CYS A N    1 
ATOM   1256  C  CA   . CYS A 1 128 ? 27.687  10.333  -16.028 1.00 8.98  ? 159 CYS A CA   1 
ATOM   1257  C  C    . CYS A 1 128 ? 26.366  10.269  -16.819 1.00 8.92  ? 159 CYS A C    1 
ATOM   1258  O  O    . CYS A 1 128 ? 26.160  11.054  -17.745 1.00 8.72  ? 159 CYS A O    1 
ATOM   1259  C  CB   . CYS A 1 128 ? 27.492  10.610  -14.530 1.00 9.50  ? 159 CYS A CB   1 
ATOM   1260  S  SG   . CYS A 1 128 ? 28.951  10.136  -13.532 1.00 2.00  ? 159 CYS A SG   1 
ATOM   1261  H  H    . CYS A 1 128 ? 28.780  12.130  -16.096 1.00 17.00 ? 159 CYS A H    1 
ATOM   1262  N  N    . PRO A 1 129 ? 25.536  9.233   -16.577 1.00 7.70  ? 160 PRO A N    1 
ATOM   1263  C  CA   . PRO A 1 129 ? 24.259  9.099   -17.289 1.00 6.42  ? 160 PRO A CA   1 
ATOM   1264  C  C    . PRO A 1 129 ? 23.164  10.053  -16.779 1.00 5.54  ? 160 PRO A C    1 
ATOM   1265  O  O    . PRO A 1 129 ? 22.374  10.602  -17.558 1.00 3.32  ? 160 PRO A O    1 
ATOM   1266  C  CB   . PRO A 1 129 ? 23.900  7.637   -17.039 1.00 6.68  ? 160 PRO A CB   1 
ATOM   1267  C  CG   . PRO A 1 129 ? 24.442  7.395   -15.685 1.00 5.63  ? 160 PRO A CG   1 
ATOM   1268  C  CD   . PRO A 1 129 ? 25.800  8.027   -15.771 1.00 6.28  ? 160 PRO A CD   1 
ATOM   1269  N  N    . THR A 1 130 ? 23.136  10.242  -15.466 1.00 6.11  ? 161 THR A N    1 
ATOM   1270  C  CA   . THR A 1 130 ? 22.173  11.120  -14.827 1.00 7.38  ? 161 THR A CA   1 
ATOM   1271  C  C    . THR A 1 130 ? 22.946  12.072  -13.928 1.00 8.96  ? 161 THR A C    1 
ATOM   1272  O  O    . THR A 1 130 ? 23.996  11.700  -13.404 1.00 8.93  ? 161 THR A O    1 
ATOM   1273  C  CB   . THR A 1 130 ? 21.205  10.329  -13.941 1.00 8.31  ? 161 THR A CB   1 
ATOM   1274  O  OG1  . THR A 1 130 ? 21.885  9.908   -12.752 1.00 8.31  ? 161 THR A OG1  1 
ATOM   1275  C  CG2  . THR A 1 130 ? 20.654  9.111   -14.700 1.00 5.63  ? 161 THR A CG2  1 
ATOM   1276  H  H    . THR A 1 130 ? 23.778  9.809   -14.869 1.00 17.00 ? 161 THR A H    1 
ATOM   1277  H  HG1  . THR A 1 130 ? 21.188  9.512   -12.218 1.00 17.00 ? 161 THR A HG1  1 
ATOM   1278  N  N    . PRO A 1 131 ? 22.415  13.294  -13.697 1.00 9.61  ? 162 PRO A N    1 
ATOM   1279  C  CA   . PRO A 1 131 ? 23.052  14.312  -12.855 1.00 9.37  ? 162 PRO A CA   1 
ATOM   1280  C  C    . PRO A 1 131 ? 23.350  13.845  -11.442 1.00 8.45  ? 162 PRO A C    1 
ATOM   1281  O  O    . PRO A 1 131 ? 24.172  14.481  -10.744 1.00 9.12  ? 162 PRO A O    1 
ATOM   1282  C  CB   . PRO A 1 131 ? 22.057  15.476  -12.898 1.00 8.00  ? 162 PRO A CB   1 
ATOM   1283  C  CG   . PRO A 1 131 ? 20.778  14.833  -13.183 1.00 8.57  ? 162 PRO A CG   1 
ATOM   1284  C  CD   . PRO A 1 131 ? 21.144  13.814  -14.222 1.00 10.54 ? 162 PRO A CD   1 
ATOM   1285  N  N    . MET A 1 132 ? 22.684  12.769  -11.012 1.00 4.70  ? 163 MET A N    1 
ATOM   1286  C  CA   . MET A 1 132 ? 22.961  12.230  -9.681  1.00 5.82  ? 163 MET A CA   1 
ATOM   1287  C  C    . MET A 1 132 ? 23.863  11.008  -9.778  1.00 4.08  ? 163 MET A C    1 
ATOM   1288  O  O    . MET A 1 132 ? 23.987  10.230  -8.835  1.00 2.24  ? 163 MET A O    1 
ATOM   1289  C  CB   . MET A 1 132 ? 21.671  11.894  -8.926  1.00 5.85  ? 163 MET A CB   1 
ATOM   1290  C  CG   . MET A 1 132 ? 21.017  13.104  -8.272  1.00 7.27  ? 163 MET A CG   1 
ATOM   1291  S  SD   . MET A 1 132 ? 22.107  14.021  -7.187  1.00 4.09  ? 163 MET A SD   1 
ATOM   1292  C  CE   . MET A 1 132 ? 22.526  15.411  -8.208  1.00 3.21  ? 163 MET A CE   1 
ATOM   1293  H  H    . MET A 1 132 ? 22.029  12.312  -11.575 1.00 17.00 ? 163 MET A H    1 
ATOM   1294  N  N    . GLY A 1 133 ? 24.516  10.878  -10.924 1.00 4.74  ? 164 GLY A N    1 
ATOM   1295  C  CA   . GLY A 1 133 ? 25.375  9.748   -11.171 1.00 6.00  ? 164 GLY A CA   1 
ATOM   1296  C  C    . GLY A 1 133 ? 24.665  8.881   -12.180 1.00 8.04  ? 164 GLY A C    1 
ATOM   1297  O  O    . GLY A 1 133 ? 24.739  9.127   -13.380 1.00 6.06  ? 164 GLY A O    1 
ATOM   1298  H  H    . GLY A 1 133 ? 24.438  11.549  -11.625 1.00 17.00 ? 164 GLY A H    1 
ATOM   1299  N  N    . VAL A 1 134 ? 23.951  7.878   -11.675 1.00 12.10 ? 165 VAL A N    1 
ATOM   1300  C  CA   . VAL A 1 134 ? 23.181  6.948   -12.504 1.00 13.87 ? 165 VAL A CA   1 
ATOM   1301  C  C    . VAL A 1 134 ? 21.678  6.971   -12.230 1.00 15.13 ? 165 VAL A C    1 
ATOM   1302  O  O    . VAL A 1 134 ? 20.895  6.676   -13.128 1.00 18.76 ? 165 VAL A O    1 
ATOM   1303  C  CB   . VAL A 1 134 ? 23.654  5.517   -12.346 1.00 11.63 ? 165 VAL A CB   1 
ATOM   1304  C  CG1  . VAL A 1 134 ? 24.911  5.324   -13.157 1.00 13.58 ? 165 VAL A CG1  1 
ATOM   1305  C  CG2  . VAL A 1 134 ? 23.873  5.190   -10.850 1.00 9.31  ? 165 VAL A CG2  1 
ATOM   1306  H  H    . VAL A 1 134 ? 23.940  7.803   -10.700 1.00 17.00 ? 165 VAL A H    1 
ATOM   1307  N  N    . LYS A 1 135 ? 21.270  7.345   -11.019 1.00 13.35 ? 166 LYS A N    1 
ATOM   1308  C  CA   . LYS A 1 135 ? 19.854  7.365   -10.668 1.00 12.05 ? 166 LYS A CA   1 
ATOM   1309  C  C    . LYS A 1 135 ? 19.185  8.626   -11.052 1.00 12.83 ? 166 LYS A C    1 
ATOM   1310  O  O    . LYS A 1 135 ? 19.792  9.685   -10.953 1.00 15.11 ? 166 LYS A O    1 
ATOM   1311  C  CB   . LYS A 1 135 ? 19.658  7.185   -9.178  1.00 10.99 ? 166 LYS A CB   1 
ATOM   1312  C  CG   . LYS A 1 135 ? 19.938  5.799   -8.681  1.00 8.94  ? 166 LYS A CG   1 
ATOM   1313  C  CD   . LYS A 1 135 ? 19.634  5.720   -7.214  1.00 8.69  ? 166 LYS A CD   1 
ATOM   1314  C  CE   . LYS A 1 135 ? 19.782  4.318   -6.694  1.00 11.62 ? 166 LYS A CE   1 
ATOM   1315  N  NZ   . LYS A 1 135 ? 19.283  4.243   -5.297  1.00 13.12 ? 166 LYS A NZ   1 
ATOM   1316  H  H    . LYS A 1 135 ? 21.921  7.644   -10.358 1.00 17.00 ? 166 LYS A H    1 
ATOM   1317  H  HZ1  . LYS A 1 135 ? 18.288  4.544   -5.270  1.00 17.00 ? 166 LYS A HZ1  1 
ATOM   1318  H  HZ2  . LYS A 1 135 ? 19.361  3.267   -4.948  1.00 17.00 ? 166 LYS A HZ2  1 
ATOM   1319  H  HZ3  . LYS A 1 135 ? 19.851  4.874   -4.694  1.00 17.00 ? 166 LYS A HZ3  1 
ATOM   1320  N  N    . GLY A 1 136 ? 17.915  8.524   -11.439 1.00 13.34 ? 167 GLY A N    1 
ATOM   1321  C  CA   . GLY A 1 136 ? 17.157  9.709   -11.823 1.00 13.78 ? 167 GLY A CA   1 
ATOM   1322  C  C    . GLY A 1 136 ? 16.914  9.823   -13.316 1.00 12.57 ? 167 GLY A C    1 
ATOM   1323  O  O    . GLY A 1 136 ? 17.213  8.904   -14.083 1.00 11.67 ? 167 GLY A O    1 
ATOM   1324  H  H    . GLY A 1 136 ? 17.502  7.641   -11.513 1.00 17.00 ? 167 GLY A H    1 
ATOM   1325  N  N    . ASN A 1 137 ? 16.382  10.967  -13.726 1.00 11.88 ? 168 ASN A N    1 
ATOM   1326  C  CA   . ASN A 1 137 ? 16.077  11.199  -15.125 1.00 12.51 ? 168 ASN A CA   1 
ATOM   1327  C  C    . ASN A 1 137 ? 17.122  12.080  -15.749 1.00 11.49 ? 168 ASN A C    1 
ATOM   1328  O  O    . ASN A 1 137 ? 17.974  12.637  -15.042 1.00 8.88  ? 168 ASN A O    1 
ATOM   1329  C  CB   . ASN A 1 137 ? 14.704  11.848  -15.257 1.00 15.69 ? 168 ASN A CB   1 
ATOM   1330  C  CG   . ASN A 1 137 ? 13.589  10.927  -14.813 1.00 16.27 ? 168 ASN A CG   1 
ATOM   1331  O  OD1  . ASN A 1 137 ? 13.095  10.124  -15.605 1.00 16.96 ? 168 ASN A OD1  1 
ATOM   1332  N  ND2  . ASN A 1 137 ? 13.198  11.021  -13.537 1.00 15.84 ? 168 ASN A ND2  1 
ATOM   1333  H  H    . ASN A 1 137 ? 16.266  11.703  -13.092 1.00 17.00 ? 168 ASN A H    1 
ATOM   1334  H  HD21 . ASN A 1 137 ? 12.474  10.416  -13.268 1.00 17.00 ? 168 ASN A HD21 1 
ATOM   1335  H  HD22 . ASN A 1 137 ? 13.616  11.667  -12.935 1.00 17.00 ? 168 ASN A HD22 1 
ATOM   1336  N  N    . LYS A 1 138 ? 17.024  12.215  -17.073 1.00 9.49  ? 169 LYS A N    1 
ATOM   1337  C  CA   . LYS A 1 138 ? 17.936  13.026  -17.853 1.00 7.92  ? 169 LYS A CA   1 
ATOM   1338  C  C    . LYS A 1 138 ? 18.116  14.409  -17.190 1.00 5.33  ? 169 LYS A C    1 
ATOM   1339  O  O    . LYS A 1 138 ? 19.154  15.055  -17.314 1.00 5.75  ? 169 LYS A O    1 
ATOM   1340  C  CB   . LYS A 1 138 ? 17.404  13.119  -19.278 1.00 6.26  ? 169 LYS A CB   1 
ATOM   1341  C  CG   . LYS A 1 138 ? 18.232  14.017  -20.138 1.00 10.81 ? 169 LYS A CG   1 
ATOM   1342  C  CD   . LYS A 1 138 ? 17.748  14.014  -21.528 1.00 14.74 ? 169 LYS A CD   1 
ATOM   1343  C  CE   . LYS A 1 138 ? 17.948  12.638  -22.099 1.00 16.11 ? 169 LYS A CE   1 
ATOM   1344  N  NZ   . LYS A 1 138 ? 19.387  12.221  -21.977 1.00 15.96 ? 169 LYS A NZ   1 
ATOM   1345  H  H    . LYS A 1 138 ? 16.311  11.728  -17.533 1.00 17.00 ? 169 LYS A H    1 
ATOM   1346  H  HZ1  . LYS A 1 138 ? 20.000  12.927  -22.432 1.00 17.00 ? 169 LYS A HZ1  1 
ATOM   1347  H  HZ2  . LYS A 1 138 ? 19.649  12.130  -20.975 1.00 17.00 ? 169 LYS A HZ2  1 
ATOM   1348  H  HZ3  . LYS A 1 138 ? 19.515  11.301  -22.445 1.00 17.00 ? 169 LYS A HZ3  1 
ATOM   1349  N  N    . GLU A 1 139 ? 17.086  14.860  -16.500 1.00 2.91  ? 170 GLU A N    1 
ATOM   1350  C  CA   . GLU A 1 139 ? 17.174  16.104  -15.781 1.00 5.31  ? 170 GLU A CA   1 
ATOM   1351  C  C    . GLU A 1 139 ? 16.686  15.814  -14.376 1.00 8.51  ? 170 GLU A C    1 
ATOM   1352  O  O    . GLU A 1 139 ? 16.369  14.654  -14.029 1.00 9.37  ? 170 GLU A O    1 
ATOM   1353  C  CB   . GLU A 1 139 ? 16.323  17.198  -16.423 1.00 6.77  ? 170 GLU A CB   1 
ATOM   1354  C  CG   . GLU A 1 139 ? 16.807  17.676  -17.801 1.00 6.99  ? 170 GLU A CG   1 
ATOM   1355  C  CD   . GLU A 1 139 ? 16.465  16.687  -18.891 1.00 9.25  ? 170 GLU A CD   1 
ATOM   1356  O  OE1  . GLU A 1 139 ? 15.647  15.774  -18.636 1.00 10.72 ? 170 GLU A OE1  1 
ATOM   1357  O  OE2  . GLU A 1 139 ? 16.999  16.831  -20.011 1.00 9.61  ? 170 GLU A OE2  1 
ATOM   1358  H  H    . GLU A 1 139 ? 16.258  14.355  -16.428 1.00 17.00 ? 170 GLU A H    1 
ATOM   1359  N  N    . LEU A 1 140 ? 16.654  16.853  -13.554 1.00 9.00  ? 171 LEU A N    1 
ATOM   1360  C  CA   . LEU A 1 140 ? 16.181  16.715  -12.187 1.00 9.79  ? 171 LEU A CA   1 
ATOM   1361  C  C    . LEU A 1 140 ? 14.889  17.547  -12.104 1.00 10.70 ? 171 LEU A C    1 
ATOM   1362  O  O    . LEU A 1 140 ? 14.449  18.112  -13.123 1.00 9.01  ? 171 LEU A O    1 
ATOM   1363  C  CB   . LEU A 1 140 ? 17.249  17.250  -11.232 1.00 11.20 ? 171 LEU A CB   1 
ATOM   1364  C  CG   . LEU A 1 140 ? 17.665  16.352  -10.062 1.00 10.28 ? 171 LEU A CG   1 
ATOM   1365  C  CD1  . LEU A 1 140 ? 18.108  15.014  -10.572 1.00 5.50  ? 171 LEU A CD1  1 
ATOM   1366  C  CD2  . LEU A 1 140 ? 18.764  17.029  -9.266  1.00 10.54 ? 171 LEU A CD2  1 
ATOM   1367  H  H    . LEU A 1 140 ? 16.899  17.746  -13.864 1.00 17.00 ? 171 LEU A H    1 
ATOM   1368  N  N    . PRO A 1 141 ? 14.226  17.587  -10.921 1.00 9.91  ? 172 PRO A N    1 
ATOM   1369  C  CA   . PRO A 1 141 ? 12.998  18.380  -10.828 1.00 9.10  ? 172 PRO A CA   1 
ATOM   1370  C  C    . PRO A 1 141 ? 13.346  19.812  -11.162 1.00 8.68  ? 172 PRO A C    1 
ATOM   1371  O  O    . PRO A 1 141 ? 14.523  20.159  -11.252 1.00 9.89  ? 172 PRO A O    1 
ATOM   1372  C  CB   . PRO A 1 141 ? 12.653  18.274  -9.342  1.00 7.24  ? 172 PRO A CB   1 
ATOM   1373  C  CG   . PRO A 1 141 ? 13.107  16.935  -9.007  1.00 7.49  ? 172 PRO A CG   1 
ATOM   1374  C  CD   . PRO A 1 141 ? 14.457  16.881  -9.648  1.00 8.86  ? 172 PRO A CD   1 
ATOM   1375  N  N    . ASP A 1 142 ? 12.342  20.637  -11.394 1.00 8.22  ? 173 ASP A N    1 
ATOM   1376  C  CA   . ASP A 1 142 ? 12.620  22.032  -11.634 1.00 7.78  ? 173 ASP A CA   1 
ATOM   1377  C  C    . ASP A 1 142 ? 12.934  22.638  -10.291 1.00 6.63  ? 173 ASP A C    1 
ATOM   1378  O  O    . ASP A 1 142 ? 12.557  22.126  -9.255  1.00 2.00  ? 173 ASP A O    1 
ATOM   1379  C  CB   . ASP A 1 142 ? 11.406  22.766  -12.178 1.00 12.87 ? 173 ASP A CB   1 
ATOM   1380  C  CG   . ASP A 1 142 ? 11.709  24.226  -12.472 1.00 19.60 ? 173 ASP A CG   1 
ATOM   1381  O  OD1  . ASP A 1 142 ? 12.636  24.460  -13.310 1.00 24.17 ? 173 ASP A OD1  1 
ATOM   1382  O  OD2  . ASP A 1 142 ? 11.067  25.120  -11.842 1.00 18.52 ? 173 ASP A OD2  1 
ATOM   1383  H  H    . ASP A 1 142 ? 11.425  20.304  -11.385 1.00 17.00 ? 173 ASP A H    1 
ATOM   1384  N  N    . SER A 1 143 ? 13.626  23.753  -10.323 1.00 9.94  ? 174 SER A N    1 
ATOM   1385  C  CA   . SER A 1 143 ? 13.967  24.469  -9.116  1.00 12.87 ? 174 SER A CA   1 
ATOM   1386  C  C    . SER A 1 143 ? 12.682  24.990  -8.450  1.00 10.91 ? 174 SER A C    1 
ATOM   1387  O  O    . SER A 1 143 ? 12.408  24.680  -7.298  1.00 9.39  ? 174 SER A O    1 
ATOM   1388  C  CB   . SER A 1 143 ? 14.922  25.613  -9.488  1.00 17.19 ? 174 SER A CB   1 
ATOM   1389  O  OG   . SER A 1 143 ? 15.953  25.117  -10.359 1.00 21.66 ? 174 SER A OG   1 
ATOM   1390  H  H    . SER A 1 143 ? 13.972  24.089  -11.176 1.00 17.00 ? 174 SER A H    1 
ATOM   1391  H  HG   . SER A 1 143 ? 16.382  24.351  -9.959  1.00 17.00 ? 174 SER A HG   1 
ATOM   1392  N  N    . LYS A 1 144 ? 11.857  25.718  -9.198  1.00 11.25 ? 175 LYS A N    1 
ATOM   1393  C  CA   . LYS A 1 144 ? 10.615  26.265  -8.634  1.00 8.93  ? 175 LYS A CA   1 
ATOM   1394  C  C    . LYS A 1 144 ? 9.571   25.221  -8.255  1.00 5.01  ? 175 LYS A C    1 
ATOM   1395  O  O    . LYS A 1 144 ? 8.721   25.428  -7.390  1.00 2.09  ? 175 LYS A O    1 
ATOM   1396  C  CB   . LYS A 1 144 ? 10.029  27.369  -9.517  1.00 7.93  ? 175 LYS A CB   1 
ATOM   1397  C  CG   . LYS A 1 144 ? 10.624  28.721  -9.189  1.00 7.50  ? 175 LYS A CG   1 
ATOM   1398  C  CD   . LYS A 1 144 ? 9.923   29.816  -9.950  1.00 13.08 ? 175 LYS A CD   1 
ATOM   1399  C  CE   . LYS A 1 144 ? 10.549  31.171  -9.657  1.00 18.15 ? 175 LYS A CE   1 
ATOM   1400  N  NZ   . LYS A 1 144 ? 10.305  31.641  -8.256  1.00 18.79 ? 175 LYS A NZ   1 
ATOM   1401  H  H    . LYS A 1 144 ? 12.096  25.912  -10.125 1.00 17.00 ? 175 LYS A H    1 
ATOM   1402  H  HZ1  . LYS A 1 144 ? 9.278   31.689  -8.098  1.00 17.00 ? 175 LYS A HZ1  1 
ATOM   1403  H  HZ2  . LYS A 1 144 ? 10.727  30.972  -7.582  1.00 17.00 ? 175 LYS A HZ2  1 
ATOM   1404  H  HZ3  . LYS A 1 144 ? 10.718  32.585  -8.116  1.00 17.00 ? 175 LYS A HZ3  1 
ATOM   1405  N  N    . GLU A 1 145 ? 9.659   24.062  -8.856  1.00 3.02  ? 176 GLU A N    1 
ATOM   1406  C  CA   . GLU A 1 145 ? 8.708   23.044  -8.488  1.00 3.79  ? 176 GLU A CA   1 
ATOM   1407  C  C    . GLU A 1 145 ? 9.128   22.524  -7.133  1.00 3.07  ? 176 GLU A C    1 
ATOM   1408  O  O    . GLU A 1 145 ? 8.501   21.644  -6.575  1.00 3.06  ? 176 GLU A O    1 
ATOM   1409  C  CB   . GLU A 1 145 ? 8.709   21.931  -9.513  1.00 3.42  ? 176 GLU A CB   1 
ATOM   1410  C  CG   . GLU A 1 145 ? 8.096   22.359  -10.803 1.00 9.20  ? 176 GLU A CG   1 
ATOM   1411  C  CD   . GLU A 1 145 ? 6.619   22.533  -10.646 1.00 14.60 ? 176 GLU A CD   1 
ATOM   1412  O  OE1  . GLU A 1 145 ? 5.944   21.507  -10.310 1.00 19.33 ? 176 GLU A OE1  1 
ATOM   1413  O  OE2  . GLU A 1 145 ? 6.149   23.687  -10.835 1.00 14.93 ? 176 GLU A OE2  1 
ATOM   1414  H  H    . GLU A 1 145 ? 10.353  23.859  -9.509  1.00 17.00 ? 176 GLU A H    1 
ATOM   1415  N  N    . VAL A 1 146 ? 10.225  23.057  -6.617  1.00 3.99  ? 177 VAL A N    1 
ATOM   1416  C  CA   . VAL A 1 146 ? 10.728  22.639  -5.321  1.00 3.78  ? 177 VAL A CA   1 
ATOM   1417  C  C    . VAL A 1 146 ? 10.738  23.908  -4.454  1.00 2.00  ? 177 VAL A C    1 
ATOM   1418  O  O    . VAL A 1 146 ? 10.206  23.927  -3.349  1.00 2.00  ? 177 VAL A O    1 
ATOM   1419  C  CB   . VAL A 1 146 ? 12.183  21.992  -5.436  1.00 2.40  ? 177 VAL A CB   1 
ATOM   1420  C  CG1  . VAL A 1 146 ? 12.503  21.208  -4.189  1.00 2.00  ? 177 VAL A CG1  1 
ATOM   1421  C  CG2  . VAL A 1 146 ? 12.308  21.072  -6.641  1.00 2.00  ? 177 VAL A CG2  1 
ATOM   1422  H  H    . VAL A 1 146 ? 10.767  23.685  -7.112  1.00 17.00 ? 177 VAL A H    1 
ATOM   1423  N  N    . LEU A 1 147 ? 11.239  24.987  -5.041  1.00 2.00  ? 178 LEU A N    1 
ATOM   1424  C  CA   . LEU A 1 147 ? 11.349  26.294  -4.425  1.00 3.98  ? 178 LEU A CA   1 
ATOM   1425  C  C    . LEU A 1 147 ? 9.963   26.720  -3.949  1.00 7.39  ? 178 LEU A C    1 
ATOM   1426  O  O    . LEU A 1 147 ? 9.789   27.061  -2.794  1.00 9.88  ? 178 LEU A O    1 
ATOM   1427  C  CB   . LEU A 1 147 ? 11.837  27.276  -5.480  1.00 3.54  ? 178 LEU A CB   1 
ATOM   1428  C  CG   . LEU A 1 147 ? 12.407  28.661  -5.157  1.00 6.62  ? 178 LEU A CG   1 
ATOM   1429  C  CD1  . LEU A 1 147 ? 12.339  29.493  -6.419  1.00 3.42  ? 178 LEU A CD1  1 
ATOM   1430  C  CD2  . LEU A 1 147 ? 11.655  29.365  -4.050  1.00 6.06  ? 178 LEU A CD2  1 
ATOM   1431  H  H    . LEU A 1 147 ? 11.462  24.906  -5.943  1.00 17.00 ? 178 LEU A H    1 
ATOM   1432  N  N    . GLU A 1 148 ? 8.995   26.752  -4.864  1.00 9.99  ? 179 GLU A N    1 
ATOM   1433  C  CA   . GLU A 1 148 ? 7.600   27.117  -4.567  1.00 8.03  ? 179 GLU A CA   1 
ATOM   1434  C  C    . GLU A 1 148 ? 6.846   25.998  -3.812  1.00 5.96  ? 179 GLU A C    1 
ATOM   1435  O  O    . GLU A 1 148 ? 6.384   26.174  -2.680  1.00 4.43  ? 179 GLU A O    1 
ATOM   1436  C  CB   . GLU A 1 148 ? 6.842   27.396  -5.874  1.00 7.82  ? 179 GLU A CB   1 
ATOM   1437  C  CG   . GLU A 1 148 ? 7.143   28.713  -6.535  1.00 4.01  ? 179 GLU A CG   1 
ATOM   1438  C  CD   . GLU A 1 148 ? 6.473   28.829  -7.878  1.00 6.74  ? 179 GLU A CD   1 
ATOM   1439  O  OE1  . GLU A 1 148 ? 5.823   27.864  -8.345  1.00 5.93  ? 179 GLU A OE1  1 
ATOM   1440  O  OE2  . GLU A 1 148 ? 6.617   29.895  -8.480  1.00 8.48  ? 179 GLU A OE2  1 
ATOM   1441  H  H    . GLU A 1 148 ? 9.211   26.518  -5.787  1.00 17.00 ? 179 GLU A H    1 
ATOM   1442  N  N    . LYS A 1 149 ? 6.699   24.860  -4.468  1.00 2.49  ? 180 LYS A N    1 
ATOM   1443  C  CA   . LYS A 1 149 ? 6.000   23.753  -3.868  1.00 2.01  ? 180 LYS A CA   1 
ATOM   1444  C  C    . LYS A 1 149 ? 6.488   23.434  -2.458  1.00 2.83  ? 180 LYS A C    1 
ATOM   1445  O  O    . LYS A 1 149 ? 5.743   23.561  -1.501  1.00 2.00  ? 180 LYS A O    1 
ATOM   1446  C  CB   . LYS A 1 149 ? 6.069   22.498  -4.769  1.00 3.79  ? 180 LYS A CB   1 
ATOM   1447  C  CG   . LYS A 1 149 ? 5.871   22.788  -6.258  1.00 2.08  ? 180 LYS A CG   1 
ATOM   1448  C  CD   . LYS A 1 149 ? 4.794   21.960  -6.915  1.00 2.01  ? 180 LYS A CD   1 
ATOM   1449  C  CE   . LYS A 1 149 ? 4.136   22.805  -8.026  1.00 7.72  ? 180 LYS A CE   1 
ATOM   1450  N  NZ   . LYS A 1 149 ? 3.023   22.202  -8.847  1.00 10.20 ? 180 LYS A NZ   1 
ATOM   1451  H  H    . LYS A 1 149 ? 7.074   24.783  -5.368  1.00 17.00 ? 180 LYS A H    1 
ATOM   1452  H  HZ1  . LYS A 1 149 ? 2.226   21.922  -8.241  1.00 17.00 ? 180 LYS A HZ1  1 
ATOM   1453  H  HZ2  . LYS A 1 149 ? 2.699   22.912  -9.536  1.00 17.00 ? 180 LYS A HZ2  1 
ATOM   1454  H  HZ3  . LYS A 1 149 ? 3.387   21.372  -9.358  1.00 17.00 ? 180 LYS A HZ3  1 
ATOM   1455  N  N    . VAL A 1 150 ? 7.761   23.103  -2.308  1.00 6.51  ? 181 VAL A N    1 
ATOM   1456  C  CA   . VAL A 1 150 ? 8.248   22.705  -0.993  1.00 6.82  ? 181 VAL A CA   1 
ATOM   1457  C  C    . VAL A 1 150 ? 9.022   23.728  -0.147  1.00 6.86  ? 181 VAL A C    1 
ATOM   1458  O  O    . VAL A 1 150 ? 9.143   23.548  1.090   1.00 9.00  ? 181 VAL A O    1 
ATOM   1459  C  CB   . VAL A 1 150 ? 9.012   21.333  -1.113  1.00 4.52  ? 181 VAL A CB   1 
ATOM   1460  C  CG1  . VAL A 1 150 ? 10.339  21.353  -0.371  1.00 6.09  ? 181 VAL A CG1  1 
ATOM   1461  C  CG2  . VAL A 1 150 ? 8.143   20.206  -0.604  1.00 4.79  ? 181 VAL A CG2  1 
ATOM   1462  H  H    . VAL A 1 150 ? 8.382   23.137  -3.062  1.00 17.00 ? 181 VAL A H    1 
ATOM   1463  N  N    . LEU A 1 151 ? 9.443   24.842  -0.747  1.00 3.15  ? 182 LEU A N    1 
ATOM   1464  C  CA   . LEU A 1 151 ? 10.266  25.777  0.016   1.00 2.45  ? 182 LEU A CA   1 
ATOM   1465  C  C    . LEU A 1 151 ? 9.756   27.156  0.380   1.00 2.58  ? 182 LEU A C    1 
ATOM   1466  O  O    . LEU A 1 151 ? 10.130  27.676  1.430   1.00 4.05  ? 182 LEU A O    1 
ATOM   1467  C  CB   . LEU A 1 151 ? 11.687  25.868  -0.603  1.00 3.48  ? 182 LEU A CB   1 
ATOM   1468  C  CG   . LEU A 1 151 ? 12.536  24.577  -0.657  1.00 2.00  ? 182 LEU A CG   1 
ATOM   1469  C  CD1  . LEU A 1 151 ? 13.608  24.673  -1.697  1.00 2.00  ? 182 LEU A CD1  1 
ATOM   1470  C  CD2  . LEU A 1 151 ? 13.098  24.211  0.718   1.00 2.00  ? 182 LEU A CD2  1 
ATOM   1471  H  H    . LEU A 1 151 ? 9.211   25.046  -1.674  1.00 17.00 ? 182 LEU A H    1 
ATOM   1472  N  N    . LEU A 1 152 ? 8.929   27.778  -0.457  1.00 4.50  ? 183 LEU A N    1 
ATOM   1473  C  CA   . LEU A 1 152 ? 8.427   29.124  -0.149  1.00 2.69  ? 183 LEU A CA   1 
ATOM   1474  C  C    . LEU A 1 152 ? 7.459   29.171  0.999   1.00 2.32  ? 183 LEU A C    1 
ATOM   1475  O  O    . LEU A 1 152 ? 6.611   28.306  1.145   1.00 2.00  ? 183 LEU A O    1 
ATOM   1476  C  CB   . LEU A 1 152 ? 7.839   29.781  -1.372  1.00 2.00  ? 183 LEU A CB   1 
ATOM   1477  C  CG   . LEU A 1 152 ? 8.949   30.474  -2.135  1.00 4.86  ? 183 LEU A CG   1 
ATOM   1478  C  CD1  . LEU A 1 152 ? 8.470   30.870  -3.529  1.00 3.42  ? 183 LEU A CD1  1 
ATOM   1479  C  CD2  . LEU A 1 152 ? 9.442   31.692  -1.317  1.00 4.14  ? 183 LEU A CD2  1 
ATOM   1480  H  H    . LEU A 1 152 ? 8.633   27.316  -1.264  1.00 17.00 ? 183 LEU A H    1 
ATOM   1481  N  N    . ARG A 1 153 ? 7.645   30.162  1.851   1.00 4.08  ? 184 ARG A N    1 
ATOM   1482  C  CA   . ARG A 1 153 ? 6.801   30.325  3.028   1.00 6.84  ? 184 ARG A CA   1 
ATOM   1483  C  C    . ARG A 1 153 ? 5.408   30.857  2.693   1.00 7.26  ? 184 ARG A C    1 
ATOM   1484  O  O    . ARG A 1 153 ? 5.211   31.558  1.694   1.00 7.28  ? 184 ARG A O    1 
ATOM   1485  C  CB   . ARG A 1 153 ? 7.463   31.256  4.046   1.00 6.58  ? 184 ARG A CB   1 
ATOM   1486  C  CG   . ARG A 1 153 ? 7.213   32.722  3.752   1.00 8.48  ? 184 ARG A CG   1 
ATOM   1487  C  CD   . ARG A 1 153 ? 8.041   33.643  4.600   1.00 7.31  ? 184 ARG A CD   1 
ATOM   1488  N  NE   . ARG A 1 153 ? 7.941   33.339  6.009   1.00 6.25  ? 184 ARG A NE   1 
ATOM   1489  C  CZ   . ARG A 1 153 ? 8.883   33.649  6.883   1.00 9.36  ? 184 ARG A CZ   1 
ATOM   1490  N  NH1  . ARG A 1 153 ? 9.982   34.292  6.489   1.00 8.37  ? 184 ARG A NH1  1 
ATOM   1491  N  NH2  . ARG A 1 153 ? 8.788   33.192  8.125   1.00 13.46 ? 184 ARG A NH2  1 
ATOM   1492  H  H    . ARG A 1 153 ? 8.337   30.830  1.664   1.00 17.00 ? 184 ARG A H    1 
ATOM   1493  H  HE   . ARG A 1 153 ? 7.137   32.884  6.337   1.00 17.00 ? 184 ARG A HE   1 
ATOM   1494  H  HH11 . ARG A 1 153 ? 10.123  34.555  5.535   1.00 17.00 ? 184 ARG A HH11 1 
ATOM   1495  H  HH12 . ARG A 1 153 ? 10.665  34.506  7.173   1.00 17.00 ? 184 ARG A HH12 1 
ATOM   1496  H  HH21 . ARG A 1 153 ? 8.023   32.608  8.385   1.00 17.00 ? 184 ARG A HH21 1 
ATOM   1497  H  HH22 . ARG A 1 153 ? 9.493   33.425  8.795   1.00 17.00 ? 184 ARG A HH22 1 
ATOM   1498  N  N    . ARG A 1 154 ? 4.459   30.521  3.559   1.00 6.20  ? 185 ARG A N    1 
ATOM   1499  C  CA   . ARG A 1 154 ? 3.077   30.926  3.427   1.00 6.15  ? 185 ARG A CA   1 
ATOM   1500  C  C    . ARG A 1 154 ? 2.926   31.819  4.648   1.00 7.50  ? 185 ARG A C    1 
ATOM   1501  O  O    . ARG A 1 154 ? 3.041   33.033  4.565   1.00 7.89  ? 185 ARG A O    1 
ATOM   1502  C  CB   . ARG A 1 154 ? 2.149   29.706  3.541   1.00 6.03  ? 185 ARG A CB   1 
ATOM   1503  C  CG   . ARG A 1 154 ? 2.677   28.396  2.901   1.00 5.65  ? 185 ARG A CG   1 
ATOM   1504  C  CD   . ARG A 1 154 ? 2.963   28.543  1.405   1.00 5.15  ? 185 ARG A CD   1 
ATOM   1505  N  NE   . ARG A 1 154 ? 3.496   27.321  0.799   1.00 3.10  ? 185 ARG A NE   1 
ATOM   1506  C  CZ   . ARG A 1 154 ? 3.858   27.227  -0.483  1.00 3.37  ? 185 ARG A CZ   1 
ATOM   1507  N  NH1  . ARG A 1 154 ? 3.736   28.284  -1.296  1.00 2.15  ? 185 ARG A NH1  1 
ATOM   1508  N  NH2  . ARG A 1 154 ? 4.347   26.090  -0.956  1.00 2.00  ? 185 ARG A NH2  1 
ATOM   1509  H  H    . ARG A 1 154 ? 4.733   29.981  4.329   1.00 17.00 ? 185 ARG A H    1 
ATOM   1510  H  HE   . ARG A 1 154 ? 3.594   26.523  1.360   1.00 17.00 ? 185 ARG A HE   1 
ATOM   1511  H  HH11 . ARG A 1 154 ? 3.372   29.151  -0.955  1.00 17.00 ? 185 ARG A HH11 1 
ATOM   1512  H  HH12 . ARG A 1 154 ? 4.001   28.207  -2.257  1.00 17.00 ? 185 ARG A HH12 1 
ATOM   1513  H  HH21 . ARG A 1 154 ? 4.442   25.297  -0.355  1.00 17.00 ? 185 ARG A HH21 1 
ATOM   1514  H  HH22 . ARG A 1 154 ? 4.613   26.019  -1.917  1.00 17.00 ? 185 ARG A HH22 1 
ATOM   1515  N  N    . GLU A 1 155 ? 2.754   31.212  5.813   1.00 9.85  ? 186 GLU A N    1 
ATOM   1516  C  CA   . GLU A 1 155 ? 2.631   31.994  7.041   1.00 11.29 ? 186 GLU A CA   1 
ATOM   1517  C  C    . GLU A 1 155 ? 4.032   31.933  7.625   1.00 7.87  ? 186 GLU A C    1 
ATOM   1518  O  O    . GLU A 1 155 ? 4.740   30.968  7.359   1.00 9.76  ? 186 GLU A O    1 
ATOM   1519  C  CB   . GLU A 1 155 ? 1.599   31.344  7.990   1.00 16.10 ? 186 GLU A CB   1 
ATOM   1520  C  CG   . GLU A 1 155 ? 1.094   32.233  9.163   1.00 20.97 ? 186 GLU A CG   1 
ATOM   1521  C  CD   . GLU A 1 155 ? -0.345  31.892  9.621   1.00 25.10 ? 186 GLU A CD   1 
ATOM   1522  O  OE1  . GLU A 1 155 ? -1.152  31.442  8.769   1.00 28.18 ? 186 GLU A OE1  1 
ATOM   1523  O  OE2  . GLU A 1 155 ? -0.681  32.095  10.821  1.00 24.23 ? 186 GLU A OE2  1 
ATOM   1524  H  H    . GLU A 1 155 ? 2.782   30.240  5.899   1.00 17.00 ? 186 GLU A H    1 
ATOM   1525  N  N    . PHE A 1 156 ? 4.463   32.988  8.313   1.00 5.73  ? 187 PHE A N    1 
ATOM   1526  C  CA   . PHE A 1 156 ? 5.776   33.026  8.948   1.00 4.71  ? 187 PHE A CA   1 
ATOM   1527  C  C    . PHE A 1 156 ? 5.811   31.915  9.996   1.00 3.41  ? 187 PHE A C    1 
ATOM   1528  O  O    . PHE A 1 156 ? 4.973   31.865  10.902  1.00 2.00  ? 187 PHE A O    1 
ATOM   1529  C  CB   . PHE A 1 156 ? 6.014   34.393  9.634   1.00 6.78  ? 187 PHE A CB   1 
ATOM   1530  C  CG   . PHE A 1 156 ? 7.243   34.435  10.575  1.00 8.86  ? 187 PHE A CG   1 
ATOM   1531  C  CD1  . PHE A 1 156 ? 7.247   33.763  11.803  1.00 7.78  ? 187 PHE A CD1  1 
ATOM   1532  C  CD2  . PHE A 1 156 ? 8.376   35.174  10.240  1.00 9.88  ? 187 PHE A CD2  1 
ATOM   1533  C  CE1  . PHE A 1 156 ? 8.328   33.826  12.663  1.00 3.75  ? 187 PHE A CE1  1 
ATOM   1534  C  CE2  . PHE A 1 156 ? 9.457   35.232  11.107  1.00 8.39  ? 187 PHE A CE2  1 
ATOM   1535  C  CZ   . PHE A 1 156 ? 9.419   34.551  12.323  1.00 6.06  ? 187 PHE A CZ   1 
ATOM   1536  H  H    . PHE A 1 156 ? 3.872   33.758  8.403   1.00 17.00 ? 187 PHE A H    1 
ATOM   1537  N  N    . ILE A 1 157 ? 6.760   31.004  9.870   1.00 4.37  ? 188 ILE A N    1 
ATOM   1538  C  CA   . ILE A 1 157 ? 6.861   29.942  10.857  1.00 5.50  ? 188 ILE A CA   1 
ATOM   1539  C  C    . ILE A 1 157 ? 7.981   30.349  11.810  1.00 7.75  ? 188 ILE A C    1 
ATOM   1540  O  O    . ILE A 1 157 ? 9.099   30.665  11.360  1.00 10.51 ? 188 ILE A O    1 
ATOM   1541  C  CB   . ILE A 1 157 ? 7.140   28.580  10.197  1.00 3.23  ? 188 ILE A CB   1 
ATOM   1542  C  CG1  . ILE A 1 157 ? 5.856   28.066  9.565   1.00 2.00  ? 188 ILE A CG1  1 
ATOM   1543  C  CG2  . ILE A 1 157 ? 7.623   27.595  11.214  1.00 2.00  ? 188 ILE A CG2  1 
ATOM   1544  C  CD1  . ILE A 1 157 ? 6.051   26.991  8.599   1.00 4.38  ? 188 ILE A CD1  1 
ATOM   1545  H  H    . ILE A 1 157 ? 7.385   31.031  9.108   1.00 17.00 ? 188 ILE A H    1 
ATOM   1546  N  N    . PRO A 1 158 ? 7.668   30.476  13.117  1.00 5.98  ? 189 PRO A N    1 
ATOM   1547  C  CA   . PRO A 1 158 ? 8.659   30.865  14.116  1.00 5.12  ? 189 PRO A CA   1 
ATOM   1548  C  C    . PRO A 1 158 ? 9.510   29.715  14.567  1.00 4.48  ? 189 PRO A C    1 
ATOM   1549  O  O    . PRO A 1 158 ? 9.017   28.611  14.695  1.00 5.06  ? 189 PRO A O    1 
ATOM   1550  C  CB   . PRO A 1 158 ? 7.797   31.362  15.264  1.00 4.50  ? 189 PRO A CB   1 
ATOM   1551  C  CG   . PRO A 1 158 ? 6.673   30.486  15.194  1.00 3.78  ? 189 PRO A CG   1 
ATOM   1552  C  CD   . PRO A 1 158 ? 6.335   30.446  13.723  1.00 5.13  ? 189 PRO A CD   1 
ATOM   1553  N  N    . ASP A 1 159 ? 10.795  29.986  14.782  1.00 6.51  ? 190 ASP A N    1 
ATOM   1554  C  CA   . ASP A 1 159 ? 11.735  28.996  15.257  1.00 6.80  ? 190 ASP A CA   1 
ATOM   1555  C  C    . ASP A 1 159 ? 11.254  28.542  16.618  1.00 6.36  ? 190 ASP A C    1 
ATOM   1556  O  O    . ASP A 1 159 ? 10.869  29.358  17.449  1.00 7.61  ? 190 ASP A O    1 
ATOM   1557  C  CB   . ASP A 1 159 ? 13.113  29.625  15.405  1.00 8.59  ? 190 ASP A CB   1 
ATOM   1558  C  CG   . ASP A 1 159 ? 14.009  28.846  16.361  1.00 11.99 ? 190 ASP A CG   1 
ATOM   1559  O  OD1  . ASP A 1 159 ? 14.046  27.604  16.278  1.00 14.63 ? 190 ASP A OD1  1 
ATOM   1560  O  OD2  . ASP A 1 159 ? 14.650  29.455  17.234  1.00 13.60 ? 190 ASP A OD2  1 
ATOM   1561  H  H    . ASP A 1 159 ? 11.098  30.900  14.667  1.00 17.00 ? 190 ASP A H    1 
ATOM   1562  N  N    . PRO A 1 160 ? 11.273  27.238  16.871  1.00 7.01  ? 191 PRO A N    1 
ATOM   1563  C  CA   . PRO A 1 160 ? 10.821  26.728  18.173  1.00 8.44  ? 191 PRO A CA   1 
ATOM   1564  C  C    . PRO A 1 160 ? 11.852  26.917  19.293  1.00 8.48  ? 191 PRO A C    1 
ATOM   1565  O  O    . PRO A 1 160 ? 11.585  26.621  20.462  1.00 9.22  ? 191 PRO A O    1 
ATOM   1566  C  CB   . PRO A 1 160 ? 10.547  25.241  17.887  1.00 9.19  ? 191 PRO A CB   1 
ATOM   1567  C  CG   . PRO A 1 160 ? 11.526  24.931  16.813  1.00 10.56 ? 191 PRO A CG   1 
ATOM   1568  C  CD   . PRO A 1 160 ? 11.429  26.146  15.903  1.00 8.77  ? 191 PRO A CD   1 
ATOM   1569  N  N    . GLN A 1 161 ? 13.013  27.459  18.940  1.00 7.58  ? 192 GLN A N    1 
ATOM   1570  C  CA   . GLN A 1 161 ? 14.082  27.659  19.912  1.00 5.34  ? 192 GLN A CA   1 
ATOM   1571  C  C    . GLN A 1 161 ? 14.219  29.086  20.377  1.00 3.90  ? 192 GLN A C    1 
ATOM   1572  O  O    . GLN A 1 161 ? 15.080  29.373  21.201  1.00 5.29  ? 192 GLN A O    1 
ATOM   1573  C  CB   . GLN A 1 161 ? 15.418  27.147  19.353  1.00 5.07  ? 192 GLN A CB   1 
ATOM   1574  C  CG   . GLN A 1 161 ? 15.325  25.706  18.841  1.00 4.91  ? 192 GLN A CG   1 
ATOM   1575  C  CD   . GLN A 1 161 ? 16.661  25.057  18.677  1.00 4.27  ? 192 GLN A CD   1 
ATOM   1576  O  OE1  . GLN A 1 161 ? 16.935  24.435  17.660  1.00 2.00  ? 192 GLN A OE1  1 
ATOM   1577  N  NE2  . GLN A 1 161 ? 17.513  25.201  19.682  1.00 8.38  ? 192 GLN A NE2  1 
ATOM   1578  H  H    . GLN A 1 161 ? 13.115  27.693  18.020  1.00 17.00 ? 192 GLN A H    1 
ATOM   1579  H  HE21 . GLN A 1 161 ? 18.389  24.776  19.571  1.00 17.00 ? 192 GLN A HE21 1 
ATOM   1580  H  HE22 . GLN A 1 161 ? 17.255  25.701  20.480  1.00 17.00 ? 192 GLN A HE22 1 
ATOM   1581  N  N    . GLY A 1 162 ? 13.383  29.970  19.843  1.00 2.00  ? 193 GLY A N    1 
ATOM   1582  C  CA   . GLY A 1 162 ? 13.434  31.368  20.234  1.00 2.27  ? 193 GLY A CA   1 
ATOM   1583  C  C    . GLY A 1 162 ? 14.663  32.112  19.736  1.00 3.70  ? 193 GLY A C    1 
ATOM   1584  O  O    . GLY A 1 162 ? 15.185  32.991  20.410  1.00 2.81  ? 193 GLY A O    1 
ATOM   1585  H  H    . GLY A 1 162 ? 12.694  29.689  19.205  1.00 17.00 ? 193 GLY A H    1 
ATOM   1586  N  N    . SER A 1 163 ? 15.136  31.761  18.550  1.00 4.37  ? 194 SER A N    1 
ATOM   1587  C  CA   . SER A 1 163 ? 16.298  32.416  17.987  1.00 2.00  ? 194 SER A CA   1 
ATOM   1588  C  C    . SER A 1 163 ? 15.745  33.776  17.595  1.00 2.59  ? 194 SER A C    1 
ATOM   1589  O  O    . SER A 1 163 ? 14.705  33.869  16.956  1.00 2.00  ? 194 SER A O    1 
ATOM   1590  C  CB   . SER A 1 163 ? 16.861  31.660  16.757  1.00 3.45  ? 194 SER A CB   1 
ATOM   1591  O  OG   . SER A 1 163 ? 17.204  30.278  16.986  1.00 2.00  ? 194 SER A OG   1 
ATOM   1592  H  H    . SER A 1 163 ? 14.621  31.156  18.017  1.00 17.00 ? 194 SER A H    1 
ATOM   1593  H  HG   . SER A 1 163 ? 17.433  29.906  16.124  1.00 17.00 ? 194 SER A HG   1 
ATOM   1594  N  N    . ASN A 1 164 ? 16.380  34.813  18.133  1.00 5.45  ? 195 ASN A N    1 
ATOM   1595  C  CA   . ASN A 1 164 ? 16.021  36.206  17.907  1.00 2.47  ? 195 ASN A CA   1 
ATOM   1596  C  C    . ASN A 1 164 ? 16.726  36.761  16.685  1.00 3.03  ? 195 ASN A C    1 
ATOM   1597  O  O    . ASN A 1 164 ? 17.306  35.993  15.906  1.00 2.00  ? 195 ASN A O    1 
ATOM   1598  C  CB   . ASN A 1 164 ? 16.358  37.028  19.141  1.00 2.00  ? 195 ASN A CB   1 
ATOM   1599  C  CG   . ASN A 1 164 ? 17.738  36.743  19.676  1.00 2.00  ? 195 ASN A CG   1 
ATOM   1600  O  OD1  . ASN A 1 164 ? 18.641  36.415  18.942  1.00 2.00  ? 195 ASN A OD1  1 
ATOM   1601  N  ND2  . ASN A 1 164 ? 17.900  36.862  20.969  1.00 3.80  ? 195 ASN A ND2  1 
ATOM   1602  H  H    . ASN A 1 164 ? 17.158  34.616  18.692  1.00 17.00 ? 195 ASN A H    1 
ATOM   1603  H  HD21 . ASN A 1 164 ? 18.802  36.744  21.278  1.00 17.00 ? 195 ASN A HD21 1 
ATOM   1604  H  HD22 . ASN A 1 164 ? 17.132  37.088  21.541  1.00 17.00 ? 195 ASN A HD22 1 
ATOM   1605  N  N    . MET A 1 165 ? 16.622  38.078  16.485  1.00 4.58  ? 196 MET A N    1 
ATOM   1606  C  CA   . MET A 1 165 ? 17.251  38.748  15.342  1.00 4.10  ? 196 MET A CA   1 
ATOM   1607  C  C    . MET A 1 165 ? 18.732  39.084  15.580  1.00 4.41  ? 196 MET A C    1 
ATOM   1608  O  O    . MET A 1 165 ? 19.507  39.287  14.638  1.00 5.32  ? 196 MET A O    1 
ATOM   1609  C  CB   . MET A 1 165 ? 16.442  39.976  14.923  1.00 2.00  ? 196 MET A CB   1 
ATOM   1610  C  CG   . MET A 1 165 ? 15.210  39.630  14.128  1.00 2.00  ? 196 MET A CG   1 
ATOM   1611  S  SD   . MET A 1 165 ? 15.523  38.631  12.661  1.00 2.00  ? 196 MET A SD   1 
ATOM   1612  C  CE   . MET A 1 165 ? 15.823  39.898  11.538  1.00 2.00  ? 196 MET A CE   1 
ATOM   1613  H  H    . MET A 1 165 ? 16.090  38.612  17.117  1.00 17.00 ? 196 MET A H    1 
ATOM   1614  N  N    . MET A 1 166 ? 19.122  39.063  16.850  1.00 5.49  ? 197 MET A N    1 
ATOM   1615  C  CA   . MET A 1 166 ? 20.491  39.325  17.282  1.00 4.00  ? 197 MET A CA   1 
ATOM   1616  C  C    . MET A 1 166 ? 21.255  38.131  16.781  1.00 3.67  ? 197 MET A C    1 
ATOM   1617  O  O    . MET A 1 166 ? 22.261  38.276  16.115  1.00 6.19  ? 197 MET A O    1 
ATOM   1618  C  CB   . MET A 1 166 ? 20.578  39.348  18.810  1.00 6.63  ? 197 MET A CB   1 
ATOM   1619  C  CG   . MET A 1 166 ? 21.592  40.299  19.320  1.00 5.20  ? 197 MET A CG   1 
ATOM   1620  S  SD   . MET A 1 166 ? 21.292  41.822  18.435  1.00 6.19  ? 197 MET A SD   1 
ATOM   1621  C  CE   . MET A 1 166 ? 21.721  42.907  19.676  1.00 7.44  ? 197 MET A CE   1 
ATOM   1622  H  H    . MET A 1 166 ? 18.450  38.845  17.527  1.00 17.00 ? 197 MET A H    1 
ATOM   1623  N  N    . PHE A 1 167 ? 20.779  36.945  17.136  1.00 2.00  ? 198 PHE A N    1 
ATOM   1624  C  CA   . PHE A 1 167 ? 21.377  35.714  16.674  1.00 2.00  ? 198 PHE A CA   1 
ATOM   1625  C  C    . PHE A 1 167 ? 21.304  35.695  15.156  1.00 2.00  ? 198 PHE A C    1 
ATOM   1626  O  O    . PHE A 1 167 ? 22.302  35.591  14.496  1.00 2.00  ? 198 PHE A O    1 
ATOM   1627  C  CB   . PHE A 1 167 ? 20.628  34.517  17.255  1.00 2.00  ? 198 PHE A CB   1 
ATOM   1628  C  CG   . PHE A 1 167 ? 21.042  33.205  16.692  1.00 2.00  ? 198 PHE A CG   1 
ATOM   1629  C  CD1  . PHE A 1 167 ? 20.810  32.890  15.365  1.00 2.00  ? 198 PHE A CD1  1 
ATOM   1630  C  CD2  . PHE A 1 167 ? 21.642  32.262  17.498  1.00 2.32  ? 198 PHE A CD2  1 
ATOM   1631  C  CE1  . PHE A 1 167 ? 21.170  31.657  14.851  1.00 2.83  ? 198 PHE A CE1  1 
ATOM   1632  C  CE2  . PHE A 1 167 ? 22.008  31.008  16.993  1.00 3.53  ? 198 PHE A CE2  1 
ATOM   1633  C  CZ   . PHE A 1 167 ? 21.769  30.716  15.665  1.00 3.95  ? 198 PHE A CZ   1 
ATOM   1634  H  H    . PHE A 1 167 ? 20.018  36.910  17.743  1.00 17.00 ? 198 PHE A H    1 
ATOM   1635  N  N    . ALA A 1 168 ? 20.116  35.821  14.597  1.00 5.82  ? 199 ALA A N    1 
ATOM   1636  C  CA   . ALA A 1 168 ? 19.957  35.783  13.139  1.00 7.92  ? 199 ALA A CA   1 
ATOM   1637  C  C    . ALA A 1 168 ? 21.014  36.581  12.378  1.00 7.48  ? 199 ALA A C    1 
ATOM   1638  O  O    . ALA A 1 168 ? 21.693  36.032  11.510  1.00 6.93  ? 199 ALA A O    1 
ATOM   1639  C  CB   . ALA A 1 168 ? 18.543  36.244  12.724  1.00 6.83  ? 199 ALA A CB   1 
ATOM   1640  H  H    . ALA A 1 168 ? 19.314  35.931  15.152  1.00 17.00 ? 199 ALA A H    1 
ATOM   1641  N  N    . PHE A 1 169 ? 21.170  37.860  12.715  1.00 6.24  ? 200 PHE A N    1 
ATOM   1642  C  CA   . PHE A 1 169 ? 22.152  38.702  12.030  1.00 5.50  ? 200 PHE A CA   1 
ATOM   1643  C  C    . PHE A 1 169 ? 23.615  38.409  12.353  1.00 4.32  ? 200 PHE A C    1 
ATOM   1644  O  O    . PHE A 1 169 ? 24.512  38.739  11.575  1.00 2.00  ? 200 PHE A O    1 
ATOM   1645  C  CB   . PHE A 1 169 ? 21.821  40.165  12.248  1.00 3.65  ? 200 PHE A CB   1 
ATOM   1646  C  CG   . PHE A 1 169 ? 20.752  40.668  11.328  1.00 5.09  ? 200 PHE A CG   1 
ATOM   1647  C  CD1  . PHE A 1 169 ? 20.876  40.494  9.949   1.00 4.02  ? 200 PHE A CD1  1 
ATOM   1648  C  CD2  . PHE A 1 169 ? 19.653  41.368  11.822  1.00 6.38  ? 200 PHE A CD2  1 
ATOM   1649  C  CE1  . PHE A 1 169 ? 19.940  41.008  9.072   1.00 4.07  ? 200 PHE A CE1  1 
ATOM   1650  C  CE2  . PHE A 1 169 ? 18.704  41.893  10.949  1.00 7.06  ? 200 PHE A CE2  1 
ATOM   1651  C  CZ   . PHE A 1 169 ? 18.857  41.709  9.561   1.00 5.90  ? 200 PHE A CZ   1 
ATOM   1652  H  H    . PHE A 1 169 ? 20.613  38.246  13.422  1.00 17.00 ? 200 PHE A H    1 
ATOM   1653  N  N    . PHE A 1 170 ? 23.831  37.779  13.505  1.00 4.63  ? 201 PHE A N    1 
ATOM   1654  C  CA   . PHE A 1 170 ? 25.154  37.376  13.969  1.00 4.45  ? 201 PHE A CA   1 
ATOM   1655  C  C    . PHE A 1 170 ? 25.603  36.216  13.098  1.00 4.39  ? 201 PHE A C    1 
ATOM   1656  O  O    . PHE A 1 170 ? 26.688  36.236  12.533  1.00 6.88  ? 201 PHE A O    1 
ATOM   1657  C  CB   . PHE A 1 170 ? 25.097  36.910  15.418  1.00 2.62  ? 201 PHE A CB   1 
ATOM   1658  C  CG   . PHE A 1 170 ? 26.433  36.803  16.053  1.00 4.79  ? 201 PHE A CG   1 
ATOM   1659  C  CD1  . PHE A 1 170 ? 27.319  35.796  15.670  1.00 5.41  ? 201 PHE A CD1  1 
ATOM   1660  C  CD2  . PHE A 1 170 ? 26.827  37.722  17.026  1.00 4.36  ? 201 PHE A CD2  1 
ATOM   1661  C  CE1  . PHE A 1 170 ? 28.596  35.700  16.252  1.00 6.11  ? 201 PHE A CE1  1 
ATOM   1662  C  CE2  . PHE A 1 170 ? 28.096  37.648  17.617  1.00 4.57  ? 201 PHE A CE2  1 
ATOM   1663  C  CZ   . PHE A 1 170 ? 28.985  36.636  17.233  1.00 5.92  ? 201 PHE A CZ   1 
ATOM   1664  H  H    . PHE A 1 170 ? 23.076  37.572  14.095  1.00 17.00 ? 201 PHE A H    1 
ATOM   1665  N  N    . ALA A 1 171 ? 24.742  35.218  12.970  1.00 3.12  ? 202 ALA A N    1 
ATOM   1666  C  CA   . ALA A 1 171 ? 25.015  34.062  12.143  1.00 2.00  ? 202 ALA A CA   1 
ATOM   1667  C  C    . ALA A 1 171 ? 25.266  34.493  10.717  1.00 2.91  ? 202 ALA A C    1 
ATOM   1668  O  O    . ALA A 1 171 ? 25.900  33.747  9.976   1.00 6.01  ? 202 ALA A O    1 
ATOM   1669  C  CB   . ALA A 1 171 ? 23.867  33.102  12.189  1.00 2.00  ? 202 ALA A CB   1 
ATOM   1670  H  H    . ALA A 1 171 ? 23.880  35.271  13.436  1.00 17.00 ? 202 ALA A H    1 
ATOM   1671  N  N    . GLN A 1 172 ? 24.794  35.684  10.330  1.00 2.00  ? 203 GLN A N    1 
ATOM   1672  C  CA   . GLN A 1 172 ? 24.996  36.173  8.971   1.00 2.75  ? 203 GLN A CA   1 
ATOM   1673  C  C    . GLN A 1 172 ? 26.336  36.875  8.793   1.00 3.55  ? 203 GLN A C    1 
ATOM   1674  O  O    . GLN A 1 172 ? 27.060  36.652  7.828   1.00 2.00  ? 203 GLN A O    1 
ATOM   1675  C  CB   . GLN A 1 172 ? 23.881  37.121  8.541   1.00 2.30  ? 203 GLN A CB   1 
ATOM   1676  C  CG   . GLN A 1 172 ? 24.033  37.476  7.081   1.00 2.92  ? 203 GLN A CG   1 
ATOM   1677  C  CD   . GLN A 1 172 ? 23.156  38.593  6.623   1.00 2.47  ? 203 GLN A CD   1 
ATOM   1678  O  OE1  . GLN A 1 172 ? 22.877  38.710  5.434   1.00 4.64  ? 203 GLN A OE1  1 
ATOM   1679  N  NE2  . GLN A 1 172 ? 22.735  39.440  7.540   1.00 2.00  ? 203 GLN A NE2  1 
ATOM   1680  H  H    . GLN A 1 172 ? 24.270  36.211  10.961  1.00 17.00 ? 203 GLN A H    1 
ATOM   1681  H  HE21 . GLN A 1 172 ? 22.132  40.129  7.196   1.00 17.00 ? 203 GLN A HE21 1 
ATOM   1682  H  HE22 . GLN A 1 172 ? 23.003  39.357  8.474   1.00 17.00 ? 203 GLN A HE22 1 
ATOM   1683  N  N    . HIS A 1 173 ? 26.611  37.781  9.713   1.00 5.61  ? 204 HIS A N    1 
ATOM   1684  C  CA   . HIS A 1 173 ? 27.831  38.574  9.735   1.00 6.31  ? 204 HIS A CA   1 
ATOM   1685  C  C    . HIS A 1 173 ? 29.065  37.682  9.952   1.00 6.07  ? 204 HIS A C    1 
ATOM   1686  O  O    . HIS A 1 173 ? 30.080  37.796  9.257   1.00 5.42  ? 204 HIS A O    1 
ATOM   1687  C  CB   . HIS A 1 173 ? 27.660  39.616  10.854  1.00 7.76  ? 204 HIS A CB   1 
ATOM   1688  C  CG   . HIS A 1 173 ? 28.926  40.258  11.334  1.00 7.16  ? 204 HIS A CG   1 
ATOM   1689  N  ND1  . HIS A 1 173 ? 29.457  41.389  10.752  1.00 6.87  ? 204 HIS A ND1  1 
ATOM   1690  C  CD2  . HIS A 1 173 ? 29.685  40.005  12.426  1.00 6.67  ? 204 HIS A CD2  1 
ATOM   1691  C  CE1  . HIS A 1 173 ? 30.482  41.809  11.469  1.00 6.55  ? 204 HIS A CE1  1 
ATOM   1692  N  NE2  . HIS A 1 173 ? 30.641  40.987  12.490  1.00 6.70  ? 204 HIS A NE2  1 
ATOM   1693  H  H    . HIS A 1 173 ? 25.942  37.914  10.419  1.00 17.00 ? 204 HIS A H    1 
ATOM   1694  H  HD1  . HIS A 1 173 ? 29.100  41.838  9.953   1.00 17.00 ? 204 HIS A HD1  1 
ATOM   1695  H  HE2  . HIS A 1 173 ? 31.321  41.055  13.189  1.00 17.00 ? 204 HIS A HE2  1 
ATOM   1696  N  N    . PHE A 1 174 ? 28.943  36.777  10.910  1.00 4.97  ? 205 PHE A N    1 
ATOM   1697  C  CA   . PHE A 1 174 ? 29.992  35.842  11.295  1.00 4.68  ? 205 PHE A CA   1 
ATOM   1698  C  C    . PHE A 1 174 ? 30.412  34.922  10.166  1.00 2.91  ? 205 PHE A C    1 
ATOM   1699  O  O    . PHE A 1 174 ? 31.562  34.874  9.771   1.00 2.01  ? 205 PHE A O    1 
ATOM   1700  C  CB   . PHE A 1 174 ? 29.493  35.019  12.483  1.00 4.82  ? 205 PHE A CB   1 
ATOM   1701  C  CG   . PHE A 1 174 ? 30.397  33.905  12.875  1.00 6.83  ? 205 PHE A CG   1 
ATOM   1702  C  CD1  . PHE A 1 174 ? 31.662  34.158  13.385  1.00 7.28  ? 205 PHE A CD1  1 
ATOM   1703  C  CD2  . PHE A 1 174 ? 29.966  32.590  12.766  1.00 7.78  ? 205 PHE A CD2  1 
ATOM   1704  C  CE1  . PHE A 1 174 ? 32.485  33.097  13.786  1.00 10.12 ? 205 PHE A CE1  1 
ATOM   1705  C  CE2  . PHE A 1 174 ? 30.787  31.514  13.168  1.00 7.65  ? 205 PHE A CE2  1 
ATOM   1706  C  CZ   . PHE A 1 174 ? 32.037  31.759  13.675  1.00 7.72  ? 205 PHE A CZ   1 
ATOM   1707  H  H    . PHE A 1 174 ? 28.083  36.725  11.371  1.00 17.00 ? 205 PHE A H    1 
ATOM   1708  N  N    . THR A 1 175 ? 29.473  34.147  9.669   1.00 4.16  ? 206 THR A N    1 
ATOM   1709  C  CA   . THR A 1 175 ? 29.764  33.231  8.585   1.00 3.70  ? 206 THR A CA   1 
ATOM   1710  C  C    . THR A 1 175 ? 30.141  33.979  7.313   1.00 2.23  ? 206 THR A C    1 
ATOM   1711  O  O    . THR A 1 175 ? 30.676  33.395  6.375   1.00 2.00  ? 206 THR A O    1 
ATOM   1712  C  CB   . THR A 1 175 ? 28.565  32.335  8.312   1.00 2.00  ? 206 THR A CB   1 
ATOM   1713  O  OG1  . THR A 1 175 ? 27.420  33.134  8.014   1.00 2.00  ? 206 THR A OG1  1 
ATOM   1714  C  CG2  . THR A 1 175 ? 28.293  31.501  9.500   1.00 2.00  ? 206 THR A CG2  1 
ATOM   1715  H  H    . THR A 1 175 ? 28.553  34.180  10.008  1.00 17.00 ? 206 THR A H    1 
ATOM   1716  H  HG1  . THR A 1 175 ? 26.629  32.704  8.381   1.00 17.00 ? 206 THR A HG1  1 
ATOM   1717  N  N    . HIS A 1 176 ? 29.898  35.279  7.294   1.00 2.53  ? 207 HIS A N    1 
ATOM   1718  C  CA   . HIS A 1 176 ? 30.217  36.038  6.108   1.00 5.16  ? 207 HIS A CA   1 
ATOM   1719  C  C    . HIS A 1 176 ? 31.662  36.454  5.909   1.00 5.10  ? 207 HIS A C    1 
ATOM   1720  O  O    . HIS A 1 176 ? 31.978  37.214  5.009   1.00 5.59  ? 207 HIS A O    1 
ATOM   1721  C  CB   . HIS A 1 176 ? 29.213  37.173  5.891   1.00 8.16  ? 207 HIS A CB   1 
ATOM   1722  C  CG   . HIS A 1 176 ? 27.956  36.719  5.207   1.00 8.39  ? 207 HIS A CG   1 
ATOM   1723  N  ND1  . HIS A 1 176 ? 27.314  35.548  5.549   1.00 7.32  ? 207 HIS A ND1  1 
ATOM   1724  C  CD2  . HIS A 1 176 ? 27.300  37.203  4.126   1.00 7.27  ? 207 HIS A CD2  1 
ATOM   1725  C  CE1  . HIS A 1 176 ? 26.329  35.323  4.703   1.00 7.04  ? 207 HIS A CE1  1 
ATOM   1726  N  NE2  . HIS A 1 176 ? 26.298  36.312  3.830   1.00 6.63  ? 207 HIS A NE2  1 
ATOM   1727  H  H    . HIS A 1 176 ? 29.503  35.733  8.063   1.00 17.00 ? 207 HIS A H    1 
ATOM   1728  H  HD1  . HIS A 1 176 ? 27.523  34.988  6.335   1.00 17.00 ? 207 HIS A HD1  1 
ATOM   1729  H  HE2  . HIS A 1 176 ? 25.640  36.383  3.102   1.00 17.00 ? 207 HIS A HE2  1 
ATOM   1730  N  N    . GLN A 1 177 ? 32.547  35.959  6.767   1.00 6.04  ? 208 GLN A N    1 
ATOM   1731  C  CA   . GLN A 1 177 ? 33.959  36.226  6.601   1.00 2.10  ? 208 GLN A CA   1 
ATOM   1732  C  C    . GLN A 1 177 ? 34.413  35.039  5.827   1.00 2.00  ? 208 GLN A C    1 
ATOM   1733  O  O    . GLN A 1 177 ? 35.037  35.201  4.812   1.00 4.37  ? 208 GLN A O    1 
ATOM   1734  C  CB   . GLN A 1 177 ? 34.711  36.371  7.920   1.00 2.00  ? 208 GLN A CB   1 
ATOM   1735  C  CG   . GLN A 1 177 ? 34.768  35.175  8.817   1.00 2.00  ? 208 GLN A CG   1 
ATOM   1736  C  CD   . GLN A 1 177 ? 35.205  35.568  10.213  1.00 2.73  ? 208 GLN A CD   1 
ATOM   1737  O  OE1  . GLN A 1 177 ? 35.603  36.708  10.439  1.00 3.14  ? 208 GLN A OE1  1 
ATOM   1738  N  NE2  . GLN A 1 177 ? 35.108  34.646  11.160  1.00 2.08  ? 208 GLN A NE2  1 
ATOM   1739  H  H    . GLN A 1 177 ? 32.225  35.428  7.521   1.00 17.00 ? 208 GLN A H    1 
ATOM   1740  H  HE21 . GLN A 1 177 ? 35.329  34.888  12.082  1.00 17.00 ? 208 GLN A HE21 1 
ATOM   1741  H  HE22 . GLN A 1 177 ? 34.789  33.758  10.902  1.00 17.00 ? 208 GLN A HE22 1 
ATOM   1742  N  N    . PHE A 1 178 ? 34.025  33.839  6.242   1.00 3.74  ? 209 PHE A N    1 
ATOM   1743  C  CA   . PHE A 1 178 ? 34.446  32.663  5.482   1.00 5.26  ? 209 PHE A CA   1 
ATOM   1744  C  C    . PHE A 1 178 ? 33.667  32.441  4.224   1.00 4.43  ? 209 PHE A C    1 
ATOM   1745  O  O    . PHE A 1 178 ? 34.245  32.059  3.218   1.00 6.01  ? 209 PHE A O    1 
ATOM   1746  C  CB   . PHE A 1 178 ? 34.525  31.363  6.282   1.00 7.37  ? 209 PHE A CB   1 
ATOM   1747  C  CG   . PHE A 1 178 ? 33.729  31.342  7.548   1.00 5.92  ? 209 PHE A CG   1 
ATOM   1748  C  CD1  . PHE A 1 178 ? 34.135  32.057  8.672   1.00 2.98  ? 209 PHE A CD1  1 
ATOM   1749  C  CD2  . PHE A 1 178 ? 32.656  30.480  7.661   1.00 9.32  ? 209 PHE A CD2  1 
ATOM   1750  C  CE1  . PHE A 1 178 ? 33.492  31.903  9.890   1.00 6.15  ? 209 PHE A CE1  1 
ATOM   1751  C  CE2  . PHE A 1 178 ? 32.000  30.319  8.889   1.00 12.08 ? 209 PHE A CE2  1 
ATOM   1752  C  CZ   . PHE A 1 178 ? 32.426  31.034  10.007  1.00 8.44  ? 209 PHE A CZ   1 
ATOM   1753  H  H    . PHE A 1 178 ? 33.433  33.751  7.007   1.00 17.00 ? 209 PHE A H    1 
ATOM   1754  N  N    . PHE A 1 179 ? 32.355  32.628  4.280   1.00 4.71  ? 210 PHE A N    1 
ATOM   1755  C  CA   . PHE A 1 179 ? 31.529  32.497  3.077   1.00 3.75  ? 210 PHE A CA   1 
ATOM   1756  C  C    . PHE A 1 179 ? 31.690  33.812  2.320   1.00 2.59  ? 210 PHE A C    1 
ATOM   1757  O  O    . PHE A 1 179 ? 31.469  34.884  2.887   1.00 3.97  ? 210 PHE A O    1 
ATOM   1758  C  CB   . PHE A 1 179 ? 30.079  32.253  3.463   1.00 3.38  ? 210 PHE A CB   1 
ATOM   1759  C  CG   . PHE A 1 179 ? 29.879  30.990  4.241   1.00 7.50  ? 210 PHE A CG   1 
ATOM   1760  C  CD1  . PHE A 1 179 ? 30.369  29.767  3.762   1.00 8.52  ? 210 PHE A CD1  1 
ATOM   1761  C  CD2  . PHE A 1 179 ? 29.229  31.007  5.464   1.00 7.87  ? 210 PHE A CD2  1 
ATOM   1762  C  CE1  . PHE A 1 179 ? 30.211  28.602  4.500   1.00 6.69  ? 210 PHE A CE1  1 
ATOM   1763  C  CE2  . PHE A 1 179 ? 29.069  29.832  6.202   1.00 8.19  ? 210 PHE A CE2  1 
ATOM   1764  C  CZ   . PHE A 1 179 ? 29.560  28.638  5.718   1.00 7.15  ? 210 PHE A CZ   1 
ATOM   1765  H  H    . PHE A 1 179 ? 31.930  32.896  5.112   1.00 17.00 ? 210 PHE A H    1 
ATOM   1766  N  N    . LYS A 1 180 ? 32.119  33.741  1.070   1.00 2.00  ? 211 LYS A N    1 
ATOM   1767  C  CA   . LYS A 1 180 ? 32.352  34.948  0.296   1.00 2.00  ? 211 LYS A CA   1 
ATOM   1768  C  C    . LYS A 1 180 ? 32.436  34.665  -1.188  1.00 2.00  ? 211 LYS A C    1 
ATOM   1769  O  O    . LYS A 1 180 ? 33.095  35.385  -1.913  1.00 2.00  ? 211 LYS A O    1 
ATOM   1770  C  CB   . LYS A 1 180 ? 33.672  35.602  0.743   1.00 2.41  ? 211 LYS A CB   1 
ATOM   1771  C  CG   . LYS A 1 180 ? 33.575  36.573  1.905   1.00 2.00  ? 211 LYS A CG   1 
ATOM   1772  C  CD   . LYS A 1 180 ? 34.928  37.030  2.387   1.00 2.55  ? 211 LYS A CD   1 
ATOM   1773  C  CE   . LYS A 1 180 ? 35.638  37.928  1.399   1.00 2.85  ? 211 LYS A CE   1 
ATOM   1774  N  NZ   . LYS A 1 180 ? 36.668  38.774  2.091   1.00 2.01  ? 211 LYS A NZ   1 
ATOM   1775  H  H    . LYS A 1 180 ? 32.279  32.873  0.646   1.00 17.00 ? 211 LYS A H    1 
ATOM   1776  H  HZ1  . LYS A 1 180 ? 37.370  38.164  2.559   1.00 17.00 ? 211 LYS A HZ1  1 
ATOM   1777  H  HZ2  . LYS A 1 180 ? 37.148  39.314  1.349   1.00 17.00 ? 211 LYS A HZ2  1 
ATOM   1778  H  HZ3  . LYS A 1 180 ? 36.224  39.408  2.784   1.00 17.00 ? 211 LYS A HZ3  1 
ATOM   1779  N  N    . THR A 1 181 ? 31.758  33.628  -1.644  1.00 2.00  ? 212 THR A N    1 
ATOM   1780  C  CA   . THR A 1 181 ? 31.803  33.228  -3.040  1.00 2.00  ? 212 THR A CA   1 
ATOM   1781  C  C    . THR A 1 181 ? 32.182  34.254  -4.083  1.00 2.28  ? 212 THR A C    1 
ATOM   1782  O  O    . THR A 1 181 ? 31.622  35.332  -4.168  1.00 3.04  ? 212 THR A O    1 
ATOM   1783  C  CB   . THR A 1 181 ? 30.515  32.519  -3.435  1.00 3.04  ? 212 THR A CB   1 
ATOM   1784  O  OG1  . THR A 1 181 ? 30.338  31.383  -2.564  1.00 6.04  ? 212 THR A OG1  1 
ATOM   1785  C  CG2  . THR A 1 181 ? 30.522  32.079  -4.917  1.00 2.00  ? 212 THR A CG2  1 
ATOM   1786  H  H    . THR A 1 181 ? 31.180  33.136  -1.028  1.00 17.00 ? 212 THR A H    1 
ATOM   1787  H  HG1  . THR A 1 181 ? 29.565  31.636  -2.026  1.00 17.00 ? 212 THR A HG1  1 
ATOM   1788  N  N    . ASP A 1 182 ? 33.225  33.911  -4.817  1.00 5.67  ? 213 ASP A N    1 
ATOM   1789  C  CA   . ASP A 1 182 ? 33.760  34.701  -5.911  1.00 10.03 ? 213 ASP A CA   1 
ATOM   1790  C  C    . ASP A 1 182 ? 32.928  34.261  -7.117  1.00 10.09 ? 213 ASP A C    1 
ATOM   1791  O  O    . ASP A 1 182 ? 33.287  33.337  -7.832  1.00 8.83  ? 213 ASP A O    1 
ATOM   1792  C  CB   . ASP A 1 182 ? 35.266  34.364  -6.072  1.00 13.48 ? 213 ASP A CB   1 
ATOM   1793  C  CG   . ASP A 1 182 ? 35.864  34.784  -7.419  1.00 13.29 ? 213 ASP A CG   1 
ATOM   1794  O  OD1  . ASP A 1 182 ? 35.276  35.579  -8.160  1.00 13.04 ? 213 ASP A OD1  1 
ATOM   1795  O  OD2  . ASP A 1 182 ? 36.958  34.291  -7.726  1.00 14.57 ? 213 ASP A OD2  1 
ATOM   1796  H  H    . ASP A 1 182 ? 33.678  33.092  -4.597  1.00 17.00 ? 213 ASP A H    1 
ATOM   1797  N  N    . HIS A 1 183 ? 31.792  34.920  -7.303  1.00 9.74  ? 214 HIS A N    1 
ATOM   1798  C  CA   . HIS A 1 183 ? 30.901  34.604  -8.396  1.00 9.64  ? 214 HIS A CA   1 
ATOM   1799  C  C    . HIS A 1 183 ? 31.549  34.916  -9.737  1.00 10.07 ? 214 HIS A C    1 
ATOM   1800  O  O    . HIS A 1 183 ? 31.286  34.240  -10.719 1.00 11.86 ? 214 HIS A O    1 
ATOM   1801  C  CB   . HIS A 1 183 ? 29.608  35.382  -8.264  1.00 11.88 ? 214 HIS A CB   1 
ATOM   1802  C  CG   . HIS A 1 183 ? 29.026  35.366  -6.888  1.00 16.06 ? 214 HIS A CG   1 
ATOM   1803  N  ND1  . HIS A 1 183 ? 28.983  36.487  -6.082  1.00 15.74 ? 214 HIS A ND1  1 
ATOM   1804  C  CD2  . HIS A 1 183 ? 28.423  34.375  -6.185  1.00 21.07 ? 214 HIS A CD2  1 
ATOM   1805  C  CE1  . HIS A 1 183 ? 28.372  36.189  -4.945  1.00 19.58 ? 214 HIS A CE1  1 
ATOM   1806  N  NE2  . HIS A 1 183 ? 28.022  34.914  -4.980  1.00 21.15 ? 214 HIS A NE2  1 
ATOM   1807  H  H    . HIS A 1 183 ? 31.604  35.609  -6.633  1.00 17.00 ? 214 HIS A H    1 
ATOM   1808  H  HD1  . HIS A 1 183 ? 29.337  37.384  -6.281  1.00 17.00 ? 214 HIS A HD1  1 
ATOM   1809  H  HE2  . HIS A 1 183 ? 27.547  34.427  -4.258  1.00 17.00 ? 214 HIS A HE2  1 
ATOM   1810  N  N    . LYS A 1 184 ? 32.375  35.952  -9.800  1.00 11.74 ? 215 LYS A N    1 
ATOM   1811  C  CA   . LYS A 1 184 ? 33.027  36.277  -11.064 1.00 13.16 ? 215 LYS A CA   1 
ATOM   1812  C  C    . LYS A 1 184 ? 33.737  35.020  -11.641 1.00 13.28 ? 215 LYS A C    1 
ATOM   1813  O  O    . LYS A 1 184 ? 33.760  34.809  -12.859 1.00 11.79 ? 215 LYS A O    1 
ATOM   1814  C  CB   . LYS A 1 184 ? 34.019  37.444  -10.874 1.00 14.42 ? 215 LYS A CB   1 
ATOM   1815  C  CG   . LYS A 1 184 ? 35.528  37.036  -10.723 1.00 16.52 ? 215 LYS A CG   1 
ATOM   1816  C  CD   . LYS A 1 184 ? 36.473  38.213  -10.358 1.00 16.45 ? 215 LYS A CD   1 
ATOM   1817  C  CE   . LYS A 1 184 ? 36.006  39.015  -9.097  1.00 13.84 ? 215 LYS A CE   1 
ATOM   1818  N  NZ   . LYS A 1 184 ? 36.579  40.394  -8.949  1.00 3.70  ? 215 LYS A NZ   1 
ATOM   1819  H  H    . LYS A 1 184 ? 32.558  36.494  -9.012  1.00 17.00 ? 215 LYS A H    1 
ATOM   1820  H  HZ1  . LYS A 1 184 ? 36.293  40.927  -9.797  1.00 17.00 ? 215 LYS A HZ1  1 
ATOM   1821  H  HZ2  . LYS A 1 184 ? 36.186  40.860  -8.106  1.00 17.00 ? 215 LYS A HZ2  1 
ATOM   1822  H  HZ3  . LYS A 1 184 ? 37.616  40.370  -8.890  1.00 17.00 ? 215 LYS A HZ3  1 
ATOM   1823  N  N    . ARG A 1 185 ? 34.320  34.207  -10.750 1.00 11.53 ? 216 ARG A N    1 
ATOM   1824  C  CA   . ARG A 1 185 ? 35.015  32.977  -11.130 1.00 9.85  ? 216 ARG A CA   1 
ATOM   1825  C  C    . ARG A 1 185 ? 33.945  31.885  -11.187 1.00 7.84  ? 216 ARG A C    1 
ATOM   1826  O  O    . ARG A 1 185 ? 34.035  30.942  -11.972 1.00 5.48  ? 216 ARG A O    1 
ATOM   1827  C  CB   . ARG A 1 185 ? 36.047  32.612  -10.063 1.00 12.65 ? 216 ARG A CB   1 
ATOM   1828  C  CG   . ARG A 1 185 ? 37.468  32.387  -10.537 1.00 14.39 ? 216 ARG A CG   1 
ATOM   1829  C  CD   . ARG A 1 185 ? 38.240  33.687  -10.533 1.00 18.65 ? 216 ARG A CD   1 
ATOM   1830  N  NE   . ARG A 1 185 ? 39.660  33.436  -10.351 1.00 17.58 ? 216 ARG A NE   1 
ATOM   1831  C  CZ   . ARG A 1 185 ? 40.255  33.388  -9.172  1.00 18.77 ? 216 ARG A CZ   1 
ATOM   1832  N  NH1  . ARG A 1 185 ? 39.558  33.599  -8.063  1.00 18.68 ? 216 ARG A NH1  1 
ATOM   1833  N  NH2  . ARG A 1 185 ? 41.525  33.013  -9.101  1.00 21.42 ? 216 ARG A NH2  1 
ATOM   1834  H  H    . ARG A 1 185 ? 34.272  34.408  -9.799  1.00 17.00 ? 216 ARG A H    1 
ATOM   1835  H  HE   . ARG A 1 185 ? 40.207  33.294  -11.151 1.00 17.00 ? 216 ARG A HE   1 
ATOM   1836  H  HH11 . ARG A 1 185 ? 38.592  33.775  -8.130  1.00 17.00 ? 216 ARG A HH11 1 
ATOM   1837  H  HH12 . ARG A 1 185 ? 40.007  33.558  -7.170  1.00 17.00 ? 216 ARG A HH12 1 
ATOM   1838  H  HH21 . ARG A 1 185 ? 42.019  32.777  -9.937  1.00 17.00 ? 216 ARG A HH21 1 
ATOM   1839  H  HH22 . ARG A 1 185 ? 41.984  32.970  -8.214  1.00 17.00 ? 216 ARG A HH22 1 
ATOM   1840  N  N    . GLY A 1 186 ? 32.984  31.990  -10.273 1.00 7.68  ? 217 GLY A N    1 
ATOM   1841  C  CA   . GLY A 1 186 ? 31.878  31.060  -10.200 1.00 5.23  ? 217 GLY A CA   1 
ATOM   1842  C  C    . GLY A 1 186 ? 31.657  30.528  -8.801  1.00 5.19  ? 217 GLY A C    1 
ATOM   1843  O  O    . GLY A 1 186 ? 32.352  30.940  -7.863  1.00 3.19  ? 217 GLY A O    1 
ATOM   1844  H  H    . GLY A 1 186 ? 33.030  32.679  -9.591  1.00 17.00 ? 217 GLY A H    1 
ATOM   1845  N  N    . PRO A 1 187 ? 30.587  29.722  -8.604  1.00 6.98  ? 218 PRO A N    1 
ATOM   1846  C  CA   . PRO A 1 187 ? 30.298  29.134  -7.295  1.00 6.14  ? 218 PRO A CA   1 
ATOM   1847  C  C    . PRO A 1 187 ? 31.345  28.029  -7.148  1.00 8.99  ? 218 PRO A C    1 
ATOM   1848  O  O    . PRO A 1 187 ? 31.691  27.313  -8.120  1.00 9.90  ? 218 PRO A O    1 
ATOM   1849  C  CB   . PRO A 1 187 ? 28.910  28.565  -7.482  1.00 2.01  ? 218 PRO A CB   1 
ATOM   1850  C  CG   . PRO A 1 187 ? 28.883  28.188  -8.908  1.00 5.27  ? 218 PRO A CG   1 
ATOM   1851  C  CD   . PRO A 1 187 ? 29.539  29.361  -9.578  1.00 6.79  ? 218 PRO A CD   1 
ATOM   1852  N  N    . GLY A 1 188 ? 31.898  27.908  -5.956  1.00 11.19 ? 219 GLY A N    1 
ATOM   1853  C  CA   . GLY A 1 188 ? 32.938  26.908  -5.754  1.00 12.58 ? 219 GLY A CA   1 
ATOM   1854  C  C    . GLY A 1 188 ? 34.258  27.633  -5.587  1.00 10.91 ? 219 GLY A C    1 
ATOM   1855  O  O    . GLY A 1 188 ? 35.251  27.046  -5.139  1.00 11.69 ? 219 GLY A O    1 
ATOM   1856  H  H    . GLY A 1 188 ? 31.641  28.489  -5.213  1.00 17.00 ? 219 GLY A H    1 
ATOM   1857  N  N    . PHE A 1 189 ? 34.226  28.925  -5.922  1.00 8.49  ? 220 PHE A N    1 
ATOM   1858  C  CA   . PHE A 1 189 ? 35.353  29.837  -5.837  1.00 3.56  ? 220 PHE A CA   1 
ATOM   1859  C  C    . PHE A 1 189 ? 35.086  30.803  -4.699  1.00 3.35  ? 220 PHE A C    1 
ATOM   1860  O  O    . PHE A 1 189 ? 34.019  31.380  -4.608  1.00 5.38  ? 220 PHE A O    1 
ATOM   1861  C  CB   . PHE A 1 189 ? 35.489  30.607  -7.142  1.00 2.17  ? 220 PHE A CB   1 
ATOM   1862  C  CG   . PHE A 1 189 ? 36.161  29.834  -8.223  1.00 2.00  ? 220 PHE A CG   1 
ATOM   1863  C  CD1  . PHE A 1 189 ? 37.507  29.551  -8.132  1.00 4.01  ? 220 PHE A CD1  1 
ATOM   1864  C  CD2  . PHE A 1 189 ? 35.461  29.403  -9.335  1.00 2.00  ? 220 PHE A CD2  1 
ATOM   1865  C  CE1  . PHE A 1 189 ? 38.149  28.850  -9.134  1.00 6.84  ? 220 PHE A CE1  1 
ATOM   1866  C  CE2  . PHE A 1 189 ? 36.082  28.708  -10.341 1.00 2.00  ? 220 PHE A CE2  1 
ATOM   1867  C  CZ   . PHE A 1 189 ? 37.425  28.426  -10.249 1.00 4.73  ? 220 PHE A CZ   1 
ATOM   1868  H  H    . PHE A 1 189 ? 33.413  29.345  -6.264  1.00 17.00 ? 220 PHE A H    1 
ATOM   1869  N  N    . THR A 1 190 ? 36.052  30.982  -3.823  1.00 2.00  ? 221 THR A N    1 
ATOM   1870  C  CA   . THR A 1 190 ? 35.870  31.865  -2.697  1.00 2.00  ? 221 THR A CA   1 
ATOM   1871  C  C    . THR A 1 190 ? 36.782  33.056  -2.837  1.00 3.29  ? 221 THR A C    1 
ATOM   1872  O  O    . THR A 1 190 ? 37.503  33.164  -3.838  1.00 3.15  ? 221 THR A O    1 
ATOM   1873  C  CB   . THR A 1 190 ? 36.169  31.127  -1.380  1.00 3.11  ? 221 THR A CB   1 
ATOM   1874  O  OG1  . THR A 1 190 ? 36.132  32.037  -0.267  1.00 2.00  ? 221 THR A OG1  1 
ATOM   1875  C  CG2  . THR A 1 190 ? 37.524  30.445  -1.450  1.00 3.74  ? 221 THR A CG2  1 
ATOM   1876  H  H    . THR A 1 190 ? 36.919  30.555  -3.963  1.00 17.00 ? 221 THR A H    1 
ATOM   1877  H  HG1  . THR A 1 190 ? 36.104  31.512  0.552   1.00 17.00 ? 221 THR A HG1  1 
ATOM   1878  N  N    . ARG A 1 191 ? 36.670  33.970  -1.863  1.00 4.97  ? 222 ARG A N    1 
ATOM   1879  C  CA   . ARG A 1 191 ? 37.452  35.196  -1.755  1.00 5.99  ? 222 ARG A CA   1 
ATOM   1880  C  C    . ARG A 1 191 ? 37.894  35.274  -0.308  1.00 6.40  ? 222 ARG A C    1 
ATOM   1881  O  O    . ARG A 1 191 ? 38.550  36.234  0.102   1.00 9.81  ? 222 ARG A O    1 
ATOM   1882  C  CB   . ARG A 1 191 ? 36.615  36.446  -2.048  1.00 8.40  ? 222 ARG A CB   1 
ATOM   1883  C  CG   . ARG A 1 191 ? 35.821  36.431  -3.315  1.00 12.23 ? 222 ARG A CG   1 
ATOM   1884  C  CD   . ARG A 1 191 ? 34.992  37.699  -3.426  1.00 18.90 ? 222 ARG A CD   1 
ATOM   1885  N  NE   . ARG A 1 191 ? 35.755  38.831  -3.944  1.00 26.45 ? 222 ARG A NE   1 
ATOM   1886  C  CZ   . ARG A 1 191 ? 36.347  38.854  -5.145  1.00 31.19 ? 222 ARG A CZ   1 
ATOM   1887  N  NH1  . ARG A 1 191 ? 36.270  37.794  -5.962  1.00 30.27 ? 222 ARG A NH1  1 
ATOM   1888  N  NH2  . ARG A 1 191 ? 37.020  39.944  -5.536  1.00 31.23 ? 222 ARG A NH2  1 
ATOM   1889  H  H    . ARG A 1 191 ? 35.988  33.792  -1.186  1.00 17.00 ? 222 ARG A H    1 
ATOM   1890  H  HE   . ARG A 1 191 ? 35.842  39.625  -3.378  1.00 17.00 ? 222 ARG A HE   1 
ATOM   1891  H  HH11 . ARG A 1 191 ? 35.760  36.978  -5.694  1.00 17.00 ? 222 ARG A HH11 1 
ATOM   1892  H  HH12 . ARG A 1 191 ? 36.715  37.823  -6.857  1.00 17.00 ? 222 ARG A HH12 1 
ATOM   1893  H  HH21 . ARG A 1 191 ? 37.078  40.741  -4.935  1.00 17.00 ? 222 ARG A HH21 1 
ATOM   1894  H  HH22 . ARG A 1 191 ? 37.461  39.957  -6.433  1.00 17.00 ? 222 ARG A HH22 1 
ATOM   1895  N  N    . GLY A 1 192 ? 37.421  34.339  0.500   1.00 5.60  ? 223 GLY A N    1 
ATOM   1896  C  CA   . GLY A 1 192 ? 37.824  34.305  1.896   1.00 6.57  ? 223 GLY A CA   1 
ATOM   1897  C  C    . GLY A 1 192 ? 39.008  33.347  1.931   1.00 7.75  ? 223 GLY A C    1 
ATOM   1898  O  O    . GLY A 1 192 ? 38.953  32.271  2.564   1.00 8.48  ? 223 GLY A O    1 
ATOM   1899  H  H    . GLY A 1 192 ? 36.799  33.669  0.183   1.00 17.00 ? 223 GLY A H    1 
ATOM   1900  N  N    . LEU A 1 193 ? 40.063  33.724  1.197   1.00 6.40  ? 224 LEU A N    1 
ATOM   1901  C  CA   . LEU A 1 193 ? 41.294  32.943  1.060   1.00 3.94  ? 224 LEU A CA   1 
ATOM   1902  C  C    . LEU A 1 193 ? 41.886  32.471  2.347   1.00 2.01  ? 224 LEU A C    1 
ATOM   1903  O  O    . LEU A 1 193 ? 42.538  31.448  2.382   1.00 3.95  ? 224 LEU A O    1 
ATOM   1904  C  CB   . LEU A 1 193 ? 42.327  33.696  0.257   1.00 2.00  ? 224 LEU A CB   1 
ATOM   1905  C  CG   . LEU A 1 193 ? 41.894  33.726  -1.198  1.00 2.01  ? 224 LEU A CG   1 
ATOM   1906  C  CD1  . LEU A 1 193 ? 42.706  34.722  -1.997  1.00 2.01  ? 224 LEU A CD1  1 
ATOM   1907  C  CD2  . LEU A 1 193 ? 42.020  32.343  -1.724  1.00 2.00  ? 224 LEU A CD2  1 
ATOM   1908  H  H    . LEU A 1 193 ? 40.014  34.588  0.732   1.00 17.00 ? 224 LEU A H    1 
ATOM   1909  N  N    . GLY A 1 194 ? 41.639  33.194  3.418   1.00 2.95  ? 225 GLY A N    1 
ATOM   1910  C  CA   . GLY A 1 194 ? 42.128  32.757  4.704   1.00 2.00  ? 225 GLY A CA   1 
ATOM   1911  C  C    . GLY A 1 194 ? 41.144  31.760  5.293   1.00 2.79  ? 225 GLY A C    1 
ATOM   1912  O  O    . GLY A 1 194 ? 40.824  31.881  6.465   1.00 5.21  ? 225 GLY A O    1 
ATOM   1913  H  H    . GLY A 1 194 ? 41.133  34.025  3.356   1.00 17.00 ? 225 GLY A H    1 
ATOM   1914  N  N    . HIS A 1 195 ? 40.640  30.828  4.472   1.00 2.00  ? 226 HIS A N    1 
ATOM   1915  C  CA   . HIS A 1 195 ? 39.678  29.780  4.864   1.00 2.00  ? 226 HIS A CA   1 
ATOM   1916  C  C    . HIS A 1 195 ? 39.518  29.635  6.375   1.00 2.00  ? 226 HIS A C    1 
ATOM   1917  O  O    . HIS A 1 195 ? 40.110  28.751  6.988   1.00 2.00  ? 226 HIS A O    1 
ATOM   1918  C  CB   . HIS A 1 195 ? 40.092  28.420  4.290   1.00 2.00  ? 226 HIS A CB   1 
ATOM   1919  C  CG   . HIS A 1 195 ? 40.020  28.328  2.800   1.00 2.00  ? 226 HIS A CG   1 
ATOM   1920  N  ND1  . HIS A 1 195 ? 39.307  27.348  2.151   1.00 2.00  ? 226 HIS A ND1  1 
ATOM   1921  C  CD2  . HIS A 1 195 ? 40.564  29.096  1.829   1.00 3.09  ? 226 HIS A CD2  1 
ATOM   1922  C  CE1  . HIS A 1 195 ? 39.407  27.520  0.845   1.00 2.00  ? 226 HIS A CE1  1 
ATOM   1923  N  NE2  . HIS A 1 195 ? 40.165  28.574  0.624   1.00 2.00  ? 226 HIS A NE2  1 
ATOM   1924  H  H    . HIS A 1 195 ? 40.964  30.832  3.559   1.00 17.00 ? 226 HIS A H    1 
ATOM   1925  H  HD1  . HIS A 1 195 ? 38.768  26.628  2.518   1.00 17.00 ? 226 HIS A HD1  1 
ATOM   1926  H  HE2  . HIS A 1 195 ? 40.399  28.935  -0.262  1.00 17.00 ? 226 HIS A HE2  1 
ATOM   1927  N  N    . GLY A 1 196 ? 38.747  30.526  6.984   1.00 2.94  ? 227 GLY A N    1 
ATOM   1928  C  CA   . GLY A 1 196 ? 38.545  30.454  8.420   1.00 3.20  ? 227 GLY A CA   1 
ATOM   1929  C  C    . GLY A 1 196 ? 38.227  31.772  9.107   1.00 2.12  ? 227 GLY A C    1 
ATOM   1930  O  O    . GLY A 1 196 ? 38.144  32.822  8.468   1.00 2.00  ? 227 GLY A O    1 
ATOM   1931  H  H    . GLY A 1 196 ? 38.366  31.284  6.495   1.00 17.00 ? 227 GLY A H    1 
ATOM   1932  N  N    . VAL A 1 197 ? 38.092  31.690  10.430  1.00 2.00  ? 228 VAL A N    1 
ATOM   1933  C  CA   . VAL A 1 197 ? 37.763  32.821  11.283  1.00 2.00  ? 228 VAL A CA   1 
ATOM   1934  C  C    . VAL A 1 197 ? 38.914  33.803  11.369  1.00 2.26  ? 228 VAL A C    1 
ATOM   1935  O  O    . VAL A 1 197 ? 39.510  33.996  12.423  1.00 2.93  ? 228 VAL A O    1 
ATOM   1936  C  CB   . VAL A 1 197 ? 37.384  32.316  12.679  1.00 2.00  ? 228 VAL A CB   1 
ATOM   1937  C  CG1  . VAL A 1 197 ? 36.815  33.412  13.528  1.00 2.00  ? 228 VAL A CG1  1 
ATOM   1938  C  CG2  . VAL A 1 197 ? 36.379  31.217  12.538  1.00 3.04  ? 228 VAL A CG2  1 
ATOM   1939  H  H    . VAL A 1 197 ? 38.244  30.813  10.835  1.00 17.00 ? 228 VAL A H    1 
ATOM   1940  N  N    . ASP A 1 198 ? 39.223  34.440  10.248  1.00 3.63  ? 229 ASP A N    1 
ATOM   1941  C  CA   . ASP A 1 198 ? 40.323  35.403  10.190  1.00 4.03  ? 229 ASP A CA   1 
ATOM   1942  C  C    . ASP A 1 198 ? 39.880  36.836  10.429  1.00 4.00  ? 229 ASP A C    1 
ATOM   1943  O  O    . ASP A 1 198 ? 40.614  37.755  10.128  1.00 6.69  ? 229 ASP A O    1 
ATOM   1944  C  CB   . ASP A 1 198 ? 41.039  35.316  8.831   1.00 5.56  ? 229 ASP A CB   1 
ATOM   1945  C  CG   . ASP A 1 198 ? 40.132  35.687  7.638   1.00 9.14  ? 229 ASP A CG   1 
ATOM   1946  O  OD1  . ASP A 1 198 ? 39.024  36.228  7.840   1.00 8.76  ? 229 ASP A OD1  1 
ATOM   1947  O  OD2  . ASP A 1 198 ? 40.538  35.434  6.476   1.00 11.13 ? 229 ASP A OD2  1 
ATOM   1948  H  H    . ASP A 1 198 ? 38.719  34.271  9.432   1.00 17.00 ? 229 ASP A H    1 
ATOM   1949  N  N    . LEU A 1 199 ? 38.637  37.026  10.862  1.00 4.80  ? 230 LEU A N    1 
ATOM   1950  C  CA   . LEU A 1 199 ? 38.051  38.354  11.116  1.00 2.00  ? 230 LEU A CA   1 
ATOM   1951  C  C    . LEU A 1 199 ? 38.323  39.373  10.030  1.00 2.00  ? 230 LEU A C    1 
ATOM   1952  O  O    . LEU A 1 199 ? 38.299  40.566  10.279  1.00 2.00  ? 230 LEU A O    1 
ATOM   1953  C  CB   . LEU A 1 199 ? 38.449  38.879  12.481  1.00 2.02  ? 230 LEU A CB   1 
ATOM   1954  C  CG   . LEU A 1 199 ? 37.780  38.174  13.677  1.00 4.72  ? 230 LEU A CG   1 
ATOM   1955  C  CD1  . LEU A 1 199 ? 36.612  39.023  14.199  1.00 7.57  ? 230 LEU A CD1  1 
ATOM   1956  C  CD2  . LEU A 1 199 ? 37.293  36.753  13.349  1.00 4.47  ? 230 LEU A CD2  1 
ATOM   1957  H  H    . LEU A 1 199 ? 38.083  36.240  11.024  1.00 17.00 ? 230 LEU A H    1 
ATOM   1958  N  N    . ASN A 1 200 ? 38.467  38.866  8.802   1.00 2.93  ? 231 ASN A N    1 
ATOM   1959  C  CA   . ASN A 1 200 ? 38.721  39.660  7.604   1.00 2.00  ? 231 ASN A CA   1 
ATOM   1960  C  C    . ASN A 1 200 ? 37.597  40.621  7.353   1.00 2.00  ? 231 ASN A C    1 
ATOM   1961  O  O    . ASN A 1 200 ? 37.800  41.664  6.753   1.00 2.00  ? 231 ASN A O    1 
ATOM   1962  C  CB   . ASN A 1 200 ? 38.911  38.742  6.374   1.00 3.72  ? 231 ASN A CB   1 
ATOM   1963  C  CG   . ASN A 1 200 ? 37.668  38.647  5.443   1.00 2.02  ? 231 ASN A CG   1 
ATOM   1964  O  OD1  . ASN A 1 200 ? 37.232  39.632  4.847   1.00 2.02  ? 231 ASN A OD1  1 
ATOM   1965  N  ND2  . ASN A 1 200 ? 37.180  37.440  5.253   1.00 2.05  ? 231 ASN A ND2  1 
ATOM   1966  H  H    . ASN A 1 200 ? 38.407  37.902  8.734   1.00 17.00 ? 231 ASN A H    1 
ATOM   1967  H  HD21 . ASN A 1 200 ? 36.406  37.367  4.647   1.00 17.00 ? 231 ASN A HD21 1 
ATOM   1968  H  HD22 . ASN A 1 200 ? 37.593  36.673  5.690   1.00 17.00 ? 231 ASN A HD22 1 
ATOM   1969  N  N    . HIS A 1 201 ? 36.404  40.224  7.799   1.00 3.24  ? 232 HIS A N    1 
ATOM   1970  C  CA   . HIS A 1 201 ? 35.185  40.991  7.637   1.00 2.06  ? 232 HIS A CA   1 
ATOM   1971  C  C    . HIS A 1 201 ? 35.243  42.336  8.328   1.00 2.02  ? 232 HIS A C    1 
ATOM   1972  O  O    . HIS A 1 201 ? 34.688  43.316  7.839   1.00 2.27  ? 232 HIS A O    1 
ATOM   1973  C  CB   . HIS A 1 201 ? 33.949  40.158  8.024   1.00 2.01  ? 232 HIS A CB   1 
ATOM   1974  C  CG   . HIS A 1 201 ? 33.934  39.681  9.438   1.00 2.48  ? 232 HIS A CG   1 
ATOM   1975  N  ND1  . HIS A 1 201 ? 34.265  40.485  10.511  1.00 5.99  ? 232 HIS A ND1  1 
ATOM   1976  C  CD2  . HIS A 1 201 ? 33.563  38.492  9.965   1.00 2.00  ? 232 HIS A CD2  1 
ATOM   1977  C  CE1  . HIS A 1 201 ? 34.099  39.809  11.639  1.00 2.24  ? 232 HIS A CE1  1 
ATOM   1978  N  NE2  . HIS A 1 201 ? 33.672  38.597  11.334  1.00 2.00  ? 232 HIS A NE2  1 
ATOM   1979  H  H    . HIS A 1 201 ? 36.371  39.348  8.221   1.00 17.00 ? 232 HIS A H    1 
ATOM   1980  H  HD1  . HIS A 1 201 ? 34.524  41.431  10.486  1.00 17.00 ? 232 HIS A HD1  1 
ATOM   1981  H  HE2  . HIS A 1 201 ? 33.542  37.842  11.950  1.00 17.00 ? 232 HIS A HE2  1 
ATOM   1982  N  N    . ILE A 1 202 ? 35.950  42.393  9.443   1.00 2.02  ? 233 ILE A N    1 
ATOM   1983  C  CA   . ILE A 1 202 ? 36.121  43.662  10.149  1.00 3.60  ? 233 ILE A CA   1 
ATOM   1984  C  C    . ILE A 1 202 ? 37.343  44.385  9.545   1.00 4.90  ? 233 ILE A C    1 
ATOM   1985  O  O    . ILE A 1 202 ? 37.272  45.564  9.214   1.00 6.38  ? 233 ILE A O    1 
ATOM   1986  C  CB   . ILE A 1 202 ? 36.442  43.467  11.643  1.00 2.00  ? 233 ILE A CB   1 
ATOM   1987  C  CG1  . ILE A 1 202 ? 35.255  42.890  12.395  1.00 2.00  ? 233 ILE A CG1  1 
ATOM   1988  C  CG2  . ILE A 1 202 ? 36.951  44.756  12.258  1.00 2.00  ? 233 ILE A CG2  1 
ATOM   1989  C  CD1  . ILE A 1 202 ? 35.626  42.381  13.770  1.00 2.05  ? 233 ILE A CD1  1 
ATOM   1990  H  H    . ILE A 1 202 ? 36.451  41.606  9.742   1.00 17.00 ? 233 ILE A H    1 
ATOM   1991  N  N    . TYR A 1 203 ? 38.429  43.635  9.335   1.00 4.53  ? 234 TYR A N    1 
ATOM   1992  C  CA   . TYR A 1 203 ? 39.687  44.181  8.856   1.00 3.69  ? 234 TYR A CA   1 
ATOM   1993  C  C    . TYR A 1 203 ? 40.056  44.285  7.383   1.00 5.60  ? 234 TYR A C    1 
ATOM   1994  O  O    . TYR A 1 203 ? 41.217  44.536  7.058   1.00 6.74  ? 234 TYR A O    1 
ATOM   1995  C  CB   . TYR A 1 203 ? 40.804  43.483  9.597   1.00 2.37  ? 234 TYR A CB   1 
ATOM   1996  C  CG   . TYR A 1 203 ? 40.692  43.610  11.082  1.00 2.00  ? 234 TYR A CG   1 
ATOM   1997  C  CD1  . TYR A 1 203 ? 41.002  44.795  11.729  1.00 2.00  ? 234 TYR A CD1  1 
ATOM   1998  C  CD2  . TYR A 1 203 ? 40.363  42.527  11.844  1.00 2.00  ? 234 TYR A CD2  1 
ATOM   1999  C  CE1  . TYR A 1 203 ? 41.009  44.877  13.096  1.00 2.00  ? 234 TYR A CE1  1 
ATOM   2000  C  CE2  . TYR A 1 203 ? 40.359  42.597  13.199  1.00 2.00  ? 234 TYR A CE2  1 
ATOM   2001  C  CZ   . TYR A 1 203 ? 40.691  43.765  13.820  1.00 2.00  ? 234 TYR A CZ   1 
ATOM   2002  O  OH   . TYR A 1 203 ? 40.767  43.753  15.183  1.00 2.54  ? 234 TYR A OH   1 
ATOM   2003  H  H    . TYR A 1 203 ? 38.397  42.673  9.504   1.00 17.00 ? 234 TYR A H    1 
ATOM   2004  H  HH   . TYR A 1 203 ? 40.563  42.839  15.434  1.00 17.00 ? 234 TYR A HH   1 
ATOM   2005  N  N    . GLY A 1 204 ? 39.095  44.187  6.485   1.00 7.80  ? 235 GLY A N    1 
ATOM   2006  C  CA   . GLY A 1 204 ? 39.439  44.278  5.074   1.00 10.54 ? 235 GLY A CA   1 
ATOM   2007  C  C    . GLY A 1 204 ? 39.962  42.948  4.594   1.00 10.74 ? 235 GLY A C    1 
ATOM   2008  O  O    . GLY A 1 204 ? 40.685  42.260  5.315   1.00 11.16 ? 235 GLY A O    1 
ATOM   2009  H  H    . GLY A 1 204 ? 38.173  44.001  6.750   1.00 17.00 ? 235 GLY A H    1 
ATOM   2010  N  N    . GLU A 1 205 ? 39.623  42.590  3.366   1.00 13.39 ? 236 GLU A N    1 
ATOM   2011  C  CA   . GLU A 1 205 ? 40.060  41.292  2.802   1.00 16.86 ? 236 GLU A CA   1 
ATOM   2012  C  C    . GLU A 1 205 ? 41.565  41.166  2.509   1.00 14.73 ? 236 GLU A C    1 
ATOM   2013  O  O    . GLU A 1 205 ? 42.018  40.088  2.123   1.00 15.04 ? 236 GLU A O    1 
ATOM   2014  C  CB   . GLU A 1 205 ? 39.298  40.957  1.485   1.00 20.98 ? 236 GLU A CB   1 
ATOM   2015  C  CG   . GLU A 1 205 ? 37.843  41.436  1.380   1.00 23.90 ? 236 GLU A CG   1 
ATOM   2016  C  CD   . GLU A 1 205 ? 37.731  42.903  1.002   1.00 26.51 ? 236 GLU A CD   1 
ATOM   2017  O  OE1  . GLU A 1 205 ? 38.475  43.348  0.079   1.00 26.27 ? 236 GLU A OE1  1 
ATOM   2018  O  OE2  . GLU A 1 205 ? 36.897  43.599  1.638   1.00 27.21 ? 236 GLU A OE2  1 
ATOM   2019  H  H    . GLU A 1 205 ? 39.046  43.192  2.865   1.00 17.00 ? 236 GLU A H    1 
ATOM   2020  N  N    . THR A 1 206 ? 42.316  42.261  2.651   1.00 10.73 ? 237 THR A N    1 
ATOM   2021  C  CA   . THR A 1 206 ? 43.724  42.249  2.322   1.00 7.76  ? 237 THR A CA   1 
ATOM   2022  C  C    . THR A 1 206 ? 44.582  42.916  3.372   1.00 7.58  ? 237 THR A C    1 
ATOM   2023  O  O    . THR A 1 206 ? 44.331  42.774  4.563   1.00 9.61  ? 237 THR A O    1 
ATOM   2024  C  CB   . THR A 1 206 ? 43.964  42.986  1.001   1.00 7.43  ? 237 THR A CB   1 
ATOM   2025  O  OG1  . THR A 1 206 ? 43.445  44.311  1.116   1.00 6.34  ? 237 THR A OG1  1 
ATOM   2026  C  CG2  . THR A 1 206 ? 43.305  42.293  -0.154  1.00 5.60  ? 237 THR A CG2  1 
ATOM   2027  H  H    . THR A 1 206 ? 41.937  43.054  3.067   1.00 17.00 ? 237 THR A H    1 
ATOM   2028  H  HG1  . THR A 1 206 ? 42.495  44.232  0.941   1.00 17.00 ? 237 THR A HG1  1 
ATOM   2029  N  N    . LEU A 1 207 ? 45.652  43.569  2.904   1.00 7.06  ? 238 LEU A N    1 
ATOM   2030  C  CA   . LEU A 1 207 ? 46.610  44.302  3.725   1.00 4.70  ? 238 LEU A CA   1 
ATOM   2031  C  C    . LEU A 1 207 ? 46.384  45.719  3.269   1.00 2.00  ? 238 LEU A C    1 
ATOM   2032  O  O    . LEU A 1 207 ? 46.147  46.624  4.080   1.00 2.00  ? 238 LEU A O    1 
ATOM   2033  C  CB   . LEU A 1 207 ? 48.034  43.835  3.394   1.00 2.00  ? 238 LEU A CB   1 
ATOM   2034  C  CG   . LEU A 1 207 ? 49.280  44.262  4.168   1.00 2.46  ? 238 LEU A CG   1 
ATOM   2035  C  CD1  . LEU A 1 207 ? 50.105  45.191  3.286   1.00 6.42  ? 238 LEU A CD1  1 
ATOM   2036  C  CD2  . LEU A 1 207 ? 48.946  44.910  5.516   1.00 3.28  ? 238 LEU A CD2  1 
ATOM   2037  H  H    . LEU A 1 207 ? 45.904  43.536  1.969   1.00 17.00 ? 238 LEU A H    1 
ATOM   2038  N  N    . ASP A 1 208 ? 46.313  45.860  1.949   1.00 2.00  ? 239 ASP A N    1 
ATOM   2039  C  CA   . ASP A 1 208 ? 46.108  47.153  1.300   1.00 6.88  ? 239 ASP A CA   1 
ATOM   2040  C  C    . ASP A 1 208 ? 44.845  47.831  1.840   1.00 8.78  ? 239 ASP A C    1 
ATOM   2041  O  O    . ASP A 1 208 ? 44.875  49.003  2.243   1.00 8.23  ? 239 ASP A O    1 
ATOM   2042  C  CB   . ASP A 1 208 ? 45.988  46.942  -0.220  1.00 8.16  ? 239 ASP A CB   1 
ATOM   2043  C  CG   . ASP A 1 208 ? 46.148  48.243  -1.028  1.00 12.92 ? 239 ASP A CG   1 
ATOM   2044  O  OD1  . ASP A 1 208 ? 45.319  49.201  -0.850  1.00 15.40 ? 239 ASP A OD1  1 
ATOM   2045  O  OD2  . ASP A 1 208 ? 47.101  48.291  -1.865  1.00 11.72 ? 239 ASP A OD2  1 
ATOM   2046  H  H    . ASP A 1 208 ? 46.419  45.082  1.375   1.00 17.00 ? 239 ASP A H    1 
ATOM   2047  N  N    . ARG A 1 209 ? 43.762  47.048  1.891   1.00 9.49  ? 240 ARG A N    1 
ATOM   2048  C  CA   . ARG A 1 209 ? 42.451  47.504  2.349   1.00 6.34  ? 240 ARG A CA   1 
ATOM   2049  C  C    . ARG A 1 209 ? 42.422  47.698  3.840   1.00 4.64  ? 240 ARG A C    1 
ATOM   2050  O  O    . ARG A 1 209 ? 41.759  48.592  4.355   1.00 4.54  ? 240 ARG A O    1 
ATOM   2051  C  CB   . ARG A 1 209 ? 41.376  46.494  1.948   1.00 7.67  ? 240 ARG A CB   1 
ATOM   2052  C  CG   . ARG A 1 209 ? 40.015  46.766  2.571   1.00 6.28  ? 240 ARG A CG   1 
ATOM   2053  C  CD   . ARG A 1 209 ? 38.924  45.993  1.874   1.00 6.36  ? 240 ARG A CD   1 
ATOM   2054  N  NE   . ARG A 1 209 ? 37.615  46.294  2.442   1.00 5.61  ? 240 ARG A NE   1 
ATOM   2055  C  CZ   . ARG A 1 209 ? 36.517  46.507  1.730   1.00 3.60  ? 240 ARG A CZ   1 
ATOM   2056  N  NH1  . ARG A 1 209 ? 36.550  46.441  0.413   1.00 2.03  ? 240 ARG A NH1  1 
ATOM   2057  N  NH2  . ARG A 1 209 ? 35.402  46.870  2.344   1.00 3.99  ? 240 ARG A NH2  1 
ATOM   2058  H  H    . ARG A 1 209 ? 43.865  46.128  1.584   1.00 17.00 ? 240 ARG A H    1 
ATOM   2059  H  HE   . ARG A 1 209 ? 37.543  46.341  3.418   1.00 17.00 ? 240 ARG A HE   1 
ATOM   2060  H  HH11 . ARG A 1 209 ? 37.402  46.232  -0.065  1.00 17.00 ? 240 ARG A HH11 1 
ATOM   2061  H  HH12 . ARG A 1 209 ? 35.711  46.607  -0.107  1.00 17.00 ? 240 ARG A HH12 1 
ATOM   2062  H  HH21 . ARG A 1 209 ? 35.397  46.986  3.337   1.00 17.00 ? 240 ARG A HH21 1 
ATOM   2063  H  HH22 . ARG A 1 209 ? 34.564  47.037  1.821   1.00 17.00 ? 240 ARG A HH22 1 
ATOM   2064  N  N    . GLN A 1 210 ? 43.097  46.800  4.529   1.00 2.34  ? 241 GLN A N    1 
ATOM   2065  C  CA   . GLN A 1 210 ? 43.181  46.850  5.972   1.00 3.09  ? 241 GLN A CA   1 
ATOM   2066  C  C    . GLN A 1 210 ? 43.872  48.184  6.362   1.00 3.20  ? 241 GLN A C    1 
ATOM   2067  O  O    . GLN A 1 210 ? 43.568  48.810  7.389   1.00 2.02  ? 241 GLN A O    1 
ATOM   2068  C  CB   . GLN A 1 210 ? 43.966  45.613  6.438   1.00 2.00  ? 241 GLN A CB   1 
ATOM   2069  C  CG   . GLN A 1 210 ? 44.314  45.555  7.887   1.00 2.01  ? 241 GLN A CG   1 
ATOM   2070  C  CD   . GLN A 1 210 ? 45.792  45.711  8.121   1.00 3.61  ? 241 GLN A CD   1 
ATOM   2071  O  OE1  . GLN A 1 210 ? 46.527  46.300  7.308   1.00 5.13  ? 241 GLN A OE1  1 
ATOM   2072  N  NE2  . GLN A 1 210 ? 46.249  45.177  9.234   1.00 3.24  ? 241 GLN A NE2  1 
ATOM   2073  H  H    . GLN A 1 210 ? 43.565  46.078  4.076   1.00 17.00 ? 241 GLN A H    1 
ATOM   2074  H  HE21 . GLN A 1 210 ? 47.187  45.290  9.474   1.00 17.00 ? 241 GLN A HE21 1 
ATOM   2075  H  HE22 . GLN A 1 210 ? 45.574  44.688  9.737   1.00 17.00 ? 241 GLN A HE22 1 
ATOM   2076  N  N    . HIS A 1 211 ? 44.797  48.620  5.525   1.00 3.18  ? 242 HIS A N    1 
ATOM   2077  C  CA   . HIS A 1 211 ? 45.488  49.856  5.801   1.00 7.73  ? 242 HIS A CA   1 
ATOM   2078  C  C    . HIS A 1 211 ? 44.538  51.039  5.630   1.00 8.30  ? 242 HIS A C    1 
ATOM   2079  O  O    . HIS A 1 211 ? 44.523  51.952  6.468   1.00 7.87  ? 242 HIS A O    1 
ATOM   2080  C  CB   . HIS A 1 211 ? 46.727  50.012  4.896   1.00 10.12 ? 242 HIS A CB   1 
ATOM   2081  C  CG   . HIS A 1 211 ? 47.928  49.217  5.346   1.00 8.62  ? 242 HIS A CG   1 
ATOM   2082  N  ND1  . HIS A 1 211 ? 48.025  48.642  6.596   1.00 7.89  ? 242 HIS A ND1  1 
ATOM   2083  C  CD2  . HIS A 1 211 ? 49.054  48.861  4.684   1.00 4.03  ? 242 HIS A CD2  1 
ATOM   2084  C  CE1  . HIS A 1 211 ? 49.149  47.958  6.683   1.00 2.60  ? 242 HIS A CE1  1 
ATOM   2085  N  NE2  . HIS A 1 211 ? 49.790  48.074  5.536   1.00 3.72  ? 242 HIS A NE2  1 
ATOM   2086  H  H    . HIS A 1 211 ? 45.013  48.085  4.733   1.00 17.00 ? 242 HIS A H    1 
ATOM   2087  H  HD1  . HIS A 1 211 ? 47.336  48.643  7.299   1.00 17.00 ? 242 HIS A HD1  1 
ATOM   2088  H  HE2  . HIS A 1 211 ? 50.649  47.651  5.327   1.00 17.00 ? 242 HIS A HE2  1 
ATOM   2089  N  N    . LYS A 1 212 ? 43.701  50.980  4.584   1.00 11.96 ? 243 LYS A N    1 
ATOM   2090  C  CA   . LYS A 1 212 ? 42.705  52.038  4.261   1.00 11.85 ? 243 LYS A CA   1 
ATOM   2091  C  C    . LYS A 1 212 ? 41.529  52.173  5.229   1.00 8.46  ? 243 LYS A C    1 
ATOM   2092  O  O    . LYS A 1 212 ? 40.586  52.916  4.959   1.00 6.08  ? 243 LYS A O    1 
ATOM   2093  C  CB   . LYS A 1 212 ? 42.146  51.864  2.844   1.00 12.53 ? 243 LYS A CB   1 
ATOM   2094  C  CG   . LYS A 1 212 ? 43.172  52.004  1.738   1.00 13.56 ? 243 LYS A CG   1 
ATOM   2095  C  CD   . LYS A 1 212 ? 42.479  52.255  0.410   1.00 16.30 ? 243 LYS A CD   1 
ATOM   2096  C  CE   . LYS A 1 212 ? 41.666  51.064  -0.035  1.00 16.84 ? 243 LYS A CE   1 
ATOM   2097  N  NZ   . LYS A 1 212 ? 40.900  51.442  -1.259  1.00 13.17 ? 243 LYS A NZ   1 
ATOM   2098  H  H    . LYS A 1 212 ? 43.728  50.197  3.995   1.00 17.00 ? 243 LYS A H    1 
ATOM   2099  H  HZ1  . LYS A 1 212 ? 40.280  52.243  -1.035  1.00 17.00 ? 243 LYS A HZ1  1 
ATOM   2100  H  HZ2  . LYS A 1 212 ? 41.557  51.721  -2.016  1.00 17.00 ? 243 LYS A HZ2  1 
ATOM   2101  H  HZ3  . LYS A 1 212 ? 40.330  50.634  -1.581  1.00 17.00 ? 243 LYS A HZ3  1 
ATOM   2102  N  N    . LEU A 1 213 ? 41.612  51.467  6.351   1.00 7.51  ? 244 LEU A N    1 
ATOM   2103  C  CA   . LEU A 1 213 ? 40.578  51.500  7.363   1.00 5.53  ? 244 LEU A CA   1 
ATOM   2104  C  C    . LEU A 1 213 ? 41.184  51.824  8.694   1.00 4.40  ? 244 LEU A C    1 
ATOM   2105  O  O    . LEU A 1 213 ? 40.464  52.158  9.626   1.00 4.26  ? 244 LEU A O    1 
ATOM   2106  C  CB   . LEU A 1 213 ? 39.925  50.129  7.487   1.00 7.76  ? 244 LEU A CB   1 
ATOM   2107  C  CG   . LEU A 1 213 ? 39.160  49.605  6.296   1.00 5.97  ? 244 LEU A CG   1 
ATOM   2108  C  CD1  . LEU A 1 213 ? 38.969  48.096  6.487   1.00 7.67  ? 244 LEU A CD1  1 
ATOM   2109  C  CD2  . LEU A 1 213 ? 37.859  50.382  6.191   1.00 2.00  ? 244 LEU A CD2  1 
ATOM   2110  H  H    . LEU A 1 213 ? 42.379  50.889  6.511   1.00 17.00 ? 244 LEU A H    1 
ATOM   2111  N  N    . ARG A 1 214 ? 42.492  51.653  8.814   1.00 4.52  ? 245 ARG A N    1 
ATOM   2112  C  CA   . ARG A 1 214 ? 43.125  51.913  10.087  1.00 4.12  ? 245 ARG A CA   1 
ATOM   2113  C  C    . ARG A 1 214 ? 43.507  53.363  10.281  1.00 4.54  ? 245 ARG A C    1 
ATOM   2114  O  O    . ARG A 1 214 ? 43.761  54.104  9.320   1.00 3.25  ? 245 ARG A O    1 
ATOM   2115  C  CB   . ARG A 1 214 ? 44.339  51.041  10.287  1.00 3.77  ? 245 ARG A CB   1 
ATOM   2116  C  CG   . ARG A 1 214 ? 44.778  50.996  11.722  1.00 4.42  ? 245 ARG A CG   1 
ATOM   2117  C  CD   . ARG A 1 214 ? 46.170  50.472  11.777  1.00 9.96  ? 245 ARG A CD   1 
ATOM   2118  N  NE   . ARG A 1 214 ? 46.352  49.334  10.864  1.00 15.35 ? 245 ARG A NE   1 
ATOM   2119  C  CZ   . ARG A 1 214 ? 47.473  48.629  10.741  1.00 17.12 ? 245 ARG A CZ   1 
ATOM   2120  N  NH1  . ARG A 1 214 ? 48.562  48.931  11.449  1.00 17.73 ? 245 ARG A NH1  1 
ATOM   2121  N  NH2  . ARG A 1 214 ? 47.464  47.546  9.986   1.00 20.39 ? 245 ARG A NH2  1 
ATOM   2122  H  H    . ARG A 1 214 ? 43.054  51.399  8.056   1.00 17.00 ? 245 ARG A H    1 
ATOM   2123  H  HE   . ARG A 1 214 ? 45.607  49.035  10.303  1.00 17.00 ? 245 ARG A HE   1 
ATOM   2124  H  HH11 . ARG A 1 214 ? 48.538  49.705  12.082  1.00 17.00 ? 245 ARG A HH11 1 
ATOM   2125  H  HH12 . ARG A 1 214 ? 49.399  48.395  11.347  1.00 17.00 ? 245 ARG A HH12 1 
ATOM   2126  H  HH21 . ARG A 1 214 ? 46.614  47.281  9.536   1.00 17.00 ? 245 ARG A HH21 1 
ATOM   2127  H  HH22 . ARG A 1 214 ? 48.287  46.989  9.877   1.00 17.00 ? 245 ARG A HH22 1 
ATOM   2128  N  N    . LEU A 1 215 ? 43.535  53.756  11.552  1.00 5.49  ? 246 LEU A N    1 
ATOM   2129  C  CA   . LEU A 1 215 ? 43.883  55.114  11.955  1.00 4.17  ? 246 LEU A CA   1 
ATOM   2130  C  C    . LEU A 1 215 ? 45.400  55.287  12.003  1.00 2.69  ? 246 LEU A C    1 
ATOM   2131  O  O    . LEU A 1 215 ? 45.933  56.337  11.709  1.00 2.09  ? 246 LEU A O    1 
ATOM   2132  C  CB   . LEU A 1 215 ? 43.297  55.375  13.334  1.00 2.00  ? 246 LEU A CB   1 
ATOM   2133  C  CG   . LEU A 1 215 ? 43.357  56.789  13.878  1.00 2.75  ? 246 LEU A CG   1 
ATOM   2134  C  CD1  . LEU A 1 215 ? 42.767  57.772  12.869  1.00 2.00  ? 246 LEU A CD1  1 
ATOM   2135  C  CD2  . LEU A 1 215 ? 42.623  56.837  15.193  1.00 3.76  ? 246 LEU A CD2  1 
ATOM   2136  H  H    . LEU A 1 215 ? 43.299  53.099  12.247  1.00 17.00 ? 246 LEU A H    1 
ATOM   2137  N  N    . PHE A 1 216 ? 46.080  54.199  12.306  1.00 3.21  ? 247 PHE A N    1 
ATOM   2138  C  CA   . PHE A 1 216 ? 47.507  54.183  12.439  1.00 2.00  ? 247 PHE A CA   1 
ATOM   2139  C  C    . PHE A 1 216 ? 47.793  55.078  13.623  1.00 2.00  ? 247 PHE A C    1 
ATOM   2140  O  O    . PHE A 1 216 ? 48.654  55.936  13.591  1.00 2.39  ? 247 PHE A O    1 
ATOM   2141  C  CB   . PHE A 1 216 ? 48.182  54.656  11.168  1.00 2.00  ? 247 PHE A CB   1 
ATOM   2142  C  CG   . PHE A 1 216 ? 48.095  53.691  10.043  1.00 2.00  ? 247 PHE A CG   1 
ATOM   2143  C  CD1  . PHE A 1 216 ? 48.497  52.370  10.201  1.00 4.24  ? 247 PHE A CD1  1 
ATOM   2144  C  CD2  . PHE A 1 216 ? 47.637  54.096  8.814   1.00 2.00  ? 247 PHE A CD2  1 
ATOM   2145  C  CE1  . PHE A 1 216 ? 48.442  51.450  9.126   1.00 3.01  ? 247 PHE A CE1  1 
ATOM   2146  C  CE2  . PHE A 1 216 ? 47.580  53.203  7.747   1.00 2.06  ? 247 PHE A CE2  1 
ATOM   2147  C  CZ   . PHE A 1 216 ? 47.987  51.871  7.909   1.00 2.00  ? 247 PHE A CZ   1 
ATOM   2148  H  H    . PHE A 1 216 ? 45.580  53.376  12.443  1.00 17.00 ? 247 PHE A H    1 
ATOM   2149  N  N    . LYS A 1 217 ? 47.062  54.810  14.696  1.00 2.00  ? 248 LYS A N    1 
ATOM   2150  C  CA   . LYS A 1 217 ? 47.145  55.542  15.958  1.00 2.23  ? 248 LYS A CA   1 
ATOM   2151  C  C    . LYS A 1 217 ? 46.609  54.685  17.105  1.00 2.00  ? 248 LYS A C    1 
ATOM   2152  O  O    . LYS A 1 217 ? 45.466  54.306  17.092  1.00 4.06  ? 248 LYS A O    1 
ATOM   2153  C  CB   . LYS A 1 217 ? 46.286  56.813  15.875  1.00 4.39  ? 248 LYS A CB   1 
ATOM   2154  C  CG   . LYS A 1 217 ? 47.022  58.040  15.369  1.00 4.99  ? 248 LYS A CG   1 
ATOM   2155  C  CD   . LYS A 1 217 ? 47.919  58.525  16.468  1.00 8.01  ? 248 LYS A CD   1 
ATOM   2156  C  CE   . LYS A 1 217 ? 47.097  59.061  17.641  1.00 4.91  ? 248 LYS A CE   1 
ATOM   2157  N  NZ   . LYS A 1 217 ? 46.505  60.382  17.271  1.00 5.30  ? 248 LYS A NZ   1 
ATOM   2158  H  H    . LYS A 1 217 ? 46.395  54.096  14.647  1.00 17.00 ? 248 LYS A H    1 
ATOM   2159  H  HZ1  . LYS A 1 217 ? 45.924  60.269  16.417  1.00 17.00 ? 248 LYS A HZ1  1 
ATOM   2160  H  HZ2  . LYS A 1 217 ? 45.903  60.723  18.049  1.00 17.00 ? 248 LYS A HZ2  1 
ATOM   2161  H  HZ3  . LYS A 1 217 ? 47.262  61.071  17.097  1.00 17.00 ? 248 LYS A HZ3  1 
ATOM   2162  N  N    . ASP A 1 218 ? 47.412  54.413  18.115  1.00 2.00  ? 249 ASP A N    1 
ATOM   2163  C  CA   . ASP A 1 218 ? 46.975  53.617  19.248  1.00 2.00  ? 249 ASP A CA   1 
ATOM   2164  C  C    . ASP A 1 218 ? 46.442  52.276  18.805  1.00 2.71  ? 249 ASP A C    1 
ATOM   2165  O  O    . ASP A 1 218 ? 45.630  51.684  19.497  1.00 5.75  ? 249 ASP A O    1 
ATOM   2166  C  CB   . ASP A 1 218 ? 45.866  54.295  20.032  1.00 2.01  ? 249 ASP A CB   1 
ATOM   2167  C  CG   . ASP A 1 218 ? 46.163  55.726  20.373  1.00 12.92 ? 249 ASP A CG   1 
ATOM   2168  O  OD1  . ASP A 1 218 ? 47.001  56.355  19.693  1.00 18.65 ? 249 ASP A OD1  1 
ATOM   2169  O  OD2  . ASP A 1 218 ? 45.517  56.260  21.311  1.00 20.03 ? 249 ASP A OD2  1 
ATOM   2170  H  H    . ASP A 1 218 ? 48.316  54.784  18.113  1.00 17.00 ? 249 ASP A H    1 
ATOM   2171  N  N    . GLY A 1 219 ? 46.873  51.794  17.648  1.00 4.21  ? 250 GLY A N    1 
ATOM   2172  C  CA   . GLY A 1 219 ? 46.396  50.508  17.168  1.00 6.51  ? 250 GLY A CA   1 
ATOM   2173  C  C    . GLY A 1 219 ? 44.949  50.519  16.718  1.00 8.14  ? 250 GLY A C    1 
ATOM   2174  O  O    . GLY A 1 219 ? 44.440  49.505  16.267  1.00 10.62 ? 250 GLY A O    1 
ATOM   2175  H  H    . GLY A 1 219 ? 47.505  52.309  17.123  1.00 17.00 ? 250 GLY A H    1 
ATOM   2176  N  N    . LYS A 1 220 ? 44.311  51.683  16.797  1.00 8.01  ? 251 LYS A N    1 
ATOM   2177  C  CA   . LYS A 1 220 ? 42.917  51.887  16.444  1.00 6.07  ? 251 LYS A CA   1 
ATOM   2178  C  C    . LYS A 1 220 ? 42.519  51.736  14.980  1.00 8.27  ? 251 LYS A C    1 
ATOM   2179  O  O    . LYS A 1 220 ? 43.294  52.023  14.034  1.00 7.61  ? 251 LYS A O    1 
ATOM   2180  C  CB   . LYS A 1 220 ? 42.478  53.281  16.867  1.00 4.42  ? 251 LYS A CB   1 
ATOM   2181  C  CG   . LYS A 1 220 ? 42.399  53.530  18.339  1.00 7.62  ? 251 LYS A CG   1 
ATOM   2182  C  CD   . LYS A 1 220 ? 41.925  54.978  18.605  1.00 10.47 ? 251 LYS A CD   1 
ATOM   2183  C  CE   . LYS A 1 220 ? 41.700  55.252  20.085  1.00 9.42  ? 251 LYS A CE   1 
ATOM   2184  N  NZ   . LYS A 1 220 ? 40.755  54.237  20.647  1.00 11.13 ? 251 LYS A NZ   1 
ATOM   2185  H  H    . LYS A 1 220 ? 44.786  52.465  17.120  1.00 17.00 ? 251 LYS A H    1 
ATOM   2186  H  HZ1  . LYS A 1 220 ? 41.139  53.286  20.477  1.00 17.00 ? 251 LYS A HZ1  1 
ATOM   2187  H  HZ2  . LYS A 1 220 ? 40.674  54.374  21.674  1.00 17.00 ? 251 LYS A HZ2  1 
ATOM   2188  H  HZ3  . LYS A 1 220 ? 39.821  54.326  20.199  1.00 17.00 ? 251 LYS A HZ3  1 
ATOM   2189  N  N    . LEU A 1 221 ? 41.238  51.387  14.835  1.00 8.02  ? 252 LEU A N    1 
ATOM   2190  C  CA   . LEU A 1 221 ? 40.547  51.226  13.562  1.00 5.71  ? 252 LEU A CA   1 
ATOM   2191  C  C    . LEU A 1 221 ? 39.920  52.610  13.355  1.00 5.70  ? 252 LEU A C    1 
ATOM   2192  O  O    . LEU A 1 221 ? 39.591  53.297  14.332  1.00 5.66  ? 252 LEU A O    1 
ATOM   2193  C  CB   . LEU A 1 221 ? 39.456  50.189  13.754  1.00 3.88  ? 252 LEU A CB   1 
ATOM   2194  C  CG   . LEU A 1 221 ? 39.193  49.185  12.649  1.00 5.86  ? 252 LEU A CG   1 
ATOM   2195  C  CD1  . LEU A 1 221 ? 40.398  49.010  11.732  1.00 3.03  ? 252 LEU A CD1  1 
ATOM   2196  C  CD2  . LEU A 1 221 ? 38.799  47.893  13.326  1.00 4.39  ? 252 LEU A CD2  1 
ATOM   2197  H  H    . LEU A 1 221 ? 40.717  51.248  15.645  1.00 17.00 ? 252 LEU A H    1 
ATOM   2198  N  N    . LYS A 1 222 ? 39.803  53.064  12.118  1.00 5.85  ? 253 LYS A N    1 
ATOM   2199  C  CA   . LYS A 1 222 ? 39.209  54.385  11.891  1.00 7.51  ? 253 LYS A CA   1 
ATOM   2200  C  C    . LYS A 1 222 ? 37.713  54.320  12.193  1.00 8.96  ? 253 LYS A C    1 
ATOM   2201  O  O    . LYS A 1 222 ? 37.074  53.273  11.978  1.00 10.33 ? 253 LYS A O    1 
ATOM   2202  C  CB   . LYS A 1 222 ? 39.375  54.807  10.444  1.00 7.30  ? 253 LYS A CB   1 
ATOM   2203  C  CG   . LYS A 1 222 ? 39.733  56.226  10.281  1.00 8.11  ? 253 LYS A CG   1 
ATOM   2204  C  CD   . LYS A 1 222 ? 41.089  56.300  9.630   1.00 10.91 ? 253 LYS A CD   1 
ATOM   2205  C  CE   . LYS A 1 222 ? 41.054  55.959  8.120   1.00 10.55 ? 253 LYS A CE   1 
ATOM   2206  N  NZ   . LYS A 1 222 ? 40.504  54.613  7.779   1.00 8.32  ? 253 LYS A NZ   1 
ATOM   2207  H  H    . LYS A 1 222 ? 40.050  52.504  11.363  1.00 17.00 ? 253 LYS A H    1 
ATOM   2208  H  HZ1  . LYS A 1 222 ? 39.527  54.514  8.120   1.00 17.00 ? 253 LYS A HZ1  1 
ATOM   2209  H  HZ2  . LYS A 1 222 ? 40.524  54.467  6.750   1.00 17.00 ? 253 LYS A HZ2  1 
ATOM   2210  H  HZ3  . LYS A 1 222 ? 41.119  53.919  8.240   1.00 17.00 ? 253 LYS A HZ3  1 
ATOM   2211  N  N    . TYR A 1 223 ? 37.162  55.431  12.670  1.00 6.51  ? 254 TYR A N    1 
ATOM   2212  C  CA   . TYR A 1 223 ? 35.749  55.514  12.982  1.00 4.81  ? 254 TYR A CA   1 
ATOM   2213  C  C    . TYR A 1 223 ? 35.321  56.934  12.741  1.00 4.33  ? 254 TYR A C    1 
ATOM   2214  O  O    . TYR A 1 223 ? 36.128  57.745  12.311  1.00 10.02 ? 254 TYR A O    1 
ATOM   2215  C  CB   . TYR A 1 223 ? 35.518  55.135  14.438  1.00 7.31  ? 254 TYR A CB   1 
ATOM   2216  C  CG   . TYR A 1 223 ? 36.327  55.916  15.457  1.00 10.76 ? 254 TYR A CG   1 
ATOM   2217  C  CD1  . TYR A 1 223 ? 36.460  57.316  15.364  1.00 8.47  ? 254 TYR A CD1  1 
ATOM   2218  C  CD2  . TYR A 1 223 ? 36.980  55.248  16.516  1.00 9.26  ? 254 TYR A CD2  1 
ATOM   2219  C  CE1  . TYR A 1 223 ? 37.220  58.025  16.276  1.00 8.06  ? 254 TYR A CE1  1 
ATOM   2220  C  CE2  . TYR A 1 223 ? 37.745  55.949  17.446  1.00 8.80  ? 254 TYR A CE2  1 
ATOM   2221  C  CZ   . TYR A 1 223 ? 37.871  57.341  17.316  1.00 9.37  ? 254 TYR A CZ   1 
ATOM   2222  O  OH   . TYR A 1 223 ? 38.706  58.025  18.184  1.00 7.61  ? 254 TYR A OH   1 
ATOM   2223  H  H    . TYR A 1 223 ? 37.696  56.244  12.796  1.00 17.00 ? 254 TYR A H    1 
ATOM   2224  H  HH   . TYR A 1 223 ? 39.072  57.425  18.838  1.00 17.00 ? 254 TYR A HH   1 
ATOM   2225  N  N    . GLN A 1 224 ? 34.096  57.269  13.089  1.00 2.00  ? 255 GLN A N    1 
ATOM   2226  C  CA   . GLN A 1 224 ? 33.644  58.633  12.911  1.00 4.71  ? 255 GLN A CA   1 
ATOM   2227  C  C    . GLN A 1 224 ? 32.497  58.916  13.829  1.00 4.94  ? 255 GLN A C    1 
ATOM   2228  O  O    . GLN A 1 224 ? 31.633  58.052  14.047  1.00 5.21  ? 255 GLN A O    1 
ATOM   2229  C  CB   . GLN A 1 224 ? 33.222  58.891  11.476  1.00 7.46  ? 255 GLN A CB   1 
ATOM   2230  C  CG   . GLN A 1 224 ? 31.850  58.358  11.141  1.00 11.10 ? 255 GLN A CG   1 
ATOM   2231  C  CD   . GLN A 1 224 ? 31.321  58.939  9.869   1.00 10.26 ? 255 GLN A CD   1 
ATOM   2232  O  OE1  . GLN A 1 224 ? 30.969  60.113  9.811   1.00 9.88  ? 255 GLN A OE1  1 
ATOM   2233  N  NE2  . GLN A 1 224 ? 31.266  58.121  8.831   1.00 13.58 ? 255 GLN A NE2  1 
ATOM   2234  H  H    . GLN A 1 224 ? 33.467  56.612  13.450  1.00 17.00 ? 255 GLN A H    1 
ATOM   2235  H  HE21 . GLN A 1 224 ? 30.877  58.489  8.018   1.00 17.00 ? 255 GLN A HE21 1 
ATOM   2236  H  HE22 . GLN A 1 224 ? 31.576  57.197  8.920   1.00 17.00 ? 255 GLN A HE22 1 
ATOM   2237  N  N    . VAL A 1 225 ? 32.460  60.128  14.361  1.00 4.30  ? 256 VAL A N    1 
ATOM   2238  C  CA   . VAL A 1 225 ? 31.384  60.441  15.273  1.00 7.87  ? 256 VAL A CA   1 
ATOM   2239  C  C    . VAL A 1 225 ? 30.215  61.165  14.668  1.00 9.87  ? 256 VAL A C    1 
ATOM   2240  O  O    . VAL A 1 225 ? 30.355  62.281  14.167  1.00 9.96  ? 256 VAL A O    1 
ATOM   2241  C  CB   . VAL A 1 225 ? 31.876  61.136  16.544  1.00 7.48  ? 256 VAL A CB   1 
ATOM   2242  C  CG1  . VAL A 1 225 ? 30.687  61.621  17.381  1.00 4.20  ? 256 VAL A CG1  1 
ATOM   2243  C  CG2  . VAL A 1 225 ? 32.709  60.125  17.354  1.00 7.43  ? 256 VAL A CG2  1 
ATOM   2244  H  H    . VAL A 1 225 ? 33.119  60.812  14.135  1.00 17.00 ? 256 VAL A H    1 
ATOM   2245  N  N    . ILE A 1 226 ? 29.063  60.492  14.711  1.00 9.97  ? 257 ILE A N    1 
ATOM   2246  C  CA   . ILE A 1 226 ? 27.825  61.030  14.185  1.00 8.56  ? 257 ILE A CA   1 
ATOM   2247  C  C    . ILE A 1 226 ? 26.956  61.332  15.397  1.00 8.10  ? 257 ILE A C    1 
ATOM   2248  O  O    . ILE A 1 226 ? 26.537  60.422  16.113  1.00 9.05  ? 257 ILE A O    1 
ATOM   2249  C  CB   . ILE A 1 226 ? 27.137  60.000  13.289  1.00 10.18 ? 257 ILE A CB   1 
ATOM   2250  C  CG1  . ILE A 1 226 ? 28.069  59.592  12.145  1.00 8.79  ? 257 ILE A CG1  1 
ATOM   2251  C  CG2  . ILE A 1 226 ? 25.813  60.575  12.762  1.00 11.77 ? 257 ILE A CG2  1 
ATOM   2252  C  CD1  . ILE A 1 226 ? 27.511  58.502  11.254  1.00 11.45 ? 257 ILE A CD1  1 
ATOM   2253  H  H    . ILE A 1 226 ? 29.061  59.592  15.107  1.00 17.00 ? 257 ILE A H    1 
ATOM   2254  N  N    . GLY A 1 227 ? 26.799  62.614  15.699  1.00 8.89  ? 258 GLY A N    1 
ATOM   2255  C  CA   . GLY A 1 227 ? 25.986  63.001  16.839  1.00 12.07 ? 258 GLY A CA   1 
ATOM   2256  C  C    . GLY A 1 227 ? 26.507  62.623  18.227  1.00 13.24 ? 258 GLY A C    1 
ATOM   2257  O  O    . GLY A 1 227 ? 26.223  63.317  19.213  1.00 15.10 ? 258 GLY A O    1 
ATOM   2258  H  H    . GLY A 1 227 ? 27.250  63.292  15.154  1.00 17.00 ? 258 GLY A H    1 
ATOM   2259  N  N    . GLY A 1 228 ? 27.259  61.536  18.327  1.00 11.61 ? 259 GLY A N    1 
ATOM   2260  C  CA   . GLY A 1 228 ? 27.772  61.143  19.614  1.00 10.53 ? 259 GLY A CA   1 
ATOM   2261  C  C    . GLY A 1 228 ? 28.176  59.696  19.584  1.00 13.48 ? 259 GLY A C    1 
ATOM   2262  O  O    . GLY A 1 228 ? 28.741  59.183  20.550  1.00 14.21 ? 259 GLY A O    1 
ATOM   2263  H  H    . GLY A 1 228 ? 27.504  60.996  17.566  1.00 17.00 ? 259 GLY A H    1 
ATOM   2264  N  N    . GLU A 1 229 ? 27.889  59.008  18.487  1.00 13.48 ? 260 GLU A N    1 
ATOM   2265  C  CA   . GLU A 1 229 ? 28.255  57.613  18.439  1.00 14.38 ? 260 GLU A CA   1 
ATOM   2266  C  C    . GLU A 1 229 ? 29.319  57.401  17.375  1.00 15.42 ? 260 GLU A C    1 
ATOM   2267  O  O    . GLU A 1 229 ? 29.382  58.148  16.360  1.00 15.17 ? 260 GLU A O    1 
ATOM   2268  C  CB   . GLU A 1 229 ? 27.033  56.730  18.130  1.00 17.47 ? 260 GLU A CB   1 
ATOM   2269  C  CG   . GLU A 1 229 ? 25.712  57.081  18.841  1.00 22.43 ? 260 GLU A CG   1 
ATOM   2270  C  CD   . GLU A 1 229 ? 25.716  56.888  20.377  1.00 24.24 ? 260 GLU A CD   1 
ATOM   2271  O  OE1  . GLU A 1 229 ? 26.545  56.098  20.908  1.00 24.60 ? 260 GLU A OE1  1 
ATOM   2272  O  OE2  . GLU A 1 229 ? 24.863  57.539  21.044  1.00 22.82 ? 260 GLU A OE2  1 
ATOM   2273  H  H    . GLU A 1 229 ? 27.442  59.391  17.705  1.00 17.00 ? 260 GLU A H    1 
ATOM   2274  N  N    . VAL A 1 230 ? 30.150  56.385  17.620  1.00 12.08 ? 261 VAL A N    1 
ATOM   2275  C  CA   . VAL A 1 230 ? 31.201  55.989  16.694  1.00 7.45  ? 261 VAL A CA   1 
ATOM   2276  C  C    . VAL A 1 230 ? 30.544  55.142  15.611  1.00 5.07  ? 261 VAL A C    1 
ATOM   2277  O  O    . VAL A 1 230 ? 29.787  54.214  15.915  1.00 3.62  ? 261 VAL A O    1 
ATOM   2278  C  CB   . VAL A 1 230 ? 32.299  55.155  17.426  1.00 6.82  ? 261 VAL A CB   1 
ATOM   2279  C  CG1  . VAL A 1 230 ? 32.950  54.136  16.480  1.00 2.00  ? 261 VAL A CG1  1 
ATOM   2280  C  CG2  . VAL A 1 230 ? 33.347  56.083  18.033  1.00 2.82  ? 261 VAL A CG2  1 
ATOM   2281  H  H    . VAL A 1 230 ? 30.034  55.865  18.438  1.00 17.00 ? 261 VAL A H    1 
ATOM   2282  N  N    . TYR A 1 231 ? 30.771  55.531  14.363  1.00 3.14  ? 262 TYR A N    1 
ATOM   2283  C  CA   . TYR A 1 231 ? 30.255  54.823  13.204  1.00 4.23  ? 262 TYR A CA   1 
ATOM   2284  C  C    . TYR A 1 231 ? 31.430  54.727  12.295  1.00 4.21  ? 262 TYR A C    1 
ATOM   2285  O  O    . TYR A 1 231 ? 32.317  55.551  12.366  1.00 5.01  ? 262 TYR A O    1 
ATOM   2286  C  CB   . TYR A 1 231 ? 29.133  55.600  12.516  1.00 6.32  ? 262 TYR A CB   1 
ATOM   2287  C  CG   . TYR A 1 231 ? 27.813  55.484  13.246  1.00 4.53  ? 262 TYR A CG   1 
ATOM   2288  C  CD1  . TYR A 1 231 ? 27.134  54.281  13.266  1.00 2.48  ? 262 TYR A CD1  1 
ATOM   2289  C  CD2  . TYR A 1 231 ? 27.336  56.530  14.045  1.00 3.90  ? 262 TYR A CD2  1 
ATOM   2290  C  CE1  . TYR A 1 231 ? 26.032  54.088  14.075  1.00 5.67  ? 262 TYR A CE1  1 
ATOM   2291  C  CE2  . TYR A 1 231 ? 26.232  56.355  14.860  1.00 6.35  ? 262 TYR A CE2  1 
ATOM   2292  C  CZ   . TYR A 1 231 ? 25.581  55.113  14.886  1.00 7.22  ? 262 TYR A CZ   1 
ATOM   2293  O  OH   . TYR A 1 231 ? 24.558  54.847  15.784  1.00 3.17  ? 262 TYR A OH   1 
ATOM   2294  H  H    . TYR A 1 231 ? 31.330  56.302  14.183  1.00 17.00 ? 262 TYR A H    1 
ATOM   2295  H  HH   . TYR A 1 231 ? 24.266  55.687  16.152  1.00 17.00 ? 262 TYR A HH   1 
ATOM   2296  N  N    . PRO A 1 232 ? 31.485  53.692  11.457  1.00 8.04  ? 263 PRO A N    1 
ATOM   2297  C  CA   . PRO A 1 232 ? 32.568  53.432  10.496  1.00 9.15  ? 263 PRO A CA   1 
ATOM   2298  C  C    . PRO A 1 232 ? 32.913  54.587  9.573   1.00 9.74  ? 263 PRO A C    1 
ATOM   2299  O  O    . PRO A 1 232 ? 32.063  55.420  9.248   1.00 10.76 ? 263 PRO A O    1 
ATOM   2300  C  CB   . PRO A 1 232 ? 32.043  52.232  9.703   1.00 10.54 ? 263 PRO A CB   1 
ATOM   2301  C  CG   . PRO A 1 232 ? 31.290  51.466  10.753  1.00 11.90 ? 263 PRO A CG   1 
ATOM   2302  C  CD   . PRO A 1 232 ? 30.514  52.581  11.451  1.00 10.79 ? 263 PRO A CD   1 
ATOM   2303  N  N    . PRO A 1 233 ? 34.167  54.627  9.103   1.00 10.20 ? 264 PRO A N    1 
ATOM   2304  C  CA   . PRO A 1 233 ? 34.572  55.708  8.207   1.00 9.74  ? 264 PRO A CA   1 
ATOM   2305  C  C    . PRO A 1 233 ? 33.765  55.595  6.913   1.00 5.71  ? 264 PRO A C    1 
ATOM   2306  O  O    . PRO A 1 233 ? 33.161  54.562  6.633   1.00 4.34  ? 264 PRO A O    1 
ATOM   2307  C  CB   . PRO A 1 233 ? 36.085  55.446  8.006   1.00 10.53 ? 264 PRO A CB   1 
ATOM   2308  C  CG   . PRO A 1 233 ? 36.216  53.963  8.126   1.00 11.78 ? 264 PRO A CG   1 
ATOM   2309  C  CD   . PRO A 1 233 ? 35.249  53.626  9.262   1.00 12.96 ? 264 PRO A CD   1 
ATOM   2310  N  N    . THR A 1 234 ? 33.733  56.672  6.155   1.00 3.88  ? 265 THR A N    1 
ATOM   2311  C  CA   . THR A 1 234 ? 32.988  56.719  4.923   1.00 2.82  ? 265 THR A CA   1 
ATOM   2312  C  C    . THR A 1 234 ? 33.864  56.331  3.778   1.00 2.44  ? 265 THR A C    1 
ATOM   2313  O  O    . THR A 1 234 ? 35.037  56.669  3.777   1.00 3.08  ? 265 THR A O    1 
ATOM   2314  C  CB   . THR A 1 234 ? 32.547  58.124  4.672   1.00 3.38  ? 265 THR A CB   1 
ATOM   2315  O  OG1  . THR A 1 234 ? 33.648  59.001  4.936   1.00 2.30  ? 265 THR A OG1  1 
ATOM   2316  C  CG2  . THR A 1 234 ? 31.383  58.483  5.583   1.00 4.91  ? 265 THR A CG2  1 
ATOM   2317  H  H    . THR A 1 234 ? 34.235  57.475  6.392   1.00 17.00 ? 265 THR A H    1 
ATOM   2318  H  HG1  . THR A 1 234 ? 33.319  59.910  4.869   1.00 17.00 ? 265 THR A HG1  1 
ATOM   2319  N  N    . VAL A 1 235 ? 33.289  55.667  2.784   1.00 2.00  ? 266 VAL A N    1 
ATOM   2320  C  CA   . VAL A 1 235 ? 34.053  55.271  1.617   1.00 4.44  ? 266 VAL A CA   1 
ATOM   2321  C  C    . VAL A 1 235 ? 34.702  56.517  1.022   1.00 5.65  ? 266 VAL A C    1 
ATOM   2322  O  O    . VAL A 1 235 ? 35.842  56.486  0.547   1.00 7.22  ? 266 VAL A O    1 
ATOM   2323  C  CB   . VAL A 1 235 ? 33.165  54.641  0.526   1.00 4.69  ? 266 VAL A CB   1 
ATOM   2324  C  CG1  . VAL A 1 235 ? 32.340  55.715  -0.171  1.00 3.73  ? 266 VAL A CG1  1 
ATOM   2325  C  CG2  . VAL A 1 235 ? 34.032  53.913  -0.508  1.00 7.70  ? 266 VAL A CG2  1 
ATOM   2326  H  H    . VAL A 1 235 ? 32.345  55.411  2.864   1.00 17.00 ? 266 VAL A H    1 
ATOM   2327  N  N    . LYS A 1 236 ? 33.972  57.625  1.055   1.00 6.89  ? 267 LYS A N    1 
ATOM   2328  C  CA   . LYS A 1 236 ? 34.502  58.848  0.489   1.00 8.92  ? 267 LYS A CA   1 
ATOM   2329  C  C    . LYS A 1 236 ? 35.753  59.273  1.250   1.00 10.06 ? 267 LYS A C    1 
ATOM   2330  O  O    . LYS A 1 236 ? 36.722  59.755  0.654   1.00 9.76  ? 267 LYS A O    1 
ATOM   2331  C  CB   . LYS A 1 236 ? 33.463  59.967  0.505   1.00 8.78  ? 267 LYS A CB   1 
ATOM   2332  C  CG   . LYS A 1 236 ? 34.043  61.300  0.049   1.00 6.03  ? 267 LYS A CG   1 
ATOM   2333  C  CD   . LYS A 1 236 ? 33.079  62.435  0.154   1.00 2.90  ? 267 LYS A CD   1 
ATOM   2334  C  CE   . LYS A 1 236 ? 33.760  63.629  -0.407  1.00 8.74  ? 267 LYS A CE   1 
ATOM   2335  N  NZ   . LYS A 1 236 ? 35.058  63.829  0.322   1.00 13.00 ? 267 LYS A NZ   1 
ATOM   2336  H  H    . LYS A 1 236 ? 33.087  57.609  1.466   1.00 17.00 ? 267 LYS A H    1 
ATOM   2337  H  HZ1  . LYS A 1 236 ? 34.870  63.976  1.334   1.00 17.00 ? 267 LYS A HZ1  1 
ATOM   2338  H  HZ2  . LYS A 1 236 ? 35.696  63.020  0.198   1.00 17.00 ? 267 LYS A HZ2  1 
ATOM   2339  H  HZ3  . LYS A 1 236 ? 35.515  64.680  -0.063  1.00 17.00 ? 267 LYS A HZ3  1 
ATOM   2340  N  N    . ASP A 1 237 ? 35.717  59.069  2.561   1.00 10.51 ? 268 ASP A N    1 
ATOM   2341  C  CA   . ASP A 1 237 ? 36.811  59.432  3.429   1.00 10.81 ? 268 ASP A CA   1 
ATOM   2342  C  C    . ASP A 1 237 ? 37.957  58.439  3.325   1.00 8.67  ? 268 ASP A C    1 
ATOM   2343  O  O    . ASP A 1 237 ? 39.088  58.799  3.008   1.00 9.82  ? 268 ASP A O    1 
ATOM   2344  C  CB   . ASP A 1 237 ? 36.295  59.509  4.850   1.00 16.34 ? 268 ASP A CB   1 
ATOM   2345  C  CG   . ASP A 1 237 ? 37.334  59.938  5.796   1.00 22.64 ? 268 ASP A CG   1 
ATOM   2346  O  OD1  . ASP A 1 237 ? 37.530  61.177  5.928   1.00 27.65 ? 268 ASP A OD1  1 
ATOM   2347  O  OD2  . ASP A 1 237 ? 37.978  59.029  6.365   1.00 24.82 ? 268 ASP A OD2  1 
ATOM   2348  H  H    . ASP A 1 237 ? 34.953  58.621  2.971   1.00 17.00 ? 268 ASP A H    1 
ATOM   2349  N  N    . THR A 1 238 ? 37.675  57.200  3.667   1.00 5.01  ? 269 THR A N    1 
ATOM   2350  C  CA   . THR A 1 238 ? 38.658  56.139  3.581   1.00 6.00  ? 269 THR A CA   1 
ATOM   2351  C  C    . THR A 1 238 ? 38.385  55.451  2.266   1.00 3.08  ? 269 THR A C    1 
ATOM   2352  O  O    . THR A 1 238 ? 37.505  54.616  2.212   1.00 4.26  ? 269 THR A O    1 
ATOM   2353  C  CB   . THR A 1 238 ? 38.413  55.127  4.719   1.00 8.61  ? 269 THR A CB   1 
ATOM   2354  O  OG1  . THR A 1 238 ? 37.062  54.655  4.662   1.00 7.37  ? 269 THR A OG1  1 
ATOM   2355  C  CG2  . THR A 1 238 ? 38.580  55.782  6.068   1.00 8.73  ? 269 THR A CG2  1 
ATOM   2356  H  H    . THR A 1 238 ? 36.801  56.940  3.996   1.00 17.00 ? 269 THR A H    1 
ATOM   2357  H  HG1  . THR A 1 238 ? 36.847  54.232  3.827   1.00 17.00 ? 269 THR A HG1  1 
ATOM   2358  N  N    . GLN A 1 239 ? 39.159  55.710  1.231   1.00 2.00  ? 270 GLN A N    1 
ATOM   2359  C  CA   . GLN A 1 239 ? 38.854  55.126  -0.068  1.00 4.53  ? 270 GLN A CA   1 
ATOM   2360  C  C    . GLN A 1 239 ? 38.593  53.627  -0.211  1.00 7.54  ? 270 GLN A C    1 
ATOM   2361  O  O    . GLN A 1 239 ? 38.581  53.115  -1.336  1.00 9.51  ? 270 GLN A O    1 
ATOM   2362  C  CB   . GLN A 1 239 ? 39.836  55.583  -1.138  1.00 2.31  ? 270 GLN A CB   1 
ATOM   2363  C  CG   . GLN A 1 239 ? 39.781  57.053  -1.457  1.00 12.12 ? 270 GLN A CG   1 
ATOM   2364  C  CD   . GLN A 1 239 ? 40.479  57.938  -0.417  1.00 15.77 ? 270 GLN A CD   1 
ATOM   2365  O  OE1  . GLN A 1 239 ? 41.006  57.454  0.584   1.00 19.80 ? 270 GLN A OE1  1 
ATOM   2366  N  NE2  . GLN A 1 239 ? 40.488  59.241  -0.663  1.00 16.44 ? 270 GLN A NE2  1 
ATOM   2367  H  H    . GLN A 1 239 ? 39.920  56.288  1.397   1.00 17.00 ? 270 GLN A H    1 
ATOM   2368  H  HE21 . GLN A 1 239 ? 40.919  59.790  0.021   1.00 17.00 ? 270 GLN A HE21 1 
ATOM   2369  H  HE22 . GLN A 1 239 ? 40.064  59.589  -1.470  1.00 17.00 ? 270 GLN A HE22 1 
ATOM   2370  N  N    . VAL A 1 240 ? 38.422  52.912  0.904   1.00 8.82  ? 271 VAL A N    1 
ATOM   2371  C  CA   . VAL A 1 240 ? 38.116  51.470  0.891   1.00 6.56  ? 271 VAL A CA   1 
ATOM   2372  C  C    . VAL A 1 240 ? 36.840  51.264  0.087   1.00 8.97  ? 271 VAL A C    1 
ATOM   2373  O  O    . VAL A 1 240 ? 35.786  51.783  0.452   1.00 11.66 ? 271 VAL A O    1 
ATOM   2374  C  CB   . VAL A 1 240 ? 37.879  50.938  2.300   1.00 2.00  ? 271 VAL A CB   1 
ATOM   2375  C  CG1  . VAL A 1 240 ? 37.093  51.931  3.078   1.00 2.00  ? 271 VAL A CG1  1 
ATOM   2376  C  CG2  . VAL A 1 240 ? 37.140  49.651  2.251   1.00 2.00  ? 271 VAL A CG2  1 
ATOM   2377  H  H    . VAL A 1 240 ? 38.582  53.285  1.776   1.00 17.00 ? 271 VAL A H    1 
ATOM   2378  N  N    . GLU A 1 241 ? 36.937  50.524  -1.010  1.00 8.44  ? 272 GLU A N    1 
ATOM   2379  C  CA   . GLU A 1 241 ? 35.789  50.284  -1.867  1.00 8.56  ? 272 GLU A CA   1 
ATOM   2380  C  C    . GLU A 1 241 ? 34.697  49.498  -1.180  1.00 8.48  ? 272 GLU A C    1 
ATOM   2381  O  O    . GLU A 1 241 ? 34.973  48.567  -0.416  1.00 12.81 ? 272 GLU A O    1 
ATOM   2382  C  CB   . GLU A 1 241 ? 36.229  49.550  -3.110  1.00 13.24 ? 272 GLU A CB   1 
ATOM   2383  C  CG   . GLU A 1 241 ? 35.836  50.231  -4.407  1.00 17.86 ? 272 GLU A CG   1 
ATOM   2384  C  CD   . GLU A 1 241 ? 36.193  49.385  -5.621  1.00 20.53 ? 272 GLU A CD   1 
ATOM   2385  O  OE1  . GLU A 1 241 ? 35.384  48.464  -5.968  1.00 21.81 ? 272 GLU A OE1  1 
ATOM   2386  O  OE2  . GLU A 1 241 ? 37.281  49.634  -6.200  1.00 17.65 ? 272 GLU A OE2  1 
ATOM   2387  H  H    . GLU A 1 241 ? 37.803  50.146  -1.244  1.00 17.00 ? 272 GLU A H    1 
ATOM   2388  N  N    . MET A 1 242 ? 33.456  49.857  -1.469  1.00 6.17  ? 273 MET A N    1 
ATOM   2389  C  CA   . MET A 1 242 ? 32.292  49.188  -0.880  1.00 4.85  ? 273 MET A CA   1 
ATOM   2390  C  C    . MET A 1 242 ? 31.273  48.861  -1.953  1.00 5.82  ? 273 MET A C    1 
ATOM   2391  O  O    . MET A 1 242 ? 31.520  49.096  -3.146  1.00 4.58  ? 273 MET A O    1 
ATOM   2392  C  CB   . MET A 1 242 ? 31.619  50.056  0.178   1.00 2.00  ? 273 MET A CB   1 
ATOM   2393  C  CG   . MET A 1 242 ? 32.162  49.873  1.559   1.00 2.00  ? 273 MET A CG   1 
ATOM   2394  S  SD   . MET A 1 242 ? 32.088  48.190  2.079   1.00 6.78  ? 273 MET A SD   1 
ATOM   2395  C  CE   . MET A 1 242 ? 31.206  48.312  3.606   1.00 2.00  ? 273 MET A CE   1 
ATOM   2396  H  H    . MET A 1 242 ? 33.302  50.567  -2.122  1.00 17.00 ? 273 MET A H    1 
ATOM   2397  N  N    . ILE A 1 243 ? 30.165  48.241  -1.542  1.00 8.01  ? 274 ILE A N    1 
ATOM   2398  C  CA   . ILE A 1 243 ? 29.080  47.932  -2.476  1.00 9.56  ? 274 ILE A CA   1 
ATOM   2399  C  C    . ILE A 1 243 ? 27.791  48.610  -1.983  1.00 9.28  ? 274 ILE A C    1 
ATOM   2400  O  O    . ILE A 1 243 ? 27.209  48.207  -0.959  1.00 7.45  ? 274 ILE A O    1 
ATOM   2401  C  CB   . ILE A 1 243 ? 28.824  46.431  -2.632  1.00 10.21 ? 274 ILE A CB   1 
ATOM   2402  C  CG1  . ILE A 1 243 ? 30.129  45.637  -2.561  1.00 10.29 ? 274 ILE A CG1  1 
ATOM   2403  C  CG2  . ILE A 1 243 ? 28.210  46.181  -4.007  1.00 10.79 ? 274 ILE A CG2  1 
ATOM   2404  C  CD1  . ILE A 1 243 ? 29.945  44.119  -2.561  1.00 9.07  ? 274 ILE A CD1  1 
ATOM   2405  H  H    . ILE A 1 243 ? 30.062  47.943  -0.611  1.00 17.00 ? 274 ILE A H    1 
ATOM   2406  N  N    . TYR A 1 244 ? 27.401  49.676  -2.693  1.00 9.47  ? 275 TYR A N    1 
ATOM   2407  C  CA   . TYR A 1 244 ? 26.214  50.492  -2.367  1.00 8.98  ? 275 TYR A CA   1 
ATOM   2408  C  C    . TYR A 1 244 ? 25.434  50.952  -3.612  1.00 8.71  ? 275 TYR A C    1 
ATOM   2409  O  O    . TYR A 1 244 ? 26.025  51.352  -4.626  1.00 8.79  ? 275 TYR A O    1 
ATOM   2410  C  CB   . TYR A 1 244 ? 26.616  51.756  -1.584  1.00 5.26  ? 275 TYR A CB   1 
ATOM   2411  C  CG   . TYR A 1 244 ? 26.972  51.554  -0.134  1.00 2.00  ? 275 TYR A CG   1 
ATOM   2412  C  CD1  . TYR A 1 244 ? 26.027  51.162  0.780   1.00 2.40  ? 275 TYR A CD1  1 
ATOM   2413  C  CD2  . TYR A 1 244 ? 28.232  51.818  0.323   1.00 2.00  ? 275 TYR A CD2  1 
ATOM   2414  C  CE1  . TYR A 1 244 ? 26.324  51.039  2.125   1.00 3.09  ? 275 TYR A CE1  1 
ATOM   2415  C  CE2  . TYR A 1 244 ? 28.541  51.701  1.663   1.00 5.36  ? 275 TYR A CE2  1 
ATOM   2416  C  CZ   . TYR A 1 244 ? 27.577  51.307  2.574   1.00 3.34  ? 275 TYR A CZ   1 
ATOM   2417  O  OH   . TYR A 1 244 ? 27.877  51.176  3.931   1.00 3.83  ? 275 TYR A OH   1 
ATOM   2418  H  H    . TYR A 1 244 ? 27.908  49.956  -3.486  1.00 17.00 ? 275 TYR A H    1 
ATOM   2419  H  HH   . TYR A 1 244 ? 28.845  51.140  4.024   1.00 17.00 ? 275 TYR A HH   1 
ATOM   2420  N  N    . PRO A 1 245 ? 24.089  50.940  -3.528  1.00 9.42  ? 276 PRO A N    1 
ATOM   2421  C  CA   . PRO A 1 245 ? 23.201  51.348  -4.620  1.00 8.79  ? 276 PRO A CA   1 
ATOM   2422  C  C    . PRO A 1 245 ? 23.484  52.792  -5.067  1.00 8.92  ? 276 PRO A C    1 
ATOM   2423  O  O    . PRO A 1 245 ? 23.505  53.717  -4.255  1.00 5.66  ? 276 PRO A O    1 
ATOM   2424  C  CB   . PRO A 1 245 ? 21.817  51.175  -3.997  1.00 7.94  ? 276 PRO A CB   1 
ATOM   2425  C  CG   . PRO A 1 245 ? 21.998  50.075  -3.035  1.00 4.79  ? 276 PRO A CG   1 
ATOM   2426  C  CD   . PRO A 1 245 ? 23.299  50.453  -2.385  1.00 9.23  ? 276 PRO A CD   1 
ATOM   2427  N  N    . PRO A 1 246 ? 23.634  52.996  -6.384  1.00 11.53 ? 277 PRO A N    1 
ATOM   2428  C  CA   . PRO A 1 246 ? 23.930  54.288  -7.029  1.00 11.71 ? 277 PRO A CA   1 
ATOM   2429  C  C    . PRO A 1 246 ? 22.917  55.380  -6.771  1.00 13.06 ? 277 PRO A C    1 
ATOM   2430  O  O    . PRO A 1 246 ? 22.304  55.902  -7.706  1.00 14.68 ? 277 PRO A O    1 
ATOM   2431  C  CB   . PRO A 1 246 ? 24.026  53.930  -8.523  1.00 9.49  ? 277 PRO A CB   1 
ATOM   2432  C  CG   . PRO A 1 246 ? 23.072  52.756  -8.633  1.00 11.70 ? 277 PRO A CG   1 
ATOM   2433  C  CD   . PRO A 1 246 ? 23.361  51.947  -7.389  1.00 11.21 ? 277 PRO A CD   1 
ATOM   2434  N  N    . HIS A 1 247 ? 22.761  55.742  -5.505  1.00 13.41 ? 278 HIS A N    1 
ATOM   2435  C  CA   . HIS A 1 247 ? 21.829  56.780  -5.097  1.00 14.85 ? 278 HIS A CA   1 
ATOM   2436  C  C    . HIS A 1 247 ? 22.057  56.997  -3.641  1.00 14.63 ? 278 HIS A C    1 
ATOM   2437  O  O    . HIS A 1 247 ? 21.661  58.020  -3.121  1.00 15.99 ? 278 HIS A O    1 
ATOM   2438  C  CB   . HIS A 1 247 ? 20.348  56.402  -5.344  1.00 20.54 ? 278 HIS A CB   1 
ATOM   2439  C  CG   . HIS A 1 247 ? 19.858  55.216  -4.557  1.00 22.38 ? 278 HIS A CG   1 
ATOM   2440  N  ND1  . HIS A 1 247 ? 19.646  53.981  -5.130  1.00 22.58 ? 278 HIS A ND1  1 
ATOM   2441  C  CD2  . HIS A 1 247 ? 19.492  55.091  -3.256  1.00 24.71 ? 278 HIS A CD2  1 
ATOM   2442  C  CE1  . HIS A 1 247 ? 19.170  53.147  -4.219  1.00 24.28 ? 278 HIS A CE1  1 
ATOM   2443  N  NE2  . HIS A 1 247 ? 19.067  53.795  -3.073  1.00 21.86 ? 278 HIS A NE2  1 
ATOM   2444  H  H    . HIS A 1 247 ? 23.382  55.400  -4.841  1.00 17.00 ? 278 HIS A H    1 
ATOM   2445  H  HD1  . HIS A 1 247 ? 19.796  53.764  -6.078  1.00 17.00 ? 278 HIS A HD1  1 
ATOM   2446  H  HE2  . HIS A 1 247 ? 18.748  53.411  -2.223  1.00 17.00 ? 278 HIS A HE2  1 
ATOM   2447  N  N    . ILE A 1 248 ? 22.580  55.980  -2.958  1.00 14.25 ? 279 ILE A N    1 
ATOM   2448  C  CA   . ILE A 1 248 ? 22.893  56.113  -1.539  1.00 14.30 ? 279 ILE A CA   1 
ATOM   2449  C  C    . ILE A 1 248 ? 23.724  57.427  -1.431  1.00 15.64 ? 279 ILE A C    1 
ATOM   2450  O  O    . ILE A 1 248 ? 24.710  57.613  -2.168  1.00 16.05 ? 279 ILE A O    1 
ATOM   2451  C  CB   . ILE A 1 248 ? 23.712  54.853  -1.015  1.00 12.05 ? 279 ILE A CB   1 
ATOM   2452  C  CG1  . ILE A 1 248 ? 22.778  53.815  -0.407  1.00 7.37  ? 279 ILE A CG1  1 
ATOM   2453  C  CG2  . ILE A 1 248 ? 24.794  55.253  0.014   1.00 10.94 ? 279 ILE A CG2  1 
ATOM   2454  C  CD1  . ILE A 1 248 ? 21.857  53.216  -1.351  1.00 2.00  ? 279 ILE A CD1  1 
ATOM   2455  H  H    . ILE A 1 248 ? 22.793  55.139  -3.385  1.00 17.00 ? 279 ILE A H    1 
ATOM   2456  N  N    . PRO A 1 249 ? 23.322  58.337  -0.519  1.00 14.59 ? 280 PRO A N    1 
ATOM   2457  C  CA   . PRO A 1 249 ? 23.884  59.653  -0.190  1.00 15.11 ? 280 PRO A CA   1 
ATOM   2458  C  C    . PRO A 1 249 ? 25.407  59.860  -0.112  1.00 16.93 ? 280 PRO A C    1 
ATOM   2459  O  O    . PRO A 1 249 ? 25.857  60.981  0.037   1.00 18.28 ? 280 PRO A O    1 
ATOM   2460  C  CB   . PRO A 1 249 ? 23.216  59.969  1.158   1.00 14.16 ? 280 PRO A CB   1 
ATOM   2461  C  CG   . PRO A 1 249 ? 22.769  58.618  1.676   1.00 12.75 ? 280 PRO A CG   1 
ATOM   2462  C  CD   . PRO A 1 249 ? 22.264  57.981  0.446   1.00 10.34 ? 280 PRO A CD   1 
ATOM   2463  N  N    . GLU A 1 250 ? 26.197  58.798  -0.189  1.00 19.49 ? 281 GLU A N    1 
ATOM   2464  C  CA   . GLU A 1 250 ? 27.669  58.887  -0.115  1.00 22.14 ? 281 GLU A CA   1 
ATOM   2465  C  C    . GLU A 1 250 ? 28.125  59.245  1.283   1.00 20.13 ? 281 GLU A C    1 
ATOM   2466  O  O    . GLU A 1 250 ? 29.336  59.352  1.541   1.00 19.53 ? 281 GLU A O    1 
ATOM   2467  C  CB   . GLU A 1 250 ? 28.305  59.804  -1.194  1.00 25.62 ? 281 GLU A CB   1 
ATOM   2468  C  CG   . GLU A 1 250 ? 28.058  59.320  -2.672  1.00 34.98 ? 281 GLU A CG   1 
ATOM   2469  C  CD   . GLU A 1 250 ? 28.884  60.067  -3.760  1.00 41.41 ? 281 GLU A CD   1 
ATOM   2470  O  OE1  . GLU A 1 250 ? 29.380  61.208  -3.485  1.00 44.27 ? 281 GLU A OE1  1 
ATOM   2471  O  OE2  . GLU A 1 250 ? 29.028  59.505  -4.897  1.00 41.09 ? 281 GLU A OE2  1 
ATOM   2472  H  H    . GLU A 1 250 ? 25.791  57.932  -0.373  1.00 17.00 ? 281 GLU A H    1 
ATOM   2473  N  N    . ASN A 1 251 ? 27.136  59.396  2.175   1.00 16.57 ? 282 ASN A N    1 
ATOM   2474  C  CA   . ASN A 1 251 ? 27.368  59.668  3.597   1.00 14.71 ? 282 ASN A CA   1 
ATOM   2475  C  C    . ASN A 1 251 ? 26.970  58.373  4.251   1.00 14.42 ? 282 ASN A C    1 
ATOM   2476  O  O    . ASN A 1 251 ? 27.270  58.178  5.430   1.00 16.41 ? 282 ASN A O    1 
ATOM   2477  C  CB   . ASN A 1 251 ? 26.436  60.715  4.204   1.00 13.10 ? 282 ASN A CB   1 
ATOM   2478  C  CG   . ASN A 1 251 ? 26.112  61.822  3.264   1.00 18.96 ? 282 ASN A CG   1 
ATOM   2479  O  OD1  . ASN A 1 251 ? 26.987  62.377  2.598   1.00 21.71 ? 282 ASN A OD1  1 
ATOM   2480  N  ND2  . ASN A 1 251 ? 24.839  62.171  3.204   1.00 19.44 ? 282 ASN A ND2  1 
ATOM   2481  H  H    . ASN A 1 251 ? 26.214  59.396  1.894   1.00 17.00 ? 282 ASN A H    1 
ATOM   2482  H  HD21 . ASN A 1 251 ? 24.645  62.878  2.553   1.00 17.00 ? 282 ASN A HD21 1 
ATOM   2483  H  HD22 . ASN A 1 251 ? 24.172  61.739  3.769   1.00 17.00 ? 282 ASN A HD22 1 
ATOM   2484  N  N    . LEU A 1 252 ? 26.168  57.561  3.547   1.00 11.95 ? 283 LEU A N    1 
ATOM   2485  C  CA   . LEU A 1 252 ? 25.764  56.275  4.116   1.00 12.68 ? 283 LEU A CA   1 
ATOM   2486  C  C    . LEU A 1 252 ? 26.997  55.464  4.065   1.00 10.93 ? 283 LEU A C    1 
ATOM   2487  O  O    . LEU A 1 252 ? 27.486  54.969  5.062   1.00 10.00 ? 283 LEU A O    1 
ATOM   2488  C  CB   . LEU A 1 252 ? 24.720  55.535  3.256   1.00 14.30 ? 283 LEU A CB   1 
ATOM   2489  C  CG   . LEU A 1 252 ? 24.587  53.981  3.370   1.00 11.84 ? 283 LEU A CG   1 
ATOM   2490  C  CD1  . LEU A 1 252 ? 24.689  53.402  4.802   1.00 14.37 ? 283 LEU A CD1  1 
ATOM   2491  C  CD2  . LEU A 1 252 ? 23.256  53.549  2.793   1.00 15.34 ? 283 LEU A CD2  1 
ATOM   2492  H  H    . LEU A 1 252 ? 25.868  57.826  2.667   1.00 17.00 ? 283 LEU A H    1 
ATOM   2493  N  N    . GLN A 1 253 ? 27.423  55.304  2.828   1.00 10.18 ? 284 GLN A N    1 
ATOM   2494  C  CA   . GLN A 1 253 ? 28.585  54.551  2.449   1.00 11.42 ? 284 GLN A CA   1 
ATOM   2495  C  C    . GLN A 1 253 ? 29.601  54.271  3.578   1.00 9.93  ? 284 GLN A C    1 
ATOM   2496  O  O    . GLN A 1 253 ? 30.645  54.934  3.673   1.00 12.51 ? 284 GLN A O    1 
ATOM   2497  C  CB   . GLN A 1 253 ? 29.206  55.256  1.226   1.00 12.81 ? 284 GLN A CB   1 
ATOM   2498  C  CG   . GLN A 1 253 ? 28.178  55.625  0.152   1.00 9.40  ? 284 GLN A CG   1 
ATOM   2499  C  CD   . GLN A 1 253 ? 28.674  55.377  -1.266  1.00 13.29 ? 284 GLN A CD   1 
ATOM   2500  O  OE1  . GLN A 1 253 ? 29.196  54.292  -1.580  1.00 15.49 ? 284 GLN A OE1  1 
ATOM   2501  N  NE2  . GLN A 1 253 ? 28.474  56.361  -2.147  1.00 13.74 ? 284 GLN A NE2  1 
ATOM   2502  H  H    . GLN A 1 253 ? 26.899  55.733  2.140   1.00 17.00 ? 284 GLN A H    1 
ATOM   2503  H  HE21 . GLN A 1 253 ? 28.789  56.213  -3.061  1.00 17.00 ? 284 GLN A HE21 1 
ATOM   2504  H  HE22 . GLN A 1 253 ? 28.023  57.159  -1.844  1.00 17.00 ? 284 GLN A HE22 1 
ATOM   2505  N  N    . PHE A 1 254 ? 29.261  53.340  4.463   1.00 6.36  ? 285 PHE A N    1 
ATOM   2506  C  CA   . PHE A 1 254 ? 30.135  53.004  5.574   1.00 6.05  ? 285 PHE A CA   1 
ATOM   2507  C  C    . PHE A 1 254 ? 31.212  52.037  5.085   1.00 6.98  ? 285 PHE A C    1 
ATOM   2508  O  O    . PHE A 1 254 ? 30.982  51.276  4.133   1.00 5.27  ? 285 PHE A O    1 
ATOM   2509  C  CB   . PHE A 1 254 ? 29.337  52.450  6.764   1.00 4.74  ? 285 PHE A CB   1 
ATOM   2510  C  CG   . PHE A 1 254 ? 28.519  53.491  7.498   1.00 3.08  ? 285 PHE A CG   1 
ATOM   2511  C  CD1  . PHE A 1 254 ? 28.919  54.812  7.539   1.00 4.22  ? 285 PHE A CD1  1 
ATOM   2512  C  CD2  . PHE A 1 254 ? 27.345  53.142  8.140   1.00 5.15  ? 285 PHE A CD2  1 
ATOM   2513  C  CE1  . PHE A 1 254 ? 28.155  55.775  8.207   1.00 6.22  ? 285 PHE A CE1  1 
ATOM   2514  C  CE2  . PHE A 1 254 ? 26.572  54.105  8.817   1.00 6.20  ? 285 PHE A CE2  1 
ATOM   2515  C  CZ   . PHE A 1 254 ? 26.978  55.418  8.848   1.00 4.49  ? 285 PHE A CZ   1 
ATOM   2516  H  H    . PHE A 1 254 ? 28.373  52.939  4.415   1.00 17.00 ? 285 PHE A H    1 
ATOM   2517  N  N    . ALA A 1 255 ? 32.385  52.090  5.730   1.00 7.71  ? 286 ALA A N    1 
ATOM   2518  C  CA   . ALA A 1 255 ? 33.548  51.291  5.364   1.00 5.01  ? 286 ALA A CA   1 
ATOM   2519  C  C    . ALA A 1 255 ? 33.663  49.878  5.946   1.00 6.95  ? 286 ALA A C    1 
ATOM   2520  O  O    . ALA A 1 255 ? 33.932  48.921  5.204   1.00 9.24  ? 286 ALA A O    1 
ATOM   2521  C  CB   . ALA A 1 255 ? 34.765  52.069  5.653   1.00 4.70  ? 286 ALA A CB   1 
ATOM   2522  H  H    . ALA A 1 255 ? 32.461  52.743  6.457   1.00 17.00 ? 286 ALA A H    1 
ATOM   2523  N  N    . VAL A 1 256 ? 33.595  49.747  7.268   1.00 6.40  ? 287 VAL A N    1 
ATOM   2524  C  CA   . VAL A 1 256 ? 33.636  48.428  7.947   1.00 8.44  ? 287 VAL A CA   1 
ATOM   2525  C  C    . VAL A 1 256 ? 34.625  47.268  7.638   1.00 7.62  ? 287 VAL A C    1 
ATOM   2526  O  O    . VAL A 1 256 ? 35.182  46.705  8.583   1.00 6.75  ? 287 VAL A O    1 
ATOM   2527  C  CB   . VAL A 1 256 ? 32.195  47.792  8.081   1.00 9.47  ? 287 VAL A CB   1 
ATOM   2528  C  CG1  . VAL A 1 256 ? 31.253  48.784  8.740   1.00 11.08 ? 287 VAL A CG1  1 
ATOM   2529  C  CG2  . VAL A 1 256 ? 31.634  47.333  6.717   1.00 7.81  ? 287 VAL A CG2  1 
ATOM   2530  H  H    . VAL A 1 256 ? 33.529  50.551  7.818   1.00 17.00 ? 287 VAL A H    1 
ATOM   2531  N  N    . GLY A 1 257 ? 34.757  46.824  6.382   1.00 5.58  ? 288 GLY A N    1 
ATOM   2532  C  CA   . GLY A 1 257 ? 35.689  45.739  6.118   1.00 5.55  ? 288 GLY A CA   1 
ATOM   2533  C  C    . GLY A 1 257 ? 35.250  44.750  5.053   1.00 6.50  ? 288 GLY A C    1 
ATOM   2534  O  O    . GLY A 1 257 ? 35.949  44.567  4.040   1.00 8.51  ? 288 GLY A O    1 
ATOM   2535  H  H    . GLY A 1 257 ? 34.238  47.179  5.638   1.00 17.00 ? 288 GLY A H    1 
ATOM   2536  N  N    . GLN A 1 258 ? 34.137  44.057  5.297   1.00 4.81  ? 289 GLN A N    1 
ATOM   2537  C  CA   . GLN A 1 258 ? 33.589  43.086  4.329   1.00 5.28  ? 289 GLN A CA   1 
ATOM   2538  C  C    . GLN A 1 258 ? 32.686  43.876  3.358   1.00 3.69  ? 289 GLN A C    1 
ATOM   2539  O  O    . GLN A 1 258 ? 31.568  44.201  3.693   1.00 2.15  ? 289 GLN A O    1 
ATOM   2540  C  CB   . GLN A 1 258 ? 32.771  42.014  5.073   1.00 3.59  ? 289 GLN A CB   1 
ATOM   2541  C  CG   . GLN A 1 258 ? 32.931  40.595  4.549   1.00 2.00  ? 289 GLN A CG   1 
ATOM   2542  C  CD   . GLN A 1 258 ? 32.122  40.352  3.311   1.00 2.00  ? 289 GLN A CD   1 
ATOM   2543  O  OE1  . GLN A 1 258 ? 31.992  41.218  2.452   1.00 2.02  ? 289 GLN A OE1  1 
ATOM   2544  N  NE2  . GLN A 1 258 ? 31.574  39.163  3.202   1.00 3.19  ? 289 GLN A NE2  1 
ATOM   2545  H  H    . GLN A 1 258 ? 33.699  44.195  6.161   1.00 17.00 ? 289 GLN A H    1 
ATOM   2546  H  HE21 . GLN A 1 258 ? 31.031  38.918  2.430   1.00 17.00 ? 289 GLN A HE21 1 
ATOM   2547  H  HE22 . GLN A 1 258 ? 31.769  38.567  3.935   1.00 17.00 ? 289 GLN A HE22 1 
ATOM   2548  N  N    . GLU A 1 259 ? 33.155  44.102  2.137   1.00 4.59  ? 290 GLU A N    1 
ATOM   2549  C  CA   . GLU A 1 259 ? 32.452  44.899  1.126   1.00 4.76  ? 290 GLU A CA   1 
ATOM   2550  C  C    . GLU A 1 259 ? 30.945  44.775  0.902   1.00 4.93  ? 290 GLU A C    1 
ATOM   2551  O  O    . GLU A 1 259 ? 30.324  45.703  0.371   1.00 3.91  ? 290 GLU A O    1 
ATOM   2552  C  CB   . GLU A 1 259 ? 33.167  44.763  -0.223  1.00 9.93  ? 290 GLU A CB   1 
ATOM   2553  C  CG   . GLU A 1 259 ? 33.243  46.076  -1.000  1.00 16.25 ? 290 GLU A CG   1 
ATOM   2554  C  CD   . GLU A 1 259 ? 33.910  45.965  -2.371  1.00 20.60 ? 290 GLU A CD   1 
ATOM   2555  O  OE1  . GLU A 1 259 ? 33.586  45.013  -3.119  1.00 26.19 ? 290 GLU A OE1  1 
ATOM   2556  O  OE2  . GLU A 1 259 ? 34.734  46.843  -2.713  1.00 19.40 ? 290 GLU A OE2  1 
ATOM   2557  H  H    . GLU A 1 259 ? 34.030  43.722  1.925   1.00 17.00 ? 290 GLU A H    1 
ATOM   2558  N  N    . VAL A 1 260 ? 30.355  43.636  1.261   1.00 6.23  ? 291 VAL A N    1 
ATOM   2559  C  CA   . VAL A 1 260 ? 28.919  43.413  1.066   1.00 2.01  ? 291 VAL A CA   1 
ATOM   2560  C  C    . VAL A 1 260 ? 28.104  43.950  2.236   1.00 2.00  ? 291 VAL A C    1 
ATOM   2561  O  O    . VAL A 1 260 ? 27.117  44.600  2.011   1.00 2.00  ? 291 VAL A O    1 
ATOM   2562  C  CB   . VAL A 1 260 ? 28.613  41.916  0.783   1.00 2.16  ? 291 VAL A CB   1 
ATOM   2563  C  CG1  . VAL A 1 260 ? 28.475  41.135  2.077   1.00 2.92  ? 291 VAL A CG1  1 
ATOM   2564  C  CG2  . VAL A 1 260 ? 27.389  41.779  -0.077  1.00 2.00  ? 291 VAL A CG2  1 
ATOM   2565  H  H    . VAL A 1 260 ? 30.895  42.928  1.673   1.00 17.00 ? 291 VAL A H    1 
ATOM   2566  N  N    . PHE A 1 261 ? 28.595  43.785  3.465   1.00 2.00  ? 292 PHE A N    1 
ATOM   2567  C  CA   . PHE A 1 261 ? 27.932  44.251  4.704   1.00 2.12  ? 292 PHE A CA   1 
ATOM   2568  C  C    . PHE A 1 261 ? 27.181  45.586  4.726   1.00 4.04  ? 292 PHE A C    1 
ATOM   2569  O  O    . PHE A 1 261 ? 26.576  45.919  5.759   1.00 2.86  ? 292 PHE A O    1 
ATOM   2570  C  CB   . PHE A 1 261 ? 28.902  44.289  5.887   1.00 2.00  ? 292 PHE A CB   1 
ATOM   2571  C  CG   . PHE A 1 261 ? 29.352  42.960  6.331   1.00 2.78  ? 292 PHE A CG   1 
ATOM   2572  C  CD1  . PHE A 1 261 ? 29.077  41.821  5.571   1.00 2.00  ? 292 PHE A CD1  1 
ATOM   2573  C  CD2  . PHE A 1 261 ? 30.050  42.825  7.523   1.00 3.77  ? 292 PHE A CD2  1 
ATOM   2574  C  CE1  . PHE A 1 261 ? 29.489  40.581  5.997   1.00 2.00  ? 292 PHE A CE1  1 
ATOM   2575  C  CE2  . PHE A 1 261 ? 30.474  41.569  7.956   1.00 2.21  ? 292 PHE A CE2  1 
ATOM   2576  C  CZ   . PHE A 1 261 ? 30.193  40.453  7.193   1.00 2.12  ? 292 PHE A CZ   1 
ATOM   2577  H  H    . PHE A 1 261 ? 29.476  43.369  3.552   1.00 17.00 ? 292 PHE A H    1 
ATOM   2578  N  N    . GLY A 1 262 ? 27.283  46.388  3.668   1.00 3.51  ? 293 GLY A N    1 
ATOM   2579  C  CA   . GLY A 1 262 ? 26.564  47.649  3.646   1.00 4.36  ? 293 GLY A CA   1 
ATOM   2580  C  C    . GLY A 1 262 ? 25.155  47.476  3.098   1.00 5.44  ? 293 GLY A C    1 
ATOM   2581  O  O    . GLY A 1 262 ? 24.281  48.321  3.253   1.00 6.21  ? 293 GLY A O    1 
ATOM   2582  H  H    . GLY A 1 262 ? 27.844  46.166  2.904   1.00 17.00 ? 293 GLY A H    1 
ATOM   2583  N  N    . LEU A 1 263 ? 24.916  46.323  2.507   1.00 5.41  ? 294 LEU A N    1 
ATOM   2584  C  CA   . LEU A 1 263 ? 23.633  46.020  1.905   1.00 6.65  ? 294 LEU A CA   1 
ATOM   2585  C  C    . LEU A 1 263 ? 22.503  45.593  2.834   1.00 7.01  ? 294 LEU A C    1 
ATOM   2586  O  O    . LEU A 1 263 ? 21.402  45.318  2.350   1.00 7.62  ? 294 LEU A O    1 
ATOM   2587  C  CB   . LEU A 1 263 ? 23.828  45.010  0.767   1.00 7.25  ? 294 LEU A CB   1 
ATOM   2588  C  CG   . LEU A 1 263 ? 24.886  45.495  -0.252  1.00 7.31  ? 294 LEU A CG   1 
ATOM   2589  C  CD1  . LEU A 1 263 ? 25.466  44.349  -1.067  1.00 2.70  ? 294 LEU A CD1  1 
ATOM   2590  C  CD2  . LEU A 1 263 ? 24.341  46.630  -1.152  1.00 5.35  ? 294 LEU A CD2  1 
ATOM   2591  H  H    . LEU A 1 263 ? 25.629  45.660  2.452   1.00 17.00 ? 294 LEU A H    1 
ATOM   2592  N  N    . VAL A 1 264 ? 22.757  45.559  4.147   1.00 5.61  ? 295 VAL A N    1 
ATOM   2593  C  CA   . VAL A 1 264 ? 21.733  45.214  5.166   1.00 5.09  ? 295 VAL A CA   1 
ATOM   2594  C  C    . VAL A 1 264 ? 22.116  45.851  6.499   1.00 5.39  ? 295 VAL A C    1 
ATOM   2595  O  O    . VAL A 1 264 ? 23.125  45.473  7.098   1.00 9.80  ? 295 VAL A O    1 
ATOM   2596  C  CB   . VAL A 1 264 ? 21.592  43.679  5.405   1.00 2.63  ? 295 VAL A CB   1 
ATOM   2597  C  CG1  . VAL A 1 264 ? 20.644  43.402  6.544   1.00 2.00  ? 295 VAL A CG1  1 
ATOM   2598  C  CG2  . VAL A 1 264 ? 21.087  43.004  4.171   1.00 3.82  ? 295 VAL A CG2  1 
ATOM   2599  H  H    . VAL A 1 264 ? 23.656  45.779  4.465   1.00 17.00 ? 295 VAL A H    1 
ATOM   2600  N  N    . PRO A 1 265 ? 21.272  46.731  7.038   1.00 2.71  ? 296 PRO A N    1 
ATOM   2601  C  CA   . PRO A 1 265 ? 21.501  47.433  8.310   1.00 2.21  ? 296 PRO A CA   1 
ATOM   2602  C  C    . PRO A 1 265 ? 21.829  46.569  9.511   1.00 2.00  ? 296 PRO A C    1 
ATOM   2603  O  O    . PRO A 1 265 ? 22.377  47.052  10.482  1.00 2.00  ? 296 PRO A O    1 
ATOM   2604  C  CB   . PRO A 1 265 ? 20.205  48.191  8.518   1.00 3.39  ? 296 PRO A CB   1 
ATOM   2605  C  CG   . PRO A 1 265 ? 19.757  48.464  7.101   1.00 3.93  ? 296 PRO A CG   1 
ATOM   2606  C  CD   . PRO A 1 265 ? 20.000  47.138  6.440   1.00 3.56  ? 296 PRO A CD   1 
ATOM   2607  N  N    . GLY A 1 266 ? 21.427  45.310  9.488   1.00 2.00  ? 297 GLY A N    1 
ATOM   2608  C  CA   . GLY A 1 266 ? 21.748  44.428  10.599  1.00 2.02  ? 297 GLY A CA   1 
ATOM   2609  C  C    . GLY A 1 266 ? 23.242  44.155  10.555  1.00 3.63  ? 297 GLY A C    1 
ATOM   2610  O  O    . GLY A 1 266 ? 23.929  44.242  11.575  1.00 5.44  ? 297 GLY A O    1 
ATOM   2611  H  H    . GLY A 1 266 ? 20.897  44.994  8.735   1.00 17.00 ? 297 GLY A H    1 
ATOM   2612  N  N    . LEU A 1 267 ? 23.741  43.834  9.362   1.00 2.00  ? 298 LEU A N    1 
ATOM   2613  C  CA   . LEU A 1 267 ? 25.148  43.582  9.158   1.00 2.00  ? 298 LEU A CA   1 
ATOM   2614  C  C    . LEU A 1 267 ? 25.875  44.831  9.659   1.00 2.00  ? 298 LEU A C    1 
ATOM   2615  O  O    . LEU A 1 267 ? 26.529  44.789  10.695  1.00 2.00  ? 298 LEU A O    1 
ATOM   2616  C  CB   . LEU A 1 267 ? 25.399  43.327  7.670   1.00 2.00  ? 298 LEU A CB   1 
ATOM   2617  C  CG   . LEU A 1 267 ? 25.581  41.886  7.123   1.00 2.00  ? 298 LEU A CG   1 
ATOM   2618  C  CD1  . LEU A 1 267 ? 25.277  40.821  8.137   1.00 2.00  ? 298 LEU A CD1  1 
ATOM   2619  C  CD2  . LEU A 1 267 ? 24.792  41.689  5.855   1.00 2.00  ? 298 LEU A CD2  1 
ATOM   2620  H  H    . LEU A 1 267 ? 23.144  43.809  8.588   1.00 17.00 ? 298 LEU A H    1 
ATOM   2621  N  N    . MET A 1 268 ? 25.638  45.965  9.004   1.00 2.00  ? 299 MET A N    1 
ATOM   2622  C  CA   . MET A 1 268 ? 26.236  47.243  9.383   1.00 2.00  ? 299 MET A CA   1 
ATOM   2623  C  C    . MET A 1 268 ? 26.163  47.595  10.864  1.00 2.00  ? 299 MET A C    1 
ATOM   2624  O  O    . MET A 1 268 ? 26.955  48.389  11.352  1.00 2.00  ? 299 MET A O    1 
ATOM   2625  C  CB   . MET A 1 268 ? 25.599  48.357  8.594   1.00 2.00  ? 299 MET A CB   1 
ATOM   2626  C  CG   . MET A 1 268 ? 26.403  49.619  8.671   1.00 6.09  ? 299 MET A CG   1 
ATOM   2627  S  SD   . MET A 1 268 ? 28.065  49.321  7.981   1.00 7.88  ? 299 MET A SD   1 
ATOM   2628  C  CE   . MET A 1 268 ? 27.725  49.030  6.352   1.00 2.00  ? 299 MET A CE   1 
ATOM   2629  H  H    . MET A 1 268 ? 25.056  45.934  8.216   1.00 17.00 ? 299 MET A H    1 
ATOM   2630  N  N    . MET A 1 269 ? 25.168  47.058  11.562  1.00 4.57  ? 300 MET A N    1 
ATOM   2631  C  CA   . MET A 1 269 ? 24.997  47.283  12.998  1.00 4.35  ? 300 MET A CA   1 
ATOM   2632  C  C    . MET A 1 269 ? 26.100  46.515  13.722  1.00 4.23  ? 300 MET A C    1 
ATOM   2633  O  O    . MET A 1 269 ? 26.794  47.089  14.563  1.00 3.74  ? 300 MET A O    1 
ATOM   2634  C  CB   . MET A 1 269 ? 23.608  46.808  13.463  1.00 3.85  ? 300 MET A CB   1 
ATOM   2635  C  CG   . MET A 1 269 ? 23.399  46.757  14.974  1.00 3.54  ? 300 MET A CG   1 
ATOM   2636  S  SD   . MET A 1 269 ? 22.739  45.112  15.509  1.00 2.97  ? 300 MET A SD   1 
ATOM   2637  C  CE   . MET A 1 269 ? 22.767  45.271  17.315  1.00 2.00  ? 300 MET A CE   1 
ATOM   2638  H  H    . MET A 1 269 ? 24.498  46.490  11.124  1.00 17.00 ? 300 MET A H    1 
ATOM   2639  N  N    . TYR A 1 270 ? 26.302  45.251  13.335  1.00 3.70  ? 301 TYR A N    1 
ATOM   2640  C  CA   . TYR A 1 270 ? 27.315  44.389  13.939  1.00 2.89  ? 301 TYR A CA   1 
ATOM   2641  C  C    . TYR A 1 270 ? 28.752  44.814  13.660  1.00 4.30  ? 301 TYR A C    1 
ATOM   2642  O  O    . TYR A 1 270 ? 29.624  44.637  14.505  1.00 2.77  ? 301 TYR A O    1 
ATOM   2643  C  CB   . TYR A 1 270 ? 27.100  42.943  13.520  1.00 2.00  ? 301 TYR A CB   1 
ATOM   2644  C  CG   . TYR A 1 270 ? 26.414  42.111  14.568  1.00 2.00  ? 301 TYR A CG   1 
ATOM   2645  C  CD1  . TYR A 1 270 ? 26.732  42.240  15.917  1.00 2.00  ? 301 TYR A CD1  1 
ATOM   2646  C  CD2  . TYR A 1 270 ? 25.456  41.169  14.210  1.00 2.80  ? 301 TYR A CD2  1 
ATOM   2647  C  CE1  . TYR A 1 270 ? 26.097  41.438  16.879  1.00 3.54  ? 301 TYR A CE1  1 
ATOM   2648  C  CE2  . TYR A 1 270 ? 24.827  40.367  15.160  1.00 2.00  ? 301 TYR A CE2  1 
ATOM   2649  C  CZ   . TYR A 1 270 ? 25.143  40.501  16.478  1.00 2.00  ? 301 TYR A CZ   1 
ATOM   2650  O  OH   . TYR A 1 270 ? 24.506  39.690  17.374  1.00 2.15  ? 301 TYR A OH   1 
ATOM   2651  H  H    . TYR A 1 270 ? 25.734  44.890  12.613  1.00 17.00 ? 301 TYR A H    1 
ATOM   2652  H  HH   . TYR A 1 270 ? 23.801  39.202  16.926  1.00 17.00 ? 301 TYR A HH   1 
ATOM   2653  N  N    . ALA A 1 271 ? 29.005  45.352  12.466  1.00 5.40  ? 302 ALA A N    1 
ATOM   2654  C  CA   . ALA A 1 271 ? 30.337  45.833  12.110  1.00 3.56  ? 302 ALA A CA   1 
ATOM   2655  C  C    . ALA A 1 271 ? 30.622  47.006  13.036  1.00 3.65  ? 302 ALA A C    1 
ATOM   2656  O  O    . ALA A 1 271 ? 31.685  47.094  13.621  1.00 5.96  ? 302 ALA A O    1 
ATOM   2657  C  CB   . ALA A 1 271 ? 30.379  46.290  10.674  1.00 2.00  ? 302 ALA A CB   1 
ATOM   2658  H  H    . ALA A 1 271 ? 28.259  45.426  11.829  1.00 17.00 ? 302 ALA A H    1 
ATOM   2659  N  N    . THR A 1 272 ? 29.646  47.877  13.216  1.00 2.62  ? 303 THR A N    1 
ATOM   2660  C  CA   . THR A 1 272 ? 29.842  49.010  14.089  1.00 3.01  ? 303 THR A CA   1 
ATOM   2661  C  C    . THR A 1 272 ? 30.117  48.518  15.507  1.00 2.35  ? 303 THR A C    1 
ATOM   2662  O  O    . THR A 1 272 ? 30.869  49.135  16.257  1.00 2.00  ? 303 THR A O    1 
ATOM   2663  C  CB   . THR A 1 272 ? 28.632  49.995  14.026  1.00 4.84  ? 303 THR A CB   1 
ATOM   2664  O  OG1  . THR A 1 272 ? 28.446  50.453  12.667  1.00 2.64  ? 303 THR A OG1  1 
ATOM   2665  C  CG2  . THR A 1 272 ? 28.892  51.210  14.934  1.00 2.97  ? 303 THR A CG2  1 
ATOM   2666  H  H    . THR A 1 272 ? 28.785  47.785  12.761  1.00 17.00 ? 303 THR A H    1 
ATOM   2667  H  HG1  . THR A 1 272 ? 28.092  49.739  12.121  1.00 17.00 ? 303 THR A HG1  1 
ATOM   2668  N  N    . ILE A 1 273 ? 29.587  47.349  15.835  1.00 4.53  ? 304 ILE A N    1 
ATOM   2669  C  CA   . ILE A 1 273 ? 29.796  46.780  17.170  1.00 6.53  ? 304 ILE A CA   1 
ATOM   2670  C  C    . ILE A 1 273 ? 31.285  46.545  17.305  1.00 6.19  ? 304 ILE A C    1 
ATOM   2671  O  O    . ILE A 1 273 ? 31.961  47.245  18.057  1.00 7.21  ? 304 ILE A O    1 
ATOM   2672  C  CB   . ILE A 1 273 ? 29.079  45.372  17.384  1.00 7.88  ? 304 ILE A CB   1 
ATOM   2673  C  CG1  . ILE A 1 273 ? 27.541  45.473  17.254  1.00 5.24  ? 304 ILE A CG1  1 
ATOM   2674  C  CG2  . ILE A 1 273 ? 29.475  44.798  18.774  1.00 6.22  ? 304 ILE A CG2  1 
ATOM   2675  C  CD1  . ILE A 1 273 ? 26.889  46.356  18.323  1.00 5.47  ? 304 ILE A CD1  1 
ATOM   2676  H  H    . ILE A 1 273 ? 29.033  46.871  15.188  1.00 17.00 ? 304 ILE A H    1 
ATOM   2677  N  N    . TRP A 1 274 ? 31.771  45.581  16.517  1.00 6.29  ? 305 TRP A N    1 
ATOM   2678  C  CA   . TRP A 1 274 ? 33.168  45.166  16.473  1.00 2.91  ? 305 TRP A CA   1 
ATOM   2679  C  C    . TRP A 1 274 ? 34.149  46.313  16.293  1.00 2.33  ? 305 TRP A C    1 
ATOM   2680  O  O    . TRP A 1 274 ? 35.142  46.368  17.006  1.00 3.41  ? 305 TRP A O    1 
ATOM   2681  C  CB   . TRP A 1 274 ? 33.358  44.124  15.372  1.00 2.70  ? 305 TRP A CB   1 
ATOM   2682  C  CG   . TRP A 1 274 ? 32.604  42.835  15.623  1.00 4.76  ? 305 TRP A CG   1 
ATOM   2683  C  CD1  . TRP A 1 274 ? 31.509  42.374  14.935  1.00 5.10  ? 305 TRP A CD1  1 
ATOM   2684  C  CD2  . TRP A 1 274 ? 32.902  41.827  16.615  1.00 5.26  ? 305 TRP A CD2  1 
ATOM   2685  N  NE1  . TRP A 1 274 ? 31.111  41.144  15.432  1.00 4.66  ? 305 TRP A NE1  1 
ATOM   2686  C  CE2  . TRP A 1 274 ? 31.953  40.787  16.457  1.00 5.43  ? 305 TRP A CE2  1 
ATOM   2687  C  CE3  . TRP A 1 274 ? 33.880  41.702  17.615  1.00 4.21  ? 305 TRP A CE3  1 
ATOM   2688  C  CZ2  . TRP A 1 274 ? 31.961  39.652  17.251  1.00 3.41  ? 305 TRP A CZ2  1 
ATOM   2689  C  CZ3  . TRP A 1 274 ? 33.881  40.575  18.403  1.00 2.01  ? 305 TRP A CZ3  1 
ATOM   2690  C  CH2  . TRP A 1 274 ? 32.933  39.568  18.217  1.00 3.71  ? 305 TRP A CH2  1 
ATOM   2691  H  H    . TRP A 1 274 ? 31.146  45.137  15.907  1.00 17.00 ? 305 TRP A H    1 
ATOM   2692  H  HE1  . TRP A 1 274 ? 30.302  40.643  15.212  1.00 17.00 ? 305 TRP A HE1  1 
ATOM   2693  N  N    . LEU A 1 275 ? 33.897  47.210  15.339  1.00 2.27  ? 306 LEU A N    1 
ATOM   2694  C  CA   . LEU A 1 275 ? 34.768  48.368  15.120  1.00 2.00  ? 306 LEU A CA   1 
ATOM   2695  C  C    . LEU A 1 275 ? 35.039  48.999  16.454  1.00 2.00  ? 306 LEU A C    1 
ATOM   2696  O  O    . LEU A 1 275 ? 36.166  49.291  16.799  1.00 2.01  ? 306 LEU A O    1 
ATOM   2697  C  CB   . LEU A 1 275 ? 34.091  49.417  14.246  1.00 3.46  ? 306 LEU A CB   1 
ATOM   2698  C  CG   . LEU A 1 275 ? 34.675  50.845  14.231  1.00 3.25  ? 306 LEU A CG   1 
ATOM   2699  C  CD1  . LEU A 1 275 ? 35.894  50.962  13.339  1.00 2.85  ? 306 LEU A CD1  1 
ATOM   2700  C  CD2  . LEU A 1 275 ? 33.635  51.771  13.699  1.00 2.00  ? 306 LEU A CD2  1 
ATOM   2701  H  H    . LEU A 1 275 ? 33.107  47.088  14.785  1.00 17.00 ? 306 LEU A H    1 
ATOM   2702  N  N    . ARG A 1 276 ? 33.987  49.194  17.215  1.00 2.19  ? 307 ARG A N    1 
ATOM   2703  C  CA   . ARG A 1 276 ? 34.143  49.772  18.525  1.00 5.81  ? 307 ARG A CA   1 
ATOM   2704  C  C    . ARG A 1 276 ? 34.881  48.816  19.465  1.00 6.36  ? 307 ARG A C    1 
ATOM   2705  O  O    . ARG A 1 276 ? 35.759  49.253  20.203  1.00 7.50  ? 307 ARG A O    1 
ATOM   2706  C  CB   . ARG A 1 276 ? 32.779  50.168  19.065  1.00 8.94  ? 307 ARG A CB   1 
ATOM   2707  C  CG   . ARG A 1 276 ? 32.037  51.105  18.121  1.00 9.15  ? 307 ARG A CG   1 
ATOM   2708  C  CD   . ARG A 1 276 ? 30.550  51.061  18.381  1.00 9.94  ? 307 ARG A CD   1 
ATOM   2709  N  NE   . ARG A 1 276 ? 30.101  52.173  19.205  1.00 7.48  ? 307 ARG A NE   1 
ATOM   2710  C  CZ   . ARG A 1 276 ? 28.972  52.814  18.979  1.00 5.34  ? 307 ARG A CZ   1 
ATOM   2711  N  NH1  . ARG A 1 276 ? 28.201  52.430  17.966  1.00 3.57  ? 307 ARG A NH1  1 
ATOM   2712  N  NH2  . ARG A 1 276 ? 28.645  53.846  19.739  1.00 5.78  ? 307 ARG A NH2  1 
ATOM   2713  H  H    . ARG A 1 276 ? 33.082  48.938  16.932  1.00 17.00 ? 307 ARG A H    1 
ATOM   2714  H  HE   . ARG A 1 276 ? 30.661  52.456  19.958  1.00 17.00 ? 307 ARG A HE   1 
ATOM   2715  H  HH11 . ARG A 1 276 ? 28.460  51.668  17.377  1.00 17.00 ? 307 ARG A HH11 1 
ATOM   2716  H  HH12 . ARG A 1 276 ? 27.342  52.916  17.796  1.00 17.00 ? 307 ARG A HH12 1 
ATOM   2717  H  HH21 . ARG A 1 276 ? 29.253  54.130  20.480  1.00 17.00 ? 307 ARG A HH21 1 
ATOM   2718  H  HH22 . ARG A 1 276 ? 27.789  54.340  19.584  1.00 17.00 ? 307 ARG A HH22 1 
ATOM   2719  N  N    . GLU A 1 277 ? 34.579  47.515  19.415  1.00 8.46  ? 308 GLU A N    1 
ATOM   2720  C  CA   . GLU A 1 277 ? 35.287  46.560  20.272  1.00 9.48  ? 308 GLU A CA   1 
ATOM   2721  C  C    . GLU A 1 277 ? 36.785  46.704  20.083  1.00 9.32  ? 308 GLU A C    1 
ATOM   2722  O  O    . GLU A 1 277 ? 37.497  46.838  21.073  1.00 13.06 ? 308 GLU A O    1 
ATOM   2723  C  CB   . GLU A 1 277 ? 34.880  45.085  20.056  1.00 6.42  ? 308 GLU A CB   1 
ATOM   2724  C  CG   . GLU A 1 277 ? 35.538  44.106  21.082  1.00 5.22  ? 308 GLU A CG   1 
ATOM   2725  C  CD   . GLU A 1 277 ? 35.235  44.429  22.581  1.00 7.81  ? 308 GLU A CD   1 
ATOM   2726  O  OE1  . GLU A 1 277 ? 35.153  45.633  22.966  1.00 7.83  ? 308 GLU A OE1  1 
ATOM   2727  O  OE2  . GLU A 1 277 ? 35.100  43.467  23.384  1.00 3.55  ? 308 GLU A OE2  1 
ATOM   2728  H  H    . GLU A 1 277 ? 33.865  47.229  18.814  1.00 17.00 ? 308 GLU A H    1 
ATOM   2729  N  N    . HIS A 1 278 ? 37.252  46.747  18.831  1.00 9.14  ? 309 HIS A N    1 
ATOM   2730  C  CA   . HIS A 1 278 ? 38.688  46.889  18.541  1.00 7.32  ? 309 HIS A CA   1 
ATOM   2731  C  C    . HIS A 1 278 ? 39.275  47.994  19.398  1.00 3.84  ? 309 HIS A C    1 
ATOM   2732  O  O    . HIS A 1 278 ? 40.025  47.732  20.328  1.00 2.01  ? 309 HIS A O    1 
ATOM   2733  C  CB   . HIS A 1 278 ? 38.956  47.198  17.054  1.00 8.48  ? 309 HIS A CB   1 
ATOM   2734  C  CG   . HIS A 1 278 ? 40.404  47.097  16.676  1.00 8.95  ? 309 HIS A CG   1 
ATOM   2735  N  ND1  . HIS A 1 278 ? 41.012  45.900  16.350  1.00 9.70  ? 309 HIS A ND1  1 
ATOM   2736  C  CD2  . HIS A 1 278 ? 41.375  48.035  16.610  1.00 10.23 ? 309 HIS A CD2  1 
ATOM   2737  C  CE1  . HIS A 1 278 ? 42.290  46.102  16.099  1.00 6.67  ? 309 HIS A CE1  1 
ATOM   2738  N  NE2  . HIS A 1 278 ? 42.537  47.389  16.251  1.00 9.30  ? 309 HIS A NE2  1 
ATOM   2739  H  H    . HIS A 1 278 ? 36.608  46.703  18.101  1.00 17.00 ? 309 HIS A H    1 
ATOM   2740  H  HD1  . HIS A 1 278 ? 40.535  45.050  16.354  1.00 17.00 ? 309 HIS A HD1  1 
ATOM   2741  H  HE2  . HIS A 1 278 ? 43.403  47.853  16.143  1.00 17.00 ? 309 HIS A HE2  1 
ATOM   2742  N  N    . GLN A 1 279 ? 38.875  49.222  19.122  1.00 2.11  ? 310 GLN A N    1 
ATOM   2743  C  CA   . GLN A 1 279 ? 39.376  50.335  19.881  1.00 2.30  ? 310 GLN A CA   1 
ATOM   2744  C  C    . GLN A 1 279 ? 39.360  50.074  21.373  1.00 2.14  ? 310 GLN A C    1 
ATOM   2745  O  O    . GLN A 1 279 ? 40.375  50.221  22.050  1.00 2.00  ? 310 GLN A O    1 
ATOM   2746  C  CB   . GLN A 1 279 ? 38.599  51.600  19.564  1.00 2.00  ? 310 GLN A CB   1 
ATOM   2747  C  CG   . GLN A 1 279 ? 39.140  52.354  18.393  1.00 2.00  ? 310 GLN A CG   1 
ATOM   2748  C  CD   . GLN A 1 279 ? 38.947  51.613  17.113  1.00 2.00  ? 310 GLN A CD   1 
ATOM   2749  O  OE1  . GLN A 1 279 ? 39.435  50.500  16.922  1.00 3.66  ? 310 GLN A OE1  1 
ATOM   2750  N  NE2  . GLN A 1 279 ? 38.219  52.222  16.218  1.00 6.63  ? 310 GLN A NE2  1 
ATOM   2751  H  H    . GLN A 1 279 ? 38.225  49.379  18.402  1.00 17.00 ? 310 GLN A H    1 
ATOM   2752  H  HE21 . GLN A 1 279 ? 38.049  51.788  15.359  1.00 17.00 ? 310 GLN A HE21 1 
ATOM   2753  H  HE22 . GLN A 1 279 ? 37.863  53.097  16.437  1.00 17.00 ? 310 GLN A HE22 1 
ATOM   2754  N  N    . ARG A 1 280 ? 38.226  49.633  21.885  1.00 2.56  ? 311 ARG A N    1 
ATOM   2755  C  CA   . ARG A 1 280 ? 38.143  49.396  23.312  1.00 4.37  ? 311 ARG A CA   1 
ATOM   2756  C  C    . ARG A 1 280 ? 39.299  48.517  23.787  1.00 4.93  ? 311 ARG A C    1 
ATOM   2757  O  O    . ARG A 1 280 ? 39.874  48.757  24.844  1.00 6.68  ? 311 ARG A O    1 
ATOM   2758  C  CB   . ARG A 1 280 ? 36.797  48.782  23.708  1.00 4.84  ? 311 ARG A CB   1 
ATOM   2759  C  CG   . ARG A 1 280 ? 36.763  48.445  25.195  1.00 5.69  ? 311 ARG A CG   1 
ATOM   2760  C  CD   . ARG A 1 280 ? 35.570  47.626  25.602  1.00 3.36  ? 311 ARG A CD   1 
ATOM   2761  N  NE   . ARG A 1 280 ? 35.961  46.565  26.515  1.00 2.00  ? 311 ARG A NE   1 
ATOM   2762  C  CZ   . ARG A 1 280 ? 36.532  45.435  26.115  1.00 3.45  ? 311 ARG A CZ   1 
ATOM   2763  N  NH1  . ARG A 1 280 ? 36.782  45.240  24.833  1.00 2.00  ? 311 ARG A NH1  1 
ATOM   2764  N  NH2  . ARG A 1 280 ? 36.835  44.487  26.989  1.00 6.55  ? 311 ARG A NH2  1 
ATOM   2765  H  H    . ARG A 1 280 ? 37.444  49.448  21.314  1.00 17.00 ? 311 ARG A H    1 
ATOM   2766  H  HE   . ARG A 1 280 ? 35.794  46.694  27.472  1.00 17.00 ? 311 ARG A HE   1 
ATOM   2767  H  HH11 . ARG A 1 280 ? 36.574  45.948  24.166  1.00 17.00 ? 311 ARG A HH11 1 
ATOM   2768  H  HH12 . ARG A 1 280 ? 37.212  44.388  24.534  1.00 17.00 ? 311 ARG A HH12 1 
ATOM   2769  H  HH21 . ARG A 1 280 ? 36.638  44.620  27.961  1.00 17.00 ? 311 ARG A HH21 1 
ATOM   2770  H  HH22 . ARG A 1 280 ? 37.270  43.643  26.676  1.00 17.00 ? 311 ARG A HH22 1 
ATOM   2771  N  N    . VAL A 1 281 ? 39.649  47.504  23.008  1.00 3.67  ? 312 VAL A N    1 
ATOM   2772  C  CA   . VAL A 1 281 ? 40.751  46.649  23.390  1.00 2.29  ? 312 VAL A CA   1 
ATOM   2773  C  C    . VAL A 1 281 ? 42.020  47.482  23.288  1.00 2.43  ? 312 VAL A C    1 
ATOM   2774  O  O    . VAL A 1 281 ? 42.721  47.643  24.275  1.00 2.00  ? 312 VAL A O    1 
ATOM   2775  C  CB   . VAL A 1 281 ? 40.892  45.431  22.478  1.00 2.05  ? 312 VAL A CB   1 
ATOM   2776  C  CG1  . VAL A 1 281 ? 42.093  44.624  22.917  1.00 4.91  ? 312 VAL A CG1  1 
ATOM   2777  C  CG2  . VAL A 1 281 ? 39.656  44.569  22.536  1.00 3.13  ? 312 VAL A CG2  1 
ATOM   2778  H  H    . VAL A 1 281 ? 39.157  47.349  22.174  1.00 17.00 ? 312 VAL A H    1 
ATOM   2779  N  N    . CYS A 1 282 ? 42.261  48.056  22.105  1.00 2.54  ? 313 CYS A N    1 
ATOM   2780  C  CA   . CYS A 1 282 ? 43.429  48.887  21.819  1.00 2.00  ? 313 CYS A CA   1 
ATOM   2781  C  C    . CYS A 1 282 ? 43.801  49.805  22.967  1.00 2.51  ? 313 CYS A C    1 
ATOM   2782  O  O    . CYS A 1 282 ? 44.967  50.063  23.187  1.00 3.59  ? 313 CYS A O    1 
ATOM   2783  C  CB   . CYS A 1 282 ? 43.186  49.792  20.604  1.00 2.55  ? 313 CYS A CB   1 
ATOM   2784  S  SG   . CYS A 1 282 ? 43.362  49.129  18.948  1.00 2.00  ? 313 CYS A SG   1 
ATOM   2785  H  H    . CYS A 1 282 ? 41.613  47.910  21.388  1.00 17.00 ? 313 CYS A H    1 
ATOM   2786  N  N    . ASP A 1 283 ? 42.815  50.368  23.651  1.00 4.13  ? 314 ASP A N    1 
ATOM   2787  C  CA   . ASP A 1 283 ? 43.092  51.283  24.761  1.00 5.17  ? 314 ASP A CA   1 
ATOM   2788  C  C    . ASP A 1 283 ? 43.576  50.526  25.990  1.00 5.78  ? 314 ASP A C    1 
ATOM   2789  O  O    . ASP A 1 283 ? 44.443  51.003  26.736  1.00 6.16  ? 314 ASP A O    1 
ATOM   2790  C  CB   . ASP A 1 283 ? 41.840  52.077  25.105  1.00 4.50  ? 314 ASP A CB   1 
ATOM   2791  C  CG   . ASP A 1 283 ? 41.332  52.858  23.937  1.00 5.25  ? 314 ASP A CG   1 
ATOM   2792  O  OD1  . ASP A 1 283 ? 42.176  53.594  23.348  1.00 5.60  ? 314 ASP A OD1  1 
ATOM   2793  O  OD2  . ASP A 1 283 ? 40.115  52.720  23.617  1.00 2.00  ? 314 ASP A OD2  1 
ATOM   2794  H  H    . ASP A 1 283 ? 41.889  50.167  23.391  1.00 17.00 ? 314 ASP A H    1 
ATOM   2795  N  N    . ILE A 1 284 ? 42.968  49.365  26.210  1.00 5.39  ? 315 ILE A N    1 
ATOM   2796  C  CA   . ILE A 1 284 ? 43.305  48.498  27.325  1.00 6.79  ? 315 ILE A CA   1 
ATOM   2797  C  C    . ILE A 1 284 ? 44.741  48.066  27.064  1.00 7.43  ? 315 ILE A C    1 
ATOM   2798  O  O    . ILE A 1 284 ? 45.604  48.142  27.945  1.00 9.80  ? 315 ILE A O    1 
ATOM   2799  C  CB   . ILE A 1 284 ? 42.396  47.262  27.326  1.00 6.75  ? 315 ILE A CB   1 
ATOM   2800  C  CG1  . ILE A 1 284 ? 40.935  47.696  27.361  1.00 2.28  ? 315 ILE A CG1  1 
ATOM   2801  C  CG2  . ILE A 1 284 ? 42.744  46.347  28.499  1.00 7.18  ? 315 ILE A CG2  1 
ATOM   2802  C  CD1  . ILE A 1 284 ? 40.010  46.592  26.972  1.00 6.35  ? 315 ILE A CD1  1 
ATOM   2803  H  H    . ILE A 1 284 ? 42.261  49.086  25.588  1.00 17.00 ? 315 ILE A H    1 
ATOM   2804  N  N    . LEU A 1 285 ? 44.987  47.595  25.846  1.00 6.36  ? 316 LEU A N    1 
ATOM   2805  C  CA   . LEU A 1 285 ? 46.323  47.209  25.447  1.00 3.79  ? 316 LEU A CA   1 
ATOM   2806  C  C    . LEU A 1 285 ? 47.233  48.437  25.576  1.00 3.48  ? 316 LEU A C    1 
ATOM   2807  O  O    . LEU A 1 285 ? 48.304  48.332  26.169  1.00 5.22  ? 316 LEU A O    1 
ATOM   2808  C  CB   . LEU A 1 285 ? 46.305  46.703  24.008  1.00 2.22  ? 316 LEU A CB   1 
ATOM   2809  C  CG   . LEU A 1 285 ? 46.452  45.187  23.858  1.00 2.16  ? 316 LEU A CG   1 
ATOM   2810  C  CD1  . LEU A 1 285 ? 45.821  44.480  25.039  1.00 2.00  ? 316 LEU A CD1  1 
ATOM   2811  C  CD2  . LEU A 1 285 ? 45.884  44.711  22.524  1.00 2.00  ? 316 LEU A CD2  1 
ATOM   2812  H  H    . LEU A 1 285 ? 44.253  47.487  25.218  1.00 17.00 ? 316 LEU A H    1 
ATOM   2813  N  N    . LYS A 1 286 ? 46.752  49.604  25.131  1.00 2.20  ? 317 LYS A N    1 
ATOM   2814  C  CA   . LYS A 1 286 ? 47.517  50.848  25.171  1.00 3.20  ? 317 LYS A CA   1 
ATOM   2815  C  C    . LYS A 1 286 ? 47.867  51.339  26.561  1.00 2.24  ? 317 LYS A C    1 
ATOM   2816  O  O    . LYS A 1 286 ? 48.711  52.221  26.709  1.00 2.52  ? 317 LYS A O    1 
ATOM   2817  C  CB   . LYS A 1 286 ? 46.841  51.979  24.377  1.00 4.91  ? 317 LYS A CB   1 
ATOM   2818  C  CG   . LYS A 1 286 ? 47.766  53.212  24.116  1.00 3.43  ? 317 LYS A CG   1 
ATOM   2819  C  CD   . LYS A 1 286 ? 47.183  54.534  24.672  1.00 4.08  ? 317 LYS A CD   1 
ATOM   2820  C  CE   . LYS A 1 286 ? 47.021  54.521  26.210  1.00 3.93  ? 317 LYS A CE   1 
ATOM   2821  N  NZ   . LYS A 1 286 ? 46.025  55.491  26.782  1.00 2.00  ? 317 LYS A NZ   1 
ATOM   2822  H  H    . LYS A 1 286 ? 45.855  49.636  24.758  1.00 17.00 ? 317 LYS A H    1 
ATOM   2823  H  HZ1  . LYS A 1 286 ? 45.089  55.303  26.369  1.00 17.00 ? 317 LYS A HZ1  1 
ATOM   2824  H  HZ2  . LYS A 1 286 ? 45.978  55.373  27.815  1.00 17.00 ? 317 LYS A HZ2  1 
ATOM   2825  H  HZ3  . LYS A 1 286 ? 46.316  56.464  26.556  1.00 17.00 ? 317 LYS A HZ3  1 
ATOM   2826  N  N    . GLN A 1 287 ? 47.206  50.832  27.586  1.00 2.00  ? 318 GLN A N    1 
ATOM   2827  C  CA   . GLN A 1 287 ? 47.589  51.261  28.909  1.00 2.84  ? 318 GLN A CA   1 
ATOM   2828  C  C    . GLN A 1 287 ? 48.089  50.122  29.723  1.00 2.02  ? 318 GLN A C    1 
ATOM   2829  O  O    . GLN A 1 287 ? 48.061  50.130  30.949  1.00 2.02  ? 318 GLN A O    1 
ATOM   2830  C  CB   . GLN A 1 287 ? 46.517  52.043  29.630  1.00 6.86  ? 318 GLN A CB   1 
ATOM   2831  C  CG   . GLN A 1 287 ? 47.151  52.888  30.735  1.00 14.07 ? 318 GLN A CG   1 
ATOM   2832  C  CD   . GLN A 1 287 ? 48.631  53.290  30.458  1.00 15.20 ? 318 GLN A CD   1 
ATOM   2833  O  OE1  . GLN A 1 287 ? 49.500  53.149  31.324  1.00 12.20 ? 318 GLN A OE1  1 
ATOM   2834  N  NE2  . GLN A 1 287 ? 48.902  53.791  29.256  1.00 16.85 ? 318 GLN A NE2  1 
ATOM   2835  H  H    . GLN A 1 287 ? 46.453  50.212  27.466  1.00 17.00 ? 318 GLN A H    1 
ATOM   2836  H  HE21 . GLN A 1 287 ? 49.825  54.059  29.074  1.00 17.00 ? 318 GLN A HE21 1 
ATOM   2837  H  HE22 . GLN A 1 287 ? 48.179  53.872  28.601  1.00 17.00 ? 318 GLN A HE22 1 
ATOM   2838  N  N    . GLU A 1 288 ? 48.485  49.108  28.987  1.00 2.00  ? 319 GLU A N    1 
ATOM   2839  C  CA   . GLU A 1 288 ? 49.087  47.922  29.527  1.00 5.09  ? 319 GLU A CA   1 
ATOM   2840  C  C    . GLU A 1 288 ? 50.510  47.952  28.924  1.00 4.70  ? 319 GLU A C    1 
ATOM   2841  O  O    . GLU A 1 288 ? 51.496  47.409  29.469  1.00 4.66  ? 319 GLU A O    1 
ATOM   2842  C  CB   . GLU A 1 288 ? 48.304  46.707  29.047  1.00 8.79  ? 319 GLU A CB   1 
ATOM   2843  C  CG   . GLU A 1 288 ? 47.250  46.279  30.014  1.00 11.12 ? 319 GLU A CG   1 
ATOM   2844  C  CD   . GLU A 1 288 ? 47.850  45.829  31.318  1.00 14.49 ? 319 GLU A CD   1 
ATOM   2845  O  OE1  . GLU A 1 288 ? 48.704  44.884  31.325  1.00 16.71 ? 319 GLU A OE1  1 
ATOM   2846  O  OE2  . GLU A 1 288 ? 47.456  46.436  32.330  1.00 12.46 ? 319 GLU A OE2  1 
ATOM   2847  H  H    . GLU A 1 288 ? 48.316  49.153  28.027  1.00 17.00 ? 319 GLU A H    1 
ATOM   2848  N  N    . HIS A 1 289 ? 50.590  48.607  27.778  1.00 2.16  ? 320 HIS A N    1 
ATOM   2849  C  CA   . HIS A 1 289 ? 51.818  48.757  27.053  1.00 2.45  ? 320 HIS A CA   1 
ATOM   2850  C  C    . HIS A 1 289 ? 51.900  50.186  26.544  1.00 2.10  ? 320 HIS A C    1 
ATOM   2851  O  O    . HIS A 1 289 ? 51.689  50.469  25.363  1.00 2.00  ? 320 HIS A O    1 
ATOM   2852  C  CB   . HIS A 1 289 ? 51.877  47.722  25.945  1.00 2.00  ? 320 HIS A CB   1 
ATOM   2853  C  CG   . HIS A 1 289 ? 51.809  46.325  26.463  1.00 4.85  ? 320 HIS A CG   1 
ATOM   2854  N  ND1  . HIS A 1 289 ? 50.609  45.685  26.686  1.00 9.73  ? 320 HIS A ND1  1 
ATOM   2855  C  CD2  . HIS A 1 289 ? 52.768  45.495  26.944  1.00 4.62  ? 320 HIS A CD2  1 
ATOM   2856  C  CE1  . HIS A 1 289 ? 50.826  44.530  27.293  1.00 7.42  ? 320 HIS A CE1  1 
ATOM   2857  N  NE2  . HIS A 1 289 ? 52.130  44.389  27.459  1.00 4.75  ? 320 HIS A NE2  1 
ATOM   2858  H  H    . HIS A 1 289 ? 49.786  49.005  27.381  1.00 17.00 ? 320 HIS A H    1 
ATOM   2859  H  HD1  . HIS A 1 289 ? 49.724  46.011  26.414  1.00 17.00 ? 320 HIS A HD1  1 
ATOM   2860  H  HE2  . HIS A 1 289 ? 52.559  43.598  27.848  1.00 17.00 ? 320 HIS A HE2  1 
ATOM   2861  N  N    . PRO A 1 290 ? 52.195  51.120  27.463  1.00 2.00  ? 321 PRO A N    1 
ATOM   2862  C  CA   . PRO A 1 290 ? 52.314  52.542  27.161  1.00 4.01  ? 321 PRO A CA   1 
ATOM   2863  C  C    . PRO A 1 290 ? 53.417  52.746  26.144  1.00 6.21  ? 321 PRO A C    1 
ATOM   2864  O  O    . PRO A 1 290 ? 53.547  53.782  25.507  1.00 8.62  ? 321 PRO A O    1 
ATOM   2865  C  CB   . PRO A 1 290 ? 52.677  53.130  28.522  1.00 2.69  ? 321 PRO A CB   1 
ATOM   2866  C  CG   . PRO A 1 290 ? 53.360  51.992  29.225  1.00 2.04  ? 321 PRO A CG   1 
ATOM   2867  C  CD   . PRO A 1 290 ? 52.469  50.874  28.890  1.00 2.00  ? 321 PRO A CD   1 
ATOM   2868  N  N    . GLU A 1 291 ? 54.195  51.705  25.957  1.00 7.63  ? 322 GLU A N    1 
ATOM   2869  C  CA   . GLU A 1 291 ? 55.308  51.772  25.048  1.00 9.14  ? 322 GLU A CA   1 
ATOM   2870  C  C    . GLU A 1 291 ? 55.098  50.955  23.794  1.00 9.59  ? 322 GLU A C    1 
ATOM   2871  O  O    . GLU A 1 291 ? 56.056  50.588  23.123  1.00 11.06 ? 322 GLU A O    1 
ATOM   2872  C  CB   . GLU A 1 291 ? 56.551  51.300  25.778  1.00 8.39  ? 322 GLU A CB   1 
ATOM   2873  C  CG   . GLU A 1 291 ? 56.223  50.563  27.059  1.00 7.42  ? 322 GLU A CG   1 
ATOM   2874  C  CD   . GLU A 1 291 ? 55.654  49.177  26.848  1.00 5.81  ? 322 GLU A CD   1 
ATOM   2875  O  OE1  . GLU A 1 291 ? 56.009  48.491  25.858  1.00 6.43  ? 322 GLU A OE1  1 
ATOM   2876  O  OE2  . GLU A 1 291 ? 54.881  48.756  27.725  1.00 8.35  ? 322 GLU A OE2  1 
ATOM   2877  H  H    . GLU A 1 291 ? 54.011  50.869  26.400  1.00 17.00 ? 322 GLU A H    1 
ATOM   2878  N  N    . TRP A 1 292 ? 53.862  50.580  23.513  1.00 9.72  ? 323 TRP A N    1 
ATOM   2879  C  CA   . TRP A 1 292 ? 53.619  49.843  22.286  1.00 8.89  ? 323 TRP A CA   1 
ATOM   2880  C  C    . TRP A 1 292 ? 53.370  50.895  21.198  1.00 7.34  ? 323 TRP A C    1 
ATOM   2881  O  O    . TRP A 1 292 ? 53.154  52.079  21.499  1.00 7.04  ? 323 TRP A O    1 
ATOM   2882  C  CB   . TRP A 1 292 ? 52.442  48.874  22.425  1.00 9.82  ? 323 TRP A CB   1 
ATOM   2883  C  CG   . TRP A 1 292 ? 52.882  47.531  22.863  1.00 9.72  ? 323 TRP A CG   1 
ATOM   2884  C  CD1  . TRP A 1 292 ? 54.146  47.165  23.177  1.00 10.65 ? 323 TRP A CD1  1 
ATOM   2885  C  CD2  . TRP A 1 292 ? 52.066  46.362  23.037  1.00 10.83 ? 323 TRP A CD2  1 
ATOM   2886  N  NE1  . TRP A 1 292 ? 54.181  45.843  23.534  1.00 11.81 ? 323 TRP A NE1  1 
ATOM   2887  C  CE2  . TRP A 1 292 ? 52.917  45.324  23.460  1.00 10.53 ? 323 TRP A CE2  1 
ATOM   2888  C  CE3  . TRP A 1 292 ? 50.699  46.093  22.876  1.00 11.36 ? 323 TRP A CE3  1 
ATOM   2889  C  CZ2  . TRP A 1 292 ? 52.453  44.029  23.729  1.00 11.65 ? 323 TRP A CZ2  1 
ATOM   2890  C  CZ3  . TRP A 1 292 ? 50.239  44.805  23.141  1.00 11.70 ? 323 TRP A CZ3  1 
ATOM   2891  C  CH2  . TRP A 1 292 ? 51.117  43.790  23.565  1.00 10.34 ? 323 TRP A CH2  1 
ATOM   2892  H  H    . TRP A 1 292 ? 53.101  50.862  24.060  1.00 17.00 ? 323 TRP A H    1 
ATOM   2893  H  HE1  . TRP A 1 292 ? 55.001  45.363  23.780  1.00 17.00 ? 323 TRP A HE1  1 
ATOM   2894  N  N    . GLY A 1 293 ? 53.510  50.485  19.944  1.00 6.49  ? 324 GLY A N    1 
ATOM   2895  C  CA   . GLY A 1 293 ? 53.300  51.399  18.840  1.00 2.48  ? 324 GLY A CA   1 
ATOM   2896  C  C    . GLY A 1 293 ? 52.011  50.966  18.196  1.00 2.64  ? 324 GLY A C    1 
ATOM   2897  O  O    . GLY A 1 293 ? 51.486  49.885  18.491  1.00 2.40  ? 324 GLY A O    1 
ATOM   2898  H  H    . GLY A 1 293 ? 53.742  49.548  19.781  1.00 17.00 ? 324 GLY A H    1 
ATOM   2899  N  N    . ASP A 1 294 ? 51.525  51.771  17.270  1.00 2.00  ? 325 ASP A N    1 
ATOM   2900  C  CA   . ASP A 1 294 ? 50.283  51.459  16.599  1.00 2.00  ? 325 ASP A CA   1 
ATOM   2901  C  C    . ASP A 1 294 ? 50.279  50.077  16.026  1.00 2.00  ? 325 ASP A C    1 
ATOM   2902  O  O    . ASP A 1 294 ? 49.451  49.286  16.403  1.00 3.67  ? 325 ASP A O    1 
ATOM   2903  C  CB   . ASP A 1 294 ? 49.978  52.480  15.519  1.00 4.77  ? 325 ASP A CB   1 
ATOM   2904  C  CG   . ASP A 1 294 ? 48.843  52.043  14.601  1.00 5.65  ? 325 ASP A CG   1 
ATOM   2905  O  OD1  . ASP A 1 294 ? 47.652  52.101  15.001  1.00 2.03  ? 325 ASP A OD1  1 
ATOM   2906  O  OD2  . ASP A 1 294 ? 49.164  51.665  13.451  1.00 6.83  ? 325 ASP A OD2  1 
ATOM   2907  H  H    . ASP A 1 294 ? 52.008  52.593  17.050  1.00 17.00 ? 325 ASP A H    1 
ATOM   2908  N  N    . GLU A 1 295 ? 51.235  49.743  15.169  1.00 3.71  ? 326 GLU A N    1 
ATOM   2909  C  CA   . GLU A 1 295 ? 51.245  48.402  14.584  1.00 3.67  ? 326 GLU A CA   1 
ATOM   2910  C  C    . GLU A 1 295 ? 51.222  47.262  15.552  1.00 2.53  ? 326 GLU A C    1 
ATOM   2911  O  O    . GLU A 1 295 ? 50.665  46.246  15.233  1.00 5.18  ? 326 GLU A O    1 
ATOM   2912  C  CB   . GLU A 1 295 ? 52.390  48.204  13.618  1.00 4.06  ? 326 GLU A CB   1 
ATOM   2913  C  CG   . GLU A 1 295 ? 51.954  48.126  12.155  1.00 5.47  ? 326 GLU A CG   1 
ATOM   2914  C  CD   . GLU A 1 295 ? 51.465  46.737  11.753  1.00 8.77  ? 326 GLU A CD   1 
ATOM   2915  O  OE1  . GLU A 1 295 ? 51.285  45.860  12.628  1.00 4.34  ? 326 GLU A OE1  1 
ATOM   2916  O  OE2  . GLU A 1 295 ? 51.265  46.523  10.537  1.00 13.35 ? 326 GLU A OE2  1 
ATOM   2917  H  H    . GLU A 1 295 ? 51.934  50.376  14.923  1.00 17.00 ? 326 GLU A H    1 
ATOM   2918  N  N    . GLN A 1 296 ? 51.785  47.408  16.738  1.00 2.93  ? 327 GLN A N    1 
ATOM   2919  C  CA   . GLN A 1 296 ? 51.730  46.295  17.669  1.00 3.86  ? 327 GLN A CA   1 
ATOM   2920  C  C    . GLN A 1 296 ? 50.354  46.153  18.283  1.00 3.24  ? 327 GLN A C    1 
ATOM   2921  O  O    . GLN A 1 296 ? 49.810  45.037  18.334  1.00 3.18  ? 327 GLN A O    1 
ATOM   2922  C  CB   . GLN A 1 296 ? 52.761  46.426  18.775  1.00 8.95  ? 327 GLN A CB   1 
ATOM   2923  C  CG   . GLN A 1 296 ? 52.636  45.312  19.813  1.00 6.86  ? 327 GLN A CG   1 
ATOM   2924  C  CD   . GLN A 1 296 ? 53.943  44.906  20.412  1.00 3.24  ? 327 GLN A CD   1 
ATOM   2925  O  OE1  . GLN A 1 296 ? 54.891  45.690  20.526  1.00 3.63  ? 327 GLN A OE1  1 
ATOM   2926  N  NE2  . GLN A 1 296 ? 54.007  43.660  20.800  1.00 5.94  ? 327 GLN A NE2  1 
ATOM   2927  H  H    . GLN A 1 296 ? 52.216  48.247  16.990  1.00 17.00 ? 327 GLN A H    1 
ATOM   2928  H  HE21 . GLN A 1 296 ? 54.861  43.358  21.155  1.00 17.00 ? 327 GLN A HE21 1 
ATOM   2929  H  HE22 . GLN A 1 296 ? 53.209  43.099  20.709  1.00 17.00 ? 327 GLN A HE22 1 
ATOM   2930  N  N    . LEU A 1 297 ? 49.828  47.275  18.781  1.00 2.00  ? 328 LEU A N    1 
ATOM   2931  C  CA   . LEU A 1 297 ? 48.486  47.348  19.377  1.00 2.00  ? 328 LEU A CA   1 
ATOM   2932  C  C    . LEU A 1 297 ? 47.404  46.802  18.411  1.00 2.00  ? 328 LEU A C    1 
ATOM   2933  O  O    . LEU A 1 297 ? 46.518  46.011  18.794  1.00 2.00  ? 328 LEU A O    1 
ATOM   2934  C  CB   . LEU A 1 297 ? 48.171  48.789  19.747  1.00 2.00  ? 328 LEU A CB   1 
ATOM   2935  C  CG   . LEU A 1 297 ? 48.928  49.350  20.944  1.00 2.00  ? 328 LEU A CG   1 
ATOM   2936  C  CD1  . LEU A 1 297 ? 48.701  50.820  21.032  1.00 2.00  ? 328 LEU A CD1  1 
ATOM   2937  C  CD2  . LEU A 1 297 ? 48.446  48.682  22.209  1.00 4.54  ? 328 LEU A CD2  1 
ATOM   2938  H  H    . LEU A 1 297 ? 50.360  48.098  18.719  1.00 17.00 ? 328 LEU A H    1 
ATOM   2939  N  N    . PHE A 1 298 ? 47.512  47.201  17.149  1.00 2.01  ? 329 PHE A N    1 
ATOM   2940  C  CA   . PHE A 1 298 ? 46.622  46.731  16.102  1.00 2.00  ? 329 PHE A CA   1 
ATOM   2941  C  C    . PHE A 1 298 ? 46.741  45.235  15.922  1.00 2.00  ? 329 PHE A C    1 
ATOM   2942  O  O    . PHE A 1 298 ? 45.739  44.543  15.873  1.00 2.00  ? 329 PHE A O    1 
ATOM   2943  C  CB   . PHE A 1 298 ? 46.961  47.377  14.765  1.00 2.78  ? 329 PHE A CB   1 
ATOM   2944  C  CG   . PHE A 1 298 ? 46.175  46.823  13.628  1.00 4.83  ? 329 PHE A CG   1 
ATOM   2945  C  CD1  . PHE A 1 298 ? 46.589  45.672  12.972  1.00 4.06  ? 329 PHE A CD1  1 
ATOM   2946  C  CD2  . PHE A 1 298 ? 44.989  47.427  13.233  1.00 6.45  ? 329 PHE A CD2  1 
ATOM   2947  C  CE1  . PHE A 1 298 ? 45.848  45.128  11.947  1.00 2.01  ? 329 PHE A CE1  1 
ATOM   2948  C  CE2  . PHE A 1 298 ? 44.223  46.879  12.189  1.00 6.04  ? 329 PHE A CE2  1 
ATOM   2949  C  CZ   . PHE A 1 298 ? 44.659  45.732  11.550  1.00 3.61  ? 329 PHE A CZ   1 
ATOM   2950  H  H    . PHE A 1 298 ? 48.217  47.843  16.922  1.00 17.00 ? 329 PHE A H    1 
ATOM   2951  N  N    . GLN A 1 299 ? 47.969  44.746  15.777  1.00 2.11  ? 330 GLN A N    1 
ATOM   2952  C  CA   . GLN A 1 299 ? 48.203  43.319  15.568  1.00 2.95  ? 330 GLN A CA   1 
ATOM   2953  C  C    . GLN A 1 299 ? 47.866  42.439  16.746  1.00 2.58  ? 330 GLN A C    1 
ATOM   2954  O  O    . GLN A 1 299 ? 47.463  41.286  16.574  1.00 2.00  ? 330 GLN A O    1 
ATOM   2955  C  CB   . GLN A 1 299 ? 49.611  43.051  15.085  1.00 2.00  ? 330 GLN A CB   1 
ATOM   2956  C  CG   . GLN A 1 299 ? 49.872  43.599  13.683  1.00 2.14  ? 330 GLN A CG   1 
ATOM   2957  C  CD   . GLN A 1 299 ? 49.255  42.793  12.575  1.00 2.00  ? 330 GLN A CD   1 
ATOM   2958  O  OE1  . GLN A 1 299 ? 48.789  41.673  12.792  1.00 2.00  ? 330 GLN A OE1  1 
ATOM   2959  N  NE2  . GLN A 1 299 ? 49.301  43.337  11.354  1.00 2.00  ? 330 GLN A NE2  1 
ATOM   2960  H  H    . GLN A 1 299 ? 48.748  45.345  15.790  1.00 17.00 ? 330 GLN A H    1 
ATOM   2961  H  HE21 . GLN A 1 299 ? 48.900  42.843  10.616  1.00 17.00 ? 330 GLN A HE21 1 
ATOM   2962  H  HE22 . GLN A 1 299 ? 49.744  44.206  11.262  1.00 17.00 ? 330 GLN A HE22 1 
ATOM   2963  N  N    . THR A 1 300 ? 47.989  42.982  17.940  1.00 2.00  ? 331 THR A N    1 
ATOM   2964  C  CA   . THR A 1 300 ? 47.646  42.201  19.105  1.00 4.48  ? 331 THR A CA   1 
ATOM   2965  C  C    . THR A 1 300 ? 46.109  42.179  19.275  1.00 5.83  ? 331 THR A C    1 
ATOM   2966  O  O    . THR A 1 300 ? 45.533  41.143  19.673  1.00 2.00  ? 331 THR A O    1 
ATOM   2967  C  CB   . THR A 1 300 ? 48.296  42.786  20.370  1.00 6.83  ? 331 THR A CB   1 
ATOM   2968  O  OG1  . THR A 1 300 ? 49.683  43.052  20.138  1.00 5.15  ? 331 THR A OG1  1 
ATOM   2969  C  CG2  . THR A 1 300 ? 48.145  41.812  21.524  1.00 5.96  ? 331 THR A CG2  1 
ATOM   2970  H  H    . THR A 1 300 ? 48.311  43.898  18.028  1.00 17.00 ? 331 THR A H    1 
ATOM   2971  H  HG1  . THR A 1 300 ? 49.772  43.574  19.345  1.00 17.00 ? 331 THR A HG1  1 
ATOM   2972  N  N    . SER A 1 301 ? 45.459  43.322  18.971  1.00 7.16  ? 332 SER A N    1 
ATOM   2973  C  CA   . SER A 1 301 ? 43.990  43.466  19.087  1.00 6.33  ? 332 SER A CA   1 
ATOM   2974  C  C    . SER A 1 301 ? 43.239  42.447  18.212  1.00 5.99  ? 332 SER A C    1 
ATOM   2975  O  O    . SER A 1 301 ? 42.445  41.662  18.733  1.00 6.05  ? 332 SER A O    1 
ATOM   2976  C  CB   . SER A 1 301 ? 43.534  44.901  18.757  1.00 4.81  ? 332 SER A CB   1 
ATOM   2977  O  OG   . SER A 1 301 ? 43.902  45.816  19.774  1.00 2.00  ? 332 SER A OG   1 
ATOM   2978  H  H    . SER A 1 301 ? 45.967  44.102  18.662  1.00 17.00 ? 332 SER A H    1 
ATOM   2979  H  HG   . SER A 1 301 ? 44.866  45.887  19.805  1.00 17.00 ? 332 SER A HG   1 
ATOM   2980  N  N    . LYS A 1 302 ? 43.512  42.434  16.901  1.00 4.72  ? 333 LYS A N    1 
ATOM   2981  C  CA   . LYS A 1 302 ? 42.884  41.468  15.987  1.00 2.85  ? 333 LYS A CA   1 
ATOM   2982  C  C    . LYS A 1 302 ? 42.955  40.043  16.538  1.00 2.00  ? 333 LYS A C    1 
ATOM   2983  O  O    . LYS A 1 302 ? 42.076  39.253  16.323  1.00 2.00  ? 333 LYS A O    1 
ATOM   2984  C  CB   . LYS A 1 302 ? 43.549  41.525  14.604  1.00 2.00  ? 333 LYS A CB   1 
ATOM   2985  C  CG   . LYS A 1 302 ? 43.124  40.415  13.649  1.00 2.00  ? 333 LYS A CG   1 
ATOM   2986  C  CD   . LYS A 1 302 ? 43.406  40.782  12.217  1.00 2.07  ? 333 LYS A CD   1 
ATOM   2987  C  CE   . LYS A 1 302 ? 42.871  39.725  11.267  1.00 2.00  ? 333 LYS A CE   1 
ATOM   2988  N  NZ   . LYS A 1 302 ? 42.821  40.129  9.813   1.00 2.00  ? 333 LYS A NZ   1 
ATOM   2989  H  H    . LYS A 1 302 ? 44.180  43.061  16.545  1.00 17.00 ? 333 LYS A H    1 
ATOM   2990  H  HZ1  . LYS A 1 302 ? 43.778  40.380  9.490   1.00 17.00 ? 333 LYS A HZ1  1 
ATOM   2991  H  HZ2  . LYS A 1 302 ? 42.454  39.343  9.239   1.00 17.00 ? 333 LYS A HZ2  1 
ATOM   2992  H  HZ3  . LYS A 1 302 ? 42.183  40.943  9.715   1.00 17.00 ? 333 LYS A HZ3  1 
ATOM   2993  N  N    . LEU A 1 303 ? 43.999  39.741  17.282  1.00 2.00  ? 334 LEU A N    1 
ATOM   2994  C  CA   . LEU A 1 303 ? 44.153  38.424  17.840  1.00 3.63  ? 334 LEU A CA   1 
ATOM   2995  C  C    . LEU A 1 303 ? 43.186  38.236  18.981  1.00 3.84  ? 334 LEU A C    1 
ATOM   2996  O  O    . LEU A 1 303 ? 42.525  37.203  19.074  1.00 6.12  ? 334 LEU A O    1 
ATOM   2997  C  CB   . LEU A 1 303 ? 45.596  38.187  18.316  1.00 4.71  ? 334 LEU A CB   1 
ATOM   2998  C  CG   . LEU A 1 303 ? 46.715  37.899  17.308  1.00 2.00  ? 334 LEU A CG   1 
ATOM   2999  C  CD1  . LEU A 1 303 ? 47.977  37.614  18.082  1.00 2.19  ? 334 LEU A CD1  1 
ATOM   3000  C  CD2  . LEU A 1 303 ? 46.361  36.734  16.444  1.00 2.00  ? 334 LEU A CD2  1 
ATOM   3001  H  H    . LEU A 1 303 ? 44.696  40.408  17.444  1.00 17.00 ? 334 LEU A H    1 
ATOM   3002  N  N    . ILE A 1 304 ? 43.118  39.216  19.867  1.00 5.18  ? 335 ILE A N    1 
ATOM   3003  C  CA   . ILE A 1 304 ? 42.208  39.125  21.005  1.00 3.47  ? 335 ILE A CA   1 
ATOM   3004  C  C    . ILE A 1 304 ? 40.772  39.026  20.520  1.00 2.11  ? 335 ILE A C    1 
ATOM   3005  O  O    . ILE A 1 304 ? 40.080  38.094  20.907  1.00 2.83  ? 335 ILE A O    1 
ATOM   3006  C  CB   . ILE A 1 304 ? 42.398  40.293  21.978  1.00 3.70  ? 335 ILE A CB   1 
ATOM   3007  C  CG1  . ILE A 1 304 ? 43.760  40.172  22.671  1.00 2.80  ? 335 ILE A CG1  1 
ATOM   3008  C  CG2  . ILE A 1 304 ? 41.293  40.322  22.970  1.00 3.82  ? 335 ILE A CG2  1 
ATOM   3009  C  CD1  . ILE A 1 304 ? 44.032  41.240  23.672  1.00 2.00  ? 335 ILE A CD1  1 
ATOM   3010  H  H    . ILE A 1 304 ? 43.680  40.011  19.759  1.00 17.00 ? 335 ILE A H    1 
ATOM   3011  N  N    . LEU A 1 305 ? 40.345  39.942  19.648  1.00 2.00  ? 336 LEU A N    1 
ATOM   3012  C  CA   . LEU A 1 305 ? 38.992  39.908  19.082  1.00 3.42  ? 336 LEU A CA   1 
ATOM   3013  C  C    . LEU A 1 305 ? 38.706  38.518  18.517  1.00 4.25  ? 336 LEU A C    1 
ATOM   3014  O  O    . LEU A 1 305 ? 37.673  37.934  18.825  1.00 7.40  ? 336 LEU A O    1 
ATOM   3015  C  CB   . LEU A 1 305 ? 38.807  40.939  17.965  1.00 3.45  ? 336 LEU A CB   1 
ATOM   3016  C  CG   . LEU A 1 305 ? 38.093  42.246  18.293  1.00 2.87  ? 336 LEU A CG   1 
ATOM   3017  C  CD1  . LEU A 1 305 ? 38.794  42.965  19.427  1.00 2.81  ? 336 LEU A CD1  1 
ATOM   3018  C  CD2  . LEU A 1 305 ? 38.069  43.094  17.054  1.00 2.00  ? 336 LEU A CD2  1 
ATOM   3019  H  H    . LEU A 1 305 ? 40.966  40.652  19.391  1.00 17.00 ? 336 LEU A H    1 
ATOM   3020  N  N    . ILE A 1 306 ? 39.608  37.984  17.700  1.00 2.40  ? 337 ILE A N    1 
ATOM   3021  C  CA   . ILE A 1 306 ? 39.421  36.641  17.159  1.00 2.06  ? 337 ILE A CA   1 
ATOM   3022  C  C    . ILE A 1 306 ? 39.208  35.678  18.327  1.00 2.00  ? 337 ILE A C    1 
ATOM   3023  O  O    . ILE A 1 306 ? 38.324  34.838  18.297  1.00 2.20  ? 337 ILE A O    1 
ATOM   3024  C  CB   . ILE A 1 306 ? 40.652  36.156  16.337  1.00 2.00  ? 337 ILE A CB   1 
ATOM   3025  C  CG1  . ILE A 1 306 ? 40.804  36.998  15.073  1.00 4.30  ? 337 ILE A CG1  1 
ATOM   3026  C  CG2  . ILE A 1 306 ? 40.500  34.688  15.937  1.00 2.00  ? 337 ILE A CG2  1 
ATOM   3027  C  CD1  . ILE A 1 306 ? 41.909  36.522  14.148  1.00 6.30  ? 337 ILE A CD1  1 
ATOM   3028  H  H    . ILE A 1 306 ? 40.418  38.486  17.457  1.00 17.00 ? 337 ILE A H    1 
ATOM   3029  N  N    . GLY A 1 307 ? 39.996  35.850  19.379  1.00 2.13  ? 338 GLY A N    1 
ATOM   3030  C  CA   . GLY A 1 307 ? 39.892  34.985  20.532  1.00 2.00  ? 338 GLY A CA   1 
ATOM   3031  C  C    . GLY A 1 307 ? 38.503  35.052  21.095  1.00 2.27  ? 338 GLY A C    1 
ATOM   3032  O  O    . GLY A 1 307 ? 37.899  34.031  21.386  1.00 2.00  ? 338 GLY A O    1 
ATOM   3033  H  H    . GLY A 1 307 ? 40.666  36.566  19.385  1.00 17.00 ? 338 GLY A H    1 
ATOM   3034  N  N    . GLU A 1 308 ? 37.990  36.270  21.212  1.00 3.70  ? 339 GLU A N    1 
ATOM   3035  C  CA   . GLU A 1 308 ? 36.650  36.511  21.751  1.00 4.91  ? 339 GLU A CA   1 
ATOM   3036  C  C    . GLU A 1 308 ? 35.621  35.820  20.869  1.00 2.36  ? 339 GLU A C    1 
ATOM   3037  O  O    . GLU A 1 308 ? 34.795  35.048  21.327  1.00 2.00  ? 339 GLU A O    1 
ATOM   3038  C  CB   . GLU A 1 308 ? 36.346  38.028  21.785  1.00 5.31  ? 339 GLU A CB   1 
ATOM   3039  C  CG   . GLU A 1 308 ? 37.211  38.848  22.694  1.00 2.00  ? 339 GLU A CG   1 
ATOM   3040  C  CD   . GLU A 1 308 ? 36.868  40.317  22.600  1.00 6.95  ? 339 GLU A CD   1 
ATOM   3041  O  OE1  . GLU A 1 308 ? 37.358  40.990  21.660  1.00 8.19  ? 339 GLU A OE1  1 
ATOM   3042  O  OE2  . GLU A 1 308 ? 36.086  40.802  23.457  1.00 11.74 ? 339 GLU A OE2  1 
ATOM   3043  H  H    . GLU A 1 308 ? 38.528  37.029  20.912  1.00 17.00 ? 339 GLU A H    1 
ATOM   3044  N  N    . THR A 1 309 ? 35.711  36.103  19.588  1.00 2.00  ? 340 THR A N    1 
ATOM   3045  C  CA   . THR A 1 309 ? 34.817  35.553  18.629  1.00 2.00  ? 340 THR A CA   1 
ATOM   3046  C  C    . THR A 1 309 ? 34.731  34.041  18.744  1.00 2.67  ? 340 THR A C    1 
ATOM   3047  O  O    . THR A 1 309 ? 33.654  33.471  18.702  1.00 5.36  ? 340 THR A O    1 
ATOM   3048  C  CB   . THR A 1 309 ? 35.237  35.929  17.239  1.00 2.28  ? 340 THR A CB   1 
ATOM   3049  O  OG1  . THR A 1 309 ? 35.256  37.361  17.121  1.00 3.10  ? 340 THR A OG1  1 
ATOM   3050  C  CG2  . THR A 1 309 ? 34.258  35.354  16.243  1.00 4.89  ? 340 THR A CG2  1 
ATOM   3051  H  H    . THR A 1 309 ? 36.421  36.685  19.283  1.00 17.00 ? 340 THR A H    1 
ATOM   3052  H  HG1  . THR A 1 309 ? 35.868  37.741  17.765  1.00 17.00 ? 340 THR A HG1  1 
ATOM   3053  N  N    . ILE A 1 310 ? 35.842  33.362  18.915  1.00 4.18  ? 341 ILE A N    1 
ATOM   3054  C  CA   . ILE A 1 310 ? 35.731  31.919  19.037  1.00 5.63  ? 341 ILE A CA   1 
ATOM   3055  C  C    . ILE A 1 310 ? 35.005  31.564  20.341  1.00 3.80  ? 341 ILE A C    1 
ATOM   3056  O  O    . ILE A 1 310 ? 34.355  30.529  20.421  1.00 5.56  ? 341 ILE A O    1 
ATOM   3057  C  CB   . ILE A 1 310 ? 37.111  31.197  18.976  1.00 6.45  ? 341 ILE A CB   1 
ATOM   3058  C  CG1  . ILE A 1 310 ? 37.836  31.548  17.675  1.00 8.91  ? 341 ILE A CG1  1 
ATOM   3059  C  CG2  . ILE A 1 310 ? 36.906  29.722  18.964  1.00 9.12  ? 341 ILE A CG2  1 
ATOM   3060  C  CD1  . ILE A 1 310 ? 39.110  30.739  17.420  1.00 5.03  ? 341 ILE A CD1  1 
ATOM   3061  H  H    . ILE A 1 310 ? 36.713  33.814  18.969  1.00 17.00 ? 341 ILE A H    1 
ATOM   3062  N  N    . LYS A 1 311 ? 35.083  32.430  21.345  1.00 2.00  ? 342 LYS A N    1 
ATOM   3063  C  CA   . LYS A 1 311 ? 34.436  32.158  22.610  1.00 2.00  ? 342 LYS A CA   1 
ATOM   3064  C  C    . LYS A 1 311 ? 32.941  32.272  22.421  1.00 5.31  ? 342 LYS A C    1 
ATOM   3065  O  O    . LYS A 1 311 ? 32.182  31.312  22.669  1.00 5.00  ? 342 LYS A O    1 
ATOM   3066  C  CB   . LYS A 1 311 ? 34.882  33.162  23.642  1.00 2.00  ? 342 LYS A CB   1 
ATOM   3067  C  CG   . LYS A 1 311 ? 34.222  32.999  24.970  1.00 2.00  ? 342 LYS A CG   1 
ATOM   3068  C  CD   . LYS A 1 311 ? 34.951  32.007  25.853  1.00 3.78  ? 342 LYS A CD   1 
ATOM   3069  C  CE   . LYS A 1 311 ? 35.125  32.564  27.282  1.00 2.41  ? 342 LYS A CE   1 
ATOM   3070  N  NZ   . LYS A 1 311 ? 36.066  31.759  28.098  1.00 9.50  ? 342 LYS A NZ   1 
ATOM   3071  H  H    . LYS A 1 311 ? 35.607  33.250  21.251  1.00 17.00 ? 342 LYS A H    1 
ATOM   3072  H  HZ1  . LYS A 1 311 ? 36.974  31.697  27.592  1.00 17.00 ? 342 LYS A HZ1  1 
ATOM   3073  H  HZ2  . LYS A 1 311 ? 36.210  32.207  29.024  1.00 17.00 ? 342 LYS A HZ2  1 
ATOM   3074  H  HZ3  . LYS A 1 311 ? 35.688  30.799  28.226  1.00 17.00 ? 342 LYS A HZ3  1 
ATOM   3075  N  N    . ILE A 1 312 ? 32.514  33.449  21.960  1.00 6.44  ? 343 ILE A N    1 
ATOM   3076  C  CA   . ILE A 1 312 ? 31.091  33.727  21.723  1.00 5.56  ? 343 ILE A CA   1 
ATOM   3077  C  C    . ILE A 1 312 ? 30.501  32.663  20.791  1.00 4.19  ? 343 ILE A C    1 
ATOM   3078  O  O    . ILE A 1 312 ? 29.589  31.927  21.177  1.00 5.16  ? 343 ILE A O    1 
ATOM   3079  C  CB   . ILE A 1 312 ? 30.882  35.154  21.181  1.00 3.70  ? 343 ILE A CB   1 
ATOM   3080  C  CG1  . ILE A 1 312 ? 31.231  36.183  22.266  1.00 2.00  ? 343 ILE A CG1  1 
ATOM   3081  C  CG2  . ILE A 1 312 ? 29.462  35.325  20.684  1.00 3.60  ? 343 ILE A CG2  1 
ATOM   3082  C  CD1  . ILE A 1 312 ? 31.236  37.604  21.771  1.00 2.00  ? 343 ILE A CD1  1 
ATOM   3083  H  H    . ILE A 1 312 ? 33.194  34.124  21.767  1.00 17.00 ? 343 ILE A H    1 
ATOM   3084  N  N    . VAL A 1 313 ? 31.086  32.493  19.620  1.00 2.00  ? 344 VAL A N    1 
ATOM   3085  C  CA   . VAL A 1 313 ? 30.596  31.470  18.699  1.00 3.91  ? 344 VAL A CA   1 
ATOM   3086  C  C    . VAL A 1 313 ? 30.501  30.010  19.218  1.00 3.64  ? 344 VAL A C    1 
ATOM   3087  O  O    . VAL A 1 313 ? 29.865  29.193  18.582  1.00 4.39  ? 344 VAL A O    1 
ATOM   3088  C  CB   . VAL A 1 313 ? 31.324  31.595  17.337  1.00 4.33  ? 344 VAL A CB   1 
ATOM   3089  C  CG1  . VAL A 1 313 ? 31.125  30.397  16.447  1.00 2.00  ? 344 VAL A CG1  1 
ATOM   3090  C  CG2  . VAL A 1 313 ? 30.821  32.876  16.658  1.00 6.85  ? 344 VAL A CG2  1 
ATOM   3091  H  H    . VAL A 1 313 ? 31.870  33.032  19.375  1.00 17.00 ? 344 VAL A H    1 
ATOM   3092  N  N    . ILE A 1 314 ? 31.060  29.697  20.391  1.00 4.86  ? 345 ILE A N    1 
ATOM   3093  C  CA   . ILE A 1 314 ? 30.967  28.335  20.957  1.00 4.89  ? 345 ILE A CA   1 
ATOM   3094  C  C    . ILE A 1 314 ? 30.078  28.425  22.184  1.00 5.38  ? 345 ILE A C    1 
ATOM   3095  O  O    . ILE A 1 314 ? 29.027  27.804  22.250  1.00 4.63  ? 345 ILE A O    1 
ATOM   3096  C  CB   . ILE A 1 314 ? 32.364  27.757  21.411  1.00 5.11  ? 345 ILE A CB   1 
ATOM   3097  C  CG1  . ILE A 1 314 ? 33.243  27.413  20.189  1.00 5.11  ? 345 ILE A CG1  1 
ATOM   3098  C  CG2  . ILE A 1 314 ? 32.177  26.491  22.286  1.00 2.00  ? 345 ILE A CG2  1 
ATOM   3099  C  CD1  . ILE A 1 314 ? 32.976  26.031  19.600  1.00 2.49  ? 345 ILE A CD1  1 
ATOM   3100  H  H    . ILE A 1 314 ? 31.568  30.374  20.886  1.00 17.00 ? 345 ILE A H    1 
ATOM   3101  N  N    . GLU A 1 315 ? 30.510  29.253  23.129  1.00 6.83  ? 346 GLU A N    1 
ATOM   3102  C  CA   . GLU A 1 315 ? 29.821  29.497  24.394  1.00 8.20  ? 346 GLU A CA   1 
ATOM   3103  C  C    . GLU A 1 315 ? 28.379  30.084  24.310  1.00 7.48  ? 346 GLU A C    1 
ATOM   3104  O  O    . GLU A 1 315 ? 27.583  29.891  25.239  1.00 8.29  ? 346 GLU A O    1 
ATOM   3105  C  CB   . GLU A 1 315 ? 30.702  30.435  25.254  1.00 10.20 ? 346 GLU A CB   1 
ATOM   3106  C  CG   . GLU A 1 315 ? 32.134  29.945  25.531  1.00 12.36 ? 346 GLU A CG   1 
ATOM   3107  C  CD   . GLU A 1 315 ? 32.259  28.980  26.730  1.00 15.76 ? 346 GLU A CD   1 
ATOM   3108  O  OE1  . GLU A 1 315 ? 31.352  28.138  26.942  1.00 16.08 ? 346 GLU A OE1  1 
ATOM   3109  O  OE2  . GLU A 1 315 ? 33.283  29.057  27.455  1.00 14.88 ? 346 GLU A OE2  1 
ATOM   3110  H  H    . GLU A 1 315 ? 31.349  29.714  22.966  1.00 17.00 ? 346 GLU A H    1 
ATOM   3111  N  N    . ASP A 1 316 ? 28.064  30.821  23.239  1.00 5.69  ? 347 ASP A N    1 
ATOM   3112  C  CA   . ASP A 1 316 ? 26.751  31.462  23.074  1.00 2.89  ? 347 ASP A CA   1 
ATOM   3113  C  C    . ASP A 1 316 ? 25.993  30.956  21.871  1.00 2.66  ? 347 ASP A C    1 
ATOM   3114  O  O    . ASP A 1 316 ? 24.858  30.476  21.989  1.00 2.00  ? 347 ASP A O    1 
ATOM   3115  C  CB   . ASP A 1 316 ? 26.889  32.974  22.872  1.00 2.73  ? 347 ASP A CB   1 
ATOM   3116  C  CG   . ASP A 1 316 ? 27.471  33.680  24.063  1.00 3.15  ? 347 ASP A CG   1 
ATOM   3117  O  OD1  . ASP A 1 316 ? 26.993  33.390  25.166  1.00 4.46  ? 347 ASP A OD1  1 
ATOM   3118  O  OD2  . ASP A 1 316 ? 28.397  34.515  23.898  1.00 2.45  ? 347 ASP A OD2  1 
ATOM   3119  H  H    . ASP A 1 316 ? 28.755  30.921  22.556  1.00 17.00 ? 347 ASP A H    1 
ATOM   3120  N  N    . TYR A 1 317 ? 26.603  31.162  20.705  1.00 2.40  ? 348 TYR A N    1 
ATOM   3121  C  CA   . TYR A 1 317 ? 26.042  30.788  19.408  1.00 2.00  ? 348 TYR A CA   1 
ATOM   3122  C  C    . TYR A 1 317 ? 25.802  29.312  19.251  1.00 4.77  ? 348 TYR A C    1 
ATOM   3123  O  O    . TYR A 1 317 ? 24.672  28.910  18.965  1.00 8.04  ? 348 TYR A O    1 
ATOM   3124  C  CB   . TYR A 1 317 ? 26.952  31.263  18.318  1.00 2.00  ? 348 TYR A CB   1 
ATOM   3125  C  CG   . TYR A 1 317 ? 26.456  31.097  16.918  1.00 2.22  ? 348 TYR A CG   1 
ATOM   3126  C  CD1  . TYR A 1 317 ? 26.615  29.882  16.243  1.00 3.47  ? 348 TYR A CD1  1 
ATOM   3127  C  CD2  . TYR A 1 317 ? 26.010  32.205  16.185  1.00 2.18  ? 348 TYR A CD2  1 
ATOM   3128  C  CE1  . TYR A 1 317 ? 26.369  29.773  14.848  1.00 3.64  ? 348 TYR A CE1  1 
ATOM   3129  C  CE2  . TYR A 1 317 ? 25.752  32.104  14.797  1.00 3.53  ? 348 TYR A CE2  1 
ATOM   3130  C  CZ   . TYR A 1 317 ? 25.947  30.886  14.130  1.00 2.00  ? 348 TYR A CZ   1 
ATOM   3131  O  OH   . TYR A 1 317 ? 25.791  30.781  12.759  1.00 2.00  ? 348 TYR A OH   1 
ATOM   3132  H  H    . TYR A 1 317 ? 27.488  31.585  20.716  1.00 17.00 ? 348 TYR A H    1 
ATOM   3133  H  HH   . TYR A 1 317 ? 25.854  31.635  12.340  1.00 17.00 ? 348 TYR A HH   1 
ATOM   3134  N  N    . VAL A 1 318 ? 26.852  28.496  19.383  1.00 6.33  ? 349 VAL A N    1 
ATOM   3135  C  CA   . VAL A 1 318 ? 26.679  27.043  19.294  1.00 4.05  ? 349 VAL A CA   1 
ATOM   3136  C  C    . VAL A 1 318 ? 25.848  26.584  20.489  1.00 3.50  ? 349 VAL A C    1 
ATOM   3137  O  O    . VAL A 1 318 ? 24.890  25.844  20.334  1.00 6.54  ? 349 VAL A O    1 
ATOM   3138  C  CB   . VAL A 1 318 ? 28.004  26.272  19.244  1.00 2.76  ? 349 VAL A CB   1 
ATOM   3139  C  CG1  . VAL A 1 318 ? 27.710  24.767  19.168  1.00 5.24  ? 349 VAL A CG1  1 
ATOM   3140  C  CG2  . VAL A 1 318 ? 28.794  26.668  18.011  1.00 2.00  ? 349 VAL A CG2  1 
ATOM   3141  H  H    . VAL A 1 318 ? 27.756  28.855  19.508  1.00 17.00 ? 349 VAL A H    1 
ATOM   3142  N  N    . GLN A 1 319 ? 26.155  27.101  21.664  1.00 4.47  ? 350 GLN A N    1 
ATOM   3143  C  CA   . GLN A 1 319 ? 25.416  26.745  22.866  1.00 4.48  ? 350 GLN A CA   1 
ATOM   3144  C  C    . GLN A 1 319 ? 23.918  26.949  22.725  1.00 3.35  ? 350 GLN A C    1 
ATOM   3145  O  O    . GLN A 1 319 ? 23.145  26.130  23.197  1.00 2.61  ? 350 GLN A O    1 
ATOM   3146  C  CB   . GLN A 1 319 ? 25.936  27.534  24.058  1.00 7.32  ? 350 GLN A CB   1 
ATOM   3147  C  CG   . GLN A 1 319 ? 25.218  27.234  25.345  1.00 8.99  ? 350 GLN A CG   1 
ATOM   3148  C  CD   . GLN A 1 319 ? 25.363  25.802  25.758  1.00 8.81  ? 350 GLN A CD   1 
ATOM   3149  O  OE1  . GLN A 1 319 ? 24.486  24.986  25.507  1.00 11.39 ? 350 GLN A OE1  1 
ATOM   3150  N  NE2  . GLN A 1 319 ? 26.471  25.484  26.391  1.00 8.72  ? 350 GLN A NE2  1 
ATOM   3151  H  H    . GLN A 1 319 ? 26.925  27.704  21.729  1.00 17.00 ? 350 GLN A H    1 
ATOM   3152  H  HE21 . GLN A 1 319 ? 26.485  24.541  26.650  1.00 17.00 ? 350 GLN A HE21 1 
ATOM   3153  H  HE22 . GLN A 1 319 ? 27.156  26.166  26.561  1.00 17.00 ? 350 GLN A HE22 1 
ATOM   3154  N  N    . HIS A 1 320 ? 23.513  28.047  22.097  1.00 5.52  ? 351 HIS A N    1 
ATOM   3155  C  CA   . HIS A 1 320 ? 22.095  28.316  21.885  1.00 7.16  ? 351 HIS A CA   1 
ATOM   3156  C  C    . HIS A 1 320 ? 21.538  27.414  20.772  1.00 8.42  ? 351 HIS A C    1 
ATOM   3157  O  O    . HIS A 1 320 ? 20.499  26.730  20.962  1.00 9.63  ? 351 HIS A O    1 
ATOM   3158  C  CB   . HIS A 1 320 ? 21.862  29.778  21.487  1.00 8.77  ? 351 HIS A CB   1 
ATOM   3159  C  CG   . HIS A 1 320 ? 20.514  30.027  20.881  1.00 8.61  ? 351 HIS A CG   1 
ATOM   3160  N  ND1  . HIS A 1 320 ? 20.235  29.770  19.555  1.00 6.10  ? 351 HIS A ND1  1 
ATOM   3161  C  CD2  . HIS A 1 320 ? 19.354  30.447  21.437  1.00 9.90  ? 351 HIS A CD2  1 
ATOM   3162  C  CE1  . HIS A 1 320 ? 18.959  30.010  19.323  1.00 10.96 ? 351 HIS A CE1  1 
ATOM   3163  N  NE2  . HIS A 1 320 ? 18.402  30.424  20.448  1.00 12.42 ? 351 HIS A NE2  1 
ATOM   3164  H  H    . HIS A 1 320 ? 24.185  28.691  21.791  1.00 17.00 ? 351 HIS A H    1 
ATOM   3165  H  HD1  . HIS A 1 320 ? 20.868  29.467  18.868  1.00 17.00 ? 351 HIS A HD1  1 
ATOM   3166  H  HE2  . HIS A 1 320 ? 17.460  30.696  20.540  1.00 17.00 ? 351 HIS A HE2  1 
ATOM   3167  N  N    . LEU A 1 321 ? 22.212  27.433  19.612  1.00 5.18  ? 352 LEU A N    1 
ATOM   3168  C  CA   . LEU A 1 321 ? 21.783  26.662  18.452  1.00 3.46  ? 352 LEU A CA   1 
ATOM   3169  C  C    . LEU A 1 321 ? 21.746  25.151  18.734  1.00 3.95  ? 352 LEU A C    1 
ATOM   3170  O  O    . LEU A 1 321 ? 21.115  24.384  18.003  1.00 3.68  ? 352 LEU A O    1 
ATOM   3171  C  CB   . LEU A 1 321 ? 22.669  27.006  17.252  1.00 2.00  ? 352 LEU A CB   1 
ATOM   3172  C  CG   . LEU A 1 321 ? 22.201  26.575  15.863  1.00 2.00  ? 352 LEU A CG   1 
ATOM   3173  C  CD1  . LEU A 1 321 ? 22.217  27.734  14.906  1.00 2.00  ? 352 LEU A CD1  1 
ATOM   3174  C  CD2  . LEU A 1 321 ? 23.089  25.512  15.356  1.00 2.02  ? 352 LEU A CD2  1 
ATOM   3175  H  H    . LEU A 1 321 ? 23.048  27.942  19.532  1.00 17.00 ? 352 LEU A H    1 
ATOM   3176  N  N    . SER A 1 322 ? 22.383  24.737  19.827  1.00 4.19  ? 353 SER A N    1 
ATOM   3177  C  CA   . SER A 1 322 ? 22.418  23.330  20.198  1.00 3.77  ? 353 SER A CA   1 
ATOM   3178  C  C    . SER A 1 322 ? 21.232  22.939  21.069  1.00 2.68  ? 353 SER A C    1 
ATOM   3179  O  O    . SER A 1 322 ? 20.582  21.917  20.836  1.00 2.02  ? 353 SER A O    1 
ATOM   3180  C  CB   . SER A 1 322 ? 23.760  22.962  20.886  1.00 2.02  ? 353 SER A CB   1 
ATOM   3181  O  OG   . SER A 1 322 ? 23.809  23.329  22.248  1.00 2.00  ? 353 SER A OG   1 
ATOM   3182  H  H    . SER A 1 322 ? 22.882  25.363  20.385  1.00 17.00 ? 353 SER A H    1 
ATOM   3183  H  HG   . SER A 1 322 ? 23.786  24.288  22.366  1.00 17.00 ? 353 SER A HG   1 
ATOM   3184  N  N    . GLY A 1 323 ? 20.922  23.796  22.035  1.00 4.01  ? 354 GLY A N    1 
ATOM   3185  C  CA   . GLY A 1 323 ? 19.854  23.498  22.960  1.00 5.99  ? 354 GLY A CA   1 
ATOM   3186  C  C    . GLY A 1 323 ? 20.286  22.239  23.692  1.00 6.72  ? 354 GLY A C    1 
ATOM   3187  O  O    . GLY A 1 323 ? 19.702  21.159  23.508  1.00 6.40  ? 354 GLY A O    1 
ATOM   3188  H  H    . GLY A 1 323 ? 21.426  24.627  22.131  1.00 17.00 ? 354 GLY A H    1 
ATOM   3189  N  N    . TYR A 1 324 ? 21.348  22.344  24.483  1.00 6.78  ? 355 TYR A N    1 
ATOM   3190  C  CA   . TYR A 1 324 ? 21.815  21.161  25.167  1.00 9.30  ? 355 TYR A CA   1 
ATOM   3191  C  C    . TYR A 1 324 ? 21.373  21.031  26.603  1.00 10.99 ? 355 TYR A C    1 
ATOM   3192  O  O    . TYR A 1 324 ? 20.265  20.552  26.896  1.00 11.59 ? 355 TYR A O    1 
ATOM   3193  C  CB   . TYR A 1 324 ? 23.336  20.976  24.999  1.00 6.50  ? 355 TYR A CB   1 
ATOM   3194  C  CG   . TYR A 1 324 ? 23.715  20.311  23.677  1.00 6.95  ? 355 TYR A CG   1 
ATOM   3195  C  CD1  . TYR A 1 324 ? 22.757  19.624  22.916  1.00 6.07  ? 355 TYR A CD1  1 
ATOM   3196  C  CD2  . TYR A 1 324 ? 25.021  20.349  23.191  1.00 6.85  ? 355 TYR A CD2  1 
ATOM   3197  C  CE1  . TYR A 1 324 ? 23.082  18.992  21.713  1.00 2.83  ? 355 TYR A CE1  1 
ATOM   3198  C  CE2  . TYR A 1 324 ? 25.361  19.707  21.982  1.00 7.01  ? 355 TYR A CE2  1 
ATOM   3199  C  CZ   . TYR A 1 324 ? 24.373  19.028  21.251  1.00 4.87  ? 355 TYR A CZ   1 
ATOM   3200  O  OH   . TYR A 1 324 ? 24.666  18.366  20.076  1.00 2.66  ? 355 TYR A OH   1 
ATOM   3201  H  H    . TYR A 1 324 ? 21.816  23.198  24.588  1.00 17.00 ? 355 TYR A H    1 
ATOM   3202  H  HH   . TYR A 1 324 ? 25.606  18.455  19.889  1.00 17.00 ? 355 TYR A HH   1 
ATOM   3203  N  N    . HIS A 1 325 ? 22.244  21.480  27.486  1.00 12.83 ? 356 HIS A N    1 
ATOM   3204  C  CA   . HIS A 1 325 ? 22.068  21.429  28.931  1.00 14.57 ? 356 HIS A CA   1 
ATOM   3205  C  C    . HIS A 1 325 ? 23.505  21.469  29.369  1.00 15.17 ? 356 HIS A C    1 
ATOM   3206  O  O    . HIS A 1 325 ? 23.880  22.310  30.186  1.00 16.88 ? 356 HIS A O    1 
ATOM   3207  C  CB   . HIS A 1 325 ? 21.428  20.127  29.404  1.00 15.30 ? 356 HIS A CB   1 
ATOM   3208  C  CG   . HIS A 1 325 ? 19.992  20.275  29.817  1.00 17.68 ? 356 HIS A CG   1 
ATOM   3209  N  ND1  . HIS A 1 325 ? 19.007  19.398  29.417  1.00 16.64 ? 356 HIS A ND1  1 
ATOM   3210  C  CD2  . HIS A 1 325 ? 19.378  21.200  30.594  1.00 17.40 ? 356 HIS A CD2  1 
ATOM   3211  C  CE1  . HIS A 1 325 ? 17.851  19.773  29.931  1.00 16.42 ? 356 HIS A CE1  1 
ATOM   3212  N  NE2  . HIS A 1 325 ? 18.048  20.864  30.647  1.00 15.81 ? 356 HIS A NE2  1 
ATOM   3213  H  H    . HIS A 1 325 ? 23.064  21.914  27.162  1.00 17.00 ? 356 HIS A H    1 
ATOM   3214  H  HD1  . HIS A 1 325 ? 19.144  18.643  28.801  1.00 17.00 ? 356 HIS A HD1  1 
ATOM   3215  H  HE2  . HIS A 1 325 ? 17.342  21.374  31.092  1.00 17.00 ? 356 HIS A HE2  1 
ATOM   3216  N  N    . PHE A 1 326 ? 24.315  20.583  28.775  1.00 14.97 ? 357 PHE A N    1 
ATOM   3217  C  CA   . PHE A 1 326 ? 25.744  20.553  29.055  1.00 11.10 ? 357 PHE A CA   1 
ATOM   3218  C  C    . PHE A 1 326 ? 26.321  21.873  28.536  1.00 9.60  ? 357 PHE A C    1 
ATOM   3219  O  O    . PHE A 1 326 ? 26.025  22.275  27.410  1.00 7.00  ? 357 PHE A O    1 
ATOM   3220  C  CB   . PHE A 1 326 ? 26.446  19.402  28.329  1.00 12.08 ? 357 PHE A CB   1 
ATOM   3221  C  CG   . PHE A 1 326 ? 27.949  19.544  28.325  1.00 11.78 ? 357 PHE A CG   1 
ATOM   3222  C  CD1  . PHE A 1 326 ? 28.639  19.643  29.519  1.00 10.66 ? 357 PHE A CD1  1 
ATOM   3223  C  CD2  . PHE A 1 326 ? 28.653  19.721  27.144  1.00 10.97 ? 357 PHE A CD2  1 
ATOM   3224  C  CE1  . PHE A 1 326 ? 29.984  19.929  29.540  1.00 9.96  ? 357 PHE A CE1  1 
ATOM   3225  C  CE2  . PHE A 1 326 ? 30.006  20.007  27.164  1.00 10.25 ? 357 PHE A CE2  1 
ATOM   3226  C  CZ   . PHE A 1 326 ? 30.674  20.116  28.365  1.00 9.43  ? 357 PHE A CZ   1 
ATOM   3227  H  H    . PHE A 1 326 ? 23.956  19.951  28.121  1.00 17.00 ? 357 PHE A H    1 
ATOM   3228  N  N    . LYS A 1 327 ? 27.159  22.520  29.346  1.00 8.29  ? 358 LYS A N    1 
ATOM   3229  C  CA   . LYS A 1 327 ? 27.773  23.798  28.982  1.00 6.45  ? 358 LYS A CA   1 
ATOM   3230  C  C    . LYS A 1 327 ? 29.064  23.676  28.144  1.00 5.51  ? 358 LYS A C    1 
ATOM   3231  O  O    . LYS A 1 327 ? 30.132  23.373  28.649  1.00 2.00  ? 358 LYS A O    1 
ATOM   3232  C  CB   . LYS A 1 327 ? 28.029  24.618  30.222  1.00 2.03  ? 358 LYS A CB   1 
ATOM   3233  C  CG   . LYS A 1 327 ? 28.034  26.081  29.969  1.00 4.01  ? 358 LYS A CG   1 
ATOM   3234  C  CD   . LYS A 1 327 ? 28.561  26.800  31.198  1.00 10.83 ? 358 LYS A CD   1 
ATOM   3235  C  CE   . LYS A 1 327 ? 27.964  26.217  32.499  1.00 12.84 ? 358 LYS A CE   1 
ATOM   3236  N  NZ   . LYS A 1 327 ? 28.439  26.870  33.778  1.00 14.90 ? 358 LYS A NZ   1 
ATOM   3237  H  H    . LYS A 1 327 ? 27.413  22.093  30.192  1.00 17.00 ? 358 LYS A H    1 
ATOM   3238  H  HZ1  . LYS A 1 327 ? 28.242  27.890  33.716  1.00 17.00 ? 358 LYS A HZ1  1 
ATOM   3239  H  HZ2  . LYS A 1 327 ? 27.921  26.464  34.584  1.00 17.00 ? 358 LYS A HZ2  1 
ATOM   3240  H  HZ3  . LYS A 1 327 ? 29.460  26.721  33.905  1.00 17.00 ? 358 LYS A HZ3  1 
ATOM   3241  N  N    . LEU A 1 328 ? 28.923  23.882  26.841  1.00 6.21  ? 359 LEU A N    1 
ATOM   3242  C  CA   . LEU A 1 328 ? 30.023  23.822  25.909  1.00 5.37  ? 359 LEU A CA   1 
ATOM   3243  C  C    . LEU A 1 328 ? 31.080  24.723  26.469  1.00 5.26  ? 359 LEU A C    1 
ATOM   3244  O  O    . LEU A 1 328 ? 30.751  25.572  27.272  1.00 6.41  ? 359 LEU A O    1 
ATOM   3245  C  CB   . LEU A 1 328 ? 29.559  24.316  24.536  1.00 6.50  ? 359 LEU A CB   1 
ATOM   3246  C  CG   . LEU A 1 328 ? 28.444  23.513  23.866  1.00 5.34  ? 359 LEU A CG   1 
ATOM   3247  C  CD1  . LEU A 1 328 ? 28.221  24.000  22.457  1.00 2.00  ? 359 LEU A CD1  1 
ATOM   3248  C  CD2  . LEU A 1 328 ? 28.793  22.020  23.872  1.00 6.16  ? 359 LEU A CD2  1 
ATOM   3249  H  H    . LEU A 1 328 ? 28.033  24.065  26.501  1.00 17.00 ? 359 LEU A H    1 
ATOM   3250  N  N    . LYS A 1 329 ? 32.329  24.551  26.039  1.00 6.93  ? 360 LYS A N    1 
ATOM   3251  C  CA   . LYS A 1 329 ? 33.458  25.354  26.546  1.00 8.41  ? 360 LYS A CA   1 
ATOM   3252  C  C    . LYS A 1 329 ? 34.555  25.558  25.536  1.00 8.75  ? 360 LYS A C    1 
ATOM   3253  O  O    . LYS A 1 329 ? 35.034  24.618  24.913  1.00 7.31  ? 360 LYS A O    1 
ATOM   3254  C  CB   . LYS A 1 329 ? 34.086  24.729  27.794  1.00 4.30  ? 360 LYS A CB   1 
ATOM   3255  C  CG   . LYS A 1 329 ? 35.099  25.587  28.470  1.00 2.00  ? 360 LYS A CG   1 
ATOM   3256  C  CD   . LYS A 1 329 ? 35.590  24.904  29.740  1.00 3.84  ? 360 LYS A CD   1 
ATOM   3257  C  CE   . LYS A 1 329 ? 36.367  23.602  29.426  1.00 7.61  ? 360 LYS A CE   1 
ATOM   3258  N  NZ   . LYS A 1 329 ? 37.248  23.061  30.518  1.00 4.61  ? 360 LYS A NZ   1 
ATOM   3259  H  H    . LYS A 1 329 ? 32.517  23.907  25.342  1.00 17.00 ? 360 LYS A H    1 
ATOM   3260  H  HZ1  . LYS A 1 329 ? 37.972  23.762  30.767  1.00 17.00 ? 360 LYS A HZ1  1 
ATOM   3261  H  HZ2  . LYS A 1 329 ? 36.672  22.831  31.352  1.00 17.00 ? 360 LYS A HZ2  1 
ATOM   3262  H  HZ3  . LYS A 1 329 ? 37.706  22.194  30.169  1.00 17.00 ? 360 LYS A HZ3  1 
ATOM   3263  N  N    . PHE A 1 330 ? 34.954  26.809  25.382  1.00 10.63 ? 361 PHE A N    1 
ATOM   3264  C  CA   . PHE A 1 330 ? 36.012  27.136  24.451  1.00 10.77 ? 361 PHE A CA   1 
ATOM   3265  C  C    . PHE A 1 330 ? 37.271  26.985  25.255  1.00 10.16 ? 361 PHE A C    1 
ATOM   3266  O  O    . PHE A 1 330 ? 37.570  27.847  26.078  1.00 13.15 ? 361 PHE A O    1 
ATOM   3267  C  CB   . PHE A 1 330 ? 35.906  28.589  23.985  1.00 9.40  ? 361 PHE A CB   1 
ATOM   3268  C  CG   . PHE A 1 330 ? 37.099  29.052  23.171  1.00 9.09  ? 361 PHE A CG   1 
ATOM   3269  C  CD1  . PHE A 1 330 ? 37.680  28.215  22.208  1.00 7.36  ? 361 PHE A CD1  1 
ATOM   3270  C  CD2  . PHE A 1 330 ? 37.617  30.329  23.344  1.00 5.82  ? 361 PHE A CD2  1 
ATOM   3271  C  CE1  . PHE A 1 330 ? 38.739  28.652  21.441  1.00 4.18  ? 361 PHE A CE1  1 
ATOM   3272  C  CE2  . PHE A 1 330 ? 38.669  30.763  22.582  1.00 4.08  ? 361 PHE A CE2  1 
ATOM   3273  C  CZ   . PHE A 1 330 ? 39.229  29.917  21.623  1.00 5.10  ? 361 PHE A CZ   1 
ATOM   3274  H  H    . PHE A 1 330 ? 34.561  27.522  25.923  1.00 17.00 ? 361 PHE A H    1 
ATOM   3275  N  N    . ASP A 1 331 ? 37.973  25.878  25.064  1.00 9.21  ? 362 ASP A N    1 
ATOM   3276  C  CA   . ASP A 1 331 ? 39.219  25.633  25.785  1.00 9.97  ? 362 ASP A CA   1 
ATOM   3277  C  C    . ASP A 1 331 ? 40.194  24.891  24.888  1.00 8.34  ? 362 ASP A C    1 
ATOM   3278  O  O    . ASP A 1 331 ? 40.239  23.659  24.904  1.00 6.74  ? 362 ASP A O    1 
ATOM   3279  C  CB   . ASP A 1 331 ? 38.976  24.830  27.078  1.00 9.33  ? 362 ASP A CB   1 
ATOM   3280  C  CG   . ASP A 1 331 ? 40.219  24.748  27.976  1.00 10.94 ? 362 ASP A CG   1 
ATOM   3281  O  OD1  . ASP A 1 331 ? 41.240  25.434  27.717  1.00 13.85 ? 362 ASP A OD1  1 
ATOM   3282  O  OD2  . ASP A 1 331 ? 40.164  24.002  28.972  1.00 10.07 ? 362 ASP A OD2  1 
ATOM   3283  H  H    . ASP A 1 331 ? 37.632  25.193  24.450  1.00 17.00 ? 362 ASP A H    1 
ATOM   3284  N  N    . PRO A 1 332 ? 40.988  25.640  24.096  1.00 7.25  ? 363 PRO A N    1 
ATOM   3285  C  CA   . PRO A 1 332 ? 41.979  25.057  23.176  1.00 6.85  ? 363 PRO A CA   1 
ATOM   3286  C  C    . PRO A 1 332 ? 42.899  23.980  23.777  1.00 5.98  ? 363 PRO A C    1 
ATOM   3287  O  O    . PRO A 1 332 ? 43.243  23.003  23.090  1.00 3.96  ? 363 PRO A O    1 
ATOM   3288  C  CB   . PRO A 1 332 ? 42.734  26.292  22.657  1.00 8.23  ? 363 PRO A CB   1 
ATOM   3289  C  CG   . PRO A 1 332 ? 41.634  27.344  22.604  1.00 6.00  ? 363 PRO A CG   1 
ATOM   3290  C  CD   . PRO A 1 332 ? 40.910  27.112  23.931  1.00 5.30  ? 363 PRO A CD   1 
ATOM   3291  N  N    . GLU A 1 333 ? 43.218  24.106  25.066  1.00 5.56  ? 364 GLU A N    1 
ATOM   3292  C  CA   . GLU A 1 333 ? 44.088  23.121  25.738  1.00 7.44  ? 364 GLU A CA   1 
ATOM   3293  C  C    . GLU A 1 333 ? 43.499  21.714  25.843  1.00 5.05  ? 364 GLU A C    1 
ATOM   3294  O  O    . GLU A 1 333 ? 44.186  20.800  26.240  1.00 2.00  ? 364 GLU A O    1 
ATOM   3295  C  CB   . GLU A 1 333 ? 44.486  23.582  27.146  1.00 11.03 ? 364 GLU A CB   1 
ATOM   3296  C  CG   . GLU A 1 333 ? 45.236  24.911  27.202  1.00 13.37 ? 364 GLU A CG   1 
ATOM   3297  C  CD   . GLU A 1 333 ? 45.644  25.306  28.624  1.00 15.14 ? 364 GLU A CD   1 
ATOM   3298  O  OE1  . GLU A 1 333 ? 45.620  24.431  29.531  1.00 12.89 ? 364 GLU A OE1  1 
ATOM   3299  O  OE2  . GLU A 1 333 ? 45.972  26.503  28.835  1.00 14.58 ? 364 GLU A OE2  1 
ATOM   3300  H  H    . GLU A 1 333 ? 42.884  24.875  25.563  1.00 17.00 ? 364 GLU A H    1 
ATOM   3301  N  N    . LEU A 1 334 ? 42.213  21.562  25.540  1.00 7.43  ? 365 LEU A N    1 
ATOM   3302  C  CA   . LEU A 1 334 ? 41.527  20.268  25.598  1.00 6.13  ? 365 LEU A CA   1 
ATOM   3303  C  C    . LEU A 1 334 ? 42.007  19.381  24.461  1.00 7.51  ? 365 LEU A C    1 
ATOM   3304  O  O    . LEU A 1 334 ? 42.074  18.166  24.611  1.00 9.15  ? 365 LEU A O    1 
ATOM   3305  C  CB   . LEU A 1 334 ? 39.998  20.443  25.498  1.00 3.71  ? 365 LEU A CB   1 
ATOM   3306  C  CG   . LEU A 1 334 ? 39.317  21.253  26.600  1.00 2.40  ? 365 LEU A CG   1 
ATOM   3307  C  CD1  . LEU A 1 334 ? 37.840  21.248  26.385  1.00 2.00  ? 365 LEU A CD1  1 
ATOM   3308  C  CD2  . LEU A 1 334 ? 39.655  20.650  27.964  1.00 2.49  ? 365 LEU A CD2  1 
ATOM   3309  H  H    . LEU A 1 334 ? 41.681  22.337  25.275  1.00 17.00 ? 365 LEU A H    1 
ATOM   3310  N  N    . LEU A 1 335 ? 42.368  19.996  23.337  1.00 5.75  ? 366 LEU A N    1 
ATOM   3311  C  CA   . LEU A 1 335 ? 42.832  19.246  22.180  1.00 4.88  ? 366 LEU A CA   1 
ATOM   3312  C  C    . LEU A 1 335 ? 44.368  19.106  22.154  1.00 3.46  ? 366 LEU A C    1 
ATOM   3313  O  O    . LEU A 1 335 ? 44.942  18.392  21.328  1.00 2.00  ? 366 LEU A O    1 
ATOM   3314  C  CB   . LEU A 1 335 ? 42.302  19.911  20.886  1.00 5.75  ? 366 LEU A CB   1 
ATOM   3315  C  CG   . LEU A 1 335 ? 40.844  19.657  20.462  1.00 4.32  ? 366 LEU A CG   1 
ATOM   3316  C  CD1  . LEU A 1 335 ? 40.442  20.618  19.359  1.00 4.05  ? 366 LEU A CD1  1 
ATOM   3317  C  CD2  . LEU A 1 335 ? 40.613  18.200  20.033  1.00 2.46  ? 366 LEU A CD2  1 
ATOM   3318  H  H    . LEU A 1 335 ? 42.328  20.974  23.282  1.00 17.00 ? 366 LEU A H    1 
ATOM   3319  N  N    . PHE A 1 336 ? 45.022  19.747  23.107  1.00 3.95  ? 367 PHE A N    1 
ATOM   3320  C  CA   . PHE A 1 336 ? 46.481  19.730  23.174  1.00 4.93  ? 367 PHE A CA   1 
ATOM   3321  C  C    . PHE A 1 336 ? 47.095  18.348  23.232  1.00 4.93  ? 367 PHE A C    1 
ATOM   3322  O  O    . PHE A 1 336 ? 48.133  18.104  22.642  1.00 6.91  ? 367 PHE A O    1 
ATOM   3323  C  CB   . PHE A 1 336 ? 47.001  20.613  24.327  1.00 3.64  ? 367 PHE A CB   1 
ATOM   3324  C  CG   . PHE A 1 336 ? 46.891  22.127  24.068  1.00 3.53  ? 367 PHE A CG   1 
ATOM   3325  C  CD1  . PHE A 1 336 ? 46.413  22.626  22.852  1.00 4.65  ? 367 PHE A CD1  1 
ATOM   3326  C  CD2  . PHE A 1 336 ? 47.301  23.042  25.031  1.00 2.00  ? 367 PHE A CD2  1 
ATOM   3327  C  CE1  . PHE A 1 336 ? 46.353  24.005  22.604  1.00 2.54  ? 367 PHE A CE1  1 
ATOM   3328  C  CE2  . PHE A 1 336 ? 47.245  24.410  24.791  1.00 2.00  ? 367 PHE A CE2  1 
ATOM   3329  C  CZ   . PHE A 1 336 ? 46.771  24.892  23.573  1.00 2.00  ? 367 PHE A CZ   1 
ATOM   3330  H  H    . PHE A 1 336 ? 44.521  20.229  23.794  1.00 17.00 ? 367 PHE A H    1 
ATOM   3331  N  N    . ASN A 1 337 ? 46.462  17.421  23.921  1.00 6.79  ? 368 ASN A N    1 
ATOM   3332  C  CA   . ASN A 1 337 ? 47.030  16.071  23.957  1.00 7.37  ? 368 ASN A CA   1 
ATOM   3333  C  C    . ASN A 1 337 ? 46.429  15.073  22.911  1.00 4.46  ? 368 ASN A C    1 
ATOM   3334  O  O    . ASN A 1 337 ? 46.739  13.880  22.906  1.00 2.00  ? 368 ASN A O    1 
ATOM   3335  C  CB   . ASN A 1 337 ? 46.987  15.514  25.380  1.00 8.12  ? 368 ASN A CB   1 
ATOM   3336  C  CG   . ASN A 1 337 ? 45.786  14.705  25.623  1.00 9.80  ? 368 ASN A CG   1 
ATOM   3337  O  OD1  . ASN A 1 337 ? 44.692  15.068  25.205  1.00 14.28 ? 368 ASN A OD1  1 
ATOM   3338  N  ND2  . ASN A 1 337 ? 45.969  13.564  26.256  1.00 16.41 ? 368 ASN A ND2  1 
ATOM   3339  H  H    . ASN A 1 337 ? 45.610  17.600  24.373  1.00 17.00 ? 368 ASN A H    1 
ATOM   3340  H  HD21 . ASN A 1 337 ? 45.160  13.039  26.400  1.00 17.00 ? 368 ASN A HD21 1 
ATOM   3341  H  HD22 . ASN A 1 337 ? 46.871  13.307  26.531  1.00 17.00 ? 368 ASN A HD22 1 
ATOM   3342  N  N    . GLN A 1 338 ? 45.631  15.589  21.990  1.00 2.90  ? 369 GLN A N    1 
ATOM   3343  C  CA   . GLN A 1 338 ? 45.029  14.773  20.952  1.00 4.66  ? 369 GLN A CA   1 
ATOM   3344  C  C    . GLN A 1 338 ? 45.594  15.162  19.605  1.00 4.72  ? 369 GLN A C    1 
ATOM   3345  O  O    . GLN A 1 338 ? 46.087  16.281  19.440  1.00 9.59  ? 369 GLN A O    1 
ATOM   3346  C  CB   . GLN A 1 338 ? 43.516  14.996  20.888  1.00 6.37  ? 369 GLN A CB   1 
ATOM   3347  C  CG   . GLN A 1 338 ? 42.680  13.815  21.342  1.00 11.76 ? 369 GLN A CG   1 
ATOM   3348  C  CD   . GLN A 1 338 ? 42.448  13.817  22.838  1.00 12.80 ? 369 GLN A CD   1 
ATOM   3349  O  OE1  . GLN A 1 338 ? 42.144  14.862  23.413  1.00 12.08 ? 369 GLN A OE1  1 
ATOM   3350  N  NE2  . GLN A 1 338 ? 42.585  12.647  23.478  1.00 11.75 ? 369 GLN A NE2  1 
ATOM   3351  H  H    . GLN A 1 338 ? 45.455  16.554  21.957  1.00 17.00 ? 369 GLN A H    1 
ATOM   3352  H  HE21 . GLN A 1 338 ? 42.438  12.711  24.444  1.00 17.00 ? 369 GLN A HE21 1 
ATOM   3353  H  HE22 . GLN A 1 338 ? 42.819  11.835  22.995  1.00 17.00 ? 369 GLN A HE22 1 
ATOM   3354  N  N    . GLN A 1 339 ? 45.514  14.248  18.645  1.00 2.66  ? 370 GLN A N    1 
ATOM   3355  C  CA   . GLN A 1 339 ? 45.976  14.530  17.306  1.00 2.00  ? 370 GLN A CA   1 
ATOM   3356  C  C    . GLN A 1 339 ? 44.942  15.497  16.806  1.00 2.77  ? 370 GLN A C    1 
ATOM   3357  O  O    . GLN A 1 339 ? 43.760  15.262  16.982  1.00 2.63  ? 370 GLN A O    1 
ATOM   3358  C  CB   . GLN A 1 339 ? 45.928  13.282  16.456  1.00 4.38  ? 370 GLN A CB   1 
ATOM   3359  C  CG   . GLN A 1 339 ? 46.452  12.052  17.140  1.00 5.45  ? 370 GLN A CG   1 
ATOM   3360  C  CD   . GLN A 1 339 ? 46.504  10.899  16.200  1.00 9.44  ? 370 GLN A CD   1 
ATOM   3361  O  OE1  . GLN A 1 339 ? 45.646  10.017  16.246  1.00 14.13 ? 370 GLN A OE1  1 
ATOM   3362  N  NE2  . GLN A 1 339 ? 47.491  10.901  15.312  1.00 10.11 ? 370 GLN A NE2  1 
ATOM   3363  H  H    . GLN A 1 339 ? 45.075  13.398  18.835  1.00 17.00 ? 370 GLN A H    1 
ATOM   3364  H  HE21 . GLN A 1 339 ? 47.491  10.146  14.679  1.00 17.00 ? 370 GLN A HE21 1 
ATOM   3365  H  HE22 . GLN A 1 339 ? 48.173  11.602  15.267  1.00 17.00 ? 370 GLN A HE22 1 
ATOM   3366  N  N    . PHE A 1 340 ? 45.384  16.612  16.235  1.00 4.92  ? 371 PHE A N    1 
ATOM   3367  C  CA   . PHE A 1 340 ? 44.484  17.650  15.738  1.00 2.86  ? 371 PHE A CA   1 
ATOM   3368  C  C    . PHE A 1 340 ? 45.253  18.473  14.744  1.00 2.59  ? 371 PHE A C    1 
ATOM   3369  O  O    . PHE A 1 340 ? 46.442  18.660  14.916  1.00 3.26  ? 371 PHE A O    1 
ATOM   3370  C  CB   . PHE A 1 340 ? 44.039  18.561  16.888  1.00 2.00  ? 371 PHE A CB   1 
ATOM   3371  C  CG   . PHE A 1 340 ? 43.084  19.622  16.461  1.00 2.01  ? 371 PHE A CG   1 
ATOM   3372  C  CD1  . PHE A 1 340 ? 41.841  19.290  15.961  1.00 3.67  ? 371 PHE A CD1  1 
ATOM   3373  C  CD2  . PHE A 1 340 ? 43.451  20.945  16.471  1.00 3.20  ? 371 PHE A CD2  1 
ATOM   3374  C  CE1  . PHE A 1 340 ? 40.977  20.263  15.465  1.00 4.31  ? 371 PHE A CE1  1 
ATOM   3375  C  CE2  . PHE A 1 340 ? 42.595  21.917  15.979  1.00 4.95  ? 371 PHE A CE2  1 
ATOM   3376  C  CZ   . PHE A 1 340 ? 41.351  21.569  15.470  1.00 3.29  ? 371 PHE A CZ   1 
ATOM   3377  H  H    . PHE A 1 340 ? 46.342  16.793  16.151  1.00 17.00 ? 371 PHE A H    1 
ATOM   3378  N  N    . GLN A 1 341 ? 44.596  18.936  13.689  1.00 3.29  ? 372 GLN A N    1 
ATOM   3379  C  CA   . GLN A 1 341 ? 45.266  19.773  12.694  1.00 3.34  ? 372 GLN A CA   1 
ATOM   3380  C  C    . GLN A 1 341 ? 44.794  21.192  12.856  1.00 2.42  ? 372 GLN A C    1 
ATOM   3381  O  O    . GLN A 1 341 ? 43.645  21.487  12.589  1.00 3.54  ? 372 GLN A O    1 
ATOM   3382  C  CB   . GLN A 1 341 ? 44.941  19.351  11.262  1.00 2.69  ? 372 GLN A CB   1 
ATOM   3383  C  CG   . GLN A 1 341 ? 45.306  17.916  10.922  1.00 5.25  ? 372 GLN A CG   1 
ATOM   3384  C  CD   . GLN A 1 341 ? 46.748  17.614  11.115  1.00 2.80  ? 372 GLN A CD   1 
ATOM   3385  O  OE1  . GLN A 1 341 ? 47.607  18.412  10.767  1.00 4.34  ? 372 GLN A OE1  1 
ATOM   3386  N  NE2  . GLN A 1 341 ? 47.033  16.446  11.668  1.00 3.75  ? 372 GLN A NE2  1 
ATOM   3387  H  H    . GLN A 1 341 ? 43.641  18.757  13.584  1.00 17.00 ? 372 GLN A H    1 
ATOM   3388  H  HE21 . GLN A 1 341 ? 47.984  16.253  11.830  1.00 17.00 ? 372 GLN A HE21 1 
ATOM   3389  H  HE22 . GLN A 1 341 ? 46.309  15.836  11.898  1.00 17.00 ? 372 GLN A HE22 1 
ATOM   3390  N  N    . TYR A 1 342 ? 45.650  22.051  13.363  1.00 2.00  ? 373 TYR A N    1 
ATOM   3391  C  CA   . TYR A 1 342 ? 45.287  23.427  13.486  1.00 2.00  ? 373 TYR A CA   1 
ATOM   3392  C  C    . TYR A 1 342 ? 45.429  24.021  12.090  1.00 2.78  ? 373 TYR A C    1 
ATOM   3393  O  O    . TYR A 1 342 ? 46.271  24.878  11.822  1.00 2.00  ? 373 TYR A O    1 
ATOM   3394  C  CB   . TYR A 1 342 ? 46.187  24.087  14.487  1.00 2.65  ? 373 TYR A CB   1 
ATOM   3395  C  CG   . TYR A 1 342 ? 46.035  23.471  15.842  1.00 2.40  ? 373 TYR A CG   1 
ATOM   3396  C  CD1  . TYR A 1 342 ? 46.761  22.371  16.199  1.00 2.00  ? 373 TYR A CD1  1 
ATOM   3397  C  CD2  . TYR A 1 342 ? 45.177  24.027  16.785  1.00 5.23  ? 373 TYR A CD2  1 
ATOM   3398  C  CE1  . TYR A 1 342 ? 46.655  21.838  17.468  1.00 4.09  ? 373 TYR A CE1  1 
ATOM   3399  C  CE2  . TYR A 1 342 ? 45.059  23.493  18.071  1.00 4.11  ? 373 TYR A CE2  1 
ATOM   3400  C  CZ   . TYR A 1 342 ? 45.804  22.407  18.406  1.00 2.55  ? 373 TYR A CZ   1 
ATOM   3401  O  OH   . TYR A 1 342 ? 45.721  21.927  19.690  1.00 2.01  ? 373 TYR A OH   1 
ATOM   3402  H  H    . TYR A 1 342 ? 46.548  21.729  13.596  1.00 17.00 ? 373 TYR A H    1 
ATOM   3403  H  HH   . TYR A 1 342 ? 45.125  22.491  20.195  1.00 17.00 ? 373 TYR A HH   1 
ATOM   3404  N  N    . GLN A 1 343 ? 44.546  23.546  11.217  1.00 4.94  ? 374 GLN A N    1 
ATOM   3405  C  CA   . GLN A 1 343 ? 44.492  23.921  9.821   1.00 5.73  ? 374 GLN A CA   1 
ATOM   3406  C  C    . GLN A 1 343 ? 43.056  23.689  9.345   1.00 6.46  ? 374 GLN A C    1 
ATOM   3407  O  O    . GLN A 1 343 ? 42.395  22.750  9.783   1.00 6.46  ? 374 GLN A O    1 
ATOM   3408  C  CB   . GLN A 1 343 ? 45.477  23.031  9.063   1.00 7.00  ? 374 GLN A CB   1 
ATOM   3409  C  CG   . GLN A 1 343 ? 45.165  22.784  7.602   1.00 8.67  ? 374 GLN A CG   1 
ATOM   3410  C  CD   . GLN A 1 343 ? 46.019  21.659  7.018   1.00 9.33  ? 374 GLN A CD   1 
ATOM   3411  O  OE1  . GLN A 1 343 ? 46.318  21.666  5.823   1.00 10.59 ? 374 GLN A OE1  1 
ATOM   3412  N  NE2  . GLN A 1 343 ? 46.400  20.682  7.854   1.00 5.64  ? 374 GLN A NE2  1 
ATOM   3413  H  H    . GLN A 1 343 ? 43.824  22.946  11.500  1.00 17.00 ? 374 GLN A H    1 
ATOM   3414  H  HE21 . GLN A 1 343 ? 46.988  20.006  7.459   1.00 17.00 ? 374 GLN A HE21 1 
ATOM   3415  H  HE22 . GLN A 1 343 ? 46.114  20.671  8.787   1.00 17.00 ? 374 GLN A HE22 1 
ATOM   3416  N  N    . ASN A 1 344 ? 42.599  24.529  8.418   1.00 8.75  ? 375 ASN A N    1 
ATOM   3417  C  CA   . ASN A 1 344 ? 41.240  24.445  7.868   1.00 6.70  ? 375 ASN A CA   1 
ATOM   3418  C  C    . ASN A 1 344 ? 41.109  24.952  6.421   1.00 5.63  ? 375 ASN A C    1 
ATOM   3419  O  O    . ASN A 1 344 ? 41.914  25.744  5.909   1.00 2.00  ? 375 ASN A O    1 
ATOM   3420  C  CB   . ASN A 1 344 ? 40.250  25.221  8.755   1.00 5.97  ? 375 ASN A CB   1 
ATOM   3421  C  CG   . ASN A 1 344 ? 38.826  25.133  8.242   1.00 4.01  ? 375 ASN A CG   1 
ATOM   3422  O  OD1  . ASN A 1 344 ? 38.201  24.075  8.316   1.00 3.17  ? 375 ASN A OD1  1 
ATOM   3423  N  ND2  . ASN A 1 344 ? 38.327  26.218  7.669   1.00 2.00  ? 375 ASN A ND2  1 
ATOM   3424  H  H    . ASN A 1 344 ? 43.177  25.237  8.069   1.00 17.00 ? 375 ASN A H    1 
ATOM   3425  H  HD21 . ASN A 1 344 ? 37.390  26.174  7.398   1.00 17.00 ? 375 ASN A HD21 1 
ATOM   3426  H  HD22 . ASN A 1 344 ? 38.928  26.996  7.588   1.00 17.00 ? 375 ASN A HD22 1 
ATOM   3427  N  N    . ARG A 1 345 ? 40.067  24.472  5.761   1.00 6.80  ? 376 ARG A N    1 
ATOM   3428  C  CA   . ARG A 1 345 ? 39.784  24.868  4.395   1.00 7.29  ? 376 ARG A CA   1 
ATOM   3429  C  C    . ARG A 1 345 ? 38.289  24.717  4.283   1.00 7.16  ? 376 ARG A C    1 
ATOM   3430  O  O    . ARG A 1 345 ? 37.805  23.579  4.384   1.00 8.06  ? 376 ARG A O    1 
ATOM   3431  C  CB   . ARG A 1 345 ? 40.442  23.910  3.430   1.00 4.66  ? 376 ARG A CB   1 
ATOM   3432  C  CG   . ARG A 1 345 ? 40.415  24.389  2.029   1.00 4.51  ? 376 ARG A CG   1 
ATOM   3433  C  CD   . ARG A 1 345 ? 41.667  25.168  1.749   1.00 4.43  ? 376 ARG A CD   1 
ATOM   3434  N  NE   . ARG A 1 345 ? 42.340  24.577  0.607   1.00 2.34  ? 376 ARG A NE   1 
ATOM   3435  C  CZ   . ARG A 1 345 ? 43.553  24.060  0.672   1.00 3.45  ? 376 ARG A CZ   1 
ATOM   3436  N  NH1  . ARG A 1 345 ? 44.223  24.079  1.814   1.00 8.41  ? 376 ARG A NH1  1 
ATOM   3437  N  NH2  . ARG A 1 345 ? 44.069  23.475  -0.379  1.00 2.00  ? 376 ARG A NH2  1 
ATOM   3438  H  H    . ARG A 1 345 ? 39.463  23.817  6.180   1.00 17.00 ? 376 ARG A H    1 
ATOM   3439  H  HE   . ARG A 1 345 ? 41.880  24.558  -0.258  1.00 17.00 ? 376 ARG A HE   1 
ATOM   3440  H  HH11 . ARG A 1 345 ? 43.819  24.484  2.634   1.00 17.00 ? 376 ARG A HH11 1 
ATOM   3441  H  HH12 . ARG A 1 345 ? 45.144  23.691  1.851   1.00 17.00 ? 376 ARG A HH12 1 
ATOM   3442  H  HH21 . ARG A 1 345 ? 43.586  23.399  -1.251  1.00 17.00 ? 376 ARG A HH21 1 
ATOM   3443  H  HH22 . ARG A 1 345 ? 44.965  23.072  -0.230  1.00 17.00 ? 376 ARG A HH22 1 
ATOM   3444  N  N    . ILE A 1 346 ? 37.564  25.845  4.128   1.00 7.47  ? 377 ILE A N    1 
ATOM   3445  C  CA   . ILE A 1 346 ? 36.082  25.832  4.035   1.00 5.62  ? 377 ILE A CA   1 
ATOM   3446  C  C    . ILE A 1 346 ? 35.547  25.268  2.751   1.00 4.67  ? 377 ILE A C    1 
ATOM   3447  O  O    . ILE A 1 346 ? 35.990  25.639  1.647   1.00 2.00  ? 377 ILE A O    1 
ATOM   3448  C  CB   . ILE A 1 346 ? 35.409  27.208  4.278   1.00 4.87  ? 377 ILE A CB   1 
ATOM   3449  C  CG1  . ILE A 1 346 ? 35.645  28.122  3.083   1.00 7.95  ? 377 ILE A CG1  1 
ATOM   3450  C  CG2  . ILE A 1 346 ? 35.925  27.844  5.575   1.00 3.98  ? 377 ILE A CG2  1 
ATOM   3451  C  CD1  . ILE A 1 346 ? 35.391  29.591  3.366   1.00 6.27  ? 377 ILE A CD1  1 
ATOM   3452  H  H    . ILE A 1 346 ? 38.000  26.711  4.131   1.00 17.00 ? 377 ILE A H    1 
ATOM   3453  N  N    . ALA A 1 347 ? 34.664  24.287  2.943   1.00 6.02  ? 378 ALA A N    1 
ATOM   3454  C  CA   . ALA A 1 347 ? 34.005  23.556  1.859   1.00 8.65  ? 378 ALA A CA   1 
ATOM   3455  C  C    . ALA A 1 347 ? 32.837  24.316  1.236   1.00 8.81  ? 378 ALA A C    1 
ATOM   3456  O  O    . ALA A 1 347 ? 32.367  25.312  1.796   1.00 9.96  ? 378 ALA A O    1 
ATOM   3457  C  CB   . ALA A 1 347 ? 33.513  22.198  2.373   1.00 6.22  ? 378 ALA A CB   1 
ATOM   3458  H  H    . ALA A 1 347 ? 34.447  24.043  3.863   1.00 17.00 ? 378 ALA A H    1 
ATOM   3459  N  N    . SER A 1 348 ? 32.374  23.846  0.080   1.00 7.76  ? 379 SER A N    1 
ATOM   3460  C  CA   . SER A 1 348 ? 31.224  24.467  -0.570  1.00 10.79 ? 379 SER A CA   1 
ATOM   3461  C  C    . SER A 1 348 ? 29.915  24.038  0.132   1.00 10.61 ? 379 SER A C    1 
ATOM   3462  O  O    . SER A 1 348 ? 28.975  24.845  0.241   1.00 12.10 ? 379 SER A O    1 
ATOM   3463  C  CB   . SER A 1 348 ? 31.168  24.148  -2.072  1.00 9.45  ? 379 SER A CB   1 
ATOM   3464  O  OG   . SER A 1 348 ? 32.129  23.183  -2.464  1.00 7.73  ? 379 SER A OG   1 
ATOM   3465  H  H    . SER A 1 348 ? 32.820  23.097  -0.370  1.00 17.00 ? 379 SER A H    1 
ATOM   3466  H  HG   . SER A 1 348 ? 33.025  23.529  -2.357  1.00 17.00 ? 379 SER A HG   1 
ATOM   3467  N  N    . GLU A 1 349 ? 29.877  22.798  0.633   1.00 7.11  ? 380 GLU A N    1 
ATOM   3468  C  CA   . GLU A 1 349 ? 28.705  22.280  1.346   1.00 5.34  ? 380 GLU A CA   1 
ATOM   3469  C  C    . GLU A 1 349 ? 28.410  23.172  2.553   1.00 6.07  ? 380 GLU A C    1 
ATOM   3470  O  O    . GLU A 1 349 ? 27.281  23.637  2.747   1.00 7.26  ? 380 GLU A O    1 
ATOM   3471  C  CB   . GLU A 1 349 ? 28.921  20.846  1.866   1.00 3.56  ? 380 GLU A CB   1 
ATOM   3472  C  CG   . GLU A 1 349 ? 30.102  20.091  1.295   1.00 3.36  ? 380 GLU A CG   1 
ATOM   3473  C  CD   . GLU A 1 349 ? 29.939  19.791  -0.162  1.00 2.18  ? 380 GLU A CD   1 
ATOM   3474  O  OE1  . GLU A 1 349 ? 29.405  20.628  -0.885  1.00 3.12  ? 380 GLU A OE1  1 
ATOM   3475  O  OE2  . GLU A 1 349 ? 30.333  18.709  -0.597  1.00 3.99  ? 380 GLU A OE2  1 
ATOM   3476  H  H    . GLU A 1 349 ? 30.672  22.261  0.483   1.00 17.00 ? 380 GLU A H    1 
ATOM   3477  N  N    . PHE A 1 350 ? 29.437  23.434  3.348   1.00 4.15  ? 381 PHE A N    1 
ATOM   3478  C  CA   . PHE A 1 350 ? 29.257  24.246  4.537   1.00 4.20  ? 381 PHE A CA   1 
ATOM   3479  C  C    . PHE A 1 350 ? 28.594  25.542  4.135   1.00 3.52  ? 381 PHE A C    1 
ATOM   3480  O  O    . PHE A 1 350 ? 27.685  26.007  4.808   1.00 2.00  ? 381 PHE A O    1 
ATOM   3481  C  CB   . PHE A 1 350 ? 30.605  24.506  5.219   1.00 3.67  ? 381 PHE A CB   1 
ATOM   3482  C  CG   . PHE A 1 350 ? 30.494  24.902  6.651   1.00 2.00  ? 381 PHE A CG   1 
ATOM   3483  C  CD1  . PHE A 1 350 ? 29.844  24.094  7.547   1.00 2.00  ? 381 PHE A CD1  1 
ATOM   3484  C  CD2  . PHE A 1 350 ? 31.017  26.099  7.097   1.00 2.00  ? 381 PHE A CD2  1 
ATOM   3485  C  CE1  . PHE A 1 350 ? 29.710  24.471  8.880   1.00 2.00  ? 381 PHE A CE1  1 
ATOM   3486  C  CE2  . PHE A 1 350 ? 30.889  26.489  8.421   1.00 2.00  ? 381 PHE A CE2  1 
ATOM   3487  C  CZ   . PHE A 1 350 ? 30.230  25.668  9.317   1.00 2.00  ? 381 PHE A CZ   1 
ATOM   3488  H  H    . PHE A 1 350 ? 30.321  23.082  3.136   1.00 17.00 ? 381 PHE A H    1 
ATOM   3489  N  N    . ASN A 1 351 ? 29.029  26.089  3.003   1.00 4.09  ? 382 ASN A N    1 
ATOM   3490  C  CA   . ASN A 1 351 ? 28.483  27.344  2.486   1.00 3.40  ? 382 ASN A CA   1 
ATOM   3491  C  C    . ASN A 1 351 ? 27.034  27.118  2.125   1.00 3.43  ? 382 ASN A C    1 
ATOM   3492  O  O    . ASN A 1 351 ? 26.158  27.742  2.706   1.00 2.85  ? 382 ASN A O    1 
ATOM   3493  C  CB   . ASN A 1 351 ? 29.299  27.831  1.279   1.00 3.77  ? 382 ASN A CB   1 
ATOM   3494  C  CG   . ASN A 1 351 ? 28.653  29.008  0.557   1.00 3.64  ? 382 ASN A CG   1 
ATOM   3495  O  OD1  . ASN A 1 351 ? 27.846  28.830  -0.356  1.00 4.30  ? 382 ASN A OD1  1 
ATOM   3496  N  ND2  . ASN A 1 351 ? 29.040  30.208  0.930   1.00 2.26  ? 382 ASN A ND2  1 
ATOM   3497  H  H    . ASN A 1 351 ? 29.716  25.622  2.492   1.00 17.00 ? 382 ASN A H    1 
ATOM   3498  H  HD21 . ASN A 1 351 ? 28.665  30.997  0.478   1.00 17.00 ? 382 ASN A HD21 1 
ATOM   3499  H  HD22 . ASN A 1 351 ? 29.706  30.297  1.632   1.00 17.00 ? 382 ASN A HD22 1 
ATOM   3500  N  N    . THR A 1 352 ? 26.779  26.208  1.192   1.00 3.24  ? 383 THR A N    1 
ATOM   3501  C  CA   . THR A 1 352 ? 25.420  25.905  0.796   1.00 3.92  ? 383 THR A CA   1 
ATOM   3502  C  C    . THR A 1 352 ? 24.517  25.631  2.023   1.00 3.76  ? 383 THR A C    1 
ATOM   3503  O  O    . THR A 1 352 ? 23.659  26.445  2.371   1.00 3.98  ? 383 THR A O    1 
ATOM   3504  C  CB   . THR A 1 352 ? 25.402  24.758  -0.249  1.00 2.23  ? 383 THR A CB   1 
ATOM   3505  O  OG1  . THR A 1 352 ? 25.248  25.323  -1.560  1.00 2.01  ? 383 THR A OG1  1 
ATOM   3506  C  CG2  . THR A 1 352 ? 24.293  23.754  0.028   1.00 2.00  ? 383 THR A CG2  1 
ATOM   3507  H  H    . THR A 1 352 ? 27.497  25.745  0.730   1.00 17.00 ? 383 THR A H    1 
ATOM   3508  H  HG1  . THR A 1 352 ? 25.115  24.612  -2.206  1.00 17.00 ? 383 THR A HG1  1 
ATOM   3509  N  N    . LEU A 1 353 ? 24.779  24.567  2.754   1.00 2.00  ? 384 LEU A N    1 
ATOM   3510  C  CA   . LEU A 1 353 ? 23.944  24.264  3.890   1.00 2.00  ? 384 LEU A CA   1 
ATOM   3511  C  C    . LEU A 1 353 ? 23.725  25.370  4.908   1.00 2.00  ? 384 LEU A C    1 
ATOM   3512  O  O    . LEU A 1 353 ? 22.887  25.242  5.780   1.00 2.00  ? 384 LEU A O    1 
ATOM   3513  C  CB   . LEU A 1 353 ? 24.483  23.008  4.591   1.00 3.92  ? 384 LEU A CB   1 
ATOM   3514  C  CG   . LEU A 1 353 ? 25.567  22.976  5.669   1.00 2.00  ? 384 LEU A CG   1 
ATOM   3515  C  CD1  . LEU A 1 353 ? 25.045  23.394  7.060   1.00 2.09  ? 384 LEU A CD1  1 
ATOM   3516  C  CD2  . LEU A 1 353 ? 26.095  21.570  5.728   1.00 2.00  ? 384 LEU A CD2  1 
ATOM   3517  H  H    . LEU A 1 353 ? 25.521  23.982  2.529   1.00 17.00 ? 384 LEU A H    1 
ATOM   3518  N  N    . TYR A 1 354 ? 24.509  26.428  4.838   1.00 2.45  ? 385 TYR A N    1 
ATOM   3519  C  CA   . TYR A 1 354 ? 24.412  27.511  5.822   1.00 2.81  ? 385 TYR A CA   1 
ATOM   3520  C  C    . TYR A 1 354 ? 23.517  28.619  5.339   1.00 3.57  ? 385 TYR A C    1 
ATOM   3521  O  O    . TYR A 1 354 ? 23.456  29.665  5.938   1.00 5.19  ? 385 TYR A O    1 
ATOM   3522  C  CB   . TYR A 1 354 ? 25.806  28.085  6.130   1.00 3.50  ? 385 TYR A CB   1 
ATOM   3523  C  CG   . TYR A 1 354 ? 26.129  28.179  7.596   1.00 2.00  ? 385 TYR A CG   1 
ATOM   3524  C  CD1  . TYR A 1 354 ? 25.728  29.281  8.338   1.00 3.62  ? 385 TYR A CD1  1 
ATOM   3525  C  CD2  . TYR A 1 354 ? 26.832  27.173  8.239   1.00 2.00  ? 385 TYR A CD2  1 
ATOM   3526  C  CE1  . TYR A 1 354 ? 26.017  29.389  9.699   1.00 2.74  ? 385 TYR A CE1  1 
ATOM   3527  C  CE2  . TYR A 1 354 ? 27.132  27.262  9.591   1.00 2.68  ? 385 TYR A CE2  1 
ATOM   3528  C  CZ   . TYR A 1 354 ? 26.723  28.375  10.318  1.00 3.48  ? 385 TYR A CZ   1 
ATOM   3529  O  OH   . TYR A 1 354 ? 27.030  28.504  11.656  1.00 2.71  ? 385 TYR A OH   1 
ATOM   3530  H  H    . TYR A 1 354 ? 25.202  26.508  4.152   1.00 17.00 ? 385 TYR A H    1 
ATOM   3531  H  HH   . TYR A 1 354 ? 27.598  27.781  11.930  1.00 17.00 ? 385 TYR A HH   1 
ATOM   3532  N  N    . HIS A 1 355 ? 22.864  28.420  4.209   1.00 5.28  ? 386 HIS A N    1 
ATOM   3533  C  CA   . HIS A 1 355 ? 21.984  29.439  3.679   1.00 3.68  ? 386 HIS A CA   1 
ATOM   3534  C  C    . HIS A 1 355 ? 20.754  29.362  4.536   1.00 4.18  ? 386 HIS A C    1 
ATOM   3535  O  O    . HIS A 1 355 ? 19.810  28.662  4.211   1.00 6.09  ? 386 HIS A O    1 
ATOM   3536  C  CB   . HIS A 1 355 ? 21.631  29.161  2.216   1.00 6.34  ? 386 HIS A CB   1 
ATOM   3537  C  CG   . HIS A 1 355 ? 22.787  29.283  1.272   1.00 5.92  ? 386 HIS A CG   1 
ATOM   3538  N  ND1  . HIS A 1 355 ? 24.083  29.474  1.697   1.00 8.15  ? 386 HIS A ND1  1 
ATOM   3539  C  CD2  . HIS A 1 355 ? 22.842  29.243  -0.079  1.00 6.69  ? 386 HIS A CD2  1 
ATOM   3540  C  CE1  . HIS A 1 355 ? 24.887  29.553  0.651   1.00 8.47  ? 386 HIS A CE1  1 
ATOM   3541  N  NE2  . HIS A 1 355 ? 24.157  29.416  -0.439  1.00 9.37  ? 386 HIS A NE2  1 
ATOM   3542  H  H    . HIS A 1 355 ? 22.948  27.556  3.761   1.00 17.00 ? 386 HIS A H    1 
ATOM   3543  H  HD1  . HIS A 1 355 ? 24.416  29.439  2.620   1.00 17.00 ? 386 HIS A HD1  1 
ATOM   3544  H  HE2  . HIS A 1 355 ? 24.507  29.456  -1.358  1.00 17.00 ? 386 HIS A HE2  1 
ATOM   3545  N  N    . TRP A 1 356 ? 20.799  30.057  5.659   1.00 4.60  ? 387 TRP A N    1 
ATOM   3546  C  CA   . TRP A 1 356 ? 19.698  30.077  6.596   1.00 5.61  ? 387 TRP A CA   1 
ATOM   3547  C  C    . TRP A 1 356 ? 18.706  31.244  6.448   1.00 7.89  ? 387 TRP A C    1 
ATOM   3548  O  O    . TRP A 1 356 ? 18.268  31.856  7.462   1.00 7.13  ? 387 TRP A O    1 
ATOM   3549  C  CB   . TRP A 1 356 ? 20.234  30.026  8.017   1.00 4.91  ? 387 TRP A CB   1 
ATOM   3550  C  CG   . TRP A 1 356 ? 20.944  28.793  8.331   1.00 5.12  ? 387 TRP A CG   1 
ATOM   3551  C  CD1  . TRP A 1 356 ? 21.017  27.661  7.565   1.00 6.53  ? 387 TRP A CD1  1 
ATOM   3552  C  CD2  . TRP A 1 356 ? 21.702  28.531  9.513   1.00 6.20  ? 387 TRP A CD2  1 
ATOM   3553  N  NE1  . TRP A 1 356 ? 21.788  26.705  8.201   1.00 5.46  ? 387 TRP A NE1  1 
ATOM   3554  C  CE2  . TRP A 1 356 ? 22.218  27.206  9.399   1.00 3.94  ? 387 TRP A CE2  1 
ATOM   3555  C  CE3  . TRP A 1 356 ? 21.997  29.282  10.661  1.00 4.49  ? 387 TRP A CE3  1 
ATOM   3556  C  CZ2  . TRP A 1 356 ? 23.009  26.615  10.387  1.00 2.00  ? 387 TRP A CZ2  1 
ATOM   3557  C  CZ3  . TRP A 1 356 ? 22.793  28.686  11.653  1.00 5.91  ? 387 TRP A CZ3  1 
ATOM   3558  C  CH2  . TRP A 1 356 ? 23.289  27.354  11.500  1.00 2.60  ? 387 TRP A CH2  1 
ATOM   3559  H  H    . TRP A 1 356 ? 21.616  30.557  5.882   1.00 17.00 ? 387 TRP A H    1 
ATOM   3560  H  HE1  . TRP A 1 356 ? 22.047  25.843  7.796   1.00 17.00 ? 387 TRP A HE1  1 
ATOM   3561  N  N    . HIS A 1 357 ? 18.320  31.521  5.198   1.00 7.84  ? 388 HIS A N    1 
ATOM   3562  C  CA   . HIS A 1 357 ? 17.327  32.568  4.905   1.00 8.98  ? 388 HIS A CA   1 
ATOM   3563  C  C    . HIS A 1 357 ? 16.019  32.268  5.663   1.00 7.35  ? 388 HIS A C    1 
ATOM   3564  O  O    . HIS A 1 357 ? 15.285  33.169  6.039   1.00 5.85  ? 388 HIS A O    1 
ATOM   3565  C  CB   . HIS A 1 357 ? 17.110  32.691  3.398   1.00 8.70  ? 388 HIS A CB   1 
ATOM   3566  C  CG   . HIS A 1 357 ? 18.458  33.073  2.775   1.00 10.72 ? 388 HIS A CG   1 
ATOM   3567  N  ND1  . HIS A 1 357 ? 19.269  32.173  2.059   1.00 9.12  ? 388 HIS A ND1  1 
ATOM   3568  C  CD2  . HIS A 1 357 ? 19.059  34.335  2.895   1.00 9.17  ? 388 HIS A CD2  1 
ATOM   3569  C  CE1  . HIS A 1 357 ? 20.358  32.917  1.753   1.00 5.92  ? 388 HIS A CE1  1 
ATOM   3570  N  NE2  . HIS A 1 357 ? 20.280  34.157  2.205   1.00 6.91  ? 388 HIS A NE2  1 
ATOM   3571  H  H    . HIS A 1 357 ? 18.701  30.993  4.470   1.00 17.00 ? 388 HIS A H    1 
ATOM   3572  H  HD1  . HIS A 1 357 ? 19.074  31.246  1.806   1.00 17.00 ? 388 HIS A HD1  1 
ATOM   3573  N  N    . PRO A 1 358 ? 15.686  30.985  5.837   1.00 6.33  ? 389 PRO A N    1 
ATOM   3574  C  CA   . PRO A 1 358 ? 14.464  30.694  6.575   1.00 7.21  ? 389 PRO A CA   1 
ATOM   3575  C  C    . PRO A 1 358 ? 14.460  31.380  7.937   1.00 6.58  ? 389 PRO A C    1 
ATOM   3576  O  O    . PRO A 1 358 ? 13.423  31.451  8.600   1.00 8.58  ? 389 PRO A O    1 
ATOM   3577  C  CB   . PRO A 1 358 ? 14.523  29.168  6.691   1.00 7.18  ? 389 PRO A CB   1 
ATOM   3578  C  CG   . PRO A 1 358 ? 14.990  28.808  5.318   1.00 2.98  ? 389 PRO A CG   1 
ATOM   3579  C  CD   . PRO A 1 358 ? 16.071  29.809  5.023   1.00 4.99  ? 389 PRO A CD   1 
ATOM   3580  N  N    . LEU A 1 359 ? 15.619  31.856  8.368   1.00 3.42  ? 390 LEU A N    1 
ATOM   3581  C  CA   . LEU A 1 359 ? 15.698  32.537  9.648   1.00 7.56  ? 390 LEU A CA   1 
ATOM   3582  C  C    . LEU A 1 359 ? 14.958  33.883  9.618   1.00 9.43  ? 390 LEU A C    1 
ATOM   3583  O  O    . LEU A 1 359 ? 14.372  34.312  10.616  1.00 8.51  ? 390 LEU A O    1 
ATOM   3584  C  CB   . LEU A 1 359 ? 17.162  32.755  10.009  1.00 8.41  ? 390 LEU A CB   1 
ATOM   3585  C  CG   . LEU A 1 359 ? 17.851  31.595  10.703  1.00 8.00  ? 390 LEU A CG   1 
ATOM   3586  C  CD1  . LEU A 1 359 ? 19.335  31.804  10.623  1.00 8.33  ? 390 LEU A CD1  1 
ATOM   3587  C  CD2  . LEU A 1 359 ? 17.367  31.505  12.157  1.00 7.23  ? 390 LEU A CD2  1 
ATOM   3588  H  H    . LEU A 1 359 ? 16.444  31.735  7.874   1.00 17.00 ? 390 LEU A H    1 
ATOM   3589  N  N    . LEU A 1 360 ? 14.985  34.509  8.438   1.00 11.61 ? 391 LEU A N    1 
ATOM   3590  C  CA   . LEU A 1 360 ? 14.403  35.823  8.119   1.00 9.20  ? 391 LEU A CA   1 
ATOM   3591  C  C    . LEU A 1 360 ? 12.909  36.075  8.317   1.00 9.46  ? 391 LEU A C    1 
ATOM   3592  O  O    . LEU A 1 360 ? 12.054  35.356  7.780   1.00 11.92 ? 391 LEU A O    1 
ATOM   3593  C  CB   . LEU A 1 360 ? 14.716  36.146  6.675   1.00 5.02  ? 391 LEU A CB   1 
ATOM   3594  C  CG   . LEU A 1 360 ? 16.157  36.460  6.446   1.00 2.72  ? 391 LEU A CG   1 
ATOM   3595  C  CD1  . LEU A 1 360 ? 16.382  36.560  4.946   1.00 5.95  ? 391 LEU A CD1  1 
ATOM   3596  C  CD2  . LEU A 1 360 ? 16.439  37.751  7.169   1.00 2.01  ? 391 LEU A CD2  1 
ATOM   3597  H  H    . LEU A 1 360 ? 15.411  34.019  7.714   1.00 17.00 ? 391 LEU A H    1 
ATOM   3598  N  N    . PRO A 1 361 ? 12.576  37.165  9.013   1.00 8.45  ? 392 PRO A N    1 
ATOM   3599  C  CA   . PRO A 1 361 ? 11.193  37.549  9.278   1.00 8.75  ? 392 PRO A CA   1 
ATOM   3600  C  C    . PRO A 1 361 ? 10.661  38.244  8.029   1.00 8.94  ? 392 PRO A C    1 
ATOM   3601  O  O    . PRO A 1 361 ? 11.423  38.525  7.090   1.00 6.32  ? 392 PRO A O    1 
ATOM   3602  C  CB   . PRO A 1 361 ? 11.350  38.553  10.406  1.00 9.06  ? 392 PRO A CB   1 
ATOM   3603  C  CG   . PRO A 1 361 ? 12.575  39.276  9.989   1.00 8.10  ? 392 PRO A CG   1 
ATOM   3604  C  CD   . PRO A 1 361 ? 13.507  38.138  9.600   1.00 8.85  ? 392 PRO A CD   1 
ATOM   3605  N  N    . ASP A 1 362 ? 9.366   38.556  8.031   1.00 8.90  ? 393 ASP A N    1 
ATOM   3606  C  CA   . ASP A 1 362 ? 8.760   39.233  6.892   1.00 6.66  ? 393 ASP A CA   1 
ATOM   3607  C  C    . ASP A 1 362 ? 8.846   40.740  7.102   1.00 4.57  ? 393 ASP A C    1 
ATOM   3608  O  O    . ASP A 1 362 ? 8.725   41.513  6.164   1.00 3.61  ? 393 ASP A O    1 
ATOM   3609  C  CB   . ASP A 1 362 ? 7.315   38.755  6.689   1.00 11.74 ? 393 ASP A CB   1 
ATOM   3610  C  CG   . ASP A 1 362 ? 7.215   37.246  6.319   1.00 16.59 ? 393 ASP A CG   1 
ATOM   3611  O  OD1  . ASP A 1 362 ? 7.395   36.899  5.123   1.00 17.02 ? 393 ASP A OD1  1 
ATOM   3612  O  OD2  . ASP A 1 362 ? 6.933   36.414  7.221   1.00 18.83 ? 393 ASP A OD2  1 
ATOM   3613  H  H    . ASP A 1 362 ? 8.810   38.337  8.801   1.00 17.00 ? 393 ASP A H    1 
ATOM   3614  N  N    . THR A 1 363 ? 9.093   41.147  8.343   1.00 5.93  ? 394 THR A N    1 
ATOM   3615  C  CA   . THR A 1 363 ? 9.232   42.561  8.705   1.00 7.22  ? 394 THR A CA   1 
ATOM   3616  C  C    . THR A 1 363 ? 10.373  42.730  9.669   1.00 7.17  ? 394 THR A C    1 
ATOM   3617  O  O    . THR A 1 363 ? 10.494  42.002  10.652  1.00 6.59  ? 394 THR A O    1 
ATOM   3618  C  CB   . THR A 1 363 ? 8.005   43.148  9.438   1.00 9.13  ? 394 THR A CB   1 
ATOM   3619  O  OG1  . THR A 1 363 ? 7.206   42.096  10.006  1.00 11.48 ? 394 THR A OG1  1 
ATOM   3620  C  CG2  . THR A 1 363 ? 7.180   44.032  8.512   1.00 8.23  ? 394 THR A CG2  1 
ATOM   3621  H  H    . THR A 1 363 ? 9.179   40.516  9.079   1.00 17.00 ? 394 THR A H    1 
ATOM   3622  H  HG1  . THR A 1 363 ? 6.376   42.461  10.325  1.00 17.00 ? 394 THR A HG1  1 
ATOM   3623  N  N    . PHE A 1 364 ? 11.208  43.714  9.399   1.00 8.24  ? 395 PHE A N    1 
ATOM   3624  C  CA   . PHE A 1 364 ? 12.328  43.965  10.265  1.00 7.97  ? 395 PHE A CA   1 
ATOM   3625  C  C    . PHE A 1 364 ? 11.769  44.992  11.189  1.00 9.26  ? 395 PHE A C    1 
ATOM   3626  O  O    . PHE A 1 364 ? 11.632  46.171  10.855  1.00 12.25 ? 395 PHE A O    1 
ATOM   3627  C  CB   . PHE A 1 364 ? 13.494  44.409  9.413   1.00 6.83  ? 395 PHE A CB   1 
ATOM   3628  C  CG   . PHE A 1 364 ? 13.921  43.353  8.436   1.00 5.69  ? 395 PHE A CG   1 
ATOM   3629  C  CD1  . PHE A 1 364 ? 14.575  42.199  8.891   1.00 4.68  ? 395 PHE A CD1  1 
ATOM   3630  C  CD2  . PHE A 1 364 ? 13.570  43.446  7.081   1.00 4.44  ? 395 PHE A CD2  1 
ATOM   3631  C  CE1  . PHE A 1 364 ? 14.863  41.154  8.023   1.00 4.23  ? 395 PHE A CE1  1 
ATOM   3632  C  CE2  . PHE A 1 364 ? 13.858  42.411  6.199   1.00 2.71  ? 395 PHE A CE2  1 
ATOM   3633  C  CZ   . PHE A 1 364 ? 14.505  41.258  6.675   1.00 5.02  ? 395 PHE A CZ   1 
ATOM   3634  H  H    . PHE A 1 364 ? 11.053  44.270  8.604   1.00 17.00 ? 395 PHE A H    1 
ATOM   3635  N  N    . ASN A 1 365 ? 11.278  44.484  12.301  1.00 9.65  ? 396 ASN A N    1 
ATOM   3636  C  CA   . ASN A 1 365 ? 10.615  45.315  13.275  1.00 11.56 ? 396 ASN A CA   1 
ATOM   3637  C  C    . ASN A 1 365 ? 11.475  45.928  14.391  1.00 10.06 ? 396 ASN A C    1 
ATOM   3638  O  O    . ASN A 1 365 ? 11.725  45.290  15.433  1.00 9.55  ? 396 ASN A O    1 
ATOM   3639  C  CB   . ASN A 1 365 ? 9.436   44.512  13.831  1.00 14.88 ? 396 ASN A CB   1 
ATOM   3640  C  CG   . ASN A 1 365 ? 9.029   44.951  15.223  1.00 20.29 ? 396 ASN A CG   1 
ATOM   3641  O  OD1  . ASN A 1 365 ? 8.761   46.138  15.462  1.00 24.85 ? 396 ASN A OD1  1 
ATOM   3642  N  ND2  . ASN A 1 365 ? 9.033   44.006  16.171  1.00 22.67 ? 396 ASN A ND2  1 
ATOM   3643  H  H    . ASN A 1 365 ? 11.390  43.534  12.510  1.00 17.00 ? 396 ASN A H    1 
ATOM   3644  H  HD21 . ASN A 1 365 ? 8.772   44.243  17.078  1.00 17.00 ? 396 ASN A HD21 1 
ATOM   3645  H  HD22 . ASN A 1 365 ? 9.326   43.112  15.905  1.00 17.00 ? 396 ASN A HD22 1 
ATOM   3646  N  N    . ILE A 1 366 ? 11.979  47.141  14.156  1.00 8.17  ? 397 ILE A N    1 
ATOM   3647  C  CA   . ILE A 1 366 ? 12.745  47.811  15.193  1.00 7.42  ? 397 ILE A CA   1 
ATOM   3648  C  C    . ILE A 1 366 ? 11.747  48.589  16.047  1.00 8.95  ? 397 ILE A C    1 
ATOM   3649  O  O    . ILE A 1 366 ? 11.348  49.717  15.702  1.00 4.10  ? 397 ILE A O    1 
ATOM   3650  C  CB   . ILE A 1 366 ? 13.859  48.726  14.670  1.00 6.11  ? 397 ILE A CB   1 
ATOM   3651  C  CG1  . ILE A 1 366 ? 15.155  47.929  14.495  1.00 2.96  ? 397 ILE A CG1  1 
ATOM   3652  C  CG2  . ILE A 1 366 ? 14.151  49.840  15.705  1.00 7.48  ? 397 ILE A CG2  1 
ATOM   3653  C  CD1  . ILE A 1 366 ? 15.132  46.984  13.349  1.00 4.02  ? 397 ILE A CD1  1 
ATOM   3654  H  H    . ILE A 1 366 ? 11.769  47.592  13.318  1.00 17.00 ? 397 ILE A H    1 
ATOM   3655  N  N    . GLU A 1 367 ? 11.298  47.894  17.101  1.00 10.24 ? 398 GLU A N    1 
ATOM   3656  C  CA   . GLU A 1 367 ? 10.330  48.370  18.079  1.00 11.83 ? 398 GLU A CA   1 
ATOM   3657  C  C    . GLU A 1 367 ? 9.847   49.770  17.785  1.00 11.62 ? 398 GLU A C    1 
ATOM   3658  O  O    . GLU A 1 367 ? 10.654  50.726  17.705  1.00 7.48  ? 398 GLU A O    1 
ATOM   3659  C  CB   . GLU A 1 367 ? 10.896  48.299  19.513  1.00 15.98 ? 398 GLU A CB   1 
ATOM   3660  C  CG   . GLU A 1 367 ? 11.669  46.990  19.892  1.00 17.74 ? 398 GLU A CG   1 
ATOM   3661  C  CD   . GLU A 1 367 ? 10.843  45.692  19.827  1.00 20.27 ? 398 GLU A CD   1 
ATOM   3662  O  OE1  . GLU A 1 367 ? 10.371  45.350  18.710  1.00 22.28 ? 398 GLU A OE1  1 
ATOM   3663  O  OE2  . GLU A 1 367 ? 10.718  44.995  20.879  1.00 16.61 ? 398 GLU A OE2  1 
ATOM   3664  H  H    . GLU A 1 367 ? 11.666  46.990  17.190  1.00 17.00 ? 398 GLU A H    1 
ATOM   3665  N  N    . ASP A 1 368 ? 8.524   49.843  17.605  1.00 12.44 ? 399 ASP A N    1 
ATOM   3666  C  CA   . ASP A 1 368 ? 7.776   51.066  17.310  1.00 12.05 ? 399 ASP A CA   1 
ATOM   3667  C  C    . ASP A 1 368 ? 7.880   51.366  15.840  1.00 11.33 ? 399 ASP A C    1 
ATOM   3668  O  O    . ASP A 1 368 ? 7.874   52.537  15.431  1.00 12.93 ? 399 ASP A O    1 
ATOM   3669  C  CB   . ASP A 1 368 ? 8.248   52.272  18.141  1.00 12.17 ? 399 ASP A CB   1 
ATOM   3670  C  CG   . ASP A 1 368 ? 7.275   53.443  18.096  1.00 9.82  ? 399 ASP A CG   1 
ATOM   3671  O  OD1  . ASP A 1 368 ? 6.243   53.363  18.790  1.00 10.25 ? 399 ASP A OD1  1 
ATOM   3672  O  OD2  . ASP A 1 368 ? 7.553   54.441  17.382  1.00 10.80 ? 399 ASP A OD2  1 
ATOM   3673  H  H    . ASP A 1 368 ? 8.031   49.004  17.658  1.00 17.00 ? 399 ASP A H    1 
ATOM   3674  N  N    . GLN A 1 369 ? 8.055   50.301  15.066  1.00 10.07 ? 400 GLN A N    1 
ATOM   3675  C  CA   . GLN A 1 369 ? 8.095   50.387  13.613  1.00 12.52 ? 400 GLN A CA   1 
ATOM   3676  C  C    . GLN A 1 369 ? 8.513   49.075  13.014  1.00 12.73 ? 400 GLN A C    1 
ATOM   3677  O  O    . GLN A 1 369 ? 9.210   48.288  13.641  1.00 13.37 ? 400 GLN A O    1 
ATOM   3678  C  CB   . GLN A 1 369 ? 8.982   51.510  13.079  1.00 13.96 ? 400 GLN A CB   1 
ATOM   3679  C  CG   . GLN A 1 369 ? 8.458   52.038  11.749  1.00 15.67 ? 400 GLN A CG   1 
ATOM   3680  C  CD   . GLN A 1 369 ? 8.866   53.485  11.460  1.00 20.37 ? 400 GLN A CD   1 
ATOM   3681  O  OE1  . GLN A 1 369 ? 9.664   54.092  12.187  1.00 21.37 ? 400 GLN A OE1  1 
ATOM   3682  N  NE2  . GLN A 1 369 ? 8.318   54.042  10.381  1.00 21.19 ? 400 GLN A NE2  1 
ATOM   3683  H  H    . GLN A 1 369 ? 8.225   49.421  15.459  1.00 17.00 ? 400 GLN A H    1 
ATOM   3684  H  HE21 . GLN A 1 369 ? 8.582   54.968  10.205  1.00 17.00 ? 400 GLN A HE21 1 
ATOM   3685  H  HE22 . GLN A 1 369 ? 7.698   53.525  9.833   1.00 17.00 ? 400 GLN A HE22 1 
ATOM   3686  N  N    . GLU A 1 370 ? 8.015   48.817  11.816  1.00 13.29 ? 401 GLU A N    1 
ATOM   3687  C  CA   . GLU A 1 370 ? 8.329   47.595  11.110  1.00 13.03 ? 401 GLU A CA   1 
ATOM   3688  C  C    . GLU A 1 370 ? 8.623   47.978  9.674   1.00 9.69  ? 401 GLU A C    1 
ATOM   3689  O  O    . GLU A 1 370 ? 7.840   48.687  9.035   1.00 2.37  ? 401 GLU A O    1 
ATOM   3690  C  CB   . GLU A 1 370 ? 7.153   46.603  11.166  1.00 19.53 ? 401 GLU A CB   1 
ATOM   3691  C  CG   . GLU A 1 370 ? 6.823   46.080  12.579  1.00 25.87 ? 401 GLU A CG   1 
ATOM   3692  C  CD   . GLU A 1 370 ? 6.079   44.738  12.598  1.00 29.84 ? 401 GLU A CD   1 
ATOM   3693  O  OE1  . GLU A 1 370 ? 6.761   43.667  12.497  1.00 27.16 ? 401 GLU A OE1  1 
ATOM   3694  O  OE2  . GLU A 1 370 ? 4.820   44.773  12.751  1.00 33.42 ? 401 GLU A OE2  1 
ATOM   3695  H  H    . GLU A 1 370 ? 7.430   49.453  11.360  1.00 17.00 ? 401 GLU A H    1 
ATOM   3696  N  N    . TYR A 1 371 ? 9.765   47.503  9.187   1.00 9.49  ? 402 TYR A N    1 
ATOM   3697  C  CA   . TYR A 1 371 ? 10.223  47.767  7.828   1.00 7.95  ? 402 TYR A CA   1 
ATOM   3698  C  C    . TYR A 1 371 ? 10.104  46.540  6.902   1.00 6.52  ? 402 TYR A C    1 
ATOM   3699  O  O    . TYR A 1 371 ? 10.121  45.368  7.358   1.00 4.90  ? 402 TYR A O    1 
ATOM   3700  C  CB   . TYR A 1 371 ? 11.671  48.273  7.864   1.00 5.18  ? 402 TYR A CB   1 
ATOM   3701  C  CG   . TYR A 1 371 ? 11.836  49.515  8.686   1.00 2.00  ? 402 TYR A CG   1 
ATOM   3702  C  CD1  . TYR A 1 371 ? 12.071  49.441  10.048  1.00 2.36  ? 402 TYR A CD1  1 
ATOM   3703  C  CD2  . TYR A 1 371 ? 11.768  50.761  8.104   1.00 2.00  ? 402 TYR A CD2  1 
ATOM   3704  C  CE1  . TYR A 1 371 ? 12.240  50.591  10.815  1.00 2.01  ? 402 TYR A CE1  1 
ATOM   3705  C  CE2  . TYR A 1 371 ? 11.936  51.908  8.845   1.00 2.00  ? 402 TYR A CE2  1 
ATOM   3706  C  CZ   . TYR A 1 371 ? 12.181  51.831  10.202  1.00 2.00  ? 402 TYR A CZ   1 
ATOM   3707  O  OH   . TYR A 1 371 ? 12.444  52.999  10.918  1.00 3.16  ? 402 TYR A OH   1 
ATOM   3708  H  H    . TYR A 1 371 ? 10.340  46.944  9.742   1.00 17.00 ? 402 TYR A H    1 
ATOM   3709  H  HH   . TYR A 1 371 ? 12.399  53.762  10.319  1.00 17.00 ? 402 TYR A HH   1 
ATOM   3710  N  N    . SER A 1 372 ? 9.950   46.838  5.611   1.00 5.48  ? 403 SER A N    1 
ATOM   3711  C  CA   . SER A 1 372 ? 9.832   45.833  4.557   1.00 6.13  ? 403 SER A CA   1 
ATOM   3712  C  C    . SER A 1 372 ? 11.205  45.529  4.089   1.00 5.73  ? 403 SER A C    1 
ATOM   3713  O  O    . SER A 1 372 ? 12.097  46.342  4.270   1.00 8.74  ? 403 SER A O    1 
ATOM   3714  C  CB   . SER A 1 372 ? 9.099   46.397  3.359   1.00 7.60  ? 403 SER A CB   1 
ATOM   3715  O  OG   . SER A 1 372 ? 9.851   47.437  2.780   1.00 2.79  ? 403 SER A OG   1 
ATOM   3716  H  H    . SER A 1 372 ? 9.909   47.790  5.385   1.00 17.00 ? 403 SER A H    1 
ATOM   3717  H  HG   . SER A 1 372 ? 9.712   48.199  3.354   1.00 17.00 ? 403 SER A HG   1 
ATOM   3718  N  N    . PHE A 1 373 ? 11.387  44.396  3.438   1.00 5.48  ? 404 PHE A N    1 
ATOM   3719  C  CA   . PHE A 1 373 ? 12.716  44.086  2.955   1.00 5.17  ? 404 PHE A CA   1 
ATOM   3720  C  C    . PHE A 1 373 ? 13.141  45.328  2.164   1.00 4.57  ? 404 PHE A C    1 
ATOM   3721  O  O    . PHE A 1 373 ? 14.059  46.029  2.556   1.00 2.03  ? 404 PHE A O    1 
ATOM   3722  C  CB   . PHE A 1 373 ? 12.721  42.808  2.073   1.00 4.82  ? 404 PHE A CB   1 
ATOM   3723  C  CG   . PHE A 1 373 ? 12.927  41.532  2.843   1.00 2.00  ? 404 PHE A CG   1 
ATOM   3724  C  CD1  . PHE A 1 373 ? 11.962  41.073  3.723   1.00 4.29  ? 404 PHE A CD1  1 
ATOM   3725  C  CD2  . PHE A 1 373 ? 14.071  40.784  2.679   1.00 2.02  ? 404 PHE A CD2  1 
ATOM   3726  C  CE1  . PHE A 1 373 ? 12.131  39.867  4.438   1.00 4.27  ? 404 PHE A CE1  1 
ATOM   3727  C  CE2  . PHE A 1 373 ? 14.249  39.587  3.383   1.00 6.11  ? 404 PHE A CE2  1 
ATOM   3728  C  CZ   . PHE A 1 373 ? 13.270  39.129  4.266   1.00 3.18  ? 404 PHE A CZ   1 
ATOM   3729  H  H    . PHE A 1 373 ? 10.647  43.767  3.310   1.00 17.00 ? 404 PHE A H    1 
ATOM   3730  N  N    . LYS A 1 374 ? 12.279  45.721  1.236   1.00 6.59  ? 405 LYS A N    1 
ATOM   3731  C  CA   . LYS A 1 374 ? 12.517  46.861  0.356   1.00 7.70  ? 405 LYS A CA   1 
ATOM   3732  C  C    . LYS A 1 374 ? 13.074  48.096  1.036   1.00 8.92  ? 405 LYS A C    1 
ATOM   3733  O  O    . LYS A 1 374 ? 13.800  48.870  0.418   1.00 7.14  ? 405 LYS A O    1 
ATOM   3734  C  CB   . LYS A 1 374 ? 11.222  47.242  -0.359  1.00 8.09  ? 405 LYS A CB   1 
ATOM   3735  C  CG   . LYS A 1 374 ? 10.756  46.235  -1.384  1.00 8.28  ? 405 LYS A CG   1 
ATOM   3736  C  CD   . LYS A 1 374 ? 10.355  44.895  -0.755  1.00 7.31  ? 405 LYS A CD   1 
ATOM   3737  C  CE   . LYS A 1 374 ? 10.131  43.837  -1.833  1.00 5.64  ? 405 LYS A CE   1 
ATOM   3738  N  NZ   . LYS A 1 374 ? 9.274   42.755  -1.301  1.00 10.70 ? 405 LYS A NZ   1 
ATOM   3739  H  H    . LYS A 1 374 ? 11.438  45.244  1.209   1.00 17.00 ? 405 LYS A H    1 
ATOM   3740  H  HZ1  . LYS A 1 374 ? 8.385   43.154  -0.937  1.00 17.00 ? 405 LYS A HZ1  1 
ATOM   3741  H  HZ2  . LYS A 1 374 ? 9.060   42.096  -2.076  1.00 17.00 ? 405 LYS A HZ2  1 
ATOM   3742  H  HZ3  . LYS A 1 374 ? 9.761   42.246  -0.537  1.00 17.00 ? 405 LYS A HZ3  1 
ATOM   3743  N  N    . GLN A 1 375 ? 12.695  48.282  2.299   1.00 12.89 ? 406 GLN A N    1 
ATOM   3744  C  CA   . GLN A 1 375 ? 13.108  49.434  3.115   1.00 13.61 ? 406 GLN A CA   1 
ATOM   3745  C  C    . GLN A 1 375 ? 14.341  49.186  3.943   1.00 13.16 ? 406 GLN A C    1 
ATOM   3746  O  O    . GLN A 1 375 ? 15.128  50.103  4.171   1.00 13.49 ? 406 GLN A O    1 
ATOM   3747  C  CB   . GLN A 1 375 ? 12.020  49.812  4.109   1.00 14.82 ? 406 GLN A CB   1 
ATOM   3748  C  CG   . GLN A 1 375 ? 10.791  50.359  3.523   1.00 20.02 ? 406 GLN A CG   1 
ATOM   3749  C  CD   . GLN A 1 375 ? 9.769   50.623  4.590   1.00 24.52 ? 406 GLN A CD   1 
ATOM   3750  O  OE1  . GLN A 1 375 ? 9.347   49.708  5.305   1.00 23.41 ? 406 GLN A OE1  1 
ATOM   3751  N  NE2  . GLN A 1 375 ? 9.385   51.884  4.735   1.00 29.20 ? 406 GLN A NE2  1 
ATOM   3752  H  H    . GLN A 1 375 ? 12.117  47.612  2.708   1.00 17.00 ? 406 GLN A H    1 
ATOM   3753  H  HE21 . GLN A 1 375 ? 8.703   52.060  5.412   1.00 17.00 ? 406 GLN A HE21 1 
ATOM   3754  H  HE22 . GLN A 1 375 ? 9.793   52.567  4.156   1.00 17.00 ? 406 GLN A HE22 1 
ATOM   3755  N  N    . PHE A 1 376 ? 14.428  47.982  4.502   1.00 10.07 ? 407 PHE A N    1 
ATOM   3756  C  CA   . PHE A 1 376 ? 15.545  47.630  5.353   1.00 8.03  ? 407 PHE A CA   1 
ATOM   3757  C  C    . PHE A 1 376 ? 16.857  47.516  4.563   1.00 6.84  ? 407 PHE A C    1 
ATOM   3758  O  O    . PHE A 1 376 ? 17.885  48.051  4.985   1.00 4.58  ? 407 PHE A O    1 
ATOM   3759  C  CB   . PHE A 1 376 ? 15.235  46.344  6.119   1.00 5.19  ? 407 PHE A CB   1 
ATOM   3760  C  CG   . PHE A 1 376 ? 15.933  46.241  7.446   1.00 4.04  ? 407 PHE A CG   1 
ATOM   3761  C  CD1  . PHE A 1 376 ? 15.742  47.208  8.423   1.00 4.95  ? 407 PHE A CD1  1 
ATOM   3762  C  CD2  . PHE A 1 376 ? 16.795  45.191  7.715   1.00 4.80  ? 407 PHE A CD2  1 
ATOM   3763  C  CE1  . PHE A 1 376 ? 16.406  47.135  9.646   1.00 3.12  ? 407 PHE A CE1  1 
ATOM   3764  C  CE2  . PHE A 1 376 ? 17.460  45.106  8.933   1.00 2.85  ? 407 PHE A CE2  1 
ATOM   3765  C  CZ   . PHE A 1 376 ? 17.267  46.077  9.894   1.00 3.52  ? 407 PHE A CZ   1 
ATOM   3766  H  H    . PHE A 1 376 ? 13.753  47.308  4.291   1.00 17.00 ? 407 PHE A H    1 
ATOM   3767  N  N    . LEU A 1 377 ? 16.785  46.928  3.369   1.00 6.78  ? 408 LEU A N    1 
ATOM   3768  C  CA   . LEU A 1 377 ? 17.959  46.723  2.530   1.00 5.53  ? 408 LEU A CA   1 
ATOM   3769  C  C    . LEU A 1 377 ? 18.598  47.980  2.027   1.00 6.39  ? 408 LEU A C    1 
ATOM   3770  O  O    . LEU A 1 377 ? 17.957  48.786  1.351   1.00 7.14  ? 408 LEU A O    1 
ATOM   3771  C  CB   . LEU A 1 377 ? 17.678  45.775  1.364   1.00 2.42  ? 408 LEU A CB   1 
ATOM   3772  C  CG   . LEU A 1 377 ? 17.226  44.385  1.817   1.00 2.02  ? 408 LEU A CG   1 
ATOM   3773  C  CD1  . LEU A 1 377 ? 17.541  43.417  0.702   1.00 3.40  ? 408 LEU A CD1  1 
ATOM   3774  C  CD2  . LEU A 1 377 ? 17.909  43.961  3.125   1.00 2.00  ? 408 LEU A CD2  1 
ATOM   3775  H  H    . LEU A 1 377 ? 15.903  46.664  3.030   1.00 17.00 ? 408 LEU A H    1 
ATOM   3776  N  N    . TYR A 1 378 ? 19.899  48.082  2.328   1.00 8.44  ? 409 TYR A N    1 
ATOM   3777  C  CA   . TYR A 1 378 ? 20.780  49.193  1.976   1.00 7.68  ? 409 TYR A CA   1 
ATOM   3778  C  C    . TYR A 1 378 ? 20.331  50.502  2.627   1.00 7.81  ? 409 TYR A C    1 
ATOM   3779  O  O    . TYR A 1 378 ? 20.418  51.579  1.991   1.00 6.70  ? 409 TYR A O    1 
ATOM   3780  C  CB   . TYR A 1 378 ? 20.846  49.399  0.452   1.00 10.48 ? 409 TYR A CB   1 
ATOM   3781  C  CG   . TYR A 1 378 ? 20.503  48.205  -0.409  1.00 14.30 ? 409 TYR A CG   1 
ATOM   3782  C  CD1  . TYR A 1 378 ? 21.320  47.078  -0.421  1.00 16.16 ? 409 TYR A CD1  1 
ATOM   3783  C  CD2  . TYR A 1 378 ? 19.369  48.222  -1.245  1.00 16.54 ? 409 TYR A CD2  1 
ATOM   3784  C  CE1  . TYR A 1 378 ? 21.040  45.970  -1.254  1.00 20.79 ? 409 TYR A CE1  1 
ATOM   3785  C  CE2  . TYR A 1 378 ? 19.064  47.126  -2.080  1.00 21.50 ? 409 TYR A CE2  1 
ATOM   3786  C  CZ   . TYR A 1 378 ? 19.915  45.989  -2.081  1.00 23.10 ? 409 TYR A CZ   1 
ATOM   3787  O  OH   . TYR A 1 378 ? 19.657  44.892  -2.897  1.00 23.61 ? 409 TYR A OH   1 
ATOM   3788  H  H    . TYR A 1 378 ? 20.282  47.331  2.822   1.00 17.00 ? 409 TYR A H    1 
ATOM   3789  H  HH   . TYR A 1 378 ? 18.887  45.072  -3.442  1.00 17.00 ? 409 TYR A HH   1 
ATOM   3790  N  N    . ASN A 1 379 ? 19.866  50.449  3.877   1.00 6.67  ? 410 ASN A N    1 
ATOM   3791  C  CA   . ASN A 1 379 ? 19.410  51.702  4.489   1.00 10.16 ? 410 ASN A CA   1 
ATOM   3792  C  C    . ASN A 1 379 ? 20.358  52.439  5.442   1.00 10.16 ? 410 ASN A C    1 
ATOM   3793  O  O    . ASN A 1 379 ? 20.858  51.868  6.414   1.00 10.59 ? 410 ASN A O    1 
ATOM   3794  C  CB   . ASN A 1 379 ? 18.012  51.564  5.112   1.00 9.35  ? 410 ASN A CB   1 
ATOM   3795  C  CG   . ASN A 1 379 ? 17.236  52.857  5.063   1.00 10.65 ? 410 ASN A CG   1 
ATOM   3796  O  OD1  . ASN A 1 379 ? 17.794  53.899  5.375   1.00 14.98 ? 410 ASN A OD1  1 
ATOM   3797  N  ND2  . ASN A 1 379 ? 15.977  52.814  4.626   1.00 14.18 ? 410 ASN A ND2  1 
ATOM   3798  H  H    . ASN A 1 379 ? 19.816  49.613  4.378   1.00 17.00 ? 410 ASN A H    1 
ATOM   3799  H  HD21 . ASN A 1 379 ? 15.634  51.952  4.296   1.00 17.00 ? 410 ASN A HD21 1 
ATOM   3800  N  N    . ASN A 1 380 ? 20.588  53.720  5.134   1.00 9.06  ? 411 ASN A N    1 
ATOM   3801  C  CA   . ASN A 1 380 ? 21.444  54.617  5.934   1.00 8.23  ? 411 ASN A CA   1 
ATOM   3802  C  C    . ASN A 1 380 ? 20.752  55.022  7.270   1.00 6.71  ? 411 ASN A C    1 
ATOM   3803  O  O    . ASN A 1 380 ? 21.035  54.465  8.357   1.00 2.00  ? 411 ASN A O    1 
ATOM   3804  C  CB   . ASN A 1 380 ? 21.767  55.889  5.073   1.00 8.70  ? 411 ASN A CB   1 
ATOM   3805  C  CG   . ASN A 1 380 ? 22.837  56.845  5.706   1.00 5.49  ? 411 ASN A CG   1 
ATOM   3806  O  OD1  . ASN A 1 380 ? 23.700  56.443  6.483   1.00 5.82  ? 411 ASN A OD1  1 
ATOM   3807  N  ND2  . ASN A 1 380 ? 22.788  58.098  5.307   1.00 2.01  ? 411 ASN A ND2  1 
ATOM   3808  H  H    . ASN A 1 380 ? 20.145  54.053  4.329   1.00 17.00 ? 411 ASN A H    1 
ATOM   3809  H  HD21 . ASN A 1 380 ? 23.468  58.664  5.729   1.00 17.00 ? 411 ASN A HD21 1 
ATOM   3810  H  HD22 . ASN A 1 380 ? 22.110  58.383  4.664   1.00 17.00 ? 411 ASN A HD22 1 
ATOM   3811  N  N    . SER A 1 381 ? 19.752  55.901  7.141   1.00 5.39  ? 412 SER A N    1 
ATOM   3812  C  CA   . SER A 1 381 ? 19.070  56.426  8.287   1.00 4.37  ? 412 SER A CA   1 
ATOM   3813  C  C    . SER A 1 381 ? 18.404  55.430  9.224   1.00 3.06  ? 412 SER A C    1 
ATOM   3814  O  O    . SER A 1 381 ? 18.219  55.736  10.391  1.00 2.00  ? 412 SER A O    1 
ATOM   3815  C  CB   . SER A 1 381 ? 18.124  57.567  7.863   1.00 10.67 ? 412 SER A CB   1 
ATOM   3816  O  OG   . SER A 1 381 ? 18.330  58.772  8.641   1.00 9.20  ? 412 SER A OG   1 
ATOM   3817  H  H    . SER A 1 381 ? 19.453  56.168  6.251   1.00 17.00 ? 412 SER A H    1 
ATOM   3818  H  HG   . SER A 1 381 ? 18.434  58.552  9.567   1.00 17.00 ? 412 SER A HG   1 
ATOM   3819  N  N    . ILE A 1 382 ? 18.068  54.236  8.764   1.00 2.00  ? 413 ILE A N    1 
ATOM   3820  C  CA   . ILE A 1 382 ? 17.431  53.296  9.690   1.00 5.80  ? 413 ILE A CA   1 
ATOM   3821  C  C    . ILE A 1 382 ? 18.298  53.151  10.965  1.00 6.91  ? 413 ILE A C    1 
ATOM   3822  O  O    . ILE A 1 382 ? 17.877  53.537  12.075  1.00 4.85  ? 413 ILE A O    1 
ATOM   3823  C  CB   . ILE A 1 382 ? 17.153  51.872  9.049   1.00 8.30  ? 413 ILE A CB   1 
ATOM   3824  C  CG1  . ILE A 1 382 ? 16.069  51.969  7.949   1.00 7.25  ? 413 ILE A CG1  1 
ATOM   3825  C  CG2  . ILE A 1 382 ? 16.719  50.858  10.161  1.00 6.20  ? 413 ILE A CG2  1 
ATOM   3826  C  CD1  . ILE A 1 382 ? 15.617  50.642  7.325   1.00 2.00  ? 413 ILE A CD1  1 
ATOM   3827  H  H    . ILE A 1 382 ? 18.244  53.988  7.835   1.00 17.00 ? 413 ILE A H    1 
ATOM   3828  N  N    . LEU A 1 383 ? 19.539  52.694  10.770  1.00 7.38  ? 414 LEU A N    1 
ATOM   3829  C  CA   . LEU A 1 383 ? 20.503  52.504  11.860  1.00 6.38  ? 414 LEU A CA   1 
ATOM   3830  C  C    . LEU A 1 383 ? 20.846  53.832  12.564  1.00 4.31  ? 414 LEU A C    1 
ATOM   3831  O  O    . LEU A 1 383 ? 20.723  53.988  13.785  1.00 2.02  ? 414 LEU A O    1 
ATOM   3832  C  CB   . LEU A 1 383 ? 21.772  51.853  11.309  1.00 2.02  ? 414 LEU A CB   1 
ATOM   3833  C  CG   . LEU A 1 383 ? 22.797  51.516  12.379  1.00 2.01  ? 414 LEU A CG   1 
ATOM   3834  C  CD1  . LEU A 1 383 ? 22.246  50.618  13.456  1.00 2.00  ? 414 LEU A CD1  1 
ATOM   3835  C  CD2  . LEU A 1 383 ? 23.960  50.884  11.719  1.00 6.88  ? 414 LEU A CD2  1 
ATOM   3836  H  H    . LEU A 1 383 ? 19.825  52.486  9.855   1.00 17.00 ? 414 LEU A H    1 
ATOM   3837  N  N    . LEU A 1 384 ? 21.251  54.803  11.767  1.00 5.73  ? 415 LEU A N    1 
ATOM   3838  C  CA   . LEU A 1 384 ? 21.598  56.104  12.301  1.00 7.57  ? 415 LEU A CA   1 
ATOM   3839  C  C    . LEU A 1 384 ? 20.449  56.719  13.101  1.00 7.82  ? 415 LEU A C    1 
ATOM   3840  O  O    . LEU A 1 384 ? 20.690  57.306  14.154  1.00 9.30  ? 415 LEU A O    1 
ATOM   3841  C  CB   . LEU A 1 384 ? 22.019  57.045  11.172  1.00 4.01  ? 415 LEU A CB   1 
ATOM   3842  C  CG   . LEU A 1 384 ? 23.264  56.608  10.422  1.00 2.00  ? 415 LEU A CG   1 
ATOM   3843  C  CD1  . LEU A 1 384 ? 23.516  57.556  9.267   1.00 2.14  ? 415 LEU A CD1  1 
ATOM   3844  C  CD2  . LEU A 1 384 ? 24.416  56.567  11.391  1.00 2.00  ? 415 LEU A CD2  1 
ATOM   3845  H  H    . LEU A 1 384 ? 21.322  54.633  10.805  1.00 17.00 ? 415 LEU A H    1 
ATOM   3846  N  N    . GLU A 1 385 ? 19.209  56.547  12.642  1.00 9.91  ? 416 GLU A N    1 
ATOM   3847  C  CA   . GLU A 1 385 ? 18.067  57.138  13.336  1.00 10.97 ? 416 GLU A CA   1 
ATOM   3848  C  C    . GLU A 1 385 ? 17.744  56.432  14.630  1.00 10.37 ? 416 GLU A C    1 
ATOM   3849  O  O    . GLU A 1 385 ? 17.809  57.049  15.712  1.00 3.74  ? 416 GLU A O    1 
ATOM   3850  C  CB   . GLU A 1 385 ? 16.825  57.196  12.438  1.00 15.64 ? 416 GLU A CB   1 
ATOM   3851  C  CG   . GLU A 1 385 ? 16.876  58.258  11.283  1.00 22.94 ? 416 GLU A CG   1 
ATOM   3852  C  CD   . GLU A 1 385 ? 17.041  59.771  11.723  1.00 25.52 ? 416 GLU A CD   1 
ATOM   3853  O  OE1  . GLU A 1 385 ? 16.195  60.296  12.534  1.00 25.25 ? 416 GLU A OE1  1 
ATOM   3854  O  OE2  . GLU A 1 385 ? 17.998  60.437  11.201  1.00 19.64 ? 416 GLU A OE2  1 
ATOM   3855  H  H    . GLU A 1 385 ? 19.092  55.957  11.895  1.00 17.00 ? 416 GLU A H    1 
ATOM   3856  N  N    . HIS A 1 386 ? 17.458  55.129  14.506  1.00 10.67 ? 417 HIS A N    1 
ATOM   3857  C  CA   . HIS A 1 386 ? 17.097  54.290  15.649  1.00 9.63  ? 417 HIS A CA   1 
ATOM   3858  C  C    . HIS A 1 386 ? 18.152  54.166  16.706  1.00 11.38 ? 417 HIS A C    1 
ATOM   3859  O  O    . HIS A 1 386 ? 17.826  54.193  17.896  1.00 14.89 ? 417 HIS A O    1 
ATOM   3860  C  CB   . HIS A 1 386 ? 16.671  52.896  15.219  1.00 10.69 ? 417 HIS A CB   1 
ATOM   3861  C  CG   . HIS A 1 386 ? 15.312  52.858  14.615  1.00 10.39 ? 417 HIS A CG   1 
ATOM   3862  N  ND1  . HIS A 1 386 ? 14.953  51.944  13.651  1.00 10.74 ? 417 HIS A ND1  1 
ATOM   3863  C  CD2  . HIS A 1 386 ? 14.241  53.665  14.789  1.00 11.52 ? 417 HIS A CD2  1 
ATOM   3864  C  CE1  . HIS A 1 386 ? 13.719  52.194  13.253  1.00 13.79 ? 417 HIS A CE1  1 
ATOM   3865  N  NE2  . HIS A 1 386 ? 13.265  53.235  13.925  1.00 11.67 ? 417 HIS A NE2  1 
ATOM   3866  H  H    . HIS A 1 386 ? 17.547  54.727  13.617  1.00 17.00 ? 417 HIS A H    1 
ATOM   3867  H  HD1  . HIS A 1 386 ? 15.520  51.216  13.318  1.00 17.00 ? 417 HIS A HD1  1 
ATOM   3868  H  HE2  . HIS A 1 386 ? 12.363  53.621  13.805  1.00 17.00 ? 417 HIS A HE2  1 
ATOM   3869  N  N    . GLY A 1 387 ? 19.404  54.004  16.294  1.00 10.17 ? 418 GLY A N    1 
ATOM   3870  C  CA   . GLY A 1 387 ? 20.472  53.889  17.269  1.00 10.29 ? 418 GLY A CA   1 
ATOM   3871  C  C    . GLY A 1 387 ? 20.808  52.444  17.449  1.00 9.40  ? 418 GLY A C    1 
ATOM   3872  O  O    . GLY A 1 387 ? 20.023  51.603  17.046  1.00 11.72 ? 418 GLY A O    1 
ATOM   3873  H  H    . GLY A 1 387 ? 19.613  53.950  15.341  1.00 17.00 ? 418 GLY A H    1 
ATOM   3874  N  N    . LEU A 1 388 ? 21.975  52.155  18.021  1.00 10.31 ? 419 LEU A N    1 
ATOM   3875  C  CA   . LEU A 1 388 ? 22.419  50.773  18.242  1.00 7.24  ? 419 LEU A CA   1 
ATOM   3876  C  C    . LEU A 1 388 ? 21.567  50.064  19.307  1.00 6.46  ? 419 LEU A C    1 
ATOM   3877  O  O    . LEU A 1 388 ? 21.008  48.990  19.058  1.00 4.71  ? 419 LEU A O    1 
ATOM   3878  C  CB   . LEU A 1 388 ? 23.902  50.759  18.628  1.00 5.43  ? 419 LEU A CB   1 
ATOM   3879  C  CG   . LEU A 1 388 ? 24.935  50.407  17.560  1.00 3.60  ? 419 LEU A CG   1 
ATOM   3880  C  CD1  . LEU A 1 388 ? 25.160  48.924  17.534  1.00 3.13  ? 419 LEU A CD1  1 
ATOM   3881  C  CD2  . LEU A 1 388 ? 24.508  50.919  16.197  1.00 2.84  ? 419 LEU A CD2  1 
ATOM   3882  H  H    . LEU A 1 388 ? 22.561  52.898  18.270  1.00 17.00 ? 419 LEU A H    1 
ATOM   3883  N  N    . THR A 1 389 ? 21.449  50.699  20.473  1.00 6.41  ? 420 THR A N    1 
ATOM   3884  C  CA   . THR A 1 389 ? 20.667  50.166  21.580  1.00 6.50  ? 420 THR A CA   1 
ATOM   3885  C  C    . THR A 1 389 ? 19.250  49.875  21.057  1.00 7.54  ? 420 THR A C    1 
ATOM   3886  O  O    . THR A 1 389 ? 18.632  48.839  21.379  1.00 5.29  ? 420 THR A O    1 
ATOM   3887  C  CB   . THR A 1 389 ? 20.681  51.139  22.789  1.00 5.65  ? 420 THR A CB   1 
ATOM   3888  O  OG1  . THR A 1 389 ? 21.232  52.415  22.404  1.00 7.05  ? 420 THR A OG1  1 
ATOM   3889  C  CG2  . THR A 1 389 ? 21.537  50.580  23.872  1.00 3.61  ? 420 THR A CG2  1 
ATOM   3890  H  H    . THR A 1 389 ? 21.877  51.567  20.612  1.00 17.00 ? 420 THR A H    1 
ATOM   3891  H  HG1  . THR A 1 389 ? 21.085  53.042  23.128  1.00 17.00 ? 420 THR A HG1  1 
ATOM   3892  N  N    . GLN A 1 390 ? 18.749  50.757  20.200  1.00 8.06  ? 421 GLN A N    1 
ATOM   3893  C  CA   . GLN A 1 390 ? 17.456  50.473  19.625  1.00 10.59 ? 421 GLN A CA   1 
ATOM   3894  C  C    . GLN A 1 390 ? 17.689  49.692  18.344  1.00 7.80  ? 421 GLN A C    1 
ATOM   3895  O  O    . GLN A 1 390 ? 17.505  50.178  17.227  1.00 9.35  ? 421 GLN A O    1 
ATOM   3896  C  CB   . GLN A 1 390 ? 16.569  51.705  19.393  1.00 13.37 ? 421 GLN A CB   1 
ATOM   3897  C  CG   . GLN A 1 390 ? 15.098  51.249  19.253  1.00 18.03 ? 421 GLN A CG   1 
ATOM   3898  C  CD   . GLN A 1 390 ? 14.785  50.006  20.138  1.00 17.48 ? 421 GLN A CD   1 
ATOM   3899  O  OE1  . GLN A 1 390 ? 15.034  48.863  19.737  1.00 15.43 ? 421 GLN A OE1  1 
ATOM   3900  N  NE2  . GLN A 1 390 ? 14.310  50.243  21.360  1.00 16.09 ? 421 GLN A NE2  1 
ATOM   3901  H  H    . GLN A 1 390 ? 19.239  51.550  19.911  1.00 17.00 ? 421 GLN A H    1 
ATOM   3902  H  HE21 . GLN A 1 390 ? 14.109  49.478  21.932  1.00 17.00 ? 421 GLN A HE21 1 
ATOM   3903  H  HE22 . GLN A 1 390 ? 14.182  51.178  21.619  1.00 17.00 ? 421 GLN A HE22 1 
ATOM   3904  N  N    . PHE A 1 391 ? 18.156  48.482  18.540  1.00 2.38  ? 422 PHE A N    1 
ATOM   3905  C  CA   . PHE A 1 391 ? 18.432  47.582  17.456  1.00 2.96  ? 422 PHE A CA   1 
ATOM   3906  C  C    . PHE A 1 391 ? 18.721  46.330  18.260  1.00 3.74  ? 422 PHE A C    1 
ATOM   3907  O  O    . PHE A 1 391 ? 18.129  45.264  18.044  1.00 2.00  ? 422 PHE A O    1 
ATOM   3908  C  CB   . PHE A 1 391 ? 19.652  48.053  16.675  1.00 2.00  ? 422 PHE A CB   1 
ATOM   3909  C  CG   . PHE A 1 391 ? 19.365  48.367  15.244  1.00 2.00  ? 422 PHE A CG   1 
ATOM   3910  C  CD1  . PHE A 1 391 ? 18.865  49.598  14.873  1.00 3.01  ? 422 PHE A CD1  1 
ATOM   3911  C  CD2  . PHE A 1 391 ? 19.587  47.422  14.259  1.00 2.00  ? 422 PHE A CD2  1 
ATOM   3912  C  CE1  . PHE A 1 391 ? 18.584  49.888  13.524  1.00 5.16  ? 422 PHE A CE1  1 
ATOM   3913  C  CE2  . PHE A 1 391 ? 19.315  47.679  12.911  1.00 2.00  ? 422 PHE A CE2  1 
ATOM   3914  C  CZ   . PHE A 1 391 ? 18.813  48.906  12.535  1.00 3.97  ? 422 PHE A CZ   1 
ATOM   3915  H  H    . PHE A 1 391 ? 18.305  48.221  19.467  1.00 17.00 ? 422 PHE A H    1 
ATOM   3916  N  N    . VAL A 1 392 ? 19.533  46.524  19.293  1.00 4.83  ? 423 VAL A N    1 
ATOM   3917  C  CA   . VAL A 1 392 ? 19.897  45.450  20.202  1.00 5.07  ? 423 VAL A CA   1 
ATOM   3918  C  C    . VAL A 1 392 ? 18.612  44.993  20.900  1.00 6.65  ? 423 VAL A C    1 
ATOM   3919  O  O    . VAL A 1 392 ? 18.251  43.798  20.910  1.00 2.00  ? 423 VAL A O    1 
ATOM   3920  C  CB   . VAL A 1 392 ? 20.923  45.957  21.223  1.00 2.00  ? 423 VAL A CB   1 
ATOM   3921  C  CG1  . VAL A 1 392 ? 21.274  44.896  22.219  1.00 2.00  ? 423 VAL A CG1  1 
ATOM   3922  C  CG2  . VAL A 1 392 ? 22.125  46.405  20.489  1.00 2.00  ? 423 VAL A CG2  1 
ATOM   3923  H  H    . VAL A 1 392 ? 19.931  47.413  19.419  1.00 17.00 ? 423 VAL A H    1 
ATOM   3924  N  N    . GLU A 1 393 ? 17.872  45.985  21.384  1.00 8.89  ? 424 GLU A N    1 
ATOM   3925  C  CA   . GLU A 1 393 ? 16.633  45.714  22.081  1.00 8.59  ? 424 GLU A CA   1 
ATOM   3926  C  C    . GLU A 1 393 ? 15.574  45.124  21.124  1.00 7.16  ? 424 GLU A C    1 
ATOM   3927  O  O    . GLU A 1 393 ? 15.054  44.033  21.375  1.00 5.47  ? 424 GLU A O    1 
ATOM   3928  C  CB   . GLU A 1 393 ? 16.201  46.967  22.882  1.00 9.34  ? 424 GLU A CB   1 
ATOM   3929  C  CG   . GLU A 1 393 ? 17.178  47.218  24.062  1.00 6.31  ? 424 GLU A CG   1 
ATOM   3930  C  CD   . GLU A 1 393 ? 16.803  48.353  24.989  1.00 6.39  ? 424 GLU A CD   1 
ATOM   3931  O  OE1  . GLU A 1 393 ? 16.575  49.474  24.487  1.00 11.31 ? 424 GLU A OE1  1 
ATOM   3932  O  OE2  . GLU A 1 393 ? 16.796  48.138  26.224  1.00 2.03  ? 424 GLU A OE2  1 
ATOM   3933  H  H    . GLU A 1 393 ? 18.190  46.905  21.300  1.00 17.00 ? 424 GLU A H    1 
ATOM   3934  N  N    . SER A 1 394 ? 15.355  45.767  19.982  1.00 5.04  ? 425 SER A N    1 
ATOM   3935  C  CA   . SER A 1 394 ? 14.397  45.247  19.026  1.00 4.43  ? 425 SER A CA   1 
ATOM   3936  C  C    . SER A 1 394 ? 14.724  43.810  18.701  1.00 5.92  ? 425 SER A C    1 
ATOM   3937  O  O    . SER A 1 394 ? 13.856  42.938  18.793  1.00 8.44  ? 425 SER A O    1 
ATOM   3938  C  CB   . SER A 1 394 ? 14.424  46.025  17.728  1.00 2.03  ? 425 SER A CB   1 
ATOM   3939  O  OG   . SER A 1 394 ? 14.153  47.381  17.956  1.00 2.21  ? 425 SER A OG   1 
ATOM   3940  H  H    . SER A 1 394 ? 15.803  46.615  19.806  1.00 17.00 ? 425 SER A H    1 
ATOM   3941  H  HG   . SER A 1 394 ? 14.930  47.848  18.262  1.00 17.00 ? 425 SER A HG   1 
ATOM   3942  N  N    . PHE A 1 395 ? 15.996  43.553  18.392  1.00 6.60  ? 426 PHE A N    1 
ATOM   3943  C  CA   . PHE A 1 395 ? 16.431  42.215  18.003  1.00 4.23  ? 426 PHE A CA   1 
ATOM   3944  C  C    . PHE A 1 395 ? 16.410  41.140  19.095  1.00 4.48  ? 426 PHE A C    1 
ATOM   3945  O  O    . PHE A 1 395 ? 16.215  39.968  18.787  1.00 3.19  ? 426 PHE A O    1 
ATOM   3946  C  CB   . PHE A 1 395 ? 17.768  42.292  17.266  1.00 4.91  ? 426 PHE A CB   1 
ATOM   3947  C  CG   . PHE A 1 395 ? 17.702  43.042  15.936  1.00 3.10  ? 426 PHE A CG   1 
ATOM   3948  C  CD1  . PHE A 1 395 ? 16.492  43.484  15.422  1.00 3.38  ? 426 PHE A CD1  1 
ATOM   3949  C  CD2  . PHE A 1 395 ? 18.859  43.297  15.200  1.00 2.26  ? 426 PHE A CD2  1 
ATOM   3950  C  CE1  . PHE A 1 395 ? 16.440  44.162  14.207  1.00 2.61  ? 426 PHE A CE1  1 
ATOM   3951  C  CE2  . PHE A 1 395 ? 18.810  43.971  13.993  1.00 2.00  ? 426 PHE A CE2  1 
ATOM   3952  C  CZ   . PHE A 1 395 ? 17.602  44.404  13.495  1.00 2.00  ? 426 PHE A CZ   1 
ATOM   3953  H  H    . PHE A 1 395 ? 16.648  44.268  18.445  1.00 17.00 ? 426 PHE A H    1 
ATOM   3954  N  N    . THR A 1 396 ? 16.597  41.525  20.357  1.00 7.04  ? 427 THR A N    1 
ATOM   3955  C  CA   . THR A 1 396 ? 16.534  40.573  21.483  1.00 10.42 ? 427 THR A CA   1 
ATOM   3956  C  C    . THR A 1 396 ? 15.103  40.005  21.535  1.00 12.19 ? 427 THR A C    1 
ATOM   3957  O  O    . THR A 1 396 ? 14.868  38.854  21.940  1.00 11.56 ? 427 THR A O    1 
ATOM   3958  C  CB   . THR A 1 396 ? 16.725  41.307  22.837  1.00 11.65 ? 427 THR A CB   1 
ATOM   3959  O  OG1  . THR A 1 396 ? 17.899  42.136  22.787  1.00 15.13 ? 427 THR A OG1  1 
ATOM   3960  C  CG2  . THR A 1 396 ? 16.802  40.304  23.993  1.00 10.52 ? 427 THR A CG2  1 
ATOM   3961  H  H    . THR A 1 396 ? 16.805  42.458  20.582  1.00 17.00 ? 427 THR A H    1 
ATOM   3962  H  HG1  . THR A 1 396 ? 17.989  42.658  23.593  1.00 17.00 ? 427 THR A HG1  1 
ATOM   3963  N  N    . ARG A 1 397 ? 14.148  40.870  21.192  1.00 13.86 ? 428 ARG A N    1 
ATOM   3964  C  CA   . ARG A 1 397 ? 12.736  40.544  21.193  1.00 12.24 ? 428 ARG A CA   1 
ATOM   3965  C  C    . ARG A 1 397 ? 12.230  40.559  19.762  1.00 8.67  ? 428 ARG A C    1 
ATOM   3966  O  O    . ARG A 1 397 ? 11.800  41.592  19.257  1.00 9.72  ? 428 ARG A O    1 
ATOM   3967  C  CB   . ARG A 1 397 ? 11.951  41.572  22.026  1.00 18.41 ? 428 ARG A CB   1 
ATOM   3968  C  CG   . ARG A 1 397 ? 12.447  41.779  23.476  1.00 22.23 ? 428 ARG A CG   1 
ATOM   3969  C  CD   . ARG A 1 397 ? 13.455  42.940  23.640  1.00 24.01 ? 428 ARG A CD   1 
ATOM   3970  N  NE   . ARG A 1 397 ? 14.200  42.792  24.890  1.00 24.59 ? 428 ARG A NE   1 
ATOM   3971  C  CZ   . ARG A 1 397 ? 15.102  43.647  25.359  1.00 25.12 ? 428 ARG A CZ   1 
ATOM   3972  N  NH1  . ARG A 1 397 ? 15.400  44.752  24.697  1.00 22.81 ? 428 ARG A NH1  1 
ATOM   3973  N  NH2  . ARG A 1 397 ? 15.745  43.360  26.484  1.00 26.33 ? 428 ARG A NH2  1 
ATOM   3974  H  H    . ARG A 1 397 ? 14.381  41.782  20.897  1.00 17.00 ? 428 ARG A H    1 
ATOM   3975  H  HE   . ARG A 1 397 ? 14.028  41.994  25.430  1.00 17.00 ? 428 ARG A HE   1 
ATOM   3976  H  HH11 . ARG A 1 397 ? 14.945  44.962  23.833  1.00 17.00 ? 428 ARG A HH11 1 
ATOM   3977  H  HH12 . ARG A 1 397 ? 16.082  45.372  25.079  1.00 17.00 ? 428 ARG A HH12 1 
ATOM   3978  H  HH21 . ARG A 1 397 ? 15.544  42.506  26.966  1.00 17.00 ? 428 ARG A HH21 1 
ATOM   3979  H  HH22 . ARG A 1 397 ? 16.427  43.993  26.848  1.00 17.00 ? 428 ARG A HH22 1 
ATOM   3980  N  N    . GLN A 1 398 ? 12.401  39.434  19.085  1.00 5.68  ? 429 GLN A N    1 
ATOM   3981  C  CA   . GLN A 1 398 ? 11.924  39.227  17.730  1.00 2.59  ? 429 GLN A CA   1 
ATOM   3982  C  C    . GLN A 1 398 ? 12.235  37.856  17.252  1.00 2.00  ? 429 GLN A C    1 
ATOM   3983  O  O    . GLN A 1 398 ? 13.341  37.606  16.804  1.00 2.00  ? 429 GLN A O    1 
ATOM   3984  C  CB   . GLN A 1 398 ? 12.485  40.207  16.717  1.00 2.00  ? 429 GLN A CB   1 
ATOM   3985  C  CG   . GLN A 1 398 ? 11.895  39.891  15.332  1.00 2.68  ? 429 GLN A CG   1 
ATOM   3986  C  CD   . GLN A 1 398 ? 11.740  41.070  14.375  1.00 4.71  ? 429 GLN A CD   1 
ATOM   3987  O  OE1  . GLN A 1 398 ? 11.946  42.249  14.719  1.00 9.12  ? 429 GLN A OE1  1 
ATOM   3988  N  NE2  . GLN A 1 398 ? 11.363  40.748  13.152  1.00 4.38  ? 429 GLN A NE2  1 
ATOM   3989  H  H    . GLN A 1 398 ? 12.905  38.715  19.517  1.00 17.00 ? 429 GLN A H    1 
ATOM   3990  H  HE21 . GLN A 1 398 ? 11.221  41.447  12.484  1.00 17.00 ? 429 GLN A HE21 1 
ATOM   3991  H  HE22 . GLN A 1 398 ? 11.228  39.798  12.962  1.00 17.00 ? 429 GLN A HE22 1 
ATOM   3992  N  N    . ILE A 1 399 ? 11.247  36.976  17.317  1.00 4.03  ? 430 ILE A N    1 
ATOM   3993  C  CA   . ILE A 1 399 ? 11.407  35.592  16.858  1.00 5.43  ? 430 ILE A CA   1 
ATOM   3994  C  C    . ILE A 1 399 ? 11.763  35.522  15.371  1.00 5.54  ? 430 ILE A C    1 
ATOM   3995  O  O    . ILE A 1 399 ? 11.198  36.255  14.531  1.00 2.60  ? 430 ILE A O    1 
ATOM   3996  C  CB   . ILE A 1 399 ? 10.105  34.724  17.056  1.00 4.63  ? 430 ILE A CB   1 
ATOM   3997  C  CG1  . ILE A 1 399 ? 9.458   35.014  18.420  1.00 5.22  ? 430 ILE A CG1  1 
ATOM   3998  C  CG2  . ILE A 1 399 ? 10.437  33.224  16.998  1.00 2.59  ? 430 ILE A CG2  1 
ATOM   3999  C  CD1  . ILE A 1 399 ? 8.070   35.637  18.340  1.00 2.00  ? 430 ILE A CD1  1 
ATOM   4000  H  H    . ILE A 1 399 ? 10.379  37.280  17.644  1.00 17.00 ? 430 ILE A H    1 
ATOM   4001  N  N    . ALA A 1 400 ? 12.719  34.643  15.080  1.00 5.65  ? 431 ALA A N    1 
ATOM   4002  C  CA   . ALA A 1 400 ? 13.172  34.387  13.723  1.00 7.22  ? 431 ALA A CA   1 
ATOM   4003  C  C    . ALA A 1 400 ? 12.563  33.039  13.247  1.00 5.95  ? 431 ALA A C    1 
ATOM   4004  O  O    . ALA A 1 400 ? 12.198  32.184  14.058  1.00 3.32  ? 431 ALA A O    1 
ATOM   4005  C  CB   . ALA A 1 400 ? 14.691  34.361  13.669  1.00 10.05 ? 431 ALA A CB   1 
ATOM   4006  H  H    . ALA A 1 400 ? 13.157  34.146  15.801  1.00 17.00 ? 431 ALA A H    1 
ATOM   4007  N  N    . GLY A 1 401 ? 12.430  32.865  11.936  1.00 3.56  ? 432 GLY A N    1 
ATOM   4008  C  CA   . GLY A 1 401 ? 11.826  31.660  11.434  1.00 2.00  ? 432 GLY A CA   1 
ATOM   4009  C  C    . GLY A 1 401 ? 12.511  30.368  11.810  1.00 3.13  ? 432 GLY A C    1 
ATOM   4010  O  O    . GLY A 1 401 ? 13.668  30.337  12.199  1.00 5.31  ? 432 GLY A O    1 
ATOM   4011  H  H    . GLY A 1 401 ? 12.765  33.539  11.313  1.00 17.00 ? 432 GLY A H    1 
ATOM   4012  N  N    . ARG A 1 402 ? 11.752  29.290  11.795  1.00 4.19  ? 433 ARG A N    1 
ATOM   4013  C  CA   . ARG A 1 402 ? 12.331  27.980  12.038  1.00 5.73  ? 433 ARG A CA   1 
ATOM   4014  C  C    . ARG A 1 402 ? 12.991  27.723  10.690  1.00 7.52  ? 433 ARG A C    1 
ATOM   4015  O  O    . ARG A 1 402 ? 12.492  28.182  9.641   1.00 6.76  ? 433 ARG A O    1 
ATOM   4016  C  CB   . ARG A 1 402 ? 11.262  26.903  12.283  1.00 2.73  ? 433 ARG A CB   1 
ATOM   4017  C  CG   . ARG A 1 402 ? 11.817  25.535  12.630  1.00 2.00  ? 433 ARG A CG   1 
ATOM   4018  C  CD   . ARG A 1 402 ? 10.699  24.580  12.929  1.00 2.17  ? 433 ARG A CD   1 
ATOM   4019  N  NE   . ARG A 1 402 ? 11.177  23.411  13.648  1.00 8.03  ? 433 ARG A NE   1 
ATOM   4020  C  CZ   . ARG A 1 402 ? 10.555  22.828  14.684  1.00 12.15 ? 433 ARG A CZ   1 
ATOM   4021  N  NH1  . ARG A 1 402 ? 9.390   23.276  15.155  1.00 10.25 ? 433 ARG A NH1  1 
ATOM   4022  N  NH2  . ARG A 1 402 ? 11.157  21.833  15.334  1.00 13.24 ? 433 ARG A NH2  1 
ATOM   4023  H  H    . ARG A 1 402 ? 10.802  29.399  11.587  1.00 17.00 ? 433 ARG A H    1 
ATOM   4024  H  HE   . ARG A 1 402 ? 12.019  23.006  13.350  1.00 17.00 ? 433 ARG A HE   1 
ATOM   4025  H  HH11 . ARG A 1 402 ? 8.955   24.074  14.737  1.00 17.00 ? 433 ARG A HH11 1 
ATOM   4026  H  HH12 . ARG A 1 402 ? 8.957   22.823  15.935  1.00 17.00 ? 433 ARG A HH12 1 
ATOM   4027  H  HH21 . ARG A 1 402 ? 12.063  21.520  15.053  1.00 17.00 ? 433 ARG A HH21 1 
ATOM   4028  H  HH22 . ARG A 1 402 ? 10.701  21.394  16.109  1.00 17.00 ? 433 ARG A HH22 1 
ATOM   4029  N  N    . VAL A 1 403 ? 14.097  26.984  10.705  1.00 10.37 ? 434 VAL A N    1 
ATOM   4030  C  CA   . VAL A 1 403 ? 14.822  26.686  9.474   1.00 9.83  ? 434 VAL A CA   1 
ATOM   4031  C  C    . VAL A 1 403 ? 14.360  25.417  8.730   1.00 9.70  ? 434 VAL A C    1 
ATOM   4032  O  O    . VAL A 1 403 ? 13.770  25.489  7.638   1.00 11.43 ? 434 VAL A O    1 
ATOM   4033  C  CB   . VAL A 1 403 ? 16.356  26.636  9.734   1.00 7.27  ? 434 VAL A CB   1 
ATOM   4034  C  CG1  . VAL A 1 403 ? 17.093  26.118  8.509   1.00 4.57  ? 434 VAL A CG1  1 
ATOM   4035  C  CG2  . VAL A 1 403 ? 16.853  28.010  10.106  1.00 3.98  ? 434 VAL A CG2  1 
ATOM   4036  H  H    . VAL A 1 403 ? 14.428  26.604  11.543  1.00 17.00 ? 434 VAL A H    1 
ATOM   4037  N  N    . ALA A 1 404 ? 14.554  24.267  9.346   1.00 7.94  ? 435 ALA A N    1 
ATOM   4038  C  CA   . ALA A 1 404 ? 14.212  23.051  8.658   1.00 9.34  ? 435 ALA A CA   1 
ATOM   4039  C  C    . ALA A 1 404 ? 12.884  22.448  9.011   1.00 10.05 ? 435 ALA A C    1 
ATOM   4040  O  O    . ALA A 1 404 ? 12.826  21.370  9.593   1.00 9.81  ? 435 ALA A O    1 
ATOM   4041  C  CB   . ALA A 1 404 ? 15.326  22.027  8.824   1.00 10.27 ? 435 ALA A CB   1 
ATOM   4042  H  H    . ALA A 1 404 ? 14.909  24.219  10.252  1.00 17.00 ? 435 ALA A H    1 
ATOM   4043  N  N    . GLY A 1 405 ? 11.818  23.150  8.648   1.00 11.88 ? 436 GLY A N    1 
ATOM   4044  C  CA   . GLY A 1 405 ? 10.471  22.649  8.889   1.00 13.69 ? 436 GLY A CA   1 
ATOM   4045  C  C    . GLY A 1 405 ? 9.881   22.291  7.531   1.00 13.04 ? 436 GLY A C    1 
ATOM   4046  O  O    . GLY A 1 405 ? 9.449   21.157  7.247   1.00 11.94 ? 436 GLY A O    1 
ATOM   4047  H  H    . GLY A 1 405 ? 11.973  23.987  8.166   1.00 17.00 ? 436 GLY A H    1 
ATOM   4048  N  N    . GLY A 1 406 ? 9.886   23.302  6.678   1.00 12.81 ? 437 GLY A N    1 
ATOM   4049  C  CA   . GLY A 1 406 ? 9.390   23.161  5.324   1.00 11.81 ? 437 GLY A CA   1 
ATOM   4050  C  C    . GLY A 1 406 ? 8.743   24.483  4.954   1.00 12.20 ? 437 GLY A C    1 
ATOM   4051  O  O    . GLY A 1 406 ? 8.297   25.254  5.829   1.00 11.65 ? 437 GLY A O    1 
ATOM   4052  H  H    . GLY A 1 406 ? 10.202  24.180  6.966   1.00 17.00 ? 437 GLY A H    1 
ATOM   4053  N  N    . ARG A 1 407 ? 8.816   24.823  3.679   1.00 9.59  ? 438 ARG A N    1 
ATOM   4054  C  CA   . ARG A 1 407 ? 8.153   26.029  3.198   1.00 8.32  ? 438 ARG A CA   1 
ATOM   4055  C  C    . ARG A 1 407 ? 8.232   27.313  4.053   1.00 6.88  ? 438 ARG A C    1 
ATOM   4056  O  O    . ARG A 1 407 ? 7.201   27.908  4.322   1.00 5.01  ? 438 ARG A O    1 
ATOM   4057  C  CB   . ARG A 1 407 ? 6.676   25.684  2.985   1.00 6.43  ? 438 ARG A CB   1 
ATOM   4058  C  CG   . ARG A 1 407 ? 6.406   24.205  2.729   1.00 5.47  ? 438 ARG A CG   1 
ATOM   4059  C  CD   . ARG A 1 407 ? 4.950   23.856  2.957   1.00 4.35  ? 438 ARG A CD   1 
ATOM   4060  N  NE   . ARG A 1 407 ? 4.133   24.134  1.784   1.00 5.82  ? 438 ARG A NE   1 
ATOM   4061  C  CZ   . ARG A 1 407 ? 3.385   23.227  1.162   1.00 9.05  ? 438 ARG A CZ   1 
ATOM   4062  N  NH1  . ARG A 1 407 ? 3.340   21.980  1.601   1.00 5.56  ? 438 ARG A NH1  1 
ATOM   4063  N  NH2  . ARG A 1 407 ? 2.675   23.570  0.093   1.00 11.91 ? 438 ARG A NH2  1 
ATOM   4064  H  H    . ARG A 1 407 ? 9.280   24.249  3.030   1.00 17.00 ? 438 ARG A H    1 
ATOM   4065  H  HE   . ARG A 1 407 ? 4.134   25.048  1.430   1.00 17.00 ? 438 ARG A HE   1 
ATOM   4066  H  HH11 . ARG A 1 407 ? 3.862   21.690  2.403   1.00 17.00 ? 438 ARG A HH11 1 
ATOM   4067  H  HH12 . ARG A 1 407 ? 2.783   21.320  1.104   1.00 17.00 ? 438 ARG A HH12 1 
ATOM   4068  H  HH21 . ARG A 1 407 ? 2.719   24.511  -0.243  1.00 17.00 ? 438 ARG A HH21 1 
ATOM   4069  H  HH22 . ARG A 1 407 ? 2.117   22.894  -0.388  1.00 17.00 ? 438 ARG A HH22 1 
ATOM   4070  N  N    . ASN A 1 408 ? 9.423   27.753  4.470   1.00 6.60  ? 439 ASN A N    1 
ATOM   4071  C  CA   . ASN A 1 408 ? 9.524   28.996  5.267   1.00 6.41  ? 439 ASN A CA   1 
ATOM   4072  C  C    . ASN A 1 408 ? 10.515  30.047  4.711   1.00 5.87  ? 439 ASN A C    1 
ATOM   4073  O  O    . ASN A 1 408 ? 11.028  30.895  5.448   1.00 7.77  ? 439 ASN A O    1 
ATOM   4074  C  CB   . ASN A 1 408 ? 9.813   28.700  6.758   1.00 3.73  ? 439 ASN A CB   1 
ATOM   4075  C  CG   . ASN A 1 408 ? 9.489   29.880  7.668   1.00 2.00  ? 439 ASN A CG   1 
ATOM   4076  O  OD1  . ASN A 1 408 ? 8.551   30.625  7.439   1.00 2.00  ? 439 ASN A OD1  1 
ATOM   4077  N  ND2  . ASN A 1 408 ? 10.274  30.046  8.702   1.00 3.09  ? 439 ASN A ND2  1 
ATOM   4078  H  H    . ASN A 1 408 ? 10.223  27.246  4.238   1.00 17.00 ? 439 ASN A H    1 
ATOM   4079  H  HD21 . ASN A 1 408 ? 10.092  30.804  9.290   1.00 17.00 ? 439 ASN A HD21 1 
ATOM   4080  H  HD22 . ASN A 1 408 ? 11.024  29.418  8.828   1.00 17.00 ? 439 ASN A HD22 1 
ATOM   4081  N  N    . VAL A 1 409 ? 10.761  30.014  3.406   1.00 3.17  ? 440 VAL A N    1 
ATOM   4082  C  CA   . VAL A 1 409 ? 11.667  30.978  2.801   1.00 3.35  ? 440 VAL A CA   1 
ATOM   4083  C  C    . VAL A 1 409 ? 10.950  32.289  2.376   1.00 4.61  ? 440 VAL A C    1 
ATOM   4084  O  O    . VAL A 1 409 ? 9.987   32.255  1.599   1.00 6.46  ? 440 VAL A O    1 
ATOM   4085  C  CB   . VAL A 1 409 ? 12.362  30.345  1.582   1.00 2.55  ? 440 VAL A CB   1 
ATOM   4086  C  CG1  . VAL A 1 409 ? 13.210  31.362  0.845   1.00 5.15  ? 440 VAL A CG1  1 
ATOM   4087  C  CG2  . VAL A 1 409 ? 13.246  29.236  2.034   1.00 6.40  ? 440 VAL A CG2  1 
ATOM   4088  H  H    . VAL A 1 409 ? 10.320  29.339  2.844   1.00 17.00 ? 440 VAL A H    1 
ATOM   4089  N  N    . PRO A 1 410 ? 11.372  33.446  2.918   1.00 2.81  ? 441 PRO A N    1 
ATOM   4090  C  CA   . PRO A 1 410 ? 10.776  34.746  2.581   1.00 3.13  ? 441 PRO A CA   1 
ATOM   4091  C  C    . PRO A 1 410 ? 10.619  34.878  1.083   1.00 4.37  ? 441 PRO A C    1 
ATOM   4092  O  O    . PRO A 1 410 ? 11.614  34.769  0.371   1.00 4.57  ? 441 PRO A O    1 
ATOM   4093  C  CB   . PRO A 1 410 ? 11.817  35.724  3.091   1.00 3.40  ? 441 PRO A CB   1 
ATOM   4094  C  CG   . PRO A 1 410 ? 12.257  35.051  4.368   1.00 5.27  ? 441 PRO A CG   1 
ATOM   4095  C  CD   . PRO A 1 410 ? 12.322  33.573  4.039   1.00 2.94  ? 441 PRO A CD   1 
ATOM   4096  N  N    . ILE A 1 411 ? 9.394   35.152  0.609   1.00 4.25  ? 442 ILE A N    1 
ATOM   4097  C  CA   . ILE A 1 411 ? 9.143   35.255  -0.835  1.00 2.80  ? 442 ILE A CA   1 
ATOM   4098  C  C    . ILE A 1 411 ? 10.085  36.259  -1.499  1.00 2.00  ? 442 ILE A C    1 
ATOM   4099  O  O    . ILE A 1 411 ? 10.271  36.241  -2.701  1.00 2.09  ? 442 ILE A O    1 
ATOM   4100  C  CB   . ILE A 1 411 ? 7.618   35.507  -1.198  1.00 2.65  ? 442 ILE A CB   1 
ATOM   4101  C  CG1  . ILE A 1 411 ? 6.750   34.276  -0.890  1.00 3.25  ? 442 ILE A CG1  1 
ATOM   4102  C  CG2  . ILE A 1 411 ? 7.439   35.757  -2.695  1.00 2.00  ? 442 ILE A CG2  1 
ATOM   4103  C  CD1  . ILE A 1 411 ? 6.201   34.177  0.536   1.00 4.82  ? 442 ILE A CD1  1 
ATOM   4104  H  H    . ILE A 1 411 ? 8.645   35.241  1.232   1.00 17.00 ? 442 ILE A H    1 
ATOM   4105  N  N    . ALA A 1 412 ? 10.748  37.073  -0.702  1.00 2.00  ? 443 ALA A N    1 
ATOM   4106  C  CA   . ALA A 1 412 ? 11.673  38.037  -1.268  1.00 3.68  ? 443 ALA A CA   1 
ATOM   4107  C  C    . ALA A 1 412 ? 12.945  37.300  -1.696  1.00 3.94  ? 443 ALA A C    1 
ATOM   4108  O  O    . ALA A 1 412 ? 13.307  37.198  -2.884  1.00 2.00  ? 443 ALA A O    1 
ATOM   4109  C  CB   . ALA A 1 412 ? 12.002  39.121  -0.229  1.00 2.96  ? 443 ALA A CB   1 
ATOM   4110  H  H    . ALA A 1 412 ? 10.599  37.040  0.256   1.00 17.00 ? 443 ALA A H    1 
ATOM   4111  N  N    . VAL A 1 413 ? 13.532  36.677  -0.691  1.00 4.18  ? 444 VAL A N    1 
ATOM   4112  C  CA   . VAL A 1 413 ? 14.751  35.916  -0.793  1.00 4.48  ? 444 VAL A CA   1 
ATOM   4113  C  C    . VAL A 1 413 ? 14.539  34.563  -1.475  1.00 4.53  ? 444 VAL A C    1 
ATOM   4114  O  O    . VAL A 1 413 ? 15.382  33.677  -1.428  1.00 2.17  ? 444 VAL A O    1 
ATOM   4115  C  CB   . VAL A 1 413 ? 15.309  35.772  0.632   1.00 6.76  ? 444 VAL A CB   1 
ATOM   4116  C  CG1  . VAL A 1 413 ? 16.616  35.015  0.626   1.00 10.54 ? 444 VAL A CG1  1 
ATOM   4117  C  CG2  . VAL A 1 413 ? 15.505  37.194  1.253   1.00 4.54  ? 444 VAL A CG2  1 
ATOM   4118  H  H    . VAL A 1 413 ? 13.091  36.699  0.177   1.00 17.00 ? 444 VAL A H    1 
ATOM   4119  N  N    . GLN A 1 414 ? 13.407  34.427  -2.154  1.00 8.28  ? 445 GLN A N    1 
ATOM   4120  C  CA   . GLN A 1 414 ? 13.063  33.198  -2.852  1.00 7.49  ? 445 GLN A CA   1 
ATOM   4121  C  C    . GLN A 1 414 ? 14.076  33.032  -3.963  1.00 7.22  ? 445 GLN A C    1 
ATOM   4122  O  O    . GLN A 1 414 ? 14.474  31.932  -4.293  1.00 9.97  ? 445 GLN A O    1 
ATOM   4123  C  CB   . GLN A 1 414 ? 11.652  33.275  -3.448  1.00 8.30  ? 445 GLN A CB   1 
ATOM   4124  C  CG   . GLN A 1 414 ? 11.549  34.282  -4.590  1.00 10.97 ? 445 GLN A CG   1 
ATOM   4125  C  CD   . GLN A 1 414 ? 10.401  34.030  -5.540  1.00 10.71 ? 445 GLN A CD   1 
ATOM   4126  O  OE1  . GLN A 1 414 ? 10.094  32.894  -5.904  1.00 11.82 ? 445 GLN A OE1  1 
ATOM   4127  N  NE2  . GLN A 1 414 ? 9.783   35.103  -5.979  1.00 12.17 ? 445 GLN A NE2  1 
ATOM   4128  H  H    . GLN A 1 414 ? 12.753  35.144  -2.194  1.00 17.00 ? 445 GLN A H    1 
ATOM   4129  H  HE21 . GLN A 1 414 ? 9.062   34.970  -6.624  1.00 17.00 ? 445 GLN A HE21 1 
ATOM   4130  H  HE22 . GLN A 1 414 ? 10.087  35.968  -5.632  1.00 17.00 ? 445 GLN A HE22 1 
ATOM   4131  N  N    . ALA A 1 415 ? 14.509  34.143  -4.526  1.00 6.97  ? 446 ALA A N    1 
ATOM   4132  C  CA   . ALA A 1 415 ? 15.492  34.146  -5.611  1.00 7.81  ? 446 ALA A CA   1 
ATOM   4133  C  C    . ALA A 1 415 ? 16.802  33.474  -5.198  1.00 7.12  ? 446 ALA A C    1 
ATOM   4134  O  O    . ALA A 1 415 ? 17.414  32.761  -5.987  1.00 6.27  ? 446 ALA A O    1 
ATOM   4135  C  CB   . ALA A 1 415 ? 15.771  35.599  -6.040  1.00 11.30 ? 446 ALA A CB   1 
ATOM   4136  H  H    . ALA A 1 415 ? 14.145  34.997  -4.207  1.00 17.00 ? 446 ALA A H    1 
ATOM   4137  N  N    . VAL A 1 416 ? 17.247  33.789  -3.979  1.00 8.16  ? 447 VAL A N    1 
ATOM   4138  C  CA   . VAL A 1 416 ? 18.462  33.258  -3.364  1.00 4.79  ? 447 VAL A CA   1 
ATOM   4139  C  C    . VAL A 1 416 ? 18.244  31.775  -3.179  1.00 5.33  ? 447 VAL A C    1 
ATOM   4140  O  O    . VAL A 1 416 ? 19.059  30.968  -3.610  1.00 8.60  ? 447 VAL A O    1 
ATOM   4141  C  CB   . VAL A 1 416 ? 18.686  33.859  -1.964  1.00 2.80  ? 447 VAL A CB   1 
ATOM   4142  C  CG1  . VAL A 1 416 ? 19.826  33.170  -1.272  1.00 2.00  ? 447 VAL A CG1  1 
ATOM   4143  C  CG2  . VAL A 1 416 ? 18.884  35.356  -2.052  1.00 2.00  ? 447 VAL A CG2  1 
ATOM   4144  H  H    . VAL A 1 416 ? 16.702  34.414  -3.461  1.00 17.00 ? 447 VAL A H    1 
ATOM   4145  N  N    . ALA A 1 417 ? 17.142  31.425  -2.516  1.00 6.26  ? 448 ALA A N    1 
ATOM   4146  C  CA   . ALA A 1 417 ? 16.766  30.026  -2.258  1.00 4.80  ? 448 ALA A CA   1 
ATOM   4147  C  C    . ALA A 1 417 ? 16.696  29.233  -3.581  1.00 2.94  ? 448 ALA A C    1 
ATOM   4148  O  O    . ALA A 1 417 ? 16.995  28.045  -3.625  1.00 2.00  ? 448 ALA A O    1 
ATOM   4149  C  CB   . ALA A 1 417 ? 15.431  29.977  -1.502  1.00 4.06  ? 448 ALA A CB   1 
ATOM   4150  H  H    . ALA A 1 417 ? 16.552  32.132  -2.177  1.00 17.00 ? 448 ALA A H    1 
ATOM   4151  N  N    . LYS A 1 418 ? 16.306  29.917  -4.650  1.00 2.00  ? 449 LYS A N    1 
ATOM   4152  C  CA   . LYS A 1 418 ? 16.264  29.327  -5.960  1.00 2.01  ? 449 LYS A CA   1 
ATOM   4153  C  C    . LYS A 1 418 ? 17.697  29.029  -6.312  1.00 4.54  ? 449 LYS A C    1 
ATOM   4154  O  O    . LYS A 1 418 ? 18.055  27.863  -6.340  1.00 7.25  ? 449 LYS A O    1 
ATOM   4155  C  CB   . LYS A 1 418 ? 15.698  30.298  -6.967  1.00 4.63  ? 449 LYS A CB   1 
ATOM   4156  C  CG   . LYS A 1 418 ? 15.787  29.831  -8.399  1.00 5.70  ? 449 LYS A CG   1 
ATOM   4157  C  CD   . LYS A 1 418 ? 14.680  30.494  -9.206  1.00 10.35 ? 449 LYS A CD   1 
ATOM   4158  C  CE   . LYS A 1 418 ? 14.855  30.295  -10.703 1.00 12.05 ? 449 LYS A CE   1 
ATOM   4159  N  NZ   . LYS A 1 418 ? 15.865  31.213  -11.323 1.00 14.00 ? 449 LYS A NZ   1 
ATOM   4160  H  H    . LYS A 1 418 ? 16.027  30.845  -4.547  1.00 17.00 ? 449 LYS A H    1 
ATOM   4161  H  HZ1  . LYS A 1 418 ? 16.796  31.060  -10.887 1.00 17.00 ? 449 LYS A HZ1  1 
ATOM   4162  H  HZ2  . LYS A 1 418 ? 15.919  31.020  -12.343 1.00 17.00 ? 449 LYS A HZ2  1 
ATOM   4163  H  HZ3  . LYS A 1 418 ? 15.565  32.197  -11.174 1.00 17.00 ? 449 LYS A HZ3  1 
ATOM   4164  N  N    . ALA A 1 419 ? 18.516  30.075  -6.528  1.00 5.00  ? 450 ALA A N    1 
ATOM   4165  C  CA   . ALA A 1 419 ? 19.953  29.960  -6.869  1.00 4.09  ? 450 ALA A CA   1 
ATOM   4166  C  C    . ALA A 1 419 ? 20.545  28.762  -6.182  1.00 3.89  ? 450 ALA A C    1 
ATOM   4167  O  O    . ALA A 1 419 ? 20.940  27.799  -6.837  1.00 4.90  ? 450 ALA A O    1 
ATOM   4168  C  CB   . ALA A 1 419 ? 20.729  31.206  -6.452  1.00 3.54  ? 450 ALA A CB   1 
ATOM   4169  H  H    . ALA A 1 419 ? 18.152  30.983  -6.436  1.00 17.00 ? 450 ALA A H    1 
ATOM   4170  N  N    . SER A 1 420 ? 20.504  28.783  -4.859  1.00 2.90  ? 451 SER A N    1 
ATOM   4171  C  CA   . SER A 1 420 ? 21.010  27.689  -4.042  1.00 3.97  ? 451 SER A CA   1 
ATOM   4172  C  C    . SER A 1 420 ? 20.736  26.320  -4.682  1.00 5.25  ? 451 SER A C    1 
ATOM   4173  O  O    . SER A 1 420 ? 21.660  25.548  -4.968  1.00 5.22  ? 451 SER A O    1 
ATOM   4174  C  CB   . SER A 1 420 ? 20.348  27.767  -2.674  1.00 3.64  ? 451 SER A CB   1 
ATOM   4175  O  OG   . SER A 1 420 ? 20.415  29.097  -2.158  1.00 4.04  ? 451 SER A OG   1 
ATOM   4176  H  H    . SER A 1 420 ? 20.121  29.566  -4.419  1.00 17.00 ? 451 SER A H    1 
ATOM   4177  H  HG   . SER A 1 420 ? 19.864  29.681  -2.676  1.00 17.00 ? 451 SER A HG   1 
ATOM   4178  N  N    . ILE A 1 421 ? 19.473  26.089  -5.020  1.00 7.07  ? 452 ILE A N    1 
ATOM   4179  C  CA   . ILE A 1 421 ? 19.054  24.825  -5.614  1.00 5.33  ? 452 ILE A CA   1 
ATOM   4180  C  C    . ILE A 1 421 ? 19.769  24.585  -6.933  1.00 4.31  ? 452 ILE A C    1 
ATOM   4181  O  O    . ILE A 1 421 ? 20.557  23.636  -7.054  1.00 4.03  ? 452 ILE A O    1 
ATOM   4182  C  CB   . ILE A 1 421 ? 17.491  24.762  -5.846  1.00 4.06  ? 452 ILE A CB   1 
ATOM   4183  C  CG1  . ILE A 1 421 ? 16.738  25.176  -4.579  1.00 3.00  ? 452 ILE A CG1  1 
ATOM   4184  C  CG2  . ILE A 1 421 ? 17.060  23.343  -6.225  1.00 2.00  ? 452 ILE A CG2  1 
ATOM   4185  C  CD1  . ILE A 1 421 ? 15.250  25.217  -4.746  1.00 2.01  ? 452 ILE A CD1  1 
ATOM   4186  H  H    . ILE A 1 421 ? 18.807  26.797  -4.884  1.00 17.00 ? 452 ILE A H    1 
ATOM   4187  N  N    . ASP A 1 422 ? 19.526  25.464  -7.898  1.00 2.80  ? 453 ASP A N    1 
ATOM   4188  C  CA   . ASP A 1 422 ? 20.116  25.300  -9.228  1.00 6.03  ? 453 ASP A CA   1 
ATOM   4189  C  C    . ASP A 1 422 ? 21.629  25.644  -9.380  1.00 3.92  ? 453 ASP A C    1 
ATOM   4190  O  O    . ASP A 1 422 ? 22.256  25.333  -10.405 1.00 2.00  ? 453 ASP A O    1 
ATOM   4191  C  CB   . ASP A 1 422 ? 19.230  25.968  -10.310 1.00 8.27  ? 453 ASP A CB   1 
ATOM   4192  C  CG   . ASP A 1 422 ? 18.887  27.423  -9.986  1.00 13.39 ? 453 ASP A CG   1 
ATOM   4193  O  OD1  . ASP A 1 422 ? 18.269  27.640  -8.920  1.00 18.33 ? 453 ASP A OD1  1 
ATOM   4194  O  OD2  . ASP A 1 422 ? 19.219  28.344  -10.785 1.00 11.42 ? 453 ASP A OD2  1 
ATOM   4195  H  H    . ASP A 1 422 ? 18.978  26.241  -7.660  1.00 17.00 ? 453 ASP A H    1 
ATOM   4196  N  N    . GLN A 1 423 ? 22.219  26.195  -8.322  1.00 3.94  ? 454 GLN A N    1 
ATOM   4197  C  CA   . GLN A 1 423 ? 23.635  26.542  -8.297  1.00 2.84  ? 454 GLN A CA   1 
ATOM   4198  C  C    . GLN A 1 423 ? 24.391  25.327  -7.784  1.00 5.94  ? 454 GLN A C    1 
ATOM   4199  O  O    . GLN A 1 423 ? 25.427  24.935  -8.356  1.00 8.38  ? 454 GLN A O    1 
ATOM   4200  C  CB   . GLN A 1 423 ? 23.888  27.667  -7.324  1.00 2.47  ? 454 GLN A CB   1 
ATOM   4201  C  CG   . GLN A 1 423 ? 25.001  28.564  -7.743  1.00 3.61  ? 454 GLN A CG   1 
ATOM   4202  C  CD   . GLN A 1 423 ? 24.837  29.968  -7.216  1.00 3.07  ? 454 GLN A CD   1 
ATOM   4203  O  OE1  . GLN A 1 423 ? 24.881  30.933  -7.981  1.00 4.66  ? 454 GLN A OE1  1 
ATOM   4204  N  NE2  . GLN A 1 423 ? 24.643  30.092  -5.908  1.00 2.99  ? 454 GLN A NE2  1 
ATOM   4205  H  H    . GLN A 1 423 ? 21.663  26.318  -7.534  1.00 17.00 ? 454 GLN A H    1 
ATOM   4206  H  HE21 . GLN A 1 423 ? 24.475  31.020  -5.595  1.00 17.00 ? 454 GLN A HE21 1 
ATOM   4207  H  HE22 . GLN A 1 423 ? 24.647  29.314  -5.323  1.00 17.00 ? 454 GLN A HE22 1 
ATOM   4208  N  N    . SER A 1 424 ? 23.885  24.736  -6.698  1.00 4.18  ? 455 SER A N    1 
ATOM   4209  C  CA   . SER A 1 424 ? 24.511  23.559  -6.141  1.00 2.12  ? 455 SER A CA   1 
ATOM   4210  C  C    . SER A 1 424 ? 24.428  22.409  -7.147  1.00 2.00  ? 455 SER A C    1 
ATOM   4211  O  O    . SER A 1 424 ? 25.113  21.378  -7.005  1.00 2.00  ? 455 SER A O    1 
ATOM   4212  C  CB   . SER A 1 424 ? 23.841  23.200  -4.821  1.00 4.18  ? 455 SER A CB   1 
ATOM   4213  O  OG   . SER A 1 424 ? 24.029  24.240  -3.882  1.00 4.73  ? 455 SER A OG   1 
ATOM   4214  H  H    . SER A 1 424 ? 23.068  25.071  -6.271  1.00 17.00 ? 455 SER A H    1 
ATOM   4215  H  HG   . SER A 1 424 ? 23.426  24.954  -4.135  1.00 17.00 ? 455 SER A HG   1 
ATOM   4216  N  N    . ARG A 1 425 ? 23.570  22.592  -8.150  1.00 2.00  ? 456 ARG A N    1 
ATOM   4217  C  CA   . ARG A 1 425 ? 23.361  21.614  -9.228  1.00 3.02  ? 456 ARG A CA   1 
ATOM   4218  C  C    . ARG A 1 425 ? 24.462  21.848  -10.255 1.00 2.76  ? 456 ARG A C    1 
ATOM   4219  O  O    . ARG A 1 425 ? 25.011  20.901  -10.847 1.00 2.00  ? 456 ARG A O    1 
ATOM   4220  C  CB   . ARG A 1 425 ? 21.986  21.826  -9.892  1.00 3.39  ? 456 ARG A CB   1 
ATOM   4221  C  CG   . ARG A 1 425 ? 20.791  21.542  -9.008  1.00 2.29  ? 456 ARG A CG   1 
ATOM   4222  C  CD   . ARG A 1 425 ? 19.495  21.970  -9.663  1.00 2.19  ? 456 ARG A CD   1 
ATOM   4223  N  NE   . ARG A 1 425 ? 18.373  21.153  -9.184  1.00 8.08  ? 456 ARG A NE   1 
ATOM   4224  C  CZ   . ARG A 1 425 ? 17.109  21.256  -9.593  1.00 5.78  ? 456 ARG A CZ   1 
ATOM   4225  N  NH1  . ARG A 1 425 ? 16.771  22.163  -10.498 1.00 6.61  ? 456 ARG A NH1  1 
ATOM   4226  N  NH2  . ARG A 1 425 ? 16.194  20.406  -9.132  1.00 3.44  ? 456 ARG A NH2  1 
ATOM   4227  H  H    . ARG A 1 425 ? 23.006  23.390  -8.157  1.00 17.00 ? 456 ARG A H    1 
ATOM   4228  H  HE   . ARG A 1 425 ? 18.581  20.477  -8.510  1.00 17.00 ? 456 ARG A HE   1 
ATOM   4229  H  HH11 . ARG A 1 425 ? 17.457  22.779  -10.884 1.00 17.00 ? 456 ARG A HH11 1 
ATOM   4230  H  HH12 . ARG A 1 425 ? 15.816  22.224  -10.790 1.00 17.00 ? 456 ARG A HH12 1 
ATOM   4231  H  HH21 . ARG A 1 425 ? 16.414  19.680  -8.492  1.00 17.00 ? 456 ARG A HH21 1 
ATOM   4232  H  HH22 . ARG A 1 425 ? 15.250  20.504  -9.445  1.00 17.00 ? 456 ARG A HH22 1 
ATOM   4233  N  N    . GLU A 1 426 ? 24.747  23.132  -10.468 1.00 2.32  ? 457 GLU A N    1 
ATOM   4234  C  CA   . GLU A 1 426 ? 25.781  23.588  -11.377 1.00 2.00  ? 457 GLU A CA   1 
ATOM   4235  C  C    . GLU A 1 426 ? 27.082  22.964  -10.886 1.00 4.70  ? 457 GLU A C    1 
ATOM   4236  O  O    . GLU A 1 426 ? 27.756  22.269  -11.642 1.00 6.25  ? 457 GLU A O    1 
ATOM   4237  C  CB   . GLU A 1 426 ? 25.889  25.097  -11.286 1.00 2.00  ? 457 GLU A CB   1 
ATOM   4238  C  CG   . GLU A 1 426 ? 26.403  25.737  -12.532 1.00 10.34 ? 457 GLU A CG   1 
ATOM   4239  C  CD   . GLU A 1 426 ? 26.706  27.228  -12.365 1.00 14.98 ? 457 GLU A CD   1 
ATOM   4240  O  OE1  . GLU A 1 426 ? 26.110  27.888  -11.492 1.00 14.49 ? 457 GLU A OE1  1 
ATOM   4241  O  OE2  . GLU A 1 426 ? 27.551  27.755  -13.122 1.00 21.98 ? 457 GLU A OE2  1 
ATOM   4242  H  H    . GLU A 1 426 ? 24.222  23.815  -10.011 1.00 17.00 ? 457 GLU A H    1 
ATOM   4243  N  N    . MET A 1 427 ? 27.397  23.172  -9.600  1.00 4.19  ? 458 MET A N    1 
ATOM   4244  C  CA   . MET A 1 427 ? 28.590  22.626  -8.964  1.00 2.00  ? 458 MET A CA   1 
ATOM   4245  C  C    . MET A 1 427 ? 28.618  21.099  -8.907  1.00 3.18  ? 458 MET A C    1 
ATOM   4246  O  O    . MET A 1 427 ? 29.452  20.531  -8.214  1.00 5.15  ? 458 MET A O    1 
ATOM   4247  C  CB   . MET A 1 427 ? 28.688  23.140  -7.548  1.00 2.00  ? 458 MET A CB   1 
ATOM   4248  C  CG   . MET A 1 427 ? 28.866  24.603  -7.469  1.00 3.72  ? 458 MET A CG   1 
ATOM   4249  S  SD   . MET A 1 427 ? 29.756  25.069  -5.940  1.00 9.08  ? 458 MET A SD   1 
ATOM   4250  C  CE   . MET A 1 427 ? 28.404  24.966  -4.733  1.00 3.87  ? 458 MET A CE   1 
ATOM   4251  H  H    . MET A 1 427 ? 26.793  23.727  -9.066  1.00 17.00 ? 458 MET A H    1 
ATOM   4252  N  N    . LYS A 1 428 ? 27.673  20.440  -9.590  1.00 4.71  ? 459 LYS A N    1 
ATOM   4253  C  CA   . LYS A 1 428 ? 27.540  18.977  -9.642  1.00 2.00  ? 459 LYS A CA   1 
ATOM   4254  C  C    . LYS A 1 428 ? 27.557  18.249  -8.310  1.00 2.00  ? 459 LYS A C    1 
ATOM   4255  O  O    . LYS A 1 428 ? 28.365  17.345  -8.131  1.00 2.00  ? 459 LYS A O    1 
ATOM   4256  C  CB   . LYS A 1 428 ? 28.591  18.395  -10.581 1.00 2.00  ? 459 LYS A CB   1 
ATOM   4257  C  CG   . LYS A 1 428 ? 28.450  18.914  -12.006 1.00 3.24  ? 459 LYS A CG   1 
ATOM   4258  C  CD   . LYS A 1 428 ? 28.207  17.805  -13.032 1.00 5.00  ? 459 LYS A CD   1 
ATOM   4259  C  CE   . LYS A 1 428 ? 26.796  17.211  -12.976 1.00 9.56  ? 459 LYS A CE   1 
ATOM   4260  N  NZ   . LYS A 1 428 ? 26.457  16.342  -11.786 1.00 10.17 ? 459 LYS A NZ   1 
ATOM   4261  H  H    . LYS A 1 428 ? 27.003  20.902  -10.116 1.00 17.00 ? 459 LYS A H    1 
ATOM   4262  H  HZ1  . LYS A 1 428 ? 27.156  15.575  -11.737 1.00 17.00 ? 459 LYS A HZ1  1 
ATOM   4263  H  HZ2  . LYS A 1 428 ? 26.513  16.906  -10.913 1.00 17.00 ? 459 LYS A HZ2  1 
ATOM   4264  H  HZ3  . LYS A 1 428 ? 25.503  15.935  -11.880 1.00 17.00 ? 459 LYS A HZ3  1 
ATOM   4265  N  N    . TYR A 1 429 ? 26.691  18.654  -7.374  1.00 2.00  ? 460 TYR A N    1 
ATOM   4266  C  CA   . TYR A 1 429 ? 26.622  18.009  -6.051  1.00 3.53  ? 460 TYR A CA   1 
ATOM   4267  C  C    . TYR A 1 429 ? 26.047  16.604  -6.118  1.00 3.15  ? 460 TYR A C    1 
ATOM   4268  O  O    . TYR A 1 429 ? 25.482  16.196  -7.127  1.00 5.69  ? 460 TYR A O    1 
ATOM   4269  C  CB   . TYR A 1 429 ? 25.744  18.792  -5.088  1.00 3.52  ? 460 TYR A CB   1 
ATOM   4270  C  CG   . TYR A 1 429 ? 26.410  19.846  -4.264  1.00 2.00  ? 460 TYR A CG   1 
ATOM   4271  C  CD1  . TYR A 1 429 ? 27.215  20.786  -4.853  1.00 2.81  ? 460 TYR A CD1  1 
ATOM   4272  C  CD2  . TYR A 1 429 ? 26.133  19.965  -2.897  1.00 2.00  ? 460 TYR A CD2  1 
ATOM   4273  C  CE1  . TYR A 1 429 ? 27.738  21.860  -4.107  1.00 6.34  ? 460 TYR A CE1  1 
ATOM   4274  C  CE2  . TYR A 1 429 ? 26.631  21.018  -2.138  1.00 2.00  ? 460 TYR A CE2  1 
ATOM   4275  C  CZ   . TYR A 1 429 ? 27.438  21.974  -2.750  1.00 4.69  ? 460 TYR A CZ   1 
ATOM   4276  O  OH   . TYR A 1 429 ? 27.952  23.046  -2.050  1.00 2.00  ? 460 TYR A OH   1 
ATOM   4277  H  H    . TYR A 1 429 ? 26.081  19.388  -7.576  1.00 17.00 ? 460 TYR A H    1 
ATOM   4278  H  HH   . TYR A 1 429 ? 28.363  23.654  -2.667  1.00 17.00 ? 460 TYR A HH   1 
ATOM   4279  N  N    . GLN A 1 430 ? 26.132  15.891  -5.007  1.00 4.87  ? 461 GLN A N    1 
ATOM   4280  C  CA   . GLN A 1 430 ? 25.621  14.508  -4.921  1.00 7.47  ? 461 GLN A CA   1 
ATOM   4281  C  C    . GLN A 1 430 ? 24.276  14.389  -4.165  1.00 6.19  ? 461 GLN A C    1 
ATOM   4282  O  O    . GLN A 1 430 ? 23.843  15.309  -3.479  1.00 7.07  ? 461 GLN A O    1 
ATOM   4283  C  CB   . GLN A 1 430 ? 26.644  13.579  -4.231  1.00 6.20  ? 461 GLN A CB   1 
ATOM   4284  C  CG   . GLN A 1 430 ? 27.957  13.387  -4.941  1.00 6.01  ? 461 GLN A CG   1 
ATOM   4285  C  CD   . GLN A 1 430 ? 28.692  12.146  -4.445  1.00 6.27  ? 461 GLN A CD   1 
ATOM   4286  O  OE1  . GLN A 1 430 ? 28.672  11.841  -3.255  1.00 5.95  ? 461 GLN A OE1  1 
ATOM   4287  N  NE2  . GLN A 1 430 ? 29.336  11.424  -5.355  1.00 4.95  ? 461 GLN A NE2  1 
ATOM   4288  H  H    . GLN A 1 430 ? 26.513  16.296  -4.206  1.00 17.00 ? 461 GLN A H    1 
ATOM   4289  H  HE21 . GLN A 1 430 ? 29.732  10.596  -5.014  1.00 17.00 ? 461 GLN A HE21 1 
ATOM   4290  H  HE22 . GLN A 1 430 ? 29.374  11.713  -6.284  1.00 17.00 ? 461 GLN A HE22 1 
ATOM   4291  N  N    . SER A 1 431 ? 23.665  13.218  -4.275  1.00 6.30  ? 462 SER A N    1 
ATOM   4292  C  CA   . SER A 1 431 ? 22.398  12.897  -3.637  1.00 7.12  ? 462 SER A CA   1 
ATOM   4293  C  C    . SER A 1 431 ? 22.420  13.085  -2.137  1.00 7.03  ? 462 SER A C    1 
ATOM   4294  O  O    . SER A 1 431 ? 23.424  12.803  -1.483  1.00 8.42  ? 462 SER A O    1 
ATOM   4295  C  CB   . SER A 1 431 ? 22.019  11.445  -3.968  1.00 7.65  ? 462 SER A CB   1 
ATOM   4296  O  OG   . SER A 1 431 ? 21.258  10.847  -2.935  1.00 8.73  ? 462 SER A OG   1 
ATOM   4297  H  H    . SER A 1 431 ? 24.086  12.525  -4.817  1.00 17.00 ? 462 SER A H    1 
ATOM   4298  H  HG   . SER A 1 431 ? 20.807  10.099  -3.365  1.00 17.00 ? 462 SER A HG   1 
ATOM   4299  N  N    . LEU A 1 432 ? 21.263  13.463  -1.601  1.00 6.65  ? 463 LEU A N    1 
ATOM   4300  C  CA   . LEU A 1 432 ? 21.067  13.695  -0.180  1.00 5.59  ? 463 LEU A CA   1 
ATOM   4301  C  C    . LEU A 1 432 ? 21.484  12.504  0.660   1.00 5.14  ? 463 LEU A C    1 
ATOM   4302  O  O    . LEU A 1 432 ? 21.931  12.651  1.787   1.00 4.18  ? 463 LEU A O    1 
ATOM   4303  C  CB   . LEU A 1 432 ? 19.594  13.988  0.105   1.00 5.60  ? 463 LEU A CB   1 
ATOM   4304  C  CG   . LEU A 1 432 ? 19.240  14.094  1.595   1.00 7.74  ? 463 LEU A CG   1 
ATOM   4305  C  CD1  . LEU A 1 432 ? 19.757  15.383  2.214   1.00 7.35  ? 463 LEU A CD1  1 
ATOM   4306  C  CD2  . LEU A 1 432 ? 17.742  13.959  1.795   1.00 6.31  ? 463 LEU A CD2  1 
ATOM   4307  H  H    . LEU A 1 432 ? 20.507  13.565  -2.205  1.00 17.00 ? 463 LEU A H    1 
ATOM   4308  N  N    . ASN A 1 433 ? 21.344  11.311  0.125   1.00 5.97  ? 464 ASN A N    1 
ATOM   4309  C  CA   . ASN A 1 433 ? 21.708  10.167  0.918   1.00 8.35  ? 464 ASN A CA   1 
ATOM   4310  C  C    . ASN A 1 433 ? 23.165  9.849   0.890   1.00 8.70  ? 464 ASN A C    1 
ATOM   4311  O  O    . ASN A 1 433 ? 23.692  9.369   1.887   1.00 9.30  ? 464 ASN A O    1 
ATOM   4312  C  CB   . ASN A 1 433 ? 20.861  8.959   0.545   1.00 11.50 ? 464 ASN A CB   1 
ATOM   4313  C  CG   . ASN A 1 433 ? 19.408  9.131   0.968   1.00 12.72 ? 464 ASN A CG   1 
ATOM   4314  O  OD1  . ASN A 1 433 ? 18.503  9.021   0.149   1.00 13.26 ? 464 ASN A OD1  1 
ATOM   4315  N  ND2  . ASN A 1 433 ? 19.189  9.446   2.246   1.00 6.88  ? 464 ASN A ND2  1 
ATOM   4316  H  H    . ASN A 1 433 ? 21.004  11.220  -0.795  1.00 17.00 ? 464 ASN A H    1 
ATOM   4317  H  HD21 . ASN A 1 433 ? 18.241  9.612   2.422   1.00 17.00 ? 464 ASN A HD21 1 
ATOM   4318  H  HD22 . ASN A 1 433 ? 19.928  9.527   2.883   1.00 17.00 ? 464 ASN A HD22 1 
ATOM   4319  N  N    . GLU A 1 434 ? 23.837  10.137  -0.226  1.00 10.04 ? 465 GLU A N    1 
ATOM   4320  C  CA   . GLU A 1 434 ? 25.270  9.856   -0.309  1.00 8.16  ? 465 GLU A CA   1 
ATOM   4321  C  C    . GLU A 1 434 ? 25.924  10.674  0.772   1.00 6.29  ? 465 GLU A C    1 
ATOM   4322  O  O    . GLU A 1 434 ? 26.732  10.172  1.537   1.00 6.52  ? 465 GLU A O    1 
ATOM   4323  C  CB   . GLU A 1 434 ? 25.844  10.147  -1.695  1.00 9.50  ? 465 GLU A CB   1 
ATOM   4324  C  CG   . GLU A 1 434 ? 25.810  8.914   -2.638  1.00 15.34 ? 465 GLU A CG   1 
ATOM   4325  C  CD   . GLU A 1 434 ? 26.449  7.618   -2.023  1.00 19.10 ? 465 GLU A CD   1 
ATOM   4326  O  OE1  . GLU A 1 434 ? 27.633  7.617   -1.563  1.00 22.69 ? 465 GLU A OE1  1 
ATOM   4327  O  OE2  . GLU A 1 434 ? 25.765  6.575   -2.014  1.00 18.65 ? 465 GLU A OE2  1 
ATOM   4328  H  H    . GLU A 1 434 ? 23.375  10.566  -0.978  1.00 17.00 ? 465 GLU A H    1 
ATOM   4329  N  N    . TYR A 1 435 ? 25.433  11.893  0.938   1.00 5.84  ? 466 TYR A N    1 
ATOM   4330  C  CA   . TYR A 1 435 ? 25.927  12.781  1.981   1.00 3.65  ? 466 TYR A CA   1 
ATOM   4331  C  C    . TYR A 1 435 ? 25.605  12.242  3.376   1.00 3.74  ? 466 TYR A C    1 
ATOM   4332  O  O    . TYR A 1 435 ? 26.466  12.210  4.250   1.00 2.00  ? 466 TYR A O    1 
ATOM   4333  C  CB   . TYR A 1 435 ? 25.360  14.181  1.799   1.00 2.00  ? 466 TYR A CB   1 
ATOM   4334  C  CG   . TYR A 1 435 ? 26.199  14.990  0.876   1.00 2.00  ? 466 TYR A CG   1 
ATOM   4335  C  CD1  . TYR A 1 435 ? 25.996  14.942  -0.494  1.00 2.00  ? 466 TYR A CD1  1 
ATOM   4336  C  CD2  . TYR A 1 435 ? 27.262  15.740  1.366   1.00 3.98  ? 466 TYR A CD2  1 
ATOM   4337  C  CE1  . TYR A 1 435 ? 26.837  15.615  -1.367  1.00 5.08  ? 466 TYR A CE1  1 
ATOM   4338  C  CE2  . TYR A 1 435 ? 28.118  16.427  0.513   1.00 6.25  ? 466 TYR A CE2  1 
ATOM   4339  C  CZ   . TYR A 1 435 ? 27.907  16.366  -0.864  1.00 7.29  ? 466 TYR A CZ   1 
ATOM   4340  O  OH   . TYR A 1 435 ? 28.764  17.059  -1.728  1.00 6.93  ? 466 TYR A OH   1 
ATOM   4341  H  H    . TYR A 1 435 ? 24.734  12.207  0.325   1.00 17.00 ? 466 TYR A H    1 
ATOM   4342  H  HH   . TYR A 1 435 ? 28.572  16.852  -2.646  1.00 17.00 ? 466 TYR A HH   1 
ATOM   4343  N  N    . ARG A 1 436 ? 24.370  11.780  3.564   1.00 5.52  ? 467 ARG A N    1 
ATOM   4344  C  CA   . ARG A 1 436 ? 23.935  11.243  4.847   1.00 4.70  ? 467 ARG A CA   1 
ATOM   4345  C  C    . ARG A 1 436 ? 24.828  10.100  5.207   1.00 5.11  ? 467 ARG A C    1 
ATOM   4346  O  O    . ARG A 1 436 ? 25.275  10.013  6.327   1.00 7.83  ? 467 ARG A O    1 
ATOM   4347  C  CB   . ARG A 1 436 ? 22.478  10.780  4.809   1.00 5.03  ? 467 ARG A CB   1 
ATOM   4348  C  CG   . ARG A 1 436 ? 21.451  11.917  4.963   1.00 9.37  ? 467 ARG A CG   1 
ATOM   4349  C  CD   . ARG A 1 436 ? 19.996  11.426  4.992   1.00 5.75  ? 467 ARG A CD   1 
ATOM   4350  N  NE   . ARG A 1 436 ? 19.745  10.577  6.148   1.00 4.62  ? 467 ARG A NE   1 
ATOM   4351  C  CZ   . ARG A 1 436 ? 19.818  10.986  7.411   1.00 2.19  ? 467 ARG A CZ   1 
ATOM   4352  N  NH1  . ARG A 1 436 ? 20.111  12.245  7.682   1.00 2.00  ? 467 ARG A NH1  1 
ATOM   4353  N  NH2  . ARG A 1 436 ? 19.722  10.107  8.401   1.00 2.00  ? 467 ARG A NH2  1 
ATOM   4354  H  H    . ARG A 1 436 ? 23.737  11.815  2.820   1.00 17.00 ? 467 ARG A H    1 
ATOM   4355  H  HE   . ARG A 1 436 ? 19.506  9.642   5.985   1.00 17.00 ? 467 ARG A HE   1 
ATOM   4356  H  HH11 . ARG A 1 436 ? 20.287  12.874  6.931   1.00 17.00 ? 467 ARG A HH11 1 
ATOM   4357  H  HH12 . ARG A 1 436 ? 20.176  12.562  8.626   1.00 17.00 ? 467 ARG A HH12 1 
ATOM   4358  H  HH21 . ARG A 1 436 ? 19.596  9.139   8.193   1.00 17.00 ? 467 ARG A HH21 1 
ATOM   4359  H  HH22 . ARG A 1 436 ? 19.783  10.407  9.350   1.00 17.00 ? 467 ARG A HH22 1 
ATOM   4360  N  N    . LYS A 1 437 ? 25.128  9.246   4.240   1.00 4.14  ? 468 LYS A N    1 
ATOM   4361  C  CA   . LYS A 1 437 ? 25.991  8.108   4.470   1.00 2.41  ? 468 LYS A CA   1 
ATOM   4362  C  C    . LYS A 1 437 ? 27.384  8.643   4.798   1.00 3.04  ? 468 LYS A C    1 
ATOM   4363  O  O    . LYS A 1 437 ? 28.001  8.238   5.780   1.00 2.24  ? 468 LYS A O    1 
ATOM   4364  C  CB   . LYS A 1 437 ? 26.043  7.262   3.209   1.00 3.05  ? 468 LYS A CB   1 
ATOM   4365  C  CG   . LYS A 1 437 ? 24.785  6.548   2.883   1.00 2.00  ? 468 LYS A CG   1 
ATOM   4366  C  CD   . LYS A 1 437 ? 24.634  6.459   1.383   1.00 2.07  ? 468 LYS A CD   1 
ATOM   4367  C  CE   . LYS A 1 437 ? 25.447  5.343   0.766   1.00 4.66  ? 468 LYS A CE   1 
ATOM   4368  N  NZ   . LYS A 1 437 ? 24.978  3.992   1.137   1.00 2.26  ? 468 LYS A NZ   1 
ATOM   4369  H  H    . LYS A 1 437 ? 24.787  9.390   3.343   1.00 17.00 ? 468 LYS A H    1 
ATOM   4370  H  HZ1  . LYS A 1 437 ? 25.012  3.898   2.172   1.00 17.00 ? 468 LYS A HZ1  1 
ATOM   4371  H  HZ2  . LYS A 1 437 ? 23.992  3.875   0.827   1.00 17.00 ? 468 LYS A HZ2  1 
ATOM   4372  H  HZ3  . LYS A 1 437 ? 25.557  3.247   0.705   1.00 17.00 ? 468 LYS A HZ3  1 
ATOM   4373  N  N    . ARG A 1 438 ? 27.840  9.594   3.985   1.00 2.33  ? 469 ARG A N    1 
ATOM   4374  C  CA   . ARG A 1 438 ? 29.134  10.221  4.146   1.00 2.01  ? 469 ARG A CA   1 
ATOM   4375  C  C    . ARG A 1 438 ? 29.303  10.720  5.578   1.00 2.00  ? 469 ARG A C    1 
ATOM   4376  O  O    . ARG A 1 438 ? 30.338  10.503  6.208   1.00 2.61  ? 469 ARG A O    1 
ATOM   4377  C  CB   . ARG A 1 438 ? 29.284  11.335  3.118   1.00 2.00  ? 469 ARG A CB   1 
ATOM   4378  C  CG   . ARG A 1 438 ? 30.408  12.306  3.347   1.00 2.00  ? 469 ARG A CG   1 
ATOM   4379  C  CD   . ARG A 1 438 ? 31.782  11.729  3.136   1.00 2.00  ? 469 ARG A CD   1 
ATOM   4380  N  NE   . ARG A 1 438 ? 32.578  11.931  4.339   1.00 2.00  ? 469 ARG A NE   1 
ATOM   4381  C  CZ   . ARG A 1 438 ? 33.302  13.013  4.594   1.00 2.00  ? 469 ARG A CZ   1 
ATOM   4382  N  NH1  . ARG A 1 438 ? 33.362  14.011  3.720   1.00 5.50  ? 469 ARG A NH1  1 
ATOM   4383  N  NH2  . ARG A 1 438 ? 33.911  13.129  5.758   1.00 2.00  ? 469 ARG A NH2  1 
ATOM   4384  H  H    . ARG A 1 438 ? 27.263  9.886   3.261   1.00 17.00 ? 469 ARG A H    1 
ATOM   4385  H  HE   . ARG A 1 438 ? 32.578  11.215  5.008   1.00 17.00 ? 469 ARG A HE   1 
ATOM   4386  H  HH11 . ARG A 1 438 ? 32.861  13.963  2.857   1.00 17.00 ? 469 ARG A HH11 1 
ATOM   4387  H  HH12 . ARG A 1 438 ? 33.916  14.815  3.932   1.00 17.00 ? 469 ARG A HH12 1 
ATOM   4388  H  HH21 . ARG A 1 438 ? 33.845  12.424  6.464   1.00 17.00 ? 469 ARG A HH21 1 
ATOM   4389  H  HH22 . ARG A 1 438 ? 34.466  13.943  5.874   1.00 17.00 ? 469 ARG A HH22 1 
ATOM   4390  N  N    . PHE A 1 439 ? 28.265  11.308  6.136   1.00 2.00  ? 470 PHE A N    1 
ATOM   4391  C  CA   . PHE A 1 439 ? 28.394  11.771  7.509   1.00 3.01  ? 470 PHE A CA   1 
ATOM   4392  C  C    . PHE A 1 439 ? 27.862  10.804  8.538   1.00 2.64  ? 470 PHE A C    1 
ATOM   4393  O  O    . PHE A 1 439 ? 27.263  11.187  9.538   1.00 2.00  ? 470 PHE A O    1 
ATOM   4394  C  CB   . PHE A 1 439 ? 27.866  13.203  7.700   1.00 3.10  ? 470 PHE A CB   1 
ATOM   4395  C  CG   . PHE A 1 439 ? 28.795  14.246  7.150   1.00 2.25  ? 470 PHE A CG   1 
ATOM   4396  C  CD1  . PHE A 1 439 ? 28.900  14.445  5.766   1.00 2.00  ? 470 PHE A CD1  1 
ATOM   4397  C  CD2  . PHE A 1 439 ? 29.620  14.971  8.003   1.00 2.24  ? 470 PHE A CD2  1 
ATOM   4398  C  CE1  . PHE A 1 439 ? 29.808  15.342  5.230   1.00 2.00  ? 470 PHE A CE1  1 
ATOM   4399  C  CE2  . PHE A 1 439 ? 30.549  15.883  7.483   1.00 4.86  ? 470 PHE A CE2  1 
ATOM   4400  C  CZ   . PHE A 1 439 ? 30.643  16.069  6.081   1.00 3.26  ? 470 PHE A CZ   1 
ATOM   4401  H  H    . PHE A 1 439 ? 27.424  11.407  5.649   1.00 17.00 ? 470 PHE A H    1 
ATOM   4402  N  N    . SER A 1 440 ? 28.137  9.532   8.298   1.00 4.42  ? 471 SER A N    1 
ATOM   4403  C  CA   . SER A 1 440 ? 27.720  8.465   9.202   1.00 7.97  ? 471 SER A CA   1 
ATOM   4404  C  C    . SER A 1 440 ? 26.235  8.512   9.657   1.00 8.13  ? 471 SER A C    1 
ATOM   4405  O  O    . SER A 1 440 ? 25.891  8.266   10.831  1.00 10.12 ? 471 SER A O    1 
ATOM   4406  C  CB   . SER A 1 440 ? 28.671  8.452   10.393  1.00 8.76  ? 471 SER A CB   1 
ATOM   4407  O  OG   . SER A 1 440 ? 30.005  8.406   9.919   1.00 7.24  ? 471 SER A OG   1 
ATOM   4408  H  H    . SER A 1 440 ? 28.653  9.270   7.509   1.00 17.00 ? 471 SER A H    1 
ATOM   4409  H  HG   . SER A 1 440 ? 30.544  8.483   10.711  1.00 17.00 ? 471 SER A HG   1 
ATOM   4410  N  N    . LEU A 1 441 ? 25.363  8.815   8.708   1.00 5.55  ? 472 LEU A N    1 
ATOM   4411  C  CA   . LEU A 1 441 ? 23.948  8.885   8.970   1.00 6.04  ? 472 LEU A CA   1 
ATOM   4412  C  C    . LEU A 1 441 ? 23.419  7.783   8.089   1.00 5.28  ? 472 LEU A C    1 
ATOM   4413  O  O    . LEU A 1 441 ? 24.135  7.332   7.206   1.00 2.02  ? 472 LEU A O    1 
ATOM   4414  C  CB   . LEU A 1 441 ? 23.364  10.242  8.528   1.00 6.02  ? 472 LEU A CB   1 
ATOM   4415  C  CG   . LEU A 1 441 ? 23.977  11.544  9.059   1.00 5.93  ? 472 LEU A CG   1 
ATOM   4416  C  CD1  . LEU A 1 441 ? 23.330  12.772  8.396   1.00 5.10  ? 472 LEU A CD1  1 
ATOM   4417  C  CD2  . LEU A 1 441 ? 23.834  11.602  10.564  1.00 2.32  ? 472 LEU A CD2  1 
ATOM   4418  H  H    . LEU A 1 441 ? 25.692  8.953   7.799   1.00 17.00 ? 472 LEU A H    1 
ATOM   4419  N  N    . LYS A 1 442 ? 22.187  7.341   8.356   1.00 5.98  ? 473 LYS A N    1 
ATOM   4420  C  CA   . LYS A 1 442 ? 21.536  6.298   7.581   1.00 5.48  ? 473 LYS A CA   1 
ATOM   4421  C  C    . LYS A 1 442 ? 20.636  6.935   6.543   1.00 2.66  ? 473 LYS A C    1 
ATOM   4422  O  O    . LYS A 1 442 ? 19.787  7.750   6.894   1.00 2.01  ? 473 LYS A O    1 
ATOM   4423  C  CB   . LYS A 1 442 ? 20.710  5.378   8.487   1.00 10.01 ? 473 LYS A CB   1 
ATOM   4424  C  CG   . LYS A 1 442 ? 20.126  4.176   7.704   1.00 16.52 ? 473 LYS A CG   1 
ATOM   4425  C  CD   . LYS A 1 442 ? 19.185  3.262   8.494   1.00 19.60 ? 473 LYS A CD   1 
ATOM   4426  C  CE   . LYS A 1 442 ? 19.907  2.566   9.651   1.00 23.00 ? 473 LYS A CE   1 
ATOM   4427  N  NZ   . LYS A 1 442 ? 21.095  1.775   9.219   1.00 23.60 ? 473 LYS A NZ   1 
ATOM   4428  H  H    . LYS A 1 442 ? 21.688  7.754   9.085   1.00 17.00 ? 473 LYS A H    1 
ATOM   4429  H  HZ1  . LYS A 1 442 ? 21.770  2.380   8.710   1.00 17.00 ? 473 LYS A HZ1  1 
ATOM   4430  H  HZ2  . LYS A 1 442 ? 21.554  1.380   10.065  1.00 17.00 ? 473 LYS A HZ2  1 
ATOM   4431  H  HZ3  . LYS A 1 442 ? 20.781  0.996   8.607   1.00 17.00 ? 473 LYS A HZ3  1 
ATOM   4432  N  N    . PRO A 1 443 ? 20.816  6.585   5.248   1.00 4.57  ? 474 PRO A N    1 
ATOM   4433  C  CA   . PRO A 1 443 ? 19.987  7.157   4.174   1.00 5.99  ? 474 PRO A CA   1 
ATOM   4434  C  C    . PRO A 1 443 ? 18.491  6.927   4.369   1.00 7.13  ? 474 PRO A C    1 
ATOM   4435  O  O    . PRO A 1 443 ? 18.065  5.928   4.971   1.00 7.46  ? 474 PRO A O    1 
ATOM   4436  C  CB   . PRO A 1 443 ? 20.515  6.472   2.915   1.00 2.76  ? 474 PRO A CB   1 
ATOM   4437  C  CG   . PRO A 1 443 ? 21.047  5.204   3.404   1.00 4.13  ? 474 PRO A CG   1 
ATOM   4438  C  CD   . PRO A 1 443 ? 21.742  5.587   4.689   1.00 4.35  ? 474 PRO A CD   1 
ATOM   4439  N  N    . TYR A 1 444 ? 17.705  7.897   3.908   1.00 7.65  ? 475 TYR A N    1 
ATOM   4440  C  CA   . TYR A 1 444 ? 16.248  7.860   4.033   1.00 7.70  ? 475 TYR A CA   1 
ATOM   4441  C  C    . TYR A 1 444 ? 15.593  6.886   3.083   1.00 7.96  ? 475 TYR A C    1 
ATOM   4442  O  O    . TYR A 1 444 ? 16.057  6.689   1.960   1.00 6.78  ? 475 TYR A O    1 
ATOM   4443  C  CB   . TYR A 1 444 ? 15.650  9.243   3.848   1.00 3.59  ? 475 TYR A CB   1 
ATOM   4444  C  CG   . TYR A 1 444 ? 15.958  10.164  4.981   1.00 2.00  ? 475 TYR A CG   1 
ATOM   4445  C  CD1  . TYR A 1 444 ? 15.870  9.727   6.294   1.00 2.00  ? 475 TYR A CD1  1 
ATOM   4446  C  CD2  . TYR A 1 444 ? 16.281  11.496  4.748   1.00 2.52  ? 475 TYR A CD2  1 
ATOM   4447  C  CE1  . TYR A 1 444 ? 16.088  10.601  7.361   1.00 2.00  ? 475 TYR A CE1  1 
ATOM   4448  C  CE2  . TYR A 1 444 ? 16.492  12.380  5.801   1.00 2.00  ? 475 TYR A CE2  1 
ATOM   4449  C  CZ   . TYR A 1 444 ? 16.394  11.931  7.114   1.00 2.00  ? 475 TYR A CZ   1 
ATOM   4450  O  OH   . TYR A 1 444 ? 16.598  12.813  8.164   1.00 2.00  ? 475 TYR A OH   1 
ATOM   4451  H  H    . TYR A 1 444 ? 18.110  8.649   3.484   1.00 17.00 ? 475 TYR A H    1 
ATOM   4452  H  HH   . TYR A 1 444 ? 16.742  13.660  7.751   1.00 17.00 ? 475 TYR A HH   1 
ATOM   4453  N  N    . THR A 1 445 ? 14.505  6.285   3.558   1.00 9.03  ? 476 THR A N    1 
ATOM   4454  C  CA   . THR A 1 445 ? 13.761  5.299   2.789   1.00 9.03  ? 476 THR A CA   1 
ATOM   4455  C  C    . THR A 1 445 ? 12.627  5.915   1.999   1.00 4.99  ? 476 THR A C    1 
ATOM   4456  O  O    . THR A 1 445 ? 12.129  5.303   1.053   1.00 6.39  ? 476 THR A O    1 
ATOM   4457  C  CB   . THR A 1 445 ? 13.196  4.136   3.694   1.00 8.67  ? 476 THR A CB   1 
ATOM   4458  O  OG1  . THR A 1 445 ? 12.312  4.671   4.706   1.00 6.16  ? 476 THR A OG1  1 
ATOM   4459  C  CG2  . THR A 1 445 ? 14.343  3.364   4.338   1.00 7.57  ? 476 THR A CG2  1 
ATOM   4460  H  H    . THR A 1 445 ? 14.185  6.477   4.458   1.00 17.00 ? 476 THR A H    1 
ATOM   4461  H  HG1  . THR A 1 445 ? 11.922  3.938   5.199   1.00 17.00 ? 476 THR A HG1  1 
ATOM   4462  N  N    . SER A 1 446 ? 12.243  7.127   2.346   1.00 2.00  ? 477 SER A N    1 
ATOM   4463  C  CA   . SER A 1 446 ? 11.136  7.744   1.655   1.00 2.46  ? 477 SER A CA   1 
ATOM   4464  C  C    . SER A 1 446 ? 11.147  9.245   1.826   1.00 3.79  ? 477 SER A C    1 
ATOM   4465  O  O    . SER A 1 446 ? 11.743  9.756   2.772   1.00 4.71  ? 477 SER A O    1 
ATOM   4466  C  CB   . SER A 1 446 ? 9.831   7.200   2.229   1.00 5.31  ? 477 SER A CB   1 
ATOM   4467  O  OG   . SER A 1 446 ? 9.778   7.343   3.645   1.00 6.38  ? 477 SER A OG   1 
ATOM   4468  H  H    . SER A 1 446 ? 12.695  7.627   3.051   1.00 17.00 ? 477 SER A H    1 
ATOM   4469  H  HG   . SER A 1 446 ? 10.124  6.529   4.044   1.00 17.00 ? 477 SER A HG   1 
ATOM   4470  N  N    . PHE A 1 447 ? 10.469  9.965   0.935   1.00 3.48  ? 478 PHE A N    1 
ATOM   4471  C  CA   . PHE A 1 447 ? 10.409  11.415  1.058   1.00 3.69  ? 478 PHE A CA   1 
ATOM   4472  C  C    . PHE A 1 447 ? 9.721   11.708  2.370   1.00 5.02  ? 478 PHE A C    1 
ATOM   4473  O  O    . PHE A 1 447 ? 9.952   12.730  3.047   1.00 4.68  ? 478 PHE A O    1 
ATOM   4474  C  CB   . PHE A 1 447 ? 9.629   12.012  -0.090  1.00 3.31  ? 478 PHE A CB   1 
ATOM   4475  C  CG   . PHE A 1 447 ? 10.412  12.090  -1.356  1.00 4.00  ? 478 PHE A CG   1 
ATOM   4476  C  CD1  . PHE A 1 447 ? 10.489  10.989  -2.202  1.00 3.51  ? 478 PHE A CD1  1 
ATOM   4477  C  CD2  . PHE A 1 447 ? 11.087  13.252  -1.700  1.00 2.00  ? 478 PHE A CD2  1 
ATOM   4478  C  CE1  . PHE A 1 447 ? 11.228  11.053  -3.360  1.00 4.02  ? 478 PHE A CE1  1 
ATOM   4479  C  CE2  . PHE A 1 447 ? 11.827  13.309  -2.865  1.00 2.00  ? 478 PHE A CE2  1 
ATOM   4480  C  CZ   . PHE A 1 447 ? 11.895  12.215  -3.687  1.00 2.00  ? 478 PHE A CZ   1 
ATOM   4481  H  H    . PHE A 1 447 ? 10.025  9.520   0.181   1.00 17.00 ? 478 PHE A H    1 
ATOM   4482  N  N    . GLU A 1 448 ? 8.914   10.736  2.741   1.00 5.17  ? 479 GLU A N    1 
ATOM   4483  C  CA   . GLU A 1 448 ? 8.149   10.751  3.951   1.00 8.21  ? 479 GLU A CA   1 
ATOM   4484  C  C    . GLU A 1 448 ? 9.113   10.646  5.133   1.00 3.56  ? 479 GLU A C    1 
ATOM   4485  O  O    . GLU A 1 448 ? 8.943   11.315  6.139   1.00 2.00  ? 479 GLU A O    1 
ATOM   4486  C  CB   . GLU A 1 448 ? 7.165   9.594   3.836   1.00 16.45 ? 479 GLU A CB   1 
ATOM   4487  C  CG   . GLU A 1 448 ? 6.291   9.705   2.541   1.00 22.59 ? 479 GLU A CG   1 
ATOM   4488  C  CD   . GLU A 1 448 ? 6.491   8.566   1.507   1.00 29.04 ? 479 GLU A CD   1 
ATOM   4489  O  OE1  . GLU A 1 448 ? 5.820   7.500   1.623   1.00 32.06 ? 479 GLU A OE1  1 
ATOM   4490  O  OE2  . GLU A 1 448 ? 7.281   8.760   0.540   1.00 32.97 ? 479 GLU A OE2  1 
ATOM   4491  H  H    . GLU A 1 448 ? 8.801   9.968   2.156   1.00 17.00 ? 479 GLU A H    1 
ATOM   4492  N  N    . GLU A 1 449 ? 10.164  9.850   4.952   1.00 5.87  ? 480 GLU A N    1 
ATOM   4493  C  CA   . GLU A 1 449 ? 11.233  9.665   5.962   1.00 6.78  ? 480 GLU A CA   1 
ATOM   4494  C  C    . GLU A 1 449 ? 11.899  11.005  6.148   1.00 4.23  ? 480 GLU A C    1 
ATOM   4495  O  O    . GLU A 1 449 ? 12.189  11.415  7.265   1.00 5.87  ? 480 GLU A O    1 
ATOM   4496  C  CB   . GLU A 1 449 ? 12.323  8.704   5.464   1.00 6.04  ? 480 GLU A CB   1 
ATOM   4497  C  CG   . GLU A 1 449 ? 12.257  7.319   6.001   1.00 10.46 ? 480 GLU A CG   1 
ATOM   4498  C  CD   . GLU A 1 449 ? 13.344  7.058   7.008   1.00 13.66 ? 480 GLU A CD   1 
ATOM   4499  O  OE1  . GLU A 1 449 ? 14.491  6.738   6.601   1.00 15.23 ? 480 GLU A OE1  1 
ATOM   4500  O  OE2  . GLU A 1 449 ? 13.047  7.169   8.216   1.00 13.60 ? 480 GLU A OE2  1 
ATOM   4501  H  H    . GLU A 1 449 ? 10.234  9.338   4.128   1.00 17.00 ? 480 GLU A H    1 
ATOM   4502  N  N    . LEU A 1 450 ? 12.157  11.669  5.031   1.00 2.00  ? 481 LEU A N    1 
ATOM   4503  C  CA   . LEU A 1 450 ? 12.806  12.942  5.046   1.00 2.00  ? 481 LEU A CA   1 
ATOM   4504  C  C    . LEU A 1 450 ? 11.983  13.948  5.793   1.00 3.67  ? 481 LEU A C    1 
ATOM   4505  O  O    . LEU A 1 450 ? 12.451  14.524  6.783   1.00 4.80  ? 481 LEU A O    1 
ATOM   4506  C  CB   . LEU A 1 450 ? 13.035  13.422  3.619   1.00 2.09  ? 481 LEU A CB   1 
ATOM   4507  C  CG   . LEU A 1 450 ? 13.475  14.873  3.414   1.00 2.85  ? 481 LEU A CG   1 
ATOM   4508  C  CD1  . LEU A 1 450 ? 14.870  15.027  3.937   1.00 6.05  ? 481 LEU A CD1  1 
ATOM   4509  C  CD2  . LEU A 1 450 ? 13.405  15.292  1.939   1.00 2.00  ? 481 LEU A CD2  1 
ATOM   4510  H  H    . LEU A 1 450 ? 11.888  11.279  4.176   1.00 17.00 ? 481 LEU A H    1 
ATOM   4511  N  N    . THR A 1 451 ? 10.719  14.078  5.396   1.00 4.67  ? 482 THR A N    1 
ATOM   4512  C  CA   . THR A 1 451 ? 9.840   15.100  6.000   1.00 6.61  ? 482 THR A CA   1 
ATOM   4513  C  C    . THR A 1 451 ? 9.071   14.902  7.293   1.00 2.00  ? 482 THR A C    1 
ATOM   4514  O  O    . THR A 1 451 ? 8.728   15.870  7.944   1.00 3.41  ? 482 THR A O    1 
ATOM   4515  C  CB   . THR A 1 451 ? 8.828   15.694  4.955   1.00 11.03 ? 482 THR A CB   1 
ATOM   4516  O  OG1  . THR A 1 451 ? 8.035   14.639  4.361   1.00 14.16 ? 482 THR A OG1  1 
ATOM   4517  C  CG2  . THR A 1 451 ? 9.578   16.475  3.859   1.00 11.01 ? 482 THR A CG2  1 
ATOM   4518  H  H    . THR A 1 451 ? 10.356  13.487  4.715   1.00 17.00 ? 482 THR A H    1 
ATOM   4519  H  HG1  . THR A 1 451 ? 8.620   14.122  3.790   1.00 17.00 ? 482 THR A HG1  1 
ATOM   4520  N  N    . GLY A 1 452 ? 8.744   13.681  7.641   1.00 2.00  ? 483 GLY A N    1 
ATOM   4521  C  CA   . GLY A 1 452 ? 7.976   13.474  8.861   1.00 7.69  ? 483 GLY A CA   1 
ATOM   4522  C  C    . GLY A 1 452 ? 6.497   13.896  8.774   1.00 8.20  ? 483 GLY A C    1 
ATOM   4523  O  O    . GLY A 1 452 ? 5.799   14.006  9.799   1.00 4.26  ? 483 GLY A O    1 
ATOM   4524  H  H    . GLY A 1 452 ? 9.023   12.921  7.097   1.00 17.00 ? 483 GLY A H    1 
ATOM   4525  N  N    . GLU A 1 453 ? 6.043   14.150  7.546   1.00 8.27  ? 484 GLU A N    1 
ATOM   4526  C  CA   . GLU A 1 453 ? 4.667   14.535  7.232   1.00 6.34  ? 484 GLU A CA   1 
ATOM   4527  C  C    . GLU A 1 453 ? 4.366   13.933  5.865   1.00 7.15  ? 484 GLU A C    1 
ATOM   4528  O  O    . GLU A 1 453 ? 5.281   13.462  5.163   1.00 8.90  ? 484 GLU A O    1 
ATOM   4529  C  CB   . GLU A 1 453 ? 4.517   16.057  7.197   1.00 6.19  ? 484 GLU A CB   1 
ATOM   4530  C  CG   . GLU A 1 453 ? 5.462   16.785  6.237   1.00 6.74  ? 484 GLU A CG   1 
ATOM   4531  C  CD   . GLU A 1 453 ? 4.887   16.988  4.842   1.00 4.02  ? 484 GLU A CD   1 
ATOM   4532  O  OE1  . GLU A 1 453 ? 3.975   17.827  4.686   1.00 2.00  ? 484 GLU A OE1  1 
ATOM   4533  O  OE2  . GLU A 1 453 ? 5.375   16.321  3.907   1.00 2.00  ? 484 GLU A OE2  1 
ATOM   4534  H  H    . GLU A 1 453 ? 6.649   14.051  6.778   1.00 17.00 ? 484 GLU A H    1 
ATOM   4535  N  N    . LYS A 1 454 ? 3.105   13.956  5.457   1.00 5.21  ? 485 LYS A N    1 
ATOM   4536  C  CA   . LYS A 1 454 ? 2.770   13.359  4.170   1.00 7.08  ? 485 LYS A CA   1 
ATOM   4537  C  C    . LYS A 1 454 ? 2.565   14.274  2.967   1.00 5.90  ? 485 LYS A C    1 
ATOM   4538  O  O    . LYS A 1 454 ? 2.854   13.902  1.831   1.00 2.50  ? 485 LYS A O    1 
ATOM   4539  C  CB   . LYS A 1 454 ? 1.572   12.439  4.324   1.00 11.78 ? 485 LYS A CB   1 
ATOM   4540  C  CG   . LYS A 1 454 ? 1.934   10.966  4.297   1.00 17.23 ? 485 LYS A CG   1 
ATOM   4541  C  CD   . LYS A 1 454 ? 2.893   10.645  3.136   1.00 21.54 ? 485 LYS A CD   1 
ATOM   4542  C  CE   . LYS A 1 454 ? 3.383   9.201   3.251   1.00 24.55 ? 485 LYS A CE   1 
ATOM   4543  N  NZ   . LYS A 1 454 ? 4.062   8.937   4.577   1.00 24.05 ? 485 LYS A NZ   1 
ATOM   4544  H  H    . LYS A 1 454 ? 2.413   14.342  6.025   1.00 17.00 ? 485 LYS A H    1 
ATOM   4545  H  HZ1  . LYS A 1 454 ? 4.855   9.592   4.717   1.00 17.00 ? 485 LYS A HZ1  1 
ATOM   4546  H  HZ2  . LYS A 1 454 ? 3.368   9.070   5.340   1.00 17.00 ? 485 LYS A HZ2  1 
ATOM   4547  H  HZ3  . LYS A 1 454 ? 4.410   7.958   4.599   1.00 17.00 ? 485 LYS A HZ3  1 
ATOM   4548  N  N    . GLU A 1 455 ? 2.047   15.462  3.233   1.00 7.15  ? 486 GLU A N    1 
ATOM   4549  C  CA   . GLU A 1 455 ? 1.779   16.464  2.209   1.00 11.39 ? 486 GLU A CA   1 
ATOM   4550  C  C    . GLU A 1 455 ? 2.996   16.741  1.287   1.00 13.58 ? 486 GLU A C    1 
ATOM   4551  O  O    . GLU A 1 455 ? 2.973   16.366  0.097   1.00 17.00 ? 486 GLU A O    1 
ATOM   4552  C  CB   . GLU A 1 455 ? 1.291   17.767  2.895   1.00 13.59 ? 486 GLU A CB   1 
ATOM   4553  C  CG   . GLU A 1 455 ? 0.002   18.368  2.336   1.00 15.18 ? 486 GLU A CG   1 
ATOM   4554  C  CD   . GLU A 1 455 ? 0.209   19.721  1.672   1.00 19.86 ? 486 GLU A CD   1 
ATOM   4555  O  OE1  . GLU A 1 455 ? 1.372   20.075  1.341   1.00 20.71 ? 486 GLU A OE1  1 
ATOM   4556  O  OE2  . GLU A 1 455 ? -0.806  20.443  1.485   1.00 20.89 ? 486 GLU A OE2  1 
ATOM   4557  H  H    . GLU A 1 455 ? 1.820   15.660  4.160   1.00 17.00 ? 486 GLU A H    1 
ATOM   4558  N  N    . MET A 1 456 ? 4.038   17.401  1.821   1.00 11.16 ? 487 MET A N    1 
ATOM   4559  C  CA   . MET A 1 456 ? 5.251   17.743  1.054   1.00 8.50  ? 487 MET A CA   1 
ATOM   4560  C  C    . MET A 1 456 ? 5.897   16.494  0.477   1.00 8.60  ? 487 MET A C    1 
ATOM   4561  O  O    . MET A 1 456 ? 6.210   16.445  -0.714  1.00 7.67  ? 487 MET A O    1 
ATOM   4562  C  CB   . MET A 1 456 ? 6.272   18.465  1.934   1.00 4.48  ? 487 MET A CB   1 
ATOM   4563  C  CG   . MET A 1 456 ? 5.836   19.801  2.391   1.00 3.51  ? 487 MET A CG   1 
ATOM   4564  S  SD   . MET A 1 456 ? 7.065   20.701  3.322   1.00 2.00  ? 487 MET A SD   1 
ATOM   4565  C  CE   . MET A 1 456 ? 6.274   20.846  4.847   1.00 5.28  ? 487 MET A CE   1 
ATOM   4566  H  H    . MET A 1 456 ? 3.960   17.702  2.732   1.00 17.00 ? 487 MET A H    1 
ATOM   4567  N  N    . ALA A 1 457 ? 6.049   15.477  1.330   1.00 8.99  ? 488 ALA A N    1 
ATOM   4568  C  CA   . ALA A 1 457 ? 6.667   14.218  0.955   1.00 7.94  ? 488 ALA A CA   1 
ATOM   4569  C  C    . ALA A 1 457 ? 6.188   13.797  -0.426  1.00 7.33  ? 488 ALA A C    1 
ATOM   4570  O  O    . ALA A 1 457 ? 6.975   13.700  -1.367  1.00 2.00  ? 488 ALA A O    1 
ATOM   4571  C  CB   . ALA A 1 457 ? 6.336   13.158  2.004   1.00 7.62  ? 488 ALA A CB   1 
ATOM   4572  H  H    . ALA A 1 457 ? 5.704   15.523  2.224   1.00 17.00 ? 488 ALA A H    1 
ATOM   4573  N  N    . ALA A 1 458 ? 4.869   13.670  -0.554  1.00 11.39 ? 489 ALA A N    1 
ATOM   4574  C  CA   . ALA A 1 458 ? 4.250   13.270  -1.810  1.00 11.15 ? 489 ALA A CA   1 
ATOM   4575  C  C    . ALA A 1 458 ? 4.484   14.295  -2.913  1.00 10.24 ? 489 ALA A C    1 
ATOM   4576  O  O    . ALA A 1 458 ? 4.624   13.901  -4.071  1.00 8.21  ? 489 ALA A O    1 
ATOM   4577  C  CB   . ALA A 1 458 ? 2.779   13.025  -1.619  1.00 14.32 ? 489 ALA A CB   1 
ATOM   4578  H  H    . ALA A 1 458 ? 4.284   13.852  0.216   1.00 17.00 ? 489 ALA A H    1 
ATOM   4579  N  N    . GLU A 1 459 ? 4.493   15.592  -2.567  1.00 10.57 ? 490 GLU A N    1 
ATOM   4580  C  CA   . GLU A 1 459 ? 4.741   16.644  -3.560  1.00 10.37 ? 490 GLU A CA   1 
ATOM   4581  C  C    . GLU A 1 459 ? 6.169   16.516  -4.141  1.00 10.60 ? 490 GLU A C    1 
ATOM   4582  O  O    . GLU A 1 459 ? 6.368   16.637  -5.356  1.00 7.83  ? 490 GLU A O    1 
ATOM   4583  C  CB   . GLU A 1 459 ? 4.528   18.039  -2.963  1.00 10.50 ? 490 GLU A CB   1 
ATOM   4584  C  CG   . GLU A 1 459 ? 4.807   19.169  -3.980  1.00 13.61 ? 490 GLU A CG   1 
ATOM   4585  C  CD   . GLU A 1 459 ? 4.169   18.907  -5.374  1.00 14.75 ? 490 GLU A CD   1 
ATOM   4586  O  OE1  . GLU A 1 459 ? 2.944   18.651  -5.402  1.00 18.21 ? 490 GLU A OE1  1 
ATOM   4587  O  OE2  . GLU A 1 459 ? 4.873   18.946  -6.432  1.00 9.40  ? 490 GLU A OE2  1 
ATOM   4588  H  H    . GLU A 1 459 ? 4.324   15.839  -1.635  1.00 17.00 ? 490 GLU A H    1 
ATOM   4589  N  N    . LEU A 1 460 ? 7.150   16.266  -3.264  1.00 10.89 ? 491 LEU A N    1 
ATOM   4590  C  CA   . LEU A 1 460 ? 8.557   16.071  -3.645  1.00 6.82  ? 491 LEU A CA   1 
ATOM   4591  C  C    . LEU A 1 460 ? 8.658   14.712  -4.370  1.00 6.53  ? 491 LEU A C    1 
ATOM   4592  O  O    . LEU A 1 460 ? 9.194   14.640  -5.490  1.00 2.00  ? 491 LEU A O    1 
ATOM   4593  C  CB   . LEU A 1 460 ? 9.479   16.064  -2.396  1.00 4.50  ? 491 LEU A CB   1 
ATOM   4594  C  CG   . LEU A 1 460 ? 9.977   17.342  -1.713  1.00 2.56  ? 491 LEU A CG   1 
ATOM   4595  C  CD1  . LEU A 1 460 ? 10.652  16.992  -0.408  1.00 5.02  ? 491 LEU A CD1  1 
ATOM   4596  C  CD2  . LEU A 1 460 ? 10.953  18.084  -2.578  1.00 2.00  ? 491 LEU A CD2  1 
ATOM   4597  H  H    . LEU A 1 460 ? 6.918   16.204  -2.327  1.00 17.00 ? 491 LEU A H    1 
ATOM   4598  N  N    . LYS A 1 461 ? 8.062   13.674  -3.760  1.00 4.51  ? 492 LYS A N    1 
ATOM   4599  C  CA   . LYS A 1 461 ? 8.106   12.309  -4.288  1.00 3.61  ? 492 LYS A CA   1 
ATOM   4600  C  C    . LYS A 1 461 ? 7.616   12.323  -5.696  1.00 2.19  ? 492 LYS A C    1 
ATOM   4601  O  O    . LYS A 1 461 ? 8.047   11.563  -6.547  1.00 2.00  ? 492 LYS A O    1 
ATOM   4602  C  CB   . LYS A 1 461 ? 7.225   11.384  -3.468  1.00 8.32  ? 492 LYS A CB   1 
ATOM   4603  C  CG   . LYS A 1 461 ? 7.265   9.932   -3.923  1.00 15.99 ? 492 LYS A CG   1 
ATOM   4604  C  CD   . LYS A 1 461 ? 6.201   9.043   -3.254  1.00 17.44 ? 492 LYS A CD   1 
ATOM   4605  C  CE   . LYS A 1 461 ? 6.150   7.669   -3.933  1.00 19.28 ? 492 LYS A CE   1 
ATOM   4606  N  NZ   . LYS A 1 461 ? 5.048   6.796   -3.417  1.00 22.82 ? 492 LYS A NZ   1 
ATOM   4607  H  H    . LYS A 1 461 ? 7.564   13.881  -2.972  1.00 17.00 ? 492 LYS A H    1 
ATOM   4608  H  HZ1  . LYS A 1 461 ? 5.163   6.670   -2.391  1.00 17.00 ? 492 LYS A HZ1  1 
ATOM   4609  H  HZ2  . LYS A 1 461 ? 4.126   7.239   -3.605  1.00 17.00 ? 492 LYS A HZ2  1 
ATOM   4610  H  HZ3  . LYS A 1 461 ? 5.090   5.869   -3.886  1.00 17.00 ? 492 LYS A HZ3  1 
ATOM   4611  N  N    . ALA A 1 462 ? 6.713   13.238  -5.941  1.00 2.72  ? 493 ALA A N    1 
ATOM   4612  C  CA   . ALA A 1 462 ? 6.153   13.388  -7.257  1.00 4.29  ? 493 ALA A CA   1 
ATOM   4613  C  C    . ALA A 1 462 ? 7.260   13.839  -8.170  1.00 2.92  ? 493 ALA A C    1 
ATOM   4614  O  O    . ALA A 1 462 ? 7.515   13.267  -9.224  1.00 2.06  ? 493 ALA A O    1 
ATOM   4615  C  CB   . ALA A 1 462 ? 5.048   14.458  -7.226  1.00 7.36  ? 493 ALA A CB   1 
ATOM   4616  H  H    . ALA A 1 462 ? 6.380   13.814  -5.224  1.00 17.00 ? 493 ALA A H    1 
ATOM   4617  N  N    . LEU A 1 463 ? 7.942   14.867  -7.715  1.00 2.66  ? 494 LEU A N    1 
ATOM   4618  C  CA   . LEU A 1 463 ? 9.001   15.465  -8.485  1.00 6.25  ? 494 LEU A CA   1 
ATOM   4619  C  C    . LEU A 1 463 ? 10.226  14.604  -8.638  1.00 6.63  ? 494 LEU A C    1 
ATOM   4620  O  O    . LEU A 1 463 ? 10.616  14.251  -9.749  1.00 7.21  ? 494 LEU A O    1 
ATOM   4621  C  CB   . LEU A 1 463 ? 9.384   16.801  -7.847  1.00 6.92  ? 494 LEU A CB   1 
ATOM   4622  C  CG   . LEU A 1 463 ? 8.329   17.912  -7.924  1.00 2.96  ? 494 LEU A CG   1 
ATOM   4623  C  CD1  . LEU A 1 463 ? 8.526   18.847  -6.791  1.00 2.00  ? 494 LEU A CD1  1 
ATOM   4624  C  CD2  . LEU A 1 463 ? 8.402   18.626  -9.252  1.00 2.29  ? 494 LEU A CD2  1 
ATOM   4625  H  H    . LEU A 1 463 ? 7.720   15.231  -6.834  1.00 17.00 ? 494 LEU A H    1 
ATOM   4626  N  N    . TYR A 1 464 ? 10.854  14.306  -7.508  1.00 7.86  ? 495 TYR A N    1 
ATOM   4627  C  CA   . TYR A 1 464 ? 12.085  13.520  -7.482  1.00 6.86  ? 495 TYR A CA   1 
ATOM   4628  C  C    . TYR A 1 464 ? 11.955  12.035  -7.771  1.00 4.54  ? 495 TYR A C    1 
ATOM   4629  O  O    . TYR A 1 464 ? 12.899  11.421  -8.241  1.00 4.54  ? 495 TYR A O    1 
ATOM   4630  C  CB   . TYR A 1 464 ? 12.806  13.739  -6.151  1.00 6.21  ? 495 TYR A CB   1 
ATOM   4631  C  CG   . TYR A 1 464 ? 13.439  15.104  -6.006  1.00 4.83  ? 495 TYR A CG   1 
ATOM   4632  C  CD1  . TYR A 1 464 ? 12.685  16.225  -5.644  1.00 3.80  ? 495 TYR A CD1  1 
ATOM   4633  C  CD2  . TYR A 1 464 ? 14.792  15.288  -6.266  1.00 6.34  ? 495 TYR A CD2  1 
ATOM   4634  C  CE1  . TYR A 1 464 ? 13.269  17.483  -5.552  1.00 2.00  ? 495 TYR A CE1  1 
ATOM   4635  C  CE2  . TYR A 1 464 ? 15.376  16.545  -6.171  1.00 2.87  ? 495 TYR A CE2  1 
ATOM   4636  C  CZ   . TYR A 1 464 ? 14.607  17.616  -5.818  1.00 2.00  ? 495 TYR A CZ   1 
ATOM   4637  O  OH   . TYR A 1 464 ? 15.208  18.814  -5.736  1.00 2.00  ? 495 TYR A OH   1 
ATOM   4638  H  H    . TYR A 1 464 ? 10.505  14.642  -6.675  1.00 17.00 ? 495 TYR A H    1 
ATOM   4639  H  HH   . TYR A 1 464 ? 14.550  19.509  -5.634  1.00 17.00 ? 495 TYR A HH   1 
ATOM   4640  N  N    . SER A 1 465 ? 10.780  11.470  -7.532  1.00 5.90  ? 496 SER A N    1 
ATOM   4641  C  CA   . SER A 1 465 ? 10.540  10.033  -7.736  1.00 9.11  ? 496 SER A CA   1 
ATOM   4642  C  C    . SER A 1 465 ? 11.335  9.204   -6.716  1.00 9.64  ? 496 SER A C    1 
ATOM   4643  O  O    . SER A 1 465 ? 10.783  8.703   -5.719  1.00 10.92 ? 496 SER A O    1 
ATOM   4644  C  CB   . SER A 1 465 ? 10.885  9.585   -9.170  1.00 9.40  ? 496 SER A CB   1 
ATOM   4645  O  OG   . SER A 1 465 ? 9.979   10.106  -10.129 1.00 9.36  ? 496 SER A OG   1 
ATOM   4646  H  H    . SER A 1 465 ? 10.022  11.996  -7.210  1.00 17.00 ? 496 SER A H    1 
ATOM   4647  H  HG   . SER A 1 465 ? 9.865   11.056  -9.980  1.00 17.00 ? 496 SER A HG   1 
ATOM   4648  N  N    . ASP A 1 466 ? 12.641  9.098   -6.933  1.00 10.79 ? 497 ASP A N    1 
ATOM   4649  C  CA   . ASP A 1 466 ? 13.484  8.334   -6.028  1.00 9.31  ? 497 ASP A CA   1 
ATOM   4650  C  C    . ASP A 1 466 ? 13.942  9.200   -4.874  1.00 6.14  ? 497 ASP A C    1 
ATOM   4651  O  O    . ASP A 1 466 ? 14.281  10.358  -5.050  1.00 2.01  ? 497 ASP A O    1 
ATOM   4652  C  CB   . ASP A 1 466 ? 14.701  7.744   -6.768  1.00 13.32 ? 497 ASP A CB   1 
ATOM   4653  C  CG   . ASP A 1 466 ? 15.510  6.755   -5.905  1.00 17.98 ? 497 ASP A CG   1 
ATOM   4654  O  OD1  . ASP A 1 466 ? 15.062  6.394   -4.787  1.00 20.30 ? 497 ASP A OD1  1 
ATOM   4655  O  OD2  . ASP A 1 466 ? 16.602  6.324   -6.343  1.00 20.72 ? 497 ASP A OD2  1 
ATOM   4656  H  H    . ASP A 1 466 ? 13.057  9.581   -7.677  1.00 17.00 ? 497 ASP A H    1 
ATOM   4657  N  N    . ILE A 1 467 ? 13.925  8.624   -3.679  1.00 6.74  ? 498 ILE A N    1 
ATOM   4658  C  CA   . ILE A 1 467 ? 14.378  9.327   -2.475  1.00 5.86  ? 498 ILE A CA   1 
ATOM   4659  C  C    . ILE A 1 467 ? 15.876  9.528   -2.675  1.00 3.57  ? 498 ILE A C    1 
ATOM   4660  O  O    . ILE A 1 467 ? 16.424  10.602  -2.425  1.00 2.02  ? 498 ILE A O    1 
ATOM   4661  C  CB   . ILE A 1 467 ? 14.093  8.477   -1.202  1.00 4.13  ? 498 ILE A CB   1 
ATOM   4662  C  CG1  . ILE A 1 467 ? 14.692  9.139   0.055   1.00 5.90  ? 498 ILE A CG1  1 
ATOM   4663  C  CG2  . ILE A 1 467 ? 14.571  7.039   -1.410  1.00 2.00  ? 498 ILE A CG2  1 
ATOM   4664  C  CD1  . ILE A 1 467 ? 14.129  10.540  0.454   1.00 2.00  ? 498 ILE A CD1  1 
ATOM   4665  H  H    . ILE A 1 467 ? 13.554  7.723   -3.625  1.00 17.00 ? 498 ILE A H    1 
ATOM   4666  N  N    . ASP A 1 468 ? 16.500  8.507   -3.240  1.00 3.18  ? 499 ASP A N    1 
ATOM   4667  C  CA   . ASP A 1 468 ? 17.903  8.554   -3.517  1.00 4.80  ? 499 ASP A CA   1 
ATOM   4668  C  C    . ASP A 1 468 ? 18.291  9.589   -4.571  1.00 5.49  ? 499 ASP A C    1 
ATOM   4669  O  O    . ASP A 1 468 ? 19.427  9.576   -5.047  1.00 8.78  ? 499 ASP A O    1 
ATOM   4670  C  CB   . ASP A 1 468 ? 18.376  7.185   -3.944  1.00 7.64  ? 499 ASP A CB   1 
ATOM   4671  C  CG   . ASP A 1 468 ? 18.170  6.144   -2.877  1.00 14.90 ? 499 ASP A CG   1 
ATOM   4672  O  OD1  . ASP A 1 468 ? 18.288  6.461   -1.667  1.00 16.11 ? 499 ASP A OD1  1 
ATOM   4673  O  OD2  . ASP A 1 468 ? 17.906  4.985   -3.259  1.00 19.13 ? 499 ASP A OD2  1 
ATOM   4674  H  H    . ASP A 1 468 ? 16.003  7.697   -3.435  1.00 17.00 ? 499 ASP A H    1 
ATOM   4675  N  N    . VAL A 1 469 ? 17.383  10.489  -4.935  1.00 3.21  ? 500 VAL A N    1 
ATOM   4676  C  CA   . VAL A 1 469 ? 17.693  11.520  -5.922  1.00 2.23  ? 500 VAL A CA   1 
ATOM   4677  C  C    . VAL A 1 469 ? 17.351  12.855  -5.299  1.00 2.48  ? 500 VAL A C    1 
ATOM   4678  O  O    . VAL A 1 469 ? 17.422  13.898  -5.948  1.00 5.19  ? 500 VAL A O    1 
ATOM   4679  C  CB   . VAL A 1 469 ? 16.885  11.288  -7.224  1.00 3.09  ? 500 VAL A CB   1 
ATOM   4680  C  CG1  . VAL A 1 469 ? 17.341  12.215  -8.334  1.00 2.00  ? 500 VAL A CG1  1 
ATOM   4681  C  CG2  . VAL A 1 469 ? 17.041  9.848   -7.672  1.00 2.01  ? 500 VAL A CG2  1 
ATOM   4682  H  H    . VAL A 1 469 ? 16.477  10.525  -4.579  1.00 17.00 ? 500 VAL A H    1 
ATOM   4683  N  N    . MET A 1 470 ? 16.971  12.824  -4.026  1.00 3.00  ? 501 MET A N    1 
ATOM   4684  C  CA   . MET A 1 470 ? 16.645  14.054  -3.318  1.00 3.27  ? 501 MET A CA   1 
ATOM   4685  C  C    . MET A 1 470 ? 17.971  14.788  -3.177  1.00 5.35  ? 501 MET A C    1 
ATOM   4686  O  O    . MET A 1 470 ? 19.043  14.175  -3.078  1.00 6.35  ? 501 MET A O    1 
ATOM   4687  C  CB   . MET A 1 470 ? 16.027  13.770  -1.941  1.00 3.04  ? 501 MET A CB   1 
ATOM   4688  C  CG   . MET A 1 470 ? 15.520  14.994  -1.200  1.00 2.00  ? 501 MET A CG   1 
ATOM   4689  S  SD   . MET A 1 470 ? 14.366  15.967  -2.217  1.00 7.14  ? 501 MET A SD   1 
ATOM   4690  C  CE   . MET A 1 470 ? 14.625  17.604  -1.654  1.00 2.01  ? 501 MET A CE   1 
ATOM   4691  H  H    . MET A 1 470 ? 16.957  11.986  -3.534  1.00 17.00 ? 501 MET A H    1 
ATOM   4692  N  N    . GLU A 1 471 ? 17.902  16.105  -3.243  1.00 7.28  ? 502 GLU A N    1 
ATOM   4693  C  CA   . GLU A 1 471 ? 19.082  16.959  -3.125  1.00 10.12 ? 502 GLU A CA   1 
ATOM   4694  C  C    . GLU A 1 471 ? 19.473  17.364  -1.679  1.00 9.67  ? 502 GLU A C    1 
ATOM   4695  O  O    . GLU A 1 471 ? 18.636  17.432  -0.785  1.00 9.73  ? 502 GLU A O    1 
ATOM   4696  C  CB   . GLU A 1 471 ? 18.886  18.205  -4.003  1.00 10.42 ? 502 GLU A CB   1 
ATOM   4697  C  CG   . GLU A 1 471 ? 18.540  17.831  -5.448  1.00 10.50 ? 502 GLU A CG   1 
ATOM   4698  C  CD   . GLU A 1 471 ? 18.498  19.025  -6.384  1.00 8.16  ? 502 GLU A CD   1 
ATOM   4699  O  OE1  . GLU A 1 471 ? 19.344  19.914  -6.225  1.00 4.29  ? 502 GLU A OE1  1 
ATOM   4700  O  OE2  . GLU A 1 471 ? 17.631  19.054  -7.285  1.00 9.37  ? 502 GLU A OE2  1 
ATOM   4701  H  H    . GLU A 1 471 ? 17.028  16.516  -3.388  1.00 17.00 ? 502 GLU A H    1 
ATOM   4702  N  N    . LEU A 1 472 ? 20.756  17.623  -1.457  1.00 9.69  ? 503 LEU A N    1 
ATOM   4703  C  CA   . LEU A 1 472 ? 21.232  18.018  -0.135  1.00 8.49  ? 503 LEU A CA   1 
ATOM   4704  C  C    . LEU A 1 472 ? 20.545  19.306  0.340   1.00 8.03  ? 503 LEU A C    1 
ATOM   4705  O  O    . LEU A 1 472 ? 19.949  19.359  1.428   1.00 5.84  ? 503 LEU A O    1 
ATOM   4706  C  CB   . LEU A 1 472 ? 22.762  18.206  -0.142  1.00 5.86  ? 503 LEU A CB   1 
ATOM   4707  C  CG   . LEU A 1 472 ? 23.373  18.867  1.100   1.00 3.30  ? 503 LEU A CG   1 
ATOM   4708  C  CD1  . LEU A 1 472 ? 23.309  17.953  2.288   1.00 2.00  ? 503 LEU A CD1  1 
ATOM   4709  C  CD2  . LEU A 1 472 ? 24.787  19.227  0.827   1.00 2.59  ? 503 LEU A CD2  1 
ATOM   4710  H  H    . LEU A 1 472 ? 21.394  17.523  -2.195  1.00 17.00 ? 503 LEU A H    1 
ATOM   4711  N  N    . TYR A 1 473 ? 20.562  20.315  -0.517  1.00 7.62  ? 504 TYR A N    1 
ATOM   4712  C  CA   . TYR A 1 473 ? 19.976  21.603  -0.155  1.00 7.88  ? 504 TYR A CA   1 
ATOM   4713  C  C    . TYR A 1 473 ? 18.500  21.685  0.251   1.00 6.01  ? 504 TYR A C    1 
ATOM   4714  O  O    . TYR A 1 473 ? 18.191  22.158  1.332   1.00 4.99  ? 504 TYR A O    1 
ATOM   4715  C  CB   . TYR A 1 473 ? 20.254  22.661  -1.228  1.00 9.76  ? 504 TYR A CB   1 
ATOM   4716  C  CG   . TYR A 1 473 ? 19.684  24.010  -0.854  1.00 12.30 ? 504 TYR A CG   1 
ATOM   4717  C  CD1  . TYR A 1 473 ? 20.299  24.795  0.148   1.00 9.67  ? 504 TYR A CD1  1 
ATOM   4718  C  CD2  . TYR A 1 473 ? 18.514  24.491  -1.464  1.00 10.15 ? 504 TYR A CD2  1 
ATOM   4719  C  CE1  . TYR A 1 473 ? 19.766  26.019  0.532   1.00 8.54  ? 504 TYR A CE1  1 
ATOM   4720  C  CE2  . TYR A 1 473 ? 17.977  25.714  -1.079  1.00 10.99 ? 504 TYR A CE2  1 
ATOM   4721  C  CZ   . TYR A 1 473 ? 18.612  26.470  -0.084  1.00 9.83  ? 504 TYR A CZ   1 
ATOM   4722  O  OH   . TYR A 1 473 ? 18.116  27.698  0.271   1.00 13.89 ? 504 TYR A OH   1 
ATOM   4723  H  H    . TYR A 1 473 ? 20.969  20.189  -1.393  1.00 17.00 ? 504 TYR A H    1 
ATOM   4724  H  HH   . TYR A 1 473 ? 17.321  27.855  -0.244  1.00 17.00 ? 504 TYR A HH   1 
ATOM   4725  N  N    . PRO A 1 474 ? 17.572  21.308  -0.642  1.00 6.37  ? 505 PRO A N    1 
ATOM   4726  C  CA   . PRO A 1 474 ? 16.157  21.378  -0.303  1.00 4.76  ? 505 PRO A CA   1 
ATOM   4727  C  C    . PRO A 1 474 ? 15.821  20.475  0.858   1.00 3.94  ? 505 PRO A C    1 
ATOM   4728  O  O    . PRO A 1 474 ? 15.229  20.903  1.844   1.00 5.11  ? 505 PRO A O    1 
ATOM   4729  C  CB   . PRO A 1 474 ? 15.481  20.887  -1.578  1.00 5.46  ? 505 PRO A CB   1 
ATOM   4730  C  CG   . PRO A 1 474 ? 16.463  21.197  -2.638  1.00 5.53  ? 505 PRO A CG   1 
ATOM   4731  C  CD   . PRO A 1 474 ? 17.732  20.760  -1.994  1.00 7.46  ? 505 PRO A CD   1 
ATOM   4732  N  N    . ALA A 1 475 ? 16.257  19.229  0.757   1.00 3.48  ? 506 ALA A N    1 
ATOM   4733  C  CA   . ALA A 1 475 ? 16.006  18.226  1.780   1.00 2.44  ? 506 ALA A CA   1 
ATOM   4734  C  C    . ALA A 1 475 ? 16.408  18.702  3.167   1.00 2.55  ? 506 ALA A C    1 
ATOM   4735  O  O    . ALA A 1 475 ? 15.948  18.175  4.180   1.00 2.00  ? 506 ALA A O    1 
ATOM   4736  C  CB   . ALA A 1 475 ? 16.714  16.960  1.420   1.00 2.75  ? 506 ALA A CB   1 
ATOM   4737  H  H    . ALA A 1 475 ? 16.798  18.965  -0.014  1.00 17.00 ? 506 ALA A H    1 
ATOM   4738  N  N    . LEU A 1 476 ? 17.286  19.700  3.194   1.00 4.85  ? 507 LEU A N    1 
ATOM   4739  C  CA   . LEU A 1 476 ? 17.763  20.318  4.431   1.00 4.31  ? 507 LEU A CA   1 
ATOM   4740  C  C    . LEU A 1 476 ? 16.756  21.250  5.118   1.00 3.66  ? 507 LEU A C    1 
ATOM   4741  O  O    . LEU A 1 476 ? 16.669  21.250  6.348   1.00 2.54  ? 507 LEU A O    1 
ATOM   4742  C  CB   . LEU A 1 476 ? 19.046  21.086  4.151   1.00 5.73  ? 507 LEU A CB   1 
ATOM   4743  C  CG   . LEU A 1 476 ? 20.327  20.273  4.258   1.00 5.68  ? 507 LEU A CG   1 
ATOM   4744  C  CD1  . LEU A 1 476 ? 21.408  20.896  3.399   1.00 2.20  ? 507 LEU A CD1  1 
ATOM   4745  C  CD2  . LEU A 1 476 ? 20.742  20.228  5.750   1.00 6.54  ? 507 LEU A CD2  1 
ATOM   4746  H  H    . LEU A 1 476 ? 17.683  20.028  2.364   1.00 17.00 ? 507 LEU A H    1 
ATOM   4747  N  N    . LEU A 1 477 ? 16.047  22.065  4.328   1.00 3.63  ? 508 LEU A N    1 
ATOM   4748  C  CA   . LEU A 1 477 ? 15.034  22.997  4.849   1.00 4.36  ? 508 LEU A CA   1 
ATOM   4749  C  C    . LEU A 1 477 ? 13.655  22.321  5.006   1.00 5.62  ? 508 LEU A C    1 
ATOM   4750  O  O    . LEU A 1 477 ? 12.865  22.734  5.863   1.00 2.02  ? 508 LEU A O    1 
ATOM   4751  C  CB   . LEU A 1 477 ? 14.918  24.242  3.957   1.00 3.00  ? 508 LEU A CB   1 
ATOM   4752  C  CG   . LEU A 1 477 ? 16.174  25.100  3.775   1.00 2.00  ? 508 LEU A CG   1 
ATOM   4753  C  CD1  . LEU A 1 477 ? 15.837  26.291  2.914   1.00 2.45  ? 508 LEU A CD1  1 
ATOM   4754  C  CD2  . LEU A 1 477 ? 16.744  25.545  5.078   1.00 2.00  ? 508 LEU A CD2  1 
ATOM   4755  H  H    . LEU A 1 477 ? 16.215  22.021  3.365   1.00 17.00 ? 508 LEU A H    1 
ATOM   4756  N  N    . VAL A 1 478 ? 13.397  21.297  4.173   1.00 6.41  ? 509 VAL A N    1 
ATOM   4757  C  CA   . VAL A 1 478 ? 12.160  20.497  4.172   1.00 8.13  ? 509 VAL A CA   1 
ATOM   4758  C  C    . VAL A 1 478 ? 12.527  19.163  4.786   1.00 7.71  ? 509 VAL A C    1 
ATOM   4759  O  O    . VAL A 1 478 ? 12.298  18.094  4.212   1.00 8.86  ? 509 VAL A O    1 
ATOM   4760  C  CB   . VAL A 1 478 ? 11.619  20.243  2.713   1.00 10.37 ? 509 VAL A CB   1 
ATOM   4761  C  CG1  . VAL A 1 478 ? 12.639  19.509  1.853   1.00 9.58  ? 509 VAL A CG1  1 
ATOM   4762  C  CG2  . VAL A 1 478 ? 10.339  19.434  2.738   1.00 10.00 ? 509 VAL A CG2  1 
ATOM   4763  H  H    . VAL A 1 478 ? 14.090  21.060  3.522   1.00 17.00 ? 509 VAL A H    1 
ATOM   4764  N  N    . GLU A 1 479 ? 13.106  19.228  5.970   1.00 7.05  ? 510 GLU A N    1 
ATOM   4765  C  CA   . GLU A 1 479 ? 13.555  18.021  6.630   1.00 6.31  ? 510 GLU A CA   1 
ATOM   4766  C  C    . GLU A 1 479 ? 12.851  18.008  7.960   1.00 3.26  ? 510 GLU A C    1 
ATOM   4767  O  O    . GLU A 1 479 ? 12.534  19.052  8.495   1.00 2.00  ? 510 GLU A O    1 
ATOM   4768  C  CB   . GLU A 1 479 ? 15.077  18.085  6.815   1.00 8.00  ? 510 GLU A CB   1 
ATOM   4769  C  CG   . GLU A 1 479 ? 15.793  16.733  6.842   1.00 9.28  ? 510 GLU A CG   1 
ATOM   4770  C  CD   . GLU A 1 479 ? 16.887  16.644  7.925   1.00 9.15  ? 510 GLU A CD   1 
ATOM   4771  O  OE1  . GLU A 1 479 ? 17.412  17.722  8.344   1.00 9.23  ? 510 GLU A OE1  1 
ATOM   4772  O  OE2  . GLU A 1 479 ? 17.214  15.499  8.338   1.00 2.00  ? 510 GLU A OE2  1 
ATOM   4773  H  H    . GLU A 1 479 ? 13.190  20.072  6.460   1.00 17.00 ? 510 GLU A H    1 
ATOM   4774  N  N    . LYS A 1 480 ? 12.603  16.820  8.478   1.00 2.40  ? 511 LYS A N    1 
ATOM   4775  C  CA   . LYS A 1 480 ? 11.908  16.685  9.730   1.00 2.20  ? 511 LYS A CA   1 
ATOM   4776  C  C    . LYS A 1 480 ? 12.788  17.196  10.847  1.00 2.63  ? 511 LYS A C    1 
ATOM   4777  O  O    . LYS A 1 480 ? 13.895  16.704  11.043  1.00 4.24  ? 511 LYS A O    1 
ATOM   4778  C  CB   . LYS A 1 480 ? 11.524  15.214  9.960   1.00 3.24  ? 511 LYS A CB   1 
ATOM   4779  C  CG   . LYS A 1 480 ? 10.849  14.964  11.308  1.00 2.73  ? 511 LYS A CG   1 
ATOM   4780  C  CD   . LYS A 1 480 ? 10.886  13.501  11.695  1.00 4.47  ? 511 LYS A CD   1 
ATOM   4781  C  CE   . LYS A 1 480 ? 10.613  13.301  13.181  1.00 3.18  ? 511 LYS A CE   1 
ATOM   4782  N  NZ   . LYS A 1 480 ? 10.602  11.859  13.589  1.00 5.11  ? 511 LYS A NZ   1 
ATOM   4783  H  H    . LYS A 1 480 ? 12.902  16.012  8.008   1.00 17.00 ? 511 LYS A H    1 
ATOM   4784  H  HZ1  . LYS A 1 480 ? 11.523  11.430  13.365  1.00 17.00 ? 511 LYS A HZ1  1 
ATOM   4785  H  HZ2  . LYS A 1 480 ? 10.430  11.797  14.613  1.00 17.00 ? 511 LYS A HZ2  1 
ATOM   4786  H  HZ3  . LYS A 1 480 ? 9.847   11.360  13.076  1.00 17.00 ? 511 LYS A HZ3  1 
ATOM   4787  N  N    . PRO A 1 481 ? 12.321  18.199  11.586  1.00 2.00  ? 512 PRO A N    1 
ATOM   4788  C  CA   . PRO A 1 481 ? 13.077  18.768  12.691  1.00 2.00  ? 512 PRO A CA   1 
ATOM   4789  C  C    . PRO A 1 481 ? 13.158  17.846  13.862  1.00 2.30  ? 512 PRO A C    1 
ATOM   4790  O  O    . PRO A 1 481 ? 12.177  17.246  14.233  1.00 5.64  ? 512 PRO A O    1 
ATOM   4791  C  CB   . PRO A 1 481 ? 12.245  19.974  13.097  1.00 2.00  ? 512 PRO A CB   1 
ATOM   4792  C  CG   . PRO A 1 481 ? 11.614  20.384  11.871  1.00 3.41  ? 512 PRO A CG   1 
ATOM   4793  C  CD   . PRO A 1 481 ? 11.172  19.049  11.282  1.00 4.57  ? 512 PRO A CD   1 
ATOM   4794  N  N    . ARG A 1 482 ? 14.340  17.711  14.436  1.00 4.11  ? 513 ARG A N    1 
ATOM   4795  C  CA   . ARG A 1 482 ? 14.497  16.903  15.633  1.00 6.44  ? 513 ARG A CA   1 
ATOM   4796  C  C    . ARG A 1 482 ? 13.553  17.672  16.563  1.00 4.49  ? 513 ARG A C    1 
ATOM   4797  O  O    . ARG A 1 482 ? 13.494  18.877  16.459  1.00 4.72  ? 513 ARG A O    1 
ATOM   4798  C  CB   . ARG A 1 482 ? 15.949  16.994  16.156  1.00 7.54  ? 513 ARG A CB   1 
ATOM   4799  C  CG   . ARG A 1 482 ? 17.013  16.243  15.352  1.00 7.61  ? 513 ARG A CG   1 
ATOM   4800  C  CD   . ARG A 1 482 ? 18.399  16.616  15.860  1.00 7.91  ? 513 ARG A CD   1 
ATOM   4801  N  NE   . ARG A 1 482 ? 19.372  15.519  15.848  1.00 9.74  ? 513 ARG A NE   1 
ATOM   4802  C  CZ   . ARG A 1 482 ? 20.681  15.666  16.055  1.00 9.76  ? 513 ARG A CZ   1 
ATOM   4803  N  NH1  . ARG A 1 482 ? 21.191  16.870  16.279  1.00 11.95 ? 513 ARG A NH1  1 
ATOM   4804  N  NH2  . ARG A 1 482 ? 21.481  14.611  16.082  1.00 7.15  ? 513 ARG A NH2  1 
ATOM   4805  H  H    . ARG A 1 482 ? 15.099  18.211  14.078  1.00 17.00 ? 513 ARG A H    1 
ATOM   4806  H  HE   . ARG A 1 482 ? 19.040  14.613  15.674  1.00 17.00 ? 513 ARG A HE   1 
ATOM   4807  H  HH11 . ARG A 1 482 ? 20.590  17.668  16.297  1.00 17.00 ? 513 ARG A HH11 1 
ATOM   4808  H  HH12 . ARG A 1 482 ? 22.170  16.990  16.441  1.00 17.00 ? 513 ARG A HH12 1 
ATOM   4809  H  HH21 . ARG A 1 482 ? 21.110  13.693  15.944  1.00 17.00 ? 513 ARG A HH21 1 
ATOM   4810  H  HH22 . ARG A 1 482 ? 22.460  14.742  16.237  1.00 17.00 ? 513 ARG A HH22 1 
ATOM   4811  N  N    . PRO A 1 483 ? 12.860  17.007  17.503  1.00 3.88  ? 514 PRO A N    1 
ATOM   4812  C  CA   . PRO A 1 483 ? 11.937  17.646  18.434  1.00 4.21  ? 514 PRO A CA   1 
ATOM   4813  C  C    . PRO A 1 483 ? 11.625  19.107  18.154  1.00 6.50  ? 514 PRO A C    1 
ATOM   4814  O  O    . PRO A 1 483 ? 11.101  19.433  17.088  1.00 9.37  ? 514 PRO A O    1 
ATOM   4815  C  CB   . PRO A 1 483 ? 12.606  17.414  19.762  1.00 2.52  ? 514 PRO A CB   1 
ATOM   4816  C  CG   . PRO A 1 483 ? 12.999  15.993  19.609  1.00 5.02  ? 514 PRO A CG   1 
ATOM   4817  C  CD   . PRO A 1 483 ? 13.308  15.753  18.112  1.00 3.07  ? 514 PRO A CD   1 
ATOM   4818  N  N    . ASP A 1 484 ? 11.972  19.989  19.084  1.00 4.65  ? 515 ASP A N    1 
ATOM   4819  C  CA   . ASP A 1 484 ? 11.702  21.398  18.915  1.00 4.20  ? 515 ASP A CA   1 
ATOM   4820  C  C    . ASP A 1 484 ? 12.942  22.112  18.420  1.00 5.88  ? 515 ASP A C    1 
ATOM   4821  O  O    . ASP A 1 484 ? 13.219  23.252  18.815  1.00 7.88  ? 515 ASP A O    1 
ATOM   4822  C  CB   . ASP A 1 484 ? 11.233  21.980  20.245  1.00 5.53  ? 515 ASP A CB   1 
ATOM   4823  C  CG   . ASP A 1 484 ? 9.747   21.742  20.511  1.00 3.10  ? 515 ASP A CG   1 
ATOM   4824  O  OD1  . ASP A 1 484 ? 8.959   22.536  19.964  1.00 2.02  ? 515 ASP A OD1  1 
ATOM   4825  O  OD2  . ASP A 1 484 ? 9.378   20.808  21.276  1.00 3.62  ? 515 ASP A OD2  1 
ATOM   4826  H  H    . ASP A 1 484 ? 12.434  19.740  19.903  1.00 17.00 ? 515 ASP A H    1 
ATOM   4827  N  N    . ALA A 1 485 ? 13.652  21.449  17.511  1.00 6.99  ? 516 ALA A N    1 
ATOM   4828  C  CA   . ALA A 1 485 ? 14.898  21.944  16.927  1.00 5.47  ? 516 ALA A CA   1 
ATOM   4829  C  C    . ALA A 1 485 ? 14.630  22.918  15.823  1.00 2.98  ? 516 ALA A C    1 
ATOM   4830  O  O    . ALA A 1 485 ? 13.567  22.899  15.245  1.00 2.00  ? 516 ALA A O    1 
ATOM   4831  C  CB   . ALA A 1 485 ? 15.725  20.780  16.380  1.00 5.85  ? 516 ALA A CB   1 
ATOM   4832  H  H    . ALA A 1 485 ? 13.279  20.618  17.151  1.00 17.00 ? 516 ALA A H    1 
ATOM   4833  N  N    . ILE A 1 486 ? 15.621  23.744  15.518  1.00 2.78  ? 517 ILE A N    1 
ATOM   4834  C  CA   . ILE A 1 486 ? 15.511  24.727  14.453  1.00 3.71  ? 517 ILE A CA   1 
ATOM   4835  C  C    . ILE A 1 486 ? 15.722  24.053  13.096  1.00 2.00  ? 517 ILE A C    1 
ATOM   4836  O  O    . ILE A 1 486 ? 15.278  24.543  12.044  1.00 2.00  ? 517 ILE A O    1 
ATOM   4837  C  CB   . ILE A 1 486 ? 16.494  25.883  14.668  1.00 4.47  ? 517 ILE A CB   1 
ATOM   4838  C  CG1  . ILE A 1 486 ? 16.351  26.935  13.547  1.00 4.50  ? 517 ILE A CG1  1 
ATOM   4839  C  CG2  . ILE A 1 486 ? 17.890  25.339  14.815  1.00 5.94  ? 517 ILE A CG2  1 
ATOM   4840  C  CD1  . ILE A 1 486 ? 16.747  28.350  13.956  1.00 3.88  ? 517 ILE A CD1  1 
ATOM   4841  H  H    . ILE A 1 486 ? 16.443  23.675  16.044  1.00 17.00 ? 517 ILE A H    1 
ATOM   4842  N  N    . PHE A 1 487 ? 16.409  22.924  13.141  1.00 2.00  ? 518 PHE A N    1 
ATOM   4843  C  CA   . PHE A 1 487 ? 16.650  22.113  11.956  1.00 5.42  ? 518 PHE A CA   1 
ATOM   4844  C  C    . PHE A 1 487 ? 16.834  20.643  12.335  1.00 5.57  ? 518 PHE A C    1 
ATOM   4845  O  O    . PHE A 1 487 ? 16.946  20.294  13.510  1.00 4.28  ? 518 PHE A O    1 
ATOM   4846  C  CB   . PHE A 1 487 ? 17.805  22.629  11.066  1.00 5.31  ? 518 PHE A CB   1 
ATOM   4847  C  CG   . PHE A 1 487 ? 18.848  23.419  11.792  1.00 4.90  ? 518 PHE A CG   1 
ATOM   4848  C  CD1  . PHE A 1 487 ? 19.677  22.813  12.744  1.00 5.67  ? 518 PHE A CD1  1 
ATOM   4849  C  CD2  . PHE A 1 487 ? 19.028  24.761  11.494  1.00 2.73  ? 518 PHE A CD2  1 
ATOM   4850  C  CE1  . PHE A 1 487 ? 20.666  23.529  13.384  1.00 4.02  ? 518 PHE A CE1  1 
ATOM   4851  C  CE2  . PHE A 1 487 ? 20.002  25.477  12.120  1.00 4.78  ? 518 PHE A CE2  1 
ATOM   4852  C  CZ   . PHE A 1 487 ? 20.832  24.857  13.076  1.00 4.46  ? 518 PHE A CZ   1 
ATOM   4853  H  H    . PHE A 1 487 ? 16.757  22.586  13.994  1.00 17.00 ? 518 PHE A H    1 
ATOM   4854  N  N    . GLY A 1 488 ? 16.841  19.774  11.349  1.00 5.15  ? 519 GLY A N    1 
ATOM   4855  C  CA   . GLY A 1 488 ? 16.977  18.381  11.686  1.00 10.47 ? 519 GLY A CA   1 
ATOM   4856  C  C    . GLY A 1 488 ? 18.380  17.827  11.738  1.00 12.74 ? 519 GLY A C    1 
ATOM   4857  O  O    . GLY A 1 488 ? 19.355  18.574  11.603  1.00 13.37 ? 519 GLY A O    1 
ATOM   4858  H  H    . GLY A 1 488 ? 16.755  20.065  10.416  1.00 17.00 ? 519 GLY A H    1 
ATOM   4859  N  N    . GLU A 1 489 ? 18.451  16.500  11.901  1.00 12.26 ? 520 GLU A N    1 
ATOM   4860  C  CA   . GLU A 1 489 ? 19.699  15.740  11.950  1.00 10.67 ? 520 GLU A CA   1 
ATOM   4861  C  C    . GLU A 1 489 ? 20.606  16.022  10.747  1.00 11.23 ? 520 GLU A C    1 
ATOM   4862  O  O    . GLU A 1 489 ? 21.717  16.493  10.948  1.00 14.90 ? 520 GLU A O    1 
ATOM   4863  C  CB   . GLU A 1 489 ? 19.402  14.245  12.063  1.00 8.49  ? 520 GLU A CB   1 
ATOM   4864  C  CG   . GLU A 1 489 ? 20.424  13.340  11.434  1.00 8.05  ? 520 GLU A CG   1 
ATOM   4865  C  CD   . GLU A 1 489 ? 19.795  12.064  10.914  1.00 10.43 ? 520 GLU A CD   1 
ATOM   4866  O  OE1  . GLU A 1 489 ? 18.863  12.167  10.084  1.00 10.88 ? 520 GLU A OE1  1 
ATOM   4867  O  OE2  . GLU A 1 489 ? 20.214  10.958  11.333  1.00 11.18 ? 520 GLU A OE2  1 
ATOM   4868  H  H    . GLU A 1 489 ? 17.611  16.011  12.007  1.00 17.00 ? 520 GLU A H    1 
ATOM   4869  N  N    . THR A 1 490 ? 20.140  15.797  9.515   1.00 8.20  ? 521 THR A N    1 
ATOM   4870  C  CA   . THR A 1 490 ? 20.966  16.054  8.328   1.00 5.38  ? 521 THR A CA   1 
ATOM   4871  C  C    . THR A 1 490 ? 21.741  17.387  8.340   1.00 7.52  ? 521 THR A C    1 
ATOM   4872  O  O    . THR A 1 490 ? 22.936  17.393  8.056   1.00 9.18  ? 521 THR A O    1 
ATOM   4873  C  CB   . THR A 1 490 ? 20.133  15.945  7.064   1.00 4.52  ? 521 THR A CB   1 
ATOM   4874  O  OG1  . THR A 1 490 ? 19.680  14.604  6.942   1.00 6.69  ? 521 THR A OG1  1 
ATOM   4875  C  CG2  . THR A 1 490 ? 20.928  16.323  5.829   1.00 3.61  ? 521 THR A CG2  1 
ATOM   4876  H  H    . THR A 1 490 ? 19.241  15.430  9.387   1.00 17.00 ? 521 THR A H    1 
ATOM   4877  H  HG1  . THR A 1 490 ? 20.469  14.056  6.863   1.00 17.00 ? 521 THR A HG1  1 
ATOM   4878  N  N    . MET A 1 491 ? 21.077  18.500  8.674   1.00 7.99  ? 522 MET A N    1 
ATOM   4879  C  CA   . MET A 1 491 ? 21.726  19.812  8.741   1.00 3.20  ? 522 MET A CA   1 
ATOM   4880  C  C    . MET A 1 491 ? 22.743  19.766  9.856   1.00 3.19  ? 522 MET A C    1 
ATOM   4881  O  O    . MET A 1 491 ? 23.919  19.969  9.637   1.00 5.16  ? 522 MET A O    1 
ATOM   4882  C  CB   . MET A 1 491 ? 20.688  20.883  9.070   1.00 4.49  ? 522 MET A CB   1 
ATOM   4883  C  CG   . MET A 1 491 ? 21.232  22.250  9.481   1.00 2.00  ? 522 MET A CG   1 
ATOM   4884  S  SD   . MET A 1 491 ? 21.538  23.298  8.069   1.00 2.00  ? 522 MET A SD   1 
ATOM   4885  C  CE   . MET A 1 491 ? 20.158  24.309  8.093   1.00 5.07  ? 522 MET A CE   1 
ATOM   4886  H  H    . MET A 1 491 ? 20.131  18.443  8.903   1.00 17.00 ? 522 MET A H    1 
ATOM   4887  N  N    . VAL A 1 492 ? 22.283  19.431  11.047  1.00 3.96  ? 523 VAL A N    1 
ATOM   4888  C  CA   . VAL A 1 492 ? 23.120  19.366  12.241  1.00 6.16  ? 523 VAL A CA   1 
ATOM   4889  C  C    . VAL A 1 492 ? 24.334  18.452  12.164  1.00 3.29  ? 523 VAL A C    1 
ATOM   4890  O  O    . VAL A 1 492 ? 25.364  18.747  12.760  1.00 2.00  ? 523 VAL A O    1 
ATOM   4891  C  CB   . VAL A 1 492 ? 22.257  19.008  13.507  1.00 10.02 ? 523 VAL A CB   1 
ATOM   4892  C  CG1  . VAL A 1 492 ? 23.128  18.737  14.731  1.00 6.83  ? 523 VAL A CG1  1 
ATOM   4893  C  CG2  . VAL A 1 492 ? 21.250  20.146  13.787  1.00 9.14  ? 523 VAL A CG2  1 
ATOM   4894  H  H    . VAL A 1 492 ? 21.338  19.189  11.146  1.00 17.00 ? 523 VAL A H    1 
ATOM   4895  N  N    . GLU A 1 493 ? 24.242  17.379  11.389  1.00 2.84  ? 524 GLU A N    1 
ATOM   4896  C  CA   . GLU A 1 493 ? 25.351  16.429  11.257  1.00 2.73  ? 524 GLU A CA   1 
ATOM   4897  C  C    . GLU A 1 493 ? 26.438  16.779  10.235  1.00 3.42  ? 524 GLU A C    1 
ATOM   4898  O  O    . GLU A 1 493 ? 27.622  16.538  10.479  1.00 3.46  ? 524 GLU A O    1 
ATOM   4899  C  CB   . GLU A 1 493 ? 24.825  15.024  11.058  1.00 2.00  ? 524 GLU A CB   1 
ATOM   4900  C  CG   . GLU A 1 493 ? 24.058  14.528  12.282  1.00 6.10  ? 524 GLU A CG   1 
ATOM   4901  C  CD   . GLU A 1 493 ? 24.930  14.417  13.538  1.00 7.81  ? 524 GLU A CD   1 
ATOM   4902  O  OE1  . GLU A 1 493 ? 25.836  13.551  13.520  1.00 12.03 ? 524 GLU A OE1  1 
ATOM   4903  O  OE2  . GLU A 1 493 ? 24.694  15.147  14.542  1.00 4.53  ? 524 GLU A OE2  1 
ATOM   4904  H  H    . GLU A 1 493 ? 23.419  17.239  10.889  1.00 17.00 ? 524 GLU A H    1 
ATOM   4905  N  N    . LEU A 1 494 ? 26.060  17.347  9.098   1.00 2.55  ? 525 LEU A N    1 
ATOM   4906  C  CA   . LEU A 1 494 ? 27.059  17.756  8.119   1.00 2.00  ? 525 LEU A CA   1 
ATOM   4907  C  C    . LEU A 1 494 ? 27.788  18.998  8.647   1.00 3.00  ? 525 LEU A C    1 
ATOM   4908  O  O    . LEU A 1 494 ? 29.010  19.145  8.501   1.00 4.26  ? 525 LEU A O    1 
ATOM   4909  C  CB   . LEU A 1 494 ? 26.423  18.120  6.765   1.00 2.00  ? 525 LEU A CB   1 
ATOM   4910  C  CG   . LEU A 1 494 ? 25.614  17.193  5.838   1.00 2.00  ? 525 LEU A CG   1 
ATOM   4911  C  CD1  . LEU A 1 494 ? 25.884  17.540  4.386   1.00 2.00  ? 525 LEU A CD1  1 
ATOM   4912  C  CD2  . LEU A 1 494 ? 25.948  15.775  6.062   1.00 2.00  ? 525 LEU A CD2  1 
ATOM   4913  H  H    . LEU A 1 494 ? 25.109  17.487  8.909   1.00 17.00 ? 525 LEU A H    1 
ATOM   4914  N  N    . GLY A 1 495 ? 27.033  19.885  9.281   1.00 2.00  ? 526 GLY A N    1 
ATOM   4915  C  CA   . GLY A 1 495 ? 27.606  21.120  9.776   1.00 2.01  ? 526 GLY A CA   1 
ATOM   4916  C  C    . GLY A 1 495 ? 28.379  21.157  11.076  1.00 2.00  ? 526 GLY A C    1 
ATOM   4917  O  O    . GLY A 1 495 ? 29.278  21.966  11.236  1.00 2.00  ? 526 GLY A O    1 
ATOM   4918  H  H    . GLY A 1 495 ? 26.073  19.709  9.396   1.00 17.00 ? 526 GLY A H    1 
ATOM   4919  N  N    . ALA A 1 496 ? 28.025  20.322  12.037  1.00 4.43  ? 527 ALA A N    1 
ATOM   4920  C  CA   . ALA A 1 496 ? 28.737  20.367  13.313  1.00 7.31  ? 527 ALA A CA   1 
ATOM   4921  C  C    . ALA A 1 496 ? 30.247  20.186  13.123  1.00 7.17  ? 527 ALA A C    1 
ATOM   4922  O  O    . ALA A 1 496 ? 31.043  20.996  13.599  1.00 7.47  ? 527 ALA A O    1 
ATOM   4923  C  CB   . ALA A 1 496 ? 28.166  19.340  14.287  1.00 6.44  ? 527 ALA A CB   1 
ATOM   4924  H  H    . ALA A 1 496 ? 27.290  19.690  11.902  1.00 17.00 ? 527 ALA A H    1 
ATOM   4925  N  N    . PRO A 1 497 ? 30.652  19.130  12.394  1.00 9.05  ? 528 PRO A N    1 
ATOM   4926  C  CA   . PRO A 1 497 ? 32.050  18.794  12.097  1.00 8.69  ? 528 PRO A CA   1 
ATOM   4927  C  C    . PRO A 1 497 ? 32.734  19.942  11.389  1.00 7.26  ? 528 PRO A C    1 
ATOM   4928  O  O    . PRO A 1 497 ? 33.833  20.331  11.753  1.00 5.93  ? 528 PRO A O    1 
ATOM   4929  C  CB   . PRO A 1 497 ? 31.911  17.621  11.135  1.00 10.71 ? 528 PRO A CB   1 
ATOM   4930  C  CG   . PRO A 1 497 ? 30.659  16.956  11.586  1.00 11.11 ? 528 PRO A CG   1 
ATOM   4931  C  CD   . PRO A 1 497 ? 29.748  18.123  11.796  1.00 10.36 ? 528 PRO A CD   1 
ATOM   4932  N  N    . PHE A 1 498 ? 32.076  20.474  10.362  1.00 8.07  ? 529 PHE A N    1 
ATOM   4933  C  CA   . PHE A 1 498 ? 32.609  21.598  9.604   1.00 8.08  ? 529 PHE A CA   1 
ATOM   4934  C  C    . PHE A 1 498 ? 32.759  22.855  10.476  1.00 8.83  ? 529 PHE A C    1 
ATOM   4935  O  O    . PHE A 1 498 ? 33.780  23.535  10.390  1.00 9.23  ? 529 PHE A O    1 
ATOM   4936  C  CB   . PHE A 1 498 ? 31.708  21.928  8.412   1.00 7.13  ? 529 PHE A CB   1 
ATOM   4937  C  CG   . PHE A 1 498 ? 31.723  20.917  7.304   1.00 5.48  ? 529 PHE A CG   1 
ATOM   4938  C  CD1  . PHE A 1 498 ? 32.327  19.681  7.459   1.00 5.51  ? 529 PHE A CD1  1 
ATOM   4939  C  CD2  . PHE A 1 498 ? 31.117  21.220  6.084   1.00 7.45  ? 529 PHE A CD2  1 
ATOM   4940  C  CE1  . PHE A 1 498 ? 32.330  18.752  6.412   1.00 5.33  ? 529 PHE A CE1  1 
ATOM   4941  C  CE2  . PHE A 1 498 ? 31.114  20.299  5.026   1.00 7.75  ? 529 PHE A CE2  1 
ATOM   4942  C  CZ   . PHE A 1 498 ? 31.723  19.062  5.194   1.00 6.47  ? 529 PHE A CZ   1 
ATOM   4943  H  H    . PHE A 1 498 ? 31.217  20.088  10.101  1.00 17.00 ? 529 PHE A H    1 
ATOM   4944  N  N    . SER A 1 499 ? 31.783  23.148  11.338  1.00 9.51  ? 530 SER A N    1 
ATOM   4945  C  CA   . SER A 1 499 ? 31.863  24.345  12.181  1.00 11.67 ? 530 SER A CA   1 
ATOM   4946  C  C    . SER A 1 499 ? 32.852  24.312  13.362  1.00 11.41 ? 530 SER A C    1 
ATOM   4947  O  O    . SER A 1 499 ? 33.183  25.365  13.933  1.00 11.77 ? 530 SER A O    1 
ATOM   4948  C  CB   . SER A 1 499 ? 30.476  24.808  12.646  1.00 11.47 ? 530 SER A CB   1 
ATOM   4949  O  OG   . SER A 1 499 ? 30.463  26.232  12.824  1.00 14.15 ? 530 SER A OG   1 
ATOM   4950  H  H    . SER A 1 499 ? 31.013  22.563  11.427  1.00 17.00 ? 530 SER A H    1 
ATOM   4951  H  HG   . SER A 1 499 ? 31.125  26.457  13.493  1.00 17.00 ? 530 SER A HG   1 
ATOM   4952  N  N    . LEU A 1 500 ? 33.343  23.132  13.725  1.00 10.28 ? 531 LEU A N    1 
ATOM   4953  C  CA   . LEU A 1 500 ? 34.309  23.051  14.817  1.00 10.48 ? 531 LEU A CA   1 
ATOM   4954  C  C    . LEU A 1 500 ? 35.789  23.127  14.337  1.00 9.01  ? 531 LEU A C    1 
ATOM   4955  O  O    . LEU A 1 500 ? 36.626  23.796  14.956  1.00 9.12  ? 531 LEU A O    1 
ATOM   4956  C  CB   . LEU A 1 500 ? 34.028  21.818  15.693  1.00 8.11  ? 531 LEU A CB   1 
ATOM   4957  C  CG   . LEU A 1 500 ? 32.675  21.745  16.419  1.00 4.57  ? 531 LEU A CG   1 
ATOM   4958  C  CD1  . LEU A 1 500 ? 32.683  20.531  17.345  1.00 7.33  ? 531 LEU A CD1  1 
ATOM   4959  C  CD2  . LEU A 1 500 ? 32.406  22.982  17.231  1.00 2.00  ? 531 LEU A CD2  1 
ATOM   4960  H  H    . LEU A 1 500 ? 33.041  22.312  13.275  1.00 17.00 ? 531 LEU A H    1 
ATOM   4961  N  N    . LYS A 1 501 ? 36.092  22.516  13.197  1.00 6.92  ? 532 LYS A N    1 
ATOM   4962  C  CA   . LYS A 1 501 ? 37.445  22.559  12.675  1.00 5.28  ? 532 LYS A CA   1 
ATOM   4963  C  C    . LYS A 1 501 ? 37.794  23.933  12.164  1.00 5.46  ? 532 LYS A C    1 
ATOM   4964  O  O    . LYS A 1 501 ? 38.939  24.208  11.879  1.00 9.41  ? 532 LYS A O    1 
ATOM   4965  C  CB   . LYS A 1 501 ? 37.657  21.549  11.561  1.00 4.70  ? 532 LYS A CB   1 
ATOM   4966  C  CG   . LYS A 1 501 ? 38.157  20.202  12.059  1.00 6.49  ? 532 LYS A CG   1 
ATOM   4967  C  CD   . LYS A 1 501 ? 39.046  19.493  11.015  1.00 9.52  ? 532 LYS A CD   1 
ATOM   4968  C  CE   . LYS A 1 501 ? 40.359  20.273  10.731  1.00 9.93  ? 532 LYS A CE   1 
ATOM   4969  N  NZ   . LYS A 1 501 ? 41.267  20.404  11.923  1.00 7.08  ? 532 LYS A NZ   1 
ATOM   4970  H  H    . LYS A 1 501 ? 35.411  22.005  12.704  1.00 17.00 ? 532 LYS A H    1 
ATOM   4971  H  HZ1  . LYS A 1 501 ? 41.544  19.469  12.286  1.00 17.00 ? 532 LYS A HZ1  1 
ATOM   4972  H  HZ2  . LYS A 1 501 ? 42.113  20.924  11.618  1.00 17.00 ? 532 LYS A HZ2  1 
ATOM   4973  H  HZ3  . LYS A 1 501 ? 40.780  20.936  12.673  1.00 17.00 ? 532 LYS A HZ3  1 
ATOM   4974  N  N    . GLY A 1 502 ? 36.809  24.795  12.012  1.00 4.54  ? 533 GLY A N    1 
ATOM   4975  C  CA   . GLY A 1 502 ? 37.107  26.131  11.543  1.00 3.68  ? 533 GLY A CA   1 
ATOM   4976  C  C    . GLY A 1 502 ? 37.347  27.001  12.748  1.00 2.58  ? 533 GLY A C    1 
ATOM   4977  O  O    . GLY A 1 502 ? 37.965  28.054  12.656  1.00 3.75  ? 533 GLY A O    1 
ATOM   4978  H  H    . GLY A 1 502 ? 35.882  24.525  12.161  1.00 17.00 ? 533 GLY A H    1 
ATOM   4979  N  N    . LEU A 1 503 ? 36.824  26.576  13.884  1.00 3.31  ? 534 LEU A N    1 
ATOM   4980  C  CA   . LEU A 1 503 ? 37.000  27.344  15.103  1.00 7.49  ? 534 LEU A CA   1 
ATOM   4981  C  C    . LEU A 1 503 ? 38.284  26.874  15.782  1.00 7.83  ? 534 LEU A C    1 
ATOM   4982  O  O    . LEU A 1 503 ? 39.252  27.640  15.958  1.00 6.28  ? 534 LEU A O    1 
ATOM   4983  C  CB   . LEU A 1 503 ? 35.808  27.137  16.054  1.00 11.01 ? 534 LEU A CB   1 
ATOM   4984  C  CG   . LEU A 1 503 ? 34.453  27.856  15.903  1.00 10.58 ? 534 LEU A CG   1 
ATOM   4985  C  CD1  . LEU A 1 503 ? 34.129  28.177  14.449  1.00 8.55  ? 534 LEU A CD1  1 
ATOM   4986  C  CD2  . LEU A 1 503 ? 33.384  26.947  16.523  1.00 7.91  ? 534 LEU A CD2  1 
ATOM   4987  H  H    . LEU A 1 503 ? 36.315  25.744  13.916  1.00 17.00 ? 534 LEU A H    1 
ATOM   4988  N  N    . MET A 1 504 ? 38.293  25.594  16.131  1.00 6.27  ? 535 MET A N    1 
ATOM   4989  C  CA   . MET A 1 504 ? 39.441  25.014  16.801  1.00 6.60  ? 535 MET A CA   1 
ATOM   4990  C  C    . MET A 1 504 ? 40.662  24.946  15.900  1.00 5.02  ? 535 MET A C    1 
ATOM   4991  O  O    . MET A 1 504 ? 41.753  25.297  16.325  1.00 4.68  ? 535 MET A O    1 
ATOM   4992  C  CB   . MET A 1 504 ? 39.088  23.645  17.427  1.00 5.88  ? 535 MET A CB   1 
ATOM   4993  C  CG   . MET A 1 504 ? 38.094  23.737  18.597  1.00 4.14  ? 535 MET A CG   1 
ATOM   4994  S  SD   . MET A 1 504 ? 38.319  25.243  19.625  1.00 7.05  ? 535 MET A SD   1 
ATOM   4995  C  CE   . MET A 1 504 ? 38.712  24.449  21.233  1.00 6.28  ? 535 MET A CE   1 
ATOM   4996  H  H    . MET A 1 504 ? 37.507  25.054  15.956  1.00 17.00 ? 535 MET A H    1 
ATOM   4997  N  N    . GLY A 1 505 ? 40.476  24.503  14.660  1.00 4.39  ? 536 GLY A N    1 
ATOM   4998  C  CA   . GLY A 1 505 ? 41.580  24.424  13.714  1.00 3.73  ? 536 GLY A CA   1 
ATOM   4999  C  C    . GLY A 1 505 ? 41.985  25.809  13.226  1.00 4.58  ? 536 GLY A C    1 
ATOM   5000  O  O    . GLY A 1 505 ? 41.979  26.079  12.014  1.00 2.00  ? 536 GLY A O    1 
ATOM   5001  H  H    . GLY A 1 505 ? 39.591  24.235  14.345  1.00 17.00 ? 536 GLY A H    1 
ATOM   5002  N  N    . ASN A 1 506 ? 42.386  26.654  14.181  1.00 6.68  ? 537 ASN A N    1 
ATOM   5003  C  CA   . ASN A 1 506 ? 42.805  28.041  13.955  1.00 9.66  ? 537 ASN A CA   1 
ATOM   5004  C  C    . ASN A 1 506 ? 44.109  28.321  14.754  1.00 8.81  ? 537 ASN A C    1 
ATOM   5005  O  O    . ASN A 1 506 ? 44.157  28.103  15.976  1.00 10.58 ? 537 ASN A O    1 
ATOM   5006  C  CB   . ASN A 1 506 ? 41.689  28.957  14.459  1.00 10.35 ? 537 ASN A CB   1 
ATOM   5007  C  CG   . ASN A 1 506 ? 41.925  30.415  14.123  1.00 9.67  ? 537 ASN A CG   1 
ATOM   5008  O  OD1  . ASN A 1 506 ? 42.747  31.107  14.752  1.00 2.09  ? 537 ASN A OD1  1 
ATOM   5009  N  ND2  . ASN A 1 506 ? 41.169  30.901  13.143  1.00 11.88 ? 537 ASN A ND2  1 
ATOM   5010  H  H    . ASN A 1 506 ? 42.466  26.365  15.102  1.00 17.00 ? 537 ASN A H    1 
ATOM   5011  H  HD21 . ASN A 1 506 ? 41.302  31.842  12.914  1.00 17.00 ? 537 ASN A HD21 1 
ATOM   5012  H  HD22 . ASN A 1 506 ? 40.526  30.297  12.722  1.00 17.00 ? 537 ASN A HD22 1 
ATOM   5013  N  N    . PRO A 1 507 ? 45.154  28.859  14.088  1.00 6.73  ? 538 PRO A N    1 
ATOM   5014  C  CA   . PRO A 1 507 ? 46.415  29.147  14.769  1.00 5.44  ? 538 PRO A CA   1 
ATOM   5015  C  C    . PRO A 1 507 ? 46.344  29.593  16.229  1.00 2.91  ? 538 PRO A C    1 
ATOM   5016  O  O    . PRO A 1 507 ? 47.008  28.999  17.050  1.00 2.00  ? 538 PRO A O    1 
ATOM   5017  C  CB   . PRO A 1 507 ? 47.065  30.215  13.872  1.00 4.03  ? 538 PRO A CB   1 
ATOM   5018  C  CG   . PRO A 1 507 ? 45.947  30.781  13.106  1.00 5.09  ? 538 PRO A CG   1 
ATOM   5019  C  CD   . PRO A 1 507 ? 45.140  29.546  12.791  1.00 8.63  ? 538 PRO A CD   1 
ATOM   5020  N  N    . ILE A 1 508 ? 45.511  30.565  16.587  1.00 2.61  ? 539 ILE A N    1 
ATOM   5021  C  CA   . ILE A 1 508 ? 45.514  30.970  17.990  1.00 2.37  ? 539 ILE A CA   1 
ATOM   5022  C  C    . ILE A 1 508 ? 45.132  29.825  18.909  1.00 3.08  ? 539 ILE A C    1 
ATOM   5023  O  O    . ILE A 1 508 ? 45.602  29.775  20.047  1.00 2.87  ? 539 ILE A O    1 
ATOM   5024  C  CB   . ILE A 1 508 ? 44.695  32.265  18.305  1.00 2.21  ? 539 ILE A CB   1 
ATOM   5025  C  CG1  . ILE A 1 508 ? 43.249  31.951  18.666  1.00 3.74  ? 539 ILE A CG1  1 
ATOM   5026  C  CG2  . ILE A 1 508 ? 44.724  33.216  17.132  1.00 2.01  ? 539 ILE A CG2  1 
ATOM   5027  C  CD1  . ILE A 1 508 ? 42.598  33.105  19.388  1.00 3.81  ? 539 ILE A CD1  1 
ATOM   5028  H  H    . ILE A 1 508 ? 44.893  30.966  15.937  1.00 17.00 ? 539 ILE A H    1 
ATOM   5029  N  N    . CYS A 1 509 ? 44.320  28.892  18.396  1.00 4.65  ? 540 CYS A N    1 
ATOM   5030  C  CA   . CYS A 1 509 ? 43.893  27.721  19.158  1.00 5.85  ? 540 CYS A CA   1 
ATOM   5031  C  C    . CYS A 1 509 ? 45.055  26.757  19.338  1.00 6.09  ? 540 CYS A C    1 
ATOM   5032  O  O    . CYS A 1 509 ? 44.948  25.774  20.095  1.00 6.96  ? 540 CYS A O    1 
ATOM   5033  C  CB   . CYS A 1 509 ? 42.802  26.960  18.424  1.00 7.68  ? 540 CYS A CB   1 
ATOM   5034  S  SG   . CYS A 1 509 ? 41.186  27.641  18.413  1.00 12.17 ? 540 CYS A SG   1 
ATOM   5035  H  H    . CYS A 1 509 ? 43.956  29.016  17.509  1.00 17.00 ? 540 CYS A H    1 
ATOM   5036  N  N    . SER A 1 510 ? 46.132  27.004  18.591  1.00 5.65  ? 541 SER A N    1 
ATOM   5037  C  CA   . SER A 1 510 ? 47.320  26.162  18.643  1.00 6.17  ? 541 SER A CA   1 
ATOM   5038  C  C    . SER A 1 510 ? 48.076  26.291  19.962  1.00 6.28  ? 541 SER A C    1 
ATOM   5039  O  O    . SER A 1 510 ? 48.063  27.354  20.594  1.00 3.05  ? 541 SER A O    1 
ATOM   5040  C  CB   . SER A 1 510 ? 48.267  26.477  17.498  1.00 3.94  ? 541 SER A CB   1 
ATOM   5041  O  OG   . SER A 1 510 ? 49.077  27.576  17.852  1.00 7.67  ? 541 SER A OG   1 
ATOM   5042  H  H    . SER A 1 510 ? 46.098  27.772  18.009  1.00 17.00 ? 541 SER A H    1 
ATOM   5043  H  HG   . SER A 1 510 ? 48.467  28.321  17.934  1.00 17.00 ? 541 SER A HG   1 
ATOM   5044  N  N    . PRO A 1 511 ? 48.777  25.208  20.372  1.00 5.87  ? 542 PRO A N    1 
ATOM   5045  C  CA   . PRO A 1 511 ? 49.550  25.179  21.605  1.00 4.95  ? 542 PRO A CA   1 
ATOM   5046  C  C    . PRO A 1 511 ? 50.740  26.111  21.502  1.00 5.20  ? 542 PRO A C    1 
ATOM   5047  O  O    . PRO A 1 511 ? 51.316  26.454  22.527  1.00 6.69  ? 542 PRO A O    1 
ATOM   5048  C  CB   . PRO A 1 511 ? 49.944  23.730  21.717  1.00 4.10  ? 542 PRO A CB   1 
ATOM   5049  C  CG   . PRO A 1 511 ? 50.085  23.333  20.291  1.00 7.64  ? 542 PRO A CG   1 
ATOM   5050  C  CD   . PRO A 1 511 ? 48.871  23.915  19.677  1.00 6.22  ? 542 PRO A CD   1 
ATOM   5051  N  N    . GLN A 1 512 ? 51.083  26.546  20.281  1.00 5.10  ? 543 GLN A N    1 
ATOM   5052  C  CA   . GLN A 1 512 ? 52.184  27.503  20.110  1.00 7.83  ? 543 GLN A CA   1 
ATOM   5053  C  C    . GLN A 1 512 ? 51.677  28.926  20.350  1.00 9.13  ? 543 GLN A C    1 
ATOM   5054  O  O    . GLN A 1 512 ? 52.449  29.779  20.787  1.00 13.86 ? 543 GLN A O    1 
ATOM   5055  C  CB   . GLN A 1 512 ? 52.827  27.458  18.724  1.00 8.72  ? 543 GLN A CB   1 
ATOM   5056  C  CG   . GLN A 1 512 ? 52.762  26.139  18.012  1.00 11.96 ? 543 GLN A CG   1 
ATOM   5057  C  CD   . GLN A 1 512 ? 51.688  26.126  16.944  1.00 11.66 ? 543 GLN A CD   1 
ATOM   5058  O  OE1  . GLN A 1 512 ? 50.837  25.240  16.912  1.00 9.70  ? 543 GLN A OE1  1 
ATOM   5059  N  NE2  . GLN A 1 512 ? 51.723  27.114  16.066  1.00 7.05  ? 543 GLN A NE2  1 
ATOM   5060  H  H    . GLN A 1 512 ? 50.593  26.231  19.493  1.00 17.00 ? 543 GLN A H    1 
ATOM   5061  H  HE21 . GLN A 1 512 ? 50.992  27.142  15.424  1.00 17.00 ? 543 GLN A HE21 1 
ATOM   5062  H  HE22 . GLN A 1 512 ? 52.432  27.795  16.074  1.00 17.00 ? 543 GLN A HE22 1 
ATOM   5063  N  N    . TYR A 1 513 ? 50.402  29.195  20.042  1.00 7.70  ? 544 TYR A N    1 
ATOM   5064  C  CA   . TYR A 1 513 ? 49.795  30.527  20.250  1.00 3.69  ? 544 TYR A CA   1 
ATOM   5065  C  C    . TYR A 1 513 ? 48.979  30.693  21.531  1.00 2.57  ? 544 TYR A C    1 
ATOM   5066  O  O    . TYR A 1 513 ? 48.922  31.773  22.094  1.00 3.33  ? 544 TYR A O    1 
ATOM   5067  C  CB   . TYR A 1 513 ? 48.859  30.884  19.113  1.00 2.63  ? 544 TYR A CB   1 
ATOM   5068  C  CG   . TYR A 1 513 ? 49.500  31.323  17.830  1.00 2.00  ? 544 TYR A CG   1 
ATOM   5069  C  CD1  . TYR A 1 513 ? 50.202  30.418  17.038  1.00 2.00  ? 544 TYR A CD1  1 
ATOM   5070  C  CD2  . TYR A 1 513 ? 49.360  32.642  17.381  1.00 2.00  ? 544 TYR A CD2  1 
ATOM   5071  C  CE1  . TYR A 1 513 ? 50.753  30.800  15.828  1.00 2.00  ? 544 TYR A CE1  1 
ATOM   5072  C  CE2  . TYR A 1 513 ? 49.905  33.046  16.163  1.00 2.00  ? 544 TYR A CE2  1 
ATOM   5073  C  CZ   . TYR A 1 513 ? 50.608  32.113  15.386  1.00 2.00  ? 544 TYR A CZ   1 
ATOM   5074  O  OH   . TYR A 1 513 ? 51.175  32.489  14.183  1.00 2.00  ? 544 TYR A OH   1 
ATOM   5075  H  H    . TYR A 1 513 ? 49.851  28.481  19.667  1.00 17.00 ? 544 TYR A H    1 
ATOM   5076  H  HH   . TYR A 1 513 ? 51.117  33.442  14.065  1.00 17.00 ? 544 TYR A HH   1 
ATOM   5077  N  N    . TRP A 1 514 ? 48.333  29.632  21.986  1.00 2.12  ? 545 TRP A N    1 
ATOM   5078  C  CA   . TRP A 1 514 ? 47.477  29.697  23.176  1.00 3.54  ? 545 TRP A CA   1 
ATOM   5079  C  C    . TRP A 1 514 ? 48.137  29.940  24.532  1.00 2.00  ? 545 TRP A C    1 
ATOM   5080  O  O    . TRP A 1 514 ? 48.097  29.111  25.438  1.00 2.00  ? 545 TRP A O    1 
ATOM   5081  C  CB   . TRP A 1 514 ? 46.563  28.460  23.242  1.00 5.51  ? 545 TRP A CB   1 
ATOM   5082  C  CG   . TRP A 1 514 ? 45.380  28.607  24.178  1.00 4.29  ? 545 TRP A CG   1 
ATOM   5083  C  CD1  . TRP A 1 514 ? 45.047  27.773  25.212  1.00 3.32  ? 545 TRP A CD1  1 
ATOM   5084  C  CD2  . TRP A 1 514 ? 44.384  29.648  24.164  1.00 4.37  ? 545 TRP A CD2  1 
ATOM   5085  N  NE1  . TRP A 1 514 ? 43.911  28.229  25.840  1.00 5.82  ? 545 TRP A NE1  1 
ATOM   5086  C  CE2  . TRP A 1 514 ? 43.485  29.377  25.217  1.00 4.77  ? 545 TRP A CE2  1 
ATOM   5087  C  CE3  . TRP A 1 514 ? 44.166  30.780  23.363  1.00 3.70  ? 545 TRP A CE3  1 
ATOM   5088  C  CZ2  . TRP A 1 514 ? 42.393  30.190  25.489  1.00 4.64  ? 545 TRP A CZ2  1 
ATOM   5089  C  CZ3  . TRP A 1 514 ? 43.076  31.581  23.635  1.00 3.96  ? 545 TRP A CZ3  1 
ATOM   5090  C  CH2  . TRP A 1 514 ? 42.203  31.282  24.687  1.00 4.47  ? 545 TRP A CH2  1 
ATOM   5091  H  H    . TRP A 1 514 ? 48.446  28.791  21.535  1.00 17.00 ? 545 TRP A H    1 
ATOM   5092  H  HE1  . TRP A 1 514 ? 43.500  27.844  26.643  1.00 17.00 ? 545 TRP A HE1  1 
ATOM   5093  N  N    . LYS A 1 515 ? 48.652  31.138  24.702  1.00 2.58  ? 546 LYS A N    1 
ATOM   5094  C  CA   . LYS A 1 515 ? 49.304  31.506  25.945  1.00 3.85  ? 546 LYS A CA   1 
ATOM   5095  C  C    . LYS A 1 515 ? 49.113  33.001  26.061  1.00 2.25  ? 546 LYS A C    1 
ATOM   5096  O  O    . LYS A 1 515 ? 48.826  33.672  25.059  1.00 2.00  ? 546 LYS A O    1 
ATOM   5097  C  CB   . LYS A 1 515 ? 50.813  31.176  25.890  1.00 4.87  ? 546 LYS A CB   1 
ATOM   5098  C  CG   . LYS A 1 515 ? 51.572  31.840  24.734  1.00 8.17  ? 546 LYS A CG   1 
ATOM   5099  C  CD   . LYS A 1 515 ? 53.025  31.393  24.632  1.00 11.91 ? 546 LYS A CD   1 
ATOM   5100  C  CE   . LYS A 1 515 ? 53.155  29.881  24.347  1.00 17.78 ? 546 LYS A CE   1 
ATOM   5101  N  NZ   . LYS A 1 515 ? 54.541  29.302  24.618  1.00 17.15 ? 546 LYS A NZ   1 
ATOM   5102  H  H    . LYS A 1 515 ? 48.599  31.819  24.000  1.00 17.00 ? 546 LYS A H    1 
ATOM   5103  H  HZ1  . LYS A 1 515 ? 54.773  29.472  25.617  1.00 17.00 ? 546 LYS A HZ1  1 
ATOM   5104  H  HZ2  . LYS A 1 515 ? 54.562  28.283  24.416  1.00 17.00 ? 546 LYS A HZ2  1 
ATOM   5105  H  HZ3  . LYS A 1 515 ? 55.238  29.797  24.024  1.00 17.00 ? 546 LYS A HZ3  1 
ATOM   5106  N  N    . PRO A 1 516 ? 49.232  33.543  27.280  1.00 2.00  ? 547 PRO A N    1 
ATOM   5107  C  CA   . PRO A 1 516 ? 49.086  34.965  27.492  1.00 2.00  ? 547 PRO A CA   1 
ATOM   5108  C  C    . PRO A 1 516 ? 50.110  35.589  26.594  1.00 3.66  ? 547 PRO A C    1 
ATOM   5109  O  O    . PRO A 1 516 ? 50.676  34.909  25.769  1.00 8.04  ? 547 PRO A O    1 
ATOM   5110  C  CB   . PRO A 1 516 ? 49.495  35.114  28.941  1.00 2.00  ? 547 PRO A CB   1 
ATOM   5111  C  CG   . PRO A 1 516 ? 49.010  33.898  29.535  1.00 2.00  ? 547 PRO A CG   1 
ATOM   5112  C  CD   . PRO A 1 516 ? 49.418  32.858  28.560  1.00 2.00  ? 547 PRO A CD   1 
ATOM   5113  N  N    . SER A 1 517 ? 50.392  36.868  26.753  1.00 4.96  ? 548 SER A N    1 
ATOM   5114  C  CA   . SER A 1 517 ? 51.410  37.516  25.920  1.00 6.43  ? 548 SER A CA   1 
ATOM   5115  C  C    . SER A 1 517 ? 51.082  37.547  24.408  1.00 5.85  ? 548 SER A C    1 
ATOM   5116  O  O    . SER A 1 517 ? 51.138  38.618  23.812  1.00 7.70  ? 548 SER A O    1 
ATOM   5117  C  CB   . SER A 1 517 ? 52.838  36.958  26.230  1.00 3.07  ? 548 SER A CB   1 
ATOM   5118  O  OG   . SER A 1 517 ? 53.148  35.716  25.617  1.00 2.00  ? 548 SER A OG   1 
ATOM   5119  H  H    . SER A 1 517 ? 49.906  37.367  27.433  1.00 17.00 ? 548 SER A H    1 
ATOM   5120  H  HG   . SER A 1 517 ? 52.526  35.019  25.845  1.00 17.00 ? 548 SER A HG   1 
ATOM   5121  N  N    . THR A 1 518 ? 50.710  36.410  23.800  1.00 5.96  ? 549 THR A N    1 
ATOM   5122  C  CA   . THR A 1 518 ? 50.355  36.353  22.371  1.00 4.31  ? 549 THR A CA   1 
ATOM   5123  C  C    . THR A 1 518 ? 49.295  37.404  22.144  1.00 4.80  ? 549 THR A C    1 
ATOM   5124  O  O    . THR A 1 518 ? 49.136  37.934  21.037  1.00 2.00  ? 549 THR A O    1 
ATOM   5125  C  CB   . THR A 1 518 ? 49.699  35.020  22.009  1.00 2.00  ? 549 THR A CB   1 
ATOM   5126  O  OG1  . THR A 1 518 ? 50.466  33.962  22.568  1.00 2.00  ? 549 THR A OG1  1 
ATOM   5127  C  CG2  . THR A 1 518 ? 49.585  34.859  20.485  1.00 2.00  ? 549 THR A CG2  1 
ATOM   5128  H  H    . THR A 1 518 ? 50.710  35.505  24.152  1.00 17.00 ? 549 THR A H    1 
ATOM   5129  H  HG1  . THR A 1 518 ? 49.980  33.144  22.496  1.00 17.00 ? 549 THR A HG1  1 
ATOM   5130  N  N    . PHE A 1 519 ? 48.586  37.680  23.240  1.00 5.81  ? 550 PHE A N    1 
ATOM   5131  C  CA   . PHE A 1 519 ? 47.500  38.615  23.259  1.00 5.96  ? 550 PHE A CA   1 
ATOM   5132  C  C    . PHE A 1 519 ? 47.870  39.816  24.063  1.00 6.35  ? 550 PHE A C    1 
ATOM   5133  O  O    . PHE A 1 519 ? 47.014  40.469  24.659  1.00 11.27 ? 550 PHE A O    1 
ATOM   5134  C  CB   . PHE A 1 519 ? 46.235  37.925  23.780  1.00 3.91  ? 550 PHE A CB   1 
ATOM   5135  C  CG   . PHE A 1 519 ? 45.954  36.646  23.085  1.00 2.00  ? 550 PHE A CG   1 
ATOM   5136  C  CD1  . PHE A 1 519 ? 45.790  36.621  21.702  1.00 2.00  ? 550 PHE A CD1  1 
ATOM   5137  C  CD2  . PHE A 1 519 ? 45.943  35.447  23.788  1.00 3.83  ? 550 PHE A CD2  1 
ATOM   5138  C  CE1  . PHE A 1 519 ? 45.624  35.418  21.013  1.00 2.07  ? 550 PHE A CE1  1 
ATOM   5139  C  CE2  . PHE A 1 519 ? 45.774  34.213  23.112  1.00 3.71  ? 550 PHE A CE2  1 
ATOM   5140  C  CZ   . PHE A 1 519 ? 45.615  34.204  21.718  1.00 3.04  ? 550 PHE A CZ   1 
ATOM   5141  H  H    . PHE A 1 519 ? 48.788  37.185  24.053  1.00 17.00 ? 550 PHE A H    1 
ATOM   5142  N  N    . GLY A 1 520 ? 49.148  40.142  24.032  1.00 5.02  ? 551 GLY A N    1 
ATOM   5143  C  CA   . GLY A 1 520 ? 49.611  41.323  24.742  1.00 6.28  ? 551 GLY A CA   1 
ATOM   5144  C  C    . GLY A 1 520 ? 49.823  41.173  26.229  1.00 4.24  ? 551 GLY A C    1 
ATOM   5145  O  O    . GLY A 1 520 ? 50.536  41.974  26.828  1.00 5.02  ? 551 GLY A O    1 
ATOM   5146  H  H    . GLY A 1 520 ? 49.745  39.653  23.445  1.00 17.00 ? 551 GLY A H    1 
ATOM   5147  N  N    . GLY A 1 521 ? 49.221  40.162  26.830  1.00 2.00  ? 552 GLY A N    1 
ATOM   5148  C  CA   . GLY A 1 521 ? 49.419  39.992  28.241  1.00 2.21  ? 552 GLY A CA   1 
ATOM   5149  C  C    . GLY A 1 521 ? 48.532  38.898  28.756  1.00 4.92  ? 552 GLY A C    1 
ATOM   5150  O  O    . GLY A 1 521 ? 48.054  38.069  27.978  1.00 3.12  ? 552 GLY A O    1 
ATOM   5151  H  H    . GLY A 1 521 ? 48.643  39.544  26.342  1.00 17.00 ? 552 GLY A H    1 
ATOM   5152  N  N    . GLU A 1 522 ? 48.407  38.846  30.082  1.00 6.60  ? 553 GLU A N    1 
ATOM   5153  C  CA   . GLU A 1 522 ? 47.548  37.892  30.774  1.00 6.26  ? 553 GLU A CA   1 
ATOM   5154  C  C    . GLU A 1 522 ? 46.191  38.557  30.617  1.00 7.13  ? 553 GLU A C    1 
ATOM   5155  O  O    . GLU A 1 522 ? 45.172  37.894  30.426  1.00 8.30  ? 553 GLU A O    1 
ATOM   5156  C  CB   . GLU A 1 522 ? 47.930  37.845  32.256  1.00 5.64  ? 553 GLU A CB   1 
ATOM   5157  C  CG   . GLU A 1 522 ? 47.287  36.729  33.049  1.00 9.33  ? 553 GLU A CG   1 
ATOM   5158  C  CD   . GLU A 1 522 ? 47.753  35.341  32.601  1.00 14.33 ? 553 GLU A CD   1 
ATOM   5159  O  OE1  . GLU A 1 522 ? 48.892  34.931  32.970  1.00 14.74 ? 553 GLU A OE1  1 
ATOM   5160  O  OE2  . GLU A 1 522 ? 46.974  34.653  31.888  1.00 13.78 ? 553 GLU A OE2  1 
ATOM   5161  H  H    . GLU A 1 522 ? 48.944  39.467  30.615  1.00 17.00 ? 553 GLU A H    1 
ATOM   5162  N  N    . VAL A 1 523 ? 46.244  39.893  30.652  1.00 5.53  ? 554 VAL A N    1 
ATOM   5163  C  CA   . VAL A 1 523 ? 45.119  40.809  30.516  1.00 3.07  ? 554 VAL A CA   1 
ATOM   5164  C  C    . VAL A 1 523 ? 44.371  40.456  29.251  1.00 3.35  ? 554 VAL A C    1 
ATOM   5165  O  O    . VAL A 1 523 ? 43.267  39.933  29.333  1.00 5.34  ? 554 VAL A O    1 
ATOM   5166  C  CB   . VAL A 1 523 ? 45.639  42.257  30.420  1.00 4.67  ? 554 VAL A CB   1 
ATOM   5167  C  CG1  . VAL A 1 523 ? 44.526  43.274  30.635  1.00 3.57  ? 554 VAL A CG1  1 
ATOM   5168  C  CG2  . VAL A 1 523 ? 46.754  42.462  31.438  1.00 5.72  ? 554 VAL A CG2  1 
ATOM   5169  H  H    . VAL A 1 523 ? 47.129  40.268  30.799  1.00 17.00 ? 554 VAL A H    1 
ATOM   5170  N  N    . GLY A 1 524 ? 44.980  40.708  28.093  1.00 2.00  ? 555 GLY A N    1 
ATOM   5171  C  CA   . GLY A 1 524 ? 44.350  40.369  26.823  1.00 2.18  ? 555 GLY A CA   1 
ATOM   5172  C  C    . GLY A 1 524 ? 43.835  38.928  26.745  1.00 2.00  ? 555 GLY A C    1 
ATOM   5173  O  O    . GLY A 1 524 ? 42.753  38.645  26.257  1.00 2.04  ? 555 GLY A O    1 
ATOM   5174  H  H    . GLY A 1 524 ? 45.856  41.130  28.085  1.00 17.00 ? 555 GLY A H    1 
ATOM   5175  N  N    . PHE A 1 525 ? 44.613  38.003  27.262  1.00 3.98  ? 556 PHE A N    1 
ATOM   5176  C  CA   . PHE A 1 525 ? 44.226  36.606  27.277  1.00 5.76  ? 556 PHE A CA   1 
ATOM   5177  C  C    . PHE A 1 525 ? 42.943  36.435  28.089  1.00 8.37  ? 556 PHE A C    1 
ATOM   5178  O  O    . PHE A 1 525 ? 42.122  35.541  27.825  1.00 9.44  ? 556 PHE A O    1 
ATOM   5179  C  CB   . PHE A 1 525 ? 45.309  35.781  27.953  1.00 2.93  ? 556 PHE A CB   1 
ATOM   5180  C  CG   . PHE A 1 525 ? 45.144  34.321  27.781  1.00 2.00  ? 556 PHE A CG   1 
ATOM   5181  C  CD1  . PHE A 1 525 ? 44.833  33.794  26.541  1.00 2.00  ? 556 PHE A CD1  1 
ATOM   5182  C  CD2  . PHE A 1 525 ? 45.365  33.461  28.831  1.00 2.00  ? 556 PHE A CD2  1 
ATOM   5183  C  CE1  . PHE A 1 525 ? 44.751  32.406  26.347  1.00 2.16  ? 556 PHE A CE1  1 
ATOM   5184  C  CE2  . PHE A 1 525 ? 45.288  32.076  28.648  1.00 2.00  ? 556 PHE A CE2  1 
ATOM   5185  C  CZ   . PHE A 1 525 ? 44.981  31.547  27.405  1.00 2.00  ? 556 PHE A CZ   1 
ATOM   5186  H  H    . PHE A 1 525 ? 45.470  38.257  27.645  1.00 17.00 ? 556 PHE A H    1 
ATOM   5187  N  N    . LYS A 1 526 ? 42.788  37.275  29.107  1.00 10.12 ? 557 LYS A N    1 
ATOM   5188  C  CA   . LYS A 1 526 ? 41.626  37.204  29.980  1.00 10.56 ? 557 LYS A CA   1 
ATOM   5189  C  C    . LYS A 1 526 ? 40.484  38.112  29.548  1.00 8.68  ? 557 LYS A C    1 
ATOM   5190  O  O    . LYS A 1 526 ? 39.755  38.667  30.368  1.00 6.13  ? 557 LYS A O    1 
ATOM   5191  C  CB   . LYS A 1 526 ? 42.073  37.430  31.429  1.00 14.07 ? 557 LYS A CB   1 
ATOM   5192  C  CG   . LYS A 1 526 ? 43.102  36.355  31.881  1.00 17.38 ? 557 LYS A CG   1 
ATOM   5193  C  CD   . LYS A 1 526 ? 42.636  34.944  31.414  1.00 23.83 ? 557 LYS A CD   1 
ATOM   5194  C  CE   . LYS A 1 526 ? 43.711  33.850  31.584  1.00 25.19 ? 557 LYS A CE   1 
ATOM   5195  N  NZ   . LYS A 1 526 ? 43.226  32.457  31.156  1.00 23.70 ? 557 LYS A NZ   1 
ATOM   5196  H  H    . LYS A 1 526 ? 43.463  37.957  29.309  1.00 17.00 ? 557 LYS A H    1 
ATOM   5197  H  HZ1  . LYS A 1 526 ? 42.935  32.470  30.157  1.00 17.00 ? 557 LYS A HZ1  1 
ATOM   5198  H  HZ2  . LYS A 1 526 ? 44.016  31.790  31.275  1.00 17.00 ? 557 LYS A HZ2  1 
ATOM   5199  H  HZ3  . LYS A 1 526 ? 42.432  32.164  31.758  1.00 17.00 ? 557 LYS A HZ3  1 
ATOM   5200  N  N    . ILE A 1 527 ? 40.393  38.278  28.231  1.00 7.05  ? 558 ILE A N    1 
ATOM   5201  C  CA   . ILE A 1 527 ? 39.362  39.060  27.578  1.00 4.25  ? 558 ILE A CA   1 
ATOM   5202  C  C    . ILE A 1 527 ? 38.716  37.984  26.754  1.00 4.40  ? 558 ILE A C    1 
ATOM   5203  O  O    . ILE A 1 527 ? 37.518  37.786  26.813  1.00 7.26  ? 558 ILE A O    1 
ATOM   5204  C  CB   . ILE A 1 527 ? 39.948  40.155  26.697  1.00 2.00  ? 558 ILE A CB   1 
ATOM   5205  C  CG1  . ILE A 1 527 ? 40.413  41.305  27.590  1.00 5.52  ? 558 ILE A CG1  1 
ATOM   5206  C  CG2  . ILE A 1 527 ? 38.946  40.620  25.703  1.00 2.00  ? 558 ILE A CG2  1 
ATOM   5207  C  CD1  . ILE A 1 527 ? 40.819  42.596  26.849  1.00 8.38  ? 558 ILE A CD1  1 
ATOM   5208  H  H    . ILE A 1 527 ? 41.092  37.892  27.674  1.00 17.00 ? 558 ILE A H    1 
ATOM   5209  N  N    . ILE A 1 528 ? 39.537  37.210  26.069  1.00 4.04  ? 559 ILE A N    1 
ATOM   5210  C  CA   . ILE A 1 528 ? 39.045  36.108  25.260  1.00 5.23  ? 559 ILE A CA   1 
ATOM   5211  C  C    . ILE A 1 528 ? 38.213  35.219  26.187  1.00 7.24  ? 559 ILE A C    1 
ATOM   5212  O  O    . ILE A 1 528 ? 37.025  34.996  25.966  1.00 8.57  ? 559 ILE A O    1 
ATOM   5213  C  CB   . ILE A 1 528 ? 40.229  35.244  24.695  1.00 5.77  ? 559 ILE A CB   1 
ATOM   5214  C  CG1  . ILE A 1 528 ? 40.945  35.958  23.549  1.00 5.82  ? 559 ILE A CG1  1 
ATOM   5215  C  CG2  . ILE A 1 528 ? 39.744  33.881  24.238  1.00 5.40  ? 559 ILE A CG2  1 
ATOM   5216  C  CD1  . ILE A 1 528 ? 41.732  37.183  23.970  1.00 8.44  ? 559 ILE A CD1  1 
ATOM   5217  H  H    . ILE A 1 528 ? 40.494  37.404  26.102  1.00 17.00 ? 559 ILE A H    1 
ATOM   5218  N  N    . ASN A 1 529 ? 38.808  34.844  27.311  1.00 8.97  ? 560 ASN A N    1 
ATOM   5219  C  CA   . ASN A 1 529 ? 38.152  33.949  28.255  1.00 7.55  ? 560 ASN A CA   1 
ATOM   5220  C  C    . ASN A 1 529 ? 37.154  34.534  29.250  1.00 6.33  ? 560 ASN A C    1 
ATOM   5221  O  O    . ASN A 1 529 ? 36.989  34.030  30.369  1.00 7.42  ? 560 ASN A O    1 
ATOM   5222  C  CB   . ASN A 1 529 ? 39.206  33.112  28.967  1.00 11.05 ? 560 ASN A CB   1 
ATOM   5223  C  CG   . ASN A 1 529 ? 40.154  32.438  27.999  1.00 10.35 ? 560 ASN A CG   1 
ATOM   5224  O  OD1  . ASN A 1 529 ? 39.864  31.379  27.432  1.00 5.68  ? 560 ASN A OD1  1 
ATOM   5225  N  ND2  . ASN A 1 529 ? 41.302  33.060  27.803  1.00 11.18 ? 560 ASN A ND2  1 
ATOM   5226  H  H    . ASN A 1 529 ? 39.711  35.171  27.503  1.00 17.00 ? 560 ASN A H    1 
ATOM   5227  H  HD21 . ASN A 1 529 ? 41.923  32.641  27.174  1.00 17.00 ? 560 ASN A HD21 1 
ATOM   5228  H  HD22 . ASN A 1 529 ? 41.491  33.881  28.291  1.00 17.00 ? 560 ASN A HD22 1 
ATOM   5229  N  N    . THR A 1 530 ? 36.519  35.618  28.856  1.00 3.66  ? 561 THR A N    1 
ATOM   5230  C  CA   . THR A 1 530 ? 35.496  36.236  29.664  1.00 4.88  ? 561 THR A CA   1 
ATOM   5231  C  C    . THR A 1 530 ? 34.504  36.816  28.654  1.00 7.65  ? 561 THR A C    1 
ATOM   5232  O  O    . THR A 1 530 ? 33.545  37.526  29.014  1.00 9.17  ? 561 THR A O    1 
ATOM   5233  C  CB   . THR A 1 530 ? 36.043  37.347  30.537  1.00 3.83  ? 561 THR A CB   1 
ATOM   5234  O  OG1  . THR A 1 530 ? 36.889  38.194  29.757  1.00 10.08 ? 561 THR A OG1  1 
ATOM   5235  C  CG2  . THR A 1 530 ? 36.800  36.804  31.675  1.00 2.92  ? 561 THR A CG2  1 
ATOM   5236  H  H    . THR A 1 530 ? 36.759  36.068  28.020  1.00 17.00 ? 561 THR A H    1 
ATOM   5237  H  HG1  . THR A 1 530 ? 37.456  38.733  30.327  1.00 17.00 ? 561 THR A HG1  1 
ATOM   5238  N  N    . ALA A 1 531 ? 34.724  36.469  27.387  1.00 6.78  ? 562 ALA A N    1 
ATOM   5239  C  CA   . ALA A 1 531 ? 33.894  36.938  26.289  1.00 6.67  ? 562 ALA A CA   1 
ATOM   5240  C  C    . ALA A 1 531 ? 32.490  36.338  26.304  1.00 7.71  ? 562 ALA A C    1 
ATOM   5241  O  O    . ALA A 1 531 ? 32.273  35.223  26.816  1.00 7.64  ? 562 ALA A O    1 
ATOM   5242  C  CB   . ALA A 1 531 ? 34.579  36.640  24.959  1.00 6.06  ? 562 ALA A CB   1 
ATOM   5243  H  H    . ALA A 1 531 ? 35.439  35.850  27.149  1.00 17.00 ? 562 ALA A H    1 
ATOM   5244  N  N    . SER A 1 532 ? 31.544  37.106  25.752  1.00 7.30  ? 563 SER A N    1 
ATOM   5245  C  CA   . SER A 1 532 ? 30.138  36.728  25.654  1.00 4.46  ? 563 SER A CA   1 
ATOM   5246  C  C    . SER A 1 532 ? 29.479  37.782  24.803  1.00 3.97  ? 563 SER A C    1 
ATOM   5247  O  O    . SER A 1 532 ? 29.920  38.928  24.779  1.00 4.14  ? 563 SER A O    1 
ATOM   5248  C  CB   . SER A 1 532 ? 29.488  36.732  27.034  1.00 4.79  ? 563 SER A CB   1 
ATOM   5249  O  OG   . SER A 1 532 ? 29.481  38.032  27.590  1.00 5.13  ? 563 SER A OG   1 
ATOM   5250  H  H    . SER A 1 532 ? 31.792  37.987  25.407  1.00 17.00 ? 563 SER A H    1 
ATOM   5251  H  HG   . SER A 1 532 ? 30.279  38.203  28.122  1.00 17.00 ? 563 SER A HG   1 
ATOM   5252  N  N    . ILE A 1 533 ? 28.419  37.405  24.108  1.00 4.81  ? 564 ILE A N    1 
ATOM   5253  C  CA   . ILE A 1 533 ? 27.704  38.351  23.260  1.00 4.91  ? 564 ILE A CA   1 
ATOM   5254  C  C    . ILE A 1 533 ? 27.069  39.375  24.196  1.00 4.04  ? 564 ILE A C    1 
ATOM   5255  O  O    . ILE A 1 533 ? 26.991  40.564  23.870  1.00 3.04  ? 564 ILE A O    1 
ATOM   5256  C  CB   . ILE A 1 533 ? 26.665  37.622  22.307  1.00 4.24  ? 564 ILE A CB   1 
ATOM   5257  C  CG1  . ILE A 1 533 ? 26.508  38.375  20.973  1.00 2.00  ? 564 ILE A CG1  1 
ATOM   5258  C  CG2  . ILE A 1 533 ? 25.360  37.333  23.018  1.00 2.00  ? 564 ILE A CG2  1 
ATOM   5259  C  CD1  . ILE A 1 533 ? 26.194  39.840  21.073  1.00 2.00  ? 564 ILE A CD1  1 
ATOM   5260  H  H    . ILE A 1 533 ? 28.100  36.490  24.157  1.00 17.00 ? 564 ILE A H    1 
ATOM   5261  N  N    . GLN A 1 534 ? 26.742  38.914  25.403  1.00 5.27  ? 565 GLN A N    1 
ATOM   5262  C  CA   . GLN A 1 534 ? 26.148  39.745  26.452  1.00 8.06  ? 565 GLN A CA   1 
ATOM   5263  C  C    . GLN A 1 534 ? 27.054  40.940  26.792  1.00 6.92  ? 565 GLN A C    1 
ATOM   5264  O  O    . GLN A 1 534 ? 26.604  42.100  26.915  1.00 4.10  ? 565 GLN A O    1 
ATOM   5265  C  CB   . GLN A 1 534 ? 25.934  38.887  27.690  1.00 9.41  ? 565 GLN A CB   1 
ATOM   5266  C  CG   . GLN A 1 534 ? 25.586  39.663  28.928  1.00 14.55 ? 565 GLN A CG   1 
ATOM   5267  C  CD   . GLN A 1 534 ? 24.284  40.440  28.826  1.00 17.24 ? 565 GLN A CD   1 
ATOM   5268  O  OE1  . GLN A 1 534 ? 23.192  39.875  28.984  1.00 19.15 ? 565 GLN A OE1  1 
ATOM   5269  N  NE2  . GLN A 1 534 ? 24.392  41.749  28.588  1.00 17.33 ? 565 GLN A NE2  1 
ATOM   5270  H  H    . GLN A 1 534 ? 26.899  37.974  25.604  1.00 17.00 ? 565 GLN A H    1 
ATOM   5271  H  HE21 . GLN A 1 534 ? 23.581  42.295  28.538  1.00 17.00 ? 565 GLN A HE21 1 
ATOM   5272  H  HE22 . GLN A 1 534 ? 25.288  42.133  28.475  1.00 17.00 ? 565 GLN A HE22 1 
ATOM   5273  N  N    . SER A 1 535 ? 28.338  40.636  26.933  1.00 6.36  ? 566 SER A N    1 
ATOM   5274  C  CA   . SER A 1 535 ? 29.329  41.631  27.239  1.00 5.00  ? 566 SER A CA   1 
ATOM   5275  C  C    . SER A 1 535 ? 29.642  42.441  26.017  1.00 4.63  ? 566 SER A C    1 
ATOM   5276  O  O    . SER A 1 535 ? 29.723  43.664  26.095  1.00 8.45  ? 566 SER A O    1 
ATOM   5277  C  CB   . SER A 1 535 ? 30.576  40.958  27.724  1.00 3.56  ? 566 SER A CB   1 
ATOM   5278  O  OG   . SER A 1 535 ? 30.254  40.088  28.785  1.00 9.33  ? 566 SER A OG   1 
ATOM   5279  H  H    . SER A 1 535 ? 28.651  39.708  26.861  1.00 17.00 ? 566 SER A H    1 
ATOM   5280  H  HG   . SER A 1 535 ? 29.991  40.578  29.570  1.00 17.00 ? 566 SER A HG   1 
ATOM   5281  N  N    . LEU A 1 536 ? 29.774  41.780  24.878  1.00 2.00  ? 567 LEU A N    1 
ATOM   5282  C  CA   . LEU A 1 536 ? 30.096  42.475  23.634  1.00 2.44  ? 567 LEU A CA   1 
ATOM   5283  C  C    . LEU A 1 536 ? 29.252  43.719  23.458  1.00 3.30  ? 567 LEU A C    1 
ATOM   5284  O  O    . LEU A 1 536 ? 29.735  44.777  23.068  1.00 2.85  ? 567 LEU A O    1 
ATOM   5285  C  CB   . LEU A 1 536 ? 29.884  41.560  22.443  1.00 2.00  ? 567 LEU A CB   1 
ATOM   5286  C  CG   . LEU A 1 536 ? 30.498  42.097  21.170  1.00 2.00  ? 567 LEU A CG   1 
ATOM   5287  C  CD1  . LEU A 1 536 ? 32.000  42.119  21.342  1.00 3.56  ? 567 LEU A CD1  1 
ATOM   5288  C  CD2  . LEU A 1 536 ? 30.134  41.251  20.003  1.00 2.79  ? 567 LEU A CD2  1 
ATOM   5289  H  H    . LEU A 1 536 ? 29.650  40.810  24.866  1.00 17.00 ? 567 LEU A H    1 
ATOM   5290  N  N    . ILE A 1 537 ? 27.984  43.583  23.806  1.00 7.22  ? 568 ILE A N    1 
ATOM   5291  C  CA   . ILE A 1 537 ? 27.039  44.672  23.709  1.00 6.68  ? 568 ILE A CA   1 
ATOM   5292  C  C    . ILE A 1 537 ? 27.174  45.591  24.917  1.00 6.63  ? 568 ILE A C    1 
ATOM   5293  O  O    . ILE A 1 537 ? 27.410  46.778  24.732  1.00 6.79  ? 568 ILE A O    1 
ATOM   5294  C  CB   . ILE A 1 537 ? 25.578  44.138  23.492  1.00 5.53  ? 568 ILE A CB   1 
ATOM   5295  C  CG1  . ILE A 1 537 ? 25.161  44.309  22.033  1.00 2.00  ? 568 ILE A CG1  1 
ATOM   5296  C  CG2  . ILE A 1 537 ? 24.603  44.842  24.369  1.00 7.89  ? 568 ILE A CG2  1 
ATOM   5297  C  CD1  . ILE A 1 537 ? 25.768  43.312  21.101  1.00 2.05  ? 568 ILE A CD1  1 
ATOM   5298  H  H    . ILE A 1 537 ? 27.668  42.705  24.112  1.00 17.00 ? 568 ILE A H    1 
ATOM   5299  N  N    . CYS A 1 538 ? 27.143  45.053  26.139  1.00 8.04  ? 569 CYS A N    1 
ATOM   5300  C  CA   . CYS A 1 538 ? 27.244  45.927  27.314  1.00 12.76 ? 569 CYS A CA   1 
ATOM   5301  C  C    . CYS A 1 538 ? 28.483  46.773  27.360  1.00 10.94 ? 569 CYS A C    1 
ATOM   5302  O  O    . CYS A 1 538 ? 28.537  47.787  28.064  1.00 13.48 ? 569 CYS A O    1 
ATOM   5303  C  CB   . CYS A 1 538 ? 27.116  45.182  28.623  1.00 12.49 ? 569 CYS A CB   1 
ATOM   5304  S  SG   . CYS A 1 538 ? 25.500  45.560  29.384  1.00 17.75 ? 569 CYS A SG   1 
ATOM   5305  H  H    . CYS A 1 538 ? 27.041  44.084  26.258  1.00 17.00 ? 569 CYS A H    1 
ATOM   5306  N  N    . ASN A 1 539 ? 29.478  46.350  26.605  1.00 9.71  ? 570 ASN A N    1 
ATOM   5307  C  CA   . ASN A 1 539 ? 30.724  47.079  26.541  1.00 8.31  ? 570 ASN A CA   1 
ATOM   5308  C  C    . ASN A 1 539 ? 30.725  48.066  25.421  1.00 4.89  ? 570 ASN A C    1 
ATOM   5309  O  O    . ASN A 1 539 ? 31.348  49.108  25.546  1.00 4.84  ? 570 ASN A O    1 
ATOM   5310  C  CB   . ASN A 1 539 ? 31.906  46.136  26.357  1.00 6.38  ? 570 ASN A CB   1 
ATOM   5311  C  CG   . ASN A 1 539 ? 32.486  45.689  27.665  1.00 5.95  ? 570 ASN A CG   1 
ATOM   5312  O  OD1  . ASN A 1 539 ? 32.490  46.434  28.647  1.00 3.82  ? 570 ASN A OD1  1 
ATOM   5313  N  ND2  . ASN A 1 539 ? 32.998  44.462  27.692  1.00 8.23  ? 570 ASN A ND2  1 
ATOM   5314  H  H    . ASN A 1 539 ? 29.370  45.534  26.085  1.00 17.00 ? 570 ASN A H    1 
ATOM   5315  H  HD21 . ASN A 1 539 ? 33.362  44.169  28.554  1.00 17.00 ? 570 ASN A HD21 1 
ATOM   5316  H  HD22 . ASN A 1 539 ? 32.985  43.924  26.879  1.00 17.00 ? 570 ASN A HD22 1 
ATOM   5317  N  N    . ASN A 1 540 ? 29.994  47.754  24.353  1.00 4.26  ? 571 ASN A N    1 
ATOM   5318  C  CA   . ASN A 1 540 ? 29.980  48.608  23.174  1.00 4.87  ? 571 ASN A CA   1 
ATOM   5319  C  C    . ASN A 1 540 ? 28.733  49.385  22.822  1.00 7.37  ? 571 ASN A C    1 
ATOM   5320  O  O    . ASN A 1 540 ? 28.827  50.350  22.055  1.00 8.50  ? 571 ASN A O    1 
ATOM   5321  C  CB   . ASN A 1 540 ? 30.423  47.831  21.937  1.00 4.51  ? 571 ASN A CB   1 
ATOM   5322  C  CG   . ASN A 1 540 ? 31.898  47.544  21.934  1.00 5.01  ? 571 ASN A CG   1 
ATOM   5323  O  OD1  . ASN A 1 540 ? 32.706  48.408  21.628  1.00 2.45  ? 571 ASN A OD1  1 
ATOM   5324  N  ND2  . ASN A 1 540 ? 32.262  46.314  22.292  1.00 6.86  ? 571 ASN A ND2  1 
ATOM   5325  H  H    . ASN A 1 540 ? 29.430  46.955  24.354  1.00 17.00 ? 571 ASN A H    1 
ATOM   5326  H  HD21 . ASN A 1 540 ? 33.213  46.113  22.312  1.00 17.00 ? 571 ASN A HD21 1 
ATOM   5327  H  HD22 . ASN A 1 540 ? 31.541  45.685  22.516  1.00 17.00 ? 571 ASN A HD22 1 
ATOM   5328  N  N    . VAL A 1 541 ? 27.577  49.031  23.390  1.00 8.77  ? 572 VAL A N    1 
ATOM   5329  C  CA   . VAL A 1 541 ? 26.326  49.740  23.048  1.00 6.14  ? 572 VAL A CA   1 
ATOM   5330  C  C    . VAL A 1 541 ? 25.768  50.723  24.091  1.00 3.99  ? 572 VAL A C    1 
ATOM   5331  O  O    . VAL A 1 541 ? 25.462  50.360  25.218  1.00 2.00  ? 572 VAL A O    1 
ATOM   5332  C  CB   . VAL A 1 541 ? 25.222  48.768  22.563  1.00 4.31  ? 572 VAL A CB   1 
ATOM   5333  C  CG1  . VAL A 1 541 ? 24.318  49.476  21.614  1.00 2.00  ? 572 VAL A CG1  1 
ATOM   5334  C  CG2  . VAL A 1 541 ? 25.832  47.561  21.872  1.00 2.00  ? 572 VAL A CG2  1 
ATOM   5335  H  H    . VAL A 1 541 ? 27.578  48.391  24.105  1.00 17.00 ? 572 VAL A H    1 
ATOM   5336  N  N    . LYS A 1 542 ? 25.615  51.962  23.625  1.00 6.74  ? 573 LYS A N    1 
ATOM   5337  C  CA   . LYS A 1 542 ? 25.122  53.124  24.374  1.00 10.85 ? 573 LYS A CA   1 
ATOM   5338  C  C    . LYS A 1 542 ? 24.432  52.911  25.728  1.00 11.39 ? 573 LYS A C    1 
ATOM   5339  O  O    . LYS A 1 542 ? 24.526  53.771  26.623  1.00 10.56 ? 573 LYS A O    1 
ATOM   5340  C  CB   . LYS A 1 542 ? 24.224  53.994  23.485  1.00 14.59 ? 573 LYS A CB   1 
ATOM   5341  C  CG   . LYS A 1 542 ? 23.913  55.333  24.104  1.00 19.78 ? 573 LYS A CG   1 
ATOM   5342  C  CD   . LYS A 1 542 ? 25.197  56.167  24.269  1.00 23.04 ? 573 LYS A CD   1 
ATOM   5343  C  CE   . LYS A 1 542 ? 25.131  57.070  25.506  1.00 26.34 ? 573 LYS A CE   1 
ATOM   5344  N  NZ   . LYS A 1 542 ? 23.810  57.772  25.659  1.00 28.94 ? 573 LYS A NZ   1 
ATOM   5345  H  H    . LYS A 1 542 ? 25.889  52.112  22.698  1.00 17.00 ? 573 LYS A H    1 
ATOM   5346  H  HZ1  . LYS A 1 542 ? 23.044  57.071  25.727  1.00 17.00 ? 573 LYS A HZ1  1 
ATOM   5347  H  HZ2  . LYS A 1 542 ? 23.824  58.344  26.527  1.00 17.00 ? 573 LYS A HZ2  1 
ATOM   5348  H  HZ3  . LYS A 1 542 ? 23.644  58.385  24.836  1.00 17.00 ? 573 LYS A HZ3  1 
ATOM   5349  N  N    . GLY A 1 543 ? 23.644  51.844  25.844  1.00 11.16 ? 574 GLY A N    1 
ATOM   5350  C  CA   . GLY A 1 543 ? 22.992  51.572  27.110  1.00 12.20 ? 574 GLY A CA   1 
ATOM   5351  C  C    . GLY A 1 543 ? 23.933  50.603  27.771  1.00 12.85 ? 574 GLY A C    1 
ATOM   5352  O  O    . GLY A 1 543 ? 25.064  50.937  28.132  1.00 17.28 ? 574 GLY A O    1 
ATOM   5353  H  H    . GLY A 1 543 ? 23.594  51.223  25.102  1.00 17.00 ? 574 GLY A H    1 
ATOM   5354  N  N    . CYS A 1 544 ? 23.451  49.382  27.864  1.00 12.13 ? 575 CYS A N    1 
ATOM   5355  C  CA   . CYS A 1 544 ? 24.142  48.200  28.398  1.00 11.56 ? 575 CYS A CA   1 
ATOM   5356  C  C    . CYS A 1 544 ? 22.874  47.362  28.404  1.00 10.15 ? 575 CYS A C    1 
ATOM   5357  O  O    . CYS A 1 544 ? 22.314  47.022  29.461  1.00 6.98  ? 575 CYS A O    1 
ATOM   5358  C  CB   . CYS A 1 544 ? 24.632  48.430  29.829  1.00 15.59 ? 575 CYS A CB   1 
ATOM   5359  S  SG   . CYS A 1 544 ? 25.758  47.171  30.558  1.00 17.81 ? 575 CYS A SG   1 
ATOM   5360  H  H    . CYS A 1 544 ? 22.527  49.291  27.558  1.00 17.00 ? 575 CYS A H    1 
ATOM   5361  N  N    . PRO A 1 545 ? 22.302  47.176  27.206  1.00 6.03  ? 576 PRO A N    1 
ATOM   5362  C  CA   . PRO A 1 545 ? 21.090  46.408  27.115  1.00 3.81  ? 576 PRO A CA   1 
ATOM   5363  C  C    . PRO A 1 545 ? 21.335  44.938  27.311  1.00 7.20  ? 576 PRO A C    1 
ATOM   5364  O  O    . PRO A 1 545 ? 22.415  44.402  27.035  1.00 6.64  ? 576 PRO A O    1 
ATOM   5365  C  CB   . PRO A 1 545 ? 20.640  46.697  25.702  1.00 2.01  ? 576 PRO A CB   1 
ATOM   5366  C  CG   . PRO A 1 545 ? 21.882  46.725  24.966  1.00 2.46  ? 576 PRO A CG   1 
ATOM   5367  C  CD   . PRO A 1 545 ? 22.792  47.519  25.856  1.00 6.86  ? 576 PRO A CD   1 
ATOM   5368  N  N    . PHE A 1 546 ? 20.338  44.284  27.873  1.00 9.10  ? 577 PHE A N    1 
ATOM   5369  C  CA   . PHE A 1 546 ? 20.427  42.854  28.030  1.00 8.20  ? 577 PHE A CA   1 
ATOM   5370  C  C    . PHE A 1 546 ? 20.276  42.323  26.594  1.00 5.98  ? 577 PHE A C    1 
ATOM   5371  O  O    . PHE A 1 546 ? 19.555  42.900  25.776  1.00 4.29  ? 577 PHE A O    1 
ATOM   5372  C  CB   . PHE A 1 546 ? 19.269  42.352  28.905  1.00 11.82 ? 577 PHE A CB   1 
ATOM   5373  C  CG   . PHE A 1 546 ? 18.831  40.978  28.557  1.00 12.84 ? 577 PHE A CG   1 
ATOM   5374  C  CD1  . PHE A 1 546 ? 17.879  40.778  27.562  1.00 13.02 ? 577 PHE A CD1  1 
ATOM   5375  C  CD2  . PHE A 1 546 ? 19.438  39.886  29.151  1.00 13.58 ? 577 PHE A CD2  1 
ATOM   5376  C  CE1  . PHE A 1 546 ? 17.543  39.506  27.155  1.00 15.76 ? 577 PHE A CE1  1 
ATOM   5377  C  CE2  . PHE A 1 546 ? 19.118  38.608  28.762  1.00 17.89 ? 577 PHE A CE2  1 
ATOM   5378  C  CZ   . PHE A 1 546 ? 18.162  38.408  27.752  1.00 18.98 ? 577 PHE A CZ   1 
ATOM   5379  H  H    . PHE A 1 546 ? 19.542  44.759  28.182  1.00 17.00 ? 577 PHE A H    1 
ATOM   5380  N  N    . THR A 1 547 ? 20.936  41.222  26.294  1.00 4.09  ? 578 THR A N    1 
ATOM   5381  C  CA   . THR A 1 547 ? 20.821  40.646  24.973  1.00 3.00  ? 578 THR A CA   1 
ATOM   5382  C  C    . THR A 1 547 ? 21.008  39.167  25.069  1.00 2.31  ? 578 THR A C    1 
ATOM   5383  O  O    . THR A 1 547 ? 21.360  38.631  26.125  1.00 2.00  ? 578 THR A O    1 
ATOM   5384  C  CB   . THR A 1 547 ? 21.890  41.152  24.023  1.00 3.82  ? 578 THR A CB   1 
ATOM   5385  O  OG1  . THR A 1 547 ? 22.491  42.341  24.554  1.00 5.35  ? 578 THR A OG1  1 
ATOM   5386  C  CG2  . THR A 1 547 ? 21.270  41.419  22.649  1.00 2.26  ? 578 THR A CG2  1 
ATOM   5387  H  H    . THR A 1 547 ? 21.492  40.758  26.959  1.00 17.00 ? 578 THR A H    1 
ATOM   5388  H  HG1  . THR A 1 547 ? 22.894  42.189  25.413  1.00 17.00 ? 578 THR A HG1  1 
ATOM   5389  N  N    . SER A 1 548 ? 20.757  38.517  23.946  1.00 2.39  ? 579 SER A N    1 
ATOM   5390  C  CA   . SER A 1 548 ? 20.917  37.085  23.832  1.00 3.38  ? 579 SER A CA   1 
ATOM   5391  C  C    . SER A 1 548 ? 20.719  36.667  22.399  1.00 5.70  ? 579 SER A C    1 
ATOM   5392  O  O    . SER A 1 548 ? 20.618  37.500  21.494  1.00 3.94  ? 579 SER A O    1 
ATOM   5393  C  CB   . SER A 1 548 ? 19.926  36.340  24.712  1.00 2.00  ? 579 SER A CB   1 
ATOM   5394  O  OG   . SER A 1 548 ? 20.318  34.997  24.756  1.00 2.22  ? 579 SER A OG   1 
ATOM   5395  H  H    . SER A 1 548 ? 20.447  38.991  23.144  1.00 17.00 ? 579 SER A H    1 
ATOM   5396  H  HG   . SER A 1 548 ? 21.078  34.967  25.356  1.00 17.00 ? 579 SER A HG   1 
ATOM   5397  N  N    . PHE A 1 549 ? 20.743  35.361  22.193  1.00 11.47 ? 580 PHE A N    1 
ATOM   5398  C  CA   . PHE A 1 549 ? 20.528  34.784  20.873  1.00 16.86 ? 580 PHE A CA   1 
ATOM   5399  C  C    . PHE A 1 549 ? 19.180  34.073  20.922  1.00 18.43 ? 580 PHE A C    1 
ATOM   5400  O  O    . PHE A 1 549 ? 18.838  33.289  20.036  1.00 17.92 ? 580 PHE A O    1 
ATOM   5401  C  CB   . PHE A 1 549 ? 21.677  33.830  20.517  1.00 16.73 ? 580 PHE A CB   1 
ATOM   5402  C  CG   . PHE A 1 549 ? 22.963  34.548  20.152  1.00 19.13 ? 580 PHE A CG   1 
ATOM   5403  C  CD1  . PHE A 1 549 ? 22.930  35.795  19.484  1.00 19.48 ? 580 PHE A CD1  1 
ATOM   5404  C  CD2  . PHE A 1 549 ? 24.207  34.004  20.480  1.00 19.32 ? 580 PHE A CD2  1 
ATOM   5405  C  CE1  . PHE A 1 549 ? 24.125  36.491  19.146  1.00 16.19 ? 580 PHE A CE1  1 
ATOM   5406  C  CE2  . PHE A 1 549 ? 25.402  34.692  20.147  1.00 19.54 ? 580 PHE A CE2  1 
ATOM   5407  C  CZ   . PHE A 1 549 ? 25.350  35.942  19.476  1.00 16.01 ? 580 PHE A CZ   1 
ATOM   5408  H  H    . PHE A 1 549 ? 20.913  34.746  22.938  1.00 17.00 ? 580 PHE A H    1 
ATOM   5409  N  N    . ASN A 1 550 ? 18.410  34.400  21.966  1.00 21.90 ? 581 ASN A N    1 
ATOM   5410  C  CA   . ASN A 1 550 ? 17.089  33.831  22.225  1.00 22.08 ? 581 ASN A CA   1 
ATOM   5411  C  C    . ASN A 1 550 ? 16.135  34.972  22.526  1.00 21.89 ? 581 ASN A C    1 
ATOM   5412  O  O    . ASN A 1 550 ? 16.534  35.971  23.129  1.00 21.69 ? 581 ASN A O    1 
ATOM   5413  C  CB   . ASN A 1 550 ? 17.118  32.883  23.410  1.00 24.47 ? 581 ASN A CB   1 
ATOM   5414  C  CG   . ASN A 1 550 ? 16.022  31.881  23.334  1.00 30.11 ? 581 ASN A CG   1 
ATOM   5415  O  OD1  . ASN A 1 550 ? 14.830  32.244  23.283  1.00 35.05 ? 581 ASN A OD1  1 
ATOM   5416  N  ND2  . ASN A 1 550 ? 16.395  30.596  23.261  1.00 32.54 ? 581 ASN A ND2  1 
ATOM   5417  H  H    . ASN A 1 550 ? 18.702  35.080  22.603  1.00 17.00 ? 581 ASN A H    1 
ATOM   5418  H  HD21 . ASN A 1 550 ? 15.653  29.966  23.123  1.00 17.00 ? 581 ASN A HD21 1 
ATOM   5419  H  HD22 . ASN A 1 550 ? 17.331  30.339  23.321  1.00 17.00 ? 581 ASN A HD22 1 
ATOM   5420  N  N    . VAL A 1 551 ? 14.866  34.783  22.180  1.00 20.94 ? 582 VAL A N    1 
ATOM   5421  C  CA   . VAL A 1 551 ? 13.816  35.798  22.324  1.00 18.06 ? 582 VAL A CA   1 
ATOM   5422  C  C    . VAL A 1 551 ? 13.319  36.149  23.739  1.00 18.71 ? 582 VAL A C    1 
ATOM   5423  O  O    . VAL A 1 551 ? 12.155  36.517  23.922  1.00 17.31 ? 582 VAL A O    1 
ATOM   5424  C  CB   . VAL A 1 551 ? 12.611  35.408  21.428  1.00 15.48 ? 582 VAL A CB   1 
ATOM   5425  C  CG1  . VAL A 1 551 ? 11.682  34.467  22.179  1.00 11.97 ? 582 VAL A CG1  1 
ATOM   5426  C  CG2  . VAL A 1 551 ? 11.901  36.643  20.880  1.00 11.04 ? 582 VAL A CG2  1 
ATOM   5427  H  H    . VAL A 1 551 ? 14.584  33.895  21.889  1.00 17.00 ? 582 VAL A H    1 
ATOM   5428  N  N    . GLN A 1 552 ? 14.220  36.177  24.711  1.00 19.58 ? 583 GLN A N    1 
ATOM   5429  C  CA   . GLN A 1 552 ? 13.823  36.480  26.089  1.00 21.51 ? 583 GLN A CA   1 
ATOM   5430  C  C    . GLN A 1 552 ? 12.764  35.443  26.590  1.00 23.95 ? 583 GLN A C    1 
ATOM   5431  O  O    . GLN A 1 552 ? 11.869  35.835  27.403  1.00 22.38 ? 583 GLN A O    1 
ATOM   5432  C  CB   . GLN A 1 552 ? 13.285  37.915  26.196  1.00 15.04 ? 583 GLN A CB   1 
ATOM   5433  C  CG   . GLN A 1 552 ? 14.244  38.916  26.780  1.00 6.51  ? 583 GLN A CG   1 
ATOM   5434  C  CD   . GLN A 1 552 ? 13.538  40.203  27.217  1.00 10.79 ? 583 GLN A CD   1 
ATOM   5435  O  OE1  . GLN A 1 552 ? 12.637  40.695  26.539  1.00 17.07 ? 583 GLN A OE1  1 
ATOM   5436  N  NE2  . GLN A 1 552 ? 13.984  40.782  28.317  1.00 4.64  ? 583 GLN A NE2  1 
ATOM   5437  H  H    . GLN A 1 552 ? 15.149  35.979  24.521  1.00 17.00 ? 583 GLN A H    1 
ATOM   5438  H  HE21 . GLN A 1 552 ? 13.495  41.539  28.691  1.00 17.00 ? 583 GLN A HE21 1 
ATOM   5439  H  HE22 . GLN A 1 552 ? 14.804  40.390  28.661  1.00 17.00 ? 583 GLN A HE22 1 
ATOM   5440  N  N    . ALA B 1 1   ? 65.999  50.425  23.281  1.00 8.04  ? 33  ALA B N    1 
ATOM   5441  C  CA   . ALA B 1 1   ? 65.097  50.610  24.458  1.00 8.51  ? 33  ALA B CA   1 
ATOM   5442  C  C    . ALA B 1 1   ? 64.443  49.295  24.855  1.00 9.07  ? 33  ALA B C    1 
ATOM   5443  O  O    . ALA B 1 1   ? 64.618  48.832  25.979  1.00 10.35 ? 33  ALA B O    1 
ATOM   5444  C  CB   . ALA B 1 1   ? 64.023  51.665  24.173  1.00 6.98  ? 33  ALA B CB   1 
ATOM   5445  H  H1   . ALA B 1 1   ? 65.561  50.054  22.422  1.00 17.00 ? 33  ALA B H1   1 
ATOM   5446  H  H2   . ALA B 1 1   ? 66.480  51.308  23.030  1.00 17.00 ? 33  ALA B H2   1 
ATOM   5447  H  H3   . ALA B 1 1   ? 66.718  49.727  23.560  1.00 17.00 ? 33  ALA B H3   1 
ATOM   5448  N  N    . ASN B 1 2   ? 63.679  48.724  23.921  1.00 7.80  ? 34  ASN B N    1 
ATOM   5449  C  CA   . ASN B 1 2   ? 62.959  47.462  24.097  1.00 3.46  ? 34  ASN B CA   1 
ATOM   5450  C  C    . ASN B 1 2   ? 63.639  46.548  25.090  1.00 3.42  ? 34  ASN B C    1 
ATOM   5451  O  O    . ASN B 1 2   ? 64.704  46.013  24.819  1.00 6.32  ? 34  ASN B O    1 
ATOM   5452  C  CB   . ASN B 1 2   ? 62.798  46.766  22.741  1.00 2.55  ? 34  ASN B CB   1 
ATOM   5453  C  CG   . ASN B 1 2   ? 62.271  45.368  22.860  1.00 2.87  ? 34  ASN B CG   1 
ATOM   5454  O  OD1  . ASN B 1 2   ? 61.776  44.962  23.904  1.00 5.27  ? 34  ASN B OD1  1 
ATOM   5455  N  ND2  . ASN B 1 2   ? 62.392  44.608  21.792  1.00 3.25  ? 34  ASN B ND2  1 
ATOM   5456  H  H    . ASN B 1 2   ? 63.524  49.193  23.089  1.00 17.00 ? 34  ASN B H    1 
ATOM   5457  H  HD21 . ASN B 1 2   ? 62.081  43.681  21.791  1.00 17.00 ? 34  ASN B HD21 1 
ATOM   5458  H  HD22 . ASN B 1 2   ? 62.802  45.063  21.060  1.00 17.00 ? 34  ASN B HD22 1 
ATOM   5459  N  N    . PRO B 1 3   ? 63.045  46.397  26.274  1.00 2.00  ? 35  PRO B N    1 
ATOM   5460  C  CA   . PRO B 1 3   ? 63.509  45.570  27.387  1.00 2.00  ? 35  PRO B CA   1 
ATOM   5461  C  C    . PRO B 1 3   ? 63.723  44.119  27.008  1.00 3.68  ? 35  PRO B C    1 
ATOM   5462  O  O    . PRO B 1 3   ? 64.361  43.374  27.745  1.00 6.14  ? 35  PRO B O    1 
ATOM   5463  C  CB   . PRO B 1 3   ? 62.409  45.730  28.420  1.00 2.00  ? 35  PRO B CB   1 
ATOM   5464  C  CG   . PRO B 1 3   ? 61.203  46.084  27.575  1.00 6.87  ? 35  PRO B CG   1 
ATOM   5465  C  CD   . PRO B 1 3   ? 61.775  47.054  26.603  1.00 3.82  ? 35  PRO B CD   1 
ATOM   5466  N  N    . CYS B 1 4   ? 63.178  43.684  25.878  1.00 3.14  ? 36  CYS B N    1 
ATOM   5467  C  CA   . CYS B 1 4   ? 63.399  42.311  25.463  1.00 4.60  ? 36  CYS B CA   1 
ATOM   5468  C  C    . CYS B 1 4   ? 64.595  42.189  24.551  1.00 5.45  ? 36  CYS B C    1 
ATOM   5469  O  O    . CYS B 1 4   ? 64.873  41.104  24.043  1.00 8.11  ? 36  CYS B O    1 
ATOM   5470  C  CB   . CYS B 1 4   ? 62.166  41.711  24.802  1.00 3.87  ? 36  CYS B CB   1 
ATOM   5471  S  SG   . CYS B 1 4   ? 60.871  41.274  26.003  1.00 6.33  ? 36  CYS B SG   1 
ATOM   5472  H  H    . CYS B 1 4   ? 62.602  44.274  25.368  1.00 17.00 ? 36  CYS B H    1 
ATOM   5473  N  N    . CYS B 1 5   ? 65.300  43.305  24.339  1.00 6.59  ? 37  CYS B N    1 
ATOM   5474  C  CA   . CYS B 1 5   ? 66.506  43.353  23.501  1.00 4.53  ? 37  CYS B CA   1 
ATOM   5475  C  C    . CYS B 1 5   ? 67.471  42.269  23.938  1.00 4.26  ? 37  CYS B C    1 
ATOM   5476  O  O    . CYS B 1 5   ? 67.914  41.419  23.137  1.00 2.00  ? 37  CYS B O    1 
ATOM   5477  C  CB   . CYS B 1 5   ? 67.199  44.697  23.655  1.00 2.00  ? 37  CYS B CB   1 
ATOM   5478  S  SG   . CYS B 1 5   ? 66.554  45.937  22.523  1.00 3.46  ? 37  CYS B SG   1 
ATOM   5479  H  H    . CYS B 1 5   ? 65.008  44.137  24.759  1.00 17.00 ? 37  CYS B H    1 
ATOM   5480  N  N    . SER B 1 6   ? 67.738  42.296  25.241  1.00 2.54  ? 38  SER B N    1 
ATOM   5481  C  CA   . SER B 1 6   ? 68.614  41.363  25.896  1.00 2.00  ? 38  SER B CA   1 
ATOM   5482  C  C    . SER B 1 6   ? 68.178  39.889  25.933  1.00 2.00  ? 38  SER B C    1 
ATOM   5483  O  O    . SER B 1 6   ? 68.765  39.120  26.670  1.00 5.57  ? 38  SER B O    1 
ATOM   5484  C  CB   . SER B 1 6   ? 68.894  41.879  27.296  1.00 2.00  ? 38  SER B CB   1 
ATOM   5485  O  OG   . SER B 1 6   ? 67.793  42.616  27.781  1.00 2.00  ? 38  SER B OG   1 
ATOM   5486  H  H    . SER B 1 6   ? 67.313  42.957  25.835  1.00 17.00 ? 38  SER B H    1 
ATOM   5487  H  HG   . SER B 1 6   ? 67.881  42.775  28.725  1.00 17.00 ? 38  SER B HG   1 
ATOM   5488  N  N    . ASN B 1 7   ? 67.151  39.497  25.179  1.00 2.00  ? 39  ASN B N    1 
ATOM   5489  C  CA   . ASN B 1 7   ? 66.686  38.093  25.123  1.00 3.28  ? 39  ASN B CA   1 
ATOM   5490  C  C    . ASN B 1 7   ? 66.628  37.374  26.486  1.00 3.33  ? 39  ASN B C    1 
ATOM   5491  O  O    . ASN B 1 7   ? 66.910  36.170  26.590  1.00 2.71  ? 39  ASN B O    1 
ATOM   5492  C  CB   . ASN B 1 7   ? 67.642  37.297  24.219  1.00 5.57  ? 39  ASN B CB   1 
ATOM   5493  C  CG   . ASN B 1 7   ? 67.704  37.835  22.798  1.00 8.31  ? 39  ASN B CG   1 
ATOM   5494  O  OD1  . ASN B 1 7   ? 67.529  37.063  21.848  1.00 12.06 ? 39  ASN B OD1  1 
ATOM   5495  N  ND2  . ASN B 1 7   ? 67.982  39.139  22.635  1.00 2.33  ? 39  ASN B ND2  1 
ATOM   5496  H  H    . ASN B 1 7   ? 66.644  40.139  24.638  1.00 17.00 ? 39  ASN B H    1 
ATOM   5497  H  HD21 . ASN B 1 7   ? 67.974  39.513  21.734  1.00 17.00 ? 39  ASN B HD21 1 
ATOM   5498  H  HD22 . ASN B 1 7   ? 68.175  39.650  23.429  1.00 17.00 ? 39  ASN B HD22 1 
ATOM   5499  N  N    . PRO B 1 8   ? 66.213  38.088  27.537  1.00 2.86  ? 40  PRO B N    1 
ATOM   5500  C  CA   . PRO B 1 8   ? 66.128  37.555  28.903  1.00 2.53  ? 40  PRO B CA   1 
ATOM   5501  C  C    . PRO B 1 8   ? 65.543  36.178  29.117  1.00 3.68  ? 40  PRO B C    1 
ATOM   5502  O  O    . PRO B 1 8   ? 66.128  35.352  29.800  1.00 2.00  ? 40  PRO B O    1 
ATOM   5503  C  CB   . PRO B 1 8   ? 65.283  38.593  29.608  1.00 2.00  ? 40  PRO B CB   1 
ATOM   5504  C  CG   . PRO B 1 8   ? 65.578  39.841  28.864  1.00 3.15  ? 40  PRO B CG   1 
ATOM   5505  C  CD   . PRO B 1 8   ? 65.530  39.388  27.454  1.00 2.99  ? 40  PRO B CD   1 
ATOM   5506  N  N    . CYS B 1 9   ? 64.353  35.960  28.580  1.00 7.08  ? 41  CYS B N    1 
ATOM   5507  C  CA   . CYS B 1 9   ? 63.640  34.697  28.742  1.00 7.14  ? 41  CYS B CA   1 
ATOM   5508  C  C    . CYS B 1 9   ? 64.317  33.493  28.127  1.00 6.68  ? 41  CYS B C    1 
ATOM   5509  O  O    . CYS B 1 9   ? 64.519  33.421  26.914  1.00 10.27 ? 41  CYS B O    1 
ATOM   5510  C  CB   . CYS B 1 9   ? 62.247  34.831  28.170  1.00 7.36  ? 41  CYS B CB   1 
ATOM   5511  S  SG   . CYS B 1 9   ? 61.539  36.373  28.733  1.00 7.93  ? 41  CYS B SG   1 
ATOM   5512  H  H    . CYS B 1 9   ? 63.932  36.659  28.050  1.00 17.00 ? 41  CYS B H    1 
ATOM   5513  N  N    . GLN B 1 10  ? 64.681  32.546  28.966  1.00 3.95  ? 42  GLN B N    1 
ATOM   5514  C  CA   . GLN B 1 10  ? 65.330  31.336  28.487  1.00 5.61  ? 42  GLN B CA   1 
ATOM   5515  C  C    . GLN B 1 10  ? 64.320  30.230  28.353  1.00 3.33  ? 42  GLN B C    1 
ATOM   5516  O  O    . GLN B 1 10  ? 63.135  30.429  28.573  1.00 2.00  ? 42  GLN B O    1 
ATOM   5517  C  CB   . GLN B 1 10  ? 66.449  30.880  29.450  1.00 8.47  ? 42  GLN B CB   1 
ATOM   5518  C  CG   . GLN B 1 10  ? 67.510  31.933  29.714  1.00 12.81 ? 42  GLN B CG   1 
ATOM   5519  C  CD   . GLN B 1 10  ? 68.126  32.438  28.428  1.00 17.55 ? 42  GLN B CD   1 
ATOM   5520  O  OE1  . GLN B 1 10  ? 68.842  31.696  27.758  1.00 18.40 ? 42  GLN B OE1  1 
ATOM   5521  N  NE2  . GLN B 1 10  ? 67.826  33.691  28.053  1.00 21.17 ? 42  GLN B NE2  1 
ATOM   5522  H  H    . GLN B 1 10  ? 64.556  32.711  29.898  1.00 17.00 ? 42  GLN B H    1 
ATOM   5523  H  HE21 . GLN B 1 10  ? 68.181  34.034  27.207  1.00 17.00 ? 42  GLN B HE21 1 
ATOM   5524  H  HE22 . GLN B 1 10  ? 67.246  34.225  28.631  1.00 17.00 ? 42  GLN B HE22 1 
ATOM   5525  N  N    . ASN B 1 11  ? 64.809  29.069  27.949  1.00 3.63  ? 43  ASN B N    1 
ATOM   5526  C  CA   . ASN B 1 11  ? 63.990  27.863  27.800  1.00 4.67  ? 43  ASN B CA   1 
ATOM   5527  C  C    . ASN B 1 11  ? 62.729  27.927  26.922  1.00 4.14  ? 43  ASN B C    1 
ATOM   5528  O  O    . ASN B 1 11  ? 61.852  27.039  27.012  1.00 2.00  ? 43  ASN B O    1 
ATOM   5529  C  CB   . ASN B 1 11  ? 63.649  27.301  29.177  1.00 4.34  ? 43  ASN B CB   1 
ATOM   5530  C  CG   . ASN B 1 11  ? 64.841  26.685  29.859  1.00 7.42  ? 43  ASN B CG   1 
ATOM   5531  O  OD1  . ASN B 1 11  ? 65.607  25.914  29.259  1.00 6.50  ? 43  ASN B OD1  1 
ATOM   5532  N  ND2  . ASN B 1 11  ? 64.981  26.971  31.142  1.00 9.63  ? 43  ASN B ND2  1 
ATOM   5533  H  H    . ASN B 1 11  ? 65.763  29.008  27.748  1.00 17.00 ? 43  ASN B H    1 
ATOM   5534  H  HD21 . ASN B 1 11  ? 65.739  26.575  31.617  1.00 17.00 ? 43  ASN B HD21 1 
ATOM   5535  H  HD22 . ASN B 1 11  ? 64.316  27.553  31.542  1.00 17.00 ? 43  ASN B HD22 1 
ATOM   5536  N  N    . ARG B 1 12  ? 62.687  28.942  26.052  1.00 3.58  ? 44  ARG B N    1 
ATOM   5537  C  CA   . ARG B 1 12  ? 61.596  29.200  25.111  1.00 3.52  ? 44  ARG B CA   1 
ATOM   5538  C  C    . ARG B 1 12  ? 60.548  30.211  25.560  1.00 3.81  ? 44  ARG B C    1 
ATOM   5539  O  O    . ARG B 1 12  ? 59.749  30.662  24.743  1.00 5.62  ? 44  ARG B O    1 
ATOM   5540  C  CB   . ARG B 1 12  ? 60.897  27.911  24.678  1.00 4.03  ? 44  ARG B CB   1 
ATOM   5541  C  CG   . ARG B 1 12  ? 61.806  26.932  24.026  1.00 4.24  ? 44  ARG B CG   1 
ATOM   5542  C  CD   . ARG B 1 12  ? 62.264  27.457  22.724  1.00 2.44  ? 44  ARG B CD   1 
ATOM   5543  N  NE   . ARG B 1 12  ? 61.347  27.031  21.687  1.00 5.38  ? 44  ARG B NE   1 
ATOM   5544  C  CZ   . ARG B 1 12  ? 61.062  27.758  20.618  1.00 8.80  ? 44  ARG B CZ   1 
ATOM   5545  N  NH1  . ARG B 1 12  ? 61.618  28.945  20.453  1.00 8.29  ? 44  ARG B NH1  1 
ATOM   5546  N  NH2  . ARG B 1 12  ? 60.241  27.283  19.693  1.00 14.29 ? 44  ARG B NH2  1 
ATOM   5547  H  H    . ARG B 1 12  ? 63.427  29.578  26.048  1.00 17.00 ? 44  ARG B H    1 
ATOM   5548  H  HE   . ARG B 1 12  ? 60.906  26.161  21.776  1.00 17.00 ? 44  ARG B HE   1 
ATOM   5549  H  HH11 . ARG B 1 12  ? 62.267  29.292  21.129  1.00 17.00 ? 44  ARG B HH11 1 
ATOM   5550  H  HH12 . ARG B 1 12  ? 61.402  29.485  19.640  1.00 17.00 ? 44  ARG B HH12 1 
ATOM   5551  H  HH21 . ARG B 1 12  ? 59.832  26.375  19.787  1.00 17.00 ? 44  ARG B HH21 1 
ATOM   5552  H  HH22 . ARG B 1 12  ? 60.032  27.840  18.890  1.00 17.00 ? 44  ARG B HH22 1 
ATOM   5553  N  N    . GLY B 1 13  ? 60.541  30.575  26.834  1.00 3.50  ? 45  GLY B N    1 
ATOM   5554  C  CA   . GLY B 1 13  ? 59.557  31.537  27.294  1.00 4.26  ? 45  GLY B CA   1 
ATOM   5555  C  C    . GLY B 1 13  ? 59.557  32.785  26.432  1.00 2.45  ? 45  GLY B C    1 
ATOM   5556  O  O    . GLY B 1 13  ? 60.631  33.306  26.148  1.00 2.00  ? 45  GLY B O    1 
ATOM   5557  H  H    . GLY B 1 13  ? 61.212  30.235  27.459  1.00 17.00 ? 45  GLY B H    1 
ATOM   5558  N  N    . GLU B 1 14  ? 58.381  33.213  25.964  1.00 2.72  ? 46  GLU B N    1 
ATOM   5559  C  CA   . GLU B 1 14  ? 58.293  34.420  25.150  1.00 5.44  ? 46  GLU B CA   1 
ATOM   5560  C  C    . GLU B 1 14  ? 58.425  35.661  26.022  1.00 5.22  ? 46  GLU B C    1 
ATOM   5561  O  O    . GLU B 1 14  ? 57.759  35.778  27.054  1.00 2.33  ? 46  GLU B O    1 
ATOM   5562  C  CB   . GLU B 1 14  ? 56.980  34.491  24.388  1.00 8.48  ? 46  GLU B CB   1 
ATOM   5563  C  CG   . GLU B 1 14  ? 57.079  34.055  22.932  1.00 14.38 ? 46  GLU B CG   1 
ATOM   5564  C  CD   . GLU B 1 14  ? 56.553  32.637  22.664  1.00 16.54 ? 46  GLU B CD   1 
ATOM   5565  O  OE1  . GLU B 1 14  ? 55.891  32.051  23.565  1.00 20.33 ? 46  GLU B OE1  1 
ATOM   5566  O  OE2  . GLU B 1 14  ? 56.793  32.129  21.533  1.00 15.26 ? 46  GLU B OE2  1 
ATOM   5567  H  H    . GLU B 1 14  ? 57.571  32.693  26.176  1.00 17.00 ? 46  GLU B H    1 
ATOM   5568  N  N    . CYS B 1 15  ? 59.264  36.593  25.581  1.00 4.33  ? 47  CYS B N    1 
ATOM   5569  C  CA   . CYS B 1 15  ? 59.530  37.817  26.334  1.00 5.16  ? 47  CYS B CA   1 
ATOM   5570  C  C    . CYS B 1 15  ? 58.579  38.939  25.968  1.00 5.07  ? 47  CYS B C    1 
ATOM   5571  O  O    . CYS B 1 15  ? 58.270  39.101  24.800  1.00 8.08  ? 47  CYS B O    1 
ATOM   5572  C  CB   . CYS B 1 15  ? 60.995  38.262  26.101  1.00 2.09  ? 47  CYS B CB   1 
ATOM   5573  S  SG   . CYS B 1 15  ? 61.553  39.688  27.073  1.00 2.04  ? 47  CYS B SG   1 
ATOM   5574  H  H    . CYS B 1 15  ? 59.704  36.468  24.718  1.00 17.00 ? 47  CYS B H    1 
ATOM   5575  N  N    . MET B 1 16  ? 58.070  39.679  26.950  1.00 5.58  ? 48  MET B N    1 
ATOM   5576  C  CA   . MET B 1 16  ? 57.236  40.815  26.603  1.00 8.88  ? 48  MET B CA   1 
ATOM   5577  C  C    . MET B 1 16  ? 57.346  42.134  27.328  1.00 5.32  ? 48  MET B C    1 
ATOM   5578  O  O    . MET B 1 16  ? 57.271  42.207  28.549  1.00 2.00  ? 48  MET B O    1 
ATOM   5579  C  CB   . MET B 1 16  ? 55.792  40.452  26.378  1.00 18.95 ? 48  MET B CB   1 
ATOM   5580  C  CG   . MET B 1 16  ? 55.335  41.235  25.148  1.00 27.63 ? 48  MET B CG   1 
ATOM   5581  S  SD   . MET B 1 16  ? 56.900  41.672  24.161  1.00 30.88 ? 48  MET B SD   1 
ATOM   5582  C  CE   . MET B 1 16  ? 56.287  42.990  23.171  1.00 35.00 ? 48  MET B CE   1 
ATOM   5583  H  H    . MET B 1 16  ? 58.257  39.465  27.882  1.00 17.00 ? 48  MET B H    1 
ATOM   5584  N  N    . SER B 1 17  ? 57.450  43.181  26.525  1.00 3.08  ? 49  SER B N    1 
ATOM   5585  C  CA   . SER B 1 17  ? 57.630  44.540  27.015  1.00 5.30  ? 49  SER B CA   1 
ATOM   5586  C  C    . SER B 1 17  ? 56.534  45.121  27.911  1.00 3.39  ? 49  SER B C    1 
ATOM   5587  O  O    . SER B 1 17  ? 55.639  45.830  27.438  1.00 2.00  ? 49  SER B O    1 
ATOM   5588  C  CB   . SER B 1 17  ? 57.933  45.487  25.838  1.00 6.59  ? 49  SER B CB   1 
ATOM   5589  O  OG   . SER B 1 17  ? 57.394  44.991  24.617  1.00 7.75  ? 49  SER B OG   1 
ATOM   5590  H  H    . SER B 1 17  ? 57.426  43.091  25.552  1.00 17.00 ? 49  SER B H    1 
ATOM   5591  H  HG   . SER B 1 17  ? 57.665  45.581  23.896  1.00 17.00 ? 49  SER B HG   1 
ATOM   5592  N  N    . THR B 1 18  ? 56.666  44.885  29.213  1.00 2.33  ? 50  THR B N    1 
ATOM   5593  C  CA   . THR B 1 18  ? 55.700  45.380  30.164  1.00 2.30  ? 50  THR B CA   1 
ATOM   5594  C  C    . THR B 1 18  ? 55.912  46.799  30.713  1.00 2.00  ? 50  THR B C    1 
ATOM   5595  O  O    . THR B 1 18  ? 55.681  47.057  31.888  1.00 2.91  ? 50  THR B O    1 
ATOM   5596  C  CB   . THR B 1 18  ? 55.424  44.349  31.302  1.00 2.00  ? 50  THR B CB   1 
ATOM   5597  O  OG1  . THR B 1 18  ? 56.502  44.296  32.227  1.00 2.01  ? 50  THR B OG1  1 
ATOM   5598  C  CG2  . THR B 1 18  ? 55.274  42.996  30.726  1.00 3.40  ? 50  THR B CG2  1 
ATOM   5599  H  H    . THR B 1 18  ? 57.415  44.342  29.543  1.00 17.00 ? 50  THR B H    1 
ATOM   5600  H  HG1  . THR B 1 18  ? 56.471  45.145  32.689  1.00 17.00 ? 50  THR B HG1  1 
ATOM   5601  N  N    . GLY B 1 19  ? 56.356  47.725  29.880  1.00 2.00  ? 51  GLY B N    1 
ATOM   5602  C  CA   . GLY B 1 19  ? 56.498  49.071  30.387  1.00 5.01  ? 51  GLY B CA   1 
ATOM   5603  C  C    . GLY B 1 19  ? 57.755  49.889  30.100  1.00 9.60  ? 51  GLY B C    1 
ATOM   5604  O  O    . GLY B 1 19  ? 58.243  50.612  30.995  1.00 13.16 ? 51  GLY B O    1 
ATOM   5605  H  H    . GLY B 1 19  ? 56.547  47.481  28.955  1.00 17.00 ? 51  GLY B H    1 
ATOM   5606  N  N    . PHE B 1 20  ? 58.265  49.824  28.866  1.00 9.72  ? 52  PHE B N    1 
ATOM   5607  C  CA   . PHE B 1 20  ? 59.451  50.577  28.421  1.00 8.61  ? 52  PHE B CA   1 
ATOM   5608  C  C    . PHE B 1 20  ? 60.681  49.931  28.963  1.00 8.78  ? 52  PHE B C    1 
ATOM   5609  O  O    . PHE B 1 20  ? 61.504  49.412  28.232  1.00 6.65  ? 52  PHE B O    1 
ATOM   5610  C  CB   . PHE B 1 20  ? 59.474  52.025  28.937  1.00 9.80  ? 52  PHE B CB   1 
ATOM   5611  C  CG   . PHE B 1 20  ? 58.518  52.954  28.250  1.00 12.23 ? 52  PHE B CG   1 
ATOM   5612  C  CD1  . PHE B 1 20  ? 58.796  53.447  26.981  1.00 13.44 ? 52  PHE B CD1  1 
ATOM   5613  C  CD2  . PHE B 1 20  ? 57.358  53.395  28.901  1.00 12.32 ? 52  PHE B CD2  1 
ATOM   5614  C  CE1  . PHE B 1 20  ? 57.921  54.385  26.362  1.00 14.75 ? 52  PHE B CE1  1 
ATOM   5615  C  CE2  . PHE B 1 20  ? 56.497  54.318  28.288  1.00 12.08 ? 52  PHE B CE2  1 
ATOM   5616  C  CZ   . PHE B 1 20  ? 56.783  54.812  27.017  1.00 11.51 ? 52  PHE B CZ   1 
ATOM   5617  H  H    . PHE B 1 20  ? 57.860  49.210  28.230  1.00 17.00 ? 52  PHE B H    1 
ATOM   5618  N  N    . ASP B 1 21  ? 60.778  50.011  30.277  1.00 9.39  ? 53  ASP B N    1 
ATOM   5619  C  CA   . ASP B 1 21  ? 61.889  49.506  31.057  1.00 12.17 ? 53  ASP B CA   1 
ATOM   5620  C  C    . ASP B 1 21  ? 61.740  48.073  31.542  1.00 13.31 ? 53  ASP B C    1 
ATOM   5621  O  O    . ASP B 1 21  ? 62.721  47.461  31.971  1.00 15.56 ? 53  ASP B O    1 
ATOM   5622  C  CB   . ASP B 1 21  ? 62.025  50.401  32.278  1.00 11.51 ? 53  ASP B CB   1 
ATOM   5623  C  CG   . ASP B 1 21  ? 60.684  50.680  32.928  1.00 5.46  ? 53  ASP B CG   1 
ATOM   5624  O  OD1  . ASP B 1 21  ? 60.080  49.748  33.470  1.00 2.00  ? 53  ASP B OD1  1 
ATOM   5625  O  OD2  . ASP B 1 21  ? 60.218  51.822  32.853  1.00 2.03  ? 53  ASP B OD2  1 
ATOM   5626  H  H    . ASP B 1 21  ? 60.062  50.450  30.765  1.00 17.00 ? 53  ASP B H    1 
ATOM   5627  N  N    . GLN B 1 22  ? 60.528  47.532  31.472  1.00 13.36 ? 54  GLN B N    1 
ATOM   5628  C  CA   . GLN B 1 22  ? 60.276  46.180  31.973  1.00 12.03 ? 54  GLN B CA   1 
ATOM   5629  C  C    . GLN B 1 22  ? 59.959  45.104  30.934  1.00 10.30 ? 54  GLN B C    1 
ATOM   5630  O  O    . GLN B 1 22  ? 59.728  45.410  29.763  1.00 6.43  ? 54  GLN B O    1 
ATOM   5631  C  CB   . GLN B 1 22  ? 59.117  46.250  32.964  1.00 14.21 ? 54  GLN B CB   1 
ATOM   5632  C  CG   . GLN B 1 22  ? 59.367  45.534  34.260  1.00 19.25 ? 54  GLN B CG   1 
ATOM   5633  C  CD   . GLN B 1 22  ? 60.071  46.403  35.307  1.00 24.67 ? 54  GLN B CD   1 
ATOM   5634  O  OE1  . GLN B 1 22  ? 60.684  47.444  34.997  1.00 24.62 ? 54  GLN B OE1  1 
ATOM   5635  N  NE2  . GLN B 1 22  ? 59.985  45.969  36.567  1.00 24.81 ? 54  GLN B NE2  1 
ATOM   5636  H  H    . GLN B 1 22  ? 59.807  48.047  31.076  1.00 17.00 ? 54  GLN B H    1 
ATOM   5637  H  HE21 . GLN B 1 22  ? 60.414  46.514  37.256  1.00 17.00 ? 54  GLN B HE21 1 
ATOM   5638  H  HE22 . GLN B 1 22  ? 59.500  45.136  36.736  1.00 17.00 ? 54  GLN B HE22 1 
ATOM   5639  N  N    . TYR B 1 23  ? 59.904  43.848  31.394  1.00 8.77  ? 55  TYR B N    1 
ATOM   5640  C  CA   . TYR B 1 23  ? 59.551  42.694  30.547  1.00 7.71  ? 55  TYR B CA   1 
ATOM   5641  C  C    . TYR B 1 23  ? 59.097  41.535  31.435  1.00 8.47  ? 55  TYR B C    1 
ATOM   5642  O  O    . TYR B 1 23  ? 59.351  41.509  32.651  1.00 6.82  ? 55  TYR B O    1 
ATOM   5643  C  CB   . TYR B 1 23  ? 60.713  42.218  29.646  1.00 4.49  ? 55  TYR B CB   1 
ATOM   5644  C  CG   . TYR B 1 23  ? 61.722  41.348  30.351  1.00 5.89  ? 55  TYR B CG   1 
ATOM   5645  C  CD1  . TYR B 1 23  ? 62.744  41.920  31.124  1.00 5.81  ? 55  TYR B CD1  1 
ATOM   5646  C  CD2  . TYR B 1 23  ? 61.614  39.940  30.318  1.00 7.05  ? 55  TYR B CD2  1 
ATOM   5647  C  CE1  . TYR B 1 23  ? 63.633  41.118  31.861  1.00 7.97  ? 55  TYR B CE1  1 
ATOM   5648  C  CE2  . TYR B 1 23  ? 62.498  39.110  31.061  1.00 6.43  ? 55  TYR B CE2  1 
ATOM   5649  C  CZ   . TYR B 1 23  ? 63.509  39.711  31.835  1.00 9.24  ? 55  TYR B CZ   1 
ATOM   5650  O  OH   . TYR B 1 23  ? 64.390  38.949  32.599  1.00 7.95  ? 55  TYR B OH   1 
ATOM   5651  H  H    . TYR B 1 23  ? 60.086  43.654  32.338  1.00 17.00 ? 55  TYR B H    1 
ATOM   5652  H  HH   . TYR B 1 23  ? 64.090  38.032  32.547  1.00 17.00 ? 55  TYR B HH   1 
ATOM   5653  N  N    . LYS B 1 24  ? 58.407  40.586  30.817  1.00 10.70 ? 56  LYS B N    1 
ATOM   5654  C  CA   . LYS B 1 24  ? 57.927  39.392  31.510  1.00 11.70 ? 56  LYS B CA   1 
ATOM   5655  C  C    . LYS B 1 24  ? 58.143  38.200  30.579  1.00 11.49 ? 56  LYS B C    1 
ATOM   5656  O  O    . LYS B 1 24  ? 58.058  38.372  29.352  1.00 12.60 ? 56  LYS B O    1 
ATOM   5657  C  CB   . LYS B 1 24  ? 56.457  39.524  31.879  1.00 7.37  ? 56  LYS B CB   1 
ATOM   5658  C  CG   . LYS B 1 24  ? 56.220  40.335  33.098  1.00 7.20  ? 56  LYS B CG   1 
ATOM   5659  C  CD   . LYS B 1 24  ? 54.787  40.176  33.545  1.00 11.15 ? 56  LYS B CD   1 
ATOM   5660  C  CE   . LYS B 1 24  ? 54.500  40.927  34.842  1.00 12.08 ? 56  LYS B CE   1 
ATOM   5661  N  NZ   . LYS B 1 24  ? 55.223  40.360  36.020  1.00 10.68 ? 56  LYS B NZ   1 
ATOM   5662  H  H    . LYS B 1 24  ? 58.192  40.692  29.864  1.00 17.00 ? 56  LYS B H    1 
ATOM   5663  H  HZ1  . LYS B 1 24  ? 54.942  39.368  36.154  1.00 17.00 ? 56  LYS B HZ1  1 
ATOM   5664  H  HZ2  . LYS B 1 24  ? 56.246  40.414  35.846  1.00 17.00 ? 56  LYS B HZ2  1 
ATOM   5665  H  HZ3  . LYS B 1 24  ? 54.981  40.915  36.866  1.00 17.00 ? 56  LYS B HZ3  1 
ATOM   5666  N  N    . CYS B 1 25  ? 58.439  37.024  31.151  1.00 10.72 ? 57  CYS B N    1 
ATOM   5667  C  CA   . CYS B 1 25  ? 58.703  35.823  30.359  1.00 10.36 ? 57  CYS B CA   1 
ATOM   5668  C  C    . CYS B 1 25  ? 57.535  34.892  30.385  1.00 9.99  ? 57  CYS B C    1 
ATOM   5669  O  O    . CYS B 1 25  ? 57.105  34.460  31.469  1.00 12.30 ? 57  CYS B O    1 
ATOM   5670  C  CB   . CYS B 1 25  ? 59.933  35.095  30.885  1.00 10.08 ? 57  CYS B CB   1 
ATOM   5671  S  SG   . CYS B 1 25  ? 61.425  36.105  30.724  1.00 12.82 ? 57  CYS B SG   1 
ATOM   5672  H  H    . CYS B 1 25  ? 58.478  36.933  32.126  1.00 17.00 ? 57  CYS B H    1 
ATOM   5673  N  N    . ASP B 1 26  ? 57.052  34.537  29.203  1.00 4.68  ? 58  ASP B N    1 
ATOM   5674  C  CA   . ASP B 1 26  ? 55.910  33.651  29.123  1.00 4.54  ? 58  ASP B CA   1 
ATOM   5675  C  C    . ASP B 1 26  ? 56.396  32.215  29.141  1.00 2.79  ? 58  ASP B C    1 
ATOM   5676  O  O    . ASP B 1 26  ? 56.466  31.557  28.107  1.00 2.44  ? 58  ASP B O    1 
ATOM   5677  C  CB   . ASP B 1 26  ? 55.089  33.966  27.868  1.00 6.95  ? 58  ASP B CB   1 
ATOM   5678  C  CG   . ASP B 1 26  ? 53.623  33.642  28.035  1.00 4.52  ? 58  ASP B CG   1 
ATOM   5679  O  OD1  . ASP B 1 26  ? 53.145  33.738  29.189  1.00 3.51  ? 58  ASP B OD1  1 
ATOM   5680  O  OD2  . ASP B 1 26  ? 52.977  33.283  27.020  1.00 2.00  ? 58  ASP B OD2  1 
ATOM   5681  H  H    . ASP B 1 26  ? 57.519  34.798  28.417  1.00 17.00 ? 58  ASP B H    1 
ATOM   5682  N  N    . CYS B 1 27  ? 56.748  31.750  30.329  1.00 2.00  ? 59  CYS B N    1 
ATOM   5683  C  CA   . CYS B 1 27  ? 57.245  30.394  30.517  1.00 5.78  ? 59  CYS B CA   1 
ATOM   5684  C  C    . CYS B 1 27  ? 56.172  29.339  30.297  1.00 6.76  ? 59  CYS B C    1 
ATOM   5685  O  O    . CYS B 1 27  ? 56.409  28.137  30.492  1.00 4.82  ? 59  CYS B O    1 
ATOM   5686  C  CB   . CYS B 1 27  ? 57.806  30.230  31.919  1.00 7.85  ? 59  CYS B CB   1 
ATOM   5687  S  SG   . CYS B 1 27  ? 58.904  31.601  32.381  1.00 14.23 ? 59  CYS B SG   1 
ATOM   5688  H  H    . CYS B 1 27  ? 56.702  32.358  31.100  1.00 17.00 ? 59  CYS B H    1 
ATOM   5689  N  N    . THR B 1 28  ? 54.979  29.783  29.910  1.00 7.10  ? 60  THR B N    1 
ATOM   5690  C  CA   . THR B 1 28  ? 53.883  28.858  29.695  1.00 4.22  ? 60  THR B CA   1 
ATOM   5691  C  C    . THR B 1 28  ? 54.293  27.778  28.734  1.00 3.94  ? 60  THR B C    1 
ATOM   5692  O  O    . THR B 1 28  ? 54.954  28.045  27.717  1.00 2.41  ? 60  THR B O    1 
ATOM   5693  C  CB   . THR B 1 28  ? 52.599  29.579  29.184  1.00 4.36  ? 60  THR B CB   1 
ATOM   5694  O  OG1  . THR B 1 28  ? 52.934  30.587  28.217  1.00 3.04  ? 60  THR B OG1  1 
ATOM   5695  C  CG2  . THR B 1 28  ? 51.873  30.235  30.340  1.00 5.18  ? 60  THR B CG2  1 
ATOM   5696  H  H    . THR B 1 28  ? 54.786  30.717  29.720  1.00 17.00 ? 60  THR B H    1 
ATOM   5697  H  HG1  . THR B 1 28  ? 53.458  30.185  27.506  1.00 17.00 ? 60  THR B HG1  1 
ATOM   5698  N  N    . ARG B 1 29  ? 53.988  26.547  29.120  1.00 4.68  ? 61  ARG B N    1 
ATOM   5699  C  CA   . ARG B 1 29  ? 54.257  25.390  28.278  1.00 6.74  ? 61  ARG B CA   1 
ATOM   5700  C  C    . ARG B 1 29  ? 55.748  25.210  27.994  1.00 7.92  ? 61  ARG B C    1 
ATOM   5701  O  O    . ARG B 1 29  ? 56.136  24.910  26.856  1.00 7.23  ? 61  ARG B O    1 
ATOM   5702  C  CB   . ARG B 1 29  ? 53.475  25.516  26.960  1.00 10.49 ? 61  ARG B CB   1 
ATOM   5703  C  CG   . ARG B 1 29  ? 52.885  24.238  26.378  1.00 11.70 ? 61  ARG B CG   1 
ATOM   5704  C  CD   . ARG B 1 29  ? 51.551  24.539  25.665  1.00 9.20  ? 61  ARG B CD   1 
ATOM   5705  N  NE   . ARG B 1 29  ? 50.635  25.158  26.613  1.00 10.13 ? 61  ARG B NE   1 
ATOM   5706  C  CZ   . ARG B 1 29  ? 49.809  26.144  26.324  1.00 8.36  ? 61  ARG B CZ   1 
ATOM   5707  N  NH1  . ARG B 1 29  ? 49.764  26.608  25.090  1.00 10.72 ? 61  ARG B NH1  1 
ATOM   5708  N  NH2  . ARG B 1 29  ? 49.134  26.745  27.293  1.00 6.56  ? 61  ARG B NH2  1 
ATOM   5709  H  H    . ARG B 1 29  ? 53.595  26.401  30.002  1.00 17.00 ? 61  ARG B H    1 
ATOM   5710  H  HE   . ARG B 1 29  ? 50.629  24.818  27.532  1.00 17.00 ? 61  ARG B HE   1 
ATOM   5711  H  HH11 . ARG B 1 29  ? 50.346  26.216  24.379  1.00 17.00 ? 61  ARG B HH11 1 
ATOM   5712  H  HH12 . ARG B 1 29  ? 49.138  27.353  24.861  1.00 17.00 ? 61  ARG B HH12 1 
ATOM   5713  H  HH21 . ARG B 1 29  ? 49.256  26.452  28.241  1.00 17.00 ? 61  ARG B HH21 1 
ATOM   5714  H  HH22 . ARG B 1 29  ? 48.504  27.492  27.078  1.00 17.00 ? 61  ARG B HH22 1 
ATOM   5715  N  N    . THR B 1 30  ? 56.584  25.573  28.969  1.00 9.44  ? 62  THR B N    1 
ATOM   5716  C  CA   . THR B 1 30  ? 58.033  25.324  28.869  1.00 10.28 ? 62  THR B CA   1 
ATOM   5717  C  C    . THR B 1 30  ? 58.151  24.299  30.001  1.00 9.10  ? 62  THR B C    1 
ATOM   5718  O  O    . THR B 1 30  ? 57.129  23.886  30.568  1.00 11.23 ? 62  THR B O    1 
ATOM   5719  C  CB   . THR B 1 30  ? 58.974  26.556  29.244  1.00 10.32 ? 62  THR B CB   1 
ATOM   5720  O  OG1  . THR B 1 30  ? 58.803  26.897  30.626  1.00 9.97  ? 62  THR B OG1  1 
ATOM   5721  C  CG2  . THR B 1 30  ? 58.750  27.790  28.345  1.00 7.20  ? 62  THR B CG2  1 
ATOM   5722  H  H    . THR B 1 30  ? 56.247  26.001  29.780  1.00 17.00 ? 62  THR B H    1 
ATOM   5723  H  HG1  . THR B 1 30  ? 57.900  27.156  30.835  1.00 17.00 ? 62  THR B HG1  1 
ATOM   5724  N  N    . GLY B 1 31  ? 59.366  23.877  30.330  1.00 8.03  ? 63  GLY B N    1 
ATOM   5725  C  CA   . GLY B 1 31  ? 59.528  22.947  31.438  1.00 5.71  ? 63  GLY B CA   1 
ATOM   5726  C  C    . GLY B 1 31  ? 60.121  23.719  32.613  1.00 3.48  ? 63  GLY B C    1 
ATOM   5727  O  O    . GLY B 1 31  ? 60.476  23.160  33.663  1.00 2.00  ? 63  GLY B O    1 
ATOM   5728  H  H    . GLY B 1 31  ? 60.144  24.193  29.831  1.00 17.00 ? 63  GLY B H    1 
ATOM   5729  N  N    . PHE B 1 32  ? 60.183  25.033  32.443  1.00 3.20  ? 64  PHE B N    1 
ATOM   5730  C  CA   . PHE B 1 32  ? 60.770  25.882  33.448  1.00 5.02  ? 64  PHE B CA   1 
ATOM   5731  C  C    . PHE B 1 32  ? 59.913  27.059  33.834  1.00 4.79  ? 64  PHE B C    1 
ATOM   5732  O  O    . PHE B 1 32  ? 59.063  27.492  33.074  1.00 5.24  ? 64  PHE B O    1 
ATOM   5733  C  CB   . PHE B 1 32  ? 62.122  26.400  32.956  1.00 6.71  ? 64  PHE B CB   1 
ATOM   5734  C  CG   . PHE B 1 32  ? 63.067  25.316  32.493  1.00 6.62  ? 64  PHE B CG   1 
ATOM   5735  C  CD1  . PHE B 1 32  ? 62.929  24.751  31.227  1.00 5.90  ? 64  PHE B CD1  1 
ATOM   5736  C  CD2  . PHE B 1 32  ? 64.097  24.879  33.306  1.00 3.06  ? 64  PHE B CD2  1 
ATOM   5737  C  CE1  . PHE B 1 32  ? 63.798  23.777  30.784  1.00 3.84  ? 64  PHE B CE1  1 
ATOM   5738  C  CE2  . PHE B 1 32  ? 64.962  23.910  32.867  1.00 6.82  ? 64  PHE B CE2  1 
ATOM   5739  C  CZ   . PHE B 1 32  ? 64.807  23.359  31.595  1.00 4.62  ? 64  PHE B CZ   1 
ATOM   5740  H  H    . PHE B 1 32  ? 59.776  25.487  31.678  1.00 17.00 ? 64  PHE B H    1 
ATOM   5741  N  N    . TYR B 1 33  ? 60.192  27.600  35.012  1.00 5.04  ? 65  TYR B N    1 
ATOM   5742  C  CA   . TYR B 1 33  ? 59.479  28.744  35.561  1.00 3.85  ? 65  TYR B CA   1 
ATOM   5743  C  C    . TYR B 1 33  ? 60.498  29.696  36.183  1.00 2.13  ? 65  TYR B C    1 
ATOM   5744  O  O    . TYR B 1 33  ? 61.703  29.491  36.058  1.00 2.00  ? 65  TYR B O    1 
ATOM   5745  C  CB   . TYR B 1 33  ? 58.430  28.286  36.595  1.00 2.98  ? 65  TYR B CB   1 
ATOM   5746  C  CG   . TYR B 1 33  ? 58.962  27.392  37.680  1.00 2.00  ? 65  TYR B CG   1 
ATOM   5747  C  CD1  . TYR B 1 33  ? 59.402  26.113  37.380  1.00 3.02  ? 65  TYR B CD1  1 
ATOM   5748  C  CD2  . TYR B 1 33  ? 59.032  27.825  39.010  1.00 2.00  ? 65  TYR B CD2  1 
ATOM   5749  C  CE1  . TYR B 1 33  ? 59.916  25.258  38.379  1.00 6.16  ? 65  TYR B CE1  1 
ATOM   5750  C  CE2  . TYR B 1 33  ? 59.534  26.974  40.028  1.00 4.58  ? 65  TYR B CE2  1 
ATOM   5751  C  CZ   . TYR B 1 33  ? 59.979  25.680  39.706  1.00 4.02  ? 65  TYR B CZ   1 
ATOM   5752  O  OH   . TYR B 1 33  ? 60.467  24.806  40.680  1.00 2.00  ? 65  TYR B OH   1 
ATOM   5753  H  H    . TYR B 1 33  ? 60.925  27.230  35.547  1.00 17.00 ? 65  TYR B H    1 
ATOM   5754  H  HH   . TYR B 1 33  ? 60.743  23.983  40.255  1.00 17.00 ? 65  TYR B HH   1 
ATOM   5755  N  N    . GLY B 1 34  ? 60.011  30.720  36.866  1.00 2.98  ? 66  GLY B N    1 
ATOM   5756  C  CA   . GLY B 1 34  ? 60.896  31.698  37.476  1.00 4.33  ? 66  GLY B CA   1 
ATOM   5757  C  C    . GLY B 1 34  ? 61.180  32.768  36.436  1.00 5.27  ? 66  GLY B C    1 
ATOM   5758  O  O    . GLY B 1 34  ? 61.420  32.417  35.287  1.00 2.33  ? 66  GLY B O    1 
ATOM   5759  H  H    . GLY B 1 34  ? 59.042  30.826  36.928  1.00 17.00 ? 66  GLY B H    1 
ATOM   5760  N  N    . GLU B 1 35  ? 61.174  34.048  36.840  1.00 6.43  ? 67  GLU B N    1 
ATOM   5761  C  CA   . GLU B 1 35  ? 61.400  35.203  35.942  1.00 6.12  ? 67  GLU B CA   1 
ATOM   5762  C  C    . GLU B 1 35  ? 61.941  34.983  34.511  1.00 6.52  ? 67  GLU B C    1 
ATOM   5763  O  O    . GLU B 1 35  ? 61.457  35.620  33.568  1.00 3.84  ? 67  GLU B O    1 
ATOM   5764  C  CB   . GLU B 1 35  ? 62.243  36.289  36.628  1.00 6.94  ? 67  GLU B CB   1 
ATOM   5765  C  CG   . GLU B 1 35  ? 62.461  37.521  35.740  1.00 7.93  ? 67  GLU B CG   1 
ATOM   5766  C  CD   . GLU B 1 35  ? 63.313  38.613  36.356  1.00 9.49  ? 67  GLU B CD   1 
ATOM   5767  O  OE1  . GLU B 1 35  ? 63.927  38.386  37.427  1.00 13.48 ? 67  GLU B OE1  1 
ATOM   5768  O  OE2  . GLU B 1 35  ? 63.374  39.711  35.755  1.00 9.04  ? 67  GLU B OE2  1 
ATOM   5769  H  H    . GLU B 1 35  ? 60.995  34.228  37.784  1.00 17.00 ? 67  GLU B H    1 
ATOM   5770  N  N    . ASN B 1 36  ? 62.907  34.084  34.343  1.00 5.78  ? 68  ASN B N    1 
ATOM   5771  C  CA   . ASN B 1 36  ? 63.490  33.859  33.026  1.00 6.87  ? 68  ASN B CA   1 
ATOM   5772  C  C    . ASN B 1 36  ? 63.221  32.520  32.396  1.00 7.49  ? 68  ASN B C    1 
ATOM   5773  O  O    . ASN B 1 36  ? 63.766  32.238  31.348  1.00 7.52  ? 68  ASN B O    1 
ATOM   5774  C  CB   . ASN B 1 36  ? 65.002  34.101  33.043  1.00 8.82  ? 68  ASN B CB   1 
ATOM   5775  C  CG   . ASN B 1 36  ? 65.356  35.559  33.279  1.00 12.11 ? 68  ASN B CG   1 
ATOM   5776  O  OD1  . ASN B 1 36  ? 64.470  36.407  33.316  1.00 11.53 ? 68  ASN B OD1  1 
ATOM   5777  N  ND2  . ASN B 1 36  ? 66.632  35.864  33.509  1.00 13.57 ? 68  ASN B ND2  1 
ATOM   5778  H  H    . ASN B 1 36  ? 63.197  33.521  35.083  1.00 17.00 ? 68  ASN B H    1 
ATOM   5779  H  HD21 . ASN B 1 36  ? 67.346  35.318  33.123  1.00 17.00 ? 68  ASN B HD21 1 
ATOM   5780  N  N    . CYS B 1 37  ? 62.326  31.735  32.976  1.00 8.26  ? 69  CYS B N    1 
ATOM   5781  C  CA   . CYS B 1 37  ? 61.999  30.409  32.459  1.00 8.99  ? 69  CYS B CA   1 
ATOM   5782  C  C    . CYS B 1 37  ? 63.303  29.613  32.451  1.00 9.95  ? 69  CYS B C    1 
ATOM   5783  O  O    . CYS B 1 37  ? 63.866  29.315  31.395  1.00 8.52  ? 69  CYS B O    1 
ATOM   5784  C  CB   . CYS B 1 37  ? 61.405  30.517  31.042  1.00 12.23 ? 69  CYS B CB   1 
ATOM   5785  S  SG   . CYS B 1 37  ? 60.139  31.827  30.783  1.00 11.71 ? 69  CYS B SG   1 
ATOM   5786  H  H    . CYS B 1 37  ? 61.789  32.104  33.662  1.00 17.00 ? 69  CYS B H    1 
ATOM   5787  N  N    . THR B 1 38  ? 63.765  29.261  33.650  1.00 11.92 ? 70  THR B N    1 
ATOM   5788  C  CA   . THR B 1 38  ? 65.035  28.550  33.832  1.00 11.75 ? 70  THR B CA   1 
ATOM   5789  C  C    . THR B 1 38  ? 65.045  27.462  34.906  1.00 9.53  ? 70  THR B C    1 
ATOM   5790  O  O    . THR B 1 38  ? 65.722  26.459  34.753  1.00 8.76  ? 70  THR B O    1 
ATOM   5791  C  CB   . THR B 1 38  ? 66.144  29.567  34.154  1.00 15.05 ? 70  THR B CB   1 
ATOM   5792  O  OG1  . THR B 1 38  ? 65.620  30.565  35.060  1.00 18.26 ? 70  THR B OG1  1 
ATOM   5793  C  CG2  . THR B 1 38  ? 66.645  30.246  32.866  1.00 14.19 ? 70  THR B CG2  1 
ATOM   5794  H  H    . THR B 1 38  ? 63.248  29.502  34.448  1.00 17.00 ? 70  THR B H    1 
ATOM   5795  H  HG1  . THR B 1 38  ? 66.356  31.145  35.301  1.00 17.00 ? 70  THR B HG1  1 
ATOM   5796  N  N    . THR B 1 39  ? 64.301  27.674  35.988  1.00 8.69  ? 71  THR B N    1 
ATOM   5797  C  CA   . THR B 1 39  ? 64.215  26.705  37.092  1.00 8.06  ? 71  THR B CA   1 
ATOM   5798  C  C    . THR B 1 39  ? 63.207  25.628  36.678  1.00 6.33  ? 71  THR B C    1 
ATOM   5799  O  O    . THR B 1 39  ? 62.054  25.930  36.383  1.00 6.98  ? 71  THR B O    1 
ATOM   5800  C  CB   . THR B 1 39  ? 63.807  27.415  38.442  1.00 6.56  ? 71  THR B CB   1 
ATOM   5801  O  OG1  . THR B 1 39  ? 62.396  27.360  38.639  1.00 6.70  ? 71  THR B OG1  1 
ATOM   5802  C  CG2  . THR B 1 39  ? 64.204  28.891  38.409  1.00 5.58  ? 71  THR B CG2  1 
ATOM   5803  H  H    . THR B 1 39  ? 63.754  28.489  36.038  1.00 17.00 ? 71  THR B H    1 
ATOM   5804  H  HG1  . THR B 1 39  ? 62.138  26.458  38.850  1.00 17.00 ? 71  THR B HG1  1 
ATOM   5805  N  N    . PRO B 1 40  ? 63.618  24.352  36.672  1.00 6.29  ? 72  PRO B N    1 
ATOM   5806  C  CA   . PRO B 1 40  ? 62.692  23.277  36.262  1.00 7.79  ? 72  PRO B CA   1 
ATOM   5807  C  C    . PRO B 1 40  ? 61.670  22.715  37.245  1.00 6.75  ? 72  PRO B C    1 
ATOM   5808  O  O    . PRO B 1 40  ? 61.741  22.899  38.467  1.00 5.54  ? 72  PRO B O    1 
ATOM   5809  C  CB   . PRO B 1 40  ? 63.650  22.171  35.848  1.00 5.31  ? 72  PRO B CB   1 
ATOM   5810  C  CG   . PRO B 1 40  ? 64.698  22.295  36.914  1.00 4.90  ? 72  PRO B CG   1 
ATOM   5811  C  CD   . PRO B 1 40  ? 64.937  23.793  37.029  1.00 4.36  ? 72  PRO B CD   1 
ATOM   5812  N  N    . GLU B 1 41  ? 60.696  22.046  36.658  1.00 7.43  ? 73  GLU B N    1 
ATOM   5813  C  CA   . GLU B 1 41  ? 59.677  21.351  37.415  1.00 10.18 ? 73  GLU B CA   1 
ATOM   5814  C  C    . GLU B 1 41  ? 60.409  20.009  37.547  1.00 8.60  ? 73  GLU B C    1 
ATOM   5815  O  O    . GLU B 1 41  ? 61.203  19.651  36.681  1.00 4.57  ? 73  GLU B O    1 
ATOM   5816  C  CB   . GLU B 1 41  ? 58.399  21.173  36.571  1.00 13.97 ? 73  GLU B CB   1 
ATOM   5817  C  CG   . GLU B 1 41  ? 57.799  22.490  35.964  1.00 17.94 ? 73  GLU B CG   1 
ATOM   5818  C  CD   . GLU B 1 41  ? 57.007  22.262  34.638  1.00 20.31 ? 73  GLU B CD   1 
ATOM   5819  O  OE1  . GLU B 1 41  ? 57.081  21.145  34.046  1.00 21.00 ? 73  GLU B OE1  1 
ATOM   5820  O  OE2  . GLU B 1 41  ? 56.318  23.215  34.183  1.00 19.66 ? 73  GLU B OE2  1 
ATOM   5821  H  H    . GLU B 1 41  ? 60.669  22.002  35.678  1.00 17.00 ? 73  GLU B H    1 
ATOM   5822  N  N    . PHE B 1 42  ? 60.178  19.277  38.626  1.00 10.33 ? 74  PHE B N    1 
ATOM   5823  C  CA   . PHE B 1 42  ? 60.862  18.008  38.783  1.00 11.40 ? 74  PHE B CA   1 
ATOM   5824  C  C    . PHE B 1 42  ? 60.897  17.173  37.514  1.00 10.38 ? 74  PHE B C    1 
ATOM   5825  O  O    . PHE B 1 42  ? 61.975  16.809  37.079  1.00 13.82 ? 74  PHE B O    1 
ATOM   5826  C  CB   . PHE B 1 42  ? 60.320  17.189  39.970  1.00 14.88 ? 74  PHE B CB   1 
ATOM   5827  C  CG   . PHE B 1 42  ? 61.378  16.844  40.997  1.00 18.33 ? 74  PHE B CG   1 
ATOM   5828  C  CD1  . PHE B 1 42  ? 62.646  16.407  40.601  1.00 19.33 ? 74  PHE B CD1  1 
ATOM   5829  C  CD2  . PHE B 1 42  ? 61.135  17.019  42.357  1.00 21.28 ? 74  PHE B CD2  1 
ATOM   5830  C  CE1  . PHE B 1 42  ? 63.658  16.156  41.546  1.00 21.42 ? 74  PHE B CE1  1 
ATOM   5831  C  CE2  . PHE B 1 42  ? 62.148  16.769  43.315  1.00 22.50 ? 74  PHE B CE2  1 
ATOM   5832  C  CZ   . PHE B 1 42  ? 63.408  16.338  42.902  1.00 21.02 ? 74  PHE B CZ   1 
ATOM   5833  H  H    . PHE B 1 42  ? 59.568  19.602  39.316  1.00 17.00 ? 74  PHE B H    1 
ATOM   5834  N  N    . LEU B 1 43  ? 59.750  16.915  36.895  1.00 9.69  ? 75  LEU B N    1 
ATOM   5835  C  CA   . LEU B 1 43  ? 59.694  16.103  35.672  1.00 8.88  ? 75  LEU B CA   1 
ATOM   5836  C  C    . LEU B 1 43  ? 60.782  16.488  34.684  1.00 8.76  ? 75  LEU B C    1 
ATOM   5837  O  O    . LEU B 1 43  ? 61.399  15.614  34.062  1.00 2.24  ? 75  LEU B O    1 
ATOM   5838  C  CB   . LEU B 1 43  ? 58.328  16.252  34.998  1.00 13.40 ? 75  LEU B CB   1 
ATOM   5839  C  CG   . LEU B 1 43  ? 58.179  15.726  33.557  1.00 14.60 ? 75  LEU B CG   1 
ATOM   5840  C  CD1  . LEU B 1 43  ? 58.346  14.177  33.506  1.00 13.93 ? 75  LEU B CD1  1 
ATOM   5841  C  CD2  . LEU B 1 43  ? 56.814  16.184  32.963  1.00 15.10 ? 75  LEU B CD2  1 
ATOM   5842  H  H    . LEU B 1 43  ? 58.922  17.262  37.274  1.00 17.00 ? 75  LEU B H    1 
ATOM   5843  N  N    . THR B 1 44  ? 60.980  17.805  34.537  1.00 10.64 ? 76  THR B N    1 
ATOM   5844  C  CA   . THR B 1 44  ? 62.003  18.376  33.650  1.00 10.33 ? 76  THR B CA   1 
ATOM   5845  C  C    . THR B 1 44  ? 63.358  17.827  34.078  1.00 9.79  ? 76  THR B C    1 
ATOM   5846  O  O    . THR B 1 44  ? 64.063  17.186  33.310  1.00 7.42  ? 76  THR B O    1 
ATOM   5847  C  CB   . THR B 1 44  ? 62.063  19.898  33.824  1.00 12.33 ? 76  THR B CB   1 
ATOM   5848  O  OG1  . THR B 1 44  ? 60.730  20.420  33.800  1.00 14.34 ? 76  THR B OG1  1 
ATOM   5849  C  CG2  . THR B 1 44  ? 62.951  20.561  32.735  1.00 9.56  ? 76  THR B CG2  1 
ATOM   5850  H  H    . THR B 1 44  ? 60.439  18.451  35.030  1.00 17.00 ? 76  THR B H    1 
ATOM   5851  H  HG1  . THR B 1 44  ? 60.779  21.376  33.761  1.00 17.00 ? 76  THR B HG1  1 
ATOM   5852  N  N    . ARG B 1 45  ? 63.681  18.080  35.341  1.00 11.76 ? 77  ARG B N    1 
ATOM   5853  C  CA   . ARG B 1 45  ? 64.922  17.652  35.965  1.00 13.51 ? 77  ARG B CA   1 
ATOM   5854  C  C    . ARG B 1 45  ? 65.190  16.233  35.543  1.00 12.00 ? 77  ARG B C    1 
ATOM   5855  O  O    . ARG B 1 45  ? 66.217  15.970  34.944  1.00 13.40 ? 77  ARG B O    1 
ATOM   5856  C  CB   . ARG B 1 45  ? 64.816  17.759  37.502  1.00 16.61 ? 77  ARG B CB   1 
ATOM   5857  C  CG   . ARG B 1 45  ? 64.460  19.176  37.977  1.00 20.42 ? 77  ARG B CG   1 
ATOM   5858  C  CD   . ARG B 1 45  ? 64.391  19.338  39.502  1.00 21.85 ? 77  ARG B CD   1 
ATOM   5859  N  NE   . ARG B 1 45  ? 63.121  19.947  39.914  1.00 20.65 ? 77  ARG B NE   1 
ATOM   5860  C  CZ   . ARG B 1 45  ? 62.820  20.328  41.153  1.00 16.47 ? 77  ARG B CZ   1 
ATOM   5861  N  NH1  . ARG B 1 45  ? 63.697  20.219  42.141  1.00 11.43 ? 77  ARG B NH1  1 
ATOM   5862  N  NH2  . ARG B 1 45  ? 61.565  20.619  41.441  1.00 18.48 ? 77  ARG B NH2  1 
ATOM   5863  H  H    . ARG B 1 45  ? 63.022  18.553  35.895  1.00 17.00 ? 77  ARG B H    1 
ATOM   5864  H  HE   . ARG B 1 45  ? 62.440  20.086  39.223  1.00 17.00 ? 77  ARG B HE   1 
ATOM   5865  H  HH11 . ARG B 1 45  ? 64.608  19.844  41.970  1.00 17.00 ? 77  ARG B HH11 1 
ATOM   5866  H  HH12 . ARG B 1 45  ? 63.444  20.516  43.061  1.00 17.00 ? 77  ARG B HH12 1 
ATOM   5867  H  HH21 . ARG B 1 45  ? 60.867  20.543  40.729  1.00 17.00 ? 77  ARG B HH21 1 
ATOM   5868  H  HH22 . ARG B 1 45  ? 61.313  20.909  42.363  1.00 17.00 ? 77  ARG B HH22 1 
ATOM   5869  N  N    . ILE B 1 46  ? 64.216  15.359  35.777  1.00 11.39 ? 78  ILE B N    1 
ATOM   5870  C  CA   . ILE B 1 46  ? 64.282  13.941  35.418  1.00 13.35 ? 78  ILE B CA   1 
ATOM   5871  C  C    . ILE B 1 46  ? 64.600  13.743  33.918  1.00 12.47 ? 78  ILE B C    1 
ATOM   5872  O  O    . ILE B 1 46  ? 65.481  12.956  33.565  1.00 14.16 ? 78  ILE B O    1 
ATOM   5873  C  CB   . ILE B 1 46  ? 62.934  13.248  35.796  1.00 13.95 ? 78  ILE B CB   1 
ATOM   5874  C  CG1  . ILE B 1 46  ? 62.688  13.418  37.304  1.00 11.55 ? 78  ILE B CG1  1 
ATOM   5875  C  CG2  . ILE B 1 46  ? 62.895  11.761  35.344  1.00 10.93 ? 78  ILE B CG2  1 
ATOM   5876  C  CD1  . ILE B 1 46  ? 61.254  13.216  37.685  1.00 16.01 ? 78  ILE B CD1  1 
ATOM   5877  H  H    . ILE B 1 46  ? 63.404  15.708  36.199  1.00 17.00 ? 78  ILE B H    1 
ATOM   5878  N  N    . LYS B 1 47  ? 63.885  14.445  33.044  1.00 11.10 ? 79  LYS B N    1 
ATOM   5879  C  CA   . LYS B 1 47  ? 64.147  14.354  31.612  1.00 10.54 ? 79  LYS B CA   1 
ATOM   5880  C  C    . LYS B 1 47  ? 65.609  14.742  31.395  1.00 8.52  ? 79  LYS B C    1 
ATOM   5881  O  O    . LYS B 1 47  ? 66.446  13.912  31.079  1.00 6.40  ? 79  LYS B O    1 
ATOM   5882  C  CB   . LYS B 1 47  ? 63.268  15.350  30.823  1.00 10.08 ? 79  LYS B CB   1 
ATOM   5883  C  CG   . LYS B 1 47  ? 61.761  15.227  31.050  1.00 10.40 ? 79  LYS B CG   1 
ATOM   5884  C  CD   . LYS B 1 47  ? 60.941  16.194  30.168  1.00 7.73  ? 79  LYS B CD   1 
ATOM   5885  C  CE   . LYS B 1 47  ? 59.427  16.038  30.376  1.00 3.33  ? 79  LYS B CE   1 
ATOM   5886  N  NZ   . LYS B 1 47  ? 58.892  14.631  30.176  1.00 2.00  ? 79  LYS B NZ   1 
ATOM   5887  H  H    . LYS B 1 47  ? 63.184  15.042  33.380  1.00 17.00 ? 79  LYS B H    1 
ATOM   5888  H  HZ1  . LYS B 1 47  ? 59.174  14.277  29.238  1.00 17.00 ? 79  LYS B HZ1  1 
ATOM   5889  H  HZ2  . LYS B 1 47  ? 59.288  14.011  30.911  1.00 17.00 ? 79  LYS B HZ2  1 
ATOM   5890  H  HZ3  . LYS B 1 47  ? 57.854  14.652  30.251  1.00 17.00 ? 79  LYS B HZ3  1 
ATOM   5891  N  N    . LEU B 1 48  ? 65.889  16.024  31.591  1.00 9.17  ? 80  LEU B N    1 
ATOM   5892  C  CA   . LEU B 1 48  ? 67.221  16.600  31.425  1.00 10.31 ? 80  LEU B CA   1 
ATOM   5893  C  C    . LEU B 1 48  ? 68.333  15.665  31.901  1.00 12.09 ? 80  LEU B C    1 
ATOM   5894  O  O    . LEU B 1 48  ? 69.181  15.234  31.113  1.00 13.66 ? 80  LEU B O    1 
ATOM   5895  C  CB   . LEU B 1 48  ? 67.338  17.918  32.205  1.00 7.40  ? 80  LEU B CB   1 
ATOM   5896  C  CG   . LEU B 1 48  ? 66.349  19.062  32.001  1.00 6.93  ? 80  LEU B CG   1 
ATOM   5897  C  CD1  . LEU B 1 48  ? 67.009  20.374  32.370  1.00 3.48  ? 80  LEU B CD1  1 
ATOM   5898  C  CD2  . LEU B 1 48  ? 65.908  19.117  30.559  1.00 10.00 ? 80  LEU B CD2  1 
ATOM   5899  H  H    . LEU B 1 48  ? 65.162  16.599  31.893  1.00 17.00 ? 80  LEU B H    1 
ATOM   5900  N  N    . LEU B 1 49  ? 68.298  15.323  33.188  1.00 13.15 ? 81  LEU B N    1 
ATOM   5901  C  CA   . LEU B 1 49  ? 69.290  14.443  33.817  1.00 11.64 ? 81  LEU B CA   1 
ATOM   5902  C  C    . LEU B 1 49  ? 69.209  13.015  33.318  1.00 10.08 ? 81  LEU B C    1 
ATOM   5903  O  O    . LEU B 1 49  ? 69.587  12.096  34.027  1.00 9.97  ? 81  LEU B O    1 
ATOM   5904  C  CB   . LEU B 1 49  ? 69.110  14.434  35.343  1.00 12.94 ? 81  LEU B CB   1 
ATOM   5905  C  CG   . LEU B 1 49  ? 69.057  15.775  36.079  1.00 11.96 ? 81  LEU B CG   1 
ATOM   5906  C  CD1  . LEU B 1 49  ? 68.842  15.495  37.551  1.00 13.30 ? 81  LEU B CD1  1 
ATOM   5907  C  CD2  . LEU B 1 49  ? 70.325  16.581  35.845  1.00 12.00 ? 81  LEU B CD2  1 
ATOM   5908  H  H    . LEU B 1 49  ? 67.559  15.648  33.734  1.00 17.00 ? 81  LEU B H    1 
ATOM   5909  N  N    . LEU B 1 50  ? 68.701  12.840  32.109  1.00 10.16 ? 82  LEU B N    1 
ATOM   5910  C  CA   . LEU B 1 50  ? 68.549  11.533  31.503  1.00 10.00 ? 82  LEU B CA   1 
ATOM   5911  C  C    . LEU B 1 50  ? 68.502  11.705  29.983  1.00 11.86 ? 82  LEU B C    1 
ATOM   5912  O  O    . LEU B 1 50  ? 68.019  10.815  29.260  1.00 13.03 ? 82  LEU B O    1 
ATOM   5913  C  CB   . LEU B 1 50  ? 67.235  10.890  31.965  1.00 6.40  ? 82  LEU B CB   1 
ATOM   5914  C  CG   . LEU B 1 50  ? 67.406  9.424   32.317  1.00 7.54  ? 82  LEU B CG   1 
ATOM   5915  C  CD1  . LEU B 1 50  ? 67.617  9.295   33.839  1.00 8.16  ? 82  LEU B CD1  1 
ATOM   5916  C  CD2  . LEU B 1 50  ? 66.218  8.612   31.840  1.00 6.14  ? 82  LEU B CD2  1 
ATOM   5917  H  H    . LEU B 1 50  ? 68.338  13.550  31.566  1.00 17.00 ? 82  LEU B H    1 
ATOM   5918  N  N    . LYS B 1 51  ? 68.959  12.856  29.493  1.00 12.42 ? 83  LYS B N    1 
ATOM   5919  C  CA   . LYS B 1 51  ? 68.935  13.088  28.058  1.00 12.15 ? 83  LYS B CA   1 
ATOM   5920  C  C    . LYS B 1 51  ? 70.352  13.047  27.490  1.00 13.38 ? 83  LYS B C    1 
ATOM   5921  O  O    . LYS B 1 51  ? 71.291  13.630  28.066  1.00 14.93 ? 83  LYS B O    1 
ATOM   5922  C  CB   . LYS B 1 51  ? 68.216  14.401  27.718  1.00 12.26 ? 83  LYS B CB   1 
ATOM   5923  C  CG   . LYS B 1 51  ? 69.091  15.631  27.649  1.00 11.92 ? 83  LYS B CG   1 
ATOM   5924  C  CD   . LYS B 1 51  ? 68.880  16.349  26.313  1.00 14.80 ? 83  LYS B CD   1 
ATOM   5925  C  CE   . LYS B 1 51  ? 69.139  15.424  25.118  1.00 11.97 ? 83  LYS B CE   1 
ATOM   5926  N  NZ   . LYS B 1 51  ? 68.903  16.076  23.809  1.00 13.68 ? 83  LYS B NZ   1 
ATOM   5927  H  H    . LYS B 1 51  ? 69.331  13.544  30.082  1.00 17.00 ? 83  LYS B H    1 
ATOM   5928  H  HZ1  . LYS B 1 51  ? 69.499  16.927  23.745  1.00 17.00 ? 83  LYS B HZ1  1 
ATOM   5929  H  HZ2  . LYS B 1 51  ? 69.147  15.422  23.038  1.00 17.00 ? 83  LYS B HZ2  1 
ATOM   5930  H  HZ3  . LYS B 1 51  ? 67.902  16.349  23.736  1.00 17.00 ? 83  LYS B HZ3  1 
ATOM   5931  N  N    . PRO B 1 52  ? 70.539  12.286  26.397  1.00 9.53  ? 84  PRO B N    1 
ATOM   5932  C  CA   . PRO B 1 52  ? 71.840  12.156  25.758  1.00 8.24  ? 84  PRO B CA   1 
ATOM   5933  C  C    . PRO B 1 52  ? 72.120  13.187  24.672  1.00 10.20 ? 84  PRO B C    1 
ATOM   5934  O  O    . PRO B 1 52  ? 71.285  13.409  23.785  1.00 10.47 ? 84  PRO B O    1 
ATOM   5935  C  CB   . PRO B 1 52  ? 71.771  10.747  25.188  1.00 8.69  ? 84  PRO B CB   1 
ATOM   5936  C  CG   . PRO B 1 52  ? 70.361  10.660  24.749  1.00 6.46  ? 84  PRO B CG   1 
ATOM   5937  C  CD   . PRO B 1 52  ? 69.605  11.268  25.888  1.00 8.06  ? 84  PRO B CD   1 
ATOM   5938  N  N    . THR B 1 53  ? 73.318  13.771  24.746  1.00 9.35  ? 85  THR B N    1 
ATOM   5939  C  CA   . THR B 1 53  ? 73.860  14.768  23.808  1.00 8.59  ? 85  THR B CA   1 
ATOM   5940  C  C    . THR B 1 53  ? 73.695  14.335  22.352  1.00 7.71  ? 85  THR B C    1 
ATOM   5941  O  O    . THR B 1 53  ? 73.903  13.170  22.036  1.00 4.04  ? 85  THR B O    1 
ATOM   5942  C  CB   . THR B 1 53  ? 75.387  14.877  24.039  1.00 10.60 ? 85  THR B CB   1 
ATOM   5943  O  OG1  . THR B 1 53  ? 75.647  14.973  25.441  1.00 13.23 ? 85  THR B OG1  1 
ATOM   5944  C  CG2  . THR B 1 53  ? 75.988  16.076  23.334  1.00 14.14 ? 85  THR B CG2  1 
ATOM   5945  H  H    . THR B 1 53  ? 73.914  13.495  25.474  1.00 17.00 ? 85  THR B H    1 
ATOM   5946  H  HG1  . THR B 1 53  ? 75.106  15.657  25.847  1.00 17.00 ? 85  THR B HG1  1 
ATOM   5947  N  N    . PRO B 1 54  ? 73.420  15.283  21.434  1.00 7.35  ? 86  PRO B N    1 
ATOM   5948  C  CA   . PRO B 1 54  ? 73.253  14.954  20.016  1.00 10.52 ? 86  PRO B CA   1 
ATOM   5949  C  C    . PRO B 1 54  ? 74.455  14.206  19.489  1.00 11.72 ? 86  PRO B C    1 
ATOM   5950  O  O    . PRO B 1 54  ? 74.353  13.484  18.499  1.00 13.86 ? 86  PRO B O    1 
ATOM   5951  C  CB   . PRO B 1 54  ? 73.135  16.317  19.354  1.00 10.79 ? 86  PRO B CB   1 
ATOM   5952  C  CG   . PRO B 1 54  ? 73.931  17.222  20.269  1.00 12.78 ? 86  PRO B CG   1 
ATOM   5953  C  CD   . PRO B 1 54  ? 73.398  16.738  21.614  1.00 11.05 ? 86  PRO B CD   1 
ATOM   5954  N  N    . ASN B 1 55  ? 75.589  14.388  20.166  1.00 10.87 ? 87  ASN B N    1 
ATOM   5955  C  CA   . ASN B 1 55  ? 76.844  13.721  19.831  1.00 7.80  ? 87  ASN B CA   1 
ATOM   5956  C  C    . ASN B 1 55  ? 76.828  12.302  20.400  1.00 6.55  ? 87  ASN B C    1 
ATOM   5957  O  O    . ASN B 1 55  ? 77.134  11.357  19.694  1.00 3.19  ? 87  ASN B O    1 
ATOM   5958  C  CB   . ASN B 1 55  ? 78.021  14.481  20.431  1.00 8.11  ? 87  ASN B CB   1 
ATOM   5959  C  CG   . ASN B 1 55  ? 78.041  15.914  20.038  1.00 5.26  ? 87  ASN B CG   1 
ATOM   5960  O  OD1  . ASN B 1 55  ? 78.253  16.240  18.888  1.00 7.01  ? 87  ASN B OD1  1 
ATOM   5961  N  ND2  . ASN B 1 55  ? 77.857  16.793  21.009  1.00 8.13  ? 87  ASN B ND2  1 
ATOM   5962  H  H    . ASN B 1 55  ? 75.578  15.027  20.898  1.00 17.00 ? 87  ASN B H    1 
ATOM   5963  H  HD21 . ASN B 1 55  ? 77.837  17.733  20.726  1.00 17.00 ? 87  ASN B HD21 1 
ATOM   5964  H  HD22 . ASN B 1 55  ? 77.773  16.497  21.930  1.00 17.00 ? 87  ASN B HD22 1 
ATOM   5965  N  N    . THR B 1 56  ? 76.456  12.167  21.676  1.00 7.24  ? 88  THR B N    1 
ATOM   5966  C  CA   . THR B 1 56  ? 76.375  10.862  22.335  1.00 8.49  ? 88  THR B CA   1 
ATOM   5967  C  C    . THR B 1 56  ? 75.289  10.037  21.633  1.00 10.85 ? 88  THR B C    1 
ATOM   5968  O  O    . THR B 1 56  ? 75.216  8.816   21.744  1.00 10.50 ? 88  THR B O    1 
ATOM   5969  C  CB   . THR B 1 56  ? 76.054  11.000  23.848  1.00 7.89  ? 88  THR B CB   1 
ATOM   5970  O  OG1  . THR B 1 56  ? 74.756  11.560  24.035  1.00 9.60  ? 88  THR B OG1  1 
ATOM   5971  C  CG2  . THR B 1 56  ? 77.048  11.913  24.505  1.00 9.50  ? 88  THR B CG2  1 
ATOM   5972  H  H    . THR B 1 56  ? 76.172  12.936  22.202  1.00 17.00 ? 88  THR B H    1 
ATOM   5973  H  HG1  . THR B 1 56  ? 74.083  11.012  23.613  1.00 17.00 ? 88  THR B HG1  1 
ATOM   5974  N  N    . VAL B 1 57  ? 74.426  10.755  20.939  1.00 11.41 ? 89  VAL B N    1 
ATOM   5975  C  CA   . VAL B 1 57  ? 73.356  10.197  20.160  1.00 11.22 ? 89  VAL B CA   1 
ATOM   5976  C  C    . VAL B 1 57  ? 73.989  9.768   18.818  1.00 13.69 ? 89  VAL B C    1 
ATOM   5977  O  O    . VAL B 1 57  ? 73.865  8.605   18.391  1.00 11.65 ? 89  VAL B O    1 
ATOM   5978  C  CB   . VAL B 1 57  ? 72.281  11.308  19.971  1.00 11.22 ? 89  VAL B CB   1 
ATOM   5979  C  CG1  . VAL B 1 57  ? 71.422  11.077  18.746  1.00 10.39 ? 89  VAL B CG1  1 
ATOM   5980  C  CG2  . VAL B 1 57  ? 71.423  11.388  21.217  1.00 11.09 ? 89  VAL B CG2  1 
ATOM   5981  H  H    . VAL B 1 57  ? 74.489  11.723  20.977  1.00 17.00 ? 89  VAL B H    1 
ATOM   5982  N  N    . HIS B 1 58  ? 74.733  10.705  18.212  1.00 14.42 ? 90  HIS B N    1 
ATOM   5983  C  CA   . HIS B 1 58  ? 75.402  10.509  16.922  1.00 12.68 ? 90  HIS B CA   1 
ATOM   5984  C  C    . HIS B 1 58  ? 76.370  9.358   16.952  1.00 12.56 ? 90  HIS B C    1 
ATOM   5985  O  O    . HIS B 1 58  ? 76.436  8.588   16.005  1.00 13.08 ? 90  HIS B O    1 
ATOM   5986  C  CB   . HIS B 1 58  ? 76.152  11.769  16.475  1.00 12.63 ? 90  HIS B CB   1 
ATOM   5987  C  CG   . HIS B 1 58  ? 76.483  11.783  15.013  1.00 13.51 ? 90  HIS B CG   1 
ATOM   5988  N  ND1  . HIS B 1 58  ? 77.448  10.970  14.459  1.00 15.43 ? 90  HIS B ND1  1 
ATOM   5989  C  CD2  . HIS B 1 58  ? 75.956  12.487  13.982  1.00 14.35 ? 90  HIS B CD2  1 
ATOM   5990  C  CE1  . HIS B 1 58  ? 77.504  11.172  13.153  1.00 13.19 ? 90  HIS B CE1  1 
ATOM   5991  N  NE2  . HIS B 1 58  ? 76.608  12.086  12.837  1.00 11.31 ? 90  HIS B NE2  1 
ATOM   5992  H  H    . HIS B 1 58  ? 74.818  11.573  18.650  1.00 17.00 ? 90  HIS B H    1 
ATOM   5993  H  HD1  . HIS B 1 58  ? 77.959  10.244  14.887  1.00 17.00 ? 90  HIS B HD1  1 
ATOM   5994  H  HE2  . HIS B 1 58  ? 76.410  12.369  11.913  1.00 17.00 ? 90  HIS B HE2  1 
ATOM   5995  N  N    . TYR B 1 59  ? 77.120  9.242   18.041  1.00 12.42 ? 91  TYR B N    1 
ATOM   5996  C  CA   . TYR B 1 59  ? 78.096  8.170   18.191  1.00 11.48 ? 91  TYR B CA   1 
ATOM   5997  C  C    . TYR B 1 59  ? 77.438  6.813   17.960  1.00 10.37 ? 91  TYR B C    1 
ATOM   5998  O  O    . TYR B 1 59  ? 77.760  6.084   17.011  1.00 11.75 ? 91  TYR B O    1 
ATOM   5999  C  CB   . TYR B 1 59  ? 78.732  8.197   19.586  1.00 10.10 ? 91  TYR B CB   1 
ATOM   6000  C  CG   . TYR B 1 59  ? 79.832  7.170   19.765  1.00 12.27 ? 91  TYR B CG   1 
ATOM   6001  C  CD1  . TYR B 1 59  ? 79.530  5.846   20.087  1.00 13.63 ? 91  TYR B CD1  1 
ATOM   6002  C  CD2  . TYR B 1 59  ? 81.174  7.507   19.588  1.00 11.76 ? 91  TYR B CD2  1 
ATOM   6003  C  CE1  . TYR B 1 59  ? 80.529  4.893   20.223  1.00 11.96 ? 91  TYR B CE1  1 
ATOM   6004  C  CE2  . TYR B 1 59  ? 82.183  6.551   19.730  1.00 11.15 ? 91  TYR B CE2  1 
ATOM   6005  C  CZ   . TYR B 1 59  ? 81.848  5.250   20.046  1.00 11.19 ? 91  TYR B CZ   1 
ATOM   6006  O  OH   . TYR B 1 59  ? 82.824  4.281   20.166  1.00 14.99 ? 91  TYR B OH   1 
ATOM   6007  H  H    . TYR B 1 59  ? 76.980  9.856   18.772  1.00 17.00 ? 91  TYR B H    1 
ATOM   6008  H  HH   . TYR B 1 59  ? 83.698  4.675   20.275  1.00 17.00 ? 91  TYR B HH   1 
ATOM   6009  N  N    . ILE B 1 60  ? 76.506  6.478   18.826  1.00 7.46  ? 92  ILE B N    1 
ATOM   6010  C  CA   . ILE B 1 60  ? 75.814  5.212   18.716  1.00 6.54  ? 92  ILE B CA   1 
ATOM   6011  C  C    . ILE B 1 60  ? 75.376  4.985   17.270  1.00 6.73  ? 92  ILE B C    1 
ATOM   6012  O  O    . ILE B 1 60  ? 75.780  4.021   16.598  1.00 2.86  ? 92  ILE B O    1 
ATOM   6013  C  CB   . ILE B 1 60  ? 74.568  5.242   19.602  1.00 5.19  ? 92  ILE B CB   1 
ATOM   6014  C  CG1  . ILE B 1 60  ? 74.962  5.704   21.002  1.00 5.10  ? 92  ILE B CG1  1 
ATOM   6015  C  CG2  . ILE B 1 60  ? 73.913  3.881   19.640  1.00 2.87  ? 92  ILE B CG2  1 
ATOM   6016  C  CD1  . ILE B 1 60  ? 73.821  6.008   21.879  1.00 3.30  ? 92  ILE B CD1  1 
ATOM   6017  H  H    . ILE B 1 60  ? 76.273  7.115   19.530  1.00 17.00 ? 92  ILE B H    1 
ATOM   6018  N  N    . LEU B 1 61  ? 74.637  5.974   16.784  1.00 8.06  ? 93  LEU B N    1 
ATOM   6019  C  CA   . LEU B 1 61  ? 74.066  5.983   15.444  1.00 8.35  ? 93  LEU B CA   1 
ATOM   6020  C  C    . LEU B 1 61  ? 75.050  5.779   14.320  1.00 9.28  ? 93  LEU B C    1 
ATOM   6021  O  O    . LEU B 1 61  ? 74.634  5.328   13.249  1.00 12.18 ? 93  LEU B O    1 
ATOM   6022  C  CB   . LEU B 1 61  ? 73.301  7.286   15.210  1.00 8.19  ? 93  LEU B CB   1 
ATOM   6023  C  CG   . LEU B 1 61  ? 71.975  7.292   14.446  1.00 6.13  ? 93  LEU B CG   1 
ATOM   6024  C  CD1  . LEU B 1 61  ? 71.202  5.977   14.597  1.00 2.00  ? 93  LEU B CD1  1 
ATOM   6025  C  CD2  . LEU B 1 61  ? 71.185  8.478   14.995  1.00 3.70  ? 93  LEU B CD2  1 
ATOM   6026  H  H    . LEU B 1 61  ? 74.472  6.755   17.359  1.00 17.00 ? 93  LEU B H    1 
ATOM   6027  N  N    . THR B 1 62  ? 76.325  6.139   14.521  1.00 9.55  ? 94  THR B N    1 
ATOM   6028  C  CA   . THR B 1 62  ? 77.324  5.960   13.463  1.00 7.58  ? 94  THR B CA   1 
ATOM   6029  C  C    . THR B 1 62  ? 78.207  4.753   13.692  1.00 7.33  ? 94  THR B C    1 
ATOM   6030  O  O    . THR B 1 62  ? 78.832  4.255   12.764  1.00 8.65  ? 94  THR B O    1 
ATOM   6031  C  CB   . THR B 1 62  ? 78.205  7.182   13.246  1.00 4.53  ? 94  THR B CB   1 
ATOM   6032  O  OG1  . THR B 1 62  ? 77.476  8.369   13.547  1.00 4.96  ? 94  THR B OG1  1 
ATOM   6033  C  CG2  . THR B 1 62  ? 78.598  7.250   11.794  1.00 4.36  ? 94  THR B CG2  1 
ATOM   6034  H  H    . THR B 1 62  ? 76.595  6.552   15.365  1.00 17.00 ? 94  THR B H    1 
ATOM   6035  H  HG1  . THR B 1 62  ? 76.692  8.242   12.989  1.00 17.00 ? 94  THR B HG1  1 
ATOM   6036  N  N    . HIS B 1 63  ? 78.206  4.230   14.913  1.00 9.36  ? 95  HIS B N    1 
ATOM   6037  C  CA   . HIS B 1 63  ? 79.031  3.056   15.244  1.00 9.27  ? 95  HIS B CA   1 
ATOM   6038  C  C    . HIS B 1 63  ? 78.175  1.801   15.215  1.00 8.60  ? 95  HIS B C    1 
ATOM   6039  O  O    . HIS B 1 63  ? 77.096  1.839   14.644  1.00 11.83 ? 95  HIS B O    1 
ATOM   6040  C  CB   . HIS B 1 63  ? 79.665  3.235   16.632  1.00 9.05  ? 95  HIS B CB   1 
ATOM   6041  C  CG   . HIS B 1 63  ? 80.664  4.338   16.686  1.00 10.65 ? 95  HIS B CG   1 
ATOM   6042  N  ND1  . HIS B 1 63  ? 82.006  4.128   16.478  1.00 14.00 ? 95  HIS B ND1  1 
ATOM   6043  C  CD2  . HIS B 1 63  ? 80.513  5.673   16.846  1.00 12.52 ? 95  HIS B CD2  1 
ATOM   6044  C  CE1  . HIS B 1 63  ? 82.642  5.288   16.502  1.00 14.75 ? 95  HIS B CE1  1 
ATOM   6045  N  NE2  . HIS B 1 63  ? 81.758  6.243   16.725  1.00 13.96 ? 95  HIS B NE2  1 
ATOM   6046  H  H    . HIS B 1 63  ? 77.589  4.596   15.589  1.00 17.00 ? 95  HIS B H    1 
ATOM   6047  H  HD1  . HIS B 1 63  ? 82.456  3.267   16.333  1.00 17.00 ? 95  HIS B HD1  1 
ATOM   6048  H  HE2  . HIS B 1 63  ? 81.952  7.204   16.773  1.00 17.00 ? 95  HIS B HE2  1 
ATOM   6049  N  N    . PHE B 1 64  ? 78.705  0.690   15.754  1.00 7.54  ? 96  PHE B N    1 
ATOM   6050  C  CA   . PHE B 1 64  ? 78.028  -0.628  15.894  1.00 4.17  ? 96  PHE B CA   1 
ATOM   6051  C  C    . PHE B 1 64  ? 77.352  -1.217  14.655  1.00 4.97  ? 96  PHE B C    1 
ATOM   6052  O  O    . PHE B 1 64  ? 76.280  -1.800  14.752  1.00 2.00  ? 96  PHE B O    1 
ATOM   6053  C  CB   . PHE B 1 64  ? 76.980  -0.548  17.010  1.00 3.14  ? 96  PHE B CB   1 
ATOM   6054  C  CG   . PHE B 1 64  ? 77.426  0.225   18.200  1.00 3.84  ? 96  PHE B CG   1 
ATOM   6055  C  CD1  . PHE B 1 64  ? 77.219  1.611   18.268  1.00 6.44  ? 96  PHE B CD1  1 
ATOM   6056  C  CD2  . PHE B 1 64  ? 78.080  -0.409  19.244  1.00 7.00  ? 96  PHE B CD2  1 
ATOM   6057  C  CE1  . PHE B 1 64  ? 77.661  2.370   19.363  1.00 6.97  ? 96  PHE B CE1  1 
ATOM   6058  C  CE2  . PHE B 1 64  ? 78.529  0.327   20.346  1.00 9.74  ? 96  PHE B CE2  1 
ATOM   6059  C  CZ   . PHE B 1 64  ? 78.316  1.728   20.402  1.00 10.02 ? 96  PHE B CZ   1 
ATOM   6060  H  H    . PHE B 1 64  ? 79.615  0.746   16.100  1.00 17.00 ? 96  PHE B H    1 
ATOM   6061  N  N    . LYS B 1 65  ? 78.018  -1.140  13.511  1.00 7.09  ? 97  LYS B N    1 
ATOM   6062  C  CA   . LYS B 1 65  ? 77.451  -1.614  12.250  1.00 7.43  ? 97  LYS B CA   1 
ATOM   6063  C  C    . LYS B 1 65  ? 76.633  -2.849  12.364  1.00 10.08 ? 97  LYS B C    1 
ATOM   6064  O  O    . LYS B 1 65  ? 75.476  -2.858  11.964  1.00 13.57 ? 97  LYS B O    1 
ATOM   6065  C  CB   . LYS B 1 65  ? 78.518  -1.885  11.196  1.00 5.65  ? 97  LYS B CB   1 
ATOM   6066  C  CG   . LYS B 1 65  ? 78.004  -2.699  10.016  1.00 2.00  ? 97  LYS B CG   1 
ATOM   6067  C  CD   . LYS B 1 65  ? 78.975  -2.732  8.867   1.00 9.37  ? 97  LYS B CD   1 
ATOM   6068  C  CE   . LYS B 1 65  ? 79.163  -1.350  8.208   1.00 12.80 ? 97  LYS B CE   1 
ATOM   6069  N  NZ   . LYS B 1 65  ? 80.131  -1.372  7.044   1.00 15.38 ? 97  LYS B NZ   1 
ATOM   6070  H  H    . LYS B 1 65  ? 78.915  -0.761  13.537  1.00 17.00 ? 97  LYS B H    1 
ATOM   6071  H  HZ1  . LYS B 1 65  ? 81.066  -1.701  7.360   1.00 17.00 ? 97  LYS B HZ1  1 
ATOM   6072  H  HZ2  . LYS B 1 65  ? 79.762  -2.017  6.317   1.00 17.00 ? 97  LYS B HZ2  1 
ATOM   6073  H  HZ3  . LYS B 1 65  ? 80.217  -0.415  6.642   1.00 17.00 ? 97  LYS B HZ3  1 
ATOM   6074  N  N    . GLY B 1 66  ? 77.247  -3.905  12.880  1.00 11.17 ? 98  GLY B N    1 
ATOM   6075  C  CA   . GLY B 1 66  ? 76.562  -5.183  12.994  1.00 11.17 ? 98  GLY B CA   1 
ATOM   6076  C  C    . GLY B 1 66  ? 75.193  -5.110  13.647  1.00 12.34 ? 98  GLY B C    1 
ATOM   6077  O  O    . GLY B 1 66  ? 74.211  -5.680  13.148  1.00 13.67 ? 98  GLY B O    1 
ATOM   6078  H  H    . GLY B 1 66  ? 78.168  -3.829  13.198  1.00 17.00 ? 98  GLY B H    1 
ATOM   6079  N  N    . VAL B 1 67  ? 75.128  -4.405  14.773  1.00 11.62 ? 99  VAL B N    1 
ATOM   6080  C  CA   . VAL B 1 67  ? 73.888  -4.260  15.502  1.00 8.30  ? 99  VAL B CA   1 
ATOM   6081  C  C    . VAL B 1 67  ? 72.874  -3.637  14.572  1.00 7.75  ? 99  VAL B C    1 
ATOM   6082  O  O    . VAL B 1 67  ? 71.862  -4.242  14.257  1.00 6.20  ? 99  VAL B O    1 
ATOM   6083  C  CB   . VAL B 1 67  ? 74.100  -3.391  16.734  1.00 9.20  ? 99  VAL B CB   1 
ATOM   6084  C  CG1  . VAL B 1 67  ? 72.768  -2.762  17.200  1.00 10.96 ? 99  VAL B CG1  1 
ATOM   6085  C  CG2  . VAL B 1 67  ? 74.728  -4.236  17.837  1.00 7.46  ? 99  VAL B CG2  1 
ATOM   6086  H  H    . VAL B 1 67  ? 75.924  -3.938  15.102  1.00 17.00 ? 99  VAL B H    1 
ATOM   6087  N  N    . TRP B 1 68  ? 73.204  -2.453  14.082  1.00 9.11  ? 100 TRP B N    1 
ATOM   6088  C  CA   . TRP B 1 68  ? 72.345  -1.738  13.152  1.00 10.02 ? 100 TRP B CA   1 
ATOM   6089  C  C    . TRP B 1 68  ? 72.042  -2.618  11.970  1.00 10.70 ? 100 TRP B C    1 
ATOM   6090  O  O    . TRP B 1 68  ? 71.053  -2.392  11.276  1.00 12.91 ? 100 TRP B O    1 
ATOM   6091  C  CB   . TRP B 1 68  ? 73.004  -0.447  12.672  1.00 11.01 ? 100 TRP B CB   1 
ATOM   6092  C  CG   . TRP B 1 68  ? 73.140  0.528   13.781  1.00 14.89 ? 100 TRP B CG   1 
ATOM   6093  C  CD1  . TRP B 1 68  ? 74.286  0.897   14.400  1.00 15.69 ? 100 TRP B CD1  1 
ATOM   6094  C  CD2  . TRP B 1 68  ? 72.074  1.207   14.472  1.00 14.65 ? 100 TRP B CD2  1 
ATOM   6095  N  NE1  . TRP B 1 68  ? 74.008  1.761   15.433  1.00 16.52 ? 100 TRP B NE1  1 
ATOM   6096  C  CE2  . TRP B 1 68  ? 72.656  1.959   15.498  1.00 14.65 ? 100 TRP B CE2  1 
ATOM   6097  C  CE3  . TRP B 1 68  ? 70.681  1.243   14.318  1.00 15.87 ? 100 TRP B CE3  1 
ATOM   6098  C  CZ2  . TRP B 1 68  ? 71.901  2.740   16.367  1.00 16.31 ? 100 TRP B CZ2  1 
ATOM   6099  C  CZ3  . TRP B 1 68  ? 69.929  2.021   15.180  1.00 13.71 ? 100 TRP B CZ3  1 
ATOM   6100  C  CH2  . TRP B 1 68  ? 70.538  2.757   16.189  1.00 15.75 ? 100 TRP B CH2  1 
ATOM   6101  H  H    . TRP B 1 68  ? 74.063  -2.051  14.342  1.00 17.00 ? 100 TRP B H    1 
ATOM   6102  H  HE1  . TRP B 1 68  ? 74.692  2.196   15.994  1.00 17.00 ? 100 TRP B HE1  1 
ATOM   6103  N  N    . ASN B 1 69  ? 72.894  -3.606  11.717  1.00 9.95  ? 101 ASN B N    1 
ATOM   6104  C  CA   . ASN B 1 69  ? 72.638  -4.524  10.626  1.00 12.09 ? 101 ASN B CA   1 
ATOM   6105  C  C    . ASN B 1 69  ? 71.450  -5.367  11.042  1.00 10.45 ? 101 ASN B C    1 
ATOM   6106  O  O    . ASN B 1 69  ? 70.489  -5.536  10.292  1.00 9.54  ? 101 ASN B O    1 
ATOM   6107  C  CB   . ASN B 1 69  ? 73.845  -5.418  10.379  1.00 17.30 ? 101 ASN B CB   1 
ATOM   6108  C  CG   . ASN B 1 69  ? 74.835  -4.811  9.392   1.00 19.83 ? 101 ASN B CG   1 
ATOM   6109  O  OD1  . ASN B 1 69  ? 74.434  -4.156  8.423   1.00 21.97 ? 101 ASN B OD1  1 
ATOM   6110  N  ND2  . ASN B 1 69  ? 76.139  -5.052  9.617   1.00 19.01 ? 101 ASN B ND2  1 
ATOM   6111  H  H    . ASN B 1 69  ? 73.707  -3.696  12.242  1.00 17.00 ? 101 ASN B H    1 
ATOM   6112  H  HD21 . ASN B 1 69  ? 76.756  -4.680  8.955   1.00 17.00 ? 101 ASN B HD21 1 
ATOM   6113  H  HD22 . ASN B 1 69  ? 76.398  -5.577  10.393  1.00 17.00 ? 101 ASN B HD22 1 
ATOM   6114  N  N    . ILE B 1 70  ? 71.507  -5.844  12.274  1.00 9.61  ? 102 ILE B N    1 
ATOM   6115  C  CA   . ILE B 1 70  ? 70.436  -6.643  12.831  1.00 11.58 ? 102 ILE B CA   1 
ATOM   6116  C  C    . ILE B 1 70  ? 69.124  -5.831  12.849  1.00 10.70 ? 102 ILE B C    1 
ATOM   6117  O  O    . ILE B 1 70  ? 68.082  -6.322  12.424  1.00 11.11 ? 102 ILE B O    1 
ATOM   6118  C  CB   . ILE B 1 70  ? 70.840  -7.151  14.224  1.00 12.15 ? 102 ILE B CB   1 
ATOM   6119  C  CG1  . ILE B 1 70  ? 71.966  -8.195  14.063  1.00 12.45 ? 102 ILE B CG1  1 
ATOM   6120  C  CG2  . ILE B 1 70  ? 69.618  -7.682  14.989  1.00 12.67 ? 102 ILE B CG2  1 
ATOM   6121  C  CD1  . ILE B 1 70  ? 72.576  -8.703  15.382  1.00 12.03 ? 102 ILE B CD1  1 
ATOM   6122  H  H    . ILE B 1 70  ? 72.289  -5.644  12.826  1.00 17.00 ? 102 ILE B H    1 
ATOM   6123  N  N    . VAL B 1 71  ? 69.186  -4.580  13.294  1.00 11.23 ? 103 VAL B N    1 
ATOM   6124  C  CA   . VAL B 1 71  ? 68.007  -3.710  13.319  1.00 9.19  ? 103 VAL B CA   1 
ATOM   6125  C  C    . VAL B 1 71  ? 67.444  -3.573  11.909  1.00 10.13 ? 103 VAL B C    1 
ATOM   6126  O  O    . VAL B 1 71  ? 66.285  -3.899  11.674  1.00 11.50 ? 103 VAL B O    1 
ATOM   6127  C  CB   . VAL B 1 71  ? 68.333  -2.289  13.897  1.00 9.22  ? 103 VAL B CB   1 
ATOM   6128  C  CG1  . VAL B 1 71  ? 67.458  -1.164  13.232  1.00 3.76  ? 103 VAL B CG1  1 
ATOM   6129  C  CG2  . VAL B 1 71  ? 68.141  -2.311  15.405  1.00 6.73  ? 103 VAL B CG2  1 
ATOM   6130  H  H    . VAL B 1 71  ? 70.049  -4.248  13.612  1.00 17.00 ? 103 VAL B H    1 
ATOM   6131  N  N    . ASN B 1 72  ? 68.279  -3.155  10.967  1.00 8.67  ? 104 ASN B N    1 
ATOM   6132  C  CA   . ASN B 1 72  ? 67.846  -2.983  9.604   1.00 9.38  ? 104 ASN B CA   1 
ATOM   6133  C  C    . ASN B 1 72  ? 67.223  -4.250  9.029   1.00 12.64 ? 104 ASN B C    1 
ATOM   6134  O  O    . ASN B 1 72  ? 66.529  -4.198  8.016   1.00 15.35 ? 104 ASN B O    1 
ATOM   6135  C  CB   . ASN B 1 72  ? 68.998  -2.466  8.751   1.00 5.72  ? 104 ASN B CB   1 
ATOM   6136  C  CG   . ASN B 1 72  ? 69.377  -1.009  9.097   1.00 5.41  ? 104 ASN B CG   1 
ATOM   6137  O  OD1  . ASN B 1 72  ? 68.902  -0.445  10.086  1.00 5.13  ? 104 ASN B OD1  1 
ATOM   6138  N  ND2  . ASN B 1 72  ? 70.220  -0.394  8.275   1.00 2.00  ? 104 ASN B ND2  1 
ATOM   6139  H  H    . ASN B 1 72  ? 69.206  -2.940  11.200  1.00 17.00 ? 104 ASN B H    1 
ATOM   6140  H  HD21 . ASN B 1 72  ? 70.549  0.512   8.455   1.00 17.00 ? 104 ASN B HD21 1 
ATOM   6141  H  HD22 . ASN B 1 72  ? 70.528  -0.907  7.501   1.00 17.00 ? 104 ASN B HD22 1 
ATOM   6142  N  N    . ASN B 1 73  ? 67.469  -5.389  9.667   1.00 13.64 ? 105 ASN B N    1 
ATOM   6143  C  CA   . ASN B 1 73  ? 66.870  -6.623  9.208   1.00 14.40 ? 105 ASN B CA   1 
ATOM   6144  C  C    . ASN B 1 73  ? 65.486  -6.676  9.833   1.00 14.74 ? 105 ASN B C    1 
ATOM   6145  O  O    . ASN B 1 73  ? 64.512  -6.747  9.108   1.00 18.17 ? 105 ASN B O    1 
ATOM   6146  C  CB   . ASN B 1 73  ? 67.732  -7.853  9.567   1.00 18.79 ? 105 ASN B CB   1 
ATOM   6147  C  CG   . ASN B 1 73  ? 67.138  -8.723  10.696  1.00 21.19 ? 105 ASN B CG   1 
ATOM   6148  O  OD1  . ASN B 1 73  ? 65.985  -9.177  10.631  1.00 23.23 ? 105 ASN B OD1  1 
ATOM   6149  N  ND2  . ASN B 1 73  ? 67.951  -8.987  11.717  1.00 19.93 ? 105 ASN B ND2  1 
ATOM   6150  H  H    . ASN B 1 73  ? 68.056  -5.399  10.446  1.00 17.00 ? 105 ASN B H    1 
ATOM   6151  H  HD21 . ASN B 1 73  ? 67.597  -9.541  12.436  1.00 17.00 ? 105 ASN B HD21 1 
ATOM   6152  H  HD22 . ASN B 1 73  ? 68.851  -8.610  11.680  1.00 17.00 ? 105 ASN B HD22 1 
ATOM   6153  N  N    . ILE B 1 74  A 65.394  -6.547  11.156  1.00 15.14 ? 105 ILE B N    1 
ATOM   6154  C  CA   . ILE B 1 74  A 64.112  -6.604  11.860  1.00 16.45 ? 105 ILE B CA   1 
ATOM   6155  C  C    . ILE B 1 74  A 63.231  -5.436  11.474  1.00 15.63 ? 105 ILE B C    1 
ATOM   6156  O  O    . ILE B 1 74  A 63.388  -4.344  12.016  1.00 17.84 ? 105 ILE B O    1 
ATOM   6157  C  CB   . ILE B 1 74  A 64.300  -6.616  13.388  1.00 15.68 ? 105 ILE B CB   1 
ATOM   6158  C  CG1  . ILE B 1 74  A 64.875  -7.973  13.830  1.00 16.24 ? 105 ILE B CG1  1 
ATOM   6159  C  CG2  . ILE B 1 74  A 62.981  -6.348  14.084  1.00 13.59 ? 105 ILE B CG2  1 
ATOM   6160  C  CD1  . ILE B 1 74  A 64.710  -8.297  15.329  1.00 19.60 ? 105 ILE B CD1  1 
ATOM   6161  H  H    . ILE B 1 74  A 66.203  -6.362  11.672  1.00 17.00 ? 105 ILE B H    1 
ATOM   6162  N  N    . PRO B 1 75  ? 62.225  -5.671  10.600  1.00 16.53 ? 106 PRO B N    1 
ATOM   6163  C  CA   . PRO B 1 75  ? 61.353  -4.572  10.183  1.00 15.79 ? 106 PRO B CA   1 
ATOM   6164  C  C    . PRO B 1 75  ? 60.585  -3.961  11.348  1.00 13.01 ? 106 PRO B C    1 
ATOM   6165  O  O    . PRO B 1 75  ? 60.554  -2.741  11.505  1.00 12.40 ? 106 PRO B O    1 
ATOM   6166  C  CB   . PRO B 1 75  ? 60.445  -5.239  9.137   1.00 16.06 ? 106 PRO B CB   1 
ATOM   6167  C  CG   . PRO B 1 75  ? 61.290  -6.372  8.590   1.00 14.11 ? 106 PRO B CG   1 
ATOM   6168  C  CD   . PRO B 1 75  ? 61.822  -6.913  9.912   1.00 16.94 ? 106 PRO B CD   1 
ATOM   6169  N  N    . PHE B 1 76  ? 60.076  -4.807  12.227  1.00 10.30 ? 107 PHE B N    1 
ATOM   6170  C  CA   . PHE B 1 76  ? 59.336  -4.324  13.377  1.00 11.74 ? 107 PHE B CA   1 
ATOM   6171  C  C    . PHE B 1 76  ? 60.192  -3.603  14.414  1.00 12.95 ? 107 PHE B C    1 
ATOM   6172  O  O    . PHE B 1 76  ? 59.773  -3.480  15.585  1.00 12.17 ? 107 PHE B O    1 
ATOM   6173  C  CB   . PHE B 1 76  ? 58.583  -5.472  14.053  1.00 18.63 ? 107 PHE B CB   1 
ATOM   6174  C  CG   . PHE B 1 76  ? 59.464  -6.614  14.581  1.00 21.11 ? 107 PHE B CG   1 
ATOM   6175  C  CD1  . PHE B 1 76  ? 59.965  -7.620  13.715  1.00 21.23 ? 107 PHE B CD1  1 
ATOM   6176  C  CD2  . PHE B 1 76  ? 59.678  -6.753  15.958  1.00 22.03 ? 107 PHE B CD2  1 
ATOM   6177  C  CE1  . PHE B 1 76  ? 60.662  -8.758  14.219  1.00 21.22 ? 107 PHE B CE1  1 
ATOM   6178  C  CE2  . PHE B 1 76  ? 60.378  -7.892  16.481  1.00 24.29 ? 107 PHE B CE2  1 
ATOM   6179  C  CZ   . PHE B 1 76  ? 60.866  -8.894  15.607  1.00 22.10 ? 107 PHE B CZ   1 
ATOM   6180  H  H    . PHE B 1 76  ? 60.207  -5.764  12.091  1.00 17.00 ? 107 PHE B H    1 
ATOM   6181  N  N    . LEU B 1 77  ? 61.388  -3.166  13.980  1.00 11.44 ? 108 LEU B N    1 
ATOM   6182  C  CA   . LEU B 1 77  ? 62.367  -2.469  14.808  1.00 6.50  ? 108 LEU B CA   1 
ATOM   6183  C  C    . LEU B 1 77  ? 62.869  -1.264  14.088  1.00 5.09  ? 108 LEU B C    1 
ATOM   6184  O  O    . LEU B 1 77  ? 62.993  -0.206  14.694  1.00 6.67  ? 108 LEU B O    1 
ATOM   6185  C  CB   . LEU B 1 77  ? 63.570  -3.356  15.114  1.00 5.05  ? 108 LEU B CB   1 
ATOM   6186  C  CG   . LEU B 1 77  ? 63.607  -4.054  16.464  1.00 3.63  ? 108 LEU B CG   1 
ATOM   6187  C  CD1  . LEU B 1 77  ? 64.900  -4.836  16.597  1.00 2.90  ? 108 LEU B CD1  1 
ATOM   6188  C  CD2  . LEU B 1 77  ? 63.496  -3.026  17.552  1.00 2.76  ? 108 LEU B CD2  1 
ATOM   6189  H  H    . LEU B 1 77  ? 61.696  -3.309  13.074  1.00 17.00 ? 108 LEU B H    1 
ATOM   6190  N  N    . ARG B 1 78  ? 63.220  -1.441  12.817  1.00 3.93  ? 109 ARG B N    1 
ATOM   6191  C  CA   . ARG B 1 78  ? 63.727  -0.344  11.995  1.00 5.61  ? 109 ARG B CA   1 
ATOM   6192  C  C    . ARG B 1 78  ? 62.720  0.806   12.099  1.00 6.35  ? 109 ARG B C    1 
ATOM   6193  O  O    . ARG B 1 78  ? 63.053  1.923   12.489  1.00 2.03  ? 109 ARG B O    1 
ATOM   6194  C  CB   . ARG B 1 78  ? 63.885  -0.804  10.544  1.00 5.16  ? 109 ARG B CB   1 
ATOM   6195  C  CG   . ARG B 1 78  ? 64.310  0.304   9.616   1.00 6.29  ? 109 ARG B CG   1 
ATOM   6196  C  CD   . ARG B 1 78  ? 64.481  -0.141  8.192   1.00 7.45  ? 109 ARG B CD   1 
ATOM   6197  N  NE   . ARG B 1 78  ? 64.427  1.004   7.285   1.00 6.90  ? 109 ARG B NE   1 
ATOM   6198  C  CZ   . ARG B 1 78  ? 64.272  0.907   5.970   1.00 8.47  ? 109 ARG B CZ   1 
ATOM   6199  N  NH1  . ARG B 1 78  ? 64.153  -0.282  5.390   1.00 12.29 ? 109 ARG B NH1  1 
ATOM   6200  N  NH2  . ARG B 1 78  ? 64.204  1.997   5.232   1.00 8.58  ? 109 ARG B NH2  1 
ATOM   6201  H  H    . ARG B 1 78  ? 63.156  -2.335  12.420  1.00 17.00 ? 109 ARG B H    1 
ATOM   6202  H  HE   . ARG B 1 78  ? 64.491  1.903   7.666   1.00 17.00 ? 109 ARG B HE   1 
ATOM   6203  H  HH11 . ARG B 1 78  ? 64.170  -1.120  5.934   1.00 17.00 ? 109 ARG B HH11 1 
ATOM   6204  H  HH12 . ARG B 1 78  ? 64.036  -0.341  4.399   1.00 17.00 ? 109 ARG B HH12 1 
ATOM   6205  H  HH21 . ARG B 1 78  ? 64.252  2.881   5.683   1.00 17.00 ? 109 ARG B HH21 1 
ATOM   6206  H  HH22 . ARG B 1 78  ? 64.090  1.935   4.241   1.00 17.00 ? 109 ARG B HH22 1 
ATOM   6207  N  N    . SER B 1 79  ? 61.458  0.446   11.875  1.00 9.87  ? 110 SER B N    1 
ATOM   6208  C  CA   . SER B 1 79  ? 60.280  1.326   11.939  1.00 10.23 ? 110 SER B CA   1 
ATOM   6209  C  C    . SER B 1 79  ? 60.154  2.044   13.294  1.00 10.44 ? 110 SER B C    1 
ATOM   6210  O  O    . SER B 1 79  ? 59.785  3.225   13.362  1.00 11.36 ? 110 SER B O    1 
ATOM   6211  C  CB   . SER B 1 79  ? 59.052  0.459   11.745  1.00 9.26  ? 110 SER B CB   1 
ATOM   6212  O  OG   . SER B 1 79  ? 59.137  -0.610  12.672  1.00 11.14 ? 110 SER B OG   1 
ATOM   6213  H  H    . SER B 1 79  ? 61.276  -0.498  11.671  1.00 17.00 ? 110 SER B H    1 
ATOM   6214  H  HG   . SER B 1 79  ? 58.420  -1.234  12.509  1.00 17.00 ? 110 SER B HG   1 
ATOM   6215  N  N    . LEU B 1 80  ? 60.347  1.289   14.373  1.00 10.93 ? 111 LEU B N    1 
ATOM   6216  C  CA   . LEU B 1 80  ? 60.305  1.861   15.711  1.00 11.02 ? 111 LEU B CA   1 
ATOM   6217  C  C    . LEU B 1 80  ? 61.330  2.991   15.769  1.00 11.60 ? 111 LEU B C    1 
ATOM   6218  O  O    . LEU B 1 80  ? 61.054  4.118   16.219  1.00 11.28 ? 111 LEU B O    1 
ATOM   6219  C  CB   . LEU B 1 80  ? 60.707  0.824   16.735  1.00 8.91  ? 111 LEU B CB   1 
ATOM   6220  C  CG   . LEU B 1 80  ? 59.559  0.103   17.381  1.00 12.49 ? 111 LEU B CG   1 
ATOM   6221  C  CD1  . LEU B 1 80  ? 60.104  -0.649  18.593  1.00 11.83 ? 111 LEU B CD1  1 
ATOM   6222  C  CD2  . LEU B 1 80  ? 58.483  1.104   17.795  1.00 12.57 ? 111 LEU B CD2  1 
ATOM   6223  H  H    . LEU B 1 80  ? 60.504  0.330   14.247  1.00 17.00 ? 111 LEU B H    1 
ATOM   6224  N  N    . ILE B 1 81  ? 62.515  2.671   15.272  1.00 10.09 ? 112 ILE B N    1 
ATOM   6225  C  CA   . ILE B 1 81  ? 63.620  3.600   15.261  1.00 9.02  ? 112 ILE B CA   1 
ATOM   6226  C  C    . ILE B 1 81  ? 63.261  4.807   14.387  1.00 9.45  ? 112 ILE B C    1 
ATOM   6227  O  O    . ILE B 1 81  ? 63.258  5.951   14.873  1.00 10.64 ? 112 ILE B O    1 
ATOM   6228  C  CB   . ILE B 1 81  ? 64.944  2.872   14.785  1.00 8.57  ? 112 ILE B CB   1 
ATOM   6229  C  CG1  . ILE B 1 81  ? 65.258  1.678   15.713  1.00 5.71  ? 112 ILE B CG1  1 
ATOM   6230  C  CG2  . ILE B 1 81  ? 66.157  3.823   14.772  1.00 5.56  ? 112 ILE B CG2  1 
ATOM   6231  C  CD1  . ILE B 1 81  ? 65.803  2.063   17.056  1.00 2.04  ? 112 ILE B CD1  1 
ATOM   6232  H  H    . ILE B 1 81  ? 62.655  1.775   14.900  1.00 17.00 ? 112 ILE B H    1 
ATOM   6233  N  N    . MET B 1 82  ? 62.868  4.543   13.139  1.00 7.85  ? 113 MET B N    1 
ATOM   6234  C  CA   . MET B 1 82  ? 62.518  5.587   12.181  1.00 7.10  ? 113 MET B CA   1 
ATOM   6235  C  C    . MET B 1 82  ? 61.485  6.516   12.787  1.00 9.24  ? 113 MET B C    1 
ATOM   6236  O  O    . MET B 1 82  ? 61.641  7.772   12.786  1.00 7.43  ? 113 MET B O    1 
ATOM   6237  C  CB   . MET B 1 82  ? 61.952  4.963   10.912  1.00 3.93  ? 113 MET B CB   1 
ATOM   6238  C  CG   . MET B 1 82  ? 61.638  5.966   9.832   1.00 5.55  ? 113 MET B CG   1 
ATOM   6239  S  SD   . MET B 1 82  ? 63.094  6.561   8.978   1.00 9.67  ? 113 MET B SD   1 
ATOM   6240  C  CE   . MET B 1 82  ? 62.934  8.401   9.121   1.00 4.73  ? 113 MET B CE   1 
ATOM   6241  H  H    . MET B 1 82  ? 62.817  3.624   12.864  1.00 17.00 ? 113 MET B H    1 
ATOM   6242  N  N    . LYS B 1 83  ? 60.462  5.871   13.360  1.00 12.18 ? 114 LYS B N    1 
ATOM   6243  C  CA   . LYS B 1 83  ? 59.334  6.553   13.999  1.00 12.81 ? 114 LYS B CA   1 
ATOM   6244  C  C    . LYS B 1 83  ? 59.898  7.560   14.996  1.00 12.54 ? 114 LYS B C    1 
ATOM   6245  O  O    . LYS B 1 83  ? 59.543  8.747   14.979  1.00 11.69 ? 114 LYS B O    1 
ATOM   6246  C  CB   . LYS B 1 83  ? 58.425  5.547   14.720  1.00 10.03 ? 114 LYS B CB   1 
ATOM   6247  C  CG   . LYS B 1 83  ? 56.971  6.008   14.752  1.00 16.19 ? 114 LYS B CG   1 
ATOM   6248  C  CD   . LYS B 1 83  ? 56.054  5.176   15.661  1.00 17.31 ? 114 LYS B CD   1 
ATOM   6249  C  CE   . LYS B 1 83  ? 56.380  5.434   17.143  1.00 20.09 ? 114 LYS B CE   1 
ATOM   6250  N  NZ   . LYS B 1 83  ? 55.476  4.705   18.093  1.00 16.36 ? 114 LYS B NZ   1 
ATOM   6251  H  H    . LYS B 1 83  ? 60.476  4.899   13.356  1.00 17.00 ? 114 LYS B H    1 
ATOM   6252  H  HZ1  . LYS B 1 83  ? 54.494  5.004   17.935  1.00 17.00 ? 114 LYS B HZ1  1 
ATOM   6253  H  HZ2  . LYS B 1 83  ? 55.564  3.679   17.946  1.00 17.00 ? 114 LYS B HZ2  1 
ATOM   6254  H  HZ3  . LYS B 1 83  ? 55.763  4.943   19.065  1.00 17.00 ? 114 LYS B HZ3  1 
ATOM   6255  N  N    . TYR B 1 84  ? 60.874  7.112   15.780  1.00 11.38 ? 115 TYR B N    1 
ATOM   6256  C  CA   . TYR B 1 84  ? 61.440  7.997   16.762  1.00 9.63  ? 115 TYR B CA   1 
ATOM   6257  C  C    . TYR B 1 84  ? 62.246  9.126   16.203  1.00 9.58  ? 115 TYR B C    1 
ATOM   6258  O  O    . TYR B 1 84  ? 62.105  10.244  16.694  1.00 8.41  ? 115 TYR B O    1 
ATOM   6259  C  CB   . TYR B 1 84  ? 62.287  7.277   17.785  1.00 12.14 ? 115 TYR B CB   1 
ATOM   6260  C  CG   . TYR B 1 84  ? 62.685  8.234   18.866  1.00 11.71 ? 115 TYR B CG   1 
ATOM   6261  C  CD1  . TYR B 1 84  ? 63.793  9.064   18.726  1.00 13.73 ? 115 TYR B CD1  1 
ATOM   6262  C  CD2  . TYR B 1 84  ? 61.877  8.399   19.965  1.00 13.43 ? 115 TYR B CD2  1 
ATOM   6263  C  CE1  . TYR B 1 84  ? 64.062  10.044  19.649  1.00 17.08 ? 115 TYR B CE1  1 
ATOM   6264  C  CE2  . TYR B 1 84  ? 62.133  9.367   20.894  1.00 18.32 ? 115 TYR B CE2  1 
ATOM   6265  C  CZ   . TYR B 1 84  ? 63.214  10.196  20.736  1.00 19.01 ? 115 TYR B CZ   1 
ATOM   6266  O  OH   . TYR B 1 84  ? 63.374  11.209  21.656  1.00 23.15 ? 115 TYR B OH   1 
ATOM   6267  H  H    . TYR B 1 84  ? 61.206  6.191   15.691  1.00 17.00 ? 115 TYR B H    1 
ATOM   6268  H  HH   . TYR B 1 84  ? 64.166  11.707  21.434  1.00 17.00 ? 115 TYR B HH   1 
ATOM   6269  N  N    . VAL B 1 85  ? 63.137  8.846   15.243  1.00 10.46 ? 116 VAL B N    1 
ATOM   6270  C  CA   . VAL B 1 85  ? 63.969  9.919   14.679  1.00 11.69 ? 116 VAL B CA   1 
ATOM   6271  C  C    . VAL B 1 85  ? 63.012  10.990  14.245  1.00 11.49 ? 116 VAL B C    1 
ATOM   6272  O  O    . VAL B 1 85  ? 63.149  12.142  14.662  1.00 11.49 ? 116 VAL B O    1 
ATOM   6273  C  CB   . VAL B 1 85  ? 64.872  9.510   13.435  1.00 13.75 ? 116 VAL B CB   1 
ATOM   6274  C  CG1  . VAL B 1 85  ? 65.919  8.437   13.808  1.00 13.82 ? 116 VAL B CG1  1 
ATOM   6275  C  CG2  . VAL B 1 85  ? 64.029  9.083   12.237  1.00 11.02 ? 116 VAL B CG2  1 
ATOM   6276  H  H    . VAL B 1 85  ? 63.216  7.924   14.923  1.00 17.00 ? 116 VAL B H    1 
ATOM   6277  N  N    . LEU B 1 86  ? 61.953  10.544  13.558  1.00 12.59 ? 117 LEU B N    1 
ATOM   6278  C  CA   . LEU B 1 86  ? 60.908  11.413  13.033  1.00 11.27 ? 117 LEU B CA   1 
ATOM   6279  C  C    . LEU B 1 86  ? 60.269  12.270  14.119  1.00 11.19 ? 117 LEU B C    1 
ATOM   6280  O  O    . LEU B 1 86  ? 60.516  13.488  14.219  1.00 10.76 ? 117 LEU B O    1 
ATOM   6281  C  CB   . LEU B 1 86  ? 59.870  10.564  12.323  1.00 7.18  ? 117 LEU B CB   1 
ATOM   6282  C  CG   . LEU B 1 86  ? 59.864  10.687  10.803  1.00 8.33  ? 117 LEU B CG   1 
ATOM   6283  C  CD1  . LEU B 1 86  ? 61.238  10.969  10.285  1.00 9.75  ? 117 LEU B CD1  1 
ATOM   6284  C  CD2  . LEU B 1 86  ? 59.311  9.426   10.153  1.00 9.27  ? 117 LEU B CD2  1 
ATOM   6285  H  H    . LEU B 1 86  ? 61.865  9.582   13.414  1.00 17.00 ? 117 LEU B H    1 
ATOM   6286  N  N    . THR B 1 87  ? 59.503  11.603  14.965  1.00 11.42 ? 118 THR B N    1 
ATOM   6287  C  CA   . THR B 1 87  ? 58.801  12.242  16.066  1.00 13.75 ? 118 THR B CA   1 
ATOM   6288  C  C    . THR B 1 87  ? 59.593  13.331  16.857  1.00 16.14 ? 118 THR B C    1 
ATOM   6289  O  O    . THR B 1 87  ? 59.293  14.536  16.747  1.00 17.04 ? 118 THR B O    1 
ATOM   6290  C  CB   . THR B 1 87  ? 58.173  11.148  17.017  1.00 14.14 ? 118 THR B CB   1 
ATOM   6291  O  OG1  . THR B 1 87  ? 59.178  10.211  17.461  1.00 12.78 ? 118 THR B OG1  1 
ATOM   6292  C  CG2  . THR B 1 87  ? 57.108  10.366  16.253  1.00 12.47 ? 118 THR B CG2  1 
ATOM   6293  H  H    . THR B 1 87  ? 59.411  10.639  14.850  1.00 17.00 ? 118 THR B H    1 
ATOM   6294  H  HG1  . THR B 1 87  ? 59.447  9.697   16.686  1.00 17.00 ? 118 THR B HG1  1 
ATOM   6295  N  N    . SER B 1 88  ? 60.638  12.923  17.575  1.00 16.54 ? 119 SER B N    1 
ATOM   6296  C  CA   . SER B 1 88  ? 61.424  13.828  18.407  1.00 14.64 ? 119 SER B CA   1 
ATOM   6297  C  C    . SER B 1 88  ? 62.086  14.948  17.647  1.00 16.58 ? 119 SER B C    1 
ATOM   6298  O  O    . SER B 1 88  ? 61.935  16.110  18.016  1.00 19.07 ? 119 SER B O    1 
ATOM   6299  C  CB   . SER B 1 88  ? 62.483  13.042  19.119  1.00 14.90 ? 119 SER B CB   1 
ATOM   6300  O  OG   . SER B 1 88  ? 63.159  12.253  18.147  1.00 14.42 ? 119 SER B OG   1 
ATOM   6301  H  H    . SER B 1 88  ? 60.881  11.975  17.522  1.00 17.00 ? 119 SER B H    1 
ATOM   6302  H  HG   . SER B 1 88  ? 62.577  11.572  17.805  1.00 17.00 ? 119 SER B HG   1 
ATOM   6303  N  N    . ARG B 1 89  ? 62.773  14.612  16.562  1.00 16.01 ? 120 ARG B N    1 
ATOM   6304  C  CA   . ARG B 1 89  ? 63.488  15.612  15.762  1.00 17.17 ? 120 ARG B CA   1 
ATOM   6305  C  C    . ARG B 1 89  ? 62.727  16.910  15.499  1.00 17.53 ? 120 ARG B C    1 
ATOM   6306  O  O    . ARG B 1 89  ? 63.307  18.015  15.575  1.00 16.70 ? 120 ARG B O    1 
ATOM   6307  C  CB   . ARG B 1 89  ? 63.928  15.013  14.410  1.00 19.29 ? 120 ARG B CB   1 
ATOM   6308  C  CG   . ARG B 1 89  ? 65.041  15.800  13.680  1.00 22.61 ? 120 ARG B CG   1 
ATOM   6309  C  CD   . ARG B 1 89  ? 66.392  15.027  13.540  1.00 25.05 ? 120 ARG B CD   1 
ATOM   6310  N  NE   . ARG B 1 89  ? 67.012  14.670  14.824  1.00 29.39 ? 120 ARG B NE   1 
ATOM   6311  C  CZ   . ARG B 1 89  ? 67.775  13.588  15.041  1.00 31.52 ? 120 ARG B CZ   1 
ATOM   6312  N  NH1  . ARG B 1 89  ? 68.059  12.726  14.060  1.00 31.95 ? 120 ARG B NH1  1 
ATOM   6313  N  NH2  . ARG B 1 89  ? 68.191  13.311  16.273  1.00 32.63 ? 120 ARG B NH2  1 
ATOM   6314  H  H    . ARG B 1 89  ? 62.808  13.669  16.280  1.00 17.00 ? 120 ARG B H    1 
ATOM   6315  H  HE   . ARG B 1 89  ? 66.857  15.268  15.585  1.00 17.00 ? 120 ARG B HE   1 
ATOM   6316  H  HH11 . ARG B 1 89  ? 67.702  12.888  13.142  1.00 17.00 ? 120 ARG B HH11 1 
ATOM   6317  H  HH12 . ARG B 1 89  ? 68.632  11.927  14.246  1.00 17.00 ? 120 ARG B HH12 1 
ATOM   6318  H  HH21 . ARG B 1 89  ? 67.935  13.907  17.035  1.00 17.00 ? 120 ARG B HH21 1 
ATOM   6319  H  HH22 . ARG B 1 89  ? 68.760  12.507  16.441  1.00 17.00 ? 120 ARG B HH22 1 
ATOM   6320  N  N    . SER B 1 90  ? 61.426  16.784  15.233  1.00 15.81 ? 121 SER B N    1 
ATOM   6321  C  CA   . SER B 1 90  ? 60.624  17.950  14.903  1.00 14.02 ? 121 SER B CA   1 
ATOM   6322  C  C    . SER B 1 90  ? 59.774  18.621  15.975  1.00 13.98 ? 121 SER B C    1 
ATOM   6323  O  O    . SER B 1 90  ? 58.979  19.534  15.671  1.00 16.36 ? 121 SER B O    1 
ATOM   6324  C  CB   . SER B 1 90  ? 59.810  17.693  13.630  1.00 13.57 ? 121 SER B CB   1 
ATOM   6325  O  OG   . SER B 1 90  ? 60.667  17.499  12.509  1.00 10.71 ? 121 SER B OG   1 
ATOM   6326  H  H    . SER B 1 90  ? 61.002  15.897  15.263  1.00 17.00 ? 121 SER B H    1 
ATOM   6327  H  HG   . SER B 1 90  ? 61.221  16.732  12.677  1.00 17.00 ? 121 SER B HG   1 
ATOM   6328  N  N    . TYR B 1 91  ? 59.943  18.237  17.231  1.00 11.84 ? 122 TYR B N    1 
ATOM   6329  C  CA   . TYR B 1 91  ? 59.186  18.934  18.260  1.00 12.30 ? 122 TYR B CA   1 
ATOM   6330  C  C    . TYR B 1 91  ? 59.617  20.433  18.256  1.00 11.07 ? 122 TYR B C    1 
ATOM   6331  O  O    . TYR B 1 91  ? 58.888  21.301  18.727  1.00 6.88  ? 122 TYR B O    1 
ATOM   6332  C  CB   . TYR B 1 91  ? 59.452  18.299  19.622  1.00 14.27 ? 122 TYR B CB   1 
ATOM   6333  C  CG   . TYR B 1 91  ? 60.654  18.849  20.378  1.00 16.73 ? 122 TYR B CG   1 
ATOM   6334  C  CD1  . TYR B 1 91  ? 60.590  20.084  21.016  1.00 18.78 ? 122 TYR B CD1  1 
ATOM   6335  C  CD2  . TYR B 1 91  ? 61.833  18.121  20.491  1.00 17.27 ? 122 TYR B CD2  1 
ATOM   6336  C  CE1  . TYR B 1 91  ? 61.673  20.583  21.747  1.00 21.56 ? 122 TYR B CE1  1 
ATOM   6337  C  CE2  . TYR B 1 91  ? 62.923  18.604  21.221  1.00 19.20 ? 122 TYR B CE2  1 
ATOM   6338  C  CZ   . TYR B 1 91  ? 62.838  19.838  21.844  1.00 21.32 ? 122 TYR B CZ   1 
ATOM   6339  O  OH   . TYR B 1 91  ? 63.917  20.352  22.539  1.00 21.82 ? 122 TYR B OH   1 
ATOM   6340  H  H    . TYR B 1 91  ? 60.554  17.501  17.461  1.00 17.00 ? 122 TYR B H    1 
ATOM   6341  H  HH   . TYR B 1 91  ? 63.677  21.200  22.939  1.00 17.00 ? 122 TYR B HH   1 
ATOM   6342  N  N    . LEU B 1 92  ? 60.826  20.698  17.733  1.00 13.13 ? 123 LEU B N    1 
ATOM   6343  C  CA   . LEU B 1 92  ? 61.434  22.049  17.630  1.00 13.23 ? 123 LEU B CA   1 
ATOM   6344  C  C    . LEU B 1 92  ? 60.819  23.038  16.603  1.00 12.67 ? 123 LEU B C    1 
ATOM   6345  O  O    . LEU B 1 92  ? 61.359  24.120  16.378  1.00 11.95 ? 123 LEU B O    1 
ATOM   6346  C  CB   . LEU B 1 92  ? 62.915  21.935  17.273  1.00 8.96  ? 123 LEU B CB   1 
ATOM   6347  C  CG   . LEU B 1 92  ? 63.932  21.194  18.133  1.00 9.96  ? 123 LEU B CG   1 
ATOM   6348  C  CD1  . LEU B 1 92  ? 64.034  21.804  19.534  1.00 10.46 ? 123 LEU B CD1  1 
ATOM   6349  C  CD2  . LEU B 1 92  ? 63.577  19.725  18.182  1.00 10.97 ? 123 LEU B CD2  1 
ATOM   6350  H  H    . LEU B 1 92  ? 61.335  19.947  17.376  1.00 17.00 ? 123 LEU B H    1 
ATOM   6351  N  N    . ILE B 1 93  ? 59.736  22.672  15.927  1.00 13.18 ? 124 ILE B N    1 
ATOM   6352  C  CA   . ILE B 1 93  ? 59.182  23.607  14.958  1.00 12.45 ? 124 ILE B CA   1 
ATOM   6353  C  C    . ILE B 1 93  ? 57.818  24.186  15.316  1.00 10.84 ? 124 ILE B C    1 
ATOM   6354  O  O    . ILE B 1 93  ? 56.901  23.479  15.723  1.00 10.33 ? 124 ILE B O    1 
ATOM   6355  C  CB   . ILE B 1 93  ? 59.144  23.011  13.549  1.00 8.89  ? 124 ILE B CB   1 
ATOM   6356  C  CG1  . ILE B 1 93  ? 60.537  22.524  13.166  1.00 6.79  ? 124 ILE B CG1  1 
ATOM   6357  C  CG2  . ILE B 1 93  ? 58.660  24.053  12.547  1.00 6.52  ? 124 ILE B CG2  1 
ATOM   6358  C  CD1  . ILE B 1 93  ? 60.848  21.132  13.654  1.00 2.18  ? 124 ILE B CD1  1 
ATOM   6359  H  H    . ILE B 1 93  ? 59.276  21.821  16.091  1.00 17.00 ? 124 ILE B H    1 
ATOM   6360  N  N    . ASP B 1 94  ? 57.719  25.493  15.158  1.00 10.27 ? 125 ASP B N    1 
ATOM   6361  C  CA   . ASP B 1 94  ? 56.510  26.222  15.444  1.00 10.53 ? 125 ASP B CA   1 
ATOM   6362  C  C    . ASP B 1 94  ? 55.607  26.182  14.210  1.00 11.45 ? 125 ASP B C    1 
ATOM   6363  O  O    . ASP B 1 94  ? 55.643  27.098  13.373  1.00 15.17 ? 125 ASP B O    1 
ATOM   6364  C  CB   . ASP B 1 94  ? 56.850  27.686  15.817  1.00 10.61 ? 125 ASP B CB   1 
ATOM   6365  C  CG   . ASP B 1 94  ? 57.099  27.881  17.317  1.00 10.56 ? 125 ASP B CG   1 
ATOM   6366  O  OD1  . ASP B 1 94  ? 57.129  26.875  18.066  1.00 9.68  ? 125 ASP B OD1  1 
ATOM   6367  O  OD2  . ASP B 1 94  ? 57.262  29.050  17.746  1.00 9.80  ? 125 ASP B OD2  1 
ATOM   6368  H  H    . ASP B 1 94  ? 58.495  25.987  14.830  1.00 17.00 ? 125 ASP B H    1 
ATOM   6369  N  N    . SER B 1 95  ? 54.836  25.108  14.057  1.00 8.55  ? 126 SER B N    1 
ATOM   6370  C  CA   . SER B 1 95  ? 53.921  25.003  12.934  1.00 4.29  ? 126 SER B CA   1 
ATOM   6371  C  C    . SER B 1 95  ? 52.619  24.675  13.592  1.00 4.26  ? 126 SER B C    1 
ATOM   6372  O  O    . SER B 1 95  ? 52.550  23.695  14.333  1.00 2.83  ? 126 SER B O    1 
ATOM   6373  C  CB   . SER B 1 95  ? 54.298  23.870  11.998  1.00 3.13  ? 126 SER B CB   1 
ATOM   6374  O  OG   . SER B 1 95  ? 53.879  24.147  10.674  1.00 2.00  ? 126 SER B OG   1 
ATOM   6375  H  H    . SER B 1 95  ? 54.864  24.375  14.714  1.00 17.00 ? 126 SER B H    1 
ATOM   6376  H  HG   . SER B 1 95  ? 54.165  23.411  10.108  1.00 17.00 ? 126 SER B HG   1 
ATOM   6377  N  N    . PRO B 1 96  ? 51.595  25.547  13.434  1.00 5.31  ? 127 PRO B N    1 
ATOM   6378  C  CA   . PRO B 1 96  ? 51.551  26.816  12.688  1.00 4.41  ? 127 PRO B CA   1 
ATOM   6379  C  C    . PRO B 1 96  ? 52.640  27.831  12.970  1.00 2.00  ? 127 PRO B C    1 
ATOM   6380  O  O    . PRO B 1 96  ? 52.920  28.161  14.118  1.00 2.01  ? 127 PRO B O    1 
ATOM   6381  C  CB   . PRO B 1 96  ? 50.181  27.361  13.055  1.00 3.15  ? 127 PRO B CB   1 
ATOM   6382  C  CG   . PRO B 1 96  ? 49.383  26.148  13.021  1.00 5.00  ? 127 PRO B CG   1 
ATOM   6383  C  CD   . PRO B 1 96  ? 50.224  25.164  13.812  1.00 3.03  ? 127 PRO B CD   1 
ATOM   6384  N  N    . PRO B 1 97  ? 53.249  28.342  11.906  1.00 2.00  ? 128 PRO B N    1 
ATOM   6385  C  CA   . PRO B 1 97  ? 54.324  29.329  11.914  1.00 4.24  ? 128 PRO B CA   1 
ATOM   6386  C  C    . PRO B 1 97  ? 54.105  30.608  12.734  1.00 5.35  ? 128 PRO B C    1 
ATOM   6387  O  O    . PRO B 1 97  ? 53.015  31.184  12.735  1.00 5.71  ? 128 PRO B O    1 
ATOM   6388  C  CB   . PRO B 1 97  ? 54.492  29.658  10.418  1.00 3.22  ? 128 PRO B CB   1 
ATOM   6389  C  CG   . PRO B 1 97  ? 53.204  29.279  9.824   1.00 2.00  ? 128 PRO B CG   1 
ATOM   6390  C  CD   . PRO B 1 97  ? 52.889  28.007  10.525  1.00 2.04  ? 128 PRO B CD   1 
ATOM   6391  N  N    . THR B 1 98  ? 55.147  31.001  13.463  1.00 5.15  ? 129 THR B N    1 
ATOM   6392  C  CA   . THR B 1 98  ? 55.139  32.239  14.231  1.00 6.51  ? 129 THR B CA   1 
ATOM   6393  C  C    . THR B 1 98  ? 56.348  33.003  13.711  1.00 8.00  ? 129 THR B C    1 
ATOM   6394  O  O    . THR B 1 98  ? 57.364  32.392  13.377  1.00 10.42 ? 129 THR B O    1 
ATOM   6395  C  CB   . THR B 1 98  ? 55.373  32.024  15.743  1.00 3.92  ? 129 THR B CB   1 
ATOM   6396  O  OG1  . THR B 1 98  ? 56.576  31.278  15.948  1.00 4.54  ? 129 THR B OG1  1 
ATOM   6397  C  CG2  . THR B 1 98  ? 54.232  31.305  16.365  1.00 5.05  ? 129 THR B CG2  1 
ATOM   6398  H  H    . THR B 1 98  ? 55.965  30.464  13.502  1.00 17.00 ? 129 THR B H    1 
ATOM   6399  H  HG1  . THR B 1 98  ? 57.325  31.575  15.410  1.00 17.00 ? 129 THR B HG1  1 
ATOM   6400  N  N    . TYR B 1 99  ? 56.234  34.320  13.620  1.00 6.62  ? 130 TYR B N    1 
ATOM   6401  C  CA   . TYR B 1 99  ? 57.327  35.199  13.192  1.00 5.34  ? 130 TYR B CA   1 
ATOM   6402  C  C    . TYR B 1 99  ? 57.815  35.155  11.754  1.00 3.89  ? 130 TYR B C    1 
ATOM   6403  O  O    . TYR B 1 99  ? 57.578  34.217  10.990  1.00 3.67  ? 130 TYR B O    1 
ATOM   6404  C  CB   . TYR B 1 99  ? 58.553  35.050  14.105  1.00 5.48  ? 130 TYR B CB   1 
ATOM   6405  C  CG   . TYR B 1 99  ? 58.272  34.875  15.590  1.00 3.67  ? 130 TYR B CG   1 
ATOM   6406  C  CD1  . TYR B 1 99  ? 57.979  35.970  16.403  1.00 2.00  ? 130 TYR B CD1  1 
ATOM   6407  C  CD2  . TYR B 1 99  ? 58.339  33.605  16.174  1.00 2.00  ? 130 TYR B CD2  1 
ATOM   6408  C  CE1  . TYR B 1 99  ? 57.770  35.801  17.746  1.00 2.00  ? 130 TYR B CE1  1 
ATOM   6409  C  CE2  . TYR B 1 99  ? 58.131  33.427  17.504  1.00 2.00  ? 130 TYR B CE2  1 
ATOM   6410  C  CZ   . TYR B 1 99  ? 57.847  34.521  18.294  1.00 2.00  ? 130 TYR B CZ   1 
ATOM   6411  O  OH   . TYR B 1 99  ? 57.633  34.312  19.634  1.00 2.01  ? 130 TYR B OH   1 
ATOM   6412  H  H    . TYR B 1 99  ? 55.361  34.720  13.817  1.00 17.00 ? 130 TYR B H    1 
ATOM   6413  H  HH   . TYR B 1 99  ? 57.552  35.162  20.073  1.00 17.00 ? 130 TYR B HH   1 
ATOM   6414  N  N    . ASN B 1 100 ? 58.513  36.225  11.426  1.00 4.67  ? 131 ASN B N    1 
ATOM   6415  C  CA   . ASN B 1 100 ? 59.124  36.463  10.126  1.00 7.08  ? 131 ASN B CA   1 
ATOM   6416  C  C    . ASN B 1 100 ? 59.958  37.753  10.316  1.00 6.62  ? 131 ASN B C    1 
ATOM   6417  O  O    . ASN B 1 100 ? 59.966  38.325  11.416  1.00 7.21  ? 131 ASN B O    1 
ATOM   6418  C  CB   . ASN B 1 100 ? 58.058  36.637  9.030   1.00 5.65  ? 131 ASN B CB   1 
ATOM   6419  C  CG   . ASN B 1 100 ? 57.161  37.818  9.279   1.00 6.74  ? 131 ASN B CG   1 
ATOM   6420  O  OD1  . ASN B 1 100 ? 57.596  38.880  9.722   1.00 6.14  ? 131 ASN B OD1  1 
ATOM   6421  N  ND2  . ASN B 1 100 ? 55.897  37.643  8.991   1.00 9.81  ? 131 ASN B ND2  1 
ATOM   6422  H  H    . ASN B 1 100 ? 58.664  36.927  12.101  1.00 17.00 ? 131 ASN B H    1 
ATOM   6423  H  HD21 . ASN B 1 100 ? 55.271  38.378  9.118   1.00 17.00 ? 131 ASN B HD21 1 
ATOM   6424  H  HD22 . ASN B 1 100 ? 55.623  36.761  8.649   1.00 17.00 ? 131 ASN B HD22 1 
ATOM   6425  N  N    . VAL B 1 101 ? 60.575  38.246  9.243   1.00 5.92  ? 132 VAL B N    1 
ATOM   6426  C  CA   . VAL B 1 101 ? 61.419  39.430  9.310   1.00 5.52  ? 132 VAL B CA   1 
ATOM   6427  C  C    . VAL B 1 101 ? 60.821  40.660  9.981   1.00 6.76  ? 132 VAL B C    1 
ATOM   6428  O  O    . VAL B 1 101 ? 61.537  41.373  10.689  1.00 8.13  ? 132 VAL B O    1 
ATOM   6429  C  CB   . VAL B 1 101 ? 61.929  39.833  7.932   1.00 4.73  ? 132 VAL B CB   1 
ATOM   6430  C  CG1  . VAL B 1 101 ? 62.965  40.908  8.069   1.00 3.85  ? 132 VAL B CG1  1 
ATOM   6431  C  CG2  . VAL B 1 101 ? 62.509  38.629  7.202   1.00 7.85  ? 132 VAL B CG2  1 
ATOM   6432  H  H    . VAL B 1 101 ? 60.460  37.776  8.394   1.00 17.00 ? 132 VAL B H    1 
ATOM   6433  N  N    . HIS B 1 102 ? 59.539  40.944  9.753   1.00 7.49  ? 133 HIS B N    1 
ATOM   6434  C  CA   . HIS B 1 102 ? 58.925  42.127  10.397  1.00 8.71  ? 133 HIS B CA   1 
ATOM   6435  C  C    . HIS B 1 102 ? 58.138  41.856  11.670  1.00 6.40  ? 133 HIS B C    1 
ATOM   6436  O  O    . HIS B 1 102 ? 57.636  42.816  12.260  1.00 4.40  ? 133 HIS B O    1 
ATOM   6437  C  CB   . HIS B 1 102 ? 57.987  42.929  9.474   1.00 12.31 ? 133 HIS B CB   1 
ATOM   6438  C  CG   . HIS B 1 102 ? 58.624  43.389  8.204   1.00 20.18 ? 133 HIS B CG   1 
ATOM   6439  N  ND1  . HIS B 1 102 ? 58.086  43.119  6.961   1.00 24.47 ? 133 HIS B ND1  1 
ATOM   6440  C  CD2  . HIS B 1 102 ? 59.763  44.084  7.977   1.00 22.96 ? 133 HIS B CD2  1 
ATOM   6441  C  CE1  . HIS B 1 102 ? 58.869  43.624  6.023   1.00 26.48 ? 133 HIS B CE1  1 
ATOM   6442  N  NE2  . HIS B 1 102 ? 59.894  44.215  6.613   1.00 25.46 ? 133 HIS B NE2  1 
ATOM   6443  H  H    . HIS B 1 102 ? 58.990  40.327  9.228   1.00 17.00 ? 133 HIS B H    1 
ATOM   6444  H  HD1  . HIS B 1 102 ? 57.252  42.657  6.787   1.00 17.00 ? 133 HIS B HD1  1 
ATOM   6445  H  HE2  . HIS B 1 102 ? 60.632  44.673  6.157   1.00 17.00 ? 133 HIS B HE2  1 
ATOM   6446  N  N    . TYR B 1 103 ? 58.005  40.590  12.085  1.00 3.84  ? 134 TYR B N    1 
ATOM   6447  C  CA   . TYR B 1 103 ? 57.232  40.306  13.287  1.00 2.87  ? 134 TYR B CA   1 
ATOM   6448  C  C    . TYR B 1 103 ? 57.944  39.552  14.363  1.00 2.00  ? 134 TYR B C    1 
ATOM   6449  O  O    . TYR B 1 103 ? 58.253  38.374  14.227  1.00 2.00  ? 134 TYR B O    1 
ATOM   6450  C  CB   . TYR B 1 103 ? 55.887  39.653  12.943  1.00 3.55  ? 134 TYR B CB   1 
ATOM   6451  C  CG   . TYR B 1 103 ? 54.998  40.597  12.170  1.00 2.02  ? 134 TYR B CG   1 
ATOM   6452  C  CD1  . TYR B 1 103 ? 54.174  41.510  12.835  1.00 2.00  ? 134 TYR B CD1  1 
ATOM   6453  C  CD2  . TYR B 1 103 ? 55.067  40.664  10.778  1.00 4.03  ? 134 TYR B CD2  1 
ATOM   6454  C  CE1  . TYR B 1 103 ? 53.441  42.479  12.155  1.00 2.00  ? 134 TYR B CE1  1 
ATOM   6455  C  CE2  . TYR B 1 103 ? 54.341  41.630  10.070  1.00 4.34  ? 134 TYR B CE2  1 
ATOM   6456  C  CZ   . TYR B 1 103 ? 53.529  42.534  10.772  1.00 3.03  ? 134 TYR B CZ   1 
ATOM   6457  O  OH   . TYR B 1 103 ? 52.814  43.475  10.068  1.00 3.13  ? 134 TYR B OH   1 
ATOM   6458  H  H    . TYR B 1 103 ? 58.447  39.852  11.610  1.00 17.00 ? 134 TYR B H    1 
ATOM   6459  H  HH   . TYR B 1 103 ? 53.056  43.456  9.135   1.00 17.00 ? 134 TYR B HH   1 
ATOM   6460  N  N    . GLY B 1 104 ? 58.222  40.281  15.433  1.00 2.00  ? 135 GLY B N    1 
ATOM   6461  C  CA   . GLY B 1 104 ? 58.901  39.709  16.579  1.00 2.31  ? 135 GLY B CA   1 
ATOM   6462  C  C    . GLY B 1 104 ? 57.845  39.249  17.553  1.00 2.10  ? 135 GLY B C    1 
ATOM   6463  O  O    . GLY B 1 104 ? 58.106  38.639  18.578  1.00 2.05  ? 135 GLY B O    1 
ATOM   6464  H  H    . GLY B 1 104 ? 57.983  41.230  15.418  1.00 17.00 ? 135 GLY B H    1 
ATOM   6465  N  N    . TYR B 1 105 ? 56.618  39.613  17.249  1.00 2.62  ? 136 TYR B N    1 
ATOM   6466  C  CA   . TYR B 1 105 ? 55.515  39.211  18.078  1.00 2.00  ? 136 TYR B CA   1 
ATOM   6467  C  C    . TYR B 1 105 ? 54.608  38.375  17.209  1.00 2.00  ? 136 TYR B C    1 
ATOM   6468  O  O    . TYR B 1 105 ? 54.546  38.586  15.997  1.00 2.00  ? 136 TYR B O    1 
ATOM   6469  C  CB   . TYR B 1 105 ? 54.811  40.423  18.664  1.00 2.28  ? 136 TYR B CB   1 
ATOM   6470  C  CG   . TYR B 1 105 ? 54.564  41.551  17.704  1.00 3.15  ? 136 TYR B CG   1 
ATOM   6471  C  CD1  . TYR B 1 105 ? 54.195  41.322  16.387  1.00 4.60  ? 136 TYR B CD1  1 
ATOM   6472  C  CD2  . TYR B 1 105 ? 54.647  42.861  18.127  1.00 3.62  ? 136 TYR B CD2  1 
ATOM   6473  C  CE1  . TYR B 1 105 ? 53.915  42.373  15.529  1.00 2.06  ? 136 TYR B CE1  1 
ATOM   6474  C  CE2  . TYR B 1 105 ? 54.372  43.908  17.272  1.00 2.28  ? 136 TYR B CE2  1 
ATOM   6475  C  CZ   . TYR B 1 105 ? 54.011  43.648  15.978  1.00 2.00  ? 136 TYR B CZ   1 
ATOM   6476  O  OH   . TYR B 1 105 ? 53.774  44.671  15.115  1.00 7.27  ? 136 TYR B OH   1 
ATOM   6477  H  H    . TYR B 1 105 ? 56.429  40.100  16.428  1.00 17.00 ? 136 TYR B H    1 
ATOM   6478  H  HH   . TYR B 1 105 ? 53.542  44.340  14.240  1.00 17.00 ? 136 TYR B HH   1 
ATOM   6479  N  N    . LYS B 1 106 ? 53.893  37.445  17.838  1.00 2.00  ? 137 LYS B N    1 
ATOM   6480  C  CA   . LYS B 1 106 ? 53.045  36.494  17.135  1.00 2.00  ? 137 LYS B CA   1 
ATOM   6481  C  C    . LYS B 1 106 ? 52.313  36.979  15.895  1.00 2.64  ? 137 LYS B C    1 
ATOM   6482  O  O    . LYS B 1 106 ? 52.483  36.355  14.857  1.00 6.72  ? 137 LYS B O    1 
ATOM   6483  C  CB   . LYS B 1 106 ? 52.168  35.747  18.115  1.00 2.00  ? 137 LYS B CB   1 
ATOM   6484  C  CG   . LYS B 1 106 ? 52.981  35.008  19.171  1.00 2.00  ? 137 LYS B CG   1 
ATOM   6485  C  CD   . LYS B 1 106 ? 53.447  33.686  18.642  1.00 2.00  ? 137 LYS B CD   1 
ATOM   6486  C  CE   . LYS B 1 106 ? 54.165  32.861  19.686  1.00 2.00  ? 137 LYS B CE   1 
ATOM   6487  N  NZ   . LYS B 1 106 ? 53.338  32.528  20.894  1.00 2.90  ? 137 LYS B NZ   1 
ATOM   6488  H  H    . LYS B 1 106 ? 53.937  37.410  18.814  1.00 17.00 ? 137 LYS B H    1 
ATOM   6489  H  HZ1  . LYS B 1 106 ? 53.007  33.394  21.366  1.00 17.00 ? 137 LYS B HZ1  1 
ATOM   6490  H  HZ2  . LYS B 1 106 ? 52.523  31.952  20.600  1.00 17.00 ? 137 LYS B HZ2  1 
ATOM   6491  H  HZ3  . LYS B 1 106 ? 53.930  31.985  21.554  1.00 17.00 ? 137 LYS B HZ3  1 
ATOM   6492  N  N    . SER B 1 107 ? 51.518  38.053  15.984  1.00 2.00  ? 138 SER B N    1 
ATOM   6493  C  CA   . SER B 1 107 ? 50.805  38.645  14.836  1.00 2.00  ? 138 SER B CA   1 
ATOM   6494  C  C    . SER B 1 107 ? 50.063  37.810  13.774  1.00 2.00  ? 138 SER B C    1 
ATOM   6495  O  O    . SER B 1 107 ? 50.578  36.836  13.242  1.00 3.14  ? 138 SER B O    1 
ATOM   6496  C  CB   . SER B 1 107 ? 51.754  39.573  14.096  1.00 2.13  ? 138 SER B CB   1 
ATOM   6497  O  OG   . SER B 1 107 ? 51.486  39.601  12.702  1.00 2.00  ? 138 SER B OG   1 
ATOM   6498  H  H    . SER B 1 107 ? 51.386  38.467  16.854  1.00 17.00 ? 138 SER B H    1 
ATOM   6499  H  HG   . SER B 1 107 ? 52.299  39.945  12.321  1.00 17.00 ? 138 SER B HG   1 
ATOM   6500  N  N    . TRP B 1 108 ? 48.899  38.278  13.349  1.00 2.53  ? 139 TRP B N    1 
ATOM   6501  C  CA   . TRP B 1 108 ? 48.177  37.550  12.319  1.00 3.40  ? 139 TRP B CA   1 
ATOM   6502  C  C    . TRP B 1 108 ? 48.772  37.776  10.919  1.00 2.00  ? 139 TRP B C    1 
ATOM   6503  O  O    . TRP B 1 108 ? 48.561  36.973  10.020  1.00 2.00  ? 139 TRP B O    1 
ATOM   6504  C  CB   . TRP B 1 108 ? 46.677  37.879  12.326  1.00 2.91  ? 139 TRP B CB   1 
ATOM   6505  C  CG   . TRP B 1 108 ? 45.903  37.048  11.313  1.00 2.22  ? 139 TRP B CG   1 
ATOM   6506  C  CD1  . TRP B 1 108 ? 45.732  37.331  9.993   1.00 2.00  ? 139 TRP B CD1  1 
ATOM   6507  C  CD2  . TRP B 1 108 ? 45.317  35.750  11.518  1.00 2.34  ? 139 TRP B CD2  1 
ATOM   6508  N  NE1  . TRP B 1 108 ? 45.099  36.292  9.356   1.00 2.33  ? 139 TRP B NE1  1 
ATOM   6509  C  CE2  . TRP B 1 108 ? 44.830  35.311  10.267  1.00 2.00  ? 139 TRP B CE2  1 
ATOM   6510  C  CE3  . TRP B 1 108 ? 45.168  34.915  12.631  1.00 2.03  ? 139 TRP B CE3  1 
ATOM   6511  C  CZ2  . TRP B 1 108 ? 44.206  34.089  10.099  1.00 2.00  ? 139 TRP B CZ2  1 
ATOM   6512  C  CZ3  . TRP B 1 108 ? 44.550  33.694  12.459  1.00 2.00  ? 139 TRP B CZ3  1 
ATOM   6513  C  CH2  . TRP B 1 108 ? 44.077  33.291  11.203  1.00 2.00  ? 139 TRP B CH2  1 
ATOM   6514  H  H    . TRP B 1 108 ? 48.536  39.116  13.714  1.00 17.00 ? 139 TRP B H    1 
ATOM   6515  H  HE1  . TRP B 1 108 ? 44.853  36.262  8.410   1.00 17.00 ? 139 TRP B HE1  1 
ATOM   6516  N  N    . GLU B 1 109 ? 49.489  38.880  10.733  1.00 2.77  ? 140 GLU B N    1 
ATOM   6517  C  CA   . GLU B 1 109 ? 50.114  39.193  9.433   1.00 3.48  ? 140 GLU B CA   1 
ATOM   6518  C  C    . GLU B 1 109 ? 51.304  38.274  9.239   1.00 3.92  ? 140 GLU B C    1 
ATOM   6519  O  O    . GLU B 1 109 ? 51.657  37.891  8.106   1.00 3.24  ? 140 GLU B O    1 
ATOM   6520  C  CB   . GLU B 1 109 ? 50.576  40.652  9.381   1.00 2.00  ? 140 GLU B CB   1 
ATOM   6521  C  CG   . GLU B 1 109 ? 51.601  40.980  8.307   1.00 2.00  ? 140 GLU B CG   1 
ATOM   6522  C  CD   . GLU B 1 109 ? 51.071  40.891  6.900   1.00 2.00  ? 140 GLU B CD   1 
ATOM   6523  O  OE1  . GLU B 1 109 ? 49.840  40.948  6.690   1.00 2.00  ? 140 GLU B OE1  1 
ATOM   6524  O  OE2  . GLU B 1 109 ? 51.907  40.798  5.986   1.00 2.00  ? 140 GLU B OE2  1 
ATOM   6525  H  H    . GLU B 1 109 ? 49.609  39.486  11.496  1.00 17.00 ? 140 GLU B H    1 
ATOM   6526  N  N    . ALA B 1 110 ? 51.924  37.938  10.368  1.00 4.30  ? 141 ALA B N    1 
ATOM   6527  C  CA   . ALA B 1 110 ? 53.059  37.038  10.394  1.00 3.70  ? 141 ALA B CA   1 
ATOM   6528  C  C    . ALA B 1 110 ? 52.548  35.636  10.059  1.00 6.06  ? 141 ALA B C    1 
ATOM   6529  O  O    . ALA B 1 110 ? 53.296  34.810  9.531   1.00 8.92  ? 141 ALA B O    1 
ATOM   6530  C  CB   . ALA B 1 110 ? 53.692  37.055  11.758  1.00 4.70  ? 141 ALA B CB   1 
ATOM   6531  H  H    . ALA B 1 110 ? 51.587  38.283  11.221  1.00 17.00 ? 141 ALA B H    1 
ATOM   6532  N  N    . PHE B 1 111 ? 51.280  35.370  10.398  1.00 6.89  ? 142 PHE B N    1 
ATOM   6533  C  CA   . PHE B 1 111 ? 50.635  34.087  10.126  1.00 2.85  ? 142 PHE B CA   1 
ATOM   6534  C  C    . PHE B 1 111 ? 49.994  33.979  8.752   1.00 2.00  ? 142 PHE B C    1 
ATOM   6535  O  O    . PHE B 1 111 ? 49.987  32.926  8.167   1.00 3.15  ? 142 PHE B O    1 
ATOM   6536  C  CB   . PHE B 1 111 ? 49.569  33.782  11.150  1.00 2.00  ? 142 PHE B CB   1 
ATOM   6537  C  CG   . PHE B 1 111 ? 48.888  32.519  10.876  1.00 2.00  ? 142 PHE B CG   1 
ATOM   6538  C  CD1  . PHE B 1 111 ? 49.473  31.317  11.245  1.00 2.00  ? 142 PHE B CD1  1 
ATOM   6539  C  CD2  . PHE B 1 111 ? 47.727  32.499  10.139  1.00 2.00  ? 142 PHE B CD2  1 
ATOM   6540  C  CE1  . PHE B 1 111 ? 48.917  30.094  10.871  1.00 2.00  ? 142 PHE B CE1  1 
ATOM   6541  C  CE2  . PHE B 1 111 ? 47.158  31.286  9.756   1.00 4.73  ? 142 PHE B CE2  1 
ATOM   6542  C  CZ   . PHE B 1 111 ? 47.767  30.073  10.129  1.00 2.55  ? 142 PHE B CZ   1 
ATOM   6543  H  H    . PHE B 1 111 ? 50.768  36.041  10.885  1.00 17.00 ? 142 PHE B H    1 
ATOM   6544  N  N    . SER B 1 112 ? 49.376  35.050  8.285   1.00 2.02  ? 143 SER B N    1 
ATOM   6545  C  CA   . SER B 1 112 ? 48.715  35.066  6.993   1.00 2.00  ? 143 SER B CA   1 
ATOM   6546  C  C    . SER B 1 112 ? 49.617  35.234  5.788   1.00 2.00  ? 143 SER B C    1 
ATOM   6547  O  O    . SER B 1 112 ? 49.633  34.383  4.890   1.00 2.54  ? 143 SER B O    1 
ATOM   6548  C  CB   . SER B 1 112 ? 47.634  36.155  6.976   1.00 2.97  ? 143 SER B CB   1 
ATOM   6549  O  OG   . SER B 1 112 ? 48.104  37.408  7.469   1.00 2.00  ? 143 SER B OG   1 
ATOM   6550  H  H    . SER B 1 112 ? 49.361  35.881  8.788   1.00 17.00 ? 143 SER B H    1 
ATOM   6551  H  HG   . SER B 1 112 ? 47.349  37.979  7.623   1.00 17.00 ? 143 SER B HG   1 
ATOM   6552  N  N    . ASN B 1 113 ? 50.388  36.318  5.779   1.00 2.70  ? 144 ASN B N    1 
ATOM   6553  C  CA   . ASN B 1 113 ? 51.256  36.628  4.648   1.00 4.14  ? 144 ASN B CA   1 
ATOM   6554  C  C    . ASN B 1 113 ? 52.193  35.510  4.231   1.00 3.83  ? 144 ASN B C    1 
ATOM   6555  O  O    . ASN B 1 113 ? 53.278  35.373  4.782   1.00 4.45  ? 144 ASN B O    1 
ATOM   6556  C  CB   . ASN B 1 113 ? 52.057  37.891  4.892   1.00 2.00  ? 144 ASN B CB   1 
ATOM   6557  C  CG   . ASN B 1 113 ? 52.489  38.537  3.597   1.00 5.10  ? 144 ASN B CG   1 
ATOM   6558  O  OD1  . ASN B 1 113 ? 52.921  37.849  2.658   1.00 3.72  ? 144 ASN B OD1  1 
ATOM   6559  N  ND2  . ASN B 1 113 ? 52.276  39.849  3.521   1.00 5.94  ? 144 ASN B ND2  1 
ATOM   6560  H  H    . ASN B 1 113 ? 50.388  36.904  6.570   1.00 17.00 ? 144 ASN B H    1 
ATOM   6561  H  HD21 . ASN B 1 113 ? 51.518  40.222  4.014   1.00 17.00 ? 144 ASN B HD21 1 
ATOM   6562  N  N    . LEU B 1 114 ? 51.790  34.735  3.231   1.00 2.68  ? 145 LEU B N    1 
ATOM   6563  C  CA   . LEU B 1 114 ? 52.621  33.631  2.772   1.00 5.20  ? 145 LEU B CA   1 
ATOM   6564  C  C    . LEU B 1 114 ? 53.823  34.061  1.949   1.00 3.04  ? 145 LEU B C    1 
ATOM   6565  O  O    . LEU B 1 114 ? 54.621  33.222  1.542   1.00 3.90  ? 145 LEU B O    1 
ATOM   6566  C  CB   . LEU B 1 114 ? 51.803  32.602  1.977   1.00 5.03  ? 145 LEU B CB   1 
ATOM   6567  C  CG   . LEU B 1 114 ? 50.744  31.790  2.738   1.00 4.43  ? 145 LEU B CG   1 
ATOM   6568  C  CD1  . LEU B 1 114 ? 50.162  30.758  1.785   1.00 2.00  ? 145 LEU B CD1  1 
ATOM   6569  C  CD2  . LEU B 1 114 ? 51.339  31.116  3.955   1.00 2.32  ? 145 LEU B CD2  1 
ATOM   6570  H  H    . LEU B 1 114 ? 50.907  34.885  2.840   1.00 17.00 ? 145 LEU B H    1 
ATOM   6571  N  N    . SER B 1 115 ? 53.958  35.354  1.712   1.00 2.00  ? 146 SER B N    1 
ATOM   6572  C  CA   . SER B 1 115 ? 55.076  35.864  0.922   1.00 4.27  ? 146 SER B CA   1 
ATOM   6573  C  C    . SER B 1 115 ? 56.406  35.898  1.717   1.00 3.15  ? 146 SER B C    1 
ATOM   6574  O  O    . SER B 1 115 ? 57.477  36.056  1.153   1.00 2.10  ? 146 SER B O    1 
ATOM   6575  C  CB   . SER B 1 115 ? 54.737  37.277  0.371   1.00 5.37  ? 146 SER B CB   1 
ATOM   6576  O  OG   . SER B 1 115 ? 53.576  37.308  -0.462  1.00 2.00  ? 146 SER B OG   1 
ATOM   6577  H  H    . SER B 1 115 ? 53.313  36.009  2.048   1.00 17.00 ? 146 SER B H    1 
ATOM   6578  H  HG   . SER B 1 115 ? 53.774  36.712  -1.196  1.00 17.00 ? 146 SER B HG   1 
ATOM   6579  N  N    . TYR B 1 116 ? 56.310  35.788  3.032   1.00 3.03  ? 147 TYR B N    1 
ATOM   6580  C  CA   . TYR B 1 116 ? 57.466  35.789  3.916   1.00 2.98  ? 147 TYR B CA   1 
ATOM   6581  C  C    . TYR B 1 116 ? 58.089  34.350  4.082   1.00 4.77  ? 147 TYR B C    1 
ATOM   6582  O  O    . TYR B 1 116 ? 57.637  33.359  3.491   1.00 3.51  ? 147 TYR B O    1 
ATOM   6583  C  CB   . TYR B 1 116 ? 57.037  36.266  5.322   1.00 2.90  ? 147 TYR B CB   1 
ATOM   6584  C  CG   . TYR B 1 116 ? 56.698  37.711  5.527   1.00 2.02  ? 147 TYR B CG   1 
ATOM   6585  C  CD1  . TYR B 1 116 ? 57.617  38.720  5.252   1.00 6.40  ? 147 TYR B CD1  1 
ATOM   6586  C  CD2  . TYR B 1 116 ? 55.500  38.072  6.115   1.00 3.77  ? 147 TYR B CD2  1 
ATOM   6587  C  CE1  . TYR B 1 116 ? 57.350  40.061  5.567   1.00 5.24  ? 147 TYR B CE1  1 
ATOM   6588  C  CE2  . TYR B 1 116 ? 55.223  39.398  6.439   1.00 4.76  ? 147 TYR B CE2  1 
ATOM   6589  C  CZ   . TYR B 1 116 ? 56.150  40.382  6.160   1.00 5.57  ? 147 TYR B CZ   1 
ATOM   6590  O  OH   . TYR B 1 116 ? 55.859  41.690  6.460   1.00 4.53  ? 147 TYR B OH   1 
ATOM   6591  H  H    . TYR B 1 116 ? 55.426  35.666  3.434   1.00 17.00 ? 147 TYR B H    1 
ATOM   6592  H  HH   . TYR B 1 116 ? 54.930  41.710  6.740   1.00 17.00 ? 147 TYR B HH   1 
ATOM   6593  N  N    . TYR B 1 117 ? 59.126  34.274  4.912   1.00 3.28  ? 148 TYR B N    1 
ATOM   6594  C  CA   . TYR B 1 117 ? 59.808  33.056  5.257   1.00 2.00  ? 148 TYR B CA   1 
ATOM   6595  C  C    . TYR B 1 117 ? 59.546  33.050  6.743   1.00 2.00  ? 148 TYR B C    1 
ATOM   6596  O  O    . TYR B 1 117 ? 59.717  34.092  7.388   1.00 2.00  ? 148 TYR B O    1 
ATOM   6597  C  CB   . TYR B 1 117 ? 61.321  33.225  5.081   1.00 2.46  ? 148 TYR B CB   1 
ATOM   6598  C  CG   . TYR B 1 117 ? 61.903  32.929  3.736   1.00 2.00  ? 148 TYR B CG   1 
ATOM   6599  C  CD1  . TYR B 1 117 ? 61.861  31.659  3.210   1.00 2.00  ? 148 TYR B CD1  1 
ATOM   6600  C  CD2  . TYR B 1 117 ? 62.523  33.914  3.006   1.00 2.00  ? 148 TYR B CD2  1 
ATOM   6601  C  CE1  . TYR B 1 117 ? 62.432  31.375  1.962   1.00 4.50  ? 148 TYR B CE1  1 
ATOM   6602  C  CE2  . TYR B 1 117 ? 63.099  33.650  1.766   1.00 2.00  ? 148 TYR B CE2  1 
ATOM   6603  C  CZ   . TYR B 1 117 ? 63.053  32.374  1.242   1.00 2.00  ? 148 TYR B CZ   1 
ATOM   6604  O  OH   . TYR B 1 117 ? 63.616  32.082  0.015   1.00 2.00  ? 148 TYR B OH   1 
ATOM   6605  H  H    . TYR B 1 117 ? 59.466  35.096  5.326   1.00 17.00 ? 148 TYR B H    1 
ATOM   6606  H  HH   . TYR B 1 117 ? 64.227  32.803  -0.190  1.00 17.00 ? 148 TYR B HH   1 
ATOM   6607  N  N    . THR B 1 118 ? 59.170  31.910  7.314   1.00 2.96  ? 149 THR B N    1 
ATOM   6608  C  CA   . THR B 1 118 ? 58.953  31.878  8.767   1.00 5.60  ? 149 THR B CA   1 
ATOM   6609  C  C    . THR B 1 118 ? 60.358  32.034  9.373   1.00 5.35  ? 149 THR B C    1 
ATOM   6610  O  O    . THR B 1 118 ? 61.351  32.047  8.643   1.00 5.75  ? 149 THR B O    1 
ATOM   6611  C  CB   . THR B 1 118 ? 58.207  30.589  9.246   1.00 6.11  ? 149 THR B CB   1 
ATOM   6612  O  OG1  . THR B 1 118 ? 57.648  30.791  10.552  1.00 4.69  ? 149 THR B OG1  1 
ATOM   6613  C  CG2  . THR B 1 118 ? 59.130  29.404  9.271   1.00 5.25  ? 149 THR B CG2  1 
ATOM   6614  H  H    . THR B 1 118 ? 59.113  31.097  6.780   1.00 17.00 ? 149 THR B H    1 
ATOM   6615  H  HG1  . THR B 1 118 ? 57.178  31.636  10.584  1.00 17.00 ? 149 THR B HG1  1 
ATOM   6616  N  N    . ARG B 1 119 ? 60.461  32.155  10.689  1.00 5.04  ? 150 ARG B N    1 
ATOM   6617  C  CA   . ARG B 1 119 ? 61.762  32.378  11.304  1.00 3.18  ? 150 ARG B CA   1 
ATOM   6618  C  C    . ARG B 1 119 ? 61.796  31.759  12.674  1.00 2.04  ? 150 ARG B C    1 
ATOM   6619  O  O    . ARG B 1 119 ? 61.097  32.192  13.564  1.00 2.02  ? 150 ARG B O    1 
ATOM   6620  C  CB   . ARG B 1 119 ? 61.997  33.888  11.423  1.00 5.30  ? 150 ARG B CB   1 
ATOM   6621  C  CG   . ARG B 1 119 ? 63.385  34.312  11.838  1.00 4.82  ? 150 ARG B CG   1 
ATOM   6622  C  CD   . ARG B 1 119 ? 64.221  34.821  10.650  1.00 4.86  ? 150 ARG B CD   1 
ATOM   6623  N  NE   . ARG B 1 119 ? 64.429  36.264  10.642  1.00 2.00  ? 150 ARG B NE   1 
ATOM   6624  C  CZ   . ARG B 1 119 ? 64.853  36.981  11.685  1.00 2.00  ? 150 ARG B CZ   1 
ATOM   6625  N  NH1  . ARG B 1 119 ? 65.128  36.427  12.858  1.00 2.00  ? 150 ARG B NH1  1 
ATOM   6626  N  NH2  . ARG B 1 119 ? 64.992  38.280  11.559  1.00 2.04  ? 150 ARG B NH2  1 
ATOM   6627  H  H    . ARG B 1 119 ? 59.665  32.100  11.263  1.00 17.00 ? 150 ARG B H    1 
ATOM   6628  H  HE   . ARG B 1 119 ? 64.236  36.747  9.808   1.00 17.00 ? 150 ARG B HE   1 
ATOM   6629  H  HH11 . ARG B 1 119 ? 65.048  35.443  12.996  1.00 17.00 ? 150 ARG B HH11 1 
ATOM   6630  H  HH12 . ARG B 1 119 ? 65.451  37.000  13.610  1.00 17.00 ? 150 ARG B HH12 1 
ATOM   6631  H  HH21 . ARG B 1 119 ? 64.772  38.720  10.686  1.00 17.00 ? 150 ARG B HH21 1 
ATOM   6632  H  HH22 . ARG B 1 119 ? 65.332  38.824  12.322  1.00 17.00 ? 150 ARG B HH22 1 
ATOM   6633  N  N    . ALA B 1 120 ? 62.637  30.748  12.844  1.00 4.33  ? 151 ALA B N    1 
ATOM   6634  C  CA   . ALA B 1 120 ? 62.768  30.052  14.121  1.00 2.66  ? 151 ALA B CA   1 
ATOM   6635  C  C    . ALA B 1 120 ? 62.973  31.013  15.294  1.00 3.35  ? 151 ALA B C    1 
ATOM   6636  O  O    . ALA B 1 120 ? 62.462  30.795  16.380  1.00 3.83  ? 151 ALA B O    1 
ATOM   6637  C  CB   . ALA B 1 120 ? 63.900  29.079  14.048  1.00 3.38  ? 151 ALA B CB   1 
ATOM   6638  H  H    . ALA B 1 120 ? 63.207  30.489  12.099  1.00 17.00 ? 151 ALA B H    1 
ATOM   6639  N  N    . LEU B 1 121 ? 63.729  32.080  15.085  1.00 4.52  ? 152 LEU B N    1 
ATOM   6640  C  CA   . LEU B 1 121 ? 63.957  33.021  16.153  1.00 3.37  ? 152 LEU B CA   1 
ATOM   6641  C  C    . LEU B 1 121 ? 63.555  34.376  15.677  1.00 3.12  ? 152 LEU B C    1 
ATOM   6642  O  O    . LEU B 1 121 ? 63.838  34.754  14.547  1.00 2.00  ? 152 LEU B O    1 
ATOM   6643  C  CB   . LEU B 1 121 ? 65.414  32.999  16.643  1.00 3.87  ? 152 LEU B CB   1 
ATOM   6644  C  CG   . LEU B 1 121 ? 65.749  31.793  17.551  1.00 3.11  ? 152 LEU B CG   1 
ATOM   6645  C  CD1  . LEU B 1 121 ? 67.118  31.909  18.191  1.00 2.00  ? 152 LEU B CD1  1 
ATOM   6646  C  CD2  . LEU B 1 121 ? 64.690  31.689  18.638  1.00 4.57  ? 152 LEU B CD2  1 
ATOM   6647  H  H    . LEU B 1 121 ? 64.125  32.280  14.216  1.00 17.00 ? 152 LEU B H    1 
ATOM   6648  N  N    . PRO B 1 122 ? 62.848  35.119  16.531  1.00 2.82  ? 153 PRO B N    1 
ATOM   6649  C  CA   . PRO B 1 122 ? 62.401  36.448  16.173  1.00 3.42  ? 153 PRO B CA   1 
ATOM   6650  C  C    . PRO B 1 122 ? 63.581  37.368  15.908  1.00 3.52  ? 153 PRO B C    1 
ATOM   6651  O  O    . PRO B 1 122 ? 64.646  37.217  16.510  1.00 4.42  ? 153 PRO B O    1 
ATOM   6652  C  CB   . PRO B 1 122 ? 61.652  36.873  17.422  1.00 2.00  ? 153 PRO B CB   1 
ATOM   6653  C  CG   . PRO B 1 122 ? 62.431  36.255  18.476  1.00 2.00  ? 153 PRO B CG   1 
ATOM   6654  C  CD   . PRO B 1 122 ? 62.598  34.875  17.958  1.00 2.52  ? 153 PRO B CD   1 
ATOM   6655  N  N    . PRO B 1 123 ? 63.412  38.319  14.986  1.00 3.08  ? 154 PRO B N    1 
ATOM   6656  C  CA   . PRO B 1 123 ? 64.497  39.242  14.696  1.00 4.74  ? 154 PRO B CA   1 
ATOM   6657  C  C    . PRO B 1 123 ? 64.818  40.063  15.949  1.00 6.59  ? 154 PRO B C    1 
ATOM   6658  O  O    . PRO B 1 123 ? 64.134  39.980  16.982  1.00 7.04  ? 154 PRO B O    1 
ATOM   6659  C  CB   . PRO B 1 123 ? 63.905  40.120  13.593  1.00 4.00  ? 154 PRO B CB   1 
ATOM   6660  C  CG   . PRO B 1 123 ? 62.450  40.075  13.884  1.00 3.97  ? 154 PRO B CG   1 
ATOM   6661  C  CD   . PRO B 1 123 ? 62.228  38.639  14.180  1.00 2.60  ? 154 PRO B CD   1 
ATOM   6662  N  N    . VAL B 1 124 ? 65.884  40.841  15.858  1.00 8.29  ? 155 VAL B N    1 
ATOM   6663  C  CA   . VAL B 1 124 ? 66.306  41.676  16.964  1.00 7.61  ? 155 VAL B CA   1 
ATOM   6664  C  C    . VAL B 1 124 ? 65.600  43.012  16.804  1.00 6.74  ? 155 VAL B C    1 
ATOM   6665  O  O    . VAL B 1 124 ? 65.595  43.602  15.727  1.00 7.05  ? 155 VAL B O    1 
ATOM   6666  C  CB   . VAL B 1 124 ? 67.847  41.830  16.956  1.00 7.45  ? 155 VAL B CB   1 
ATOM   6667  C  CG1  . VAL B 1 124 ? 68.272  42.805  18.025  1.00 10.76 ? 155 VAL B CG1  1 
ATOM   6668  C  CG2  . VAL B 1 124 ? 68.524  40.461  17.169  1.00 3.53  ? 155 VAL B CG2  1 
ATOM   6669  H  H    . VAL B 1 124 ? 66.409  40.848  15.027  1.00 17.00 ? 155 VAL B H    1 
ATOM   6670  N  N    . ALA B 1 125 ? 64.959  43.479  17.859  1.00 8.09  ? 156 ALA B N    1 
ATOM   6671  C  CA   . ALA B 1 125 ? 64.252  44.762  17.769  1.00 10.81 ? 156 ALA B CA   1 
ATOM   6672  C  C    . ALA B 1 125 ? 65.121  45.871  17.193  1.00 11.18 ? 156 ALA B C    1 
ATOM   6673  O  O    . ALA B 1 125 ? 66.226  46.110  17.664  1.00 12.54 ? 156 ALA B O    1 
ATOM   6674  C  CB   . ALA B 1 125 ? 63.735  45.178  19.120  1.00 11.18 ? 156 ALA B CB   1 
ATOM   6675  H  H    . ALA B 1 125 ? 64.982  42.970  18.692  1.00 17.00 ? 156 ALA B H    1 
ATOM   6676  N  N    . ASP B 1 126 ? 64.568  46.600  16.231  1.00 11.64 ? 157 ASP B N    1 
ATOM   6677  C  CA   . ASP B 1 126 ? 65.259  47.713  15.561  1.00 10.58 ? 157 ASP B CA   1 
ATOM   6678  C  C    . ASP B 1 126 ? 65.695  48.844  16.491  1.00 9.53  ? 157 ASP B C    1 
ATOM   6679  O  O    . ASP B 1 126 ? 66.345  49.779  16.045  1.00 8.06  ? 157 ASP B O    1 
ATOM   6680  C  CB   . ASP B 1 126 ? 64.365  48.329  14.474  1.00 12.41 ? 157 ASP B CB   1 
ATOM   6681  C  CG   . ASP B 1 126 ? 63.965  47.335  13.387  1.00 17.21 ? 157 ASP B CG   1 
ATOM   6682  O  OD1  . ASP B 1 126 ? 63.715  46.144  13.718  1.00 24.25 ? 157 ASP B OD1  1 
ATOM   6683  O  OD2  . ASP B 1 126 ? 63.895  47.750  12.198  1.00 15.99 ? 157 ASP B OD2  1 
ATOM   6684  H  H    . ASP B 1 126 ? 63.663  46.363  15.949  1.00 17.00 ? 157 ASP B H    1 
ATOM   6685  N  N    . ASP B 1 127 ? 65.307  48.786  17.765  1.00 10.65 ? 158 ASP B N    1 
ATOM   6686  C  CA   . ASP B 1 127 ? 65.672  49.824  18.739  1.00 10.05 ? 158 ASP B CA   1 
ATOM   6687  C  C    . ASP B 1 127 ? 66.685  49.326  19.789  1.00 9.54  ? 158 ASP B C    1 
ATOM   6688  O  O    . ASP B 1 127 ? 66.838  49.915  20.860  1.00 10.60 ? 158 ASP B O    1 
ATOM   6689  C  CB   . ASP B 1 127 ? 64.415  50.369  19.442  1.00 12.10 ? 158 ASP B CB   1 
ATOM   6690  C  CG   . ASP B 1 127 ? 63.766  49.344  20.386  1.00 14.66 ? 158 ASP B CG   1 
ATOM   6691  O  OD1  . ASP B 1 127 ? 64.432  48.895  21.327  1.00 17.07 ? 158 ASP B OD1  1 
ATOM   6692  O  OD2  . ASP B 1 127 ? 62.586  48.984  20.205  1.00 17.92 ? 158 ASP B OD2  1 
ATOM   6693  H  H    . ASP B 1 127 ? 64.767  48.036  18.063  1.00 17.00 ? 158 ASP B H    1 
ATOM   6694  N  N    . CYS B 1 128 ? 67.326  48.205  19.523  1.00 8.82  ? 159 CYS B N    1 
ATOM   6695  C  CA   . CYS B 1 128 ? 68.291  47.665  20.462  1.00 9.10  ? 159 CYS B CA   1 
ATOM   6696  C  C    . CYS B 1 128 ? 69.606  48.440  20.496  1.00 7.81  ? 159 CYS B C    1 
ATOM   6697  O  O    . CYS B 1 128 ? 69.839  49.283  19.627  1.00 9.04  ? 159 CYS B O    1 
ATOM   6698  C  CB   . CYS B 1 128 ? 68.508  46.172  20.201  1.00 7.47  ? 159 CYS B CB   1 
ATOM   6699  S  SG   . CYS B 1 128 ? 67.038  45.222  20.692  1.00 2.00  ? 159 CYS B SG   1 
ATOM   6700  H  H    . CYS B 1 128 ? 67.185  47.724  18.680  1.00 17.00 ? 159 CYS B H    1 
ATOM   6701  N  N    . PRO B 1 129 ? 70.428  48.245  21.559  1.00 5.56  ? 160 PRO B N    1 
ATOM   6702  C  CA   . PRO B 1 129 ? 71.702  48.948  21.671  1.00 3.54  ? 160 PRO B CA   1 
ATOM   6703  C  C    . PRO B 1 129 ? 72.766  48.450  20.715  1.00 5.12  ? 160 PRO B C    1 
ATOM   6704  O  O    . PRO B 1 129 ? 73.505  49.251  20.138  1.00 4.70  ? 160 PRO B O    1 
ATOM   6705  C  CB   . PRO B 1 129 ? 72.074  48.722  23.119  1.00 2.00  ? 160 PRO B CB   1 
ATOM   6706  C  CG   . PRO B 1 129 ? 71.499  47.437  23.411  1.00 2.00  ? 160 PRO B CG   1 
ATOM   6707  C  CD   . PRO B 1 129 ? 70.165  47.477  22.789  1.00 2.00  ? 160 PRO B CD   1 
ATOM   6708  N  N    . THR B 1 130 ? 72.818  47.132  20.529  1.00 6.03  ? 161 THR B N    1 
ATOM   6709  C  CA   . THR B 1 130 ? 73.775  46.507  19.637  1.00 6.05  ? 161 THR B CA   1 
ATOM   6710  C  C    . THR B 1 130 ? 72.997  45.591  18.712  1.00 6.90  ? 161 THR B C    1 
ATOM   6711  O  O    . THR B 1 130 ? 71.958  45.070  19.098  1.00 5.54  ? 161 THR B O    1 
ATOM   6712  C  CB   . THR B 1 130 ? 74.754  45.617  20.406  1.00 7.36  ? 161 THR B CB   1 
ATOM   6713  O  OG1  . THR B 1 130 ? 74.051  44.447  20.853  1.00 10.24 ? 161 THR B OG1  1 
ATOM   6714  C  CG2  . THR B 1 130 ? 75.390  46.363  21.585  1.00 5.68  ? 161 THR B CG2  1 
ATOM   6715  H  H    . THR B 1 130 ? 72.198  46.536  20.986  1.00 17.00 ? 161 THR B H    1 
ATOM   6716  H  HG1  . THR B 1 130 ? 74.747  43.881  21.207  1.00 17.00 ? 161 THR B HG1  1 
ATOM   6717  N  N    . PRO B 1 131 ? 73.517  45.345  17.489  1.00 8.14  ? 162 PRO B N    1 
ATOM   6718  C  CA   . PRO B 1 131 ? 72.886  44.480  16.493  1.00 7.00  ? 162 PRO B CA   1 
ATOM   6719  C  C    . PRO B 1 131 ? 72.631  43.069  16.983  1.00 7.43  ? 162 PRO B C    1 
ATOM   6720  O  O    . PRO B 1 131 ? 71.845  42.331  16.364  1.00 8.99  ? 162 PRO B O    1 
ATOM   6721  C  CB   . PRO B 1 131 ? 73.873  44.505  15.327  1.00 7.59  ? 162 PRO B CB   1 
ATOM   6722  C  CG   . PRO B 1 131 ? 75.160  44.846  15.960  1.00 10.53 ? 162 PRO B CG   1 
ATOM   6723  C  CD   . PRO B 1 131 ? 74.753  45.916  16.933  1.00 9.46  ? 162 PRO B CD   1 
ATOM   6724  N  N    . MET B 1 132 ? 73.295  42.668  18.062  1.00 3.67  ? 163 MET B N    1 
ATOM   6725  C  CA   . MET B 1 132 ? 73.027  41.341  18.583  1.00 3.89  ? 163 MET B CA   1 
ATOM   6726  C  C    . MET B 1 132 ? 72.166  41.453  19.816  1.00 2.66  ? 163 MET B C    1 
ATOM   6727  O  O    . MET B 1 132 ? 72.069  40.527  20.627  1.00 2.64  ? 163 MET B O    1 
ATOM   6728  C  CB   . MET B 1 132 ? 74.314  40.590  18.901  1.00 7.36  ? 163 MET B CB   1 
ATOM   6729  C  CG   . MET B 1 132 ? 74.953  39.900  17.704  1.00 5.45  ? 163 MET B CG   1 
ATOM   6730  S  SD   . MET B 1 132 ? 73.826  38.816  16.920  1.00 2.00  ? 163 MET B SD   1 
ATOM   6731  C  CE   . MET B 1 132 ? 73.420  39.802  15.449  1.00 4.45  ? 163 MET B CE   1 
ATOM   6732  H  H    . MET B 1 132 ? 73.939  43.242  18.521  1.00 17.00 ? 163 MET B H    1 
ATOM   6733  N  N    . GLY B 1 133 ? 71.512  42.589  19.935  1.00 2.00  ? 164 GLY B N    1 
ATOM   6734  C  CA   . GLY B 1 133 ? 70.670  42.820  21.077  1.00 5.82  ? 164 GLY B CA   1 
ATOM   6735  C  C    . GLY B 1 133 ? 71.398  43.831  21.922  1.00 9.42  ? 164 GLY B C    1 
ATOM   6736  O  O    . GLY B 1 133 ? 71.387  45.015  21.608  1.00 13.11 ? 164 GLY B O    1 
ATOM   6737  H  H    . GLY B 1 133 ? 71.576  43.284  19.262  1.00 17.00 ? 164 GLY B H    1 
ATOM   6738  N  N    . VAL B 1 134 ? 72.082  43.359  22.954  1.00 10.82 ? 165 VAL B N    1 
ATOM   6739  C  CA   . VAL B 1 134 ? 72.837  44.220  23.849  1.00 11.10 ? 165 VAL B CA   1 
ATOM   6740  C  C    . VAL B 1 134 ? 74.343  43.986  23.828  1.00 14.28 ? 165 VAL B C    1 
ATOM   6741  O  O    . VAL B 1 134 ? 75.101  44.894  24.171  1.00 17.26 ? 165 VAL B O    1 
ATOM   6742  C  CB   . VAL B 1 134 ? 72.362  44.068  25.295  1.00 12.10 ? 165 VAL B CB   1 
ATOM   6743  C  CG1  . VAL B 1 134 ? 71.122  44.889  25.515  1.00 14.18 ? 165 VAL B CG1  1 
ATOM   6744  C  CG2  . VAL B 1 134 ? 72.116  42.569  25.645  1.00 10.27 ? 165 VAL B CG2  1 
ATOM   6745  H  H    . VAL B 1 134 ? 72.071  42.391  23.068  1.00 17.00 ? 165 VAL B H    1 
ATOM   6746  N  N    . LYS B 1 135 ? 74.779  42.778  23.445  1.00 15.27 ? 166 LYS B N    1 
ATOM   6747  C  CA   . LYS B 1 135 ? 76.213  42.418  23.399  1.00 13.28 ? 166 LYS B CA   1 
ATOM   6748  C  C    . LYS B 1 135 ? 76.868  42.771  22.100  1.00 13.01 ? 166 LYS B C    1 
ATOM   6749  O  O    . LYS B 1 135 ? 76.274  42.628  21.035  1.00 14.73 ? 166 LYS B O    1 
ATOM   6750  C  CB   . LYS B 1 135 ? 76.436  40.921  23.614  1.00 12.73 ? 166 LYS B CB   1 
ATOM   6751  C  CG   . LYS B 1 135 ? 76.236  40.448  25.029  1.00 8.76  ? 166 LYS B CG   1 
ATOM   6752  C  CD   . LYS B 1 135 ? 76.515  38.981  25.127  1.00 6.63  ? 166 LYS B CD   1 
ATOM   6753  C  CE   . LYS B 1 135 ? 76.352  38.508  26.542  1.00 7.08  ? 166 LYS B CE   1 
ATOM   6754  N  NZ   . LYS B 1 135 ? 76.885  37.145  26.630  1.00 13.52 ? 166 LYS B NZ   1 
ATOM   6755  H  H    . LYS B 1 135 ? 74.129  42.106  23.160  1.00 17.00 ? 166 LYS B H    1 
ATOM   6756  H  HZ1  . LYS B 1 135 ? 76.357  36.543  25.967  1.00 17.00 ? 166 LYS B HZ1  1 
ATOM   6757  H  HZ2  . LYS B 1 135 ? 77.893  37.142  26.376  1.00 17.00 ? 166 LYS B HZ2  1 
ATOM   6758  H  HZ3  . LYS B 1 135 ? 76.763  36.769  27.592  1.00 17.00 ? 166 LYS B HZ3  1 
ATOM   6759  N  N    . GLY B 1 136 ? 78.120  43.187  22.186  1.00 14.66 ? 167 GLY B N    1 
ATOM   6760  C  CA   . GLY B 1 136 ? 78.855  43.558  20.985  1.00 14.52 ? 167 GLY B CA   1 
ATOM   6761  C  C    . GLY B 1 136 ? 79.069  45.046  20.860  1.00 11.43 ? 167 GLY B C    1 
ATOM   6762  O  O    . GLY B 1 136 ? 78.760  45.796  21.778  1.00 11.55 ? 167 GLY B O    1 
ATOM   6763  H  H    . GLY B 1 136 ? 78.542  43.311  23.059  1.00 17.00 ? 167 GLY B H    1 
ATOM   6764  N  N    . ASN B 1 137 ? 79.577  45.464  19.708  1.00 10.70 ? 168 ASN B N    1 
ATOM   6765  C  CA   . ASN B 1 137 ? 79.862  46.882  19.424  1.00 11.43 ? 168 ASN B CA   1 
ATOM   6766  C  C    . ASN B 1 137 ? 78.726  47.524  18.629  1.00 8.38  ? 168 ASN B C    1 
ATOM   6767  O  O    . ASN B 1 137 ? 77.826  46.832  18.175  1.00 5.00  ? 168 ASN B O    1 
ATOM   6768  C  CB   . ASN B 1 137 ? 81.142  47.012  18.560  1.00 14.23 ? 168 ASN B CB   1 
ATOM   6769  C  CG   . ASN B 1 137 ? 82.419  46.794  19.340  1.00 14.22 ? 168 ASN B CG   1 
ATOM   6770  O  OD1  . ASN B 1 137 ? 82.905  47.722  19.986  1.00 17.72 ? 168 ASN B OD1  1 
ATOM   6771  N  ND2  . ASN B 1 137 ? 83.001  45.584  19.245  1.00 12.41 ? 168 ASN B ND2  1 
ATOM   6772  H  H    . ASN B 1 137 ? 79.713  44.810  18.995  1.00 17.00 ? 168 ASN B H    1 
ATOM   6773  H  HD21 . ASN B 1 137 ? 83.836  45.451  19.742  1.00 17.00 ? 168 ASN B HD21 1 
ATOM   6774  H  HD22 . ASN B 1 137 ? 82.586  44.898  18.683  1.00 17.00 ? 168 ASN B HD22 1 
ATOM   6775  N  N    . LYS B 1 138 ? 78.830  48.833  18.394  1.00 7.43  ? 169 LYS B N    1 
ATOM   6776  C  CA   . LYS B 1 138 ? 77.841  49.555  17.595  1.00 6.40  ? 169 LYS B CA   1 
ATOM   6777  C  C    . LYS B 1 138 ? 77.707  48.866  16.231  1.00 5.89  ? 169 LYS B C    1 
ATOM   6778  O  O    . LYS B 1 138 ? 76.687  48.991  15.546  1.00 6.01  ? 169 LYS B O    1 
ATOM   6779  C  CB   . LYS B 1 138 ? 78.246  51.022  17.392  1.00 5.28  ? 169 LYS B CB   1 
ATOM   6780  C  CG   . LYS B 1 138 ? 77.316  51.845  16.459  1.00 2.02  ? 169 LYS B CG   1 
ATOM   6781  C  CD   . LYS B 1 138 ? 77.841  53.262  16.199  1.00 4.75  ? 169 LYS B CD   1 
ATOM   6782  C  CE   . LYS B 1 138 ? 77.992  54.089  17.484  1.00 10.66 ? 169 LYS B CE   1 
ATOM   6783  N  NZ   . LYS B 1 138 ? 76.702  54.303  18.229  1.00 17.38 ? 169 LYS B NZ   1 
ATOM   6784  H  H    . LYS B 1 138 ? 79.584  49.318  18.784  1.00 17.00 ? 169 LYS B H    1 
ATOM   6785  H  HZ1  . LYS B 1 138 ? 76.297  53.388  18.510  1.00 17.00 ? 169 LYS B HZ1  1 
ATOM   6786  H  HZ2  . LYS B 1 138 ? 76.894  54.867  19.081  1.00 17.00 ? 169 LYS B HZ2  1 
ATOM   6787  H  HZ3  . LYS B 1 138 ? 76.024  54.813  17.627  1.00 17.00 ? 169 LYS B HZ3  1 
ATOM   6788  N  N    . GLU B 1 139 ? 78.771  48.202  15.809  1.00 5.52  ? 170 GLU B N    1 
ATOM   6789  C  CA   . GLU B 1 139 ? 78.743  47.458  14.567  1.00 8.79  ? 170 GLU B CA   1 
ATOM   6790  C  C    . GLU B 1 139 ? 79.275  46.075  14.884  1.00 10.91 ? 170 GLU B C    1 
ATOM   6791  O  O    . GLU B 1 139 ? 79.680  45.797  16.015  1.00 12.74 ? 170 GLU B O    1 
ATOM   6792  C  CB   . GLU B 1 139 ? 79.632  48.082  13.503  1.00 13.18 ? 170 GLU B CB   1 
ATOM   6793  C  CG   . GLU B 1 139 ? 79.238  49.475  13.058  1.00 20.11 ? 170 GLU B CG   1 
ATOM   6794  C  CD   . GLU B 1 139 ? 79.720  50.584  13.995  1.00 24.05 ? 170 GLU B CD   1 
ATOM   6795  O  OE1  . GLU B 1 139 ? 80.563  50.335  14.895  1.00 25.95 ? 170 GLU B OE1  1 
ATOM   6796  O  OE2  . GLU B 1 139 ? 79.242  51.725  13.823  1.00 28.51 ? 170 GLU B OE2  1 
ATOM   6797  H  H    . GLU B 1 139 ? 79.584  48.160  16.342  1.00 17.00 ? 170 GLU B H    1 
ATOM   6798  N  N    . LEU B 1 140 ? 79.310  45.217  13.876  1.00 11.79 ? 171 LEU B N    1 
ATOM   6799  C  CA   . LEU B 1 140 ? 79.789  43.846  14.031  1.00 10.31 ? 171 LEU B CA   1 
ATOM   6800  C  C    . LEU B 1 140 ? 81.048  43.774  13.190  1.00 9.60  ? 171 LEU B C    1 
ATOM   6801  O  O    . LEU B 1 140 ? 81.446  44.774  12.612  1.00 10.43 ? 171 LEU B O    1 
ATOM   6802  C  CB   . LEU B 1 140 ? 78.722  42.863  13.496  1.00 9.61  ? 171 LEU B CB   1 
ATOM   6803  C  CG   . LEU B 1 140 ? 78.331  41.698  14.402  1.00 6.32  ? 171 LEU B CG   1 
ATOM   6804  C  CD1  . LEU B 1 140 ? 77.849  42.210  15.751  1.00 5.99  ? 171 LEU B CD1  1 
ATOM   6805  C  CD2  . LEU B 1 140 ? 77.273  40.915  13.729  1.00 9.23  ? 171 LEU B CD2  1 
ATOM   6806  H  H    . LEU B 1 140 ? 79.060  45.515  12.978  1.00 17.00 ? 171 LEU B H    1 
ATOM   6807  N  N    . PRO B 1 141 ? 81.731  42.614  13.157  1.00 10.70 ? 172 PRO B N    1 
ATOM   6808  C  CA   . PRO B 1 141 ? 82.944  42.518  12.339  1.00 9.49  ? 172 PRO B CA   1 
ATOM   6809  C  C    . PRO B 1 141 ? 82.565  42.838  10.899  1.00 7.01  ? 172 PRO B C    1 
ATOM   6810  O  O    . PRO B 1 141 ? 81.380  42.937  10.589  1.00 7.07  ? 172 PRO B O    1 
ATOM   6811  C  CB   . PRO B 1 141 ? 83.312  41.028  12.457  1.00 8.74  ? 172 PRO B CB   1 
ATOM   6812  C  CG   . PRO B 1 141 ? 82.892  40.697  13.833  1.00 10.32 ? 172 PRO B CG   1 
ATOM   6813  C  CD   . PRO B 1 141 ? 81.524  41.356  13.911  1.00 12.66 ? 172 PRO B CD   1 
ATOM   6814  N  N    . ASP B 1 142 ? 83.545  43.078  10.035  1.00 5.30  ? 173 ASP B N    1 
ATOM   6815  C  CA   . ASP B 1 142 ? 83.213  43.307  8.647   1.00 4.52  ? 173 ASP B CA   1 
ATOM   6816  C  C    . ASP B 1 142 ? 82.987  41.951  8.027   1.00 4.56  ? 173 ASP B C    1 
ATOM   6817  O  O    . ASP B 1 142 ? 83.537  40.949  8.471   1.00 2.00  ? 173 ASP B O    1 
ATOM   6818  C  CB   . ASP B 1 142 ? 84.324  43.983  7.885   1.00 5.71  ? 173 ASP B CB   1 
ATOM   6819  C  CG   . ASP B 1 142 ? 83.930  44.264  6.454   1.00 5.06  ? 173 ASP B CG   1 
ATOM   6820  O  OD1  . ASP B 1 142 ? 83.276  45.304  6.247   1.00 11.19 ? 173 ASP B OD1  1 
ATOM   6821  O  OD2  . ASP B 1 142 ? 84.233  43.457  5.549   1.00 2.00  ? 173 ASP B OD2  1 
ATOM   6822  H  H    . ASP B 1 142 ? 84.471  43.092  10.338  1.00 17.00 ? 173 ASP B H    1 
ATOM   6823  N  N    . SER B 1 143 ? 82.204  41.928  6.964   1.00 7.88  ? 174 SER B N    1 
ATOM   6824  C  CA   . SER B 1 143 ? 81.917  40.672  6.307   1.00 10.62 ? 174 SER B CA   1 
ATOM   6825  C  C    . SER B 1 143 ? 83.209  40.049  5.774   1.00 10.50 ? 174 SER B C    1 
ATOM   6826  O  O    . SER B 1 143 ? 83.557  38.933  6.156   1.00 9.53  ? 174 SER B O    1 
ATOM   6827  C  CB   . SER B 1 143 ? 80.890  40.872  5.189   1.00 13.02 ? 174 SER B CB   1 
ATOM   6828  O  OG   . SER B 1 143 ? 79.796  41.644  5.661   1.00 17.90 ? 174 SER B OG   1 
ATOM   6829  H  H    . SER B 1 143 ? 81.769  42.738  6.629   1.00 17.00 ? 174 SER B H    1 
ATOM   6830  H  HG   . SER B 1 143 ? 79.506  41.301  6.514   1.00 17.00 ? 174 SER B HG   1 
ATOM   6831  N  N    . LYS B 1 144 ? 83.945  40.781  4.942   1.00 10.72 ? 175 LYS B N    1 
ATOM   6832  C  CA   . LYS B 1 144 ? 85.191  40.253  4.391   1.00 10.25 ? 175 LYS B CA   1 
ATOM   6833  C  C    . LYS B 1 144 ? 86.246  39.885  5.427   1.00 7.54  ? 175 LYS B C    1 
ATOM   6834  O  O    . LYS B 1 144 ? 87.037  38.959  5.223   1.00 7.33  ? 175 LYS B O    1 
ATOM   6835  C  CB   . LYS B 1 144 ? 85.750  41.156  3.296   1.00 11.02 ? 175 LYS B CB   1 
ATOM   6836  C  CG   . LYS B 1 144 ? 85.032  40.914  1.982   1.00 16.52 ? 175 LYS B CG   1 
ATOM   6837  C  CD   . LYS B 1 144 ? 85.666  41.649  0.801   1.00 22.11 ? 175 LYS B CD   1 
ATOM   6838  C  CE   . LYS B 1 144 ? 84.913  41.360  -0.531  1.00 21.68 ? 175 LYS B CE   1 
ATOM   6839  N  NZ   . LYS B 1 144 ? 84.976  39.930  -0.959  1.00 20.82 ? 175 LYS B NZ   1 
ATOM   6840  H  H    . LYS B 1 144 ? 83.633  41.663  4.665   1.00 17.00 ? 175 LYS B H    1 
ATOM   6841  H  HZ1  . LYS B 1 144 ? 85.973  39.645  -1.036  1.00 17.00 ? 175 LYS B HZ1  1 
ATOM   6842  H  HZ2  . LYS B 1 144 ? 84.498  39.330  -0.265  1.00 17.00 ? 175 LYS B HZ2  1 
ATOM   6843  H  HZ3  . LYS B 1 144 ? 84.517  39.823  -1.886  1.00 17.00 ? 175 LYS B HZ3  1 
ATOM   6844  N  N    . GLU B 1 145 ? 86.206  40.537  6.573   1.00 4.26  ? 176 GLU B N    1 
ATOM   6845  C  CA   . GLU B 1 145 ? 87.150  40.198  7.606   1.00 5.94  ? 176 GLU B CA   1 
ATOM   6846  C  C    . GLU B 1 145 ? 86.757  38.840  8.192   1.00 7.88  ? 176 GLU B C    1 
ATOM   6847  O  O    . GLU B 1 145 ? 87.416  38.326  9.104   1.00 9.29  ? 176 GLU B O    1 
ATOM   6848  C  CB   . GLU B 1 145 ? 87.155  41.271  8.676   1.00 10.26 ? 176 GLU B CB   1 
ATOM   6849  C  CG   . GLU B 1 145 ? 87.950  42.503  8.286   1.00 14.89 ? 176 GLU B CG   1 
ATOM   6850  C  CD   . GLU B 1 145 ? 89.413  42.173  8.112   1.00 16.57 ? 176 GLU B CD   1 
ATOM   6851  O  OE1  . GLU B 1 145 ? 90.127  42.113  9.148   1.00 17.20 ? 176 GLU B OE1  1 
ATOM   6852  O  OE2  . GLU B 1 145 ? 89.837  41.940  6.949   1.00 17.59 ? 176 GLU B OE2  1 
ATOM   6853  H  H    . GLU B 1 145 ? 85.533  41.221  6.747   1.00 17.00 ? 176 GLU B H    1 
ATOM   6854  N  N    . VAL B 1 146 ? 85.658  38.280  7.690   1.00 5.74  ? 177 VAL B N    1 
ATOM   6855  C  CA   . VAL B 1 146 ? 85.192  36.993  8.133   1.00 2.31  ? 177 VAL B CA   1 
ATOM   6856  C  C    . VAL B 1 146 ? 85.203  36.124  6.874   1.00 3.13  ? 177 VAL B C    1 
ATOM   6857  O  O    . VAL B 1 146 ? 85.781  35.015  6.850   1.00 2.00  ? 177 VAL B O    1 
ATOM   6858  C  CB   . VAL B 1 146 ? 83.788  37.093  8.739   1.00 2.00  ? 177 VAL B CB   1 
ATOM   6859  C  CG1  . VAL B 1 146 ? 83.488  35.865  9.540   1.00 2.92  ? 177 VAL B CG1  1 
ATOM   6860  C  CG2  . VAL B 1 146 ? 83.681  38.275  9.648   1.00 2.00  ? 177 VAL B CG2  1 
ATOM   6861  H  H    . VAL B 1 146 ? 85.121  38.770  7.065   1.00 17.00 ? 177 VAL B H    1 
ATOM   6862  N  N    . LEU B 1 147 ? 84.705  36.714  5.795   1.00 3.18  ? 178 LEU B N    1 
ATOM   6863  C  CA   . LEU B 1 147 ? 84.601  36.078  4.488   1.00 5.90  ? 178 LEU B CA   1 
ATOM   6864  C  C    . LEU B 1 147 ? 85.990  35.598  4.040   1.00 8.40  ? 178 LEU B C    1 
ATOM   6865  O  O    . LEU B 1 147 ? 86.179  34.419  3.695   1.00 8.93  ? 178 LEU B O    1 
ATOM   6866  C  CB   . LEU B 1 147 ? 84.053  37.096  3.486   1.00 3.40  ? 178 LEU B CB   1 
ATOM   6867  C  CG   . LEU B 1 147 ? 83.480  36.737  2.114   1.00 2.75  ? 178 LEU B CG   1 
ATOM   6868  C  CD1  . LEU B 1 147 ? 83.526  37.957  1.260   1.00 2.52  ? 178 LEU B CD1  1 
ATOM   6869  C  CD2  . LEU B 1 147 ? 84.268  35.666  1.418   1.00 6.66  ? 178 LEU B CD2  1 
ATOM   6870  H  H    . LEU B 1 147 ? 84.525  37.621  5.857   1.00 17.00 ? 178 LEU B H    1 
ATOM   6871  N  N    . GLU B 1 148 ? 86.944  36.532  4.004   1.00 10.08 ? 179 GLU B N    1 
ATOM   6872  C  CA   . GLU B 1 148 ? 88.336  36.233  3.618   1.00 9.40  ? 179 GLU B CA   1 
ATOM   6873  C  C    . GLU B 1 148 ? 89.104  35.507  4.733   1.00 8.54  ? 179 GLU B C    1 
ATOM   6874  O  O    . GLU B 1 148 ? 89.587  34.363  4.550   1.00 5.90  ? 179 GLU B O    1 
ATOM   6875  C  CB   . GLU B 1 148 ? 89.088  37.517  3.311   1.00 10.20 ? 179 GLU B CB   1 
ATOM   6876  C  CG   . GLU B 1 148 ? 88.735  38.191  2.015   1.00 8.88  ? 179 GLU B CG   1 
ATOM   6877  C  CD   . GLU B 1 148 ? 89.444  39.552  1.868   1.00 11.38 ? 179 GLU B CD   1 
ATOM   6878  O  OE1  . GLU B 1 148 ? 90.107  40.049  2.828   1.00 5.50  ? 179 GLU B OE1  1 
ATOM   6879  O  OE2  . GLU B 1 148 ? 89.322  40.140  0.773   1.00 13.20 ? 179 GLU B OE2  1 
ATOM   6880  H  H    . GLU B 1 148 ? 86.705  37.444  4.223   1.00 17.00 ? 179 GLU B H    1 
ATOM   6881  N  N    . LYS B 1 149 ? 89.194  36.179  5.883   1.00 4.41  ? 180 LYS B N    1 
ATOM   6882  C  CA   . LYS B 1 149 ? 89.897  35.630  7.036   1.00 5.64  ? 180 LYS B CA   1 
ATOM   6883  C  C    . LYS B 1 149 ? 89.492  34.194  7.431   1.00 6.20  ? 180 LYS B C    1 
ATOM   6884  O  O    . LYS B 1 149 ? 90.338  33.281  7.427   1.00 3.30  ? 180 LYS B O    1 
ATOM   6885  C  CB   . LYS B 1 149 ? 89.727  36.572  8.223   1.00 6.08  ? 180 LYS B CB   1 
ATOM   6886  C  CG   . LYS B 1 149 ? 90.070  38.014  7.896   1.00 7.13  ? 180 LYS B CG   1 
ATOM   6887  C  CD   . LYS B 1 149 ? 91.353  38.490  8.592   1.00 8.60  ? 180 LYS B CD   1 
ATOM   6888  C  CE   . LYS B 1 149 ? 91.790  39.867  8.056   1.00 11.36 ? 180 LYS B CE   1 
ATOM   6889  N  NZ   . LYS B 1 149 ? 92.787  40.611  8.905   1.00 9.01  ? 180 LYS B NZ   1 
ATOM   6890  H  H    . LYS B 1 149 ? 88.773  37.061  5.949   1.00 17.00 ? 180 LYS B H    1 
ATOM   6891  H  HZ1  . LYS B 1 149 ? 92.383  40.767  9.851   1.00 17.00 ? 180 LYS B HZ1  1 
ATOM   6892  H  HZ2  . LYS B 1 149 ? 93.658  40.047  8.996   1.00 17.00 ? 180 LYS B HZ2  1 
ATOM   6893  H  HZ3  . LYS B 1 149 ? 93.013  41.526  8.462   1.00 17.00 ? 180 LYS B HZ3  1 
ATOM   6894  N  N    . VAL B 1 150 ? 88.195  33.987  7.708   1.00 6.35  ? 181 VAL B N    1 
ATOM   6895  C  CA   . VAL B 1 150 ? 87.708  32.679  8.127   1.00 5.80  ? 181 VAL B CA   1 
ATOM   6896  C  C    . VAL B 1 150 ? 86.926  31.802  7.113   1.00 7.39  ? 181 VAL B C    1 
ATOM   6897  O  O    . VAL B 1 150 ? 86.825  30.562  7.268   1.00 8.07  ? 181 VAL B O    1 
ATOM   6898  C  CB   . VAL B 1 150 ? 86.976  32.831  9.469   1.00 3.40  ? 181 VAL B CB   1 
ATOM   6899  C  CG1  . VAL B 1 150 ? 85.662  32.079  9.486   1.00 8.30  ? 181 VAL B CG1  1 
ATOM   6900  C  CG2  . VAL B 1 150 ? 87.854  32.333  10.577  1.00 5.90  ? 181 VAL B CG2  1 
ATOM   6901  H  H    . VAL B 1 150 ? 87.564  34.727  7.617   1.00 17.00 ? 181 VAL B H    1 
ATOM   6902  N  N    . LEU B 1 151 ? 86.466  32.395  6.018   1.00 6.04  ? 182 LEU B N    1 
ATOM   6903  C  CA   . LEU B 1 151 ? 85.678  31.612  5.068   1.00 5.33  ? 182 LEU B CA   1 
ATOM   6904  C  C    . LEU B 1 151 ? 86.223  31.242  3.670   1.00 4.57  ? 182 LEU B C    1 
ATOM   6905  O  O    . LEU B 1 151 ? 85.908  30.161  3.166   1.00 3.25  ? 182 LEU B O    1 
ATOM   6906  C  CB   . LEU B 1 151 ? 84.270  32.234  4.965   1.00 5.04  ? 182 LEU B CB   1 
ATOM   6907  C  CG   . LEU B 1 151 ? 83.482  32.299  6.290   1.00 2.83  ? 182 LEU B CG   1 
ATOM   6908  C  CD1  . LEU B 1 151 ? 82.341  33.277  6.205   1.00 3.85  ? 182 LEU B CD1  1 
ATOM   6909  C  CD2  . LEU B 1 151 ? 82.970  30.949  6.700   1.00 2.00  ? 182 LEU B CD2  1 
ATOM   6910  H  H    . LEU B 1 151 ? 86.644  33.343  5.843   1.00 17.00 ? 182 LEU B H    1 
ATOM   6911  N  N    . LEU B 1 152 ? 87.022  32.099  3.037   1.00 3.62  ? 183 LEU B N    1 
ATOM   6912  C  CA   . LEU B 1 152 ? 87.500  31.753  1.707   1.00 4.21  ? 183 LEU B CA   1 
ATOM   6913  C  C    . LEU B 1 152 ? 88.512  30.613  1.654   1.00 4.91  ? 183 LEU B C    1 
ATOM   6914  O  O    . LEU B 1 152 ? 89.417  30.513  2.485   1.00 3.51  ? 183 LEU B O    1 
ATOM   6915  C  CB   . LEU B 1 152 ? 88.015  32.976  0.990   1.00 4.18  ? 183 LEU B CB   1 
ATOM   6916  C  CG   . LEU B 1 152 ? 86.916  33.719  0.252   1.00 2.44  ? 183 LEU B CG   1 
ATOM   6917  C  CD1  . LEU B 1 152 ? 87.393  35.079  -0.207  1.00 3.88  ? 183 LEU B CD1  1 
ATOM   6918  C  CD2  . LEU B 1 152 ? 86.486  32.896  -0.927  1.00 2.82  ? 183 LEU B CD2  1 
ATOM   6919  H  H    . LEU B 1 152 ? 87.319  32.922  3.470   1.00 17.00 ? 183 LEU B H    1 
ATOM   6920  N  N    . ARG B 1 153 ? 88.309  29.722  0.689   1.00 6.81  ? 184 ARG B N    1 
ATOM   6921  C  CA   . ARG B 1 153 ? 89.176  28.553  0.517   1.00 7.45  ? 184 ARG B CA   1 
ATOM   6922  C  C    . ARG B 1 153 ? 90.558  28.936  -0.005  1.00 9.08  ? 184 ARG B C    1 
ATOM   6923  O  O    . ARG B 1 153 ? 90.738  29.989  -0.654  1.00 9.33  ? 184 ARG B O    1 
ATOM   6924  C  CB   . ARG B 1 153 ? 88.544  27.509  -0.422  1.00 4.83  ? 184 ARG B CB   1 
ATOM   6925  C  CG   . ARG B 1 153 ? 88.781  27.798  -1.897  1.00 7.81  ? 184 ARG B CG   1 
ATOM   6926  C  CD   . ARG B 1 153 ? 87.932  26.962  -2.805  1.00 8.53  ? 184 ARG B CD   1 
ATOM   6927  N  NE   . ARG B 1 153 ? 87.996  25.545  -2.488  1.00 9.56  ? 184 ARG B NE   1 
ATOM   6928  C  CZ   . ARG B 1 153 ? 87.010  24.676  -2.719  1.00 10.26 ? 184 ARG B CZ   1 
ATOM   6929  N  NH1  . ARG B 1 153 ? 85.868  25.056  -3.287  1.00 5.81  ? 184 ARG B NH1  1 
ATOM   6930  N  NH2  . ARG B 1 153 ? 87.126  23.432  -2.274  1.00 12.75 ? 184 ARG B NH2  1 
ATOM   6931  H  H    . ARG B 1 153 ? 87.587  29.877  0.045   1.00 17.00 ? 184 ARG B H    1 
ATOM   6932  H  HE   . ARG B 1 153 ? 88.816  25.200  -2.075  1.00 17.00 ? 184 ARG B HE   1 
ATOM   6933  H  HH11 . ARG B 1 153 ? 85.717  26.002  -3.566  1.00 17.00 ? 184 ARG B HH11 1 
ATOM   6934  H  HH12 . ARG B 1 153 ? 85.175  24.359  -3.401  1.00 17.00 ? 184 ARG B HH12 1 
ATOM   6935  H  HH21 . ARG B 1 153 ? 87.937  23.163  -1.759  1.00 17.00 ? 184 ARG B HH21 1 
ATOM   6936  H  HH22 . ARG B 1 153 ? 86.404  22.760  -2.438  1.00 17.00 ? 184 ARG B HH22 1 
ATOM   6937  N  N    . ARG B 1 154 ? 91.518  28.062  0.303   1.00 7.55  ? 185 ARG B N    1 
ATOM   6938  C  CA   . ARG B 1 154 ? 92.899  28.204  -0.115  1.00 6.52  ? 185 ARG B CA   1 
ATOM   6939  C  C    . ARG B 1 154 ? 93.079  26.993  -1.001  1.00 5.51  ? 185 ARG B C    1 
ATOM   6940  O  O    . ARG B 1 154 ? 93.028  27.091  -2.215  1.00 5.53  ? 185 ARG B O    1 
ATOM   6941  C  CB   . ARG B 1 154 ? 93.825  28.114  1.092   1.00 7.69  ? 185 ARG B CB   1 
ATOM   6942  C  CG   . ARG B 1 154 ? 93.289  28.778  2.374   1.00 7.07  ? 185 ARG B CG   1 
ATOM   6943  C  CD   . ARG B 1 154 ? 93.003  30.266  2.206   1.00 4.88  ? 185 ARG B CD   1 
ATOM   6944  N  NE   . ARG B 1 154 ? 92.492  30.868  3.432   1.00 2.00  ? 185 ARG B NE   1 
ATOM   6945  C  CZ   . ARG B 1 154 ? 92.130  32.141  3.534   1.00 2.85  ? 185 ARG B CZ   1 
ATOM   6946  N  NH1  . ARG B 1 154 ? 92.232  32.957  2.478   1.00 2.43  ? 185 ARG B NH1  1 
ATOM   6947  N  NH2  . ARG B 1 154 ? 91.608  32.585  4.674   1.00 2.00  ? 185 ARG B NH2  1 
ATOM   6948  H  H    . ARG B 1 154 ? 91.244  27.285  0.832   1.00 17.00 ? 185 ARG B H    1 
ATOM   6949  H  HE   . ARG B 1 154 ? 92.408  30.299  4.226   1.00 17.00 ? 185 ARG B HE   1 
ATOM   6950  H  HH11 . ARG B 1 154 ? 92.587  32.615  1.608   1.00 17.00 ? 185 ARG B HH11 1 
ATOM   6951  H  HH12 . ARG B 1 154 ? 91.966  33.917  2.556   1.00 17.00 ? 185 ARG B HH12 1 
ATOM   6952  H  HH21 . ARG B 1 154 ? 91.491  31.959  5.443   1.00 17.00 ? 185 ARG B HH21 1 
ATOM   6953  H  HH22 . ARG B 1 154 ? 91.344  33.545  4.762   1.00 17.00 ? 185 ARG B HH22 1 
ATOM   6954  N  N    . GLU B 1 155 ? 93.184  25.828  -0.375  1.00 7.68  ? 186 GLU B N    1 
ATOM   6955  C  CA   . GLU B 1 155 ? 93.318  24.554  -1.103  1.00 7.03  ? 186 GLU B CA   1 
ATOM   6956  C  C    . GLU B 1 155 ? 91.928  23.959  -1.063  1.00 3.80  ? 186 GLU B C    1 
ATOM   6957  O  O    . GLU B 1 155 ? 91.189  24.232  -0.124  1.00 2.00  ? 186 GLU B O    1 
ATOM   6958  C  CB   . GLU B 1 155 ? 94.312  23.628  -0.399  1.00 5.46  ? 186 GLU B CB   1 
ATOM   6959  C  CG   . GLU B 1 155 ? 94.904  22.560  -1.297  1.00 10.50 ? 186 GLU B CG   1 
ATOM   6960  C  CD   . GLU B 1 155 ? 96.364  22.224  -0.953  1.00 12.52 ? 186 GLU B CD   1 
ATOM   6961  O  OE1  . GLU B 1 155 ? 97.191  23.160  -0.866  1.00 14.16 ? 186 GLU B OE1  1 
ATOM   6962  O  OE2  . GLU B 1 155 ? 96.696  21.026  -0.789  1.00 13.49 ? 186 GLU B OE2  1 
ATOM   6963  H  H    . GLU B 1 155 ? 93.101  25.786  0.596   1.00 17.00 ? 186 GLU B H    1 
ATOM   6964  N  N    . PHE B 1 156 ? 91.533  23.251  -2.114  1.00 4.08  ? 187 PHE B N    1 
ATOM   6965  C  CA   . PHE B 1 156 ? 90.204  22.642  -2.149  1.00 3.95  ? 187 PHE B CA   1 
ATOM   6966  C  C    . PHE B 1 156 ? 90.154  21.629  -1.043  1.00 2.00  ? 187 PHE B C    1 
ATOM   6967  O  O    . PHE B 1 156 ? 90.984  20.751  -0.997  1.00 4.69  ? 187 PHE B O    1 
ATOM   6968  C  CB   . PHE B 1 156 ? 89.960  21.956  -3.502  1.00 6.69  ? 187 PHE B CB   1 
ATOM   6969  C  CG   . PHE B 1 156 ? 88.755  21.002  -3.538  1.00 9.62  ? 187 PHE B CG   1 
ATOM   6970  C  CD1  . PHE B 1 156 ? 88.759  19.782  -2.821  1.00 9.41  ? 187 PHE B CD1  1 
ATOM   6971  C  CD2  . PHE B 1 156 ? 87.642  21.293  -4.329  1.00 8.96  ? 187 PHE B CD2  1 
ATOM   6972  C  CE1  . PHE B 1 156 ? 87.700  18.892  -2.893  1.00 5.43  ? 187 PHE B CE1  1 
ATOM   6973  C  CE2  . PHE B 1 156 ? 86.579  20.399  -4.395  1.00 7.62  ? 187 PHE B CE2  1 
ATOM   6974  C  CZ   . PHE B 1 156 ? 86.616  19.196  -3.674  1.00 6.73  ? 187 PHE B CZ   1 
ATOM   6975  H  H    . PHE B 1 156 ? 92.147  23.132  -2.864  1.00 17.00 ? 187 PHE B H    1 
ATOM   6976  N  N    . ILE B 1 157 ? 89.214  21.751  -0.130  1.00 2.00  ? 188 ILE B N    1 
ATOM   6977  C  CA   . ILE B 1 157 ? 89.141  20.773  0.925   1.00 2.00  ? 188 ILE B CA   1 
ATOM   6978  C  C    . ILE B 1 157 ? 88.047  19.782  0.535   1.00 4.28  ? 188 ILE B C    1 
ATOM   6979  O  O    . ILE B 1 157 ? 86.938  20.173  0.239   1.00 5.86  ? 188 ILE B O    1 
ATOM   6980  C  CB   . ILE B 1 157 ? 88.879  21.442  2.277   1.00 2.00  ? 188 ILE B CB   1 
ATOM   6981  C  CG1  . ILE B 1 157 ? 90.162  22.072  2.764   1.00 2.00  ? 188 ILE B CG1  1 
ATOM   6982  C  CG2  . ILE B 1 157 ? 88.416  20.442  3.312   1.00 3.10  ? 188 ILE B CG2  1 
ATOM   6983  C  CD1  . ILE B 1 157 ? 89.973  23.038  3.928   1.00 7.35  ? 188 ILE B CD1  1 
ATOM   6984  H  H    . ILE B 1 157 ? 88.580  22.504  -0.149  1.00 17.00 ? 188 ILE B H    1 
ATOM   6985  N  N    . PRO B 1 158 ? 88.383  18.497  0.406   1.00 4.01  ? 189 PRO B N    1 
ATOM   6986  C  CA   . PRO B 1 158 ? 87.387  17.508  0.042   1.00 4.04  ? 189 PRO B CA   1 
ATOM   6987  C  C    . PRO B 1 158 ? 86.564  17.076  1.243   1.00 6.39  ? 189 PRO B C    1 
ATOM   6988  O  O    . PRO B 1 158 ? 87.059  17.032  2.386   1.00 5.75  ? 189 PRO B O    1 
ATOM   6989  C  CB   . PRO B 1 158 ? 88.247  16.360  -0.480  1.00 3.65  ? 189 PRO B CB   1 
ATOM   6990  C  CG   . PRO B 1 158 ? 89.393  16.406  0.396   1.00 3.16  ? 189 PRO B CG   1 
ATOM   6991  C  CD   . PRO B 1 158 ? 89.719  17.880  0.423   1.00 5.11  ? 189 PRO B CD   1 
ATOM   6992  N  N    . ASP B 1 159 ? 85.300  16.769  0.970   1.00 7.56  ? 190 ASP B N    1 
ATOM   6993  C  CA   . ASP B 1 159 ? 84.379  16.296  1.985   1.00 7.48  ? 190 ASP B CA   1 
ATOM   6994  C  C    . ASP B 1 159 ? 84.891  14.947  2.473   1.00 7.08  ? 190 ASP B C    1 
ATOM   6995  O  O    . ASP B 1 159 ? 85.372  14.145  1.689   1.00 7.81  ? 190 ASP B O    1 
ATOM   6996  C  CB   . ASP B 1 159 ? 82.984  16.124  1.378   1.00 9.01  ? 190 ASP B CB   1 
ATOM   6997  C  CG   . ASP B 1 159 ? 82.108  15.184  2.177   1.00 10.84 ? 190 ASP B CG   1 
ATOM   6998  O  OD1  . ASP B 1 159 ? 82.020  15.309  3.428   1.00 10.21 ? 190 ASP B OD1  1 
ATOM   6999  O  OD2  . ASP B 1 159 ? 81.523  14.292  1.545   1.00 13.41 ? 190 ASP B OD2  1 
ATOM   7000  H  H    . ASP B 1 159 ? 84.985  16.824  0.050   1.00 17.00 ? 190 ASP B H    1 
ATOM   7001  N  N    . PRO B 1 160 ? 84.861  14.712  3.785   1.00 7.47  ? 191 PRO B N    1 
ATOM   7002  C  CA   . PRO B 1 160 ? 85.332  13.423  4.293   1.00 5.99  ? 191 PRO B CA   1 
ATOM   7003  C  C    . PRO B 1 160 ? 84.281  12.321  4.156   1.00 7.54  ? 191 PRO B C    1 
ATOM   7004  O  O    . PRO B 1 160 ? 84.518  11.191  4.584   1.00 10.18 ? 191 PRO B O    1 
ATOM   7005  C  CB   . PRO B 1 160 ? 85.610  13.720  5.757   1.00 8.85  ? 191 PRO B CB   1 
ATOM   7006  C  CG   . PRO B 1 160 ? 84.647  14.843  6.067   1.00 9.31  ? 191 PRO B CG   1 
ATOM   7007  C  CD   . PRO B 1 160 ? 84.740  15.705  4.868   1.00 6.71  ? 191 PRO B CD   1 
ATOM   7008  N  N    . GLN B 1 161 ? 83.120  12.632  3.575   1.00 5.12  ? 192 GLN B N    1 
ATOM   7009  C  CA   . GLN B 1 161 ? 82.078  11.634  3.423   1.00 2.17  ? 192 GLN B CA   1 
ATOM   7010  C  C    . GLN B 1 161 ? 81.932  11.169  2.010   1.00 2.00  ? 192 GLN B C    1 
ATOM   7011  O  O    . GLN B 1 161 ? 81.086  10.354  1.719   1.00 4.91  ? 192 GLN B O    1 
ATOM   7012  C  CB   . GLN B 1 161 ? 80.745  12.161  3.929   1.00 3.19  ? 192 GLN B CB   1 
ATOM   7013  C  CG   . GLN B 1 161 ? 80.815  12.731  5.332   1.00 5.30  ? 192 GLN B CG   1 
ATOM   7014  C  CD   . GLN B 1 161 ? 79.467  12.865  5.978   1.00 2.73  ? 192 GLN B CD   1 
ATOM   7015  O  OE1  . GLN B 1 161 ? 79.175  13.848  6.634   1.00 2.08  ? 192 GLN B OE1  1 
ATOM   7016  N  NE2  . GLN B 1 161 ? 78.643  11.861  5.808   1.00 5.92  ? 192 GLN B NE2  1 
ATOM   7017  H  H    . GLN B 1 161 ? 82.998  13.539  3.299   1.00 17.00 ? 192 GLN B H    1 
ATOM   7018  H  HE21 . GLN B 1 161 ? 77.768  11.959  6.238   1.00 17.00 ? 192 GLN B HE21 1 
ATOM   7019  H  HE22 . GLN B 1 161 ? 78.911  11.077  5.292   1.00 17.00 ? 192 GLN B HE22 1 
ATOM   7020  N  N    . GLY B 1 162 ? 82.727  11.708  1.110   1.00 2.00  ? 193 GLY B N    1 
ATOM   7021  C  CA   . GLY B 1 162 ? 82.638  11.282  -0.276  1.00 3.07  ? 193 GLY B CA   1 
ATOM   7022  C  C    . GLY B 1 162 ? 81.405  11.754  -1.023  1.00 4.42  ? 193 GLY B C    1 
ATOM   7023  O  O    . GLY B 1 162 ? 80.915  11.048  -1.890  1.00 2.00  ? 193 GLY B O    1 
ATOM   7024  H  H    . GLY B 1 162 ? 83.397  12.370  1.362   1.00 17.00 ? 193 GLY B H    1 
ATOM   7025  N  N    . SER B 1 163 ? 80.917  12.956  -0.707  1.00 5.72  ? 194 SER B N    1 
ATOM   7026  C  CA   . SER B 1 163 ? 79.746  13.510  -1.370  1.00 3.24  ? 194 SER B CA   1 
ATOM   7027  C  C    . SER B 1 163 ? 80.243  13.861  -2.750  1.00 2.00  ? 194 SER B C    1 
ATOM   7028  O  O    . SER B 1 163 ? 81.241  14.535  -2.892  1.00 2.00  ? 194 SER B O    1 
ATOM   7029  C  CB   . SER B 1 163 ? 79.247  14.764  -0.641  1.00 3.10  ? 194 SER B CB   1 
ATOM   7030  O  OG   . SER B 1 163 ? 78.806  14.474  0.677   1.00 2.00  ? 194 SER B OG   1 
ATOM   7031  H  H    . SER B 1 163 ? 81.423  13.527  -0.139  1.00 17.00 ? 194 SER B H    1 
ATOM   7032  H  HG   . SER B 1 163 ? 78.555  15.337  1.034   1.00 17.00 ? 194 SER B HG   1 
ATOM   7033  N  N    . ASN B 1 164 ? 79.612  13.303  -3.757  1.00 2.00  ? 195 ASN B N    1 
ATOM   7034  C  CA   . ASN B 1 164 ? 80.008  13.554  -5.126  1.00 2.44  ? 195 ASN B CA   1 
ATOM   7035  C  C    . ASN B 1 164 ? 79.313  14.782  -5.709  1.00 4.08  ? 195 ASN B C    1 
ATOM   7036  O  O    . ASN B 1 164 ? 78.745  15.583  -4.956  1.00 3.31  ? 195 ASN B O    1 
ATOM   7037  C  CB   . ASN B 1 164 ? 79.721  12.325  -5.967  1.00 2.80  ? 195 ASN B CB   1 
ATOM   7038  C  CG   . ASN B 1 164 ? 78.370  11.756  -5.697  1.00 4.19  ? 195 ASN B CG   1 
ATOM   7039  O  OD1  . ASN B 1 164 ? 77.448  12.478  -5.315  1.00 5.99  ? 195 ASN B OD1  1 
ATOM   7040  N  ND2  . ASN B 1 164 ? 78.236  10.448  -5.861  1.00 4.45  ? 195 ASN B ND2  1 
ATOM   7041  H  H    . ASN B 1 164 ? 78.842  12.736  -3.548  1.00 17.00 ? 195 ASN B H    1 
ATOM   7042  H  HD21 . ASN B 1 164 ? 77.339  10.108  -5.739  1.00 17.00 ? 195 ASN B HD21 1 
ATOM   7043  H  HD22 . ASN B 1 164 ? 79.010  9.896   -6.114  1.00 17.00 ? 195 ASN B HD22 1 
ATOM   7044  N  N    . MET B 1 165 ? 79.381  14.954  -7.038  1.00 5.56  ? 196 MET B N    1 
ATOM   7045  C  CA   . MET B 1 165 ? 78.742  16.097  -7.715  1.00 4.61  ? 196 MET B CA   1 
ATOM   7046  C  C    . MET B 1 165 ? 77.284  15.832  -8.065  1.00 7.40  ? 196 MET B C    1 
ATOM   7047  O  O    . MET B 1 165 ? 76.517  16.774  -8.344  1.00 9.72  ? 196 MET B O    1 
ATOM   7048  C  CB   . MET B 1 165 ? 79.519  16.526  -8.944  1.00 2.24  ? 196 MET B CB   1 
ATOM   7049  C  CG   . MET B 1 165 ? 80.720  17.380  -8.596  1.00 2.83  ? 196 MET B CG   1 
ATOM   7050  S  SD   . MET B 1 165 ? 80.351  18.881  -7.610  1.00 2.12  ? 196 MET B SD   1 
ATOM   7051  C  CE   . MET B 1 165 ? 80.057  19.937  -8.906  1.00 2.00  ? 196 MET B CE   1 
ATOM   7052  H  H    . MET B 1 165 ? 79.889  14.313  -7.578  1.00 17.00 ? 196 MET B H    1 
ATOM   7053  N  N    . MET B 1 166 ? 76.902  14.551  -8.008  1.00 7.69  ? 197 MET B N    1 
ATOM   7054  C  CA   . MET B 1 166 ? 75.539  14.101  -8.242  1.00 4.65  ? 197 MET B CA   1 
ATOM   7055  C  C    . MET B 1 166 ? 74.770  14.593  -7.039  1.00 3.71  ? 197 MET B C    1 
ATOM   7056  O  O    . MET B 1 166 ? 73.723  15.233  -7.172  1.00 4.98  ? 197 MET B O    1 
ATOM   7057  C  CB   . MET B 1 166 ? 75.485  12.590  -8.257  1.00 6.05  ? 197 MET B CB   1 
ATOM   7058  C  CG   . MET B 1 166 ? 74.461  12.074  -9.204  1.00 6.53  ? 197 MET B CG   1 
ATOM   7059  S  SD   . MET B 1 166 ? 74.670  12.919  -10.756 1.00 5.46  ? 197 MET B SD   1 
ATOM   7060  C  CE   . MET B 1 166 ? 74.292  11.654  -11.788 1.00 4.55  ? 197 MET B CE   1 
ATOM   7061  H  H    . MET B 1 166 ? 77.583  13.884  -7.792  1.00 17.00 ? 197 MET B H    1 
ATOM   7062  N  N    . PHE B 1 167 ? 75.293  14.279  -5.864  1.00 2.00  ? 198 PHE B N    1 
ATOM   7063  C  CA   . PHE B 1 167 ? 74.695  14.733  -4.630  1.00 2.46  ? 198 PHE B CA   1 
ATOM   7064  C  C    . PHE B 1 167 ? 74.726  16.258  -4.606  1.00 3.59  ? 198 PHE B C    1 
ATOM   7065  O  O    . PHE B 1 167 ? 73.708  16.907  -4.428  1.00 3.47  ? 198 PHE B O    1 
ATOM   7066  C  CB   . PHE B 1 167 ? 75.484  14.183  -3.435  1.00 2.63  ? 198 PHE B CB   1 
ATOM   7067  C  CG   . PHE B 1 167 ? 75.087  14.763  -2.098  1.00 2.00  ? 198 PHE B CG   1 
ATOM   7068  C  CD1  . PHE B 1 167 ? 75.307  16.097  -1.800  1.00 2.00  ? 198 PHE B CD1  1 
ATOM   7069  C  CD2  . PHE B 1 167 ? 74.510  13.955  -1.130  1.00 3.27  ? 198 PHE B CD2  1 
ATOM   7070  C  CE1  . PHE B 1 167 ? 74.963  16.621  -0.574  1.00 2.62  ? 198 PHE B CE1  1 
ATOM   7071  C  CE2  . PHE B 1 167 ? 74.157  14.469  0.114   1.00 2.34  ? 198 PHE B CE2  1 
ATOM   7072  C  CZ   . PHE B 1 167 ? 74.384  15.801  0.391   1.00 3.05  ? 198 PHE B CZ   1 
ATOM   7073  H  H    . PHE B 1 167 ? 76.088  13.712  -5.829  1.00 17.00 ? 198 PHE B H    1 
ATOM   7074  N  N    . ALA B 1 168 ? 75.904  16.834  -4.775  1.00 5.43  ? 199 ALA B N    1 
ATOM   7075  C  CA   . ALA B 1 168 ? 76.037  18.286  -4.714  1.00 6.37  ? 199 ALA B CA   1 
ATOM   7076  C  C    . ALA B 1 168 ? 74.999  19.050  -5.535  1.00 6.27  ? 199 ALA B C    1 
ATOM   7077  O  O    . ALA B 1 168 ? 74.338  19.932  -5.001  1.00 6.91  ? 199 ALA B O    1 
ATOM   7078  C  CB   . ALA B 1 168 ? 77.466  18.713  -5.089  1.00 8.69  ? 199 ALA B CB   1 
ATOM   7079  H  H    . ALA B 1 168 ? 76.704  16.290  -4.924  1.00 17.00 ? 199 ALA B H    1 
ATOM   7080  N  N    . PHE B 1 169 ? 74.833  18.694  -6.811  1.00 5.50  ? 200 PHE B N    1 
ATOM   7081  C  CA   . PHE B 1 169 ? 73.870  19.362  -7.662  1.00 2.90  ? 200 PHE B CA   1 
ATOM   7082  C  C    . PHE B 1 169 ? 72.411  19.051  -7.342  1.00 3.70  ? 200 PHE B C    1 
ATOM   7083  O  O    . PHE B 1 169 ? 71.519  19.864  -7.624  1.00 2.00  ? 200 PHE B O    1 
ATOM   7084  C  CB   . PHE B 1 169 ? 74.205  19.064  -9.097  1.00 2.00  ? 200 PHE B CB   1 
ATOM   7085  C  CG   . PHE B 1 169 ? 75.233  19.977  -9.648  1.00 3.11  ? 200 PHE B CG   1 
ATOM   7086  C  CD1  . PHE B 1 169 ? 75.121  21.363  -9.426  1.00 5.52  ? 200 PHE B CD1  1 
ATOM   7087  C  CD2  . PHE B 1 169 ? 76.279  19.490  -10.420 1.00 2.85  ? 200 PHE B CD2  1 
ATOM   7088  C  CE1  . PHE B 1 169 ? 76.035  22.258  -9.973  1.00 6.90  ? 200 PHE B CE1  1 
ATOM   7089  C  CE2  . PHE B 1 169 ? 77.208  20.343  -10.983 1.00 5.15  ? 200 PHE B CE2  1 
ATOM   7090  C  CZ   . PHE B 1 169 ? 77.092  21.751  -10.764 1.00 9.34  ? 200 PHE B CZ   1 
ATOM   7091  H  H    . PHE B 1 169 ? 75.382  17.973  -7.190  1.00 17.00 ? 200 PHE B H    1 
ATOM   7092  N  N    . PHE B 1 170 ? 72.186  17.881  -6.726  1.00 5.91  ? 201 PHE B N    1 
ATOM   7093  C  CA   . PHE B 1 170 ? 70.855  17.423  -6.308  1.00 3.84  ? 201 PHE B CA   1 
ATOM   7094  C  C    . PHE B 1 170 ? 70.415  18.316  -5.162  1.00 3.57  ? 201 PHE B C    1 
ATOM   7095  O  O    . PHE B 1 170 ? 69.375  18.945  -5.235  1.00 4.83  ? 201 PHE B O    1 
ATOM   7096  C  CB   . PHE B 1 170 ? 70.911  15.971  -5.854  1.00 3.94  ? 201 PHE B CB   1 
ATOM   7097  C  CG   . PHE B 1 170 ? 69.567  15.320  -5.716  1.00 3.98  ? 201 PHE B CG   1 
ATOM   7098  C  CD1  . PHE B 1 170 ? 68.719  15.649  -4.659  1.00 3.46  ? 201 PHE B CD1  1 
ATOM   7099  C  CD2  . PHE B 1 170 ? 69.149  14.374  -6.652  1.00 2.88  ? 201 PHE B CD2  1 
ATOM   7100  C  CE1  . PHE B 1 170 ? 67.468  15.055  -4.533  1.00 2.93  ? 201 PHE B CE1  1 
ATOM   7101  C  CE2  . PHE B 1 170 ? 67.914  13.776  -6.543  1.00 2.30  ? 201 PHE B CE2  1 
ATOM   7102  C  CZ   . PHE B 1 170 ? 67.066  14.122  -5.476  1.00 4.15  ? 201 PHE B CZ   1 
ATOM   7103  H  H    . PHE B 1 170 ? 72.956  17.293  -6.552  1.00 17.00 ? 201 PHE B H    1 
ATOM   7104  N  N    . ALA B 1 171 ? 71.247  18.421  -4.134  1.00 3.31  ? 202 ALA B N    1 
ATOM   7105  C  CA   . ALA B 1 171 ? 70.961  19.274  -2.992  1.00 2.83  ? 202 ALA B CA   1 
ATOM   7106  C  C    . ALA B 1 171 ? 70.728  20.716  -3.460  1.00 2.30  ? 202 ALA B C    1 
ATOM   7107  O  O    . ALA B 1 171 ? 70.111  21.505  -2.750  1.00 2.00  ? 202 ALA B O    1 
ATOM   7108  C  CB   . ALA B 1 171 ? 72.105  19.227  -2.000  1.00 2.93  ? 202 ALA B CB   1 
ATOM   7109  H  H    . ALA B 1 171 ? 72.088  17.920  -4.158  1.00 17.00 ? 202 ALA B H    1 
ATOM   7110  N  N    . GLN B 1 172 ? 71.200  21.059  -4.653  1.00 2.00  ? 203 GLN B N    1 
ATOM   7111  C  CA   . GLN B 1 172 ? 70.991  22.411  -5.135  1.00 5.37  ? 203 GLN B CA   1 
ATOM   7112  C  C    . GLN B 1 172 ? 69.646  22.567  -5.814  1.00 7.31  ? 203 GLN B C    1 
ATOM   7113  O  O    . GLN B 1 172 ? 68.894  23.521  -5.546  1.00 6.72  ? 203 GLN B O    1 
ATOM   7114  C  CB   . GLN B 1 172 ? 72.060  22.844  -6.120  1.00 5.32  ? 203 GLN B CB   1 
ATOM   7115  C  CG   . GLN B 1 172 ? 71.910  24.315  -6.458  1.00 3.30  ? 203 GLN B CG   1 
ATOM   7116  C  CD   . GLN B 1 172 ? 72.763  24.795  -7.618  1.00 4.07  ? 203 GLN B CD   1 
ATOM   7117  O  OE1  . GLN B 1 172 ? 73.008  25.993  -7.732  1.00 3.62  ? 203 GLN B OE1  1 
ATOM   7118  N  NE2  . GLN B 1 172 ? 73.190  23.887  -8.495  1.00 2.00  ? 203 GLN B NE2  1 
ATOM   7119  H  H    . GLN B 1 172 ? 71.725  20.430  -5.184  1.00 17.00 ? 203 GLN B H    1 
ATOM   7120  H  HE21 . GLN B 1 172 ? 73.730  24.266  -9.215  1.00 17.00 ? 203 GLN B HE21 1 
ATOM   7121  H  HE22 . GLN B 1 172 ? 72.968  22.941  -8.399  1.00 17.00 ? 203 GLN B HE22 1 
ATOM   7122  N  N    . HIS B 1 173 ? 69.394  21.666  -6.759  1.00 9.04  ? 204 HIS B N    1 
ATOM   7123  C  CA   . HIS B 1 173 ? 68.145  21.616  -7.541  1.00 9.12  ? 204 HIS B CA   1 
ATOM   7124  C  C    . HIS B 1 173 ? 66.896  21.399  -6.653  1.00 6.99  ? 204 HIS B C    1 
ATOM   7125  O  O    . HIS B 1 173 ? 65.893  22.088  -6.815  1.00 6.11  ? 204 HIS B O    1 
ATOM   7126  C  CB   . HIS B 1 173 ? 68.302  20.486  -8.571  1.00 8.99  ? 204 HIS B CB   1 
ATOM   7127  C  CG   . HIS B 1 173 ? 67.025  19.994  -9.172  1.00 7.01  ? 204 HIS B CG   1 
ATOM   7128  N  ND1  . HIS B 1 173 ? 66.483  20.544  -10.311 1.00 6.10  ? 204 HIS B ND1  1 
ATOM   7129  C  CD2  . HIS B 1 173 ? 66.264  18.918  -8.876  1.00 7.03  ? 204 HIS B CD2  1 
ATOM   7130  C  CE1  . HIS B 1 173 ? 65.452  19.825  -10.699 1.00 5.52  ? 204 HIS B CE1  1 
ATOM   7131  N  NE2  . HIS B 1 173 ? 65.299  18.832  -9.846  1.00 8.06  ? 204 HIS B NE2  1 
ATOM   7132  H  H    . HIS B 1 173 ? 70.088  20.992  -6.926  1.00 17.00 ? 204 HIS B H    1 
ATOM   7133  H  HD1  . HIS B 1 173 ? 66.832  21.333  -10.785 1.00 17.00 ? 204 HIS B HD1  1 
ATOM   7134  H  HE2  . HIS B 1 173 ? 64.625  18.121  -9.904  1.00 17.00 ? 204 HIS B HE2  1 
ATOM   7135  N  N    . PHE B 1 174 ? 67.005  20.445  -5.718  1.00 7.40  ? 205 PHE B N    1 
ATOM   7136  C  CA   . PHE B 1 174 ? 65.964  20.052  -4.760  1.00 3.59  ? 205 PHE B CA   1 
ATOM   7137  C  C    . PHE B 1 174 ? 65.550  21.200  -3.849  1.00 2.95  ? 205 PHE B C    1 
ATOM   7138  O  O    . PHE B 1 174 ? 64.395  21.613  -3.816  1.00 2.00  ? 205 PHE B O    1 
ATOM   7139  C  CB   . PHE B 1 174 ? 66.495  18.894  -3.920  1.00 2.01  ? 205 PHE B CB   1 
ATOM   7140  C  CG   . PHE B 1 174 ? 65.625  18.507  -2.781  1.00 4.64  ? 205 PHE B CG   1 
ATOM   7141  C  CD1  . PHE B 1 174 ? 64.380  17.938  -3.008  1.00 5.35  ? 205 PHE B CD1  1 
ATOM   7142  C  CD2  . PHE B 1 174 ? 66.074  18.659  -1.463  1.00 4.84  ? 205 PHE B CD2  1 
ATOM   7143  C  CE1  . PHE B 1 174 ? 63.585  17.516  -1.932  1.00 7.33  ? 205 PHE B CE1  1 
ATOM   7144  C  CE2  . PHE B 1 174 ? 65.291  18.240  -0.376  1.00 7.40  ? 205 PHE B CE2  1 
ATOM   7145  C  CZ   . PHE B 1 174 ? 64.041  17.664  -0.611  1.00 6.39  ? 205 PHE B CZ   1 
ATOM   7146  H  H    . PHE B 1 174 ? 67.864  19.980  -5.661  1.00 17.00 ? 205 PHE B H    1 
ATOM   7147  N  N    . THR B 1 175 ? 66.507  21.721  -3.109  1.00 3.14  ? 206 THR B N    1 
ATOM   7148  C  CA   . THR B 1 175 ? 66.229  22.795  -2.191  1.00 2.57  ? 206 THR B CA   1 
ATOM   7149  C  C    . THR B 1 175 ? 65.826  24.017  -2.937  1.00 2.00  ? 206 THR B C    1 
ATOM   7150  O  O    . THR B 1 175 ? 65.279  24.933  -2.352  1.00 2.31  ? 206 THR B O    1 
ATOM   7151  C  CB   . THR B 1 175 ? 67.463  23.119  -1.296  1.00 4.25  ? 206 THR B CB   1 
ATOM   7152  O  OG1  . THR B 1 175 ? 68.621  23.376  -2.107  1.00 4.42  ? 206 THR B OG1  1 
ATOM   7153  C  CG2  . THR B 1 175 ? 67.745  21.971  -0.371  1.00 2.67  ? 206 THR B CG2  1 
ATOM   7154  H  H    . THR B 1 175 ? 67.433  21.414  -3.173  1.00 17.00 ? 206 THR B H    1 
ATOM   7155  H  HG1  . THR B 1 175 ? 69.424  23.067  -1.656  1.00 17.00 ? 206 THR B HG1  1 
ATOM   7156  N  N    . HIS B 1 176 ? 66.061  24.034  -4.238  1.00 2.00  ? 207 HIS B N    1 
ATOM   7157  C  CA   . HIS B 1 176 ? 65.714  25.223  -4.990  1.00 4.68  ? 207 HIS B CA   1 
ATOM   7158  C  C    . HIS B 1 176 ? 64.273  25.423  -5.391  1.00 3.80  ? 207 HIS B C    1 
ATOM   7159  O  O    . HIS B 1 176 ? 63.963  26.321  -6.147  1.00 4.78  ? 207 HIS B O    1 
ATOM   7160  C  CB   . HIS B 1 176 ? 66.692  25.467  -6.131  1.00 5.45  ? 207 HIS B CB   1 
ATOM   7161  C  CG   . HIS B 1 176 ? 67.929  26.161  -5.680  1.00 5.73  ? 207 HIS B CG   1 
ATOM   7162  N  ND1  . HIS B 1 176 ? 68.603  25.800  -4.534  1.00 6.10  ? 207 HIS B ND1  1 
ATOM   7163  C  CD2  . HIS B 1 176 ? 68.557  27.258  -6.152  1.00 7.69  ? 207 HIS B CD2  1 
ATOM   7164  C  CE1  . HIS B 1 176 ? 69.585  26.650  -4.311  1.00 6.94  ? 207 HIS B CE1  1 
ATOM   7165  N  NE2  . HIS B 1 176 ? 69.579  27.547  -5.278  1.00 7.78  ? 207 HIS B NE2  1 
ATOM   7166  H  H    . HIS B 1 176 ? 66.470  23.272  -4.697  1.00 17.00 ? 207 HIS B H    1 
ATOM   7167  H  HD1  . HIS B 1 176 ? 68.425  24.990  -3.998  1.00 17.00 ? 207 HIS B HD1  1 
ATOM   7168  H  HE2  . HIS B 1 176 ? 70.217  28.290  -5.354  1.00 17.00 ? 207 HIS B HE2  1 
ATOM   7169  N  N    . GLN B 1 177 ? 63.393  24.553  -4.921  1.00 5.70  ? 208 GLN B N    1 
ATOM   7170  C  CA   . GLN B 1 177 ? 61.960  24.715  -5.170  1.00 3.10  ? 208 GLN B CA   1 
ATOM   7171  C  C    . GLN B 1 177 ? 61.467  25.495  -3.955  1.00 2.40  ? 208 GLN B C    1 
ATOM   7172  O  O    . GLN B 1 177 ? 60.741  26.452  -4.107  1.00 2.60  ? 208 GLN B O    1 
ATOM   7173  C  CB   . GLN B 1 177 ? 61.233  23.377  -5.311  1.00 2.02  ? 208 GLN B CB   1 
ATOM   7174  C  CG   . GLN B 1 177 ? 61.243  22.460  -4.082  1.00 2.02  ? 208 GLN B CG   1 
ATOM   7175  C  CD   . GLN B 1 177 ? 60.798  21.061  -4.419  1.00 2.00  ? 208 GLN B CD   1 
ATOM   7176  O  OE1  . GLN B 1 177 ? 60.420  20.793  -5.539  1.00 2.00  ? 208 GLN B OE1  1 
ATOM   7177  N  NE2  . GLN B 1 177 ? 60.844  20.167  -3.460  1.00 2.00  ? 208 GLN B NE2  1 
ATOM   7178  H  H    . GLN B 1 177 ? 63.734  23.788  -4.415  1.00 17.00 ? 208 GLN B H    1 
ATOM   7179  H  HE21 . GLN B 1 177 ? 60.578  19.252  -3.680  1.00 17.00 ? 208 GLN B HE21 1 
ATOM   7180  H  HE22 . GLN B 1 177 ? 61.159  20.446  -2.577  1.00 17.00 ? 208 GLN B HE22 1 
ATOM   7181  N  N    . PHE B 1 178 ? 61.890  25.109  -2.753  1.00 2.71  ? 209 PHE B N    1 
ATOM   7182  C  CA   . PHE B 1 178 ? 61.481  25.849  -1.595  1.00 2.00  ? 209 PHE B CA   1 
ATOM   7183  C  C    . PHE B 1 178 ? 62.270  27.100  -1.406  1.00 3.96  ? 209 PHE B C    1 
ATOM   7184  O  O    . PHE B 1 178 ? 61.694  28.102  -1.035  1.00 7.10  ? 209 PHE B O    1 
ATOM   7185  C  CB   . PHE B 1 178 ? 61.431  25.065  -0.281  1.00 5.97  ? 209 PHE B CB   1 
ATOM   7186  C  CG   . PHE B 1 178 ? 62.252  23.824  -0.227  1.00 4.75  ? 209 PHE B CG   1 
ATOM   7187  C  CD1  . PHE B 1 178 ? 61.861  22.688  -0.920  1.00 5.46  ? 209 PHE B CD1  1 
ATOM   7188  C  CD2  . PHE B 1 178 ? 63.331  23.743  0.640   1.00 6.76  ? 209 PHE B CD2  1 
ATOM   7189  C  CE1  . PHE B 1 178 ? 62.519  21.475  -0.751  1.00 7.97  ? 209 PHE B CE1  1 
ATOM   7190  C  CE2  . PHE B 1 178 ? 64.003  22.544  0.826   1.00 10.75 ? 209 PHE B CE2  1 
ATOM   7191  C  CZ   . PHE B 1 178 ? 63.593  21.396  0.126   1.00 9.35  ? 209 PHE B CZ   1 
ATOM   7192  H  H    . PHE B 1 178 ? 62.502  24.358  -2.666  1.00 17.00 ? 209 PHE B H    1 
ATOM   7193  N  N    . PHE B 1 179 ? 63.585  27.060  -1.600  1.00 5.49  ? 210 PHE B N    1 
ATOM   7194  C  CA   . PHE B 1 179 ? 64.405  28.276  -1.468  1.00 3.77  ? 210 PHE B CA   1 
ATOM   7195  C  C    . PHE B 1 179 ? 64.230  28.984  -2.790  1.00 2.00  ? 210 PHE B C    1 
ATOM   7196  O  O    . PHE B 1 179 ? 64.443  28.396  -3.840  1.00 2.00  ? 210 PHE B O    1 
ATOM   7197  C  CB   . PHE B 1 179 ? 65.875  27.949  -1.214  1.00 2.91  ? 210 PHE B CB   1 
ATOM   7198  C  CG   . PHE B 1 179 ? 66.099  27.174  0.044   1.00 4.62  ? 210 PHE B CG   1 
ATOM   7199  C  CD1  . PHE B 1 179 ? 65.611  27.640  1.246   1.00 6.50  ? 210 PHE B CD1  1 
ATOM   7200  C  CD2  . PHE B 1 179 ? 66.763  25.957  0.026   1.00 5.71  ? 210 PHE B CD2  1 
ATOM   7201  C  CE1  . PHE B 1 179 ? 65.778  26.904  2.415   1.00 7.20  ? 210 PHE B CE1  1 
ATOM   7202  C  CE2  . PHE B 1 179 ? 66.929  25.225  1.190   1.00 7.43  ? 210 PHE B CE2  1 
ATOM   7203  C  CZ   . PHE B 1 179 ? 66.435  25.702  2.383   1.00 6.95  ? 210 PHE B CZ   1 
ATOM   7204  H  H    . PHE B 1 179 ? 64.008  26.224  -1.859  1.00 17.00 ? 210 PHE B H    1 
ATOM   7205  N  N    . LYS B 1 180 ? 63.735  30.215  -2.720  1.00 2.65  ? 211 LYS B N    1 
ATOM   7206  C  CA   . LYS B 1 180 ? 63.467  31.016  -3.901  1.00 2.72  ? 211 LYS B CA   1 
ATOM   7207  C  C    . LYS B 1 180 ? 63.386  32.517  -3.625  1.00 2.00  ? 211 LYS B C    1 
ATOM   7208  O  O    . LYS B 1 180 ? 62.757  33.237  -4.386  1.00 2.78  ? 211 LYS B O    1 
ATOM   7209  C  CB   . LYS B 1 180 ? 62.158  30.547  -4.539  1.00 2.00  ? 211 LYS B CB   1 
ATOM   7210  C  CG   . LYS B 1 180 ? 62.292  29.382  -5.481  1.00 2.00  ? 211 LYS B CG   1 
ATOM   7211  C  CD   . LYS B 1 180 ? 60.942  28.913  -5.968  1.00 2.75  ? 211 LYS B CD   1 
ATOM   7212  C  CE   . LYS B 1 180 ? 60.257  29.896  -6.908  1.00 2.00  ? 211 LYS B CE   1 
ATOM   7213  N  NZ   . LYS B 1 180 ? 59.296  29.196  -7.799  1.00 2.02  ? 211 LYS B NZ   1 
ATOM   7214  H  H    . LYS B 1 180 ? 63.567  30.588  -1.832  1.00 17.00 ? 211 LYS B H    1 
ATOM   7215  H  HZ1  . LYS B 1 180 ? 58.584  28.703  -7.225  1.00 17.00 ? 211 LYS B HZ1  1 
ATOM   7216  H  HZ2  . LYS B 1 180 ? 58.837  29.927  -8.368  1.00 17.00 ? 211 LYS B HZ2  1 
ATOM   7217  H  HZ3  . LYS B 1 180 ? 59.785  28.514  -8.413  1.00 17.00 ? 211 LYS B HZ3  1 
ATOM   7218  N  N    . THR B 1 181 ? 64.090  32.987  -2.604  1.00 2.00  ? 212 THR B N    1 
ATOM   7219  C  CA   . THR B 1 181 ? 64.067  34.394  -2.242  1.00 2.40  ? 212 THR B CA   1 
ATOM   7220  C  C    . THR B 1 181 ? 63.666  35.421  -3.317  1.00 4.26  ? 212 THR B C    1 
ATOM   7221  O  O    . THR B 1 181 ? 64.220  35.476  -4.420  1.00 3.72  ? 212 THR B O    1 
ATOM   7222  C  CB   . THR B 1 181 ? 65.380  34.822  -1.550  1.00 2.00  ? 212 THR B CB   1 
ATOM   7223  O  OG1  . THR B 1 181 ? 65.590  33.996  -0.406  1.00 2.89  ? 212 THR B OG1  1 
ATOM   7224  C  CG2  . THR B 1 181 ? 65.327  36.277  -1.092  1.00 2.00  ? 212 THR B CG2  1 
ATOM   7225  H  H    . THR B 1 181 ? 64.681  32.376  -2.116  1.00 17.00 ? 212 THR B H    1 
ATOM   7226  H  HG1  . THR B 1 181 ? 66.408  33.489  -0.588  1.00 17.00 ? 212 THR B HG1  1 
ATOM   7227  N  N    . ASP B 1 182 ? 62.611  36.153  -2.989  1.00 6.62  ? 213 ASP B N    1 
ATOM   7228  C  CA   . ASP B 1 182 ? 62.065  37.220  -3.796  1.00 10.88 ? 213 ASP B CA   1 
ATOM   7229  C  C    . ASP B 1 182 ? 62.888  38.450  -3.384  1.00 12.10 ? 213 ASP B C    1 
ATOM   7230  O  O    . ASP B 1 182 ? 62.527  39.218  -2.482  1.00 12.44 ? 213 ASP B O    1 
ATOM   7231  C  CB   . ASP B 1 182 ? 60.568  37.367  -3.440  1.00 14.73 ? 213 ASP B CB   1 
ATOM   7232  C  CG   . ASP B 1 182 ? 59.960  38.751  -3.825  1.00 17.19 ? 213 ASP B CG   1 
ATOM   7233  O  OD1  . ASP B 1 182 ? 60.555  39.528  -4.622  1.00 14.56 ? 213 ASP B OD1  1 
ATOM   7234  O  OD2  . ASP B 1 182 ? 58.857  39.048  -3.300  1.00 16.77 ? 213 ASP B OD2  1 
ATOM   7235  H  H    . ASP B 1 182 ? 62.149  35.951  -2.168  1.00 17.00 ? 213 ASP B H    1 
ATOM   7236  N  N    . HIS B 1 183 ? 64.024  38.620  -4.035  1.00 14.54 ? 214 HIS B N    1 
ATOM   7237  C  CA   . HIS B 1 183 ? 64.880  39.735  -3.693  1.00 19.00 ? 214 HIS B CA   1 
ATOM   7238  C  C    . HIS B 1 183 ? 64.186  41.069  -3.977  1.00 22.34 ? 214 HIS B C    1 
ATOM   7239  O  O    . HIS B 1 183 ? 64.359  42.032  -3.213  1.00 23.28 ? 214 HIS B O    1 
ATOM   7240  C  CB   . HIS B 1 183 ? 66.191  39.679  -4.463  1.00 21.78 ? 214 HIS B CB   1 
ATOM   7241  C  CG   . HIS B 1 183 ? 66.871  38.359  -4.392  1.00 19.75 ? 214 HIS B CG   1 
ATOM   7242  N  ND1  . HIS B 1 183 ? 66.769  37.422  -5.397  1.00 21.57 ? 214 HIS B ND1  1 
ATOM   7243  C  CD2  . HIS B 1 183 ? 67.659  37.813  -3.438  1.00 20.97 ? 214 HIS B CD2  1 
ATOM   7244  C  CE1  . HIS B 1 183 ? 67.465  36.348  -5.064  1.00 24.75 ? 214 HIS B CE1  1 
ATOM   7245  N  NE2  . HIS B 1 183 ? 68.017  36.562  -3.880  1.00 24.12 ? 214 HIS B NE2  1 
ATOM   7246  H  H    . HIS B 1 183 ? 64.247  37.944  -4.707  1.00 17.00 ? 214 HIS B H    1 
ATOM   7247  H  HD1  . HIS B 1 183 ? 66.268  37.488  -6.243  1.00 17.00 ? 214 HIS B HD1  1 
ATOM   7248  H  HE2  . HIS B 1 183 ? 68.593  35.925  -3.386  1.00 17.00 ? 214 HIS B HE2  1 
ATOM   7249  N  N    . LYS B 1 184 ? 63.381  41.135  -5.045  1.00 20.94 ? 215 LYS B N    1 
ATOM   7250  C  CA   . LYS B 1 184 ? 62.713  42.401  -5.376  1.00 16.46 ? 215 LYS B CA   1 
ATOM   7251  C  C    . LYS B 1 184 ? 62.016  42.920  -4.121  1.00 12.19 ? 215 LYS B C    1 
ATOM   7252  O  O    . LYS B 1 184 ? 62.062  44.097  -3.844  1.00 13.73 ? 215 LYS B O    1 
ATOM   7253  C  CB   . LYS B 1 184 ? 61.756  42.259  -6.581  1.00 16.09 ? 215 LYS B CB   1 
ATOM   7254  C  CG   . LYS B 1 184 ? 60.297  42.184  -6.218  1.00 21.41 ? 215 LYS B CG   1 
ATOM   7255  C  CD   . LYS B 1 184 ? 59.400  41.917  -7.420  1.00 25.91 ? 215 LYS B CD   1 
ATOM   7256  C  CE   . LYS B 1 184 ? 59.562  40.507  -8.031  1.00 26.57 ? 215 LYS B CE   1 
ATOM   7257  N  NZ   . LYS B 1 184 ? 58.508  40.218  -9.095  1.00 26.22 ? 215 LYS B NZ   1 
ATOM   7258  H  H    . LYS B 1 184 ? 63.220  40.350  -5.598  1.00 17.00 ? 215 LYS B H    1 
ATOM   7259  H  HZ1  . LYS B 1 184 ? 58.553  40.918  -9.862  1.00 17.00 ? 215 LYS B HZ1  1 
ATOM   7260  H  HZ2  . LYS B 1 184 ? 58.676  39.265  -9.480  1.00 17.00 ? 215 LYS B HZ2  1 
ATOM   7261  H  HZ3  . LYS B 1 184 ? 57.568  40.244  -8.650  1.00 17.00 ? 215 LYS B HZ3  1 
ATOM   7262  N  N    . ARG B 1 185 ? 61.480  42.019  -3.316  1.00 9.86  ? 216 ARG B N    1 
ATOM   7263  C  CA   . ARG B 1 185 ? 60.813  42.411  -2.091  1.00 10.34 ? 216 ARG B CA   1 
ATOM   7264  C  C    . ARG B 1 185 ? 61.891  42.503  -1.024  1.00 8.48  ? 216 ARG B C    1 
ATOM   7265  O  O    . ARG B 1 185 ? 61.800  43.305  -0.089  1.00 5.84  ? 216 ARG B O    1 
ATOM   7266  C  CB   . ARG B 1 185 ? 59.797  41.338  -1.678  1.00 14.11 ? 216 ARG B CB   1 
ATOM   7267  C  CG   . ARG B 1 185 ? 58.360  41.813  -1.473  1.00 16.05 ? 216 ARG B CG   1 
ATOM   7268  C  CD   . ARG B 1 185 ? 57.577  41.824  -2.769  1.00 16.90 ? 216 ARG B CD   1 
ATOM   7269  N  NE   . ARG B 1 185 ? 56.164  41.630  -2.490  1.00 17.60 ? 216 ARG B NE   1 
ATOM   7270  C  CZ   . ARG B 1 185 ? 55.586  40.437  -2.409  1.00 18.44 ? 216 ARG B CZ   1 
ATOM   7271  N  NH1  . ARG B 1 185 ? 56.305  39.346  -2.610  1.00 18.82 ? 216 ARG B NH1  1 
ATOM   7272  N  NH2  . ARG B 1 185 ? 54.317  40.324  -2.032  1.00 20.77 ? 216 ARG B NH2  1 
ATOM   7273  H  H    . ARG B 1 185 ? 61.565  41.069  -3.503  1.00 17.00 ? 216 ARG B H    1 
ATOM   7274  H  HE   . ARG B 1 185 ? 55.603  42.420  -2.351  1.00 17.00 ? 216 ARG B HE   1 
ATOM   7275  H  HH11 . ARG B 1 185 ? 57.258  39.464  -2.802  1.00 17.00 ? 216 ARG B HH11 1 
ATOM   7276  H  HH12 . ARG B 1 185 ? 55.898  38.434  -2.556  1.00 17.00 ? 216 ARG B HH12 1 
ATOM   7277  H  HH21 . ARG B 1 185 ? 53.788  41.140  -1.802  1.00 17.00 ? 216 ARG B HH21 1 
ATOM   7278  H  HH22 . ARG B 1 185 ? 53.893  39.420  -1.973  1.00 17.00 ? 216 ARG B HH22 1 
ATOM   7279  N  N    . GLY B 1 186 ? 62.853  41.592  -1.124  1.00 7.29  ? 217 GLY B N    1 
ATOM   7280  C  CA   . GLY B 1 186 ? 63.955  41.563  -0.190  1.00 7.66  ? 217 GLY B CA   1 
ATOM   7281  C  C    . GLY B 1 186 ? 64.212  40.188  0.366   1.00 7.88  ? 217 GLY B C    1 
ATOM   7282  O  O    . GLY B 1 186 ? 63.536  39.243  -0.031  1.00 7.68  ? 217 GLY B O    1 
ATOM   7283  H  H    . GLY B 1 186 ? 62.819  40.902  -1.799  1.00 17.00 ? 217 GLY B H    1 
ATOM   7284  N  N    . PRO B 1 187 ? 65.274  40.020  1.181   1.00 9.52  ? 218 PRO B N    1 
ATOM   7285  C  CA   . PRO B 1 187 ? 65.590  38.730  1.775   1.00 7.72  ? 218 PRO B CA   1 
ATOM   7286  C  C    . PRO B 1 187 ? 64.542  38.597  2.882   1.00 10.73 ? 218 PRO B C    1 
ATOM   7287  O  O    . PRO B 1 187 ? 64.180  39.594  3.539   1.00 10.20 ? 218 PRO B O    1 
ATOM   7288  C  CB   . PRO B 1 187 ? 66.986  38.951  2.317   1.00 5.64  ? 218 PRO B CB   1 
ATOM   7289  C  CG   . PRO B 1 187 ? 66.949  40.361  2.745   1.00 7.80  ? 218 PRO B CG   1 
ATOM   7290  C  CD   . PRO B 1 187 ? 66.260  41.034  1.596   1.00 9.27  ? 218 PRO B CD   1 
ATOM   7291  N  N    . GLY B 1 188 ? 64.042  37.383  3.083   1.00 11.04 ? 219 GLY B N    1 
ATOM   7292  C  CA   . GLY B 1 188 ? 62.983  37.197  4.065   1.00 12.22 ? 219 GLY B CA   1 
ATOM   7293  C  C    . GLY B 1 188 ? 61.664  37.004  3.318   1.00 11.28 ? 219 GLY B C    1 
ATOM   7294  O  O    . GLY B 1 188 ? 60.684  36.531  3.885   1.00 11.82 ? 219 GLY B O    1 
ATOM   7295  H  H    . GLY B 1 188 ? 64.368  36.616  2.569   1.00 17.00 ? 219 GLY B H    1 
ATOM   7296  N  N    . PHE B 1 189 ? 61.680  37.358  2.027   1.00 8.96  ? 220 PHE B N    1 
ATOM   7297  C  CA   . PHE B 1 189 ? 60.562  37.229  1.106   1.00 4.78  ? 220 PHE B CA   1 
ATOM   7298  C  C    . PHE B 1 189 ? 60.853  36.072  0.154   1.00 3.38  ? 220 PHE B C    1 
ATOM   7299  O  O    . PHE B 1 189 ? 61.917  36.012  -0.427  1.00 2.02  ? 220 PHE B O    1 
ATOM   7300  C  CB   . PHE B 1 189 ? 60.379  38.515  0.300   1.00 2.03  ? 220 PHE B CB   1 
ATOM   7301  C  CG   . PHE B 1 189 ? 59.691  39.590  1.055   1.00 2.77  ? 220 PHE B CG   1 
ATOM   7302  C  CD1  . PHE B 1 189 ? 58.359  39.456  1.414   1.00 5.01  ? 220 PHE B CD1  1 
ATOM   7303  C  CD2  . PHE B 1 189 ? 60.376  40.724  1.460   1.00 5.47  ? 220 PHE B CD2  1 
ATOM   7304  C  CE1  . PHE B 1 189 ? 57.714  40.434  2.174   1.00 4.91  ? 220 PHE B CE1  1 
ATOM   7305  C  CE2  . PHE B 1 189 ? 59.739  41.719  2.224   1.00 5.33  ? 220 PHE B CE2  1 
ATOM   7306  C  CZ   . PHE B 1 189 ? 58.415  41.570  2.579   1.00 5.01  ? 220 PHE B CZ   1 
ATOM   7307  H  H    . PHE B 1 189 ? 62.489  37.739  1.627   1.00 17.00 ? 220 PHE B H    1 
ATOM   7308  N  N    . THR B 1 190 ? 59.898  35.164  -0.003  1.00 3.75  ? 221 THR B N    1 
ATOM   7309  C  CA   . THR B 1 190 ? 60.050  34.024  -0.877  1.00 2.00  ? 221 THR B CA   1 
ATOM   7310  C  C    . THR B 1 190 ? 59.125  34.137  -2.072  1.00 2.67  ? 221 THR B C    1 
ATOM   7311  O  O    . THR B 1 190 ? 58.414  35.123  -2.226  1.00 4.68  ? 221 THR B O    1 
ATOM   7312  C  CB   . THR B 1 190 ? 59.754  32.741  -0.099  1.00 4.43  ? 221 THR B CB   1 
ATOM   7313  O  OG1  . THR B 1 190 ? 59.778  31.603  -0.980  1.00 7.18  ? 221 THR B OG1  1 
ATOM   7314  C  CG2  . THR B 1 190 ? 58.422  32.845  0.621   1.00 3.28  ? 221 THR B CG2  1 
ATOM   7315  H  H    . THR B 1 190 ? 59.042  35.295  0.450   1.00 17.00 ? 221 THR B H    1 
ATOM   7316  H  HG1  . THR B 1 190 ? 59.835  30.802  -0.430  1.00 17.00 ? 221 THR B HG1  1 
ATOM   7317  N  N    . ARG B 1 191 ? 59.247  33.174  -2.975  1.00 4.87  ? 222 ARG B N    1 
ATOM   7318  C  CA   . ARG B 1 191 ? 58.425  33.043  -4.195  1.00 7.55  ? 222 ARG B CA   1 
ATOM   7319  C  C    . ARG B 1 191 ? 58.009  31.549  -4.254  1.00 7.21  ? 222 ARG B C    1 
ATOM   7320  O  O    . ARG B 1 191 ? 57.400  31.078  -5.225  1.00 7.43  ? 222 ARG B O    1 
ATOM   7321  C  CB   . ARG B 1 191 ? 59.223  33.349  -5.471  1.00 8.60  ? 222 ARG B CB   1 
ATOM   7322  C  CG   . ARG B 1 191 ? 60.047  34.587  -5.435  1.00 13.39 ? 222 ARG B CG   1 
ATOM   7323  C  CD   . ARG B 1 191 ? 60.859  34.702  -6.720  1.00 18.52 ? 222 ARG B CD   1 
ATOM   7324  N  NE   . ARG B 1 191 ? 60.068  35.211  -7.834  1.00 24.08 ? 222 ARG B NE   1 
ATOM   7325  C  CZ   . ARG B 1 191 ? 59.460  36.401  -7.846  1.00 27.64 ? 222 ARG B CZ   1 
ATOM   7326  N  NH1  . ARG B 1 191 ? 59.540  37.221  -6.810  1.00 27.28 ? 222 ARG B NH1  1 
ATOM   7327  N  NH2  . ARG B 1 191 ? 58.747  36.775  -8.900  1.00 30.08 ? 222 ARG B NH2  1 
ATOM   7328  H  H    . ARG B 1 191 ? 59.947  32.508  -2.819  1.00 17.00 ? 222 ARG B H    1 
ATOM   7329  H  HE   . ARG B 1 191 ? 59.973  34.645  -8.627  1.00 17.00 ? 222 ARG B HE   1 
ATOM   7330  H  HH11 . ARG B 1 191 ? 60.060  36.968  -5.995  1.00 17.00 ? 222 ARG B HH11 1 
ATOM   7331  H  HH12 . ARG B 1 191 ? 59.075  38.105  -6.851  1.00 17.00 ? 222 ARG B HH12 1 
ATOM   7332  H  HH21 . ARG B 1 191 ? 58.665  36.164  -9.687  1.00 17.00 ? 222 ARG B HH21 1 
ATOM   7333  H  HH22 . ARG B 1 191 ? 58.293  37.666  -8.913  1.00 17.00 ? 222 ARG B HH22 1 
ATOM   7334  N  N    . GLY B 1 192 ? 58.462  30.788  -3.269  1.00 5.45  ? 223 GLY B N    1 
ATOM   7335  C  CA   . GLY B 1 192 ? 58.112  29.399  -3.207  1.00 6.42  ? 223 GLY B CA   1 
ATOM   7336  C  C    . GLY B 1 192 ? 56.957  29.398  -2.238  1.00 7.95  ? 223 GLY B C    1 
ATOM   7337  O  O    . GLY B 1 192 ? 57.039  28.817  -1.134  1.00 7.35  ? 223 GLY B O    1 
ATOM   7338  H  H    . GLY B 1 192 ? 59.043  31.140  -2.576  1.00 17.00 ? 223 GLY B H    1 
ATOM   7339  N  N    . LEU B 1 193 ? 55.876  30.067  -2.658  1.00 7.07  ? 224 LEU B N    1 
ATOM   7340  C  CA   . LEU B 1 193 ? 54.651  30.212  -1.862  1.00 3.35  ? 224 LEU B CA   1 
ATOM   7341  C  C    . LEU B 1 193 ? 54.090  28.920  -1.346  1.00 2.52  ? 224 LEU B C    1 
ATOM   7342  O  O    . LEU B 1 193 ? 53.481  28.885  -0.286  1.00 2.42  ? 224 LEU B O    1 
ATOM   7343  C  CB   . LEU B 1 193 ? 53.595  30.982  -2.639  1.00 2.00  ? 224 LEU B CB   1 
ATOM   7344  C  CG   . LEU B 1 193 ? 53.985  32.460  -2.662  1.00 4.31  ? 224 LEU B CG   1 
ATOM   7345  C  CD1  . LEU B 1 193 ? 53.170  33.227  -3.698  1.00 2.01  ? 224 LEU B CD1  1 
ATOM   7346  C  CD2  . LEU B 1 193 ? 53.848  33.048  -1.250  1.00 3.76  ? 224 LEU B CD2  1 
ATOM   7347  H  H    . LEU B 1 193 ? 55.911  30.468  -3.554  1.00 17.00 ? 224 LEU B H    1 
ATOM   7348  N  N    . GLY B 1 194 ? 54.359  27.843  -2.066  1.00 2.86  ? 225 GLY B N    1 
ATOM   7349  C  CA   . GLY B 1 194 ? 53.882  26.553  -1.644  1.00 2.12  ? 225 GLY B CA   1 
ATOM   7350  C  C    . GLY B 1 194 ? 54.835  25.995  -0.627  1.00 2.14  ? 225 GLY B C    1 
ATOM   7351  O  O    . GLY B 1 194 ? 55.146  24.816  -0.702  1.00 4.78  ? 225 GLY B O    1 
ATOM   7352  H  H    . GLY B 1 194 ? 54.884  27.902  -2.887  1.00 17.00 ? 225 GLY B H    1 
ATOM   7353  N  N    . HIS B 1 195 ? 55.280  26.830  0.312   1.00 2.00  ? 226 HIS B N    1 
ATOM   7354  C  CA   . HIS B 1 195 ? 56.223  26.438  1.377   1.00 3.76  ? 226 HIS B CA   1 
ATOM   7355  C  C    . HIS B 1 195 ? 56.474  24.931  1.559   1.00 2.78  ? 226 HIS B C    1 
ATOM   7356  O  O    . HIS B 1 195 ? 55.961  24.330  2.510   1.00 2.02  ? 226 HIS B O    1 
ATOM   7357  C  CB   . HIS B 1 195 ? 55.795  27.036  2.729   1.00 2.00  ? 226 HIS B CB   1 
ATOM   7358  C  CG   . HIS B 1 195 ? 55.915  28.527  2.791   1.00 3.05  ? 226 HIS B CG   1 
ATOM   7359  N  ND1  . HIS B 1 195 ? 56.658  29.180  3.753   1.00 2.01  ? 226 HIS B ND1  1 
ATOM   7360  C  CD2  . HIS B 1 195 ? 55.393  29.494  1.994   1.00 4.24  ? 226 HIS B CD2  1 
ATOM   7361  C  CE1  . HIS B 1 195 ? 56.587  30.482  3.542   1.00 4.94  ? 226 HIS B CE1  1 
ATOM   7362  N  NE2  . HIS B 1 195 ? 55.825  30.700  2.484   1.00 2.76  ? 226 HIS B NE2  1 
ATOM   7363  H  H    . HIS B 1 195 ? 54.924  27.728  0.320   1.00 17.00 ? 226 HIS B H    1 
ATOM   7364  H  HD1  . HIS B 1 195 ? 57.189  28.835  4.490   1.00 17.00 ? 226 HIS B HD1  1 
ATOM   7365  H  HE2  . HIS B 1 195 ? 55.612  31.595  2.115   1.00 17.00 ? 226 HIS B HE2  1 
ATOM   7366  N  N    . GLY B 1 196 ? 57.263  24.344  0.653   1.00 2.00  ? 227 GLY B N    1 
ATOM   7367  C  CA   . GLY B 1 196 ? 57.562  22.923  0.717   1.00 3.41  ? 227 GLY B CA   1 
ATOM   7368  C  C    . GLY B 1 196 ? 57.830  22.202  -0.602  1.00 2.00  ? 227 GLY B C    1 
ATOM   7369  O  O    . GLY B 1 196 ? 57.841  22.796  -1.677  1.00 2.00  ? 227 GLY B O    1 
ATOM   7370  H  H    . GLY B 1 196 ? 57.600  24.838  -0.119  1.00 17.00 ? 227 GLY B H    1 
ATOM   7371  N  N    . VAL B 1 197 ? 58.015  20.892  -0.498  1.00 2.00  ? 228 VAL B N    1 
ATOM   7372  C  CA   . VAL B 1 197 ? 58.291  20.019  -1.639  1.00 2.77  ? 228 VAL B CA   1 
ATOM   7373  C  C    . VAL B 1 197 ? 57.089  19.902  -2.612  1.00 3.36  ? 228 VAL B C    1 
ATOM   7374  O  O    . VAL B 1 197 ? 56.437  18.848  -2.752  1.00 2.00  ? 228 VAL B O    1 
ATOM   7375  C  CB   . VAL B 1 197 ? 58.707  18.617  -1.113  1.00 2.43  ? 228 VAL B CB   1 
ATOM   7376  C  CG1  . VAL B 1 197 ? 59.318  17.785  -2.214  1.00 2.79  ? 228 VAL B CG1  1 
ATOM   7377  C  CG2  . VAL B 1 197 ? 59.688  18.760  0.020   1.00 2.01  ? 228 VAL B CG2  1 
ATOM   7378  H  H    . VAL B 1 197 ? 57.936  20.514  0.405   1.00 17.00 ? 228 VAL B H    1 
ATOM   7379  N  N    . ASP B 1 198 ? 56.815  21.002  -3.296  1.00 3.36  ? 229 ASP B N    1 
ATOM   7380  C  CA   . ASP B 1 198 ? 55.703  21.052  -4.232  1.00 4.97  ? 229 ASP B CA   1 
ATOM   7381  C  C    . ASP B 1 198 ? 56.149  20.775  -5.661  1.00 4.72  ? 229 ASP B C    1 
ATOM   7382  O  O    . ASP B 1 198 ? 55.398  20.988  -6.589  1.00 9.08  ? 229 ASP B O    1 
ATOM   7383  C  CB   . ASP B 1 198 ? 54.961  22.429  -4.153  1.00 6.77  ? 229 ASP B CB   1 
ATOM   7384  C  CG   . ASP B 1 198 ? 55.855  23.652  -4.541  1.00 10.19 ? 229 ASP B CG   1 
ATOM   7385  O  OD1  . ASP B 1 198 ? 56.975  23.468  -5.060  1.00 8.73  ? 229 ASP B OD1  1 
ATOM   7386  O  OD2  . ASP B 1 198 ? 55.437  24.817  -4.313  1.00 11.40 ? 229 ASP B OD2  1 
ATOM   7387  H  H    . ASP B 1 198 ? 57.353  21.805  -3.161  1.00 17.00 ? 229 ASP B H    1 
ATOM   7388  N  N    . LEU B 1 199 ? 57.393  20.374  -5.846  1.00 4.08  ? 230 LEU B N    1 
ATOM   7389  C  CA   . LEU B 1 199 ? 57.941  20.128  -7.175  1.00 2.00  ? 230 LEU B CA   1 
ATOM   7390  C  C    . LEU B 1 199 ? 57.658  21.225  -8.185  1.00 2.00  ? 230 LEU B C    1 
ATOM   7391  O  O    . LEU B 1 199 ? 57.700  21.002  -9.392  1.00 2.00  ? 230 LEU B O    1 
ATOM   7392  C  CB   . LEU B 1 199 ? 57.533  18.763  -7.690  1.00 2.00  ? 230 LEU B CB   1 
ATOM   7393  C  CG   . LEU B 1 199 ? 58.220  17.587  -6.964  1.00 4.83  ? 230 LEU B CG   1 
ATOM   7394  C  CD1  . LEU B 1 199 ? 59.331  17.005  -7.820  1.00 7.44  ? 230 LEU B CD1  1 
ATOM   7395  C  CD2  . LEU B 1 199 ? 58.741  17.953  -5.560  1.00 2.02  ? 230 LEU B CD2  1 
ATOM   7396  H  H    . LEU B 1 199 ? 57.962  20.239  -5.066  1.00 17.00 ? 230 LEU B H    1 
ATOM   7397  N  N    . ASN B 1 200 ? 57.500  22.441  -7.671  1.00 2.00  ? 231 ASN B N    1 
ATOM   7398  C  CA   . ASN B 1 200 ? 57.236  23.622  -8.487  1.00 2.00  ? 231 ASN B CA   1 
ATOM   7399  C  C    . ASN B 1 200 ? 58.346  23.869  -9.466  1.00 2.00  ? 231 ASN B C    1 
ATOM   7400  O  O    . ASN B 1 200 ? 58.107  24.413  -10.532 1.00 2.00  ? 231 ASN B O    1 
ATOM   7401  C  CB   . ASN B 1 200 ? 57.001  24.881  -7.619  1.00 2.01  ? 231 ASN B CB   1 
ATOM   7402  C  CG   . ASN B 1 200 ? 58.199  25.817  -7.551  1.00 4.44  ? 231 ASN B CG   1 
ATOM   7403  O  OD1  . ASN B 1 200 ? 58.602  26.405  -8.554  1.00 5.23  ? 231 ASN B OD1  1 
ATOM   7404  N  ND2  . ASN B 1 200 ? 58.733  26.009  -6.347  1.00 6.30  ? 231 ASN B ND2  1 
ATOM   7405  H  H    . ASN B 1 200 ? 57.557  22.522  -6.709  1.00 17.00 ? 231 ASN B H    1 
ATOM   7406  H  HD21 . ASN B 1 200 ? 59.493  26.634  -6.291  1.00 17.00 ? 231 ASN B HD21 1 
ATOM   7407  H  HD22 . ASN B 1 200 ? 58.353  25.555  -5.572  1.00 17.00 ? 231 ASN B HD22 1 
ATOM   7408  N  N    . HIS B 1 201 ? 59.566  23.502  -9.065  1.00 3.26  ? 232 HIS B N    1 
ATOM   7409  C  CA   . HIS B 1 201 ? 60.760  23.659  -9.874  1.00 2.00  ? 232 HIS B CA   1 
ATOM   7410  C  C    . HIS B 1 201 ? 60.671  22.947  -11.211 1.00 2.00  ? 232 HIS B C    1 
ATOM   7411  O  O    . HIS B 1 201 ? 61.192  23.437  -12.205 1.00 2.00  ? 232 HIS B O    1 
ATOM   7412  C  CB   . HIS B 1 201 ? 62.010  23.258  -9.086  1.00 2.01  ? 232 HIS B CB   1 
ATOM   7413  C  CG   . HIS B 1 201 ? 62.020  21.844  -8.596  1.00 3.83  ? 232 HIS B CG   1 
ATOM   7414  N  ND1  . HIS B 1 201 ? 61.693  20.761  -9.388  1.00 4.62  ? 232 HIS B ND1  1 
ATOM   7415  C  CD2  . HIS B 1 201 ? 62.387  21.327  -7.400  1.00 4.67  ? 232 HIS B CD2  1 
ATOM   7416  C  CE1  . HIS B 1 201 ? 61.861  19.641  -8.704  1.00 2.45  ? 232 HIS B CE1  1 
ATOM   7417  N  NE2  . HIS B 1 201 ? 62.282  19.957  -7.494  1.00 3.68  ? 232 HIS B NE2  1 
ATOM   7418  H  H    . HIS B 1 201 ? 59.634  23.140  -8.164  1.00 17.00 ? 232 HIS B H    1 
ATOM   7419  H  HD1  . HIS B 1 201 ? 61.422  20.791  -10.328 1.00 17.00 ? 232 HIS B HD1  1 
ATOM   7420  H  HE2  . HIS B 1 201 ? 62.417  19.341  -6.738  1.00 17.00 ? 232 HIS B HE2  1 
ATOM   7421  N  N    . ILE B 1 202 ? 59.951  21.829  -11.246 1.00 2.00  ? 233 ILE B N    1 
ATOM   7422  C  CA   . ILE B 1 202 ? 59.768  21.093  -12.489 1.00 3.62  ? 233 ILE B CA   1 
ATOM   7423  C  C    . ILE B 1 202 ? 58.557  21.668  -13.204 1.00 3.70  ? 233 ILE B C    1 
ATOM   7424  O  O    . ILE B 1 202 ? 58.605  21.935  -14.409 1.00 3.85  ? 233 ILE B O    1 
ATOM   7425  C  CB   . ILE B 1 202 ? 59.425  19.574  -12.255 1.00 5.52  ? 233 ILE B CB   1 
ATOM   7426  C  CG1  . ILE B 1 202 ? 60.619  18.806  -11.682 1.00 4.92  ? 233 ILE B CG1  1 
ATOM   7427  C  CG2  . ILE B 1 202 ? 58.921  18.916  -13.571 1.00 3.53  ? 233 ILE B CG2  1 
ATOM   7428  C  CD1  . ILE B 1 202 ? 60.239  17.431  -11.159 1.00 2.73  ? 233 ILE B CD1  1 
ATOM   7429  H  H    . ILE B 1 202 ? 59.441  21.522  -10.469 1.00 17.00 ? 233 ILE B H    1 
ATOM   7430  N  N    . TYR B 1 203 ? 57.494  21.895  -12.431 1.00 2.00  ? 234 TYR B N    1 
ATOM   7431  C  CA   . TYR B 1 203 ? 56.230  22.338  -12.994 1.00 3.47  ? 234 TYR B CA   1 
ATOM   7432  C  C    . TYR B 1 203 ? 55.825  23.794  -13.148 1.00 4.44  ? 234 TYR B C    1 
ATOM   7433  O  O    . TYR B 1 203 ? 54.658  24.070  -13.406 1.00 3.69  ? 234 TYR B O    1 
ATOM   7434  C  CB   . TYR B 1 203 ? 55.111  21.600  -12.294 1.00 2.27  ? 234 TYR B CB   1 
ATOM   7435  C  CG   . TYR B 1 203 ? 55.203  20.117  -12.407 1.00 2.00  ? 234 TYR B CG   1 
ATOM   7436  C  CD1  . TYR B 1 203 ? 54.923  19.469  -13.609 1.00 2.00  ? 234 TYR B CD1  1 
ATOM   7437  C  CD2  . TYR B 1 203 ? 55.509  19.368  -11.301 1.00 2.00  ? 234 TYR B CD2  1 
ATOM   7438  C  CE1  . TYR B 1 203 ? 54.938  18.090  -13.695 1.00 3.28  ? 234 TYR B CE1  1 
ATOM   7439  C  CE2  . TYR B 1 203 ? 55.530  18.011  -11.360 1.00 4.89  ? 234 TYR B CE2  1 
ATOM   7440  C  CZ   . TYR B 1 203 ? 55.240  17.348  -12.556 1.00 3.88  ? 234 TYR B CZ   1 
ATOM   7441  O  OH   . TYR B 1 203 ? 55.219  15.960  -12.554 1.00 2.00  ? 234 TYR B OH   1 
ATOM   7442  H  H    . TYR B 1 203 ? 57.536  21.781  -11.458 1.00 17.00 ? 234 TYR B H    1 
ATOM   7443  H  HH   . TYR B 1 203 ? 55.259  15.704  -11.620 1.00 17.00 ? 234 TYR B HH   1 
ATOM   7444  N  N    . GLY B 1 204 ? 56.765  24.720  -13.058 1.00 5.81  ? 235 GLY B N    1 
ATOM   7445  C  CA   . GLY B 1 204 ? 56.398  26.120  -13.180 1.00 7.65  ? 235 GLY B CA   1 
ATOM   7446  C  C    . GLY B 1 204 ? 55.882  26.622  -11.849 1.00 9.82  ? 235 GLY B C    1 
ATOM   7447  O  O    . GLY B 1 204 ? 55.149  25.924  -11.157 1.00 10.47 ? 235 GLY B O    1 
ATOM   7448  H  H    . GLY B 1 204 ? 57.689  24.461  -12.861 1.00 17.00 ? 235 GLY B H    1 
ATOM   7449  N  N    . GLU B 1 205 ? 56.210  27.860  -11.508 1.00 12.79 ? 236 GLU B N    1 
ATOM   7450  C  CA   . GLU B 1 205 ? 55.798  28.425  -10.218 1.00 15.21 ? 236 GLU B CA   1 
ATOM   7451  C  C    . GLU B 1 205 ? 54.293  28.696  -10.044 1.00 15.33 ? 236 GLU B C    1 
ATOM   7452  O  O    . GLU B 1 205 ? 53.842  29.064  -8.939  1.00 14.86 ? 236 GLU B O    1 
ATOM   7453  C  CB   . GLU B 1 205 ? 56.546  29.734  -9.932  1.00 19.18 ? 236 GLU B CB   1 
ATOM   7454  C  CG   . GLU B 1 205 ? 57.999  29.815  -10.414 1.00 24.49 ? 236 GLU B CG   1 
ATOM   7455  C  CD   . GLU B 1 205 ? 58.125  30.226  -11.870 1.00 25.03 ? 236 GLU B CD   1 
ATOM   7456  O  OE1  . GLU B 1 205 ? 57.394  31.130  -12.330 1.00 21.27 ? 236 GLU B OE1  1 
ATOM   7457  O  OE2  . GLU B 1 205 ? 58.978  29.624  -12.550 1.00 28.75 ? 236 GLU B OE2  1 
ATOM   7458  H  H    . GLU B 1 205 ? 56.777  28.348  -12.131 1.00 17.00 ? 236 GLU B H    1 
ATOM   7459  N  N    . THR B 1 206 ? 53.521  28.511  -11.120 1.00 13.15 ? 237 THR B N    1 
ATOM   7460  C  CA   . THR B 1 206 ? 52.100  28.809  -11.095 1.00 7.53  ? 237 THR B CA   1 
ATOM   7461  C  C    . THR B 1 206 ? 51.291  27.746  -11.802 1.00 9.15  ? 237 THR B C    1 
ATOM   7462  O  O    . THR B 1 206 ? 51.604  26.545  -11.758 1.00 8.39  ? 237 THR B O    1 
ATOM   7463  C  CB   . THR B 1 206 ? 51.836  30.099  -11.831 1.00 5.83  ? 237 THR B CB   1 
ATOM   7464  O  OG1  . THR B 1 206 ? 52.291  29.946  -13.181 1.00 4.99  ? 237 THR B OG1  1 
ATOM   7465  C  CG2  . THR B 1 206 ? 52.545  31.292  -11.160 1.00 5.99  ? 237 THR B CG2  1 
ATOM   7466  H  H    . THR B 1 206 ? 53.900  28.078  -11.904 1.00 17.00 ? 237 THR B H    1 
ATOM   7467  H  HG1  . THR B 1 206 ? 53.226  30.185  -13.159 1.00 17.00 ? 237 THR B HG1  1 
ATOM   7468  N  N    . LEU B 1 207 ? 50.195  28.209  -12.396 1.00 6.98  ? 238 LEU B N    1 
ATOM   7469  C  CA   . LEU B 1 207 ? 49.270  27.364  -13.137 1.00 5.22  ? 238 LEU B CA   1 
ATOM   7470  C  C    . LEU B 1 207 ? 49.486  27.800  -14.566 1.00 3.39  ? 238 LEU B C    1 
ATOM   7471  O  O    . LEU B 1 207 ? 49.754  27.016  -15.472 1.00 4.63  ? 238 LEU B O    1 
ATOM   7472  C  CB   . LEU B 1 207 ? 47.825  27.667  -12.680 1.00 2.49  ? 238 LEU B CB   1 
ATOM   7473  C  CG   . LEU B 1 207 ? 46.562  26.912  -13.137 1.00 2.63  ? 238 LEU B CG   1 
ATOM   7474  C  CD1  . LEU B 1 207 ? 45.773  27.772  -14.054 1.00 2.60  ? 238 LEU B CD1  1 
ATOM   7475  C  CD2  . LEU B 1 207 ? 46.835  25.556  -13.778 1.00 2.00  ? 238 LEU B CD2  1 
ATOM   7476  H  H    . LEU B 1 207 ? 49.886  29.127  -12.317 1.00 17.00 ? 238 LEU B H    1 
ATOM   7477  N  N    . ASP B 1 208 ? 49.500  29.099  -14.715 1.00 4.36  ? 239 ASP B N    1 
ATOM   7478  C  CA   . ASP B 1 208 ? 49.667  29.713  -15.990 1.00 5.87  ? 239 ASP B CA   1 
ATOM   7479  C  C    . ASP B 1 208 ? 50.930  29.231  -16.677 1.00 5.85  ? 239 ASP B C    1 
ATOM   7480  O  O    . ASP B 1 208 ? 50.900  28.874  -17.861 1.00 4.67  ? 239 ASP B O    1 
ATOM   7481  C  CB   . ASP B 1 208 ? 49.683  31.210  -15.794 1.00 5.97  ? 239 ASP B CB   1 
ATOM   7482  C  CG   . ASP B 1 208 ? 49.372  31.903  -17.038 1.00 13.18 ? 239 ASP B CG   1 
ATOM   7483  O  OD1  . ASP B 1 208 ? 50.018  31.512  -18.048 1.00 16.52 ? 239 ASP B OD1  1 
ATOM   7484  O  OD2  . ASP B 1 208 ? 48.454  32.772  -17.036 1.00 18.00 ? 239 ASP B OD2  1 
ATOM   7485  H  H    . ASP B 1 208 ? 49.396  29.672  -13.934 1.00 17.00 ? 239 ASP B H    1 
ATOM   7486  N  N    . ARG B 1 209 ? 52.020  29.189  -15.902 1.00 6.76  ? 240 ARG B N    1 
ATOM   7487  C  CA   . ARG B 1 209 ? 53.355  28.756  -16.355 1.00 7.43  ? 240 ARG B CA   1 
ATOM   7488  C  C    . ARG B 1 209 ? 53.422  27.251  -16.546 1.00 6.19  ? 240 ARG B C    1 
ATOM   7489  O  O    . ARG B 1 209 ? 54.133  26.734  -17.419 1.00 2.82  ? 240 ARG B O    1 
ATOM   7490  C  CB   . ARG B 1 209 ? 54.429  29.160  -15.333 1.00 8.19  ? 240 ARG B CB   1 
ATOM   7491  C  CG   . ARG B 1 209 ? 55.790  28.529  -15.589 1.00 8.23  ? 240 ARG B CG   1 
ATOM   7492  C  CD   . ARG B 1 209 ? 56.891  29.289  -14.889 1.00 8.14  ? 240 ARG B CD   1 
ATOM   7493  N  NE   . ARG B 1 209 ? 58.195  28.719  -15.232 1.00 8.35  ? 240 ARG B NE   1 
ATOM   7494  C  CZ   . ARG B 1 209 ? 59.288  29.434  -15.471 1.00 6.87  ? 240 ARG B CZ   1 
ATOM   7495  N  NH1  . ARG B 1 209 ? 59.229  30.760  -15.407 1.00 5.52  ? 240 ARG B NH1  1 
ATOM   7496  N  NH2  . ARG B 1 209 ? 60.436  28.822  -15.770 1.00 6.16  ? 240 ARG B NH2  1 
ATOM   7497  H  H    . ARG B 1 209 ? 51.908  29.468  -14.975 1.00 17.00 ? 240 ARG B H    1 
ATOM   7498  H  HE   . ARG B 1 209 ? 58.274  27.744  -15.281 1.00 17.00 ? 240 ARG B HE   1 
ATOM   7499  H  HH11 . ARG B 1 209 ? 58.371  31.219  -15.177 1.00 17.00 ? 240 ARG B HH11 1 
ATOM   7500  H  HH12 . ARG B 1 209 ? 60.055  31.298  -15.577 1.00 17.00 ? 240 ARG B HH12 1 
ATOM   7501  H  HH21 . ARG B 1 209 ? 60.478  27.825  -15.817 1.00 17.00 ? 240 ARG B HH21 1 
ATOM   7502  H  HH22 . ARG B 1 209 ? 61.258  29.367  -15.946 1.00 17.00 ? 240 ARG B HH22 1 
ATOM   7503  N  N    . GLN B 1 210 ? 52.723  26.562  -15.658 1.00 5.28  ? 241 GLN B N    1 
ATOM   7504  C  CA   . GLN B 1 210 ? 52.634  25.121  -15.684 1.00 2.68  ? 241 GLN B CA   1 
ATOM   7505  C  C    . GLN B 1 210 ? 51.971  24.730  -16.995 1.00 2.00  ? 241 GLN B C    1 
ATOM   7506  O  O    . GLN B 1 210 ? 52.322  23.736  -17.631 1.00 2.01  ? 241 GLN B O    1 
ATOM   7507  C  CB   . GLN B 1 210 ? 51.799  24.692  -14.493 1.00 2.01  ? 241 GLN B CB   1 
ATOM   7508  C  CG   . GLN B 1 210 ? 51.531  23.238  -14.432 1.00 3.16  ? 241 GLN B CG   1 
ATOM   7509  C  CD   . GLN B 1 210 ? 50.088  22.951  -14.538 1.00 2.00  ? 241 GLN B CD   1 
ATOM   7510  O  OE1  . GLN B 1 210 ? 49.345  23.703  -15.150 1.00 6.24  ? 241 GLN B OE1  1 
ATOM   7511  N  NE2  . GLN B 1 210 ? 49.656  21.888  -13.909 1.00 2.64  ? 241 GLN B NE2  1 
ATOM   7512  H  H    . GLN B 1 210 ? 52.243  27.024  -14.946 1.00 17.00 ? 241 GLN B H    1 
ATOM   7513  H  HE21 . GLN B 1 210 ? 48.716  21.639  -13.976 1.00 17.00 ? 241 GLN B HE21 1 
ATOM   7514  H  HE22 . GLN B 1 210 ? 50.330  21.401  -13.394 1.00 17.00 ? 241 GLN B HE22 1 
ATOM   7515  N  N    . HIS B 1 211 ? 51.030  25.547  -17.431 1.00 2.00  ? 242 HIS B N    1 
ATOM   7516  C  CA   . HIS B 1 211 ? 50.346  25.258  -18.668 1.00 5.33  ? 242 HIS B CA   1 
ATOM   7517  C  C    . HIS B 1 211 ? 51.281  25.412  -19.859 1.00 7.15  ? 242 HIS B C    1 
ATOM   7518  O  O    . HIS B 1 211 ? 51.309  24.559  -20.741 1.00 7.94  ? 242 HIS B O    1 
ATOM   7519  C  CB   . HIS B 1 211 ? 49.106  26.136  -18.827 1.00 8.59  ? 242 HIS B CB   1 
ATOM   7520  C  CG   . HIS B 1 211 ? 47.929  25.702  -18.001 1.00 6.42  ? 242 HIS B CG   1 
ATOM   7521  N  ND1  . HIS B 1 211 ? 47.840  24.457  -17.422 1.00 4.78  ? 242 HIS B ND1  1 
ATOM   7522  C  CD2  . HIS B 1 211 ? 46.807  26.364  -17.638 1.00 5.14  ? 242 HIS B CD2  1 
ATOM   7523  C  CE1  . HIS B 1 211 ? 46.721  24.368  -16.733 1.00 4.49  ? 242 HIS B CE1  1 
ATOM   7524  N  NE2  . HIS B 1 211 ? 46.078  25.513  -16.845 1.00 5.88  ? 242 HIS B NE2  1 
ATOM   7525  H  H    . HIS B 1 211 ? 50.810  26.340  -16.901 1.00 17.00 ? 242 HIS B H    1 
ATOM   7526  H  HD1  . HIS B 1 211 ? 48.527  23.752  -17.420 1.00 17.00 ? 242 HIS B HD1  1 
ATOM   7527  H  HE2  . HIS B 1 211 ? 45.215  25.721  -16.422 1.00 17.00 ? 242 HIS B HE2  1 
ATOM   7528  N  N    . LYS B 1 212 ? 52.083  26.472  -19.855 1.00 8.73  ? 243 LYS B N    1 
ATOM   7529  C  CA   . LYS B 1 212 ? 53.042  26.744  -20.946 1.00 8.40  ? 243 LYS B CA   1 
ATOM   7530  C  C    . LYS B 1 212 ? 54.213  25.737  -21.072 1.00 8.60  ? 243 LYS B C    1 
ATOM   7531  O  O    . LYS B 1 212 ? 55.147  25.936  -21.856 1.00 9.38  ? 243 LYS B O    1 
ATOM   7532  C  CB   . LYS B 1 212 ? 53.604  28.162  -20.805 1.00 6.46  ? 243 LYS B CB   1 
ATOM   7533  C  CG   . LYS B 1 212 ? 52.562  29.236  -20.930 1.00 9.36  ? 243 LYS B CG   1 
ATOM   7534  C  CD   . LYS B 1 212 ? 53.159  30.615  -20.993 1.00 9.30  ? 243 LYS B CD   1 
ATOM   7535  C  CE   . LYS B 1 212 ? 53.734  30.992  -19.652 1.00 12.50 ? 243 LYS B CE   1 
ATOM   7536  N  NZ   . LYS B 1 212 ? 54.484  32.282  -19.750 1.00 19.51 ? 243 LYS B NZ   1 
ATOM   7537  H  H    . LYS B 1 212 ? 52.046  27.105  -19.109 1.00 17.00 ? 243 LYS B H    1 
ATOM   7538  H  HZ1  . LYS B 1 212 ? 55.230  32.180  -20.469 1.00 17.00 ? 243 LYS B HZ1  1 
ATOM   7539  H  HZ2  . LYS B 1 212 ? 53.828  33.038  -20.035 1.00 17.00 ? 243 LYS B HZ2  1 
ATOM   7540  H  HZ3  . LYS B 1 212 ? 54.908  32.511  -18.830 1.00 17.00 ? 243 LYS B HZ3  1 
ATOM   7541  N  N    . LEU B 1 213 ? 54.192  24.689  -20.266 1.00 6.09  ? 244 LEU B N    1 
ATOM   7542  C  CA   . LEU B 1 213 ? 55.234  23.705  -20.324 1.00 3.64  ? 244 LEU B CA   1 
ATOM   7543  C  C    . LEU B 1 213 ? 54.605  22.394  -20.655 1.00 4.96  ? 244 LEU B C    1 
ATOM   7544  O  O    . LEU B 1 213 ? 55.315  21.493  -21.103 1.00 6.23  ? 244 LEU B O    1 
ATOM   7545  C  CB   . LEU B 1 213 ? 55.909  23.563  -18.979 1.00 5.78  ? 244 LEU B CB   1 
ATOM   7546  C  CG   . LEU B 1 213 ? 56.677  24.760  -18.471 1.00 7.79  ? 244 LEU B CG   1 
ATOM   7547  C  CD1  . LEU B 1 213 ? 56.994  24.559  -16.981 1.00 6.46  ? 244 LEU B CD1  1 
ATOM   7548  C  CD2  . LEU B 1 213 ? 57.902  24.911  -19.321 1.00 5.06  ? 244 LEU B CD2  1 
ATOM   7549  H  H    . LEU B 1 213 ? 53.482  24.600  -19.606 1.00 17.00 ? 244 LEU B H    1 
ATOM   7550  N  N    . ARG B 1 214 ? 53.292  22.256  -20.394 1.00 5.65  ? 245 ARG B N    1 
ATOM   7551  C  CA   . ARG B 1 214 ? 52.585  20.995  -20.655 1.00 3.74  ? 245 ARG B CA   1 
ATOM   7552  C  C    . ARG B 1 214 ? 52.209  20.738  -22.100 1.00 4.41  ? 245 ARG B C    1 
ATOM   7553  O  O    . ARG B 1 214 ? 51.840  21.653  -22.835 1.00 7.24  ? 245 ARG B O    1 
ATOM   7554  C  CB   . ARG B 1 214 ? 51.351  20.814  -19.783 1.00 2.00  ? 245 ARG B CB   1 
ATOM   7555  C  CG   . ARG B 1 214 ? 50.928  19.322  -19.779 1.00 5.02  ? 245 ARG B CG   1 
ATOM   7556  C  CD   . ARG B 1 214 ? 49.671  19.032  -19.018 1.00 5.17  ? 245 ARG B CD   1 
ATOM   7557  N  NE   . ARG B 1 214 ? 49.468  20.023  -17.974 1.00 13.78 ? 245 ARG B NE   1 
ATOM   7558  C  CZ   . ARG B 1 214 ? 48.304  20.231  -17.375 1.00 18.48 ? 245 ARG B CZ   1 
ATOM   7559  N  NH1  . ARG B 1 214 ? 47.246  19.498  -17.719 1.00 20.14 ? 245 ARG B NH1  1 
ATOM   7560  N  NH2  . ARG B 1 214 ? 48.187  21.196  -16.465 1.00 20.39 ? 245 ARG B NH2  1 
ATOM   7561  H  H    . ARG B 1 214 ? 52.768  23.011  -20.064 1.00 17.00 ? 245 ARG B H    1 
ATOM   7562  H  HE   . ARG B 1 214 ? 50.216  20.572  -17.659 1.00 17.00 ? 245 ARG B HE   1 
ATOM   7563  H  HH11 . ARG B 1 214 ? 47.319  18.792  -18.426 1.00 17.00 ? 245 ARG B HH11 1 
ATOM   7564  H  HH12 . ARG B 1 214 ? 46.373  19.657  -17.263 1.00 17.00 ? 245 ARG B HH12 1 
ATOM   7565  H  HH21 . ARG B 1 214 ? 48.981  21.760  -16.242 1.00 17.00 ? 245 ARG B HH21 1 
ATOM   7566  H  HH22 . ARG B 1 214 ? 47.312  21.355  -16.009 1.00 17.00 ? 245 ARG B HH22 1 
ATOM   7567  N  N    . LEU B 1 215 ? 52.291  19.474  -22.498 1.00 4.55  ? 246 LEU B N    1 
ATOM   7568  C  CA   . LEU B 1 215 ? 51.975  19.074  -23.856 1.00 3.29  ? 246 LEU B CA   1 
ATOM   7569  C  C    . LEU B 1 215 ? 50.472  19.027  -24.020 1.00 5.12  ? 246 LEU B C    1 
ATOM   7570  O  O    . LEU B 1 215 ? 49.940  19.317  -25.097 1.00 6.14  ? 246 LEU B O    1 
ATOM   7571  C  CB   . LEU B 1 215 ? 52.571  17.685  -24.121 1.00 3.39  ? 246 LEU B CB   1 
ATOM   7572  C  CG   . LEU B 1 215 ? 52.546  17.069  -25.532 1.00 4.03  ? 246 LEU B CG   1 
ATOM   7573  C  CD1  . LEU B 1 215 ? 53.057  18.025  -26.607 1.00 5.10  ? 246 LEU B CD1  1 
ATOM   7574  C  CD2  . LEU B 1 215 ? 53.359  15.819  -25.523 1.00 2.00  ? 246 LEU B CD2  1 
ATOM   7575  H  H    . LEU B 1 215 ? 52.578  18.793  -21.852 1.00 17.00 ? 246 LEU B H    1 
ATOM   7576  N  N    . PHE B 1 216 ? 49.795  18.703  -22.917 1.00 5.14  ? 247 PHE B N    1 
ATOM   7577  C  CA   . PHE B 1 216 ? 48.346  18.555  -22.886 1.00 2.92  ? 247 PHE B CA   1 
ATOM   7578  C  C    . PHE B 1 216 ? 48.040  17.355  -23.754 1.00 3.13  ? 247 PHE B C    1 
ATOM   7579  O  O    . PHE B 1 216 ? 47.181  17.419  -24.632 1.00 5.12  ? 247 PHE B O    1 
ATOM   7580  C  CB   . PHE B 1 216 ? 47.646  19.814  -23.398 1.00 2.00  ? 247 PHE B CB   1 
ATOM   7581  C  CG   . PHE B 1 216 ? 47.724  20.954  -22.459 1.00 2.00  ? 247 PHE B CG   1 
ATOM   7582  C  CD1  . PHE B 1 216 ? 47.316  20.816  -21.139 1.00 2.00  ? 247 PHE B CD1  1 
ATOM   7583  C  CD2  . PHE B 1 216 ? 48.196  22.156  -22.874 1.00 2.00  ? 247 PHE B CD2  1 
ATOM   7584  C  CE1  . PHE B 1 216 ? 47.379  21.870  -20.237 1.00 2.00  ? 247 PHE B CE1  1 
ATOM   7585  C  CE2  . PHE B 1 216 ? 48.261  23.220  -21.982 1.00 3.91  ? 247 PHE B CE2  1 
ATOM   7586  C  CZ   . PHE B 1 216 ? 47.850  23.070  -20.655 1.00 2.00  ? 247 PHE B CZ   1 
ATOM   7587  H  H    . PHE B 1 216 ? 50.315  18.562  -22.106 1.00 17.00 ? 247 PHE B H    1 
ATOM   7588  N  N    . LYS B 1 217 ? 48.761  16.263  -23.476 1.00 2.00  ? 248 LYS B N    1 
ATOM   7589  C  CA   . LYS B 1 217 ? 48.657  15.001  -24.189 1.00 2.00  ? 248 LYS B CA   1 
ATOM   7590  C  C    . LYS B 1 217 ? 49.226  13.878  -23.360 1.00 2.00  ? 248 LYS B C    1 
ATOM   7591  O  O    . LYS B 1 217 ? 50.386  13.894  -23.015 1.00 2.00  ? 248 LYS B O    1 
ATOM   7592  C  CB   . LYS B 1 217 ? 49.469  15.077  -25.453 1.00 2.83  ? 248 LYS B CB   1 
ATOM   7593  C  CG   . LYS B 1 217 ? 48.645  15.298  -26.664 1.00 9.43  ? 248 LYS B CG   1 
ATOM   7594  C  CD   . LYS B 1 217 ? 47.775  14.054  -26.966 1.00 9.28  ? 248 LYS B CD   1 
ATOM   7595  C  CE   . LYS B 1 217 ? 48.503  13.056  -27.850 1.00 7.27  ? 248 LYS B CE   1 
ATOM   7596  N  NZ   . LYS B 1 217 ? 48.948  13.739  -29.109 1.00 9.66  ? 248 LYS B NZ   1 
ATOM   7597  H  H    . LYS B 1 217 ? 49.433  16.317  -22.768 1.00 17.00 ? 248 LYS B H    1 
ATOM   7598  H  HZ1  . LYS B 1 217 ? 48.122  14.111  -29.618 1.00 17.00 ? 248 LYS B HZ1  1 
ATOM   7599  H  HZ2  . LYS B 1 217 ? 49.594  14.518  -28.871 1.00 17.00 ? 248 LYS B HZ2  1 
ATOM   7600  H  HZ3  . LYS B 1 217 ? 49.448  13.053  -29.709 1.00 17.00 ? 248 LYS B HZ3  1 
ATOM   7601  N  N    . ASP B 1 218 ? 48.428  12.874  -23.057 1.00 2.37  ? 249 ASP B N    1 
ATOM   7602  C  CA   . ASP B 1 218 ? 48.925  11.754  -22.262 1.00 3.45  ? 249 ASP B CA   1 
ATOM   7603  C  C    . ASP B 1 218 ? 49.513  12.245  -20.942 1.00 4.28  ? 249 ASP B C    1 
ATOM   7604  O  O    . ASP B 1 218 ? 50.460  11.657  -20.436 1.00 2.00  ? 249 ASP B O    1 
ATOM   7605  C  CB   . ASP B 1 218 ? 50.042  11.013  -22.987 1.00 4.02  ? 249 ASP B CB   1 
ATOM   7606  C  CG   . ASP B 1 218 ? 49.657  10.536  -24.358 1.00 4.05  ? 249 ASP B CG   1 
ATOM   7607  O  OD1  . ASP B 1 218 ? 48.794  11.153  -25.017 1.00 3.55  ? 249 ASP B OD1  1 
ATOM   7608  O  OD2  . ASP B 1 218 ? 50.272  9.537   -24.790 1.00 5.23  ? 249 ASP B OD2  1 
ATOM   7609  H  H    . ASP B 1 218 ? 47.508  12.866  -23.386 1.00 17.00 ? 249 ASP B H    1 
ATOM   7610  N  N    . GLY B 1 219 ? 49.025  13.377  -20.445 1.00 5.57  ? 250 GLY B N    1 
ATOM   7611  C  CA   . GLY B 1 219 ? 49.519  13.906  -19.184 1.00 7.69  ? 250 GLY B CA   1 
ATOM   7612  C  C    . GLY B 1 219 ? 50.969  14.367  -19.231 1.00 8.80  ? 250 GLY B C    1 
ATOM   7613  O  O    . GLY B 1 219 ? 51.508  14.840  -18.220 1.00 9.01  ? 250 GLY B O    1 
ATOM   7614  H  H    . GLY B 1 219 ? 48.334  13.860  -20.923 1.00 17.00 ? 250 GLY B H    1 
ATOM   7615  N  N    . LYS B 1 220 ? 51.575  14.264  -20.414 1.00 8.52  ? 251 LYS B N    1 
ATOM   7616  C  CA   . LYS B 1 220 ? 52.977  14.652  -20.655 1.00 8.92  ? 251 LYS B CA   1 
ATOM   7617  C  C    . LYS B 1 220 ? 53.386  16.128  -20.511 1.00 8.14  ? 251 LYS B C    1 
ATOM   7618  O  O    . LYS B 1 220 ? 52.611  17.058  -20.801 1.00 6.18  ? 251 LYS B O    1 
ATOM   7619  C  CB   . LYS B 1 220 ? 53.427  14.216  -22.065 1.00 7.61  ? 251 LYS B CB   1 
ATOM   7620  C  CG   . LYS B 1 220 ? 53.489  12.715  -22.314 1.00 9.29  ? 251 LYS B CG   1 
ATOM   7621  C  CD   . LYS B 1 220 ? 53.964  12.444  -23.751 1.00 8.88  ? 251 LYS B CD   1 
ATOM   7622  C  CE   . LYS B 1 220 ? 54.200  10.960  -23.983 1.00 9.58  ? 251 LYS B CE   1 
ATOM   7623  N  NZ   . LYS B 1 220 ? 55.094  10.397  -22.900 1.00 11.53 ? 251 LYS B NZ   1 
ATOM   7624  H  H    . LYS B 1 220 ? 51.093  13.908  -21.178 1.00 17.00 ? 251 LYS B H    1 
ATOM   7625  H  HZ1  . LYS B 1 220 ? 54.662  10.568  -21.970 1.00 17.00 ? 251 LYS B HZ1  1 
ATOM   7626  H  HZ2  . LYS B 1 220 ? 55.208  9.371   -23.035 1.00 17.00 ? 251 LYS B HZ2  1 
ATOM   7627  H  HZ3  . LYS B 1 220 ? 56.024  10.859  -22.932 1.00 17.00 ? 251 LYS B HZ3  1 
ATOM   7628  N  N    . LEU B 1 221 ? 54.661  16.287  -20.151 1.00 6.45  ? 252 LEU B N    1 
ATOM   7629  C  CA   . LEU B 1 221 ? 55.353  17.562  -20.013 1.00 3.84  ? 252 LEU B CA   1 
ATOM   7630  C  C    . LEU B 1 221 ? 55.984  17.744  -21.388 1.00 4.01  ? 252 LEU B C    1 
ATOM   7631  O  O    . LEU B 1 221 ? 56.380  16.773  -22.028 1.00 4.02  ? 252 LEU B O    1 
ATOM   7632  C  CB   . LEU B 1 221 ? 56.470  17.405  -19.005 1.00 3.87  ? 252 LEU B CB   1 
ATOM   7633  C  CG   . LEU B 1 221 ? 56.764  18.516  -18.023 1.00 3.62  ? 252 LEU B CG   1 
ATOM   7634  C  CD1  . LEU B 1 221 ? 55.554  19.388  -17.823 1.00 2.07  ? 252 LEU B CD1  1 
ATOM   7635  C  CD2  . LEU B 1 221 ? 57.195  17.831  -16.712 1.00 5.11  ? 252 LEU B CD2  1 
ATOM   7636  H  H    . LEU B 1 221 ? 55.186  15.484  -19.981 1.00 17.00 ? 252 LEU B H    1 
ATOM   7637  N  N    . LYS B 1 222 ? 56.054  18.964  -21.877 1.00 4.43  ? 253 LYS B N    1 
ATOM   7638  C  CA   . LYS B 1 222 ? 56.631  19.169  -23.186 1.00 5.30  ? 253 LYS B CA   1 
ATOM   7639  C  C    . LYS B 1 222 ? 58.122  18.875  -23.139 1.00 9.08  ? 253 LYS B C    1 
ATOM   7640  O  O    . LYS B 1 222 ? 58.800  19.096  -22.120 1.00 11.69 ? 253 LYS B O    1 
ATOM   7641  C  CB   . LYS B 1 222 ? 56.437  20.598  -23.611 1.00 5.80  ? 253 LYS B CB   1 
ATOM   7642  C  CG   . LYS B 1 222 ? 56.086  20.733  -25.048 1.00 9.49  ? 253 LYS B CG   1 
ATOM   7643  C  CD   . LYS B 1 222 ? 54.728  21.415  -25.169 1.00 10.98 ? 253 LYS B CD   1 
ATOM   7644  C  CE   . LYS B 1 222 ? 54.745  22.912  -24.811 1.00 9.07  ? 253 LYS B CE   1 
ATOM   7645  N  NZ   . LYS B 1 222 ? 55.201  23.258  -23.433 1.00 5.98  ? 253 LYS B NZ   1 
ATOM   7646  H  H    . LYS B 1 222 ? 55.766  19.731  -21.351 1.00 17.00 ? 253 LYS B H    1 
ATOM   7647  H  HZ1  . LYS B 1 222 ? 54.567  22.776  -22.772 1.00 17.00 ? 253 LYS B HZ1  1 
ATOM   7648  H  HZ2  . LYS B 1 222 ? 56.182  22.950  -23.283 1.00 17.00 ? 253 LYS B HZ2  1 
ATOM   7649  H  HZ3  . LYS B 1 222 ? 55.127  24.285  -23.284 1.00 17.00 ? 253 LYS B HZ3  1 
ATOM   7650  N  N    . TYR B 1 223 ? 58.653  18.396  -24.247 1.00 7.29  ? 254 TYR B N    1 
ATOM   7651  C  CA   . TYR B 1 223 ? 60.070  18.098  -24.317 1.00 3.59  ? 254 TYR B CA   1 
ATOM   7652  C  C    . TYR B 1 223 ? 60.464  18.324  -25.779 1.00 3.13  ? 254 TYR B C    1 
ATOM   7653  O  O    . TYR B 1 223 ? 59.636  18.711  -26.600 1.00 2.16  ? 254 TYR B O    1 
ATOM   7654  C  CB   . TYR B 1 223 ? 60.322  16.644  -23.860 1.00 2.02  ? 254 TYR B CB   1 
ATOM   7655  C  CG   . TYR B 1 223 ? 59.505  15.600  -24.616 1.00 4.47  ? 254 TYR B CG   1 
ATOM   7656  C  CD1  . TYR B 1 223 ? 59.307  15.713  -25.999 1.00 3.92  ? 254 TYR B CD1  1 
ATOM   7657  C  CD2  . TYR B 1 223 ? 58.938  14.512  -23.961 1.00 2.01  ? 254 TYR B CD2  1 
ATOM   7658  C  CE1  . TYR B 1 223 ? 58.588  14.805  -26.712 1.00 3.11  ? 254 TYR B CE1  1 
ATOM   7659  C  CE2  . TYR B 1 223 ? 58.216  13.585  -24.665 1.00 5.26  ? 254 TYR B CE2  1 
ATOM   7660  C  CZ   . TYR B 1 223 ? 58.044  13.740  -26.059 1.00 7.15  ? 254 TYR B CZ   1 
ATOM   7661  O  OH   . TYR B 1 223 ? 57.351  12.818  -26.823 1.00 12.83 ? 254 TYR B OH   1 
ATOM   7662  H  H    . TYR B 1 223 ? 58.113  18.259  -25.052 1.00 17.00 ? 254 TYR B H    1 
ATOM   7663  H  HH   . TYR B 1 223 ? 56.975  12.138  -26.259 1.00 17.00 ? 254 TYR B HH   1 
ATOM   7664  N  N    . GLN B 1 224 ? 61.704  18.016  -26.118 1.00 5.46  ? 255 GLN B N    1 
ATOM   7665  C  CA   . GLN B 1 224 ? 62.178  18.175  -27.476 1.00 5.88  ? 255 GLN B CA   1 
ATOM   7666  C  C    . GLN B 1 224 ? 63.345  17.271  -27.751 1.00 6.07  ? 255 GLN B C    1 
ATOM   7667  O  O    . GLN B 1 224 ? 64.242  17.128  -26.908 1.00 5.69  ? 255 GLN B O    1 
ATOM   7668  C  CB   . GLN B 1 224 ? 62.616  19.595  -27.709 1.00 8.66  ? 255 GLN B CB   1 
ATOM   7669  C  CG   . GLN B 1 224 ? 63.966  19.950  -27.172 1.00 7.23  ? 255 GLN B CG   1 
ATOM   7670  C  CD   . GLN B 1 224 ? 64.428  21.239  -27.799 1.00 9.84  ? 255 GLN B CD   1 
ATOM   7671  O  OE1  . GLN B 1 224 ? 64.741  21.295  -29.013 1.00 9.75  ? 255 GLN B OE1  1 
ATOM   7672  N  NE2  . GLN B 1 224 ? 64.426  22.304  -27.004 1.00 10.73 ? 255 GLN B NE2  1 
ATOM   7673  H  H    . GLN B 1 224 ? 62.328  17.678  -25.445 1.00 17.00 ? 255 GLN B H    1 
ATOM   7674  H  HE21 . GLN B 1 224 ? 64.729  23.137  -27.397 1.00 17.00 ? 255 GLN B HE21 1 
ATOM   7675  H  HE22 . GLN B 1 224 ? 64.145  22.190  -26.079 1.00 17.00 ? 255 GLN B HE22 1 
ATOM   7676  N  N    . VAL B 1 225 ? 63.364  16.707  -28.950 1.00 5.59  ? 256 VAL B N    1 
ATOM   7677  C  CA   . VAL B 1 225 ? 64.441  15.819  -29.283 1.00 7.63  ? 256 VAL B CA   1 
ATOM   7678  C  C    . VAL B 1 225 ? 65.606  16.438  -30.043 1.00 9.19  ? 256 VAL B C    1 
ATOM   7679  O  O    . VAL B 1 225 ? 65.461  16.935  -31.165 1.00 9.06  ? 256 VAL B O    1 
ATOM   7680  C  CB   . VAL B 1 225 ? 63.934  14.551  -29.944 1.00 6.47  ? 256 VAL B CB   1 
ATOM   7681  C  CG1  . VAL B 1 225 ? 65.091  13.717  -30.433 1.00 8.20  ? 256 VAL B CG1  1 
ATOM   7682  C  CG2  . VAL B 1 225 ? 63.162  13.755  -28.920 1.00 8.58  ? 256 VAL B CG2  1 
ATOM   7683  H  H    . VAL B 1 225 ? 62.669  16.912  -29.602 1.00 17.00 ? 256 VAL B H    1 
ATOM   7684  N  N    . ILE B 1 226 ? 66.758  16.425  -29.369 1.00 10.69 ? 257 ILE B N    1 
ATOM   7685  C  CA   . ILE B 1 226 ? 68.026  16.913  -29.890 1.00 8.51  ? 257 ILE B CA   1 
ATOM   7686  C  C    . ILE B 1 226 ? 68.928  15.703  -30.161 1.00 7.33  ? 257 ILE B C    1 
ATOM   7687  O  O    . ILE B 1 226 ? 69.383  15.022  -29.233 1.00 2.04  ? 257 ILE B O    1 
ATOM   7688  C  CB   . ILE B 1 226 ? 68.714  17.794  -28.877 1.00 9.41  ? 257 ILE B CB   1 
ATOM   7689  C  CG1  . ILE B 1 226 ? 67.770  18.909  -28.434 1.00 11.74 ? 257 ILE B CG1  1 
ATOM   7690  C  CG2  . ILE B 1 226 ? 69.986  18.362  -29.475 1.00 8.88  ? 257 ILE B CG2  1 
ATOM   7691  C  CD1  . ILE B 1 226 ? 68.380  19.842  -27.377 1.00 12.50 ? 257 ILE B CD1  1 
ATOM   7692  H  H    . ILE B 1 226 ? 66.737  16.066  -28.453 1.00 17.00 ? 257 ILE B H    1 
ATOM   7693  N  N    . GLY B 1 227 ? 69.061  15.370  -31.441 1.00 8.68  ? 258 GLY B N    1 
ATOM   7694  C  CA   . GLY B 1 227 ? 69.888  14.256  -31.848 1.00 11.85 ? 258 GLY B CA   1 
ATOM   7695  C  C    . GLY B 1 227 ? 69.350  12.887  -31.474 1.00 13.94 ? 258 GLY B C    1 
ATOM   7696  O  O    . GLY B 1 227 ? 69.623  11.905  -32.178 1.00 17.02 ? 258 GLY B O    1 
ATOM   7697  H  H    . GLY B 1 227 ? 68.578  15.890  -32.118 1.00 17.00 ? 258 GLY B H    1 
ATOM   7698  N  N    . GLY B 1 228 ? 68.603  12.796  -30.376 1.00 12.92 ? 259 GLY B N    1 
ATOM   7699  C  CA   . GLY B 1 228 ? 68.059  11.522  -29.971 1.00 10.79 ? 259 GLY B CA   1 
ATOM   7700  C  C    . GLY B 1 228 ? 67.707  11.559  -28.510 1.00 11.82 ? 259 GLY B C    1 
ATOM   7701  O  O    . GLY B 1 228 ? 67.223  10.575  -27.954 1.00 14.87 ? 259 GLY B O    1 
ATOM   7702  H  H    . GLY B 1 228 ? 68.398  13.561  -29.825 1.00 17.00 ? 259 GLY B H    1 
ATOM   7703  N  N    . GLU B 1 229 ? 67.965  12.672  -27.851 1.00 12.24 ? 260 GLU B N    1 
ATOM   7704  C  CA   . GLU B 1 229 ? 67.624  12.714  -26.445 1.00 15.57 ? 260 GLU B CA   1 
ATOM   7705  C  C    . GLU B 1 229 ? 66.568  13.776  -26.219 1.00 14.56 ? 260 GLU B C    1 
ATOM   7706  O  O    . GLU B 1 229 ? 66.503  14.788  -26.935 1.00 14.30 ? 260 GLU B O    1 
ATOM   7707  C  CB   . GLU B 1 229 ? 68.847  12.996  -25.544 1.00 17.00 ? 260 GLU B CB   1 
ATOM   7708  C  CG   . GLU B 1 229 ? 70.165  12.309  -25.922 1.00 19.80 ? 260 GLU B CG   1 
ATOM   7709  C  CD   . GLU B 1 229 ? 70.187  10.801  -25.688 1.00 21.88 ? 260 GLU B CD   1 
ATOM   7710  O  OE1  . GLU B 1 229 ? 69.431  10.292  -24.821 1.00 22.69 ? 260 GLU B OE1  1 
ATOM   7711  O  OE2  . GLU B 1 229 ? 70.991  10.130  -26.373 1.00 22.56 ? 260 GLU B OE2  1 
ATOM   7712  H  H    . GLU B 1 229 ? 68.361  13.471  -28.252 1.00 17.00 ? 260 GLU B H    1 
ATOM   7713  N  N    . VAL B 1 230 ? 65.743  13.517  -25.210 1.00 13.43 ? 261 VAL B N    1 
ATOM   7714  C  CA   . VAL B 1 230 ? 64.675  14.414  -24.802 1.00 9.03  ? 261 VAL B CA   1 
ATOM   7715  C  C    . VAL B 1 230 ? 65.304  15.512  -23.961 1.00 6.05  ? 261 VAL B C    1 
ATOM   7716  O  O    . VAL B 1 230 ? 66.027  15.229  -23.019 1.00 4.99  ? 261 VAL B O    1 
ATOM   7717  C  CB   . VAL B 1 230 ? 63.607  13.648  -23.966 1.00 7.66  ? 261 VAL B CB   1 
ATOM   7718  C  CG1  . VAL B 1 230 ? 62.961  14.590  -22.937 1.00 5.87  ? 261 VAL B CG1  1 
ATOM   7719  C  CG2  . VAL B 1 230 ? 62.570  13.011  -24.895 1.00 2.00  ? 261 VAL B CG2  1 
ATOM   7720  H  H    . VAL B 1 230 ? 65.870  12.696  -24.698 1.00 17.00 ? 261 VAL B H    1 
ATOM   7721  N  N    . TYR B 1 231 ? 65.067  16.750  -24.358 1.00 5.51  ? 262 TYR B N    1 
ATOM   7722  C  CA   . TYR B 1 231 ? 65.579  17.916  -23.666 1.00 6.02  ? 262 TYR B CA   1 
ATOM   7723  C  C    . TYR B 1 231 ? 64.378  18.817  -23.591 1.00 5.67  ? 262 TYR B C    1 
ATOM   7724  O  O    . TYR B 1 231 ? 63.518  18.757  -24.453 1.00 4.57  ? 262 TYR B O    1 
ATOM   7725  C  CB   . TYR B 1 231 ? 66.689  18.608  -24.485 1.00 6.74  ? 262 TYR B CB   1 
ATOM   7726  C  CG   . TYR B 1 231 ? 68.007  17.904  -24.383 1.00 5.74  ? 262 TYR B CG   1 
ATOM   7727  C  CD1  . TYR B 1 231 ? 68.722  17.923  -23.192 1.00 6.63  ? 262 TYR B CD1  1 
ATOM   7728  C  CD2  . TYR B 1 231 ? 68.477  17.112  -25.425 1.00 6.08  ? 262 TYR B CD2  1 
ATOM   7729  C  CE1  . TYR B 1 231 ? 69.867  17.152  -23.025 1.00 7.02  ? 262 TYR B CE1  1 
ATOM   7730  C  CE2  . TYR B 1 231 ? 69.618  16.341  -25.274 1.00 7.78  ? 262 TYR B CE2  1 
ATOM   7731  C  CZ   . TYR B 1 231 ? 70.306  16.349  -24.069 1.00 8.35  ? 262 TYR B CZ   1 
ATOM   7732  O  OH   . TYR B 1 231 ? 71.359  15.460  -23.883 1.00 12.02 ? 262 TYR B OH   1 
ATOM   7733  H  H    . TYR B 1 231 ? 64.509  16.907  -25.137 1.00 17.00 ? 262 TYR B H    1 
ATOM   7734  H  HH   . TYR B 1 231 ? 71.574  15.063  -24.733 1.00 17.00 ? 262 TYR B HH   1 
ATOM   7735  N  N    . PRO B 1 232 ? 64.314  19.673  -22.568 1.00 6.03  ? 263 PRO B N    1 
ATOM   7736  C  CA   . PRO B 1 232 ? 63.250  20.632  -22.302 1.00 8.54  ? 263 PRO B CA   1 
ATOM   7737  C  C    . PRO B 1 232 ? 62.885  21.554  -23.472 1.00 9.01  ? 263 PRO B C    1 
ATOM   7738  O  O    . PRO B 1 232 ? 63.710  21.885  -24.328 1.00 10.09 ? 263 PRO B O    1 
ATOM   7739  C  CB   . PRO B 1 232 ? 63.816  21.430  -21.127 1.00 8.65  ? 263 PRO B CB   1 
ATOM   7740  C  CG   . PRO B 1 232 ? 64.531  20.431  -20.373 1.00 9.50  ? 263 PRO B CG   1 
ATOM   7741  C  CD   . PRO B 1 232 ? 65.299  19.713  -21.479 1.00 10.74 ? 263 PRO B CD   1 
ATOM   7742  N  N    . PRO B 1 233 ? 61.636  22.013  -23.498 1.00 8.47  ? 264 PRO B N    1 
ATOM   7743  C  CA   . PRO B 1 233 ? 61.230  22.894  -24.584 1.00 7.59  ? 264 PRO B CA   1 
ATOM   7744  C  C    . PRO B 1 233 ? 62.002  24.180  -24.498 1.00 6.41  ? 264 PRO B C    1 
ATOM   7745  O  O    . PRO B 1 233 ? 62.562  24.521  -23.450 1.00 6.27  ? 264 PRO B O    1 
ATOM   7746  C  CB   . PRO B 1 233 ? 59.745  23.100  -24.310 1.00 9.86  ? 264 PRO B CB   1 
ATOM   7747  C  CG   . PRO B 1 233 ? 59.645  22.957  -22.824 1.00 10.89 ? 264 PRO B CG   1 
ATOM   7748  C  CD   . PRO B 1 233 ? 60.550  21.817  -22.519 1.00 9.87  ? 264 PRO B CD   1 
ATOM   7749  N  N    . THR B 1 234 ? 62.035  24.894  -25.609 1.00 6.13  ? 265 THR B N    1 
ATOM   7750  C  CA   . THR B 1 234 ? 62.754  26.168  -25.683 1.00 5.12  ? 265 THR B CA   1 
ATOM   7751  C  C    . THR B 1 234 ? 61.887  27.335  -25.253 1.00 3.23  ? 265 THR B C    1 
ATOM   7752  O  O    . THR B 1 234 ? 60.707  27.341  -25.523 1.00 5.60  ? 265 THR B O    1 
ATOM   7753  C  CB   . THR B 1 234 ? 63.211  26.416  -27.107 1.00 2.54  ? 265 THR B CB   1 
ATOM   7754  O  OG1  . THR B 1 234 ? 62.118  26.157  -28.002 1.00 4.56  ? 265 THR B OG1  1 
ATOM   7755  C  CG2  . THR B 1 234 ? 64.355  25.490  -27.452 1.00 2.00  ? 265 THR B CG2  1 
ATOM   7756  H  H    . THR B 1 234 ? 61.574  24.599  -26.418 1.00 17.00 ? 265 THR B H    1 
ATOM   7757  H  HG1  . THR B 1 234 ? 62.422  26.310  -28.911 1.00 17.00 ? 265 THR B HG1  1 
ATOM   7758  N  N    . VAL B 1 235 ? 62.463  28.338  -24.613 1.00 3.79  ? 266 VAL B N    1 
ATOM   7759  C  CA   . VAL B 1 235 ? 61.662  29.483  -24.206 1.00 5.96  ? 266 VAL B CA   1 
ATOM   7760  C  C    . VAL B 1 235 ? 60.984  30.024  -25.452 1.00 7.60  ? 266 VAL B C    1 
ATOM   7761  O  O    . VAL B 1 235 ? 59.853  30.479  -25.391 1.00 9.36  ? 266 VAL B O    1 
ATOM   7762  C  CB   . VAL B 1 235 ? 62.511  30.629  -23.625 1.00 4.98  ? 266 VAL B CB   1 
ATOM   7763  C  CG1  . VAL B 1 235 ? 63.290  31.345  -24.744 1.00 5.54  ? 266 VAL B CG1  1 
ATOM   7764  C  CG2  . VAL B 1 235 ? 61.612  31.643  -22.951 1.00 5.91  ? 266 VAL B CG2  1 
ATOM   7765  H  H    . VAL B 1 235 ? 63.412  28.291  -24.382 1.00 17.00 ? 266 VAL B H    1 
ATOM   7766  N  N    . LYS B 1 236 ? 61.686  29.946  -26.586 1.00 10.83 ? 267 LYS B N    1 
ATOM   7767  C  CA   . LYS B 1 236 ? 61.173  30.435  -27.866 1.00 11.67 ? 267 LYS B CA   1 
ATOM   7768  C  C    . LYS B 1 236 ? 59.921  29.667  -28.289 1.00 9.60  ? 267 LYS B C    1 
ATOM   7769  O  O    . LYS B 1 236 ? 58.982  30.212  -28.875 1.00 8.81  ? 267 LYS B O    1 
ATOM   7770  C  CB   . LYS B 1 236 ? 62.235  30.322  -28.969 1.00 10.10 ? 267 LYS B CB   1 
ATOM   7771  C  CG   . LYS B 1 236 ? 61.733  30.925  -30.280 1.00 12.94 ? 267 LYS B CG   1 
ATOM   7772  C  CD   . LYS B 1 236 ? 62.669  30.766  -31.457 1.00 11.32 ? 267 LYS B CD   1 
ATOM   7773  C  CE   . LYS B 1 236 ? 61.978  31.163  -32.748 1.00 10.87 ? 267 LYS B CE   1 
ATOM   7774  N  NZ   . LYS B 1 236 ? 60.740  30.315  -32.956 1.00 13.73 ? 267 LYS B NZ   1 
ATOM   7775  H  H    . LYS B 1 236 ? 62.578  29.554  -26.554 1.00 17.00 ? 267 LYS B H    1 
ATOM   7776  H  HZ1  . LYS B 1 236 ? 60.094  30.449  -32.154 1.00 17.00 ? 267 LYS B HZ1  1 
ATOM   7777  H  HZ2  . LYS B 1 236 ? 60.263  30.605  -33.833 1.00 17.00 ? 267 LYS B HZ2  1 
ATOM   7778  H  HZ3  . LYS B 1 236 ? 61.016  29.315  -33.025 1.00 17.00 ? 267 LYS B HZ3  1 
ATOM   7779  N  N    . ASP B 1 237 ? 59.941  28.383  -28.014 1.00 8.71  ? 268 ASP B N    1 
ATOM   7780  C  CA   . ASP B 1 237 ? 58.823  27.550  -28.355 1.00 9.02  ? 268 ASP B CA   1 
ATOM   7781  C  C    . ASP B 1 237 ? 57.709  27.714  -27.364 1.00 7.39  ? 268 ASP B C    1 
ATOM   7782  O  O    . ASP B 1 237 ? 56.617  28.070  -27.750 1.00 9.45  ? 268 ASP B O    1 
ATOM   7783  C  CB   . ASP B 1 237 ? 59.228  26.089  -28.415 1.00 10.09 ? 268 ASP B CB   1 
ATOM   7784  C  CG   . ASP B 1 237 ? 58.083  25.214  -28.776 1.00 10.62 ? 268 ASP B CG   1 
ATOM   7785  O  OD1  . ASP B 1 237 ? 57.430  25.517  -29.809 1.00 8.20  ? 268 ASP B OD1  1 
ATOM   7786  O  OD2  . ASP B 1 237 ? 57.830  24.252  -28.016 1.00 12.99 ? 268 ASP B OD2  1 
ATOM   7787  H  H    . ASP B 1 237 ? 60.689  27.981  -27.535 1.00 17.00 ? 268 ASP B H    1 
ATOM   7788  N  N    . THR B 1 238 ? 57.956  27.346  -26.114 1.00 4.94  ? 269 THR B N    1 
ATOM   7789  C  CA   . THR B 1 238 ? 56.957  27.479  -25.059 1.00 4.25  ? 269 THR B CA   1 
ATOM   7790  C  C    . THR B 1 238 ? 57.313  28.762  -24.379 1.00 2.93  ? 269 THR B C    1 
ATOM   7791  O  O    . THR B 1 238 ? 58.268  28.800  -23.622 1.00 5.09  ? 269 THR B O    1 
ATOM   7792  C  CB   . THR B 1 238 ? 56.993  26.295  -24.058 1.00 5.39  ? 269 THR B CB   1 
ATOM   7793  O  OG1  . THR B 1 238 ? 58.190  26.302  -23.264 1.00 8.20  ? 269 THR B OG1  1 
ATOM   7794  C  CG2  . THR B 1 238 ? 56.975  25.028  -24.823 1.00 8.50  ? 269 THR B CG2  1 
ATOM   7795  H  H    . THR B 1 238 ? 58.837  27.005  -25.853 1.00 17.00 ? 269 THR B H    1 
ATOM   7796  H  HG1  . THR B 1 238 ? 58.468  27.162  -22.958 1.00 17.00 ? 269 THR B HG1  1 
ATOM   7797  N  N    . GLN B 1 239 ? 56.541  29.813  -24.606 1.00 2.00  ? 270 GLN B N    1 
ATOM   7798  C  CA   . GLN B 1 239 ? 56.892  31.112  -24.034 1.00 3.49  ? 270 GLN B CA   1 
ATOM   7799  C  C    . GLN B 1 239 ? 57.050  31.262  -22.535 1.00 2.00  ? 270 GLN B C    1 
ATOM   7800  O  O    . GLN B 1 239 ? 56.905  32.353  -22.030 1.00 2.01  ? 270 GLN B O    1 
ATOM   7801  C  CB   . GLN B 1 239 ? 56.028  32.241  -24.595 1.00 8.08  ? 270 GLN B CB   1 
ATOM   7802  C  CG   . GLN B 1 239 ? 56.117  32.395  -26.114 1.00 13.24 ? 270 GLN B CG   1 
ATOM   7803  C  CD   . GLN B 1 239 ? 55.199  31.418  -26.886 1.00 16.12 ? 270 GLN B CD   1 
ATOM   7804  O  OE1  . GLN B 1 239 ? 54.633  30.471  -26.319 1.00 18.74 ? 270 GLN B OE1  1 
ATOM   7805  N  NE2  . GLN B 1 239 ? 55.032  31.672  -28.181 1.00 16.97 ? 270 GLN B NE2  1 
ATOM   7806  H  H    . GLN B 1 239 ? 55.748  29.676  -25.149 1.00 17.00 ? 270 GLN B H    1 
ATOM   7807  H  HE21 . GLN B 1 239 ? 54.454  31.069  -28.691 1.00 17.00 ? 270 GLN B HE21 1 
ATOM   7808  H  HE22 . GLN B 1 239 ? 55.502  32.438  -28.566 1.00 17.00 ? 270 GLN B HE22 1 
ATOM   7809  N  N    . VAL B 1 240 ? 57.313  30.168  -21.826 1.00 2.03  ? 271 VAL B N    1 
ATOM   7810  C  CA   . VAL B 1 240 ? 57.545  30.188  -20.381 1.00 4.08  ? 271 VAL B CA   1 
ATOM   7811  C  C    . VAL B 1 240 ? 58.819  30.977  -20.162 1.00 6.26  ? 271 VAL B C    1 
ATOM   7812  O  O    . VAL B 1 240 ? 59.866  30.610  -20.692 1.00 9.10  ? 271 VAL B O    1 
ATOM   7813  C  CB   . VAL B 1 240 ? 57.698  28.753  -19.787 1.00 2.90  ? 271 VAL B CB   1 
ATOM   7814  C  CG1  . VAL B 1 240 ? 58.449  27.855  -20.726 1.00 2.00  ? 271 VAL B CG1  1 
ATOM   7815  C  CG2  . VAL B 1 240 ? 58.403  28.813  -18.455 1.00 2.04  ? 271 VAL B CG2  1 
ATOM   7816  H  H    . VAL B 1 240 ? 57.319  29.302  -22.228 1.00 17.00 ? 271 VAL B H    1 
ATOM   7817  N  N    . GLU B 1 241 ? 58.726  32.059  -19.391 1.00 7.32  ? 272 GLU B N    1 
ATOM   7818  C  CA   . GLU B 1 241 ? 59.868  32.939  -19.150 1.00 7.24  ? 272 GLU B CA   1 
ATOM   7819  C  C    . GLU B 1 241 ? 61.015  32.269  -18.424 1.00 5.57  ? 272 GLU B C    1 
ATOM   7820  O  O    . GLU B 1 241 ? 60.784  31.466  -17.534 1.00 6.71  ? 272 GLU B O    1 
ATOM   7821  C  CB   . GLU B 1 241 ? 59.411  34.154  -18.368 1.00 9.14  ? 272 GLU B CB   1 
ATOM   7822  C  CG   . GLU B 1 241 ? 59.390  35.436  -19.171 1.00 16.84 ? 272 GLU B CG   1 
ATOM   7823  C  CD   . GLU B 1 241 ? 59.329  36.681  -18.271 1.00 22.94 ? 272 GLU B CD   1 
ATOM   7824  O  OE1  . GLU B 1 241 ? 60.316  36.940  -17.527 1.00 26.69 ? 272 GLU B OE1  1 
ATOM   7825  O  OE2  . GLU B 1 241 ? 58.289  37.399  -18.295 1.00 24.67 ? 272 GLU B OE2  1 
ATOM   7826  H  H    . GLU B 1 241 ? 57.863  32.250  -18.983 1.00 17.00 ? 272 GLU B H    1 
ATOM   7827  N  N    . MET B 1 242 ? 62.248  32.624  -18.778 1.00 4.39  ? 273 MET B N    1 
ATOM   7828  C  CA   . MET B 1 242 ? 63.443  32.044  -18.144 1.00 4.58  ? 273 MET B CA   1 
ATOM   7829  C  C    . MET B 1 242 ? 64.466  33.111  -17.864 1.00 3.83  ? 273 MET B C    1 
ATOM   7830  O  O    . MET B 1 242 ? 64.216  34.282  -18.152 1.00 5.36  ? 273 MET B O    1 
ATOM   7831  C  CB   . MET B 1 242 ? 64.091  30.990  -19.043 1.00 3.08  ? 273 MET B CB   1 
ATOM   7832  C  CG   . MET B 1 242 ? 63.560  29.610  -18.833 1.00 2.00  ? 273 MET B CG   1 
ATOM   7833  S  SD   . MET B 1 242 ? 63.727  29.220  -17.111 1.00 3.24  ? 273 MET B SD   1 
ATOM   7834  C  CE   . MET B 1 242 ? 64.630  27.653  -17.228 1.00 2.01  ? 273 MET B CE   1 
ATOM   7835  H  H    . MET B 1 242 ? 62.389  33.317  -19.453 1.00 17.00 ? 273 MET B H    1 
ATOM   7836  N  N    . ILE B 1 243 ? 65.587  32.720  -17.262 1.00 4.00  ? 274 ILE B N    1 
ATOM   7837  C  CA   . ILE B 1 243 ? 66.667  33.659  -16.985 1.00 7.45  ? 274 ILE B CA   1 
ATOM   7838  C  C    . ILE B 1 243 ? 67.957  33.193  -17.695 1.00 8.68  ? 274 ILE B C    1 
ATOM   7839  O  O    . ILE B 1 243 ? 68.548  32.179  -17.317 1.00 10.07 ? 274 ILE B O    1 
ATOM   7840  C  CB   . ILE B 1 243 ? 66.924  33.835  -15.486 1.00 7.40  ? 274 ILE B CB   1 
ATOM   7841  C  CG1  . ILE B 1 243 ? 65.621  33.805  -14.703 1.00 5.88  ? 274 ILE B CG1  1 
ATOM   7842  C  CG2  . ILE B 1 243 ? 67.554  35.199  -15.258 1.00 11.21 ? 274 ILE B CG2  1 
ATOM   7843  C  CD1  . ILE B 1 243 ? 65.818  33.852  -13.225 1.00 7.92  ? 274 ILE B CD1  1 
ATOM   7844  H  H    . ILE B 1 243 ? 65.716  31.792  -16.965 1.00 17.00 ? 274 ILE B H    1 
ATOM   7845  N  N    . TYR B 1 244 ? 68.337  33.904  -18.763 1.00 7.49  ? 275 TYR B N    1 
ATOM   7846  C  CA   . TYR B 1 244 ? 69.508  33.597  -19.578 1.00 6.58  ? 275 TYR B CA   1 
ATOM   7847  C  C    . TYR B 1 244 ? 70.295  34.846  -20.056 1.00 9.84  ? 275 TYR B C    1 
ATOM   7848  O  O    . TYR B 1 244 ? 69.711  35.860  -20.474 1.00 10.07 ? 275 TYR B O    1 
ATOM   7849  C  CB   . TYR B 1 244 ? 69.087  32.810  -20.810 1.00 4.05  ? 275 TYR B CB   1 
ATOM   7850  C  CG   . TYR B 1 244 ? 68.748  31.357  -20.585 1.00 3.96  ? 275 TYR B CG   1 
ATOM   7851  C  CD1  . TYR B 1 244 ? 69.713  30.449  -20.209 1.00 7.28  ? 275 TYR B CD1  1 
ATOM   7852  C  CD2  . TYR B 1 244 ? 67.470  30.878  -20.797 1.00 3.69  ? 275 TYR B CD2  1 
ATOM   7853  C  CE1  . TYR B 1 244 ? 69.398  29.075  -20.053 1.00 7.92  ? 275 TYR B CE1  1 
ATOM   7854  C  CE2  . TYR B 1 244 ? 67.157  29.519  -20.640 1.00 2.87  ? 275 TYR B CE2  1 
ATOM   7855  C  CZ   . TYR B 1 244 ? 68.115  28.636  -20.276 1.00 2.00  ? 275 TYR B CZ   1 
ATOM   7856  O  OH   . TYR B 1 244 ? 67.807  27.320  -20.161 1.00 2.00  ? 275 TYR B OH   1 
ATOM   7857  H  H    . TYR B 1 244 ? 67.805  34.687  -19.031 1.00 17.00 ? 275 TYR B H    1 
ATOM   7858  H  HH   . TYR B 1 244 ? 66.840  27.238  -20.153 1.00 17.00 ? 275 TYR B HH   1 
ATOM   7859  N  N    . PRO B 1 245 ? 71.647  34.765  -20.032 1.00 10.90 ? 276 PRO B N    1 
ATOM   7860  C  CA   . PRO B 1 245 ? 72.522  35.861  -20.456 1.00 8.94  ? 276 PRO B CA   1 
ATOM   7861  C  C    . PRO B 1 245 ? 72.210  36.275  -21.892 1.00 8.41  ? 276 PRO B C    1 
ATOM   7862  O  O    . PRO B 1 245 ? 72.173  35.429  -22.797 1.00 4.80  ? 276 PRO B O    1 
ATOM   7863  C  CB   . PRO B 1 245 ? 73.909  35.242  -20.337 1.00 7.88  ? 276 PRO B CB   1 
ATOM   7864  C  CG   . PRO B 1 245 ? 73.753  34.256  -19.229 1.00 7.27  ? 276 PRO B CG   1 
ATOM   7865  C  CD   . PRO B 1 245 ? 72.449  33.615  -19.554 1.00 9.86  ? 276 PRO B CD   1 
ATOM   7866  N  N    . PRO B 1 246 ? 72.052  37.600  -22.121 1.00 10.28 ? 277 PRO B N    1 
ATOM   7867  C  CA   . PRO B 1 246 ? 71.740  38.228  -23.414 1.00 10.97 ? 277 PRO B CA   1 
ATOM   7868  C  C    . PRO B 1 246 ? 72.735  37.953  -24.502 1.00 9.47  ? 277 PRO B C    1 
ATOM   7869  O  O    . PRO B 1 246 ? 73.356  38.879  -25.009 1.00 12.04 ? 277 PRO B O    1 
ATOM   7870  C  CB   . PRO B 1 246 ? 71.692  39.719  -23.076 1.00 10.10 ? 277 PRO B CB   1 
ATOM   7871  C  CG   . PRO B 1 246 ? 72.612  39.839  -21.908 1.00 9.35  ? 277 PRO B CG   1 
ATOM   7872  C  CD   . PRO B 1 246 ? 72.270  38.634  -21.087 1.00 9.08  ? 277 PRO B CD   1 
ATOM   7873  N  N    . HIS B 1 247 ? 72.831  36.687  -24.887 1.00 7.18  ? 278 HIS B N    1 
ATOM   7874  C  CA   . HIS B 1 247 ? 73.738  36.243  -25.923 1.00 9.87  ? 278 HIS B CA   1 
ATOM   7875  C  C    . HIS B 1 247 ? 73.529  34.766  -26.132 1.00 11.56 ? 278 HIS B C    1 
ATOM   7876  O  O    . HIS B 1 247 ? 73.979  34.219  -27.142 1.00 13.13 ? 278 HIS B O    1 
ATOM   7877  C  CB   . HIS B 1 247 ? 75.217  36.482  -25.557 1.00 11.38 ? 278 HIS B CB   1 
ATOM   7878  C  CG   . HIS B 1 247 ? 75.710  35.682  -24.382 1.00 9.27  ? 278 HIS B CG   1 
ATOM   7879  N  ND1  . HIS B 1 247 ? 75.903  36.239  -23.133 1.00 8.13  ? 278 HIS B ND1  1 
ATOM   7880  C  CD2  . HIS B 1 247 ? 76.078  34.382  -24.275 1.00 6.39  ? 278 HIS B CD2  1 
ATOM   7881  C  CE1  . HIS B 1 247 ? 76.367  35.317  -22.309 1.00 8.53  ? 278 HIS B CE1  1 
ATOM   7882  N  NE2  . HIS B 1 247 ? 76.482  34.182  -22.978 1.00 7.11  ? 278 HIS B NE2  1 
ATOM   7883  H  H    . HIS B 1 247 ? 72.189  36.048  -24.523 1.00 17.00 ? 278 HIS B H    1 
ATOM   7884  H  HD1  . HIS B 1 247 ? 75.750  37.184  -22.905 1.00 17.00 ? 278 HIS B HD1  1 
ATOM   7885  H  HE2  . HIS B 1 247 ? 76.795  33.325  -22.604 1.00 17.00 ? 278 HIS B HE2  1 
ATOM   7886  N  N    . ILE B 1 248 ? 72.950  34.099  -25.133 1.00 9.97  ? 279 ILE B N    1 
ATOM   7887  C  CA   . ILE B 1 248 ? 72.693  32.683  -25.244 1.00 8.77  ? 279 ILE B CA   1 
ATOM   7888  C  C    . ILE B 1 248 ? 71.845  32.565  -26.498 1.00 8.02  ? 279 ILE B C    1 
ATOM   7889  O  O    . ILE B 1 248 ? 70.829  33.243  -26.625 1.00 8.07  ? 279 ILE B O    1 
ATOM   7890  C  CB   . ILE B 1 248 ? 71.961  32.158  -24.000 1.00 11.53 ? 279 ILE B CB   1 
ATOM   7891  C  CG1  . ILE B 1 248 ? 72.942  31.410  -23.072 1.00 11.01 ? 279 ILE B CG1  1 
ATOM   7892  C  CG2  . ILE B 1 248 ? 70.817  31.234  -24.397 1.00 13.65 ? 279 ILE B CG2  1 
ATOM   7893  C  CD1  . ILE B 1 248 ? 73.822  32.269  -22.207 1.00 5.45  ? 279 ILE B CD1  1 
ATOM   7894  H  H    . ILE B 1 248 ? 72.631  34.544  -24.336 1.00 17.00 ? 279 ILE B H    1 
ATOM   7895  N  N    . PRO B 1 249 ? 72.245  31.679  -27.422 1.00 7.59  ? 280 PRO B N    1 
ATOM   7896  C  CA   . PRO B 1 249 ? 71.679  31.330  -28.736 1.00 8.29  ? 280 PRO B CA   1 
ATOM   7897  C  C    . PRO B 1 249 ? 70.151  31.243  -28.946 1.00 11.19 ? 280 PRO B C    1 
ATOM   7898  O  O    . PRO B 1 249 ? 69.680  31.115  -30.088 1.00 10.78 ? 280 PRO B O    1 
ATOM   7899  C  CB   . PRO B 1 249 ? 72.346  29.989  -29.036 1.00 6.60  ? 280 PRO B CB   1 
ATOM   7900  C  CG   . PRO B 1 249 ? 72.666  29.429  -27.660 1.00 5.85  ? 280 PRO B CG   1 
ATOM   7901  C  CD   . PRO B 1 249 ? 73.206  30.648  -26.997 1.00 5.16  ? 280 PRO B CD   1 
ATOM   7902  N  N    . GLU B 1 250 ? 69.382  31.314  -27.861 1.00 13.47 ? 281 GLU B N    1 
ATOM   7903  C  CA   . GLU B 1 250 ? 67.911  31.188  -27.900 1.00 16.30 ? 281 GLU B CA   1 
ATOM   7904  C  C    . GLU B 1 250 ? 67.456  29.768  -28.207 1.00 12.72 ? 281 GLU B C    1 
ATOM   7905  O  O    . GLU B 1 250 ? 66.272  29.498  -28.264 1.00 12.17 ? 281 GLU B O    1 
ATOM   7906  C  CB   . GLU B 1 250 ? 67.240  32.206  -28.838 1.00 20.25 ? 281 GLU B CB   1 
ATOM   7907  C  CG   . GLU B 1 250 ? 67.505  33.676  -28.416 1.00 29.79 ? 281 GLU B CG   1 
ATOM   7908  C  CD   . GLU B 1 250 ? 66.764  34.730  -29.264 1.00 36.80 ? 281 GLU B CD   1 
ATOM   7909  O  OE1  . GLU B 1 250 ? 66.247  34.364  -30.361 1.00 40.53 ? 281 GLU B OE1  1 
ATOM   7910  O  OE2  . GLU B 1 250 ? 66.693  35.925  -28.826 1.00 38.86 ? 281 GLU B OE2  1 
ATOM   7911  H  H    . GLU B 1 250 ? 69.796  31.535  -27.009 1.00 17.00 ? 281 GLU B H    1 
ATOM   7912  N  N    . ASN B 1 251 ? 68.428  28.876  -28.378 1.00 11.07 ? 282 ASN B N    1 
ATOM   7913  C  CA   . ASN B 1 251 ? 68.211  27.462  -28.629 1.00 9.09  ? 282 ASN B CA   1 
ATOM   7914  C  C    . ASN B 1 251 ? 68.682  26.834  -27.373 1.00 8.90  ? 282 ASN B C    1 
ATOM   7915  O  O    . ASN B 1 251 ? 68.478  25.649  -27.199 1.00 11.35 ? 282 ASN B O    1 
ATOM   7916  C  CB   . ASN B 1 251 ? 69.109  26.861  -29.700 1.00 10.45 ? 282 ASN B CB   1 
ATOM   7917  C  CG   . ASN B 1 251 ? 69.413  27.818  -30.823 1.00 18.39 ? 282 ASN B CG   1 
ATOM   7918  O  OD1  . ASN B 1 251 ? 68.534  28.518  -31.327 1.00 23.77 ? 282 ASN B OD1  1 
ATOM   7919  N  ND2  . ASN B 1 251 ? 70.679  27.856  -31.233 1.00 18.42 ? 282 ASN B ND2  1 
ATOM   7920  H  H    . ASN B 1 251 ? 69.341  29.192  -28.389 1.00 17.00 ? 282 ASN B H    1 
ATOM   7921  H  HD21 . ASN B 1 251 ? 70.897  28.530  -31.927 1.00 17.00 ? 282 ASN B HD21 1 
ATOM   7922  H  HD22 . ASN B 1 251 ? 71.350  27.265  -30.842 1.00 17.00 ? 282 ASN B HD22 1 
ATOM   7923  N  N    . LEU B 1 252 ? 69.479  27.551  -26.583 1.00 7.76  ? 283 LEU B N    1 
ATOM   7924  C  CA   . LEU B 1 252 ? 69.918  26.978  -25.320 1.00 9.99  ? 283 LEU B CA   1 
ATOM   7925  C  C    . LEU B 1 252 ? 68.713  27.077  -24.451 1.00 10.89 ? 283 LEU B C    1 
ATOM   7926  O  O    . LEU B 1 252 ? 68.235  26.085  -23.907 1.00 13.07 ? 283 LEU B O    1 
ATOM   7927  C  CB   . LEU B 1 252 ? 71.042  27.767  -24.636 1.00 9.58  ? 283 LEU B CB   1 
ATOM   7928  C  CG   . LEU B 1 252 ? 71.145  27.689  -23.072 1.00 12.77 ? 283 LEU B CG   1 
ATOM   7929  C  CD1  . LEU B 1 252 ? 70.935  26.283  -22.433 1.00 7.49  ? 283 LEU B CD1  1 
ATOM   7930  C  CD2  . LEU B 1 252 ? 72.504  28.272  -22.622 1.00 13.23 ? 283 LEU B CD2  1 
ATOM   7931  H  H    . LEU B 1 252 ? 69.759  28.441  -26.841 1.00 17.00 ? 283 LEU B H    1 
ATOM   7932  N  N    . GLN B 1 253 ? 68.236  28.311  -24.355 1.00 10.61 ? 284 GLN B N    1 
ATOM   7933  C  CA   . GLN B 1 253 ? 67.109  28.690  -23.535 1.00 9.20  ? 284 GLN B CA   1 
ATOM   7934  C  C    . GLN B 1 253 ? 66.119  27.567  -23.238 1.00 8.90  ? 284 GLN B C    1 
ATOM   7935  O  O    . GLN B 1 253 ? 65.048  27.501  -23.825 1.00 13.22 ? 284 GLN B O    1 
ATOM   7936  C  CB   . GLN B 1 253 ? 66.445  29.921  -24.139 1.00 5.80  ? 284 GLN B CB   1 
ATOM   7937  C  CG   . GLN B 1 253 ? 67.417  31.096  -24.332 1.00 4.32  ? 284 GLN B CG   1 
ATOM   7938  C  CD   . GLN B 1 253 ? 66.733  32.474  -24.342 1.00 3.17  ? 284 GLN B CD   1 
ATOM   7939  O  OE1  . GLN B 1 253 ? 66.064  32.832  -23.372 1.00 2.99  ? 284 GLN B OE1  1 
ATOM   7940  N  NE2  . GLN B 1 253 ? 66.914  33.247  -25.416 1.00 2.07  ? 284 GLN B NE2  1 
ATOM   7941  H  H    . GLN B 1 253 ? 68.684  28.996  -24.870 1.00 17.00 ? 284 GLN B H    1 
ATOM   7942  H  HE21 . GLN B 1 253 ? 66.445  34.105  -25.394 1.00 17.00 ? 284 GLN B HE21 1 
ATOM   7943  H  HE22 . GLN B 1 253 ? 67.482  32.940  -26.139 1.00 17.00 ? 284 GLN B HE22 1 
ATOM   7944  N  N    . PHE B 1 254 ? 66.505  26.667  -22.347 1.00 6.30  ? 285 PHE B N    1 
ATOM   7945  C  CA   . PHE B 1 254 ? 65.654  25.556  -22.004 1.00 5.35  ? 285 PHE B CA   1 
ATOM   7946  C  C    . PHE B 1 254 ? 64.593  26.073  -21.046 1.00 6.83  ? 285 PHE B C    1 
ATOM   7947  O  O    . PHE B 1 254 ? 64.850  27.066  -20.326 1.00 7.12  ? 285 PHE B O    1 
ATOM   7948  C  CB   . PHE B 1 254 ? 66.495  24.417  -21.416 1.00 3.38  ? 285 PHE B CB   1 
ATOM   7949  C  CG   . PHE B 1 254 ? 67.318  23.687  -22.443 1.00 2.00  ? 285 PHE B CG   1 
ATOM   7950  C  CD1  . PHE B 1 254 ? 66.932  23.669  -23.779 1.00 4.30  ? 285 PHE B CD1  1 
ATOM   7951  C  CD2  . PHE B 1 254 ? 68.480  23.018  -22.085 1.00 5.39  ? 285 PHE B CD2  1 
ATOM   7952  C  CE1  . PHE B 1 254 ? 67.687  23.004  -24.739 1.00 3.86  ? 285 PHE B CE1  1 
ATOM   7953  C  CE2  . PHE B 1 254 ? 69.248  22.344  -23.041 1.00 4.50  ? 285 PHE B CE2  1 
ATOM   7954  C  CZ   . PHE B 1 254 ? 68.845  22.343  -24.368 1.00 5.31  ? 285 PHE B CZ   1 
ATOM   7955  H  H    . PHE B 1 254 ? 67.407  26.721  -21.970 1.00 17.00 ? 285 PHE B H    1 
ATOM   7956  N  N    . ALA B 1 255 ? 63.415  25.433  -21.067 1.00 5.46  ? 286 ALA B N    1 
ATOM   7957  C  CA   . ALA B 1 255 ? 62.267  25.816  -20.245 1.00 4.25  ? 286 ALA B CA   1 
ATOM   7958  C  C    . ALA B 1 255 ? 62.127  25.264  -18.792 1.00 4.39  ? 286 ALA B C    1 
ATOM   7959  O  O    . ALA B 1 255 ? 61.782  25.995  -17.865 1.00 2.00  ? 286 ALA B O    1 
ATOM   7960  C  CB   . ALA B 1 255 ? 61.040  25.571  -21.031 1.00 4.35  ? 286 ALA B CB   1 
ATOM   7961  H  H    . ALA B 1 255 ? 63.338  24.698  -21.709 1.00 17.00 ? 286 ALA B H    1 
ATOM   7962  N  N    . VAL B 1 256 ? 62.288  23.962  -18.628 1.00 6.21  ? 287 VAL B N    1 
ATOM   7963  C  CA   . VAL B 1 256 ? 62.247  23.272  -17.312 1.00 8.15  ? 287 VAL B CA   1 
ATOM   7964  C  C    . VAL B 1 256 ? 61.258  23.551  -16.141 1.00 7.15  ? 287 VAL B C    1 
ATOM   7965  O  O    . VAL B 1 256 ? 60.740  22.582  -15.561 1.00 7.89  ? 287 VAL B O    1 
ATOM   7966  C  CB   . VAL B 1 256 ? 63.691  23.124  -16.704 1.00 8.79  ? 287 VAL B CB   1 
ATOM   7967  C  CG1  . VAL B 1 256 ? 64.624  22.412  -17.698 1.00 9.43  ? 287 VAL B CG1  1 
ATOM   7968  C  CG2  . VAL B 1 256 ? 64.270  24.491  -16.303 1.00 7.37  ? 287 VAL B CG2  1 
ATOM   7969  H  H    . VAL B 1 256 ? 62.435  23.423  -19.425 1.00 17.00 ? 287 VAL B H    1 
ATOM   7970  N  N    . GLY B 1 257 ? 61.057  24.808  -15.735 1.00 2.00  ? 288 GLY B N    1 
ATOM   7971  C  CA   . GLY B 1 257 ? 60.144  25.065  -14.636 1.00 2.00  ? 288 GLY B CA   1 
ATOM   7972  C  C    . GLY B 1 257 ? 60.582  26.147  -13.662 1.00 4.22  ? 288 GLY B C    1 
ATOM   7973  O  O    . GLY B 1 257 ? 59.899  27.164  -13.491 1.00 3.26  ? 288 GLY B O    1 
ATOM   7974  H  H    . GLY B 1 257 ? 61.528  25.561  -16.135 1.00 17.00 ? 288 GLY B H    1 
ATOM   7975  N  N    . GLN B 1 258 ? 61.688  25.914  -12.964 1.00 4.44  ? 289 GLN B N    1 
ATOM   7976  C  CA   . GLN B 1 258 ? 62.227  26.903  -12.022 1.00 4.45  ? 289 GLN B CA   1 
ATOM   7977  C  C    . GLN B 1 258 ? 63.131  27.858  -12.815 1.00 3.43  ? 289 GLN B C    1 
ATOM   7978  O  O    . GLN B 1 258 ? 64.262  27.518  -13.121 1.00 3.39  ? 289 GLN B O    1 
ATOM   7979  C  CB   . GLN B 1 258 ? 63.029  26.195  -10.925 1.00 4.54  ? 289 GLN B CB   1 
ATOM   7980  C  CG   . GLN B 1 258 ? 62.897  26.756  -9.511  1.00 2.00  ? 289 GLN B CG   1 
ATOM   7981  C  CD   . GLN B 1 258 ? 63.745  27.966  -9.285  1.00 2.00  ? 289 GLN B CD   1 
ATOM   7982  O  OE1  . GLN B 1 258 ? 63.928  28.804  -10.182 1.00 2.19  ? 289 GLN B OE1  1 
ATOM   7983  N  NE2  . GLN B 1 258 ? 64.292  28.071  -8.096  1.00 2.00  ? 289 GLN B NE2  1 
ATOM   7984  H  H    . GLN B 1 258 ? 62.129  25.046  -13.088 1.00 17.00 ? 289 GLN B H    1 
ATOM   7985  H  HE21 . GLN B 1 258 ? 64.874  28.828  -7.910  1.00 17.00 ? 289 GLN B HE21 1 
ATOM   7986  H  HE22 . GLN B 1 258 ? 64.085  27.395  -7.454  1.00 17.00 ? 289 GLN B HE22 1 
ATOM   7987  N  N    . GLU B 1 259 ? 62.635  29.060  -13.094 1.00 4.41  ? 290 GLU B N    1 
ATOM   7988  C  CA   . GLU B 1 259 ? 63.344  30.086  -13.877 1.00 7.63  ? 290 GLU B CA   1 
ATOM   7989  C  C    . GLU B 1 259 ? 64.879  30.324  -13.732 1.00 5.01  ? 290 GLU B C    1 
ATOM   7990  O  O    . GLU B 1 259 ? 65.519  30.828  -14.664 1.00 4.62  ? 290 GLU B O    1 
ATOM   7991  C  CB   . GLU B 1 259 ? 62.585  31.421  -13.763 1.00 10.30 ? 290 GLU B CB   1 
ATOM   7992  C  CG   . GLU B 1 259 ? 62.529  32.185  -15.076 1.00 17.02 ? 290 GLU B CG   1 
ATOM   7993  C  CD   . GLU B 1 259 ? 61.886  33.572  -14.976 1.00 23.57 ? 290 GLU B CD   1 
ATOM   7994  O  OE1  . GLU B 1 259 ? 62.227  34.351  -14.042 1.00 29.12 ? 290 GLU B OE1  1 
ATOM   7995  O  OE2  . GLU B 1 259 ? 61.065  33.904  -15.865 1.00 23.75 ? 290 GLU B OE2  1 
ATOM   7996  H  H    . GLU B 1 259 ? 61.725  29.250  -12.787 1.00 17.00 ? 290 GLU B H    1 
ATOM   7997  N  N    . VAL B 1 260 ? 65.462  29.988  -12.586 1.00 2.73  ? 291 VAL B N    1 
ATOM   7998  C  CA   . VAL B 1 260 ? 66.895  30.198  -12.407 1.00 3.84  ? 291 VAL B CA   1 
ATOM   7999  C  C    . VAL B 1 260 ? 67.723  29.030  -12.970 1.00 2.93  ? 291 VAL B C    1 
ATOM   8000  O  O    . VAL B 1 260 ? 68.713  29.254  -13.637 1.00 3.36  ? 291 VAL B O    1 
ATOM   8001  C  CB   . VAL B 1 260 ? 67.257  30.501  -10.903 1.00 2.00  ? 291 VAL B CB   1 
ATOM   8002  C  CG1  . VAL B 1 260 ? 67.383  29.256  -10.099 1.00 2.00  ? 291 VAL B CG1  1 
ATOM   8003  C  CG2  . VAL B 1 260 ? 68.501  31.296  -10.804 1.00 2.00  ? 291 VAL B CG2  1 
ATOM   8004  H  H    . VAL B 1 260 ? 64.911  29.592  -11.873 1.00 17.00 ? 291 VAL B H    1 
ATOM   8005  N  N    . PHE B 1 261 ? 67.240  27.804  -12.793 1.00 2.00  ? 292 PHE B N    1 
ATOM   8006  C  CA   . PHE B 1 261 ? 67.902  26.575  -13.235 1.00 2.00  ? 292 PHE B CA   1 
ATOM   8007  C  C    . PHE B 1 261 ? 68.664  26.538  -14.551 1.00 2.53  ? 292 PHE B C    1 
ATOM   8008  O  O    . PHE B 1 261 ? 69.284  25.516  -14.861 1.00 2.07  ? 292 PHE B O    1 
ATOM   8009  C  CB   . PHE B 1 261 ? 66.894  25.423  -13.260 1.00 2.00  ? 292 PHE B CB   1 
ATOM   8010  C  CG   . PHE B 1 261 ? 66.467  24.968  -11.916 1.00 2.00  ? 292 PHE B CG   1 
ATOM   8011  C  CD1  . PHE B 1 261 ? 66.755  25.723  -10.789 1.00 2.83  ? 292 PHE B CD1  1 
ATOM   8012  C  CD2  . PHE B 1 261 ? 65.781  23.789  -11.768 1.00 2.00  ? 292 PHE B CD2  1 
ATOM   8013  C  CE1  . PHE B 1 261 ? 66.364  25.313  -9.529  1.00 2.08  ? 292 PHE B CE1  1 
ATOM   8014  C  CE2  . PHE B 1 261 ? 65.385  23.369  -10.517 1.00 2.95  ? 292 PHE B CE2  1 
ATOM   8015  C  CZ   . PHE B 1 261 ? 65.676  24.134  -9.388  1.00 2.56  ? 292 PHE B CZ   1 
ATOM   8016  H  H    . PHE B 1 261 ? 66.354  27.725  -12.374 1.00 17.00 ? 292 PHE B H    1 
ATOM   8017  N  N    . GLY B 1 262 ? 68.532  27.563  -15.383 1.00 2.95  ? 293 GLY B N    1 
ATOM   8018  C  CA   . GLY B 1 262 ? 69.267  27.566  -16.642 1.00 6.43  ? 293 GLY B CA   1 
ATOM   8019  C  C    . GLY B 1 262 ? 70.683  28.152  -16.505 1.00 8.55  ? 293 GLY B C    1 
ATOM   8020  O  O    . GLY B 1 262 ? 71.547  28.014  -17.397 1.00 8.57  ? 293 GLY B O    1 
ATOM   8021  H  H    . GLY B 1 262 ? 67.948  28.328  -15.195 1.00 17.00 ? 293 GLY B H    1 
ATOM   8022  N  N    . LEU B 1 263 ? 70.935  28.778  -15.356 1.00 8.53  ? 294 LEU B N    1 
ATOM   8023  C  CA   . LEU B 1 263 ? 72.213  29.412  -15.079 1.00 7.11  ? 294 LEU B CA   1 
ATOM   8024  C  C    . LEU B 1 263 ? 73.358  28.469  -14.673 1.00 8.67  ? 294 LEU B C    1 
ATOM   8025  O  O    . LEU B 1 263 ? 74.480  28.948  -14.472 1.00 10.18 ? 294 LEU B O    1 
ATOM   8026  C  CB   . LEU B 1 263 ? 72.016  30.560  -14.076 1.00 5.20  ? 294 LEU B CB   1 
ATOM   8027  C  CG   . LEU B 1 263 ? 70.930  31.561  -14.542 1.00 4.76  ? 294 LEU B CG   1 
ATOM   8028  C  CD1  . LEU B 1 263 ? 70.407  32.399  -13.410 1.00 2.00  ? 294 LEU B CD1  1 
ATOM   8029  C  CD2  . LEU B 1 263 ? 71.415  32.440  -15.685 1.00 3.61  ? 294 LEU B CD2  1 
ATOM   8030  H  H    . LEU B 1 263 ? 70.226  28.829  -14.686 1.00 17.00 ? 294 LEU B H    1 
ATOM   8031  N  N    . VAL B 1 264 ? 73.102  27.151  -14.609 1.00 5.66  ? 295 VAL B N    1 
ATOM   8032  C  CA   . VAL B 1 264 ? 74.132  26.156  -14.265 1.00 4.70  ? 295 VAL B CA   1 
ATOM   8033  C  C    . VAL B 1 264 ? 73.734  24.835  -14.868 1.00 4.39  ? 295 VAL B C    1 
ATOM   8034  O  O    . VAL B 1 264 ? 72.750  24.262  -14.457 1.00 8.53  ? 295 VAL B O    1 
ATOM   8035  C  CB   . VAL B 1 264 ? 74.287  25.934  -12.747 1.00 3.58  ? 295 VAL B CB   1 
ATOM   8036  C  CG1  . VAL B 1 264 ? 75.275  24.834  -12.488 1.00 2.23  ? 295 VAL B CG1  1 
ATOM   8037  C  CG2  . VAL B 1 264 ? 74.796  27.180  -12.081 1.00 4.54  ? 295 VAL B CG2  1 
ATOM   8038  H  H    . VAL B 1 264 ? 72.194  26.828  -14.804 1.00 17.00 ? 295 VAL B H    1 
ATOM   8039  N  N    . PRO B 1 265 ? 74.568  24.269  -15.747 1.00 3.32  ? 296 PRO B N    1 
ATOM   8040  C  CA   . PRO B 1 265 ? 74.332  23.000  -16.434 1.00 2.00  ? 296 PRO B CA   1 
ATOM   8041  C  C    . PRO B 1 265 ? 74.017  21.814  -15.547 1.00 2.00  ? 296 PRO B C    1 
ATOM   8042  O  O    . PRO B 1 265 ? 73.434  20.841  -16.012 1.00 2.00  ? 296 PRO B O    1 
ATOM   8043  C  CB   . PRO B 1 265 ? 75.625  22.792  -17.204 1.00 2.21  ? 296 PRO B CB   1 
ATOM   8044  C  CG   . PRO B 1 265 ? 76.063  24.182  -17.497 1.00 2.72  ? 296 PRO B CG   1 
ATOM   8045  C  CD   . PRO B 1 265 ? 75.866  24.826  -16.149 1.00 3.13  ? 296 PRO B CD   1 
ATOM   8046  N  N    . GLY B 1 266 ? 74.409  21.891  -14.278 1.00 2.00  ? 297 GLY B N    1 
ATOM   8047  C  CA   . GLY B 1 266 ? 74.145  20.802  -13.355 1.00 2.00  ? 297 GLY B CA   1 
ATOM   8048  C  C    . GLY B 1 266 ? 72.660  20.788  -13.102 1.00 2.46  ? 297 GLY B C    1 
ATOM   8049  O  O    . GLY B 1 266 ? 71.977  19.752  -13.190 1.00 3.29  ? 297 GLY B O    1 
ATOM   8050  H  H    . GLY B 1 266 ? 74.881  22.686  -13.970 1.00 17.00 ? 297 GLY B H    1 
ATOM   8051  N  N    . LEU B 1 267 ? 72.161  21.972  -12.782 1.00 2.01  ? 298 LEU B N    1 
ATOM   8052  C  CA   . LEU B 1 267 ? 70.748  22.169  -12.546 1.00 2.58  ? 298 LEU B CA   1 
ATOM   8053  C  C    . LEU B 1 267 ? 70.031  21.633  -13.783 1.00 2.00  ? 298 LEU B C    1 
ATOM   8054  O  O    . LEU B 1 267 ? 69.382  20.580  -13.708 1.00 3.55  ? 298 LEU B O    1 
ATOM   8055  C  CB   . LEU B 1 267 ? 70.467  23.660  -12.334 1.00 2.13  ? 298 LEU B CB   1 
ATOM   8056  C  CG   . LEU B 1 267 ? 70.311  24.201  -10.902 1.00 4.02  ? 298 LEU B CG   1 
ATOM   8057  C  CD1  . LEU B 1 267 ? 70.609  23.145  -9.818  1.00 2.00  ? 298 LEU B CD1  1 
ATOM   8058  C  CD2  . LEU B 1 267 ? 71.171  25.447  -10.749 1.00 3.94  ? 298 LEU B CD2  1 
ATOM   8059  H  H    . LEU B 1 267 ? 72.746  22.751  -12.741 1.00 17.00 ? 298 LEU B H    1 
ATOM   8060  N  N    . MET B 1 268 ? 70.250  22.283  -14.925 1.00 2.00  ? 299 MET B N    1 
ATOM   8061  C  CA   . MET B 1 268 ? 69.655  21.862  -16.198 1.00 2.77  ? 299 MET B CA   1 
ATOM   8062  C  C    . MET B 1 268 ? 69.757  20.354  -16.518 1.00 2.56  ? 299 MET B C    1 
ATOM   8063  O  O    . MET B 1 268 ? 68.974  19.808  -17.299 1.00 2.00  ? 299 MET B O    1 
ATOM   8064  C  CB   . MET B 1 268 ? 70.253  22.652  -17.364 1.00 2.00  ? 299 MET B CB   1 
ATOM   8065  C  CG   . MET B 1 268 ? 69.467  22.519  -18.665 1.00 2.00  ? 299 MET B CG   1 
ATOM   8066  S  SD   . MET B 1 268 ? 67.728  23.069  -18.424 1.00 6.41  ? 299 MET B SD   1 
ATOM   8067  C  CE   . MET B 1 268 ? 68.009  24.826  -18.014 1.00 2.32  ? 299 MET B CE   1 
ATOM   8068  H  H    . MET B 1 268 ? 70.818  23.084  -14.907 1.00 17.00 ? 299 MET B H    1 
ATOM   8069  N  N    . MET B 1 269 ? 70.749  19.692  -15.954 1.00 4.23  ? 300 MET B N    1 
ATOM   8070  C  CA   . MET B 1 269 ? 70.913  18.260  -16.184 1.00 5.52  ? 300 MET B CA   1 
ATOM   8071  C  C    . MET B 1 269 ? 69.816  17.561  -15.409 1.00 5.91  ? 300 MET B C    1 
ATOM   8072  O  O    . MET B 1 269 ? 69.134  16.695  -15.956 1.00 4.88  ? 300 MET B O    1 
ATOM   8073  C  CB   . MET B 1 269 ? 72.301  17.788  -15.699 1.00 6.11  ? 300 MET B CB   1 
ATOM   8074  C  CG   . MET B 1 269 ? 72.570  16.288  -15.693 1.00 2.63  ? 300 MET B CG   1 
ATOM   8075  S  SD   . MET B 1 269 ? 73.231  15.809  -14.045 1.00 2.73  ? 300 MET B SD   1 
ATOM   8076  C  CE   . MET B 1 269 ? 73.237  14.024  -14.140 1.00 2.00  ? 300 MET B CE   1 
ATOM   8077  H  H    . MET B 1 269 ? 71.397  20.144  -15.374 1.00 17.00 ? 300 MET B H    1 
ATOM   8078  N  N    . TYR B 1 270 ? 69.618  17.982  -14.153 1.00 6.13  ? 301 TYR B N    1 
ATOM   8079  C  CA   . TYR B 1 270 ? 68.608  17.382  -13.266 1.00 5.77  ? 301 TYR B CA   1 
ATOM   8080  C  C    . TYR B 1 270 ? 67.156  17.645  -13.680 1.00 6.85  ? 301 TYR B C    1 
ATOM   8081  O  O    . TYR B 1 270 ? 66.266  16.809  -13.457 1.00 6.84  ? 301 TYR B O    1 
ATOM   8082  C  CB   . TYR B 1 270 ? 68.825  17.802  -11.810 1.00 2.53  ? 301 TYR B CB   1 
ATOM   8083  C  CG   . TYR B 1 270 ? 69.498  16.747  -10.946 1.00 4.07  ? 301 TYR B CG   1 
ATOM   8084  C  CD1  . TYR B 1 270 ? 69.211  15.380  -11.086 1.00 2.14  ? 301 TYR B CD1  1 
ATOM   8085  C  CD2  . TYR B 1 270 ? 70.450  17.118  -10.001 1.00 4.14  ? 301 TYR B CD2  1 
ATOM   8086  C  CE1  . TYR B 1 270 ? 69.867  14.427  -10.293 1.00 2.86  ? 301 TYR B CE1  1 
ATOM   8087  C  CE2  . TYR B 1 270 ? 71.106  16.174  -9.219  1.00 2.87  ? 301 TYR B CE2  1 
ATOM   8088  C  CZ   . TYR B 1 270 ? 70.818  14.850  -9.360  1.00 3.97  ? 301 TYR B CZ   1 
ATOM   8089  O  OH   . TYR B 1 270 ? 71.498  13.974  -8.538  1.00 8.21  ? 301 TYR B OH   1 
ATOM   8090  H  H    . TYR B 1 270 ? 70.182  18.716  -13.813 1.00 17.00 ? 301 TYR B H    1 
ATOM   8091  H  HH   . TYR B 1 270 ? 72.142  14.462  -8.009  1.00 17.00 ? 301 TYR B HH   1 
ATOM   8092  N  N    . ALA B 1 271 ? 66.899  18.815  -14.244 1.00 4.80  ? 302 ALA B N    1 
ATOM   8093  C  CA   . ALA B 1 271 ? 65.569  19.108  -14.697 1.00 2.01  ? 302 ALA B CA   1 
ATOM   8094  C  C    . ALA B 1 271 ? 65.308  18.151  -15.851 1.00 2.00  ? 302 ALA B C    1 
ATOM   8095  O  O    . ALA B 1 271 ? 64.293  17.488  -15.887 1.00 4.30  ? 302 ALA B O    1 
ATOM   8096  C  CB   . ALA B 1 271 ? 65.488  20.526  -15.154 1.00 3.14  ? 302 ALA B CB   1 
ATOM   8097  H  H    . ALA B 1 271 ? 67.638  19.454  -14.349 1.00 17.00 ? 302 ALA B H    1 
ATOM   8098  N  N    . THR B 1 272 ? 66.257  18.019  -16.760 1.00 2.00  ? 303 THR B N    1 
ATOM   8099  C  CA   . THR B 1 272 ? 66.065  17.135  -17.879 1.00 2.00  ? 303 THR B CA   1 
ATOM   8100  C  C    . THR B 1 272 ? 65.840  15.725  -17.367 1.00 2.00  ? 303 THR B C    1 
ATOM   8101  O  O    . THR B 1 272 ? 65.142  14.959  -17.999 1.00 2.30  ? 303 THR B O    1 
ATOM   8102  C  CB   . THR B 1 272 ? 67.248  17.193  -18.874 1.00 3.78  ? 303 THR B CB   1 
ATOM   8103  O  OG1  . THR B 1 272 ? 67.386  18.525  -19.382 1.00 2.01  ? 303 THR B OG1  1 
ATOM   8104  C  CG2  . THR B 1 272 ? 67.041  16.245  -20.044 1.00 2.00  ? 303 THR B CG2  1 
ATOM   8105  H  H    . THR B 1 272 ? 67.088  18.531  -16.701 1.00 17.00 ? 303 THR B H    1 
ATOM   8106  H  HG1  . THR B 1 272 ? 67.949  19.028  -18.779 1.00 17.00 ? 303 THR B HG1  1 
ATOM   8107  N  N    . ILE B 1 273 ? 66.372  15.396  -16.195 1.00 2.90  ? 304 ILE B N    1 
ATOM   8108  C  CA   . ILE B 1 273 ? 66.173  14.054  -15.629 1.00 3.91  ? 304 ILE B CA   1 
ATOM   8109  C  C    . ILE B 1 273 ? 64.666  13.903  -15.348 1.00 6.00  ? 304 ILE B C    1 
ATOM   8110  O  O    . ILE B 1 273 ? 63.957  13.102  -15.990 1.00 5.09  ? 304 ILE B O    1 
ATOM   8111  C  CB   . ILE B 1 273 ? 66.918  13.850  -14.257 1.00 4.26  ? 304 ILE B CB   1 
ATOM   8112  C  CG1  . ILE B 1 273 ? 68.438  14.008  -14.390 1.00 2.74  ? 304 ILE B CG1  1 
ATOM   8113  C  CG2  . ILE B 1 273 ? 66.547  12.486  -13.660 1.00 2.98  ? 304 ILE B CG2  1 
ATOM   8114  C  CD1  . ILE B 1 273 ? 69.103  12.908  -15.208 1.00 3.74  ? 304 ILE B CD1  1 
ATOM   8115  H  H    . ILE B 1 273 ? 66.920  16.048  -15.720 1.00 17.00 ? 304 ILE B H    1 
ATOM   8116  N  N    . TRP B 1 274 ? 64.185  14.723  -14.407 1.00 5.77  ? 305 TRP B N    1 
ATOM   8117  C  CA   . TRP B 1 274 ? 62.793  14.713  -13.973 1.00 2.83  ? 305 TRP B CA   1 
ATOM   8118  C  C    . TRP B 1 274 ? 61.817  14.890  -15.129 1.00 3.37  ? 305 TRP B C    1 
ATOM   8119  O  O    . TRP B 1 274 ? 60.821  14.165  -15.201 1.00 3.76  ? 305 TRP B O    1 
ATOM   8120  C  CB   . TRP B 1 274 ? 62.573  15.784  -12.921 1.00 3.73  ? 305 TRP B CB   1 
ATOM   8121  C  CG   . TRP B 1 274 ? 63.353  15.592  -11.662 1.00 4.43  ? 305 TRP B CG   1 
ATOM   8122  C  CD1  . TRP B 1 274 ? 64.463  16.296  -11.237 1.00 4.14  ? 305 TRP B CD1  1 
ATOM   8123  C  CD2  . TRP B 1 274 ? 63.067  14.649  -10.644 1.00 5.43  ? 305 TRP B CD2  1 
ATOM   8124  N  NE1  . TRP B 1 274 ? 64.872  15.834  -10.009 1.00 3.48  ? 305 TRP B NE1  1 
ATOM   8125  C  CE2  . TRP B 1 274 ? 64.025  14.823  -9.624  1.00 6.40  ? 305 TRP B CE2  1 
ATOM   8126  C  CE3  . TRP B 1 274 ? 62.091  13.659  -10.492 1.00 5.71  ? 305 TRP B CE3  1 
ATOM   8127  C  CZ2  . TRP B 1 274 ? 64.027  14.041  -8.473  1.00 6.99  ? 305 TRP B CZ2  1 
ATOM   8128  C  CZ3  . TRP B 1 274 ? 62.099  12.878  -9.342  1.00 4.99  ? 305 TRP B CZ3  1 
ATOM   8129  C  CH2  . TRP B 1 274 ? 63.055  13.072  -8.351  1.00 4.69  ? 305 TRP B CH2  1 
ATOM   8130  H  H    . TRP B 1 274 ? 64.802  15.376  -14.007 1.00 17.00 ? 305 TRP B H    1 
ATOM   8131  H  HE1  . TRP B 1 274 ? 65.692  16.049  -9.521  1.00 17.00 ? 305 TRP B HE1  1 
ATOM   8132  N  N    . LEU B 1 275 ? 62.101  15.824  -16.041 1.00 2.00  ? 306 LEU B N    1 
ATOM   8133  C  CA   . LEU B 1 275 ? 61.210  16.037  -17.180 1.00 3.76  ? 306 LEU B CA   1 
ATOM   8134  C  C    . LEU B 1 275 ? 60.935  14.677  -17.780 1.00 2.00  ? 306 LEU B C    1 
ATOM   8135  O  O    . LEU B 1 275 ? 59.813  14.266  -17.994 1.00 2.00  ? 306 LEU B O    1 
ATOM   8136  C  CB   . LEU B 1 275 ? 61.852  16.934  -18.242 1.00 3.98  ? 306 LEU B CB   1 
ATOM   8137  C  CG   . LEU B 1 275 ? 61.223  16.902  -19.646 1.00 3.76  ? 306 LEU B CG   1 
ATOM   8138  C  CD1  . LEU B 1 275 ? 59.999  17.801  -19.736 1.00 2.00  ? 306 LEU B CD1  1 
ATOM   8139  C  CD2  . LEU B 1 275 ? 62.246  17.361  -20.640 1.00 4.61  ? 306 LEU B CD2  1 
ATOM   8140  H  H    . LEU B 1 275 ? 62.917  16.339  -15.956 1.00 17.00 ? 306 LEU B H    1 
ATOM   8141  N  N    . ARG B 1 276 ? 61.988  13.942  -17.977 1.00 3.50  ? 307 ARG B N    1 
ATOM   8142  C  CA   . ARG B 1 276 ? 61.814  12.637  -18.533 1.00 7.75  ? 307 ARG B CA   1 
ATOM   8143  C  C    . ARG B 1 276 ? 61.073  11.723  -17.547 1.00 8.39  ? 307 ARG B C    1 
ATOM   8144  O  O    . ARG B 1 276 ? 60.173  10.966  -17.970 1.00 8.72  ? 307 ARG B O    1 
ATOM   8145  C  CB   . ARG B 1 276 ? 63.173  12.074  -18.962 1.00 8.38  ? 307 ARG B CB   1 
ATOM   8146  C  CG   . ARG B 1 276 ? 63.899  13.030  -19.922 1.00 10.39 ? 307 ARG B CG   1 
ATOM   8147  C  CD   . ARG B 1 276 ? 65.423  12.834  -19.861 1.00 11.28 ? 307 ARG B CD   1 
ATOM   8148  N  NE   . ARG B 1 276 ? 65.912  11.954  -20.910 1.00 10.15 ? 307 ARG B NE   1 
ATOM   8149  C  CZ   . ARG B 1 276 ? 67.024  12.184  -21.593 1.00 7.50  ? 307 ARG B CZ   1 
ATOM   8150  N  NH1  . ARG B 1 276 ? 67.739  13.248  -21.305 1.00 6.88  ? 307 ARG B NH1  1 
ATOM   8151  N  NH2  . ARG B 1 276 ? 67.368  11.407  -22.619 1.00 11.13 ? 307 ARG B NH2  1 
ATOM   8152  H  H    . ARG B 1 276 ? 62.890  14.249  -17.740 1.00 17.00 ? 307 ARG B H    1 
ATOM   8153  H  HE   . ARG B 1 276 ? 65.396  11.148  -21.118 1.00 17.00 ? 307 ARG B HE   1 
ATOM   8154  H  HH11 . ARG B 1 276 ? 67.456  13.879  -20.585 1.00 17.00 ? 307 ARG B HH11 1 
ATOM   8155  H  HH12 . ARG B 1 276 ? 68.579  13.422  -21.818 1.00 17.00 ? 307 ARG B HH12 1 
ATOM   8156  H  HH21 . ARG B 1 276 ? 66.786  10.636  -22.879 1.00 17.00 ? 307 ARG B HH21 1 
ATOM   8157  H  HH22 . ARG B 1 276 ? 68.212  11.579  -23.129 1.00 17.00 ? 307 ARG B HH22 1 
ATOM   8158  N  N    . GLU B 1 277 ? 61.386  11.806  -16.250 1.00 7.18  ? 308 GLU B N    1 
ATOM   8159  C  CA   . GLU B 1 277 ? 60.695  10.929  -15.304 1.00 8.27  ? 308 GLU B CA   1 
ATOM   8160  C  C    . GLU B 1 277 ? 59.173  11.092  -15.397 1.00 10.61 ? 308 GLU B C    1 
ATOM   8161  O  O    . GLU B 1 277 ? 58.450  10.093  -15.457 1.00 12.85 ? 308 GLU B O    1 
ATOM   8162  C  CB   . GLU B 1 277 ? 61.182  11.089  -13.861 1.00 6.01  ? 308 GLU B CB   1 
ATOM   8163  C  CG   . GLU B 1 277 ? 60.551  10.074  -12.878 1.00 5.34  ? 308 GLU B CG   1 
ATOM   8164  C  CD   . GLU B 1 277 ? 60.907  8.576   -13.160 1.00 8.03  ? 308 GLU B CD   1 
ATOM   8165  O  OE1  . GLU B 1 277 ? 61.049  8.202   -14.341 1.00 8.13  ? 308 GLU B OE1  1 
ATOM   8166  O  OE2  . GLU B 1 277 ? 61.041  7.756   -12.210 1.00 3.34  ? 308 GLU B OE2  1 
ATOM   8167  H  H    . GLU B 1 277 ? 62.076  12.434  -15.966 1.00 17.00 ? 308 GLU B H    1 
ATOM   8168  N  N    . HIS B 1 278 ? 58.687  12.334  -15.469 1.00 9.37  ? 309 HIS B N    1 
ATOM   8169  C  CA   . HIS B 1 278 ? 57.246  12.599  -15.593 1.00 6.34  ? 309 HIS B CA   1 
ATOM   8170  C  C    . HIS B 1 278 ? 56.663  11.740  -16.708 1.00 3.92  ? 309 HIS B C    1 
ATOM   8171  O  O    . HIS B 1 278 ? 55.949  10.795  -16.440 1.00 4.13  ? 309 HIS B O    1 
ATOM   8172  C  CB   . HIS B 1 278 ? 56.981  14.080  -15.916 1.00 11.16 ? 309 HIS B CB   1 
ATOM   8173  C  CG   . HIS B 1 278 ? 55.532  14.468  -15.839 1.00 10.96 ? 309 HIS B CG   1 
ATOM   8174  N  ND1  . HIS B 1 278 ? 54.923  14.829  -14.653 1.00 7.79  ? 309 HIS B ND1  1 
ATOM   8175  C  CD2  . HIS B 1 278 ? 54.562  14.511  -16.787 1.00 9.90  ? 309 HIS B CD2  1 
ATOM   8176  C  CE1  . HIS B 1 278 ? 53.645  15.072  -14.869 1.00 6.18  ? 309 HIS B CE1  1 
ATOM   8177  N  NE2  . HIS B 1 278 ? 53.400  14.884  -16.155 1.00 7.97  ? 309 HIS B NE2  1 
ATOM   8178  H  H    . HIS B 1 278 ? 59.325  13.075  -15.467 1.00 17.00 ? 309 HIS B H    1 
ATOM   8179  H  HD1  . HIS B 1 278 ? 55.412  14.816  -13.819 1.00 17.00 ? 309 HIS B HD1  1 
ATOM   8180  H  HE2  . HIS B 1 278 ? 52.529  14.979  -16.614 1.00 17.00 ? 309 HIS B HE2  1 
ATOM   8181  N  N    . GLN B 1 279 ? 57.007  12.032  -17.952 1.00 2.00  ? 310 GLN B N    1 
ATOM   8182  C  CA   . GLN B 1 279 ? 56.512  11.246  -19.073 1.00 2.40  ? 310 GLN B CA   1 
ATOM   8183  C  C    . GLN B 1 279 ? 56.557  9.764   -18.787 1.00 2.62  ? 310 GLN B C    1 
ATOM   8184  O  O    . GLN B 1 279 ? 55.544  9.103   -18.891 1.00 3.85  ? 310 GLN B O    1 
ATOM   8185  C  CB   . GLN B 1 279 ? 57.314  11.517  -20.345 1.00 2.00  ? 310 GLN B CB   1 
ATOM   8186  C  CG   . GLN B 1 279 ? 56.831  12.664  -21.119 1.00 2.61  ? 310 GLN B CG   1 
ATOM   8187  C  CD   . GLN B 1 279 ? 56.991  13.970  -20.379 1.00 5.28  ? 310 GLN B CD   1 
ATOM   8188  O  OE1  . GLN B 1 279 ? 56.462  14.178  -19.249 1.00 3.16  ? 310 GLN B OE1  1 
ATOM   8189  N  NE2  . GLN B 1 279 ? 57.707  14.884  -21.017 1.00 6.73  ? 310 GLN B NE2  1 
ATOM   8190  H  H    . GLN B 1 279 ? 57.617  12.780  -18.133 1.00 17.00 ? 310 GLN B H    1 
ATOM   8191  H  HE21 . GLN B 1 279 ? 57.820  15.773  -20.627 1.00 17.00 ? 310 GLN B HE21 1 
ATOM   8192  H  HE22 . GLN B 1 279 ? 58.087  14.649  -21.875 1.00 17.00 ? 310 GLN B HE22 1 
ATOM   8193  N  N    . ARG B 1 280 ? 57.714  9.256   -18.378 1.00 3.62  ? 311 ARG B N    1 
ATOM   8194  C  CA   . ARG B 1 280 ? 57.837  7.835   -18.113 1.00 5.40  ? 311 ARG B CA   1 
ATOM   8195  C  C    . ARG B 1 280 ? 56.712  7.379   -17.222 1.00 3.99  ? 311 ARG B C    1 
ATOM   8196  O  O    . ARG B 1 280 ? 56.155  6.299   -17.447 1.00 5.88  ? 311 ARG B O    1 
ATOM   8197  C  CB   . ARG B 1 280 ? 59.196  7.454   -17.485 1.00 5.94  ? 311 ARG B CB   1 
ATOM   8198  C  CG   . ARG B 1 280 ? 59.246  5.957   -17.116 1.00 5.39  ? 311 ARG B CG   1 
ATOM   8199  C  CD   . ARG B 1 280 ? 60.451  5.562   -16.326 1.00 2.72  ? 311 ARG B CD   1 
ATOM   8200  N  NE   . ARG B 1 280 ? 60.076  4.660   -15.249 1.00 2.00  ? 311 ARG B NE   1 
ATOM   8201  C  CZ   . ARG B 1 280 ? 59.492  5.049   -14.117 1.00 3.28  ? 311 ARG B CZ   1 
ATOM   8202  N  NH1  . ARG B 1 280 ? 59.221  6.320   -13.917 1.00 2.03  ? 311 ARG B NH1  1 
ATOM   8203  N  NH2  . ARG B 1 280 ? 59.178  4.162   -13.172 1.00 4.48  ? 311 ARG B NH2  1 
ATOM   8204  H  H    . ARG B 1 280 ? 58.489  9.844   -18.233 1.00 17.00 ? 311 ARG B H    1 
ATOM   8205  H  HE   . ARG B 1 280 ? 60.265  3.705   -15.367 1.00 17.00 ? 311 ARG B HE   1 
ATOM   8206  H  HH11 . ARG B 1 280 ? 59.445  6.996   -14.615 1.00 17.00 ? 311 ARG B HH11 1 
ATOM   8207  H  HH12 . ARG B 1 280 ? 58.782  6.607   -13.066 1.00 17.00 ? 311 ARG B HH12 1 
ATOM   8208  H  HH21 . ARG B 1 280 ? 59.378  3.192   -13.313 1.00 17.00 ? 311 ARG B HH21 1 
ATOM   8209  H  HH22 . ARG B 1 280 ? 58.732  4.464   -12.329 1.00 17.00 ? 311 ARG B HH22 1 
ATOM   8210  N  N    . VAL B 1 281 ? 56.374  8.187   -16.220 1.00 2.49  ? 312 VAL B N    1 
ATOM   8211  C  CA   . VAL B 1 281 ? 55.281  7.813   -15.340 1.00 4.05  ? 312 VAL B CA   1 
ATOM   8212  C  C    . VAL B 1 281 ? 54.020  7.885   -16.161 1.00 3.14  ? 312 VAL B C    1 
ATOM   8213  O  O    . VAL B 1 281 ? 53.335  6.877   -16.306 1.00 4.62  ? 312 VAL B O    1 
ATOM   8214  C  CB   . VAL B 1 281 ? 55.135  8.704   -14.101 1.00 4.93  ? 312 VAL B CB   1 
ATOM   8215  C  CG1  . VAL B 1 281 ? 53.941  8.228   -13.280 1.00 4.33  ? 312 VAL B CG1  1 
ATOM   8216  C  CG2  . VAL B 1 281 ? 56.406  8.634   -13.237 1.00 5.03  ? 312 VAL B CG2  1 
ATOM   8217  H  H    . VAL B 1 281 ? 56.858  9.028   -16.081 1.00 17.00 ? 312 VAL B H    1 
ATOM   8218  N  N    . CYS B 1 282 ? 53.784  9.045   -16.766 1.00 2.00  ? 313 CYS B N    1 
ATOM   8219  C  CA   . CYS B 1 282 ? 52.627  9.287   -17.618 1.00 2.00  ? 313 CYS B CA   1 
ATOM   8220  C  C    . CYS B 1 282 ? 52.235  8.126   -18.524 1.00 2.00  ? 313 CYS B C    1 
ATOM   8221  O  O    . CYS B 1 282 ? 51.061  7.880   -18.753 1.00 3.89  ? 313 CYS B O    1 
ATOM   8222  C  CB   . CYS B 1 282 ? 52.862  10.508  -18.512 1.00 3.70  ? 313 CYS B CB   1 
ATOM   8223  S  SG   . CYS B 1 282 ? 52.724  12.183  -17.735 1.00 5.84  ? 313 CYS B SG   1 
ATOM   8224  H  H    . CYS B 1 282 ? 54.417  9.773   -16.644 1.00 17.00 ? 313 CYS B H    1 
ATOM   8225  N  N    . ASP B 1 283 ? 53.205  7.415   -19.052 1.00 2.00  ? 314 ASP B N    1 
ATOM   8226  C  CA   . ASP B 1 283 ? 52.916  6.304   -19.940 1.00 2.37  ? 314 ASP B CA   1 
ATOM   8227  C  C    . ASP B 1 283 ? 52.421  5.110   -19.166 1.00 4.01  ? 314 ASP B C    1 
ATOM   8228  O  O    . ASP B 1 283 ? 51.530  4.383   -19.618 1.00 4.34  ? 314 ASP B O    1 
ATOM   8229  C  CB   . ASP B 1 283 ? 54.168  5.914   -20.719 1.00 2.86  ? 314 ASP B CB   1 
ATOM   8230  C  CG   . ASP B 1 283 ? 54.697  7.042   -21.594 1.00 2.04  ? 314 ASP B CG   1 
ATOM   8231  O  OD1  . ASP B 1 283 ? 53.903  7.627   -22.383 1.00 4.16  ? 314 ASP B OD1  1 
ATOM   8232  O  OD2  . ASP B 1 283 ? 55.913  7.324   -21.485 1.00 2.00  ? 314 ASP B OD2  1 
ATOM   8233  H  H    . ASP B 1 283 ? 54.136  7.649   -18.847 1.00 17.00 ? 314 ASP B H    1 
ATOM   8234  N  N    . ILE B 1 284 ? 53.059  4.883   -18.022 1.00 5.24  ? 315 ILE B N    1 
ATOM   8235  C  CA   . ILE B 1 284 ? 52.718  3.790   -17.122 1.00 6.36  ? 315 ILE B CA   1 
ATOM   8236  C  C    . ILE B 1 284 ? 51.283  4.045   -16.687 1.00 5.71  ? 315 ILE B C    1 
ATOM   8237  O  O    . ILE B 1 284 ? 50.433  3.183   -16.748 1.00 10.49 ? 315 ILE B O    1 
ATOM   8238  C  CB   . ILE B 1 284 ? 53.628  3.814   -15.888 1.00 5.99  ? 315 ILE B CB   1 
ATOM   8239  C  CG1  . ILE B 1 284 ? 55.092  3.804   -16.327 1.00 4.73  ? 315 ILE B CG1  1 
ATOM   8240  C  CG2  . ILE B 1 284 ? 53.297  2.630   -14.960 1.00 8.32  ? 315 ILE B CG2  1 
ATOM   8241  C  CD1  . ILE B 1 284 ? 56.043  4.112   -15.220 1.00 7.32  ? 315 ILE B CD1  1 
ATOM   8242  H  H    . ILE B 1 284 ? 53.787  5.489   -17.767 1.00 17.00 ? 315 ILE B H    1 
ATOM   8243  N  N    . LEU B 1 285 ? 51.028  5.251   -16.241 1.00 3.78  ? 316 LEU B N    1 
ATOM   8244  C  CA   . LEU B 1 285 ? 49.708  5.631   -15.836 1.00 3.11  ? 316 LEU B CA   1 
ATOM   8245  C  C    . LEU B 1 285 ? 48.807  5.460   -17.038 1.00 2.00  ? 316 LEU B C    1 
ATOM   8246  O  O    . LEU B 1 285 ? 47.765  4.834   -16.939 1.00 2.64  ? 316 LEU B O    1 
ATOM   8247  C  CB   . LEU B 1 285 ? 49.710  7.091   -15.347 1.00 2.52  ? 316 LEU B CB   1 
ATOM   8248  C  CG   . LEU B 1 285 ? 49.595  7.252   -13.829 1.00 2.14  ? 316 LEU B CG   1 
ATOM   8249  C  CD1  . LEU B 1 285 ? 50.245  6.088   -13.084 1.00 2.00  ? 316 LEU B CD1  1 
ATOM   8250  C  CD2  . LEU B 1 285 ? 50.124  8.606   -13.413 1.00 2.00  ? 316 LEU B CD2  1 
ATOM   8251  H  H    . LEU B 1 285 ? 51.764  5.888   -16.182 1.00 17.00 ? 316 LEU B H    1 
ATOM   8252  N  N    . LYS B 1 286 ? 49.278  5.875   -18.200 1.00 2.00  ? 317 LYS B N    1 
ATOM   8253  C  CA   . LYS B 1 286 ? 48.461  5.800   -19.408 1.00 3.78  ? 317 LYS B CA   1 
ATOM   8254  C  C    . LYS B 1 286 ? 48.075  4.417   -19.869 1.00 2.49  ? 317 LYS B C    1 
ATOM   8255  O  O    . LYS B 1 286 ? 47.191  4.276   -20.700 1.00 2.00  ? 317 LYS B O    1 
ATOM   8256  C  CB   . LYS B 1 286 ? 49.071  6.578   -20.572 1.00 4.47  ? 317 LYS B CB   1 
ATOM   8257  C  CG   . LYS B 1 286 ? 48.076  6.829   -21.685 1.00 8.61  ? 317 LYS B CG   1 
ATOM   8258  C  CD   . LYS B 1 286 ? 48.580  6.353   -23.037 1.00 17.31 ? 317 LYS B CD   1 
ATOM   8259  C  CE   . LYS B 1 286 ? 48.855  4.839   -23.054 1.00 21.95 ? 317 LYS B CE   1 
ATOM   8260  N  NZ   . LYS B 1 286 ? 49.747  4.324   -24.173 1.00 23.55 ? 317 LYS B NZ   1 
ATOM   8261  H  H    . LYS B 1 286 ? 50.175  6.253   -18.275 1.00 17.00 ? 317 LYS B H    1 
ATOM   8262  H  HZ1  . LYS B 1 286 ? 50.668  4.806   -24.142 1.00 17.00 ? 317 LYS B HZ1  1 
ATOM   8263  H  HZ2  . LYS B 1 286 ? 49.882  3.300   -24.041 1.00 17.00 ? 317 LYS B HZ2  1 
ATOM   8264  H  HZ3  . LYS B 1 286 ? 49.284  4.496   -25.090 1.00 17.00 ? 317 LYS B HZ3  1 
ATOM   8265  N  N    . GLN B 1 287 ? 48.752  3.394   -19.377 1.00 4.78  ? 318 GLN B N    1 
ATOM   8266  C  CA   . GLN B 1 287 ? 48.385  2.046   -19.771 1.00 5.38  ? 318 GLN B CA   1 
ATOM   8267  C  C    . GLN B 1 287 ? 47.867  1.243   -18.595 1.00 5.59  ? 318 GLN B C    1 
ATOM   8268  O  O    . GLN B 1 287 ? 47.830  0.018   -18.602 1.00 6.41  ? 318 GLN B O    1 
ATOM   8269  C  CB   . GLN B 1 287 ? 49.506  1.329   -20.506 1.00 8.99  ? 318 GLN B CB   1 
ATOM   8270  C  CG   . GLN B 1 287 ? 48.999  0.187   -21.400 1.00 13.23 ? 318 GLN B CG   1 
ATOM   8271  C  CD   . GLN B 1 287 ? 47.527  0.324   -21.802 1.00 14.29 ? 318 GLN B CD   1 
ATOM   8272  O  OE1  . GLN B 1 287 ? 46.740  -0.610  -21.617 1.00 15.02 ? 318 GLN B OE1  1 
ATOM   8273  N  NE2  . GLN B 1 287 ? 47.153  1.481   -22.344 1.00 13.19 ? 318 GLN B NE2  1 
ATOM   8274  H  H    . GLN B 1 287 ? 49.522  3.534   -18.778 1.00 17.00 ? 318 GLN B H    1 
ATOM   8275  H  HE21 . GLN B 1 287 ? 46.212  1.574   -22.588 1.00 17.00 ? 318 GLN B HE21 1 
ATOM   8276  H  HE22 . GLN B 1 287 ? 47.819  2.189   -22.468 1.00 17.00 ? 318 GLN B HE22 1 
ATOM   8277  N  N    . GLU B 1 288 ? 47.530  1.976   -17.549 1.00 6.89  ? 319 GLU B N    1 
ATOM   8278  C  CA   . GLU B 1 288 ? 46.914  1.425   -16.356 1.00 6.41  ? 319 GLU B CA   1 
ATOM   8279  C  C    . GLU B 1 288 ? 45.524  2.068   -16.397 1.00 8.53  ? 319 GLU B C    1 
ATOM   8280  O  O    . GLU B 1 288 ? 44.572  1.575   -15.762 1.00 11.23 ? 319 GLU B O    1 
ATOM   8281  C  CB   . GLU B 1 288 ? 47.651  1.871   -15.107 1.00 3.78  ? 319 GLU B CB   1 
ATOM   8282  C  CG   . GLU B 1 288 ? 48.662  0.875   -14.643 1.00 3.64  ? 319 GLU B CG   1 
ATOM   8283  C  CD   . GLU B 1 288 ? 48.002  -0.325  -14.074 1.00 2.23  ? 319 GLU B CD   1 
ATOM   8284  O  OE1  . GLU B 1 288 ? 47.257  -0.158  -13.097 1.00 3.80  ? 319 GLU B OE1  1 
ATOM   8285  O  OE2  . GLU B 1 288 ? 48.207  -1.433  -14.603 1.00 4.69  ? 319 GLU B OE2  1 
ATOM   8286  H  H    . GLU B 1 288 ? 47.759  2.922   -17.565 1.00 17.00 ? 319 GLU B H    1 
ATOM   8287  N  N    . HIS B 1 289 ? 45.435  3.183   -17.136 1.00 4.04  ? 320 HIS B N    1 
ATOM   8288  C  CA   . HIS B 1 289 ? 44.216  3.916   -17.302 1.00 2.00  ? 320 HIS B CA   1 
ATOM   8289  C  C    . HIS B 1 289 ? 44.125  4.425   -18.713 1.00 2.00  ? 320 HIS B C    1 
ATOM   8290  O  O    . HIS B 1 289 ? 44.298  5.617   -18.966 1.00 2.00  ? 320 HIS B O    1 
ATOM   8291  C  CB   . HIS B 1 289 ? 44.149  5.040   -16.281 1.00 2.00  ? 320 HIS B CB   1 
ATOM   8292  C  CG   . HIS B 1 289 ? 44.249  4.549   -14.877 1.00 3.64  ? 320 HIS B CG   1 
ATOM   8293  N  ND1  . HIS B 1 289 ? 45.458  4.361   -14.247 1.00 5.35  ? 320 HIS B ND1  1 
ATOM   8294  C  CD2  . HIS B 1 289 ? 43.304  4.105   -14.014 1.00 5.86  ? 320 HIS B CD2  1 
ATOM   8295  C  CE1  . HIS B 1 289 ? 45.257  3.817   -13.060 1.00 4.60  ? 320 HIS B CE1  1 
ATOM   8296  N  NE2  . HIS B 1 289 ? 43.958  3.655   -12.891 1.00 5.14  ? 320 HIS B NE2  1 
ATOM   8297  H  H    . HIS B 1 289 ? 46.230  3.544   -17.583 1.00 17.00 ? 320 HIS B H    1 
ATOM   8298  H  HD1  . HIS B 1 289 ? 46.335  4.606   -14.608 1.00 17.00 ? 320 HIS B HD1  1 
ATOM   8299  H  HE2  . HIS B 1 289 ? 43.540  3.279   -12.089 1.00 17.00 ? 320 HIS B HE2  1 
ATOM   8300  N  N    . PRO B 1 290 ? 43.837  3.521   -19.654 1.00 2.00  ? 321 PRO B N    1 
ATOM   8301  C  CA   . PRO B 1 290 ? 43.691  3.789   -21.087 1.00 3.47  ? 321 PRO B CA   1 
ATOM   8302  C  C    . PRO B 1 290 ? 42.561  4.763   -21.333 1.00 6.16  ? 321 PRO B C    1 
ATOM   8303  O  O    . PRO B 1 290 ? 42.409  5.318   -22.429 1.00 6.45  ? 321 PRO B O    1 
ATOM   8304  C  CB   . PRO B 1 290 ? 43.341  2.421   -21.651 1.00 3.64  ? 321 PRO B CB   1 
ATOM   8305  C  CG   . PRO B 1 290 ? 42.680  1.742   -20.498 1.00 3.92  ? 321 PRO B CG   1 
ATOM   8306  C  CD   . PRO B 1 290 ? 43.582  2.107   -19.374 1.00 2.41  ? 321 PRO B CD   1 
ATOM   8307  N  N    . GLU B 1 291 ? 41.781  4.972   -20.283 1.00 7.24  ? 322 GLU B N    1 
ATOM   8308  C  CA   . GLU B 1 291 ? 40.662  5.877   -20.324 1.00 6.21  ? 322 GLU B CA   1 
ATOM   8309  C  C    . GLU B 1 291 ? 40.887  7.149   -19.530 1.00 8.00  ? 322 GLU B C    1 
ATOM   8310  O  O    . GLU B 1 291 ? 39.934  7.816   -19.175 1.00 12.35 ? 322 GLU B O    1 
ATOM   8311  C  CB   . GLU B 1 291 ? 39.458  5.151   -19.797 1.00 6.51  ? 322 GLU B CB   1 
ATOM   8312  C  CG   . GLU B 1 291 ? 39.828  3.863   -19.078 1.00 4.57  ? 322 GLU B CG   1 
ATOM   8313  C  CD   . GLU B 1 291 ? 40.380  4.056   -17.680 1.00 3.07  ? 322 GLU B CD   1 
ATOM   8314  O  OE1  . GLU B 1 291 ? 40.019  5.018   -16.976 1.00 4.67  ? 322 GLU B OE1  1 
ATOM   8315  O  OE2  . GLU B 1 291 ? 41.152  3.195   -17.255 1.00 2.04  ? 322 GLU B OE2  1 
ATOM   8316  H  H    . GLU B 1 291 ? 42.002  4.541   -19.449 1.00 17.00 ? 322 GLU B H    1 
ATOM   8317  N  N    . TRP B 1 292 ? 42.124  7.454   -19.158 1.00 10.10 ? 323 TRP B N    1 
ATOM   8318  C  CA   . TRP B 1 292 ? 42.369  8.702   -18.428 1.00 8.83  ? 323 TRP B CA   1 
ATOM   8319  C  C    . TRP B 1 292 ? 42.579  9.805   -19.444 1.00 7.05  ? 323 TRP B C    1 
ATOM   8320  O  O    . TRP B 1 292 ? 42.836  9.530   -20.633 1.00 8.45  ? 323 TRP B O    1 
ATOM   8321  C  CB   . TRP B 1 292 ? 43.562  8.595   -17.465 1.00 9.40  ? 323 TRP B CB   1 
ATOM   8322  C  CG   . TRP B 1 292 ? 43.130  8.169   -16.107 1.00 10.67 ? 323 TRP B CG   1 
ATOM   8323  C  CD1  . TRP B 1 292 ? 41.862  7.831   -15.727 1.00 11.50 ? 323 TRP B CD1  1 
ATOM   8324  C  CD2  . TRP B 1 292 ? 43.946  8.030   -14.941 1.00 11.36 ? 323 TRP B CD2  1 
ATOM   8325  N  NE1  . TRP B 1 292 ? 41.833  7.491   -14.400 1.00 12.28 ? 323 TRP B NE1  1 
ATOM   8326  C  CE2  . TRP B 1 292 ? 43.097  7.606   -13.887 1.00 12.54 ? 323 TRP B CE2  1 
ATOM   8327  C  CE3  . TRP B 1 292 ? 45.311  8.217   -14.678 1.00 11.00 ? 323 TRP B CE3  1 
ATOM   8328  C  CZ2  . TRP B 1 292 ? 43.569  7.374   -12.592 1.00 11.63 ? 323 TRP B CZ2  1 
ATOM   8329  C  CZ3  . TRP B 1 292 ? 45.778  7.983   -13.400 1.00 9.10  ? 323 TRP B CZ3  1 
ATOM   8330  C  CH2  . TRP B 1 292 ? 44.909  7.568   -12.371 1.00 11.75 ? 323 TRP B CH2  1 
ATOM   8331  H  H    . TRP B 1 292 ? 42.890  6.910   -19.426 1.00 17.00 ? 323 TRP B H    1 
ATOM   8332  H  HE1  . TRP B 1 292 ? 41.017  7.235   -13.916 1.00 17.00 ? 323 TRP B HE1  1 
ATOM   8333  N  N    . GLY B 1 293 ? 42.393  11.041  -19.016 1.00 2.55  ? 324 GLY B N    1 
ATOM   8334  C  CA   . GLY B 1 293 ? 42.588  12.130  -19.946 1.00 3.08  ? 324 GLY B CA   1 
ATOM   8335  C  C    . GLY B 1 293 ? 43.870  12.826  -19.575 1.00 4.16  ? 324 GLY B C    1 
ATOM   8336  O  O    . GLY B 1 293 ? 44.361  12.631  -18.450 1.00 5.56  ? 324 GLY B O    1 
ATOM   8337  H  H    . GLY B 1 293 ? 42.146  11.201  -18.085 1.00 17.00 ? 324 GLY B H    1 
ATOM   8338  N  N    . ASP B 1 294 ? 44.371  13.694  -20.453 1.00 2.67  ? 325 ASP B N    1 
ATOM   8339  C  CA   . ASP B 1 294 ? 45.599  14.390  -20.156 1.00 3.33  ? 325 ASP B CA   1 
ATOM   8340  C  C    . ASP B 1 294 ? 45.634  14.972  -18.738 1.00 2.00  ? 325 ASP B C    1 
ATOM   8341  O  O    . ASP B 1 294 ? 46.518  14.636  -17.959 1.00 2.45  ? 325 ASP B O    1 
ATOM   8342  C  CB   . ASP B 1 294 ? 45.871  15.463  -21.204 1.00 5.14  ? 325 ASP B CB   1 
ATOM   8343  C  CG   . ASP B 1 294 ? 47.014  16.424  -20.797 1.00 7.18  ? 325 ASP B CG   1 
ATOM   8344  O  OD1  . ASP B 1 294 ? 48.199  16.010  -20.847 1.00 5.22  ? 325 ASP B OD1  1 
ATOM   8345  O  OD2  . ASP B 1 294 ? 46.712  17.598  -20.452 1.00 5.14  ? 325 ASP B OD2  1 
ATOM   8346  H  H    . ASP B 1 294 ? 43.887  13.836  -21.294 1.00 17.00 ? 325 ASP B H    1 
ATOM   8347  N  N    . GLU B 1 295 ? 44.646  15.778  -18.383 1.00 2.54  ? 326 GLU B N    1 
ATOM   8348  C  CA   . GLU B 1 295 ? 44.642  16.403  -17.074 1.00 3.81  ? 326 GLU B CA   1 
ATOM   8349  C  C    . GLU B 1 295 ? 44.683  15.454  -15.927 1.00 3.73  ? 326 GLU B C    1 
ATOM   8350  O  O    . GLU B 1 295 ? 45.261  15.782  -14.908 1.00 8.73  ? 326 GLU B O    1 
ATOM   8351  C  CB   . GLU B 1 295 ? 43.501  17.398  -16.901 1.00 3.32  ? 326 GLU B CB   1 
ATOM   8352  C  CG   . GLU B 1 295 ? 43.954  18.855  -16.841 1.00 4.04  ? 326 GLU B CG   1 
ATOM   8353  C  CD   . GLU B 1 295 ? 44.351  19.291  -15.426 1.00 7.13  ? 326 GLU B CD   1 
ATOM   8354  O  OE1  . GLU B 1 295 ? 44.479  18.432  -14.545 1.00 6.13  ? 326 GLU B OE1  1 
ATOM   8355  O  OE2  . GLU B 1 295 ? 44.539  20.503  -15.181 1.00 11.30 ? 326 GLU B OE2  1 
ATOM   8356  H  H    . GLU B 1 295 ? 43.918  15.966  -19.006 1.00 17.00 ? 326 GLU B H    1 
ATOM   8357  N  N    . GLN B 1 296 ? 44.152  14.259  -16.075 1.00 2.00  ? 327 GLN B N    1 
ATOM   8358  C  CA   . GLN B 1 296 ? 44.216  13.368  -14.948 1.00 2.50  ? 327 GLN B CA   1 
ATOM   8359  C  C    . GLN B 1 296 ? 45.613  12.798  -14.815 1.00 4.91  ? 327 GLN B C    1 
ATOM   8360  O  O    . GLN B 1 296 ? 46.206  12.803  -13.732 1.00 6.29  ? 327 GLN B O    1 
ATOM   8361  C  CB   . GLN B 1 296 ? 43.221  12.238  -15.093 1.00 7.56  ? 327 GLN B CB   1 
ATOM   8362  C  CG   . GLN B 1 296 ? 43.346  11.246  -13.957 1.00 7.71  ? 327 GLN B CG   1 
ATOM   8363  C  CD   . GLN B 1 296 ? 42.047  10.651  -13.546 1.00 5.12  ? 327 GLN B CD   1 
ATOM   8364  O  OE1  . GLN B 1 296 ? 41.127  10.499  -14.346 1.00 4.06  ? 327 GLN B OE1  1 
ATOM   8365  N  NE2  . GLN B 1 296 ? 41.962  10.292  -12.283 1.00 8.18  ? 327 GLN B NE2  1 
ATOM   8366  H  H    . GLN B 1 296 ? 43.765  13.971  -16.923 1.00 17.00 ? 327 GLN B H    1 
ATOM   8367  H  HE21 . GLN B 1 296 ? 41.115  9.928   -11.966 1.00 17.00 ? 327 GLN B HE21 1 
ATOM   8368  H  HE22 . GLN B 1 296 ? 42.759  10.414  -11.728 1.00 17.00 ? 327 GLN B HE22 1 
ATOM   8369  N  N    . LEU B 1 297 ? 46.131  12.285  -15.929 1.00 5.88  ? 328 LEU B N    1 
ATOM   8370  C  CA   . LEU B 1 297 ? 47.469  11.698  -15.997 1.00 3.79  ? 328 LEU B CA   1 
ATOM   8371  C  C    . LEU B 1 297 ? 48.510  12.678  -15.451 1.00 3.18  ? 328 LEU B C    1 
ATOM   8372  O  O    . LEU B 1 297 ? 49.379  12.305  -14.649 1.00 4.05  ? 328 LEU B O    1 
ATOM   8373  C  CB   . LEU B 1 297 ? 47.782  11.329  -17.451 1.00 2.00  ? 328 LEU B CB   1 
ATOM   8374  C  CG   . LEU B 1 297 ? 47.082  10.077  -17.974 1.00 2.00  ? 328 LEU B CG   1 
ATOM   8375  C  CD1  . LEU B 1 297 ? 47.244  10.021  -19.463 1.00 2.00  ? 328 LEU B CD1  1 
ATOM   8376  C  CD2  . LEU B 1 297 ? 47.646  8.812   -17.309 1.00 2.00  ? 328 LEU B CD2  1 
ATOM   8377  H  H    . LEU B 1 297 ? 45.593  12.329  -16.745 1.00 17.00 ? 328 LEU B H    1 
ATOM   8378  N  N    . PHE B 1 298 ? 48.413  13.929  -15.890 1.00 2.00  ? 329 PHE B N    1 
ATOM   8379  C  CA   . PHE B 1 298 ? 49.307  14.967  -15.438 1.00 2.00  ? 329 PHE B CA   1 
ATOM   8380  C  C    . PHE B 1 298 ? 49.217  15.164  -13.933 1.00 2.00  ? 329 PHE B C    1 
ATOM   8381  O  O    . PHE B 1 298 ? 50.238  15.263  -13.247 1.00 2.00  ? 329 PHE B O    1 
ATOM   8382  C  CB   . PHE B 1 298 ? 48.972  16.294  -16.116 1.00 3.12  ? 329 PHE B CB   1 
ATOM   8383  C  CG   . PHE B 1 298 ? 49.762  17.452  -15.584 1.00 2.38  ? 329 PHE B CG   1 
ATOM   8384  C  CD1  . PHE B 1 298 ? 49.364  18.099  -14.439 1.00 2.96  ? 329 PHE B CD1  1 
ATOM   8385  C  CD2  . PHE B 1 298 ? 50.923  17.857  -16.207 1.00 2.64  ? 329 PHE B CD2  1 
ATOM   8386  C  CE1  . PHE B 1 298 ? 50.108  19.119  -13.919 1.00 3.10  ? 329 PHE B CE1  1 
ATOM   8387  C  CE2  . PHE B 1 298 ? 51.678  18.886  -15.695 1.00 2.64  ? 329 PHE B CE2  1 
ATOM   8388  C  CZ   . PHE B 1 298 ? 51.271  19.517  -14.548 1.00 4.59  ? 329 PHE B CZ   1 
ATOM   8389  H  H    . PHE B 1 298 ? 47.713  14.152  -16.535 1.00 17.00 ? 329 PHE B H    1 
ATOM   8390  N  N    . GLN B 1 299 ? 47.997  15.311  -13.439 1.00 2.00  ? 330 GLN B N    1 
ATOM   8391  C  CA   . GLN B 1 299 ? 47.792  15.566  -12.019 1.00 2.63  ? 330 GLN B CA   1 
ATOM   8392  C  C    . GLN B 1 299 ? 48.124  14.411  -11.120 1.00 2.57  ? 330 GLN B C    1 
ATOM   8393  O  O    . GLN B 1 299 ? 48.440  14.607  -9.944  1.00 2.00  ? 330 GLN B O    1 
ATOM   8394  C  CB   . GLN B 1 299 ? 46.382  16.077  -11.740 1.00 4.44  ? 330 GLN B CB   1 
ATOM   8395  C  CG   . GLN B 1 299 ? 46.096  17.465  -12.290 1.00 2.00  ? 330 GLN B CG   1 
ATOM   8396  C  CD   . GLN B 1 299 ? 46.677  18.580  -11.453 1.00 2.03  ? 330 GLN B CD   1 
ATOM   8397  O  OE1  . GLN B 1 299 ? 47.146  18.385  -10.324 1.00 2.00  ? 330 GLN B OE1  1 
ATOM   8398  N  NE2  . GLN B 1 299 ? 46.647  19.772  -12.001 1.00 2.00  ? 330 GLN B NE2  1 
ATOM   8399  H  H    . GLN B 1 299 ? 47.208  15.252  -14.024 1.00 17.00 ? 330 GLN B H    1 
ATOM   8400  H  HE21 . GLN B 1 299 ? 47.028  20.517  -11.499 1.00 17.00 ? 330 GLN B HE21 1 
ATOM   8401  H  HE22 . GLN B 1 299 ? 46.245  19.847  -12.888 1.00 17.00 ? 330 GLN B HE22 1 
ATOM   8402  N  N    . THR B 1 300 ? 48.023  13.206  -11.658 1.00 3.12  ? 331 THR B N    1 
ATOM   8403  C  CA   . THR B 1 300 ? 48.382  12.027  -10.883 1.00 6.29  ? 331 THR B CA   1 
ATOM   8404  C  C    . THR B 1 300 ? 49.936  11.892  -10.877 1.00 5.12  ? 331 THR B C    1 
ATOM   8405  O  O    . THR B 1 300 ? 50.541  11.666  -9.837  1.00 3.77  ? 331 THR B O    1 
ATOM   8406  C  CB   . THR B 1 300 ? 47.689  10.735  -11.441 1.00 8.46  ? 331 THR B CB   1 
ATOM   8407  O  OG1  . THR B 1 300 ? 46.276  10.968  -11.615 1.00 8.15  ? 331 THR B OG1  1 
ATOM   8408  C  CG2  . THR B 1 300 ? 47.864  9.574   -10.458 1.00 7.67  ? 331 THR B CG2  1 
ATOM   8409  H  H    . THR B 1 300 ? 47.676  13.088  -12.567 1.00 17.00 ? 331 THR B H    1 
ATOM   8410  H  HG1  . THR B 1 300 ? 45.958  11.318  -10.776 1.00 17.00 ? 331 THR B HG1  1 
ATOM   8411  N  N    . SER B 1 301 ? 50.566  12.110  -12.028 1.00 5.98  ? 332 SER B N    1 
ATOM   8412  C  CA   . SER B 1 301 ? 52.021  12.026  -12.147 1.00 6.25  ? 332 SER B CA   1 
ATOM   8413  C  C    . SER B 1 301 ? 52.755  12.935  -11.130 1.00 6.57  ? 332 SER B C    1 
ATOM   8414  O  O    . SER B 1 301 ? 53.610  12.454  -10.373 1.00 6.54  ? 332 SER B O    1 
ATOM   8415  C  CB   . SER B 1 301 ? 52.487  12.362  -13.586 1.00 4.74  ? 332 SER B CB   1 
ATOM   8416  O  OG   . SER B 1 301 ? 52.116  11.394  -14.556 1.00 2.00  ? 332 SER B OG   1 
ATOM   8417  H  H    . SER B 1 301 ? 50.043  12.330  -12.823 1.00 17.00 ? 332 SER B H    1 
ATOM   8418  H  HG   . SER B 1 301 ? 51.153  11.408  -14.670 1.00 17.00 ? 332 SER B HG   1 
ATOM   8419  N  N    . LYS B 1 302 ? 52.426  14.229  -11.108 1.00 3.88  ? 333 LYS B N    1 
ATOM   8420  C  CA   . LYS B 1 302 ? 53.078  15.151  -10.199 1.00 2.00  ? 333 LYS B CA   1 
ATOM   8421  C  C    . LYS B 1 302 ? 53.014  14.608  -8.781  1.00 3.54  ? 333 LYS B C    1 
ATOM   8422  O  O    . LYS B 1 302 ? 53.927  14.805  -7.988  1.00 5.81  ? 333 LYS B O    1 
ATOM   8423  C  CB   . LYS B 1 302 ? 52.433  16.538  -10.276 1.00 3.31  ? 333 LYS B CB   1 
ATOM   8424  C  CG   . LYS B 1 302 ? 52.902  17.539  -9.188  1.00 2.00  ? 333 LYS B CG   1 
ATOM   8425  C  CD   . LYS B 1 302 ? 52.632  18.986  -9.591  1.00 2.00  ? 333 LYS B CD   1 
ATOM   8426  C  CE   . LYS B 1 302 ? 53.128  19.957  -8.526  1.00 2.00  ? 333 LYS B CE   1 
ATOM   8427  N  NZ   . LYS B 1 302 ? 53.129  21.420  -8.944  1.00 2.00  ? 333 LYS B NZ   1 
ATOM   8428  H  H    . LYS B 1 302 ? 51.715  14.571  -11.698 1.00 17.00 ? 333 LYS B H    1 
ATOM   8429  H  HZ1  . LYS B 1 302 ? 53.742  21.552  -9.773  1.00 17.00 ? 333 LYS B HZ1  1 
ATOM   8430  H  HZ2  . LYS B 1 302 ? 52.157  21.701  -9.185  1.00 17.00 ? 333 LYS B HZ2  1 
ATOM   8431  H  HZ3  . LYS B 1 302 ? 53.477  22.001  -8.155  1.00 17.00 ? 333 LYS B HZ3  1 
ATOM   8432  N  N    . LEU B 1 303 ? 51.950  13.891  -8.462  1.00 2.39  ? 334 LEU B N    1 
ATOM   8433  C  CA   . LEU B 1 303 ? 51.838  13.345  -7.124  1.00 3.22  ? 334 LEU B CA   1 
ATOM   8434  C  C    . LEU B 1 303 ? 52.858  12.238  -6.928  1.00 3.53  ? 334 LEU B C    1 
ATOM   8435  O  O    . LEU B 1 303 ? 53.554  12.175  -5.923  1.00 5.50  ? 334 LEU B O    1 
ATOM   8436  C  CB   . LEU B 1 303 ? 50.429  12.807  -6.881  1.00 2.00  ? 334 LEU B CB   1 
ATOM   8437  C  CG   . LEU B 1 303 ? 49.310  13.810  -6.612  1.00 2.00  ? 334 LEU B CG   1 
ATOM   8438  C  CD1  . LEU B 1 303 ? 48.015  13.078  -6.311  1.00 2.00  ? 334 LEU B CD1  1 
ATOM   8439  C  CD2  . LEU B 1 303 ? 49.708  14.693  -5.445  1.00 3.72  ? 334 LEU B CD2  1 
ATOM   8440  H  H    . LEU B 1 303 ? 51.233  13.726  -9.106  1.00 17.00 ? 334 LEU B H    1 
ATOM   8441  N  N    . ILE B 1 304 ? 52.944  11.355  -7.907  1.00 6.26  ? 335 ILE B N    1 
ATOM   8442  C  CA   . ILE B 1 304 ? 53.865  10.230  -7.842  1.00 4.29  ? 335 ILE B CA   1 
ATOM   8443  C  C    . ILE B 1 304 ? 55.292  10.716  -7.735  1.00 2.00  ? 335 ILE B C    1 
ATOM   8444  O  O    . ILE B 1 304 ? 55.975  10.370  -6.775  1.00 2.00  ? 335 ILE B O    1 
ATOM   8445  C  CB   . ILE B 1 304 ? 53.660  9.260   -9.028  1.00 4.18  ? 335 ILE B CB   1 
ATOM   8446  C  CG1  . ILE B 1 304 ? 52.312  8.558   -8.868  1.00 2.00  ? 335 ILE B CG1  1 
ATOM   8447  C  CG2  . ILE B 1 304 ? 54.793  8.256   -9.091  1.00 5.73  ? 335 ILE B CG2  1 
ATOM   8448  C  CD1  . ILE B 1 304 ? 52.058  7.493   -9.869  1.00 2.00  ? 335 ILE B CD1  1 
ATOM   8449  H  H    . ILE B 1 304 ? 52.368  11.473  -8.690  1.00 17.00 ? 335 ILE B H    1 
ATOM   8450  N  N    . LEU B 1 305 ? 55.719  11.550  -8.683  1.00 2.27  ? 336 LEU B N    1 
ATOM   8451  C  CA   . LEU B 1 305 ? 57.072  12.112  -8.656  1.00 2.11  ? 336 LEU B CA   1 
ATOM   8452  C  C    . LEU B 1 305 ? 57.381  12.682  -7.253  1.00 5.66  ? 336 LEU B C    1 
ATOM   8453  O  O    . LEU B 1 305 ? 58.411  12.330  -6.653  1.00 5.89  ? 336 LEU B O    1 
ATOM   8454  C  CB   . LEU B 1 305 ? 57.225  13.212  -9.686  1.00 2.00  ? 336 LEU B CB   1 
ATOM   8455  C  CG   . LEU B 1 305 ? 57.935  12.866  -10.976 1.00 2.00  ? 336 LEU B CG   1 
ATOM   8456  C  CD1  . LEU B 1 305 ? 57.223  11.721  -11.664 1.00 2.68  ? 336 LEU B CD1  1 
ATOM   8457  C  CD2  . LEU B 1 305 ? 57.928  14.116  -11.881 1.00 5.95  ? 336 LEU B CD2  1 
ATOM   8458  H  H    . LEU B 1 305 ? 55.099  11.790  -9.400  1.00 17.00 ? 336 LEU B H    1 
ATOM   8459  N  N    . ILE B 1 306 ? 56.512  13.567  -6.743  1.00 4.27  ? 337 ILE B N    1 
ATOM   8460  C  CA   . ILE B 1 306 ? 56.676  14.117  -5.401  1.00 2.75  ? 337 ILE B CA   1 
ATOM   8461  C  C    . ILE B 1 306 ? 56.881  12.942  -4.431  1.00 3.07  ? 337 ILE B C    1 
ATOM   8462  O  O    . ILE B 1 306 ? 57.751  12.982  -3.562  1.00 3.65  ? 337 ILE B O    1 
ATOM   8463  C  CB   . ILE B 1 306 ? 55.419  14.895  -4.933  1.00 2.73  ? 337 ILE B CB   1 
ATOM   8464  C  CG1  . ILE B 1 306 ? 55.219  16.143  -5.789  1.00 4.31  ? 337 ILE B CG1  1 
ATOM   8465  C  CG2  . ILE B 1 306 ? 55.551  15.279  -3.456  1.00 3.09  ? 337 ILE B CG2  1 
ATOM   8466  C  CD1  . ILE B 1 306 ? 54.113  17.092  -5.290  1.00 6.98  ? 337 ILE B CD1  1 
ATOM   8467  H  H    . ILE B 1 306 ? 55.735  13.839  -7.279  1.00 17.00 ? 337 ILE B H    1 
ATOM   8468  N  N    . GLY B 1 307 ? 56.089  11.887  -4.608  1.00 4.19  ? 338 GLY B N    1 
ATOM   8469  C  CA   . GLY B 1 307 ? 56.199  10.740  -3.746  1.00 3.70  ? 338 GLY B CA   1 
ATOM   8470  C  C    . GLY B 1 307 ? 57.595  10.174  -3.826  1.00 4.06  ? 338 GLY B C    1 
ATOM   8471  O  O    . GLY B 1 307 ? 58.193  9.857   -2.794  1.00 5.82  ? 338 GLY B O    1 
ATOM   8472  H  H    . GLY B 1 307 ? 55.415  11.869  -5.319  1.00 17.00 ? 338 GLY B H    1 
ATOM   8473  N  N    . GLU B 1 308 ? 58.121  10.074  -5.045  1.00 2.40  ? 339 GLU B N    1 
ATOM   8474  C  CA   . GLU B 1 308 ? 59.446  9.516   -5.275  1.00 2.00  ? 339 GLU B CA   1 
ATOM   8475  C  C    . GLU B 1 308 ? 60.473  10.396  -4.624  1.00 2.28  ? 339 GLU B C    1 
ATOM   8476  O  O    . GLU B 1 308 ? 61.352  9.929   -3.891  1.00 2.00  ? 339 GLU B O    1 
ATOM   8477  C  CB   . GLU B 1 308 ? 59.734  9.463   -6.759  1.00 2.88  ? 339 GLU B CB   1 
ATOM   8478  C  CG   . GLU B 1 308 ? 58.876  8.486   -7.559  1.00 4.86  ? 339 GLU B CG   1 
ATOM   8479  C  CD   . GLU B 1 308 ? 59.165  8.543   -9.058  1.00 5.13  ? 339 GLU B CD   1 
ATOM   8480  O  OE1  . GLU B 1 308 ? 58.556  9.370   -9.760  1.00 9.21  ? 339 GLU B OE1  1 
ATOM   8481  O  OE2  . GLU B 1 308 ? 60.011  7.777   -9.543  1.00 6.89  ? 339 GLU B OE2  1 
ATOM   8482  H  H    . GLU B 1 308 ? 57.599  10.401  -5.802  1.00 17.00 ? 339 GLU B H    1 
ATOM   8483  N  N    . THR B 1 309 ? 60.339  11.690  -4.891  1.00 3.22  ? 340 THR B N    1 
ATOM   8484  C  CA   . THR B 1 309 ? 61.243  12.687  -4.351  1.00 2.00  ? 340 THR B CA   1 
ATOM   8485  C  C    . THR B 1 309 ? 61.355  12.603  -2.839  1.00 2.00  ? 340 THR B C    1 
ATOM   8486  O  O    . THR B 1 309 ? 62.438  12.706  -2.310  1.00 2.31  ? 340 THR B O    1 
ATOM   8487  C  CB   . THR B 1 309 ? 60.834  14.084  -4.730  1.00 2.00  ? 340 THR B CB   1 
ATOM   8488  O  OG1  . THR B 1 309 ? 60.783  14.221  -6.154  1.00 2.00  ? 340 THR B OG1  1 
ATOM   8489  C  CG2  . THR B 1 309 ? 61.819  15.015  -4.205  1.00 2.00  ? 340 THR B CG2  1 
ATOM   8490  H  H    . THR B 1 309 ? 59.583  11.983  -5.402  1.00 17.00 ? 340 THR B H    1 
ATOM   8491  H  HG1  . THR B 1 309 ? 60.154  13.581  -6.507  1.00 17.00 ? 340 THR B HG1  1 
ATOM   8492  N  N    . ILE B 1 310 ? 60.257  12.409  -2.131  1.00 2.27  ? 341 ILE B N    1 
ATOM   8493  C  CA   . ILE B 1 310 ? 60.375  12.318  -0.696  1.00 4.18  ? 341 ILE B CA   1 
ATOM   8494  C  C    . ILE B 1 310 ? 61.119  11.039  -0.310  1.00 4.33  ? 341 ILE B C    1 
ATOM   8495  O  O    . ILE B 1 310 ? 61.779  10.997  0.733   1.00 5.41  ? 341 ILE B O    1 
ATOM   8496  C  CB   . ILE B 1 310 ? 59.006  12.381  0.023   1.00 7.16  ? 341 ILE B CB   1 
ATOM   8497  C  CG1  . ILE B 1 310 ? 58.242  13.648  -0.386  1.00 7.04  ? 341 ILE B CG1  1 
ATOM   8498  C  CG2  . ILE B 1 310 ? 59.218  12.396  1.552   1.00 10.47 ? 341 ILE B CG2  1 
ATOM   8499  C  CD1  . ILE B 1 310 ? 56.988  13.949  0.468   1.00 4.55  ? 341 ILE B CD1  1 
ATOM   8500  H  H    . ILE B 1 310 ? 59.375  12.320  -2.556  1.00 17.00 ? 341 ILE B H    1 
ATOM   8501  N  N    . LYS B 1 311 ? 61.040  10.007  -1.146  1.00 4.52  ? 342 LYS B N    1 
ATOM   8502  C  CA   . LYS B 1 311 ? 61.723  8.751   -0.844  1.00 4.61  ? 342 LYS B CA   1 
ATOM   8503  C  C    . LYS B 1 311 ? 63.218  8.962   -1.017  1.00 4.66  ? 342 LYS B C    1 
ATOM   8504  O  O    . LYS B 1 311 ? 63.978  8.818   -0.064  1.00 4.53  ? 342 LYS B O    1 
ATOM   8505  C  CB   . LYS B 1 311 ? 61.241  7.625   -1.753  1.00 6.99  ? 342 LYS B CB   1 
ATOM   8506  C  CG   . LYS B 1 311 ? 61.860  6.238   -1.471  1.00 9.05  ? 342 LYS B CG   1 
ATOM   8507  C  CD   . LYS B 1 311 ? 61.093  5.457   -0.424  1.00 7.32  ? 342 LYS B CD   1 
ATOM   8508  C  CE   . LYS B 1 311 ? 61.023  3.993   -0.819  1.00 7.85  ? 342 LYS B CE   1 
ATOM   8509  N  NZ   . LYS B 1 311 ? 60.104  3.157   0.048   1.00 10.26 ? 342 LYS B NZ   1 
ATOM   8510  H  H    . LYS B 1 311 ? 60.507  10.082  -1.965  1.00 17.00 ? 342 LYS B H    1 
ATOM   8511  H  HZ1  . LYS B 1 311 ? 60.439  3.216   1.033   1.00 17.00 ? 342 LYS B HZ1  1 
ATOM   8512  H  HZ2  . LYS B 1 311 ? 59.132  3.521   -0.007  1.00 17.00 ? 342 LYS B HZ2  1 
ATOM   8513  H  HZ3  . LYS B 1 311 ? 60.127  2.165   -0.264  1.00 17.00 ? 342 LYS B HZ3  1 
ATOM   8514  N  N    . ILE B 1 312 ? 63.636  9.322   -2.226  1.00 4.24  ? 343 ILE B N    1 
ATOM   8515  C  CA   . ILE B 1 312 ? 65.042  9.581   -2.503  1.00 2.46  ? 343 ILE B CA   1 
ATOM   8516  C  C    . ILE B 1 312 ? 65.613  10.536  -1.440  1.00 2.83  ? 343 ILE B C    1 
ATOM   8517  O  O    . ILE B 1 312 ? 66.525  10.189  -0.712  1.00 3.20  ? 343 ILE B O    1 
ATOM   8518  C  CB   . ILE B 1 312 ? 65.214  10.164  -3.922  1.00 2.00  ? 343 ILE B CB   1 
ATOM   8519  C  CG1  . ILE B 1 312 ? 64.804  9.123   -4.959  1.00 2.42  ? 343 ILE B CG1  1 
ATOM   8520  C  CG2  . ILE B 1 312 ? 66.613  10.639  -4.152  1.00 2.00  ? 343 ILE B CG2  1 
ATOM   8521  C  CD1  . ILE B 1 312 ? 64.849  9.625   -6.404  1.00 2.00  ? 343 ILE B CD1  1 
ATOM   8522  H  H    . ILE B 1 312 ? 62.961  9.418   -2.930  1.00 17.00 ? 343 ILE B H    1 
ATOM   8523  N  N    . VAL B 1 313 ? 64.999  11.694  -1.264  1.00 3.73  ? 344 VAL B N    1 
ATOM   8524  C  CA   . VAL B 1 313 ? 65.480  12.647  -0.286  1.00 3.65  ? 344 VAL B CA   1 
ATOM   8525  C  C    . VAL B 1 313 ? 65.590  12.153  1.169   1.00 5.08  ? 344 VAL B C    1 
ATOM   8526  O  O    . VAL B 1 313 ? 66.228  12.819  1.989   1.00 6.86  ? 344 VAL B O    1 
ATOM   8527  C  CB   . VAL B 1 313 ? 64.761  14.011  -0.450  1.00 2.79  ? 344 VAL B CB   1 
ATOM   8528  C  CG1  . VAL B 1 313 ? 64.926  14.915  0.789   1.00 2.77  ? 344 VAL B CG1  1 
ATOM   8529  C  CG2  . VAL B 1 313 ? 65.339  14.700  -1.690  1.00 2.41  ? 344 VAL B CG2  1 
ATOM   8530  H  H    . VAL B 1 313 ? 64.196  11.913  -1.782  1.00 17.00 ? 344 VAL B H    1 
ATOM   8531  N  N    . ILE B 1 314 ? 65.055  10.971  1.483   1.00 4.53  ? 345 ILE B N    1 
ATOM   8532  C  CA   . ILE B 1 314 ? 65.159  10.422  2.858   1.00 4.90  ? 345 ILE B CA   1 
ATOM   8533  C  C    . ILE B 1 314 ? 66.042  9.177   2.825   1.00 3.65  ? 345 ILE B C    1 
ATOM   8534  O  O    . ILE B 1 314 ? 67.028  9.073   3.551   1.00 2.00  ? 345 ILE B O    1 
ATOM   8535  C  CB   . ILE B 1 314 ? 63.778  10.008  3.474   1.00 3.57  ? 345 ILE B CB   1 
ATOM   8536  C  CG1  . ILE B 1 314 ? 62.915  11.233  3.784   1.00 2.00  ? 345 ILE B CG1  1 
ATOM   8537  C  CG2  . ILE B 1 314 ? 63.993  9.172   4.756   1.00 2.00  ? 345 ILE B CG2  1 
ATOM   8538  C  CD1  . ILE B 1 314 ? 63.140  11.804  5.167   1.00 2.00  ? 345 ILE B CD1  1 
ATOM   8539  H  H    . ILE B 1 314 ? 64.560  10.475  0.803   1.00 17.00 ? 345 ILE B H    1 
ATOM   8540  N  N    . GLU B 1 315 ? 65.633  8.227   1.988   1.00 3.66  ? 346 GLU B N    1 
ATOM   8541  C  CA   . GLU B 1 315 ? 66.319  6.949   1.762   1.00 4.23  ? 346 GLU B CA   1 
ATOM   8542  C  C    . GLU B 1 315 ? 67.747  7.032   1.134   1.00 4.39  ? 346 GLU B C    1 
ATOM   8543  O  O    . GLU B 1 315 ? 68.572  6.121   1.336   1.00 3.14  ? 346 GLU B O    1 
ATOM   8544  C  CB   . GLU B 1 315 ? 65.441  6.045   0.877   1.00 4.23  ? 346 GLU B CB   1 
ATOM   8545  C  CG   . GLU B 1 315 ? 64.018  5.761   1.394   1.00 6.74  ? 346 GLU B CG   1 
ATOM   8546  C  CD   . GLU B 1 315 ? 63.938  4.653   2.445   1.00 5.67  ? 346 GLU B CD   1 
ATOM   8547  O  OE1  . GLU B 1 315 ? 64.851  4.533   3.283   1.00 3.88  ? 346 GLU B OE1  1 
ATOM   8548  O  OE2  . GLU B 1 315 ? 62.943  3.909   2.446   1.00 2.00  ? 346 GLU B OE2  1 
ATOM   8549  H  H    . GLU B 1 315 ? 64.807  8.397   1.504   1.00 17.00 ? 346 GLU B H    1 
ATOM   8550  N  N    . ASP B 1 316 ? 68.023  8.093   0.367   1.00 2.48  ? 347 ASP B N    1 
ATOM   8551  C  CA   . ASP B 1 316 ? 69.320  8.291   -0.258  1.00 2.00  ? 347 ASP B CA   1 
ATOM   8552  C  C    . ASP B 1 316 ? 70.072  9.509   0.261   1.00 4.94  ? 347 ASP B C    1 
ATOM   8553  O  O    . ASP B 1 316 ? 71.166  9.389   0.825   1.00 7.65  ? 347 ASP B O    1 
ATOM   8554  C  CB   . ASP B 1 316 ? 69.154  8.473   -1.751  1.00 2.00  ? 347 ASP B CB   1 
ATOM   8555  C  CG   . ASP B 1 316 ? 68.579  7.276   -2.418  1.00 2.00  ? 347 ASP B CG   1 
ATOM   8556  O  OD1  . ASP B 1 316 ? 69.165  6.192   -2.303  1.00 2.00  ? 347 ASP B OD1  1 
ATOM   8557  O  OD2  . ASP B 1 316 ? 67.564  7.417   -3.111  1.00 5.86  ? 347 ASP B OD2  1 
ATOM   8558  H  H    . ASP B 1 316 ? 67.308  8.746   0.233   1.00 17.00 ? 347 ASP B H    1 
ATOM   8559  N  N    . TYR B 1 317 ? 69.495  10.684  0.009   1.00 5.37  ? 348 TYR B N    1 
ATOM   8560  C  CA   . TYR B 1 317 ? 70.066  11.979  0.382   1.00 5.47  ? 348 TYR B CA   1 
ATOM   8561  C  C    . TYR B 1 317 ? 70.312  12.136  1.881   1.00 5.66  ? 348 TYR B C    1 
ATOM   8562  O  O    . TYR B 1 317 ? 71.445  12.377  2.295   1.00 6.42  ? 348 TYR B O    1 
ATOM   8563  C  CB   . TYR B 1 317 ? 69.161  13.094  -0.149  1.00 3.98  ? 348 TYR B CB   1 
ATOM   8564  C  CG   . TYR B 1 317 ? 69.645  14.519  0.016   1.00 2.47  ? 348 TYR B CG   1 
ATOM   8565  C  CD1  . TYR B 1 317 ? 69.502  15.197  1.240   1.00 2.00  ? 348 TYR B CD1  1 
ATOM   8566  C  CD2  . TYR B 1 317 ? 70.044  15.253  -1.114  1.00 2.00  ? 348 TYR B CD2  1 
ATOM   8567  C  CE1  . TYR B 1 317 ? 69.722  16.594  1.322   1.00 3.61  ? 348 TYR B CE1  1 
ATOM   8568  C  CE2  . TYR B 1 317 ? 70.259  16.650  -1.055  1.00 2.92  ? 348 TYR B CE2  1 
ATOM   8569  C  CZ   . TYR B 1 317 ? 70.089  17.328  0.157   1.00 2.86  ? 348 TYR B CZ   1 
ATOM   8570  O  OH   . TYR B 1 317 ? 70.208  18.712  0.165   1.00 2.00  ? 348 TYR B OH   1 
ATOM   8571  H  H    . TYR B 1 317 ? 68.628  10.667  -0.446  1.00 17.00 ? 348 TYR B H    1 
ATOM   8572  H  HH   . TYR B 1 317 ? 70.157  19.059  -0.722  1.00 17.00 ? 348 TYR B HH   1 
ATOM   8573  N  N    . VAL B 1 318 ? 69.266  12.033  2.693   1.00 5.33  ? 349 VAL B N    1 
ATOM   8574  C  CA   . VAL B 1 318 ? 69.462  12.165  4.138   1.00 4.86  ? 349 VAL B CA   1 
ATOM   8575  C  C    . VAL B 1 318 ? 70.295  10.980  4.582   1.00 4.76  ? 349 VAL B C    1 
ATOM   8576  O  O    . VAL B 1 318 ? 71.243  11.150  5.339   1.00 9.14  ? 349 VAL B O    1 
ATOM   8577  C  CB   . VAL B 1 318 ? 68.126  12.223  4.970   1.00 2.78  ? 349 VAL B CB   1 
ATOM   8578  C  CG1  . VAL B 1 318 ? 68.415  12.325  6.447   1.00 2.00  ? 349 VAL B CG1  1 
ATOM   8579  C  CG2  . VAL B 1 318 ? 67.309  13.409  4.559   1.00 3.23  ? 349 VAL B CG2  1 
ATOM   8580  H  H    . VAL B 1 318 ? 68.359  11.905  2.344   1.00 17.00 ? 349 VAL B H    1 
ATOM   8581  N  N    . GLN B 1 319 ? 70.008  9.805   4.042   1.00 2.24  ? 350 GLN B N    1 
ATOM   8582  C  CA   . GLN B 1 319 ? 70.747  8.612   4.414   1.00 4.46  ? 350 GLN B CA   1 
ATOM   8583  C  C    . GLN B 1 319 ? 72.234  8.805   4.205   1.00 5.59  ? 350 GLN B C    1 
ATOM   8584  O  O    . GLN B 1 319 ? 73.025  8.455   5.075   1.00 8.08  ? 350 GLN B O    1 
ATOM   8585  C  CB   . GLN B 1 319 ? 70.257  7.400   3.636   1.00 5.59  ? 350 GLN B CB   1 
ATOM   8586  C  CG   . GLN B 1 319 ? 70.966  6.129   3.976   1.00 6.29  ? 350 GLN B CG   1 
ATOM   8587  C  CD   . GLN B 1 319 ? 70.834  5.758   5.424   1.00 5.97  ? 350 GLN B CD   1 
ATOM   8588  O  OE1  . GLN B 1 319 ? 71.725  5.993   6.215   1.00 6.69  ? 350 GLN B OE1  1 
ATOM   8589  N  NE2  . GLN B 1 319 ? 69.722  5.160   5.777   1.00 9.69  ? 350 GLN B NE2  1 
ATOM   8590  H  H    . GLN B 1 319 ? 69.258  9.726   3.416   1.00 17.00 ? 350 GLN B H    1 
ATOM   8591  H  HE21 . GLN B 1 319 ? 69.715  4.939   6.732   1.00 17.00 ? 350 GLN B HE21 1 
ATOM   8592  H  HE22 . GLN B 1 319 ? 69.020  4.972   5.114   1.00 17.00 ? 350 GLN B HE22 1 
ATOM   8593  N  N    . HIS B 1 320 ? 72.625  9.409   3.089   1.00 6.61  ? 351 HIS B N    1 
ATOM   8594  C  CA   . HIS B 1 320 ? 74.048  9.652   2.818   1.00 7.42  ? 351 HIS B CA   1 
ATOM   8595  C  C    . HIS B 1 320 ? 74.638  10.752  3.698   1.00 5.23  ? 351 HIS B C    1 
ATOM   8596  O  O    . HIS B 1 320 ? 75.703  10.583  4.294   1.00 5.01  ? 351 HIS B O    1 
ATOM   8597  C  CB   . HIS B 1 320 ? 74.278  10.032  1.346   1.00 9.46  ? 351 HIS B CB   1 
ATOM   8598  C  CG   . HIS B 1 320 ? 75.632  10.623  1.088   1.00 10.39 ? 351 HIS B CG   1 
ATOM   8599  N  ND1  . HIS B 1 320 ? 75.933  11.933  1.385   1.00 11.66 ? 351 HIS B ND1  1 
ATOM   8600  C  CD2  . HIS B 1 320 ? 76.778  10.071  0.624   1.00 11.04 ? 351 HIS B CD2  1 
ATOM   8601  C  CE1  . HIS B 1 320 ? 77.208  12.162  1.121   1.00 13.05 ? 351 HIS B CE1  1 
ATOM   8602  N  NE2  . HIS B 1 320 ? 77.743  11.047  0.659   1.00 11.62 ? 351 HIS B NE2  1 
ATOM   8603  H  H    . HIS B 1 320 ? 71.943  9.692   2.456   1.00 17.00 ? 351 HIS B H    1 
ATOM   8604  H  HD1  . HIS B 1 320 ? 75.318  12.618  1.721   1.00 17.00 ? 351 HIS B HD1  1 
ATOM   8605  H  HE2  . HIS B 1 320 ? 78.683  10.951  0.383   1.00 17.00 ? 351 HIS B HE2  1 
ATOM   8606  N  N    . LEU B 1 321 ? 73.959  11.894  3.715   1.00 3.40  ? 352 LEU B N    1 
ATOM   8607  C  CA   . LEU B 1 321 ? 74.389  13.052  4.464   1.00 2.00  ? 352 LEU B CA   1 
ATOM   8608  C  C    . LEU B 1 321 ? 74.392  12.771  5.949   1.00 2.00  ? 352 LEU B C    1 
ATOM   8609  O  O    . LEU B 1 321 ? 74.988  13.505  6.708   1.00 5.62  ? 352 LEU B O    1 
ATOM   8610  C  CB   . LEU B 1 321 ? 73.500  14.245  4.124   1.00 2.00  ? 352 LEU B CB   1 
ATOM   8611  C  CG   . LEU B 1 321 ? 73.973  15.650  4.525   1.00 2.00  ? 352 LEU B CG   1 
ATOM   8612  C  CD1  . LEU B 1 321 ? 73.980  16.611  3.327   1.00 2.00  ? 352 LEU B CD1  1 
ATOM   8613  C  CD2  . LEU B 1 321 ? 73.062  16.168  5.613   1.00 2.00  ? 352 LEU B CD2  1 
ATOM   8614  H  H    . LEU B 1 321 ? 73.101  11.957  3.241   1.00 17.00 ? 352 LEU B H    1 
ATOM   8615  N  N    . SER B 1 322 ? 73.777  11.681  6.367   1.00 2.00  ? 353 SER B N    1 
ATOM   8616  C  CA   . SER B 1 322 ? 73.761  11.351  7.772   1.00 2.51  ? 353 SER B CA   1 
ATOM   8617  C  C    . SER B 1 322 ? 74.955  10.480  8.165   1.00 3.05  ? 353 SER B C    1 
ATOM   8618  O  O    . SER B 1 322 ? 75.615  10.698  9.193   1.00 2.00  ? 353 SER B O    1 
ATOM   8619  C  CB   . SER B 1 322 ? 72.461  10.621  8.138   1.00 3.76  ? 353 SER B CB   1 
ATOM   8620  O  OG   . SER B 1 322 ? 72.501  9.239   7.835   1.00 2.00  ? 353 SER B OG   1 
ATOM   8621  H  H    . SER B 1 322 ? 73.286  11.098  5.757   1.00 17.00 ? 353 SER B H    1 
ATOM   8622  H  HG   . SER B 1 322 ? 72.541  9.068   6.883   1.00 17.00 ? 353 SER B HG   1 
ATOM   8623  N  N    . GLY B 1 323 ? 75.237  9.494   7.326   1.00 4.71  ? 354 GLY B N    1 
ATOM   8624  C  CA   . GLY B 1 323 ? 76.315  8.565   7.617   1.00 7.06  ? 354 GLY B CA   1 
ATOM   8625  C  C    . GLY B 1 323 ? 75.918  7.866   8.903   1.00 8.25  ? 354 GLY B C    1 
ATOM   8626  O  O    . GLY B 1 323 ? 76.511  8.091   9.964   1.00 9.95  ? 354 GLY B O    1 
ATOM   8627  H  H    . GLY B 1 323 ? 74.705  9.383   6.514   1.00 17.00 ? 354 GLY B H    1 
ATOM   8628  N  N    . TYR B 1 324 ? 74.886  7.047   8.843   1.00 6.56  ? 355 TYR B N    1 
ATOM   8629  C  CA   . TYR B 1 324 ? 74.462  6.430   10.064  1.00 7.51  ? 355 TYR B CA   1 
ATOM   8630  C  C    . TYR B 1 324 ? 74.887  5.009   10.197  1.00 11.30 ? 355 TYR B C    1 
ATOM   8631  O  O    . TYR B 1 324 ? 75.977  4.730   10.688  1.00 13.91 ? 355 TYR B O    1 
ATOM   8632  C  CB   . TYR B 1 324 ? 72.951  6.591   10.250  1.00 7.75  ? 355 TYR B CB   1 
ATOM   8633  C  CG   . TYR B 1 324 ? 72.568  7.935   10.842  1.00 6.83  ? 355 TYR B CG   1 
ATOM   8634  C  CD1  . TYR B 1 324 ? 73.519  8.727   11.456  1.00 4.53  ? 355 TYR B CD1  1 
ATOM   8635  C  CD2  . TYR B 1 324 ? 71.252  8.375   10.847  1.00 4.61  ? 355 TYR B CD2  1 
ATOM   8636  C  CE1  . TYR B 1 324 ? 73.175  9.901   12.057  1.00 5.35  ? 355 TYR B CE1  1 
ATOM   8637  C  CE2  . TYR B 1 324 ? 70.901  9.554   11.455  1.00 3.10  ? 355 TYR B CE2  1 
ATOM   8638  C  CZ   . TYR B 1 324 ? 71.857  10.325  12.065  1.00 3.86  ? 355 TYR B CZ   1 
ATOM   8639  O  OH   . TYR B 1 324 ? 71.506  11.526  12.700  1.00 2.18  ? 355 TYR B OH   1 
ATOM   8640  H  H    . TYR B 1 324 ? 74.412  6.876   8.003   1.00 17.00 ? 355 TYR B H    1 
ATOM   8641  H  HH   . TYR B 1 324 ? 70.550  11.624  12.691  1.00 17.00 ? 355 TYR B HH   1 
ATOM   8642  N  N    . HIS B 1 325 ? 74.038  4.112   9.699   1.00 15.77 ? 356 HIS B N    1 
ATOM   8643  C  CA   . HIS B 1 325 ? 74.207  2.656   9.754   1.00 15.54 ? 356 HIS B CA   1 
ATOM   8644  C  C    . HIS B 1 325 ? 72.756  2.228   9.717   1.00 15.06 ? 356 HIS B C    1 
ATOM   8645  O  O    . HIS B 1 325 ? 72.356  1.461   8.834   1.00 16.96 ? 356 HIS B O    1 
ATOM   8646  C  CB   . HIS B 1 325 ? 74.844  2.188   11.080  1.00 15.62 ? 356 HIS B CB   1 
ATOM   8647  C  CG   . HIS B 1 325 ? 76.275  1.786   10.946  1.00 16.93 ? 356 HIS B CG   1 
ATOM   8648  N  ND1  . HIS B 1 325 ? 77.260  2.237   11.799  1.00 16.72 ? 356 HIS B ND1  1 
ATOM   8649  C  CD2  . HIS B 1 325 ? 76.890  0.986   10.044  1.00 16.96 ? 356 HIS B CD2  1 
ATOM   8650  C  CE1  . HIS B 1 325 ? 78.423  1.732   11.430  1.00 17.93 ? 356 HIS B CE1  1 
ATOM   8651  N  NE2  . HIS B 1 325 ? 78.226  0.970   10.367  1.00 18.51 ? 356 HIS B NE2  1 
ATOM   8652  H  H    . HIS B 1 325 ? 73.236  4.436   9.229   1.00 17.00 ? 356 HIS B H    1 
ATOM   8653  H  HD1  . HIS B 1 325 ? 77.123  2.865   12.546  1.00 17.00 ? 356 HIS B HD1  1 
ATOM   8654  H  HE2  . HIS B 1 325 ? 78.936  0.522   9.865   1.00 17.00 ? 356 HIS B HE2  1 
ATOM   8655  N  N    . PHE B 1 326 ? 71.964  2.790   10.642  1.00 14.23 ? 357 PHE B N    1 
ATOM   8656  C  CA   . PHE B 1 326 ? 70.545  2.496   10.709  1.00 12.14 ? 357 PHE B CA   1 
ATOM   8657  C  C    . PHE B 1 326 ? 69.950  2.969   9.399   1.00 13.01 ? 357 PHE B C    1 
ATOM   8658  O  O    . PHE B 1 326 ? 70.275  4.082   8.933   1.00 13.24 ? 357 PHE B O    1 
ATOM   8659  C  CB   . PHE B 1 326 ? 69.859  3.241   11.848  1.00 12.00 ? 357 PHE B CB   1 
ATOM   8660  C  CG   . PHE B 1 326 ? 68.365  3.215   11.732  1.00 12.04 ? 357 PHE B CG   1 
ATOM   8661  C  CD1  . PHE B 1 326 ? 67.692  1.997   11.688  1.00 11.36 ? 357 PHE B CD1  1 
ATOM   8662  C  CD2  . PHE B 1 326 ? 67.655  4.393   11.529  1.00 11.78 ? 357 PHE B CD2  1 
ATOM   8663  C  CE1  . PHE B 1 326 ? 66.361  1.953   11.435  1.00 12.10 ? 357 PHE B CE1  1 
ATOM   8664  C  CE2  . PHE B 1 326 ? 66.308  4.363   11.271  1.00 12.99 ? 357 PHE B CE2  1 
ATOM   8665  C  CZ   . PHE B 1 326 ? 65.656  3.138   11.220  1.00 14.09 ? 357 PHE B CZ   1 
ATOM   8666  H  H    . PHE B 1 326 ? 72.335  3.434   11.278  1.00 17.00 ? 357 PHE B H    1 
ATOM   8667  N  N    . LYS B 1 327 ? 69.054  2.163   8.834   1.00 9.92  ? 358 LYS B N    1 
ATOM   8668  C  CA   . LYS B 1 327 ? 68.452  2.510   7.565   1.00 7.69  ? 358 LYS B CA   1 
ATOM   8669  C  C    . LYS B 1 327 ? 67.216  3.364   7.720   1.00 8.15  ? 358 LYS B C    1 
ATOM   8670  O  O    . LYS B 1 327 ? 66.163  2.883   8.170   1.00 6.30  ? 358 LYS B O    1 
ATOM   8671  C  CB   . LYS B 1 327 ? 68.112  1.251   6.795   1.00 6.41  ? 358 LYS B CB   1 
ATOM   8672  C  CG   . LYS B 1 327 ? 67.973  1.464   5.315   1.00 6.68  ? 358 LYS B CG   1 
ATOM   8673  C  CD   . LYS B 1 327 ? 67.514  0.187   4.690   1.00 11.72 ? 358 LYS B CD   1 
ATOM   8674  C  CE   . LYS B 1 327 ? 68.065  -1.030  5.447   1.00 13.33 ? 358 LYS B CE   1 
ATOM   8675  N  NZ   . LYS B 1 327 ? 67.533  -2.370  4.992   1.00 17.97 ? 358 LYS B NZ   1 
ATOM   8676  H  H    . LYS B 1 327 ? 68.771  1.352   9.305   1.00 17.00 ? 358 LYS B H    1 
ATOM   8677  H  HZ1  . LYS B 1 327 ? 67.756  -2.505  3.985   1.00 17.00 ? 358 LYS B HZ1  1 
ATOM   8678  H  HZ2  . LYS B 1 327 ? 67.975  -3.128  5.553   1.00 17.00 ? 358 LYS B HZ2  1 
ATOM   8679  H  HZ3  . LYS B 1 327 ? 66.502  -2.395  5.123   1.00 17.00 ? 358 LYS B HZ3  1 
ATOM   8680  N  N    . LEU B 1 328 ? 67.352  4.641   7.370   1.00 6.92  ? 359 LEU B N    1 
ATOM   8681  C  CA   . LEU B 1 328 ? 66.239  5.564   7.436   1.00 7.47  ? 359 LEU B CA   1 
ATOM   8682  C  C    . LEU B 1 328 ? 65.156  4.967   6.546   1.00 9.60  ? 359 LEU B C    1 
ATOM   8683  O  O    . LEU B 1 328 ? 65.477  4.180   5.652   1.00 9.03  ? 359 LEU B O    1 
ATOM   8684  C  CB   . LEU B 1 328 ? 66.669  6.931   6.922   1.00 7.14  ? 359 LEU B CB   1 
ATOM   8685  C  CG   . LEU B 1 328 ? 67.775  7.591   7.749   1.00 8.70  ? 359 LEU B CG   1 
ATOM   8686  C  CD1  . LEU B 1 328 ? 67.960  9.026   7.294   1.00 7.16  ? 359 LEU B CD1  1 
ATOM   8687  C  CD2  . LEU B 1 328 ? 67.456  7.537   9.254   1.00 6.70  ? 359 LEU B CD2  1 
ATOM   8688  H  H    . LEU B 1 328 ? 68.214  4.955   7.059   1.00 17.00 ? 359 LEU B H    1 
ATOM   8689  N  N    . LYS B 1 329 ? 63.898  5.364   6.769   1.00 12.30 ? 360 LYS B N    1 
ATOM   8690  C  CA   . LYS B 1 329 ? 62.749  4.849   6.011   1.00 14.08 ? 360 LYS B CA   1 
ATOM   8691  C  C    . LYS B 1 329 ? 61.659  5.866   5.759   1.00 13.74 ? 360 LYS B C    1 
ATOM   8692  O  O    . LYS B 1 329 ? 61.137  6.436   6.706   1.00 14.41 ? 360 LYS B O    1 
ATOM   8693  C  CB   . LYS B 1 329 ? 62.088  3.674   6.756   1.00 14.18 ? 360 LYS B CB   1 
ATOM   8694  C  CG   . LYS B 1 329 ? 60.863  3.134   6.055   1.00 11.69 ? 360 LYS B CG   1 
ATOM   8695  C  CD   . LYS B 1 329 ? 60.326  1.899   6.692   1.00 12.34 ? 360 LYS B CD   1 
ATOM   8696  C  CE   . LYS B 1 329 ? 59.812  2.204   8.080   1.00 13.05 ? 360 LYS B CE   1 
ATOM   8697  N  NZ   . LYS B 1 329 ? 58.973  1.058   8.608   1.00 14.26 ? 360 LYS B NZ   1 
ATOM   8698  H  H    . LYS B 1 329 ? 63.768  6.105   7.349   1.00 17.00 ? 360 LYS B H    1 
ATOM   8699  H  HZ1  . LYS B 1 329 ? 59.549  0.194   8.639   1.00 17.00 ? 360 LYS B HZ1  1 
ATOM   8700  H  HZ2  . LYS B 1 329 ? 58.631  1.288   9.560   1.00 17.00 ? 360 LYS B HZ2  1 
ATOM   8701  H  HZ3  . LYS B 1 329 ? 58.158  0.907   7.980   1.00 17.00 ? 360 LYS B HZ3  1 
ATOM   8702  N  N    . PHE B 1 330 ? 61.293  6.053   4.492   1.00 11.79 ? 361 PHE B N    1 
ATOM   8703  C  CA   . PHE B 1 330 ? 60.200  6.952   4.144   1.00 11.47 ? 361 PHE B CA   1 
ATOM   8704  C  C    . PHE B 1 330 ? 58.922  6.137   4.315   1.00 10.23 ? 361 PHE B C    1 
ATOM   8705  O  O    . PHE B 1 330 ? 58.599  5.316   3.445   1.00 10.84 ? 361 PHE B O    1 
ATOM   8706  C  CB   . PHE B 1 330 ? 60.300  7.399   2.682   1.00 10.08 ? 361 PHE B CB   1 
ATOM   8707  C  CG   . PHE B 1 330 ? 59.125  8.239   2.211   1.00 8.89  ? 361 PHE B CG   1 
ATOM   8708  C  CD1  . PHE B 1 330 ? 58.543  9.204   3.039   1.00 8.25  ? 361 PHE B CD1  1 
ATOM   8709  C  CD2  . PHE B 1 330 ? 58.591  8.047   0.942   1.00 8.30  ? 361 PHE B CD2  1 
ATOM   8710  C  CE1  . PHE B 1 330 ? 57.439  9.963   2.609   1.00 4.91  ? 361 PHE B CE1  1 
ATOM   8711  C  CE2  . PHE B 1 330 ? 57.494  8.800   0.503   1.00 5.94  ? 361 PHE B CE2  1 
ATOM   8712  C  CZ   . PHE B 1 330 ? 56.922  9.758   1.347   1.00 4.31  ? 361 PHE B CZ   1 
ATOM   8713  H  H    . PHE B 1 330 ? 61.738  5.553   3.779   1.00 17.00 ? 361 PHE B H    1 
ATOM   8714  N  N    . ASP B 1 331 ? 58.235  6.320   5.445   1.00 8.41  ? 362 ASP B N    1 
ATOM   8715  C  CA   . ASP B 1 331 ? 56.993  5.598   5.712   1.00 8.54  ? 362 ASP B CA   1 
ATOM   8716  C  C    . ASP B 1 331 ? 56.013  6.466   6.455   1.00 6.85  ? 362 ASP B C    1 
ATOM   8717  O  O    . ASP B 1 331 ? 55.927  6.393   7.680   1.00 3.24  ? 362 ASP B O    1 
ATOM   8718  C  CB   . ASP B 1 331 ? 57.252  4.319   6.519   1.00 10.56 ? 362 ASP B CB   1 
ATOM   8719  C  CG   . ASP B 1 331 ? 56.020  3.406   6.622   1.00 9.82  ? 362 ASP B CG   1 
ATOM   8720  O  OD1  . ASP B 1 331 ? 54.988  3.654   5.966   1.00 13.46 ? 362 ASP B OD1  1 
ATOM   8721  O  OD2  . ASP B 1 331 ? 56.103  2.413   7.364   1.00 8.47  ? 362 ASP B OD2  1 
ATOM   8722  H  H    . ASP B 1 331 ? 58.593  6.927   6.127   1.00 17.00 ? 362 ASP B H    1 
ATOM   8723  N  N    . PRO B 1 332 ? 55.228  7.275   5.709   1.00 7.13  ? 363 PRO B N    1 
ATOM   8724  C  CA   . PRO B 1 332 ? 54.226  8.179   6.284   1.00 6.77  ? 363 PRO B CA   1 
ATOM   8725  C  C    . PRO B 1 332 ? 53.339  7.563   7.395   1.00 5.05  ? 363 PRO B C    1 
ATOM   8726  O  O    . PRO B 1 332 ? 53.037  8.249   8.388   1.00 2.23  ? 363 PRO B O    1 
ATOM   8727  C  CB   . PRO B 1 332 ? 53.443  8.632   5.044   1.00 6.14  ? 363 PRO B CB   1 
ATOM   8728  C  CG   . PRO B 1 332 ? 54.518  8.711   4.008   1.00 4.57  ? 363 PRO B CG   1 
ATOM   8729  C  CD   . PRO B 1 332 ? 55.263  7.417   4.236   1.00 4.33  ? 363 PRO B CD   1 
ATOM   8730  N  N    . GLU B 1 333 ? 53.021  6.266   7.280   1.00 2.55  ? 364 GLU B N    1 
ATOM   8731  C  CA   . GLU B 1 333 ? 52.172  5.587   8.259   1.00 4.83  ? 364 GLU B CA   1 
ATOM   8732  C  C    . GLU B 1 333 ? 52.755  5.555   9.664   1.00 8.04  ? 364 GLU B C    1 
ATOM   8733  O  O    . GLU B 1 333 ? 52.048  5.237   10.637  1.00 8.99  ? 364 GLU B O    1 
ATOM   8734  C  CB   . GLU B 1 333 ? 51.859  4.160   7.829   1.00 3.93  ? 364 GLU B CB   1 
ATOM   8735  C  CG   . GLU B 1 333 ? 51.151  4.091   6.501   1.00 6.44  ? 364 GLU B CG   1 
ATOM   8736  C  CD   . GLU B 1 333 ? 50.482  2.737   6.181   1.00 6.56  ? 364 GLU B CD   1 
ATOM   8737  O  OE1  . GLU B 1 333 ? 50.526  1.772   7.006   1.00 3.78  ? 364 GLU B OE1  1 
ATOM   8738  O  OE2  . GLU B 1 333 ? 49.901  2.669   5.065   1.00 2.57  ? 364 GLU B OE2  1 
ATOM   8739  H  H    . GLU B 1 333 ? 53.343  5.767   6.508   1.00 17.00 ? 364 GLU B H    1 
ATOM   8740  N  N    . LEU B 1 334 ? 54.040  5.883   9.772   1.00 8.06  ? 365 LEU B N    1 
ATOM   8741  C  CA   . LEU B 1 334 ? 54.712  5.845   11.055  1.00 5.21  ? 365 LEU B CA   1 
ATOM   8742  C  C    . LEU B 1 334 ? 54.231  6.971   11.925  1.00 6.07  ? 365 LEU B C    1 
ATOM   8743  O  O    . LEU B 1 334 ? 54.157  6.833   13.138  1.00 9.42  ? 365 LEU B O    1 
ATOM   8744  C  CB   . LEU B 1 334 ? 56.229  5.915   10.866  1.00 3.40  ? 365 LEU B CB   1 
ATOM   8745  C  CG   . LEU B 1 334 ? 56.900  4.812   10.056  1.00 2.10  ? 365 LEU B CG   1 
ATOM   8746  C  CD1  . LEU B 1 334 ? 58.401  5.031   10.085  1.00 2.01  ? 365 LEU B CD1  1 
ATOM   8747  C  CD2  . LEU B 1 334 ? 56.542  3.451   10.624  1.00 2.00  ? 365 LEU B CD2  1 
ATOM   8748  H  H    . LEU B 1 334 ? 54.549  6.139   8.983   1.00 17.00 ? 365 LEU B H    1 
ATOM   8749  N  N    . LEU B 1 335 ? 53.869  8.082   11.300  1.00 5.39  ? 366 LEU B N    1 
ATOM   8750  C  CA   . LEU B 1 335 ? 53.413  9.251   12.055  1.00 5.73  ? 366 LEU B CA   1 
ATOM   8751  C  C    . LEU B 1 335 ? 51.891  9.266   12.254  1.00 5.25  ? 366 LEU B C    1 
ATOM   8752  O  O    . LEU B 1 335 ? 51.360  10.056  13.041  1.00 2.00  ? 366 LEU B O    1 
ATOM   8753  C  CB   . LEU B 1 335 ? 53.913  10.544  11.374  1.00 3.51  ? 366 LEU B CB   1 
ATOM   8754  C  CG   . LEU B 1 335 ? 55.383  10.921  11.581  1.00 2.00  ? 366 LEU B CG   1 
ATOM   8755  C  CD1  . LEU B 1 335 ? 55.819  11.987  10.634  1.00 2.00  ? 366 LEU B CD1  1 
ATOM   8756  C  CD2  . LEU B 1 335 ? 55.592  11.370  13.005  1.00 4.80  ? 366 LEU B CD2  1 
ATOM   8757  H  H    . LEU B 1 335 ? 53.901  8.127   10.318  1.00 17.00 ? 366 LEU B H    1 
ATOM   8758  N  N    . PHE B 1 336 ? 51.211  8.328   11.595  1.00 6.58  ? 367 PHE B N    1 
ATOM   8759  C  CA   . PHE B 1 336 ? 49.756  8.223   11.650  1.00 5.62  ? 367 PHE B CA   1 
ATOM   8760  C  C    . PHE B 1 336 ? 49.164  8.160   13.066  1.00 6.29  ? 367 PHE B C    1 
ATOM   8761  O  O    . PHE B 1 336 ? 48.158  8.794   13.322  1.00 9.51  ? 367 PHE B O    1 
ATOM   8762  C  CB   . PHE B 1 336 ? 49.241  7.059   10.782  1.00 2.99  ? 367 PHE B CB   1 
ATOM   8763  C  CG   . PHE B 1 336 ? 49.288  7.327   9.289   1.00 2.46  ? 367 PHE B CG   1 
ATOM   8764  C  CD1  . PHE B 1 336 ? 49.804  8.532   8.781   1.00 2.00  ? 367 PHE B CD1  1 
ATOM   8765  C  CD2  . PHE B 1 336 ? 48.851  6.353   8.379   1.00 2.00  ? 367 PHE B CD2  1 
ATOM   8766  C  CE1  . PHE B 1 336 ? 49.889  8.749   7.384   1.00 2.00  ? 367 PHE B CE1  1 
ATOM   8767  C  CE2  . PHE B 1 336 ? 48.934  6.569   6.982   1.00 2.00  ? 367 PHE B CE2  1 
ATOM   8768  C  CZ   . PHE B 1 336 ? 49.455  7.762   6.486   1.00 2.00  ? 367 PHE B CZ   1 
ATOM   8769  H  H    . PHE B 1 336 ? 51.708  7.678   11.066  1.00 17.00 ? 367 PHE B H    1 
ATOM   8770  N  N    . ASN B 1 337 ? 49.763  7.437   14.000  1.00 5.49  ? 368 ASN B N    1 
ATOM   8771  C  CA   . ASN B 1 337 ? 49.187  7.404   15.353  1.00 4.98  ? 368 ASN B CA   1 
ATOM   8772  C  C    . ASN B 1 337 ? 49.710  8.505   16.317  1.00 5.53  ? 368 ASN B C    1 
ATOM   8773  O  O    . ASN B 1 337 ? 49.338  8.566   17.503  1.00 2.00  ? 368 ASN B O    1 
ATOM   8774  C  CB   . ASN B 1 337 ? 49.338  5.993   15.961  1.00 8.55  ? 368 ASN B CB   1 
ATOM   8775  C  CG   . ASN B 1 337 ? 50.585  5.828   16.819  1.00 5.15  ? 368 ASN B CG   1 
ATOM   8776  O  OD1  . ASN B 1 337 ? 51.712  5.939   16.341  1.00 3.92  ? 368 ASN B OD1  1 
ATOM   8777  N  ND2  . ASN B 1 337 ? 50.375  5.547   18.096  1.00 4.25  ? 368 ASN B ND2  1 
ATOM   8778  H  H    . ASN B 1 337 ? 50.597  6.953   13.809  1.00 17.00 ? 368 ASN B H    1 
ATOM   8779  H  HD21 . ASN B 1 337 ? 51.146  5.429   18.681  1.00 17.00 ? 368 ASN B HD21 1 
ATOM   8780  H  HD22 . ASN B 1 337 ? 49.443  5.480   18.393  1.00 17.00 ? 368 ASN B HD22 1 
ATOM   8781  N  N    . GLN B 1 338 ? 50.563  9.383   15.797  1.00 5.99  ? 369 GLN B N    1 
ATOM   8782  C  CA   . GLN B 1 338 ? 51.130  10.462  16.599  1.00 7.34  ? 369 GLN B CA   1 
ATOM   8783  C  C    . GLN B 1 338 ? 50.611  11.842  16.167  1.00 7.07  ? 369 GLN B C    1 
ATOM   8784  O  O    . GLN B 1 338 ? 50.127  12.030  15.032  1.00 7.26  ? 369 GLN B O    1 
ATOM   8785  C  CB   . GLN B 1 338 ? 52.657  10.458  16.513  1.00 6.87  ? 369 GLN B CB   1 
ATOM   8786  C  CG   . GLN B 1 338 ? 53.341  10.138  17.794  1.00 2.00  ? 369 GLN B CG   1 
ATOM   8787  C  CD   . GLN B 1 338 ? 53.945  8.840   17.666  1.00 4.44  ? 369 GLN B CD   1 
ATOM   8788  O  OE1  . GLN B 1 338 ? 54.348  8.464   16.568  1.00 7.77  ? 369 GLN B OE1  1 
ATOM   8789  N  NE2  . GLN B 1 338 ? 53.984  8.088   18.750  1.00 8.28  ? 369 GLN B NE2  1 
ATOM   8790  H  H    . GLN B 1 338 ? 50.812  9.355   14.848  1.00 17.00 ? 369 GLN B H    1 
ATOM   8791  H  HE21 . GLN B 1 338 ? 54.366  7.198   18.615  1.00 17.00 ? 369 GLN B HE21 1 
ATOM   8792  H  HE22 . GLN B 1 338 ? 53.631  8.424   19.595  1.00 17.00 ? 369 GLN B HE22 1 
ATOM   8793  N  N    . GLN B 1 339 ? 50.714  12.801  17.079  1.00 2.00  ? 370 GLN B N    1 
ATOM   8794  C  CA   . GLN B 1 339 ? 50.273  14.121  16.764  1.00 2.72  ? 370 GLN B CA   1 
ATOM   8795  C  C    . GLN B 1 339 ? 51.307  14.599  15.752  1.00 4.76  ? 370 GLN B C    1 
ATOM   8796  O  O    . GLN B 1 339 ? 52.509  14.416  15.952  1.00 5.21  ? 370 GLN B O    1 
ATOM   8797  C  CB   . GLN B 1 339 ? 50.307  14.992  18.007  1.00 5.17  ? 370 GLN B CB   1 
ATOM   8798  C  CG   . GLN B 1 339 ? 49.802  14.309  19.269  1.00 7.67  ? 370 GLN B CG   1 
ATOM   8799  C  CD   . GLN B 1 339 ? 49.722  15.272  20.453  1.00 10.29 ? 370 GLN B CD   1 
ATOM   8800  O  OE1  . GLN B 1 339 ? 50.562  15.235  21.357  1.00 12.52 ? 370 GLN B OE1  1 
ATOM   8801  N  NE2  . GLN B 1 339 ? 48.722  16.153  20.439  1.00 11.84 ? 370 GLN B NE2  1 
ATOM   8802  H  H    . GLN B 1 339 ? 51.145  12.600  17.931  1.00 17.00 ? 370 GLN B H    1 
ATOM   8803  H  HE21 . GLN B 1 339 ? 48.700  16.773  21.205  1.00 17.00 ? 370 GLN B HE21 1 
ATOM   8804  H  HE22 . GLN B 1 339 ? 48.054  16.195  19.725  1.00 17.00 ? 370 GLN B HE22 1 
ATOM   8805  N  N    . PHE B 1 340 ? 50.841  15.176  14.651  1.00 4.94  ? 371 PHE B N    1 
ATOM   8806  C  CA   . PHE B 1 340 ? 51.717  15.669  13.609  1.00 2.54  ? 371 PHE B CA   1 
ATOM   8807  C  C    . PHE B 1 340 ? 50.915  16.674  12.792  1.00 2.75  ? 371 PHE B C    1 
ATOM   8808  O  O    . PHE B 1 340 ? 49.709  16.562  12.721  1.00 3.33  ? 371 PHE B O    1 
ATOM   8809  C  CB   . PHE B 1 340 ? 52.162  14.512  12.730  1.00 2.00  ? 371 PHE B CB   1 
ATOM   8810  C  CG   . PHE B 1 340 ? 53.102  14.912  11.672  1.00 2.70  ? 371 PHE B CG   1 
ATOM   8811  C  CD1  . PHE B 1 340 ? 54.377  15.371  11.997  1.00 4.00  ? 371 PHE B CD1  1 
ATOM   8812  C  CD2  . PHE B 1 340 ? 52.697  14.922  10.348  1.00 4.18  ? 371 PHE B CD2  1 
ATOM   8813  C  CE1  . PHE B 1 340 ? 55.236  15.851  11.013  1.00 3.29  ? 371 PHE B CE1  1 
ATOM   8814  C  CE2  . PHE B 1 340 ? 53.548  15.392  9.351   1.00 4.69  ? 371 PHE B CE2  1 
ATOM   8815  C  CZ   . PHE B 1 340 ? 54.824  15.863  9.691   1.00 4.09  ? 371 PHE B CZ   1 
ATOM   8816  H  H    . PHE B 1 340 ? 49.881  15.259  14.482  1.00 17.00 ? 371 PHE B H    1 
ATOM   8817  N  N    . GLN B 1 341 ? 51.557  17.716  12.275  1.00 3.06  ? 372 GLN B N    1 
ATOM   8818  C  CA   . GLN B 1 341 ? 50.864  18.702  11.460  1.00 3.28  ? 372 GLN B CA   1 
ATOM   8819  C  C    . GLN B 1 341 ? 51.328  18.505  10.040  1.00 4.46  ? 372 GLN B C    1 
ATOM   8820  O  O    . GLN B 1 341 ? 52.498  18.699  9.740   1.00 7.10  ? 372 GLN B O    1 
ATOM   8821  C  CB   . GLN B 1 341 ? 51.217  20.119  11.875  1.00 2.35  ? 372 GLN B CB   1 
ATOM   8822  C  CG   . GLN B 1 341 ? 50.880  20.436  13.315  1.00 6.47  ? 372 GLN B CG   1 
ATOM   8823  C  CD   . GLN B 1 341 ? 49.397  20.289  13.622  1.00 5.52  ? 372 GLN B CD   1 
ATOM   8824  O  OE1  . GLN B 1 341 ? 48.544  20.645  12.803  1.00 3.93  ? 372 GLN B OE1  1 
ATOM   8825  N  NE2  . GLN B 1 341 ? 49.087  19.762  14.809  1.00 6.41  ? 372 GLN B NE2  1 
ATOM   8826  H  H    . GLN B 1 341 ? 52.522  17.836  12.396  1.00 17.00 ? 372 GLN B H    1 
ATOM   8827  H  HE21 . GLN B 1 341 ? 48.136  19.600  14.981  1.00 17.00 ? 372 GLN B HE21 1 
ATOM   8828  H  HE22 . GLN B 1 341 ? 49.803  19.546  15.432  1.00 17.00 ? 372 GLN B HE22 1 
ATOM   8829  N  N    . TYR B 1 342 ? 50.447  18.036  9.174   1.00 4.40  ? 373 TYR B N    1 
ATOM   8830  C  CA   . TYR B 1 342 ? 50.821  17.863  7.787   1.00 2.70  ? 373 TYR B CA   1 
ATOM   8831  C  C    . TYR B 1 342 ? 50.688  19.254  7.190   1.00 3.66  ? 373 TYR B C    1 
ATOM   8832  O  O    . TYR B 1 342 ? 49.846  19.534  6.340   1.00 2.89  ? 373 TYR B O    1 
ATOM   8833  C  CB   . TYR B 1 342 ? 49.917  16.846  7.132   1.00 2.00  ? 373 TYR B CB   1 
ATOM   8834  C  CG   . TYR B 1 342 ? 50.066  15.500  7.777   1.00 3.22  ? 373 TYR B CG   1 
ATOM   8835  C  CD1  . TYR B 1 342 ? 49.329  15.153  8.908   1.00 2.71  ? 373 TYR B CD1  1 
ATOM   8836  C  CD2  . TYR B 1 342 ? 50.956  14.550  7.252   1.00 5.69  ? 373 TYR B CD2  1 
ATOM   8837  C  CE1  . TYR B 1 342 ? 49.468  13.885  9.499   1.00 2.49  ? 373 TYR B CE1  1 
ATOM   8838  C  CE2  . TYR B 1 342 ? 51.103  13.287  7.830   1.00 3.46  ? 373 TYR B CE2  1 
ATOM   8839  C  CZ   . TYR B 1 342 ? 50.354  12.961  8.949   1.00 2.58  ? 373 TYR B CZ   1 
ATOM   8840  O  OH   . TYR B 1 342 ? 50.472  11.701  9.484   1.00 3.13  ? 373 TYR B OH   1 
ATOM   8841  H  H    . TYR B 1 342 ? 49.529  17.849  9.480   1.00 17.00 ? 373 TYR B H    1 
ATOM   8842  H  HH   . TYR B 1 342 ? 51.046  11.177  8.914   1.00 17.00 ? 373 TYR B HH   1 
ATOM   8843  N  N    . GLN B 1 343 ? 51.545  20.130  7.688   1.00 4.89  ? 374 GLN B N    1 
ATOM   8844  C  CA   . GLN B 1 343 ? 51.602  21.518  7.288   1.00 6.28  ? 374 GLN B CA   1 
ATOM   8845  C  C    . GLN B 1 343 ? 53.066  22.021  7.496   1.00 7.65  ? 374 GLN B C    1 
ATOM   8846  O  O    . GLN B 1 343 ? 53.771  21.628  8.462   1.00 3.56  ? 374 GLN B O    1 
ATOM   8847  C  CB   . GLN B 1 343 ? 50.607  22.300  8.161   1.00 6.85  ? 374 GLN B CB   1 
ATOM   8848  C  CG   . GLN B 1 343 ? 50.937  23.777  8.426   1.00 5.46  ? 374 GLN B CG   1 
ATOM   8849  C  CD   . GLN B 1 343 ? 50.160  24.374  9.598   1.00 4.25  ? 374 GLN B CD   1 
ATOM   8850  O  OE1  . GLN B 1 343 ? 49.920  25.559  9.623   1.00 5.74  ? 374 GLN B OE1  1 
ATOM   8851  N  NE2  . GLN B 1 343 ? 49.786  23.557  10.571  1.00 2.92  ? 374 GLN B NE2  1 
ATOM   8852  H  H    . GLN B 1 343 ? 52.250  19.860  8.316   1.00 17.00 ? 374 GLN B H    1 
ATOM   8853  H  HE21 . GLN B 1 343 ? 49.244  23.967  11.276  1.00 17.00 ? 374 GLN B HE21 1 
ATOM   8854  H  HE22 . GLN B 1 343 ? 50.021  22.609  10.564  1.00 17.00 ? 374 GLN B HE22 1 
ATOM   8855  N  N    . ASN B 1 344 ? 53.493  22.929  6.620   1.00 6.19  ? 375 ASN B N    1 
ATOM   8856  C  CA   . ASN B 1 344 ? 54.830  23.485  6.696   1.00 5.57  ? 375 ASN B CA   1 
ATOM   8857  C  C    . ASN B 1 344 ? 54.955  24.921  6.180   1.00 5.39  ? 375 ASN B C    1 
ATOM   8858  O  O    . ASN B 1 344 ? 54.173  25.375  5.362   1.00 4.99  ? 375 ASN B O    1 
ATOM   8859  C  CB   . ASN B 1 344 ? 55.788  22.584  5.923   1.00 5.84  ? 375 ASN B CB   1 
ATOM   8860  C  CG   . ASN B 1 344 ? 57.204  23.084  5.946   1.00 3.62  ? 375 ASN B CG   1 
ATOM   8861  O  OD1  . ASN B 1 344 ? 57.898  22.970  6.955   1.00 6.32  ? 375 ASN B OD1  1 
ATOM   8862  N  ND2  . ASN B 1 344 ? 57.638  23.658  4.837   1.00 2.20  ? 375 ASN B ND2  1 
ATOM   8863  H  H    . ASN B 1 344 ? 52.914  23.254  5.900   1.00 17.00 ? 375 ASN B H    1 
ATOM   8864  H  HD21 . ASN B 1 344 ? 58.554  23.993  4.852   1.00 17.00 ? 375 ASN B HD21 1 
ATOM   8865  H  HD22 . ASN B 1 344 ? 57.012  23.703  4.075   1.00 17.00 ? 375 ASN B HD22 1 
ATOM   8866  N  N    . ARG B 1 345 ? 55.955  25.627  6.676   1.00 3.72  ? 376 ARG B N    1 
ATOM   8867  C  CA   . ARG B 1 345 ? 56.218  26.974  6.244   1.00 5.52  ? 376 ARG B CA   1 
ATOM   8868  C  C    . ARG B 1 345 ? 57.718  27.118  6.376   1.00 7.52  ? 376 ARG B C    1 
ATOM   8869  O  O    . ARG B 1 345 ? 58.217  27.047  7.501   1.00 7.27  ? 376 ARG B O    1 
ATOM   8870  C  CB   . ARG B 1 345 ? 55.551  27.949  7.174   1.00 5.69  ? 376 ARG B CB   1 
ATOM   8871  C  CG   . ARG B 1 345 ? 55.575  29.340  6.631   1.00 3.95  ? 376 ARG B CG   1 
ATOM   8872  C  CD   . ARG B 1 345 ? 54.325  29.612  5.863   1.00 2.00  ? 376 ARG B CD   1 
ATOM   8873  N  NE   . ARG B 1 345 ? 53.636  30.726  6.485   1.00 3.77  ? 376 ARG B NE   1 
ATOM   8874  C  CZ   . ARG B 1 345 ? 52.440  30.653  7.036   1.00 2.71  ? 376 ARG B CZ   1 
ATOM   8875  N  NH1  . ARG B 1 345 ? 51.788  29.510  7.017   1.00 8.19  ? 376 ARG B NH1  1 
ATOM   8876  N  NH2  . ARG B 1 345 ? 51.948  31.686  7.688   1.00 2.06  ? 376 ARG B NH2  1 
ATOM   8877  H  H    . ARG B 1 345 ? 56.540  25.229  7.362   1.00 17.00 ? 376 ARG B H    1 
ATOM   8878  H  HE   . ARG B 1 345 ? 54.094  31.592  6.503   1.00 17.00 ? 376 ARG B HE   1 
ATOM   8879  H  HH11 . ARG B 1 345 ? 52.187  28.700  6.591   1.00 17.00 ? 376 ARG B HH11 1 
ATOM   8880  H  HH12 . ARG B 1 345 ? 50.884  29.454  7.443   1.00 17.00 ? 376 ARG B HH12 1 
ATOM   8881  H  HH21 . ARG B 1 345 ? 52.462  32.539  7.783   1.00 17.00 ? 376 ARG B HH21 1 
ATOM   8882  H  HH22 . ARG B 1 345 ? 51.060  31.566  8.124   1.00 17.00 ? 376 ARG B HH22 1 
ATOM   8883  N  N    . ILE B 1 346 ? 58.426  27.289  5.242   1.00 7.94  ? 377 ILE B N    1 
ATOM   8884  C  CA   . ILE B 1 346 ? 59.892  27.384  5.237   1.00 5.03  ? 377 ILE B CA   1 
ATOM   8885  C  C    . ILE B 1 346 ? 60.408  28.682  5.841   1.00 4.12  ? 377 ILE B C    1 
ATOM   8886  O  O    . ILE B 1 346 ? 59.903  29.757  5.562   1.00 2.00  ? 377 ILE B O    1 
ATOM   8887  C  CB   . ILE B 1 346 ? 60.516  27.130  3.834   1.00 3.78  ? 377 ILE B CB   1 
ATOM   8888  C  CG1  . ILE B 1 346 ? 60.214  28.296  2.919   1.00 4.77  ? 377 ILE B CG1  1 
ATOM   8889  C  CG2  . ILE B 1 346 ? 60.006  25.836  3.233   1.00 2.00  ? 377 ILE B CG2  1 
ATOM   8890  C  CD1  . ILE B 1 346 ? 60.591  28.061  1.520   1.00 6.39  ? 377 ILE B CD1  1 
ATOM   8891  H  H    . ILE B 1 346 ? 57.972  27.287  4.383   1.00 17.00 ? 377 ILE B H    1 
ATOM   8892  N  N    . ALA B 1 347 ? 61.366  28.524  6.744   1.00 6.56  ? 378 ALA B N    1 
ATOM   8893  C  CA   . ALA B 1 347 ? 61.999  29.614  7.474   1.00 7.72  ? 378 ALA B CA   1 
ATOM   8894  C  C    . ALA B 1 347 ? 63.141  30.230  6.686   1.00 8.45  ? 378 ALA B C    1 
ATOM   8895  O  O    . ALA B 1 347 ? 63.573  29.655  5.678   1.00 7.07  ? 378 ALA B O    1 
ATOM   8896  C  CB   . ALA B 1 347 ? 62.543  29.073  8.821   1.00 8.59  ? 378 ALA B CB   1 
ATOM   8897  H  H    . ALA B 1 347 ? 61.680  27.613  6.914   1.00 17.00 ? 378 ALA B H    1 
ATOM   8898  N  N    . SER B 1 348 ? 63.632  31.385  7.149   1.00 7.49  ? 379 SER B N    1 
ATOM   8899  C  CA   . SER B 1 348 ? 64.773  32.029  6.503   1.00 7.26  ? 379 SER B CA   1 
ATOM   8900  C  C    . SER B 1 348 ? 66.059  31.334  6.920   1.00 8.52  ? 379 SER B C    1 
ATOM   8901  O  O    . SER B 1 348 ? 66.968  31.185  6.106   1.00 8.50  ? 379 SER B O    1 
ATOM   8902  C  CB   . SER B 1 348 ? 64.865  33.518  6.822   1.00 7.56  ? 379 SER B CB   1 
ATOM   8903  O  OG   . SER B 1 348 ? 63.957  33.911  7.826   1.00 10.98 ? 379 SER B OG   1 
ATOM   8904  H  H    . SER B 1 348 ? 63.192  31.865  7.887   1.00 17.00 ? 379 SER B H    1 
ATOM   8905  H  HG   . SER B 1 348 ? 63.961  34.871  7.861   1.00 17.00 ? 379 SER B HG   1 
ATOM   8906  N  N    . GLU B 1 349 ? 66.109  30.860  8.168   1.00 8.64  ? 380 GLU B N    1 
ATOM   8907  C  CA   . GLU B 1 349 ? 67.294  30.153  8.690   1.00 6.89  ? 380 GLU B CA   1 
ATOM   8908  C  C    . GLU B 1 349 ? 67.580  28.951  7.809   1.00 6.02  ? 380 GLU B C    1 
ATOM   8909  O  O    . GLU B 1 349 ? 68.673  28.795  7.284   1.00 8.07  ? 380 GLU B O    1 
ATOM   8910  C  CB   . GLU B 1 349 ? 67.099  29.660  10.141  1.00 7.87  ? 380 GLU B CB   1 
ATOM   8911  C  CG   . GLU B 1 349 ? 65.897  30.222  10.891  1.00 5.43  ? 380 GLU B CG   1 
ATOM   8912  C  CD   . GLU B 1 349 ? 66.026  31.668  11.174  1.00 2.04  ? 380 GLU B CD   1 
ATOM   8913  O  OE1  . GLU B 1 349 ? 66.518  32.406  10.323  1.00 2.00  ? 380 GLU B OE1  1 
ATOM   8914  O  OE2  . GLU B 1 349 ? 65.623  32.078  12.261  1.00 3.25  ? 380 GLU B OE2  1 
ATOM   8915  H  H    . GLU B 1 349 ? 65.309  31.029  8.703   1.00 17.00 ? 380 GLU B H    1 
ATOM   8916  N  N    . PHE B 1 350 ? 66.587  28.101  7.634   1.00 4.40  ? 381 PHE B N    1 
ATOM   8917  C  CA   . PHE B 1 350 ? 66.778  26.930  6.791   1.00 4.26  ? 381 PHE B CA   1 
ATOM   8918  C  C    . PHE B 1 350 ? 67.437  27.355  5.460   1.00 2.66  ? 381 PHE B C    1 
ATOM   8919  O  O    . PHE B 1 350 ? 68.380  26.732  4.997   1.00 2.61  ? 381 PHE B O    1 
ATOM   8920  C  CB   . PHE B 1 350 ? 65.430  26.234  6.559   1.00 3.48  ? 381 PHE B CB   1 
ATOM   8921  C  CG   . PHE B 1 350 ? 65.547  24.804  6.184   1.00 2.00  ? 381 PHE B CG   1 
ATOM   8922  C  CD1  . PHE B 1 350 ? 66.173  23.914  7.025   1.00 2.00  ? 381 PHE B CD1  1 
ATOM   8923  C  CD2  . PHE B 1 350 ? 65.053  24.351  4.965   1.00 2.92  ? 381 PHE B CD2  1 
ATOM   8924  C  CE1  . PHE B 1 350 ? 66.309  22.605  6.674   1.00 2.00  ? 381 PHE B CE1  1 
ATOM   8925  C  CE2  . PHE B 1 350 ? 65.187  23.024  4.596   1.00 2.00  ? 381 PHE B CE2  1 
ATOM   8926  C  CZ   . PHE B 1 350 ? 65.813  22.159  5.452   1.00 2.65  ? 381 PHE B CZ   1 
ATOM   8927  H  H    . PHE B 1 350 ? 65.724  28.243  8.060   1.00 17.00 ? 381 PHE B H    1 
ATOM   8928  N  N    . ASN B 1 351 ? 66.976  28.463  4.899   1.00 2.00  ? 382 ASN B N    1 
ATOM   8929  C  CA   . ASN B 1 351 ? 67.520  28.975  3.659   1.00 2.38  ? 382 ASN B CA   1 
ATOM   8930  C  C    . ASN B 1 351 ? 68.981  29.337  3.866   1.00 2.58  ? 382 ASN B C    1 
ATOM   8931  O  O    . ASN B 1 351 ? 69.880  28.749  3.248   1.00 2.00  ? 382 ASN B O    1 
ATOM   8932  C  CB   . ASN B 1 351 ? 66.702  30.183  3.197   1.00 2.46  ? 382 ASN B CB   1 
ATOM   8933  C  CG   . ASN B 1 351 ? 67.292  30.874  1.990   1.00 2.00  ? 382 ASN B CG   1 
ATOM   8934  O  OD1  . ASN B 1 351 ? 68.056  31.805  2.138   1.00 2.98  ? 382 ASN B OD1  1 
ATOM   8935  N  ND2  . ASN B 1 351 ? 66.913  30.453  0.801   1.00 2.00  ? 382 ASN B ND2  1 
ATOM   8936  H  H    . ASN B 1 351 ? 66.258  28.958  5.339   1.00 17.00 ? 382 ASN B H    1 
ATOM   8937  H  HD21 . ASN B 1 351 ? 67.336  30.905  0.044   1.00 17.00 ? 382 ASN B HD21 1 
ATOM   8938  H  HD22 . ASN B 1 351 ? 66.254  29.750  0.702   1.00 17.00 ? 382 ASN B HD22 1 
ATOM   8939  N  N    . THR B 1 352 ? 69.219  30.273  4.768   1.00 2.00  ? 383 THR B N    1 
ATOM   8940  C  CA   . THR B 1 352 ? 70.562  30.704  5.063   1.00 2.01  ? 383 THR B CA   1 
ATOM   8941  C  C    . THR B 1 352 ? 71.486  29.505  5.307   1.00 2.62  ? 383 THR B C    1 
ATOM   8942  O  O    . THR B 1 352 ? 72.302  29.187  4.447   1.00 3.13  ? 383 THR B O    1 
ATOM   8943  C  CB   . THR B 1 352 ? 70.565  31.757  6.216   1.00 2.03  ? 383 THR B CB   1 
ATOM   8944  O  OG1  . THR B 1 352 ? 70.689  33.079  5.663   1.00 2.00  ? 383 THR B OG1  1 
ATOM   8945  C  CG2  . THR B 1 352 ? 71.679  31.505  7.212   1.00 2.25  ? 383 THR B CG2  1 
ATOM   8946  H  H    . THR B 1 352 ? 68.481  30.697  5.234   1.00 17.00 ? 383 THR B H    1 
ATOM   8947  H  HG1  . THR B 1 352 ? 70.747  33.759  6.349   1.00 17.00 ? 383 THR B HG1  1 
ATOM   8948  N  N    . LEU B 1 353 ? 71.281  28.767  6.395   1.00 2.59  ? 384 LEU B N    1 
ATOM   8949  C  CA   . LEU B 1 353 ? 72.119  27.615  6.724   1.00 2.00  ? 384 LEU B CA   1 
ATOM   8950  C  C    . LEU B 1 353 ? 72.274  26.561  5.618   1.00 3.22  ? 384 LEU B C    1 
ATOM   8951  O  O    . LEU B 1 353 ? 73.118  25.665  5.717   1.00 2.00  ? 384 LEU B O    1 
ATOM   8952  C  CB   . LEU B 1 353 ? 71.612  26.947  7.998   1.00 2.32  ? 384 LEU B CB   1 
ATOM   8953  C  CG   . LEU B 1 353 ? 70.486  25.913  7.995   1.00 2.03  ? 384 LEU B CG   1 
ATOM   8954  C  CD1  . LEU B 1 353 ? 70.996  24.544  7.586   1.00 3.91  ? 384 LEU B CD1  1 
ATOM   8955  C  CD2  . LEU B 1 353 ? 69.950  25.845  9.414   1.00 2.02  ? 384 LEU B CD2  1 
ATOM   8956  H  H    . LEU B 1 353 ? 70.527  28.976  6.979   1.00 17.00 ? 384 LEU B H    1 
ATOM   8957  N  N    . TYR B 1 354 ? 71.458  26.650  4.574   1.00 4.68  ? 385 TYR B N    1 
ATOM   8958  C  CA   . TYR B 1 354 ? 71.541  25.683  3.490   1.00 5.00  ? 385 TYR B CA   1 
ATOM   8959  C  C    . TYR B 1 354 ? 72.446  26.144  2.366   1.00 5.34  ? 385 TYR B C    1 
ATOM   8960  O  O    . TYR B 1 354 ? 72.529  25.486  1.313   1.00 6.84  ? 385 TYR B O    1 
ATOM   8961  C  CB   . TYR B 1 354 ? 70.153  25.369  2.932   1.00 4.21  ? 385 TYR B CB   1 
ATOM   8962  C  CG   . TYR B 1 354 ? 69.850  23.884  2.835   1.00 3.51  ? 385 TYR B CG   1 
ATOM   8963  C  CD1  . TYR B 1 354 ? 70.272  23.127  1.742   1.00 2.18  ? 385 TYR B CD1  1 
ATOM   8964  C  CD2  . TYR B 1 354 ? 69.150  23.235  3.849   1.00 2.00  ? 385 TYR B CD2  1 
ATOM   8965  C  CE1  . TYR B 1 354 ? 70.003  21.772  1.678   1.00 2.00  ? 385 TYR B CE1  1 
ATOM   8966  C  CE2  . TYR B 1 354 ? 68.885  21.887  3.782   1.00 2.00  ? 385 TYR B CE2  1 
ATOM   8967  C  CZ   . TYR B 1 354 ? 69.311  21.167  2.711   1.00 2.00  ? 385 TYR B CZ   1 
ATOM   8968  O  OH   . TYR B 1 354 ? 69.061  19.829  2.698   1.00 3.19  ? 385 TYR B OH   1 
ATOM   8969  H  H    . TYR B 1 354 ? 70.757  27.334  4.529   1.00 17.00 ? 385 TYR B H    1 
ATOM   8970  H  HH   . TYR B 1 354 ? 69.478  19.436  1.915   1.00 17.00 ? 385 TYR B HH   1 
ATOM   8971  N  N    . HIS B 1 355 ? 73.077  27.296  2.550   1.00 4.68  ? 386 HIS B N    1 
ATOM   8972  C  CA   . HIS B 1 355 ? 73.988  27.808  1.544   1.00 4.85  ? 386 HIS B CA   1 
ATOM   8973  C  C    . HIS B 1 355 ? 75.253  26.953  1.600   1.00 6.42  ? 386 HIS B C    1 
ATOM   8974  O  O    . HIS B 1 355 ? 76.229  27.308  2.263   1.00 8.20  ? 386 HIS B O    1 
ATOM   8975  C  CB   . HIS B 1 355 ? 74.320  29.263  1.831   1.00 6.45  ? 386 HIS B CB   1 
ATOM   8976  C  CG   . HIS B 1 355 ? 73.150  30.190  1.691   1.00 7.48  ? 386 HIS B CG   1 
ATOM   8977  N  ND1  . HIS B 1 355 ? 71.863  29.744  1.485   1.00 7.21  ? 386 HIS B ND1  1 
ATOM   8978  C  CD2  . HIS B 1 355 ? 73.081  31.543  1.713   1.00 7.23  ? 386 HIS B CD2  1 
ATOM   8979  C  CE1  . HIS B 1 355 ? 71.055  30.783  1.383   1.00 6.65  ? 386 HIS B CE1  1 
ATOM   8980  N  NE2  . HIS B 1 355 ? 71.768  31.884  1.515   1.00 7.46  ? 386 HIS B NE2  1 
ATOM   8981  H  H    . HIS B 1 355 ? 72.951  27.765  3.400   1.00 17.00 ? 386 HIS B H    1 
ATOM   8982  H  HD1  . HIS B 1 355 ? 71.540  28.820  1.532   1.00 17.00 ? 386 HIS B HD1  1 
ATOM   8983  H  HE2  . HIS B 1 355 ? 71.415  32.800  1.431   1.00 17.00 ? 386 HIS B HE2  1 
ATOM   8984  N  N    . TRP B 1 356 ? 75.223  25.816  0.913   1.00 4.96  ? 387 TRP B N    1 
ATOM   8985  C  CA   . TRP B 1 356 ? 76.344  24.909  0.900   1.00 3.51  ? 387 TRP B CA   1 
ATOM   8986  C  C    . TRP B 1 356 ? 77.255  25.049  -0.300  1.00 6.17  ? 387 TRP B C    1 
ATOM   8987  O  O    . TRP B 1 356 ? 77.589  24.037  -0.960  1.00 5.41  ? 387 TRP B O    1 
ATOM   8988  C  CB   . TRP B 1 356 ? 75.871  23.478  0.999   1.00 3.86  ? 387 TRP B CB   1 
ATOM   8989  C  CG   . TRP B 1 356 ? 75.126  23.186  2.228   1.00 6.11  ? 387 TRP B CG   1 
ATOM   8990  C  CD1  . TRP B 1 356 ? 75.033  23.976  3.351   1.00 5.43  ? 387 TRP B CD1  1 
ATOM   8991  C  CD2  . TRP B 1 356 ? 74.361  22.005  2.495   1.00 5.91  ? 387 TRP B CD2  1 
ATOM   8992  N  NE1  . TRP B 1 356 ? 74.253  23.353  4.300   1.00 6.13  ? 387 TRP B NE1  1 
ATOM   8993  C  CE2  . TRP B 1 356 ? 73.833  22.139  3.808   1.00 6.28  ? 387 TRP B CE2  1 
ATOM   8994  C  CE3  . TRP B 1 356 ? 74.074  20.845  1.759   1.00 2.00  ? 387 TRP B CE3  1 
ATOM   8995  C  CZ2  . TRP B 1 356 ? 73.036  21.147  4.402   1.00 2.85  ? 387 TRP B CZ2  1 
ATOM   8996  C  CZ3  . TRP B 1 356 ? 73.284  19.861  2.351   1.00 3.91  ? 387 TRP B CZ3  1 
ATOM   8997  C  CH2  . TRP B 1 356 ? 72.776  20.020  3.663   1.00 2.88  ? 387 TRP B CH2  1 
ATOM   8998  H  H    . TRP B 1 356 ? 74.410  25.562  0.423   1.00 17.00 ? 387 TRP B H    1 
ATOM   8999  H  HE1  . TRP B 1 356 ? 73.993  23.768  5.158   1.00 17.00 ? 387 TRP B HE1  1 
ATOM   9000  N  N    . HIS B 1 357 ? 77.673  26.295  -0.568  1.00 6.40  ? 388 HIS B N    1 
ATOM   9001  C  CA   . HIS B 1 357 ? 78.631  26.596  -1.642  1.00 6.74  ? 388 HIS B CA   1 
ATOM   9002  C  C    . HIS B 1 357 ? 79.966  25.853  -1.343  1.00 6.07  ? 388 HIS B C    1 
ATOM   9003  O  O    . HIS B 1 357 ? 80.704  25.493  -2.260  1.00 4.34  ? 388 HIS B O    1 
ATOM   9004  C  CB   . HIS B 1 357 ? 78.826  28.104  -1.768  1.00 6.75  ? 388 HIS B CB   1 
ATOM   9005  C  CG   . HIS B 1 357 ? 77.492  28.741  -2.153  1.00 8.71  ? 388 HIS B CG   1 
ATOM   9006  N  ND1  . HIS B 1 357 ? 76.670  29.453  -1.271  1.00 7.60  ? 388 HIS B ND1  1 
ATOM   9007  C  CD2  . HIS B 1 357 ? 76.875  28.589  -3.397  1.00 7.57  ? 388 HIS B CD2  1 
ATOM   9008  C  CE1  . HIS B 1 357 ? 75.561  29.690  -2.003  1.00 4.65  ? 388 HIS B CE1  1 
ATOM   9009  N  NE2  . HIS B 1 357 ? 75.649  29.216  -3.208  1.00 3.76  ? 388 HIS B NE2  1 
ATOM   9010  H  H    . HIS B 1 357 ? 77.340  27.021  -0.010  1.00 17.00 ? 388 HIS B H    1 
ATOM   9011  H  HD1  . HIS B 1 357 ? 76.865  29.747  -0.356  1.00 17.00 ? 388 HIS B HD1  1 
ATOM   9012  N  N    . PRO B 1 358 ? 80.314  25.671  -0.045  1.00 5.59  ? 389 PRO B N    1 
ATOM   9013  C  CA   . PRO B 1 358 ? 81.543  24.948  0.257   1.00 4.63  ? 389 PRO B CA   1 
ATOM   9014  C  C    . PRO B 1 358 ? 81.574  23.572  -0.401  1.00 6.19  ? 389 PRO B C    1 
ATOM   9015  O  O    . PRO B 1 358 ? 82.617  22.924  -0.443  1.00 8.22  ? 389 PRO B O    1 
ATOM   9016  C  CB   . PRO B 1 358 ? 81.493  24.854  1.774   1.00 3.05  ? 389 PRO B CB   1 
ATOM   9017  C  CG   . PRO B 1 358 ? 81.039  26.203  2.122   1.00 2.00  ? 389 PRO B CG   1 
ATOM   9018  C  CD   . PRO B 1 358 ? 79.903  26.450  1.146   1.00 3.64  ? 389 PRO B CD   1 
ATOM   9019  N  N    . LEU B 1 359 ? 80.427  23.108  -0.885  1.00 6.75  ? 390 LEU B N    1 
ATOM   9020  C  CA   . LEU B 1 359 ? 80.351  21.824  -1.574  1.00 7.83  ? 390 LEU B CA   1 
ATOM   9021  C  C    . LEU B 1 359 ? 81.068  21.896  -2.930  1.00 7.39  ? 390 LEU B C    1 
ATOM   9022  O  O    . LEU B 1 359 ? 81.664  20.921  -3.388  1.00 6.80  ? 390 LEU B O    1 
ATOM   9023  C  CB   . LEU B 1 359 ? 78.886  21.454  -1.791  1.00 10.35 ? 390 LEU B CB   1 
ATOM   9024  C  CG   . LEU B 1 359 ? 78.194  20.799  -0.600  1.00 12.34 ? 390 LEU B CG   1 
ATOM   9025  C  CD1  . LEU B 1 359 ? 76.672  20.839  -0.809  1.00 14.40 ? 390 LEU B CD1  1 
ATOM   9026  C  CD2  . LEU B 1 359 ? 78.690  19.356  -0.468  1.00 10.93 ? 390 LEU B CD2  1 
ATOM   9027  H  H    . LEU B 1 359 ? 79.593  23.595  -0.767  1.00 17.00 ? 390 LEU B H    1 
ATOM   9028  N  N    . LEU B 1 360 ? 81.019  23.085  -3.529  1.00 8.39  ? 391 LEU B N    1 
ATOM   9029  C  CA   . LEU B 1 360 ? 81.594  23.419  -4.842  1.00 7.52  ? 391 LEU B CA   1 
ATOM   9030  C  C    . LEU B 1 360 ? 83.086  23.226  -5.122  1.00 8.63  ? 391 LEU B C    1 
ATOM   9031  O  O    . LEU B 1 360 ? 83.937  23.834  -4.464  1.00 8.33  ? 391 LEU B O    1 
ATOM   9032  C  CB   . LEU B 1 360 ? 81.241  24.849  -5.179  1.00 5.26  ? 391 LEU B CB   1 
ATOM   9033  C  CG   . LEU B 1 360 ? 79.771  25.025  -5.465  1.00 3.71  ? 391 LEU B CG   1 
ATOM   9034  C  CD1  . LEU B 1 360 ? 79.525  26.506  -5.595  1.00 5.61  ? 391 LEU B CD1  1 
ATOM   9035  C  CD2  . LEU B 1 360 ? 79.422  24.266  -6.736  1.00 4.10  ? 391 LEU B CD2  1 
ATOM   9036  H  H    . LEU B 1 360 ? 80.588  23.807  -3.043  1.00 17.00 ? 391 LEU B H    1 
ATOM   9037  N  N    . PRO B 1 361 ? 83.407  22.487  -6.203  1.00 8.26  ? 392 PRO B N    1 
ATOM   9038  C  CA   . PRO B 1 361 ? 84.784  22.205  -6.609  1.00 10.62 ? 392 PRO B CA   1 
ATOM   9039  C  C    . PRO B 1 361 ? 85.323  23.428  -7.327  1.00 10.01 ? 392 PRO B C    1 
ATOM   9040  O  O    . PRO B 1 361 ? 84.563  24.365  -7.592  1.00 12.13 ? 392 PRO B O    1 
ATOM   9041  C  CB   . PRO B 1 361 ? 84.604  21.037  -7.583  1.00 12.04 ? 392 PRO B CB   1 
ATOM   9042  C  CG   . PRO B 1 361 ? 83.377  21.466  -8.326  1.00 10.85 ? 392 PRO B CG   1 
ATOM   9043  C  CD   . PRO B 1 361 ? 82.462  21.945  -7.199  1.00 9.92  ? 392 PRO B CD   1 
ATOM   9044  N  N    . ASP B 1 362 ? 86.610  23.418  -7.661  1.00 8.04  ? 393 ASP B N    1 
ATOM   9045  C  CA   . ASP B 1 362 ? 87.190  24.556  -8.355  1.00 8.50  ? 393 ASP B CA   1 
ATOM   9046  C  C    . ASP B 1 362 ? 87.121  24.324  -9.856  1.00 6.35  ? 393 ASP B C    1 
ATOM   9047  O  O    . ASP B 1 362 ? 87.310  25.243  -10.653 1.00 5.28  ? 393 ASP B O    1 
ATOM   9048  C  CB   . ASP B 1 362 ? 88.619  24.820  -7.876  1.00 11.26 ? 393 ASP B CB   1 
ATOM   9049  C  CG   . ASP B 1 362 ? 88.681  25.208  -6.389  1.00 15.69 ? 393 ASP B CG   1 
ATOM   9050  O  OD1  . ASP B 1 362 ? 88.493  26.409  -6.060  1.00 16.43 ? 393 ASP B OD1  1 
ATOM   9051  O  OD2  . ASP B 1 362 ? 88.922  24.308  -5.546  1.00 19.94 ? 393 ASP B OD2  1 
ATOM   9052  H  H    . ASP B 1 362 ? 87.166  22.645  -7.447  1.00 17.00 ? 393 ASP B H    1 
ATOM   9053  N  N    . THR B 1 363 ? 86.806  23.097  -10.230 1.00 5.35  ? 394 THR B N    1 
ATOM   9054  C  CA   . THR B 1 363 ? 86.677  22.740  -11.630 1.00 7.77  ? 394 THR B CA   1 
ATOM   9055  C  C    . THR B 1 363 ? 85.526  21.754  -11.784 1.00 8.86  ? 394 THR B C    1 
ATOM   9056  O  O    . THR B 1 363 ? 85.365  20.780  -11.022 1.00 5.40  ? 394 THR B O    1 
ATOM   9057  C  CB   . THR B 1 363 ? 87.955  22.046  -12.214 1.00 9.81  ? 394 THR B CB   1 
ATOM   9058  O  OG1  . THR B 1 363 ? 88.805  21.585  -11.150 1.00 11.75 ? 394 THR B OG1  1 
ATOM   9059  C  CG2  . THR B 1 363 ? 88.713  22.949  -13.163 1.00 6.10  ? 394 THR B CG2  1 
ATOM   9060  H  H    . THR B 1 363 ? 86.667  22.381  -9.586  1.00 17.00 ? 394 THR B H    1 
ATOM   9061  H  HG1  . THR B 1 363 ? 89.636  21.277  -11.516 1.00 17.00 ? 394 THR B HG1  1 
ATOM   9062  N  N    . PHE B 1 364 ? 84.727  22.000  -12.804 1.00 9.71  ? 395 PHE B N    1 
ATOM   9063  C  CA   . PHE B 1 364 ? 83.595  21.141  -13.067 1.00 10.41 ? 395 PHE B CA   1 
ATOM   9064  C  C    . PHE B 1 364 ? 84.148  20.212  -14.107 1.00 10.95 ? 395 PHE B C    1 
ATOM   9065  O  O    . PHE B 1 364 ? 84.224  20.511  -15.303 1.00 12.68 ? 395 PHE B O    1 
ATOM   9066  C  CB   . PHE B 1 364 ? 82.381  21.988  -13.492 1.00 7.71  ? 395 PHE B CB   1 
ATOM   9067  C  CG   . PHE B 1 364 ? 81.972  22.970  -12.427 1.00 6.26  ? 395 PHE B CG   1 
ATOM   9068  C  CD1  . PHE B 1 364 ? 81.359  22.509  -11.252 1.00 5.29  ? 395 PHE B CD1  1 
ATOM   9069  C  CD2  . PHE B 1 364 ? 82.325  24.325  -12.528 1.00 4.64  ? 395 PHE B CD2  1 
ATOM   9070  C  CE1  . PHE B 1 364 ? 81.112  23.379  -10.187 1.00 8.36  ? 395 PHE B CE1  1 
ATOM   9071  C  CE2  . PHE B 1 364 ? 82.084  25.195  -11.484 1.00 5.31  ? 395 PHE B CE2  1 
ATOM   9072  C  CZ   . PHE B 1 364 ? 81.476  24.732  -10.298 1.00 8.56  ? 395 PHE B CZ   1 
ATOM   9073  H  H    . PHE B 1 364 ? 84.900  22.773  -13.380 1.00 17.00 ? 395 PHE B H    1 
ATOM   9074  N  N    . ASN B 1 365 ? 84.689  19.135  -13.580 1.00 11.07 ? 396 ASN B N    1 
ATOM   9075  C  CA   . ASN B 1 365 ? 85.328  18.139  -14.385 1.00 10.57 ? 396 ASN B CA   1 
ATOM   9076  C  C    . ASN B 1 365 ? 84.467  16.995  -14.953 1.00 8.60  ? 396 ASN B C    1 
ATOM   9077  O  O    . ASN B 1 365 ? 84.248  15.949  -14.317 1.00 4.69  ? 396 ASN B O    1 
ATOM   9078  C  CB   . ASN B 1 365 ? 86.502  17.618  -13.588 1.00 14.42 ? 396 ASN B CB   1 
ATOM   9079  C  CG   . ASN B 1 365 ? 86.908  16.271  -14.016 1.00 19.55 ? 396 ASN B CG   1 
ATOM   9080  O  OD1  . ASN B 1 365 ? 87.151  16.033  -15.213 1.00 20.65 ? 396 ASN B OD1  1 
ATOM   9081  N  ND2  . ASN B 1 365 ? 86.918  15.334  -13.061 1.00 22.83 ? 396 ASN B ND2  1 
ATOM   9082  H  H    . ASN B 1 365 ? 84.632  18.983  -12.616 1.00 17.00 ? 396 ASN B H    1 
ATOM   9083  H  HD21 . ASN B 1 365 ? 87.169  14.426  -13.306 1.00 17.00 ? 396 ASN B HD21 1 
ATOM   9084  H  HD22 . ASN B 1 365 ? 86.645  15.598  -12.161 1.00 17.00 ? 396 ASN B HD22 1 
ATOM   9085  N  N    . ILE B 1 366 ? 83.955  17.209  -16.153 1.00 8.88  ? 397 ILE B N    1 
ATOM   9086  C  CA   . ILE B 1 366 ? 83.171  16.158  -16.792 1.00 8.39  ? 397 ILE B CA   1 
ATOM   9087  C  C    . ILE B 1 366 ? 84.201  15.327  -17.520 1.00 8.87  ? 397 ILE B C    1 
ATOM   9088  O  O    . ILE B 1 366 ? 84.705  15.714  -18.580 1.00 7.77  ? 397 ILE B O    1 
ATOM   9089  C  CB   . ILE B 1 366 ? 82.021  16.687  -17.748 1.00 6.33  ? 397 ILE B CB   1 
ATOM   9090  C  CG1  . ILE B 1 366 ? 80.695  16.854  -16.969 1.00 4.63  ? 397 ILE B CG1  1 
ATOM   9091  C  CG2  . ILE B 1 366 ? 81.765  15.713  -18.847 1.00 2.89  ? 397 ILE B CG2  1 
ATOM   9092  C  CD1  . ILE B 1 366 ? 80.673  18.006  -15.979 1.00 3.98  ? 397 ILE B CD1  1 
ATOM   9093  H  H    . ILE B 1 366 ? 84.174  18.035  -16.626 1.00 17.00 ? 397 ILE B H    1 
ATOM   9094  N  N    . GLU B 1 367 ? 84.564  14.230  -16.866 1.00 10.80 ? 398 GLU B N    1 
ATOM   9095  C  CA   . GLU B 1 367 ? 85.554  13.286  -17.366 1.00 13.14 ? 398 GLU B CA   1 
ATOM   9096  C  C    . GLU B 1 367 ? 86.035  13.527  -18.799 1.00 11.73 ? 398 GLU B C    1 
ATOM   9097  O  O    . GLU B 1 367 ? 85.254  13.505  -19.787 1.00 6.59  ? 398 GLU B O    1 
ATOM   9098  C  CB   . GLU B 1 367 ? 85.077  11.841  -17.198 1.00 15.46 ? 398 GLU B CB   1 
ATOM   9099  C  CG   . GLU B 1 367 ? 84.441  11.488  -15.849 1.00 18.61 ? 398 GLU B CG   1 
ATOM   9100  C  CD   . GLU B 1 367 ? 85.371  11.611  -14.649 1.00 19.17 ? 398 GLU B CD   1 
ATOM   9101  O  OE1  . GLU B 1 367 ? 85.847  12.733  -14.421 1.00 14.54 ? 398 GLU B OE1  1 
ATOM   9102  O  OE2  . GLU B 1 367 ? 85.571  10.601  -13.903 1.00 21.64 ? 398 GLU B OE2  1 
ATOM   9103  H  H    . GLU B 1 367 ? 84.127  14.085  -16.000 1.00 17.00 ? 398 GLU B H    1 
ATOM   9104  N  N    . ASP B 1 368 ? 87.351  13.731  -18.857 1.00 13.05 ? 399 ASP B N    1 
ATOM   9105  C  CA   . ASP B 1 368 ? 88.106  14.000  -20.067 1.00 16.34 ? 399 ASP B CA   1 
ATOM   9106  C  C    . ASP B 1 368 ? 87.977  15.496  -20.427 1.00 18.97 ? 399 ASP B C    1 
ATOM   9107  O  O    . ASP B 1 368 ? 88.014  15.896  -21.615 1.00 20.08 ? 399 ASP B O    1 
ATOM   9108  C  CB   . ASP B 1 368 ? 87.694  13.051  -21.202 1.00 13.45 ? 399 ASP B CB   1 
ATOM   9109  C  CG   . ASP B 1 368 ? 88.754  12.936  -22.272 1.00 11.70 ? 399 ASP B CG   1 
ATOM   9110  O  OD1  . ASP B 1 368 ? 89.786  12.287  -22.004 1.00 4.84  ? 399 ASP B OD1  1 
ATOM   9111  O  OD2  . ASP B 1 368 ? 88.554  13.499  -23.381 1.00 14.45 ? 399 ASP B OD2  1 
ATOM   9112  H  H    . ASP B 1 368 ? 87.832  13.719  -18.009 1.00 17.00 ? 399 ASP B H    1 
ATOM   9113  N  N    . GLN B 1 369 ? 87.765  16.304  -19.379 1.00 19.28 ? 400 GLN B N    1 
ATOM   9114  C  CA   . GLN B 1 369 ? 87.692  17.767  -19.488 1.00 17.19 ? 400 GLN B CA   1 
ATOM   9115  C  C    . GLN B 1 369 ? 87.247  18.410  -18.199 1.00 15.66 ? 400 GLN B C    1 
ATOM   9116  O  O    . GLN B 1 369 ? 86.469  17.819  -17.457 1.00 17.83 ? 400 GLN B O    1 
ATOM   9117  C  CB   . GLN B 1 369 ? 86.831  18.234  -20.643 1.00 16.22 ? 400 GLN B CB   1 
ATOM   9118  C  CG   . GLN B 1 369 ? 87.373  19.535  -21.165 1.00 18.88 ? 400 GLN B CG   1 
ATOM   9119  C  CD   . GLN B 1 369 ? 86.979  19.812  -22.586 1.00 20.51 ? 400 GLN B CD   1 
ATOM   9120  O  OE1  . GLN B 1 369 ? 85.944  19.324  -23.072 1.00 19.34 ? 400 GLN B OE1  1 
ATOM   9121  N  NE2  . GLN B 1 369 ? 87.793  20.621  -23.270 1.00 17.08 ? 400 GLN B NE2  1 
ATOM   9122  H  H    . GLN B 1 369 ? 87.584  15.926  -18.491 1.00 17.00 ? 400 GLN B H    1 
ATOM   9123  H  HE21 . GLN B 1 369 ? 87.547  20.784  -24.201 1.00 17.00 ? 400 GLN B HE21 1 
ATOM   9124  H  HE22 . GLN B 1 369 ? 88.579  20.994  -22.826 1.00 17.00 ? 400 GLN B HE22 1 
ATOM   9125  N  N    . GLU B 1 370 ? 87.835  19.561  -17.887 1.00 14.17 ? 401 GLU B N    1 
ATOM   9126  C  CA   . GLU B 1 370 ? 87.520  20.298  -16.671 1.00 14.66 ? 401 GLU B CA   1 
ATOM   9127  C  C    . GLU B 1 370 ? 87.177  21.710  -17.079 1.00 14.29 ? 401 GLU B C    1 
ATOM   9128  O  O    . GLU B 1 370 ? 87.910  22.335  -17.864 1.00 15.98 ? 401 GLU B O    1 
ATOM   9129  C  CB   . GLU B 1 370 ? 88.706  20.346  -15.708 1.00 15.34 ? 401 GLU B CB   1 
ATOM   9130  C  CG   . GLU B 1 370 ? 89.046  19.015  -15.128 1.00 21.44 ? 401 GLU B CG   1 
ATOM   9131  C  CD   . GLU B 1 370 ? 89.925  19.101  -13.910 1.00 22.01 ? 401 GLU B CD   1 
ATOM   9132  O  OE1  . GLU B 1 370 ? 89.439  19.507  -12.836 1.00 24.01 ? 401 GLU B OE1  1 
ATOM   9133  O  OE2  . GLU B 1 370 ? 91.102  18.722  -14.025 1.00 24.81 ? 401 GLU B OE2  1 
ATOM   9134  H  H    . GLU B 1 370 ? 88.480  19.973  -18.497 1.00 17.00 ? 401 GLU B H    1 
ATOM   9135  N  N    . TYR B 1 371 ? 86.075  22.217  -16.534 1.00 11.23 ? 402 TYR B N    1 
ATOM   9136  C  CA   . TYR B 1 371 ? 85.621  23.555  -16.843 1.00 7.90  ? 402 TYR B CA   1 
ATOM   9137  C  C    . TYR B 1 371 ? 85.754  24.487  -15.639 1.00 7.37  ? 402 TYR B C    1 
ATOM   9138  O  O    . TYR B 1 371 ? 85.765  24.032  -14.485 1.00 5.59  ? 402 TYR B O    1 
ATOM   9139  C  CB   . TYR B 1 371 ? 84.178  23.501  -17.334 1.00 5.25  ? 402 TYR B CB   1 
ATOM   9140  C  CG   . TYR B 1 371 ? 83.990  22.652  -18.564 1.00 2.00  ? 402 TYR B CG   1 
ATOM   9141  C  CD1  . TYR B 1 371 ? 83.757  21.283  -18.468 1.00 2.00  ? 402 TYR B CD1  1 
ATOM   9142  C  CD2  . TYR B 1 371 ? 84.024  23.220  -19.826 1.00 2.41  ? 402 TYR B CD2  1 
ATOM   9143  C  CE1  . TYR B 1 371 ? 83.563  20.502  -19.618 1.00 2.79  ? 402 TYR B CE1  1 
ATOM   9144  C  CE2  . TYR B 1 371 ? 83.825  22.449  -20.978 1.00 2.69  ? 402 TYR B CE2  1 
ATOM   9145  C  CZ   . TYR B 1 371 ? 83.599  21.096  -20.872 1.00 2.00  ? 402 TYR B CZ   1 
ATOM   9146  O  OH   . TYR B 1 371 ? 83.418  20.343  -22.009 1.00 2.00  ? 402 TYR B OH   1 
ATOM   9147  H  H    . TYR B 1 371 ? 85.553  21.696  -15.898 1.00 17.00 ? 402 TYR B H    1 
ATOM   9148  H  HH   . TYR B 1 371 ? 83.584  20.892  -22.793 1.00 17.00 ? 402 TYR B HH   1 
ATOM   9149  N  N    . SER B 1 372 ? 85.928  25.775  -15.939 1.00 6.00  ? 403 SER B N    1 
ATOM   9150  C  CA   . SER B 1 372 ? 86.064  26.844  -14.952 1.00 6.57  ? 403 SER B CA   1 
ATOM   9151  C  C    . SER B 1 372 ? 84.670  27.302  -14.617 1.00 8.63  ? 403 SER B C    1 
ATOM   9152  O  O    . SER B 1 372 ? 83.749  27.053  -15.409 1.00 10.96 ? 403 SER B O    1 
ATOM   9153  C  CB   . SER B 1 372 ? 86.780  28.039  -15.580 1.00 6.63  ? 403 SER B CB   1 
ATOM   9154  O  OG   . SER B 1 372 ? 86.055  28.547  -16.674 1.00 2.00  ? 403 SER B OG   1 
ATOM   9155  H  H    . SER B 1 372 ? 85.956  25.991  -16.894 1.00 17.00 ? 403 SER B H    1 
ATOM   9156  H  HG   . SER B 1 372 ? 86.238  27.917  -17.383 1.00 17.00 ? 403 SER B HG   1 
ATOM   9157  N  N    . PHE B 1 373 ? 84.493  28.003  -13.492 1.00 7.54  ? 404 PHE B N    1 
ATOM   9158  C  CA   . PHE B 1 373 ? 83.150  28.485  -13.187 1.00 6.20  ? 404 PHE B CA   1 
ATOM   9159  C  C    . PHE B 1 373 ? 82.683  29.263  -14.430 1.00 7.15  ? 404 PHE B C    1 
ATOM   9160  O  O    . PHE B 1 373 ? 81.734  28.854  -15.106 1.00 3.64  ? 404 PHE B O    1 
ATOM   9161  C  CB   . PHE B 1 373 ? 83.144  29.353  -11.945 1.00 4.30  ? 404 PHE B CB   1 
ATOM   9162  C  CG   . PHE B 1 373 ? 82.969  28.584  -10.669 1.00 2.76  ? 404 PHE B CG   1 
ATOM   9163  C  CD1  . PHE B 1 373 ? 83.953  27.723  -10.208 1.00 2.01  ? 404 PHE B CD1  1 
ATOM   9164  C  CD2  . PHE B 1 373 ? 81.834  28.752  -9.895  1.00 4.25  ? 404 PHE B CD2  1 
ATOM   9165  C  CE1  . PHE B 1 373 ? 83.805  27.036  -8.976  1.00 2.01  ? 404 PHE B CE1  1 
ATOM   9166  C  CE2  . PHE B 1 373 ? 81.695  28.060  -8.668  1.00 5.42  ? 404 PHE B CE2  1 
ATOM   9167  C  CZ   . PHE B 1 373 ? 82.683  27.209  -8.221  1.00 2.00  ? 404 PHE B CZ   1 
ATOM   9168  H  H    . PHE B 1 373 ? 85.236  28.143  -12.871 1.00 17.00 ? 404 PHE B H    1 
ATOM   9169  N  N    . LYS B 1 374 ? 83.512  30.213  -14.849 1.00 8.30  ? 405 LYS B N    1 
ATOM   9170  C  CA   . LYS B 1 374 ? 83.257  31.056  -16.036 1.00 12.70 ? 405 LYS B CA   1 
ATOM   9171  C  C    . LYS B 1 374 ? 82.690  30.326  -17.279 1.00 13.32 ? 405 LYS B C    1 
ATOM   9172  O  O    . LYS B 1 374 ? 81.938  30.927  -18.090 1.00 10.49 ? 405 LYS B O    1 
ATOM   9173  C  CB   . LYS B 1 374 ? 84.556  31.774  -16.471 1.00 13.86 ? 405 LYS B CB   1 
ATOM   9174  C  CG   . LYS B 1 374 ? 85.071  32.843  -15.490 1.00 21.60 ? 405 LYS B CG   1 
ATOM   9175  C  CD   . LYS B 1 374 ? 85.623  32.252  -14.156 1.00 23.87 ? 405 LYS B CD   1 
ATOM   9176  C  CE   . LYS B 1 374 ? 85.746  33.352  -13.068 1.00 24.47 ? 405 LYS B CE   1 
ATOM   9177  N  NZ   . LYS B 1 374 ? 86.413  32.896  -11.791 1.00 23.42 ? 405 LYS B NZ   1 
ATOM   9178  H  H    . LYS B 1 374 ? 84.330  30.316  -14.341 1.00 17.00 ? 405 LYS B H    1 
ATOM   9179  H  HZ1  . LYS B 1 374 ? 85.874  32.108  -11.378 1.00 17.00 ? 405 LYS B HZ1  1 
ATOM   9180  H  HZ2  . LYS B 1 374 ? 87.382  32.578  -12.002 1.00 17.00 ? 405 LYS B HZ2  1 
ATOM   9181  H  HZ3  . LYS B 1 374 ? 86.450  33.686  -11.114 1.00 17.00 ? 405 LYS B HZ3  1 
ATOM   9182  N  N    . GLN B 1 375 ? 83.112  29.065  -17.443 1.00 12.37 ? 406 GLN B N    1 
ATOM   9183  C  CA   . GLN B 1 375 ? 82.712  28.233  -18.567 1.00 12.66 ? 406 GLN B CA   1 
ATOM   9184  C  C    . GLN B 1 375 ? 81.498  27.376  -18.313 1.00 13.79 ? 406 GLN B C    1 
ATOM   9185  O  O    . GLN B 1 375 ? 80.729  27.085  -19.246 1.00 14.23 ? 406 GLN B O    1 
ATOM   9186  C  CB   . GLN B 1 375 ? 83.819  27.280  -18.953 1.00 14.08 ? 406 GLN B CB   1 
ATOM   9187  C  CG   . GLN B 1 375 ? 85.073  27.876  -19.457 1.00 19.24 ? 406 GLN B CG   1 
ATOM   9188  C  CD   . GLN B 1 375 ? 86.092  26.796  -19.753 1.00 25.38 ? 406 GLN B CD   1 
ATOM   9189  O  OE1  . GLN B 1 375 ? 86.495  26.047  -18.858 1.00 23.89 ? 406 GLN B OE1  1 
ATOM   9190  N  NE2  . GLN B 1 375 ? 86.492  26.683  -21.015 1.00 28.92 ? 406 GLN B NE2  1 
ATOM   9191  H  H    . GLN B 1 375 ? 83.711  28.687  -16.769 1.00 17.00 ? 406 GLN B H    1 
ATOM   9192  H  HE21 . GLN B 1 375 ? 87.168  26.006  -21.211 1.00 17.00 ? 406 GLN B HE21 1 
ATOM   9193  H  HE22 . GLN B 1 375 ? 86.091  27.291  -21.678 1.00 17.00 ? 406 GLN B HE22 1 
ATOM   9194  N  N    . PHE B 1 376 ? 81.403  26.863  -17.088 1.00 11.93 ? 407 PHE B N    1 
ATOM   9195  C  CA   . PHE B 1 376 ? 80.301  25.993  -16.714 1.00 9.48  ? 407 PHE B CA   1 
ATOM   9196  C  C    . PHE B 1 376 ? 78.991  26.774  -16.597 1.00 9.42  ? 407 PHE B C    1 
ATOM   9197  O  O    . PHE B 1 376 ? 77.956  26.333  -17.120 1.00 8.91  ? 407 PHE B O    1 
ATOM   9198  C  CB   . PHE B 1 376 ? 80.608  25.265  -15.404 1.00 7.05  ? 407 PHE B CB   1 
ATOM   9199  C  CG   . PHE B 1 376 ? 79.918  23.940  -15.285 1.00 6.43  ? 407 PHE B CG   1 
ATOM   9200  C  CD1  . PHE B 1 376 ? 80.102  22.961  -16.254 1.00 3.01  ? 407 PHE B CD1  1 
ATOM   9201  C  CD2  . PHE B 1 376 ? 79.071  23.673  -14.209 1.00 5.67  ? 407 PHE B CD2  1 
ATOM   9202  C  CE1  . PHE B 1 376 ? 79.461  21.748  -16.156 1.00 2.00  ? 407 PHE B CE1  1 
ATOM   9203  C  CE2  . PHE B 1 376 ? 78.427  22.464  -14.105 1.00 2.00  ? 407 PHE B CE2  1 
ATOM   9204  C  CZ   . PHE B 1 376 ? 78.624  21.496  -15.084 1.00 2.53  ? 407 PHE B CZ   1 
ATOM   9205  H  H    . PHE B 1 376 ? 82.072  27.110  -16.417 1.00 17.00 ? 407 PHE B H    1 
ATOM   9206  N  N    . LEU B 1 377 ? 79.062  27.975  -16.011 1.00 7.63  ? 408 LEU B N    1 
ATOM   9207  C  CA   . LEU B 1 377 ? 77.878  28.801  -15.805 1.00 4.86  ? 408 LEU B CA   1 
ATOM   9208  C  C    . LEU B 1 377 ? 77.198  29.274  -17.064 1.00 6.64  ? 408 LEU B C    1 
ATOM   9209  O  O    . LEU B 1 377 ? 77.811  29.944  -17.902 1.00 8.13  ? 408 LEU B O    1 
ATOM   9210  C  CB   . LEU B 1 377 ? 78.169  29.979  -14.878 1.00 2.00  ? 408 LEU B CB   1 
ATOM   9211  C  CG   . LEU B 1 377 ? 78.604  29.580  -13.463 1.00 2.36  ? 408 LEU B CG   1 
ATOM   9212  C  CD1  . LEU B 1 377 ? 78.286  30.700  -12.505 1.00 2.00  ? 408 LEU B CD1  1 
ATOM   9213  C  CD2  . LEU B 1 377 ? 77.922  28.291  -12.998 1.00 3.36  ? 408 LEU B CD2  1 
ATOM   9214  H  H    . LEU B 1 377 ? 79.940  28.322  -15.747 1.00 17.00 ? 408 LEU B H    1 
ATOM   9215  N  N    . TYR B 1 378 ? 75.911  28.931  -17.159 1.00 6.62  ? 409 TYR B N    1 
ATOM   9216  C  CA   . TYR B 1 378 ? 75.053  29.293  -18.280 1.00 6.70  ? 409 TYR B CA   1 
ATOM   9217  C  C    . TYR B 1 378 ? 75.488  28.662  -19.574 1.00 4.22  ? 409 TYR B C    1 
ATOM   9218  O  O    . TYR B 1 378 ? 75.369  29.286  -20.619 1.00 2.96  ? 409 TYR B O    1 
ATOM   9219  C  CB   . TYR B 1 378 ? 75.007  30.821  -18.504 1.00 11.86 ? 409 TYR B CB   1 
ATOM   9220  C  CG   . TYR B 1 378 ? 75.328  31.717  -17.305 1.00 14.86 ? 409 TYR B CG   1 
ATOM   9221  C  CD1  . TYR B 1 378 ? 74.523  31.714  -16.158 1.00 16.37 ? 409 TYR B CD1  1 
ATOM   9222  C  CD2  . TYR B 1 378 ? 76.423  32.595  -17.347 1.00 16.63 ? 409 TYR B CD2  1 
ATOM   9223  C  CE1  . TYR B 1 378 ? 74.790  32.562  -15.085 1.00 20.33 ? 409 TYR B CE1  1 
ATOM   9224  C  CE2  . TYR B 1 378 ? 76.707  33.458  -16.274 1.00 19.76 ? 409 TYR B CE2  1 
ATOM   9225  C  CZ   . TYR B 1 378 ? 75.880  33.435  -15.146 1.00 22.01 ? 409 TYR B CZ   1 
ATOM   9226  O  OH   . TYR B 1 378 ? 76.125  34.288  -14.087 1.00 23.89 ? 409 TYR B OH   1 
ATOM   9227  H  H    . TYR B 1 378 ? 75.531  28.425  -16.414 1.00 17.00 ? 409 TYR B H    1 
ATOM   9228  H  HH   . TYR B 1 378 ? 76.873  34.851  -14.290 1.00 17.00 ? 409 TYR B HH   1 
ATOM   9229  N  N    . ASN B 1 379 ? 75.982  27.433  -19.533 1.00 5.38  ? 410 ASN B N    1 
ATOM   9230  C  CA   . ASN B 1 379 ? 76.412  26.806  -20.783 1.00 9.30  ? 410 ASN B CA   1 
ATOM   9231  C  C    . ASN B 1 379 ? 75.467  25.825  -21.478 1.00 10.61 ? 410 ASN B C    1 
ATOM   9232  O  O    . ASN B 1 379 ? 74.959  24.860  -20.876 1.00 10.48 ? 410 ASN B O    1 
ATOM   9233  C  CB   . ASN B 1 379 ? 77.788  26.181  -20.646 1.00 10.66 ? 410 ASN B CB   1 
ATOM   9234  C  CG   . ASN B 1 379 ? 78.563  26.236  -21.935 1.00 11.81 ? 410 ASN B CG   1 
ATOM   9235  O  OD1  . ASN B 1 379 ? 78.008  25.942  -23.000 1.00 13.49 ? 410 ASN B OD1  1 
ATOM   9236  N  ND2  . ASN B 1 379 ? 79.834  26.629  -21.820 1.00 13.54 ? 410 ASN B ND2  1 
ATOM   9237  H  H    . ASN B 1 379 ? 76.056  26.946  -18.690 1.00 17.00 ? 410 ASN B H    1 
ATOM   9238  H  HD21 . ASN B 1 379 ? 80.155  26.822  -20.923 1.00 17.00 ? 410 ASN B HD21 1 
ATOM   9239  N  N    . ASN B 1 380 ? 75.259  26.093  -22.767 1.00 11.43 ? 411 ASN B N    1 
ATOM   9240  C  CA   . ASN B 1 380 ? 74.384  25.277  -23.643 1.00 10.05 ? 411 ASN B CA   1 
ATOM   9241  C  C    . ASN B 1 380 ? 75.084  23.961  -24.075 1.00 8.01  ? 411 ASN B C    1 
ATOM   9242  O  O    . ASN B 1 380 ? 74.795  22.864  -23.579 1.00 3.48  ? 411 ASN B O    1 
ATOM   9243  C  CB   . ASN B 1 380 ? 73.988  26.122  -24.913 1.00 11.21 ? 411 ASN B CB   1 
ATOM   9244  C  CG   . ASN B 1 380 ? 72.919  25.432  -25.842 1.00 7.15  ? 411 ASN B CG   1 
ATOM   9245  O  OD1  . ASN B 1 380 ? 72.075  24.639  -25.399 1.00 2.01  ? 411 ASN B OD1  1 
ATOM   9246  N  ND2  . ASN B 1 380 ? 72.940  25.804  -27.124 1.00 4.24  ? 411 ASN B ND2  1 
ATOM   9247  H  H    . ASN B 1 380 ? 75.727  26.870  -23.131 1.00 17.00 ? 411 ASN B H    1 
ATOM   9248  H  HD21 . ASN B 1 380 ? 72.279  25.349  -27.685 1.00 17.00 ? 411 ASN B HD21 1 
ATOM   9249  H  HD22 . ASN B 1 380 ? 73.593  26.464  -27.431 1.00 17.00 ? 411 ASN B HD22 1 
ATOM   9250  N  N    . SER B 1 381 ? 76.078  24.106  -24.935 1.00 5.86  ? 412 SER B N    1 
ATOM   9251  C  CA   . SER B 1 381 ? 76.732  22.953  -25.455 1.00 6.09  ? 412 SER B CA   1 
ATOM   9252  C  C    . SER B 1 381 ? 77.409  22.021  -24.466 1.00 5.76  ? 412 SER B C    1 
ATOM   9253  O  O    . SER B 1 381 ? 77.575  20.847  -24.781 1.00 5.07  ? 412 SER B O    1 
ATOM   9254  C  CB   . SER B 1 381 ? 77.644  23.341  -26.618 1.00 9.36  ? 412 SER B CB   1 
ATOM   9255  O  OG   . SER B 1 381 ? 77.409  22.485  -27.748 1.00 8.35  ? 412 SER B OG   1 
ATOM   9256  H  H    . SER B 1 381 ? 76.401  24.990  -25.188 1.00 17.00 ? 412 SER B H    1 
ATOM   9257  H  HG   . SER B 1 381 ? 78.036  22.667  -28.454 1.00 17.00 ? 412 SER B HG   1 
ATOM   9258  N  N    . ILE B 1 382 ? 77.766  22.491  -23.272 1.00 5.77  ? 413 ILE B N    1 
ATOM   9259  C  CA   . ILE B 1 382 ? 78.408  21.568  -22.312 1.00 7.08  ? 413 ILE B CA   1 
ATOM   9260  C  C    . ILE B 1 382 ? 77.549  20.284  -22.159 1.00 6.94  ? 413 ILE B C    1 
ATOM   9261  O  O    . ILE B 1 382 ? 77.968  19.172  -22.526 1.00 4.33  ? 413 ILE B O    1 
ATOM   9262  C  CB   . ILE B 1 382 ? 78.669  22.223  -20.891 1.00 7.10  ? 413 ILE B CB   1 
ATOM   9263  C  CG1  . ILE B 1 382 ? 79.741  23.333  -20.986 1.00 7.20  ? 413 ILE B CG1  1 
ATOM   9264  C  CG2  . ILE B 1 382 ? 79.137  21.141  -19.884 1.00 5.83  ? 413 ILE B CG2  1 
ATOM   9265  C  CD1  . ILE B 1 382 ? 80.171  23.970  -19.642 1.00 2.00  ? 413 ILE B CD1  1 
ATOM   9266  H  H    . ILE B 1 382 ? 77.597  23.423  -23.038 1.00 17.00 ? 413 ILE B H    1 
ATOM   9267  N  N    . LEU B 1 383 ? 76.321  20.470  -21.689 1.00 6.16  ? 414 LEU B N    1 
ATOM   9268  C  CA   . LEU B 1 383 ? 75.380  19.378  -21.481 1.00 5.26  ? 414 LEU B CA   1 
ATOM   9269  C  C    . LEU B 1 383 ? 75.022  18.668  -22.797 1.00 5.71  ? 414 LEU B C    1 
ATOM   9270  O  O    . LEU B 1 383 ? 75.092  17.449  -22.924 1.00 3.72  ? 414 LEU B O    1 
ATOM   9271  C  CB   . LEU B 1 383 ? 74.109  19.926  -20.818 1.00 3.25  ? 414 LEU B CB   1 
ATOM   9272  C  CG   . LEU B 1 383 ? 73.085  18.861  -20.450 1.00 7.14  ? 414 LEU B CG   1 
ATOM   9273  C  CD1  . LEU B 1 383 ? 73.723  17.813  -19.528 1.00 5.51  ? 414 LEU B CD1  1 
ATOM   9274  C  CD2  . LEU B 1 383 ? 71.902  19.505  -19.780 1.00 9.16  ? 414 LEU B CD2  1 
ATOM   9275  H  H    . LEU B 1 383 ? 76.019  21.381  -21.486 1.00 17.00 ? 414 LEU B H    1 
ATOM   9276  N  N    . LEU B 1 384 ? 74.623  19.454  -23.776 1.00 5.81  ? 415 LEU B N    1 
ATOM   9277  C  CA   . LEU B 1 384 ? 74.252  18.909  -25.054 1.00 5.62  ? 415 LEU B CA   1 
ATOM   9278  C  C    . LEU B 1 384 ? 75.390  18.120  -25.670 1.00 7.20  ? 415 LEU B C    1 
ATOM   9279  O  O    . LEU B 1 384 ? 75.161  17.117  -26.330 1.00 9.86  ? 415 LEU B O    1 
ATOM   9280  C  CB   . LEU B 1 384 ? 73.812  20.033  -25.998 1.00 4.30  ? 415 LEU B CB   1 
ATOM   9281  C  CG   . LEU B 1 384 ? 72.521  20.746  -25.598 1.00 5.25  ? 415 LEU B CG   1 
ATOM   9282  C  CD1  . LEU B 1 384 ? 72.241  21.898  -26.561 1.00 7.29  ? 415 LEU B CD1  1 
ATOM   9283  C  CD2  . LEU B 1 384 ? 71.333  19.747  -25.564 1.00 3.11  ? 415 LEU B CD2  1 
ATOM   9284  H  H    . LEU B 1 384 ? 74.583  20.424  -23.639 1.00 17.00 ? 415 LEU B H    1 
ATOM   9285  N  N    . GLU B 1 385 ? 76.620  18.556  -25.453 1.00 9.85  ? 416 GLU B N    1 
ATOM   9286  C  CA   . GLU B 1 385 ? 77.758  17.865  -26.046 1.00 13.85 ? 416 GLU B CA   1 
ATOM   9287  C  C    . GLU B 1 385 ? 78.076  16.582  -25.327 1.00 14.28 ? 416 GLU B C    1 
ATOM   9288  O  O    . GLU B 1 385 ? 77.983  15.463  -25.887 1.00 12.94 ? 416 GLU B O    1 
ATOM   9289  C  CB   . GLU B 1 385 ? 78.989  18.756  -26.063 1.00 17.13 ? 416 GLU B CB   1 
ATOM   9290  C  CG   . GLU B 1 385 ? 78.923  19.739  -27.186 1.00 28.41 ? 416 GLU B CG   1 
ATOM   9291  C  CD   . GLU B 1 385 ? 78.631  19.036  -28.536 1.00 36.98 ? 416 GLU B CD   1 
ATOM   9292  O  OE1  . GLU B 1 385 ? 79.521  18.266  -29.015 1.00 40.12 ? 416 GLU B OE1  1 
ATOM   9293  O  OE2  . GLU B 1 385 ? 77.516  19.246  -29.110 1.00 39.84 ? 416 GLU B OE2  1 
ATOM   9294  H  H    . GLU B 1 385 ? 76.746  19.293  -24.847 1.00 17.00 ? 416 GLU B H    1 
ATOM   9295  N  N    . HIS B 1 386 ? 78.431  16.751  -24.059 1.00 12.20 ? 417 HIS B N    1 
ATOM   9296  C  CA   . HIS B 1 386 ? 78.779  15.615  -23.231 1.00 12.32 ? 417 HIS B CA   1 
ATOM   9297  C  C    . HIS B 1 386 ? 77.732  14.523  -23.104 1.00 9.03  ? 417 HIS B C    1 
ATOM   9298  O  O    . HIS B 1 386 ? 78.071  13.350  -23.124 1.00 9.47  ? 417 HIS B O    1 
ATOM   9299  C  CB   . HIS B 1 386 ? 79.199  16.097  -21.865 1.00 10.54 ? 417 HIS B CB   1 
ATOM   9300  C  CG   . HIS B 1 386 ? 80.551  16.718  -21.865 1.00 13.83 ? 417 HIS B CG   1 
ATOM   9301  N  ND1  . HIS B 1 386 ? 80.925  17.687  -20.960 1.00 17.17 ? 417 HIS B ND1  1 
ATOM   9302  C  CD2  . HIS B 1 386 ? 81.619  16.526  -22.677 1.00 13.91 ? 417 HIS B CD2  1 
ATOM   9303  C  CE1  . HIS B 1 386 ? 82.164  18.070  -21.214 1.00 16.84 ? 417 HIS B CE1  1 
ATOM   9304  N  NE2  . HIS B 1 386 ? 82.608  17.382  -22.251 1.00 17.18 ? 417 HIS B NE2  1 
ATOM   9305  H  H    . HIS B 1 386 ? 78.398  17.652  -23.679 1.00 17.00 ? 417 HIS B H    1 
ATOM   9306  H  HD1  . HIS B 1 386 ? 80.361  18.041  -20.237 1.00 17.00 ? 417 HIS B HD1  1 
ATOM   9307  H  HE2  . HIS B 1 386 ? 83.518  17.490  -22.618 1.00 17.00 ? 417 HIS B HE2  1 
ATOM   9308  N  N    . GLY B 1 387 ? 76.471  14.909  -22.979 1.00 7.89  ? 418 GLY B N    1 
ATOM   9309  C  CA   . GLY B 1 387 ? 75.427  13.924  -22.826 1.00 8.76  ? 418 GLY B CA   1 
ATOM   9310  C  C    . GLY B 1 387 ? 75.116  13.737  -21.362 1.00 8.66  ? 418 GLY B C    1 
ATOM   9311  O  O    . GLY B 1 387 ? 75.920  14.089  -20.498 1.00 9.78  ? 418 GLY B O    1 
ATOM   9312  H  H    . GLY B 1 387 ? 76.230  15.859  -22.980 1.00 17.00 ? 418 GLY B H    1 
ATOM   9313  N  N    . LEU B 1 388 ? 73.952  13.168  -21.078 1.00 7.09  ? 419 LEU B N    1 
ATOM   9314  C  CA   . LEU B 1 388 ? 73.535  12.984  -19.705 1.00 6.14  ? 419 LEU B CA   1 
ATOM   9315  C  C    . LEU B 1 388 ? 74.381  11.973  -18.981 1.00 6.06  ? 419 LEU B C    1 
ATOM   9316  O  O    . LEU B 1 388 ? 74.866  12.257  -17.888 1.00 6.68  ? 419 LEU B O    1 
ATOM   9317  C  CB   . LEU B 1 388 ? 72.043  12.609  -19.648 1.00 6.72  ? 419 LEU B CB   1 
ATOM   9318  C  CG   . LEU B 1 388 ? 70.979  13.637  -19.261 1.00 3.19  ? 419 LEU B CG   1 
ATOM   9319  C  CD1  . LEU B 1 388 ? 70.741  13.653  -17.774 1.00 2.00  ? 419 LEU B CD1  1 
ATOM   9320  C  CD2  . LEU B 1 388 ? 71.373  14.992  -19.818 1.00 2.80  ? 419 LEU B CD2  1 
ATOM   9321  H  H    . LEU B 1 388 ? 73.368  12.899  -21.812 1.00 17.00 ? 419 LEU B H    1 
ATOM   9322  N  N    . THR B 1 389 ? 74.540  10.795  -19.592 1.00 7.14  ? 420 THR B N    1 
ATOM   9323  C  CA   . THR B 1 389 ? 75.325  9.689   -19.030 1.00 4.12  ? 420 THR B CA   1 
ATOM   9324  C  C    . THR B 1 389 ? 76.722  10.202  -18.744 1.00 3.49  ? 420 THR B C    1 
ATOM   9325  O  O    . THR B 1 389 ? 77.310  9.915   -17.708 1.00 2.06  ? 420 THR B O    1 
ATOM   9326  C  CB   . THR B 1 389 ? 75.325  8.526   -19.979 1.00 3.97  ? 420 THR B CB   1 
ATOM   9327  O  OG1  . THR B 1 389 ? 74.755  8.943   -21.223 1.00 6.82  ? 420 THR B OG1  1 
ATOM   9328  C  CG2  . THR B 1 389 ? 74.469  7.431   -19.442 1.00 3.54  ? 420 THR B CG2  1 
ATOM   9329  H  H    . THR B 1 389 ? 74.134  10.642  -20.465 1.00 17.00 ? 420 THR B H    1 
ATOM   9330  H  HG1  . THR B 1 389 ? 75.008  8.297   -21.897 1.00 17.00 ? 420 THR B HG1  1 
ATOM   9331  N  N    . GLN B 1 390 ? 77.237  11.018  -19.647 1.00 3.67  ? 421 GLN B N    1 
ATOM   9332  C  CA   . GLN B 1 390 ? 78.516  11.637  -19.368 1.00 5.83  ? 421 GLN B CA   1 
ATOM   9333  C  C    . GLN B 1 390 ? 78.249  12.931  -18.617 1.00 7.05  ? 421 GLN B C    1 
ATOM   9334  O  O    . GLN B 1 390 ? 78.333  14.039  -19.153 1.00 6.57  ? 421 GLN B O    1 
ATOM   9335  C  CB   . GLN B 1 390 ? 79.367  11.927  -20.594 1.00 6.34  ? 421 GLN B CB   1 
ATOM   9336  C  CG   . GLN B 1 390 ? 80.807  12.050  -20.165 1.00 10.01 ? 421 GLN B CG   1 
ATOM   9337  C  CD   . GLN B 1 390 ? 81.099  11.169  -18.930 1.00 12.81 ? 421 GLN B CD   1 
ATOM   9338  O  OE1  . GLN B 1 390 ? 80.850  11.570  -17.789 1.00 11.57 ? 421 GLN B OE1  1 
ATOM   9339  N  NE2  . GLN B 1 390 ? 81.549  9.941   -19.166 1.00 17.30 ? 421 GLN B NE2  1 
ATOM   9340  H  H    . GLN B 1 390 ? 76.768  11.237  -20.475 1.00 17.00 ? 421 GLN B H    1 
ATOM   9341  H  HE21 . GLN B 1 390 ? 81.750  9.377   -18.394 1.00 17.00 ? 421 GLN B HE21 1 
ATOM   9342  H  HE22 . GLN B 1 390 ? 81.670  9.659   -20.094 1.00 17.00 ? 421 GLN B HE22 1 
ATOM   9343  N  N    . PHE B 1 391 ? 77.853  12.753  -17.376 1.00 4.03  ? 422 PHE B N    1 
ATOM   9344  C  CA   . PHE B 1 391 ? 77.551  13.839  -16.489 1.00 4.01  ? 422 PHE B CA   1 
ATOM   9345  C  C    . PHE B 1 391 ? 77.291  13.026  -15.252 1.00 2.00  ? 422 PHE B C    1 
ATOM   9346  O  O    . PHE B 1 391 ? 77.929  13.182  -14.235 1.00 2.06  ? 422 PHE B O    1 
ATOM   9347  C  CB   . PHE B 1 391 ? 76.307  14.610  -16.951 1.00 2.99  ? 422 PHE B CB   1 
ATOM   9348  C  CG   . PHE B 1 391 ? 76.575  16.053  -17.270 1.00 2.24  ? 422 PHE B CG   1 
ATOM   9349  C  CD1  . PHE B 1 391 ? 77.053  16.422  -18.525 1.00 3.34  ? 422 PHE B CD1  1 
ATOM   9350  C  CD2  . PHE B 1 391 ? 76.325  17.045  -16.320 1.00 2.00  ? 422 PHE B CD2  1 
ATOM   9351  C  CE1  . PHE B 1 391 ? 77.278  17.764  -18.838 1.00 6.01  ? 422 PHE B CE1  1 
ATOM   9352  C  CE2  . PHE B 1 391 ? 76.544  18.389  -16.610 1.00 2.65  ? 422 PHE B CE2  1 
ATOM   9353  C  CZ   . PHE B 1 391 ? 77.022  18.757  -17.873 1.00 5.03  ? 422 PHE B CZ   1 
ATOM   9354  H  H    . PHE B 1 391 ? 77.766  11.829  -17.072 1.00 17.00 ? 422 PHE B H    1 
ATOM   9355  N  N    . VAL B 1 392 ? 76.466  12.018  -15.424 1.00 4.24  ? 423 VAL B N    1 
ATOM   9356  C  CA   . VAL B 1 392 ? 76.117  11.114  -14.339 1.00 4.99  ? 423 VAL B CA   1 
ATOM   9357  C  C    . VAL B 1 392 ? 77.390  10.406  -13.915 1.00 3.60  ? 423 VAL B C    1 
ATOM   9358  O  O    . VAL B 1 392 ? 77.760  10.381  -12.748 1.00 2.00  ? 423 VAL B O    1 
ATOM   9359  C  CB   . VAL B 1 392 ? 75.101  10.097  -14.825 1.00 4.23  ? 423 VAL B CB   1 
ATOM   9360  C  CG1  . VAL B 1 392 ? 74.770  9.123   -13.721 1.00 4.34  ? 423 VAL B CG1  1 
ATOM   9361  C  CG2  . VAL B 1 392 ? 73.868  10.823  -15.348 1.00 3.23  ? 423 VAL B CG2  1 
ATOM   9362  H  H    . VAL B 1 392 ? 76.052  11.916  -16.311 1.00 17.00 ? 423 VAL B H    1 
ATOM   9363  N  N    . GLU B 1 393 ? 78.103  9.904   -14.899 1.00 2.03  ? 424 GLU B N    1 
ATOM   9364  C  CA   . GLU B 1 393 ? 79.338  9.245   -14.616 1.00 4.95  ? 424 GLU B CA   1 
ATOM   9365  C  C    . GLU B 1 393 ? 80.377  10.223  -14.039 1.00 8.53  ? 424 GLU B C    1 
ATOM   9366  O  O    . GLU B 1 393 ? 80.899  9.959   -12.947 1.00 11.88 ? 424 GLU B O    1 
ATOM   9367  C  CB   . GLU B 1 393 ? 79.811  8.534   -15.856 1.00 4.36  ? 424 GLU B CB   1 
ATOM   9368  C  CG   . GLU B 1 393 ? 78.757  7.584   -16.291 1.00 4.98  ? 424 GLU B CG   1 
ATOM   9369  C  CD   . GLU B 1 393 ? 79.283  6.449   -17.094 1.00 7.17  ? 424 GLU B CD   1 
ATOM   9370  O  OE1  . GLU B 1 393 ? 79.569  6.646   -18.314 1.00 6.34  ? 424 GLU B OE1  1 
ATOM   9371  O  OE2  . GLU B 1 393 ? 79.385  5.357   -16.482 1.00 9.67  ? 424 GLU B OE2  1 
ATOM   9372  H  H    . GLU B 1 393 ? 77.776  9.966   -15.819 1.00 17.00 ? 424 GLU B H    1 
ATOM   9373  N  N    . SER B 1 394 ? 80.620  11.370  -14.697 1.00 6.02  ? 425 SER B N    1 
ATOM   9374  C  CA   . SER B 1 394 ? 81.576  12.352  -14.185 1.00 2.83  ? 425 SER B CA   1 
ATOM   9375  C  C    . SER B 1 394 ? 81.271  12.691  -12.741 1.00 3.94  ? 425 SER B C    1 
ATOM   9376  O  O    . SER B 1 394 ? 82.147  12.646  -11.883 1.00 3.79  ? 425 SER B O    1 
ATOM   9377  C  CB   . SER B 1 394 ? 81.509  13.656  -14.975 1.00 2.48  ? 425 SER B CB   1 
ATOM   9378  O  OG   . SER B 1 394 ? 81.770  13.474  -16.342 1.00 4.17  ? 425 SER B OG   1 
ATOM   9379  H  H    . SER B 1 394 ? 80.186  11.540  -15.556 1.00 17.00 ? 425 SER B H    1 
ATOM   9380  H  HG   . SER B 1 394 ? 81.047  13.019  -16.770 1.00 17.00 ? 425 SER B HG   1 
ATOM   9381  N  N    . PHE B 1 395 ? 80.003  12.979  -12.467 1.00 4.44  ? 426 PHE B N    1 
ATOM   9382  C  CA   . PHE B 1 395 ? 79.573  13.380  -11.128 1.00 4.26  ? 426 PHE B CA   1 
ATOM   9383  C  C    . PHE B 1 395 ? 79.572  12.312  -10.046 1.00 3.93  ? 426 PHE B C    1 
ATOM   9384  O  O    . PHE B 1 395 ? 79.686  12.654  -8.874  1.00 2.15  ? 426 PHE B O    1 
ATOM   9385  C  CB   . PHE B 1 395 ? 78.232  14.122  -11.179 1.00 5.69  ? 426 PHE B CB   1 
ATOM   9386  C  CG   . PHE B 1 395 ? 78.278  15.422  -11.956 1.00 4.22  ? 426 PHE B CG   1 
ATOM   9387  C  CD1  . PHE B 1 395 ? 79.493  15.951  -12.406 1.00 2.00  ? 426 PHE B CD1  1 
ATOM   9388  C  CD2  . PHE B 1 395 ? 77.102  16.125  -12.216 1.00 4.65  ? 426 PHE B CD2  1 
ATOM   9389  C  CE1  . PHE B 1 395 ? 79.550  17.157  -13.096 1.00 2.43  ? 426 PHE B CE1  1 
ATOM   9390  C  CE2  . PHE B 1 395 ? 77.142  17.357  -12.916 1.00 8.14  ? 426 PHE B CE2  1 
ATOM   9391  C  CZ   . PHE B 1 395 ? 78.380  17.873  -13.353 1.00 6.57  ? 426 PHE B CZ   1 
ATOM   9392  H  H    . PHE B 1 395 ? 79.343  12.896  -13.168 1.00 17.00 ? 426 PHE B H    1 
ATOM   9393  N  N    . THR B 1 396 ? 79.408  11.043  -10.416 1.00 4.57  ? 427 THR B N    1 
ATOM   9394  C  CA   . THR B 1 396 ? 79.468  9.931   -9.451  1.00 8.12  ? 427 THR B CA   1 
ATOM   9395  C  C    . THR B 1 396 ? 80.897  9.885   -8.904  1.00 10.78 ? 427 THR B C    1 
ATOM   9396  O  O    . THR B 1 396 ? 81.137  9.490   -7.757  1.00 9.34  ? 427 THR B O    1 
ATOM   9397  C  CB   . THR B 1 396 ? 79.294  8.561   -10.152 1.00 11.65 ? 427 THR B CB   1 
ATOM   9398  O  OG1  . THR B 1 396 ? 78.109  8.568   -10.945 1.00 16.45 ? 427 THR B OG1  1 
ATOM   9399  C  CG2  . THR B 1 396 ? 79.245  7.390   -9.139  1.00 9.21  ? 427 THR B CG2  1 
ATOM   9400  H  H    . THR B 1 396 ? 79.240  10.832  -11.358 1.00 17.00 ? 427 THR B H    1 
ATOM   9401  H  HG1  . THR B 1 396 ? 78.318  8.989   -11.777 1.00 17.00 ? 427 THR B HG1  1 
ATOM   9402  N  N    . ARG B 1 397 ? 81.841  10.216  -9.786  1.00 11.86 ? 428 ARG B N    1 
ATOM   9403  C  CA   . ARG B 1 397 ? 83.262  10.223  -9.484  1.00 9.50  ? 428 ARG B CA   1 
ATOM   9404  C  C    . ARG B 1 397 ? 83.781  11.654  -9.506  1.00 8.23  ? 428 ARG B C    1 
ATOM   9405  O  O    . ARG B 1 397 ? 84.256  12.127  -10.542 1.00 9.77  ? 428 ARG B O    1 
ATOM   9406  C  CB   . ARG B 1 397 ? 84.023  9.362   -10.515 1.00 10.13 ? 428 ARG B CB   1 
ATOM   9407  C  CG   . ARG B 1 397 ? 83.497  7.918   -10.665 1.00 7.78  ? 428 ARG B CG   1 
ATOM   9408  C  CD   . ARG B 1 397 ? 82.385  7.773   -11.729 1.00 10.82 ? 428 ARG B CD   1 
ATOM   9409  N  NE   . ARG B 1 397 ? 81.644  6.505   -11.610 1.00 16.81 ? 428 ARG B NE   1 
ATOM   9410  C  CZ   . ARG B 1 397 ? 80.850  5.961   -12.552 1.00 20.02 ? 428 ARG B CZ   1 
ATOM   9411  N  NH1  . ARG B 1 397 ? 80.658  6.537   -13.743 1.00 18.71 ? 428 ARG B NH1  1 
ATOM   9412  N  NH2  . ARG B 1 397 ? 80.175  4.849   -12.274 1.00 20.90 ? 428 ARG B NH2  1 
ATOM   9413  H  H    . ARG B 1 397 ? 81.590  10.488  -10.698 1.00 17.00 ? 428 ARG B H    1 
ATOM   9414  H  HE   . ARG B 1 397 ? 81.724  6.017   -10.766 1.00 17.00 ? 428 ARG B HE   1 
ATOM   9415  H  HH11 . ARG B 1 397 ? 81.116  7.398   -13.961 1.00 17.00 ? 428 ARG B HH11 1 
ATOM   9416  H  HH12 . ARG B 1 397 ? 80.066  6.100   -14.420 1.00 17.00 ? 428 ARG B HH12 1 
ATOM   9417  H  HH21 . ARG B 1 397 ? 80.268  4.429   -11.372 1.00 17.00 ? 428 ARG B HH21 1 
ATOM   9418  H  HH22 . ARG B 1 397 ? 79.586  4.429   -12.965 1.00 17.00 ? 428 ARG B HH22 1 
ATOM   9419  N  N    . GLN B 1 398 ? 83.589  12.360  -8.391  1.00 5.94  ? 429 GLN B N    1 
ATOM   9420  C  CA   . GLN B 1 398 ? 84.080  13.731  -8.204  1.00 5.28  ? 429 GLN B CA   1 
ATOM   9421  C  C    . GLN B 1 398 ? 83.793  14.256  -6.815  1.00 3.40  ? 429 GLN B C    1 
ATOM   9422  O  O    . GLN B 1 398 ? 82.709  14.738  -6.555  1.00 2.00  ? 429 GLN B O    1 
ATOM   9423  C  CB   . GLN B 1 398 ? 83.548  14.737  -9.231  1.00 2.66  ? 429 GLN B CB   1 
ATOM   9424  C  CG   . GLN B 1 398 ? 84.141  16.117  -8.933  1.00 2.00  ? 429 GLN B CG   1 
ATOM   9425  C  CD   . GLN B 1 398 ? 84.207  17.044  -10.125 1.00 4.74  ? 429 GLN B CD   1 
ATOM   9426  O  OE1  . GLN B 1 398 ? 84.041  16.627  -11.270 1.00 3.54  ? 429 GLN B OE1  1 
ATOM   9427  N  NE2  . GLN B 1 398 ? 84.467  18.329  -9.856  1.00 7.85  ? 429 GLN B NE2  1 
ATOM   9428  H  H    . GLN B 1 398 ? 83.067  11.947  -7.674  1.00 17.00 ? 429 GLN B H    1 
ATOM   9429  H  HE21 . GLN B 1 398 ? 84.576  18.981  -10.574 1.00 17.00 ? 429 GLN B HE21 1 
ATOM   9430  H  HE22 . GLN B 1 398 ? 84.562  18.564  -8.911  1.00 17.00 ? 429 GLN B HE22 1 
ATOM   9431  N  N    . ILE B 1 399 ? 84.790  14.200  -5.938  1.00 4.33  ? 430 ILE B N    1 
ATOM   9432  C  CA   . ILE B 1 399 ? 84.634  14.663  -4.562  1.00 3.81  ? 430 ILE B CA   1 
ATOM   9433  C  C    . ILE B 1 399 ? 84.267  16.127  -4.529  1.00 5.60  ? 430 ILE B C    1 
ATOM   9434  O  O    . ILE B 1 399 ? 84.797  16.942  -5.304  1.00 7.90  ? 430 ILE B O    1 
ATOM   9435  C  CB   . ILE B 1 399 ? 85.926  14.492  -3.699  1.00 2.74  ? 430 ILE B CB   1 
ATOM   9436  C  CG1  . ILE B 1 399 ? 86.608  13.157  -3.982  1.00 4.27  ? 430 ILE B CG1  1 
ATOM   9437  C  CG2  . ILE B 1 399 ? 85.589  14.524  -2.214  1.00 2.00  ? 430 ILE B CG2  1 
ATOM   9438  C  CD1  . ILE B 1 399 ? 87.974  13.285  -4.670  1.00 3.61  ? 430 ILE B CD1  1 
ATOM   9439  H  H    . ILE B 1 399 ? 85.653  13.862  -6.242  1.00 17.00 ? 430 ILE B H    1 
ATOM   9440  N  N    . ALA B 1 400 ? 83.322  16.440  -3.656  1.00 6.06  ? 431 ALA B N    1 
ATOM   9441  C  CA   . ALA B 1 400 ? 82.857  17.800  -3.447  1.00 6.08  ? 431 ALA B CA   1 
ATOM   9442  C  C    . ALA B 1 400 ? 83.463  18.270  -2.115  1.00 5.54  ? 431 ALA B C    1 
ATOM   9443  O  O    . ALA B 1 400 ? 83.886  17.462  -1.280  1.00 4.48  ? 431 ALA B O    1 
ATOM   9444  C  CB   . ALA B 1 400 ? 81.338  17.830  -3.406  1.00 8.48  ? 431 ALA B CB   1 
ATOM   9445  H  H    . ALA B 1 400 ? 82.898  15.735  -3.126  1.00 17.00 ? 431 ALA B H    1 
ATOM   9446  N  N    . GLY B 1 401 ? 83.512  19.576  -1.919  1.00 5.33  ? 432 GLY B N    1 
ATOM   9447  C  CA   . GLY B 1 401 ? 84.118  20.106  -0.711  1.00 5.60  ? 432 GLY B CA   1 
ATOM   9448  C  C    . GLY B 1 401 ? 83.470  19.769  0.603   1.00 2.03  ? 432 GLY B C    1 
ATOM   9449  O  O    . GLY B 1 401 ? 82.310  19.440  0.659   1.00 2.00  ? 432 GLY B O    1 
ATOM   9450  H  H    . GLY B 1 401 ? 83.143  20.185  -2.580  1.00 17.00 ? 432 GLY B H    1 
ATOM   9451  N  N    . ARG B 1 402 ? 84.262  19.761  1.657   1.00 2.16  ? 433 ARG B N    1 
ATOM   9452  C  CA   . ARG B 1 402 ? 83.712  19.526  2.964   1.00 5.06  ? 433 ARG B CA   1 
ATOM   9453  C  C    . ARG B 1 402 ? 83.069  20.897  3.233   1.00 5.08  ? 433 ARG B C    1 
ATOM   9454  O  O    . ARG B 1 402 ? 83.550  21.930  2.768   1.00 3.72  ? 433 ARG B O    1 
ATOM   9455  C  CB   . ARG B 1 402 ? 84.818  19.204  3.981   1.00 8.00  ? 433 ARG B CB   1 
ATOM   9456  C  CG   . ARG B 1 402 ? 84.308  18.952  5.407   1.00 14.27 ? 433 ARG B CG   1 
ATOM   9457  C  CD   . ARG B 1 402 ? 85.421  18.975  6.484   1.00 20.45 ? 433 ARG B CD   1 
ATOM   9458  N  NE   . ARG B 1 402 ? 85.016  18.271  7.714   1.00 26.08 ? 433 ARG B NE   1 
ATOM   9459  C  CZ   . ARG B 1 402 ? 85.620  17.174  8.198   1.00 29.35 ? 433 ARG B CZ   1 
ATOM   9460  N  NH1  . ARG B 1 402 ? 86.668  16.644  7.567   1.00 31.52 ? 433 ARG B NH1  1 
ATOM   9461  N  NH2  . ARG B 1 402 ? 85.151  16.558  9.285   1.00 29.98 ? 433 ARG B NH2  1 
ATOM   9462  H  H    . ARG B 1 402 ? 85.212  19.962  1.528   1.00 17.00 ? 433 ARG B H    1 
ATOM   9463  H  HE   . ARG B 1 402 ? 84.245  18.622  8.205   1.00 17.00 ? 433 ARG B HE   1 
ATOM   9464  H  HH11 . ARG B 1 402 ? 87.017  17.056  6.727   1.00 17.00 ? 433 ARG B HH11 1 
ATOM   9465  H  HH12 . ARG B 1 402 ? 87.110  15.826  7.937   1.00 17.00 ? 433 ARG B HH12 1 
ATOM   9466  H  HH21 . ARG B 1 402 ? 84.318  16.866  9.728   1.00 17.00 ? 433 ARG B HH21 1 
ATOM   9467  H  HH22 . ARG B 1 402 ? 85.614  15.739  9.624   1.00 17.00 ? 433 ARG B HH22 1 
ATOM   9468  N  N    . VAL B 1 403 ? 81.981  20.905  3.979   1.00 7.21  ? 434 VAL B N    1 
ATOM   9469  C  CA   . VAL B 1 403 ? 81.262  22.129  4.253   1.00 6.87  ? 434 VAL B CA   1 
ATOM   9470  C  C    . VAL B 1 403 ? 81.728  22.859  5.486   1.00 7.61  ? 434 VAL B C    1 
ATOM   9471  O  O    . VAL B 1 403 ? 82.273  23.958  5.372   1.00 9.66  ? 434 VAL B O    1 
ATOM   9472  C  CB   . VAL B 1 403 ? 79.725  21.860  4.336   1.00 4.45  ? 434 VAL B CB   1 
ATOM   9473  C  CG1  . VAL B 1 403 ? 78.995  23.065  4.853   1.00 2.00  ? 434 VAL B CG1  1 
ATOM   9474  C  CG2  . VAL B 1 403 ? 79.184  21.461  2.959   1.00 4.16  ? 434 VAL B CG2  1 
ATOM   9475  H  H    . VAL B 1 403 ? 81.658  20.069  4.374   1.00 17.00 ? 434 VAL B H    1 
ATOM   9476  N  N    . ALA B 1 404 ? 81.542  22.250  6.652   1.00 7.49  ? 435 ALA B N    1 
ATOM   9477  C  CA   . ALA B 1 404 ? 81.885  22.904  7.888   1.00 7.36  ? 435 ALA B CA   1 
ATOM   9478  C  C    . ALA B 1 404 ? 83.215  22.571  8.495   1.00 8.92  ? 435 ALA B C    1 
ATOM   9479  O  O    . ALA B 1 404 ? 83.281  22.022  9.582   1.00 8.86  ? 435 ALA B O    1 
ATOM   9480  C  CB   . ALA B 1 404 ? 80.778  22.732  8.903   1.00 9.61  ? 435 ALA B CB   1 
ATOM   9481  H  H    . ALA B 1 404 ? 81.188  21.339  6.693   1.00 17.00 ? 435 ALA B H    1 
ATOM   9482  N  N    . GLY B 1 405 ? 84.279  22.927  7.788   1.00 10.57 ? 436 GLY B N    1 
ATOM   9483  C  CA   . GLY B 1 405 ? 85.630  22.725  8.284   1.00 10.43 ? 436 GLY B CA   1 
ATOM   9484  C  C    . GLY B 1 405 ? 86.150  24.116  8.598   1.00 11.46 ? 436 GLY B C    1 
ATOM   9485  O  O    . GLY B 1 405 ? 86.447  24.460  9.745   1.00 11.79 ? 436 GLY B O    1 
ATOM   9486  H  H    . GLY B 1 405 ? 84.107  23.382  6.938   1.00 17.00 ? 436 GLY B H    1 
ATOM   9487  N  N    . GLY B 1 406 ? 86.175  24.946  7.561   1.00 12.29 ? 437 GLY B N    1 
ATOM   9488  C  CA   . GLY B 1 406 ? 86.624  26.326  7.686   1.00 11.47 ? 437 GLY B CA   1 
ATOM   9489  C  C    . GLY B 1 406 ? 87.267  26.732  6.375   1.00 11.17 ? 437 GLY B C    1 
ATOM   9490  O  O    . GLY B 1 406 ? 87.831  25.867  5.685   1.00 13.30 ? 437 GLY B O    1 
ATOM   9491  H  H    . GLY B 1 406 ? 85.904  24.635  6.676   1.00 17.00 ? 437 GLY B H    1 
ATOM   9492  N  N    . ARG B 1 407 ? 87.081  27.993  5.974   1.00 7.67  ? 438 ARG B N    1 
ATOM   9493  C  CA   . ARG B 1 407 ? 87.688  28.528  4.753   1.00 4.56  ? 438 ARG B CA   1 
ATOM   9494  C  C    . ARG B 1 407 ? 87.663  27.639  3.506   1.00 2.00  ? 438 ARG B C    1 
ATOM   9495  O  O    . ARG B 1 407 ? 88.694  27.404  2.909   1.00 2.02  ? 438 ARG B O    1 
ATOM   9496  C  CB   . ARG B 1 407 ? 89.151  28.934  5.022   1.00 5.77  ? 438 ARG B CB   1 
ATOM   9497  C  CG   . ARG B 1 407 ? 89.459  29.306  6.462   1.00 5.54  ? 438 ARG B CG   1 
ATOM   9498  C  CD   . ARG B 1 407 ? 90.883  28.968  6.833   1.00 2.00  ? 438 ARG B CD   1 
ATOM   9499  N  NE   . ARG B 1 407 ? 91.802  30.073  6.586   1.00 6.71  ? 438 ARG B NE   1 
ATOM   9500  C  CZ   . ARG B 1 407 ? 92.550  30.658  7.522   1.00 7.37  ? 438 ARG B CZ   1 
ATOM   9501  N  NH1  . ARG B 1 407 ? 92.487  30.255  8.787   1.00 8.02  ? 438 ARG B NH1  1 
ATOM   9502  N  NH2  . ARG B 1 407 ? 93.423  31.600  7.180   1.00 6.47  ? 438 ARG B NH2  1 
ATOM   9503  H  H    . ARG B 1 407 ? 86.561  28.612  6.529   1.00 17.00 ? 438 ARG B H    1 
ATOM   9504  H  HE   . ARG B 1 407 ? 91.866  30.413  5.670   1.00 17.00 ? 438 ARG B HE   1 
ATOM   9505  H  HH11 . ARG B 1 407 ? 91.883  29.502  9.045   1.00 17.00 ? 438 ARG B HH11 1 
ATOM   9506  H  HH12 . ARG B 1 407 ? 93.044  30.700  9.483   1.00 17.00 ? 438 ARG B HH12 1 
ATOM   9507  H  HH21 . ARG B 1 407 ? 93.520  31.871  6.222   1.00 17.00 ? 438 ARG B HH21 1 
ATOM   9508  H  HH22 . ARG B 1 407 ? 93.985  32.038  7.882   1.00 17.00 ? 438 ARG B HH22 1 
ATOM   9509  N  N    . ASN B 1 408 ? 86.513  27.122  3.111   1.00 2.00  ? 439 ASN B N    1 
ATOM   9510  C  CA   . ASN B 1 408 ? 86.476  26.314  1.889   1.00 4.00  ? 439 ASN B CA   1 
ATOM   9511  C  C    . ASN B 1 408 ? 85.496  26.836  0.803   1.00 6.11  ? 439 ASN B C    1 
ATOM   9512  O  O    . ASN B 1 408 ? 85.061  26.091  -0.077  1.00 7.59  ? 439 ASN B O    1 
ATOM   9513  C  CB   . ASN B 1 408 ? 86.219  24.833  2.200   1.00 2.42  ? 439 ASN B CB   1 
ATOM   9514  C  CG   . ASN B 1 408 ? 86.508  23.912  1.003   1.00 2.61  ? 439 ASN B CG   1 
ATOM   9515  O  OD1  . ASN B 1 408 ? 87.442  24.129  0.251   1.00 2.00  ? 439 ASN B OD1  1 
ATOM   9516  N  ND2  . ASN B 1 408 ? 85.698  22.881  0.836   1.00 3.71  ? 439 ASN B ND2  1 
ATOM   9517  H  H    . ASN B 1 408 ? 85.705  27.287  3.635   1.00 17.00 ? 439 ASN B H    1 
ATOM   9518  H  HD21 . ASN B 1 408 ? 85.858  22.285  0.078   1.00 17.00 ? 439 ASN B HD21 1 
ATOM   9519  H  HD22 . ASN B 1 408 ? 84.947  22.753  1.462   1.00 17.00 ? 439 ASN B HD22 1 
ATOM   9520  N  N    . VAL B 1 409 ? 85.198  28.134  0.818   1.00 6.58  ? 440 VAL B N    1 
ATOM   9521  C  CA   . VAL B 1 409 ? 84.280  28.710  -0.171  1.00 4.70  ? 440 VAL B CA   1 
ATOM   9522  C  C    . VAL B 1 409 ? 85.010  29.151  -1.440  1.00 4.19  ? 440 VAL B C    1 
ATOM   9523  O  O    . VAL B 1 409 ? 85.970  29.930  -1.370  1.00 5.15  ? 440 VAL B O    1 
ATOM   9524  C  CB   . VAL B 1 409 ? 83.515  29.923  0.419   1.00 5.18  ? 440 VAL B CB   1 
ATOM   9525  C  CG1  . VAL B 1 409 ? 82.661  30.603  -0.656  1.00 2.83  ? 440 VAL B CG1  1 
ATOM   9526  C  CG2  . VAL B 1 409 ? 82.655  29.475  1.598   1.00 5.68  ? 440 VAL B CG2  1 
ATOM   9527  H  H    . VAL B 1 409 ? 85.609  28.723  1.486   1.00 17.00 ? 440 VAL B H    1 
ATOM   9528  N  N    . PRO B 1 410 ? 84.606  28.617  -2.607  1.00 2.70  ? 441 PRO B N    1 
ATOM   9529  C  CA   . PRO B 1 410 ? 85.189  28.941  -3.921  1.00 2.00  ? 441 PRO B CA   1 
ATOM   9530  C  C    . PRO B 1 410 ? 85.323  30.450  -4.096  1.00 3.38  ? 441 PRO B C    1 
ATOM   9531  O  O    . PRO B 1 410 ? 84.319  31.173  -4.065  1.00 4.61  ? 441 PRO B O    1 
ATOM   9532  C  CB   . PRO B 1 410 ? 84.155  28.389  -4.881  1.00 3.10  ? 441 PRO B CB   1 
ATOM   9533  C  CG   . PRO B 1 410 ? 83.728  27.111  -4.186  1.00 5.31  ? 441 PRO B CG   1 
ATOM   9534  C  CD   . PRO B 1 410 ? 83.636  27.510  -2.713  1.00 4.19  ? 441 PRO B CD   1 
ATOM   9535  N  N    . ILE B 1 411 ? 86.540  30.924  -4.354  1.00 2.69  ? 442 ILE B N    1 
ATOM   9536  C  CA   . ILE B 1 411 ? 86.778  32.360  -4.477  1.00 2.36  ? 442 ILE B CA   1 
ATOM   9537  C  C    . ILE B 1 411 ? 85.821  33.020  -5.436  1.00 3.51  ? 442 ILE B C    1 
ATOM   9538  O  O    . ILE B 1 411 ? 85.626  34.239  -5.379  1.00 5.06  ? 442 ILE B O    1 
ATOM   9539  C  CB   . ILE B 1 411 ? 88.277  32.724  -4.793  1.00 2.28  ? 442 ILE B CB   1 
ATOM   9540  C  CG1  . ILE B 1 411 ? 89.185  32.471  -3.568  1.00 6.00  ? 442 ILE B CG1  1 
ATOM   9541  C  CG2  . ILE B 1 411 ? 88.434  34.197  -5.030  1.00 2.48  ? 442 ILE B CG2  1 
ATOM   9542  C  CD1  . ILE B 1 411 ? 89.708  31.007  -3.379  1.00 6.49  ? 442 ILE B CD1  1 
ATOM   9543  H  H    . ILE B 1 411 ? 87.293  30.306  -4.419  1.00 17.00 ? 442 ILE B H    1 
ATOM   9544  N  N    . ALA B 1 412 ? 85.156  32.212  -6.260  1.00 3.80  ? 443 ALA B N    1 
ATOM   9545  C  CA   . ALA B 1 412 ? 84.188  32.736  -7.227  1.00 4.58  ? 443 ALA B CA   1 
ATOM   9546  C  C    . ALA B 1 412 ? 82.893  33.123  -6.505  1.00 4.97  ? 443 ALA B C    1 
ATOM   9547  O  O    . ALA B 1 412 ? 82.435  34.282  -6.500  1.00 4.43  ? 443 ALA B O    1 
ATOM   9548  C  CB   . ALA B 1 412 ? 83.895  31.672  -8.308  1.00 2.00  ? 443 ALA B CB   1 
ATOM   9549  H  H    . ALA B 1 412 ? 85.325  31.258  -6.248  1.00 17.00 ? 443 ALA B H    1 
ATOM   9550  N  N    . VAL B 1 413 ? 82.370  32.134  -5.806  1.00 4.35  ? 444 VAL B N    1 
ATOM   9551  C  CA   . VAL B 1 413 ? 81.140  32.256  -5.076  1.00 3.68  ? 444 VAL B CA   1 
ATOM   9552  C  C    . VAL B 1 413 ? 81.358  32.964  -3.736  1.00 4.25  ? 444 VAL B C    1 
ATOM   9553  O  O    . VAL B 1 413 ? 80.502  32.963  -2.861  1.00 3.81  ? 444 VAL B O    1 
ATOM   9554  C  CB   . VAL B 1 413 ? 80.553  30.846  -4.939  1.00 6.10  ? 444 VAL B CB   1 
ATOM   9555  C  CG1  . VAL B 1 413 ? 79.277  30.861  -4.187  1.00 12.02 ? 444 VAL B CG1  1 
ATOM   9556  C  CG2  . VAL B 1 413 ? 80.303  30.255  -6.326  1.00 2.52  ? 444 VAL B CG2  1 
ATOM   9557  H  H    . VAL B 1 413 ? 82.866  31.292  -5.742  1.00 17.00 ? 444 VAL B H    1 
ATOM   9558  N  N    . GLN B 1 414 ? 82.498  33.635  -3.614  1.00 7.62  ? 445 GLN B N    1 
ATOM   9559  C  CA   . GLN B 1 414 ? 82.850  34.358  -2.402  1.00 8.00  ? 445 GLN B CA   1 
ATOM   9560  C  C    . GLN B 1 414 ? 81.843  35.489  -2.233  1.00 8.13  ? 445 GLN B C    1 
ATOM   9561  O  O    . GLN B 1 414 ? 81.516  35.901  -1.112  1.00 8.91  ? 445 GLN B O    1 
ATOM   9562  C  CB   . GLN B 1 414 ? 84.258  34.942  -2.523  1.00 8.53  ? 445 GLN B CB   1 
ATOM   9563  C  CG   . GLN B 1 414 ? 84.342  36.078  -3.540  1.00 12.48 ? 445 GLN B CG   1 
ATOM   9564  C  CD   . GLN B 1 414 ? 85.491  37.076  -3.288  1.00 16.14 ? 445 GLN B CD   1 
ATOM   9565  O  OE1  . GLN B 1 414 ? 85.796  37.454  -2.132  1.00 15.51 ? 445 GLN B OE1  1 
ATOM   9566  N  NE2  . GLN B 1 414 ? 86.105  37.537  -4.378  1.00 14.13 ? 445 GLN B NE2  1 
ATOM   9567  H  H    . GLN B 1 414 ? 83.151  33.651  -4.339  1.00 17.00 ? 445 GLN B H    1 
ATOM   9568  H  HE21 . GLN B 1 414 ? 86.842  38.164  -4.245  1.00 17.00 ? 445 GLN B HE21 1 
ATOM   9569  H  HE22 . GLN B 1 414 ? 85.793  37.214  -5.248  1.00 17.00 ? 445 GLN B HE22 1 
ATOM   9570  N  N    . ALA B 1 415 ? 81.348  35.988  -3.358  1.00 7.42  ? 446 ALA B N    1 
ATOM   9571  C  CA   . ALA B 1 415 ? 80.368  37.077  -3.356  1.00 9.05  ? 446 ALA B CA   1 
ATOM   9572  C  C    . ALA B 1 415 ? 79.060  36.675  -2.646  1.00 8.19  ? 446 ALA B C    1 
ATOM   9573  O  O    . ALA B 1 415 ? 78.463  37.464  -1.895  1.00 4.38  ? 446 ALA B O    1 
ATOM   9574  C  CB   . ALA B 1 415 ? 80.070  37.481  -4.794  1.00 10.90 ? 446 ALA B CB   1 
ATOM   9575  H  H    . ALA B 1 415 ? 81.666  35.621  -4.210  1.00 17.00 ? 446 ALA B H    1 
ATOM   9576  N  N    . VAL B 1 416 ? 78.616  35.454  -2.958  1.00 6.75  ? 447 VAL B N    1 
ATOM   9577  C  CA   . VAL B 1 416 ? 77.416  34.848  -2.405  1.00 3.96  ? 447 VAL B CA   1 
ATOM   9578  C  C    . VAL B 1 416 ? 77.643  34.701  -0.924  1.00 4.18  ? 447 VAL B C    1 
ATOM   9579  O  O    . VAL B 1 416 ? 76.855  35.173  -0.125  1.00 4.03  ? 447 VAL B O    1 
ATOM   9580  C  CB   . VAL B 1 416 ? 77.221  33.444  -2.977  1.00 2.00  ? 447 VAL B CB   1 
ATOM   9581  C  CG1  . VAL B 1 416 ? 76.087  32.753  -2.274  1.00 3.53  ? 447 VAL B CG1  1 
ATOM   9582  C  CG2  . VAL B 1 416 ? 77.004  33.506  -4.469  1.00 2.00  ? 447 VAL B CG2  1 
ATOM   9583  H  H    . VAL B 1 416 ? 79.148  34.930  -3.589  1.00 17.00 ? 447 VAL B H    1 
ATOM   9584  N  N    . ALA B 1 417 ? 78.734  34.019  -0.574  1.00 4.97  ? 448 ALA B N    1 
ATOM   9585  C  CA   . ALA B 1 417 ? 79.120  33.790  0.824   1.00 4.58  ? 448 ALA B CA   1 
ATOM   9586  C  C    . ALA B 1 417 ? 79.167  35.134  1.561   1.00 4.76  ? 448 ALA B C    1 
ATOM   9587  O  O    . ALA B 1 417 ? 78.907  35.224  2.767   1.00 3.90  ? 448 ALA B O    1 
ATOM   9588  C  CB   . ALA B 1 417 ? 80.494  33.094  0.891   1.00 4.31  ? 448 ALA B CB   1 
ATOM   9589  H  H    . ALA B 1 417 ? 79.314  33.650  -1.276  1.00 17.00 ? 448 ALA B H    1 
ATOM   9590  N  N    . LYS B 1 418 ? 79.498  36.179  0.815   1.00 4.71  ? 449 LYS B N    1 
ATOM   9591  C  CA   . LYS B 1 418 ? 79.559  37.498  1.370   1.00 5.79  ? 449 LYS B CA   1 
ATOM   9592  C  C    . LYS B 1 418 ? 78.135  37.792  1.755   1.00 5.86  ? 449 LYS B C    1 
ATOM   9593  O  O    . LYS B 1 418 ? 77.788  37.703  2.934   1.00 4.25  ? 449 LYS B O    1 
ATOM   9594  C  CB   . LYS B 1 418 ? 80.061  38.499  0.318   1.00 6.88  ? 449 LYS B CB   1 
ATOM   9595  C  CG   . LYS B 1 418 ? 80.165  39.943  0.830   1.00 5.84  ? 449 LYS B CG   1 
ATOM   9596  C  CD   . LYS B 1 418 ? 81.208  40.737  0.059   1.00 2.00  ? 449 LYS B CD   1 
ATOM   9597  C  CE   . LYS B 1 418 ? 81.029  42.219  0.268   1.00 2.00  ? 449 LYS B CE   1 
ATOM   9598  N  NZ   . LYS B 1 418 ? 80.061  42.779  -0.712  1.00 2.00  ? 449 LYS B NZ   1 
ATOM   9599  H  H    . LYS B 1 418 ? 79.729  36.055  -0.124  1.00 17.00 ? 449 LYS B H    1 
ATOM   9600  H  HZ1  . LYS B 1 418 ? 80.411  42.603  -1.676  1.00 17.00 ? 449 LYS B HZ1  1 
ATOM   9601  H  HZ2  . LYS B 1 418 ? 79.133  42.323  -0.596  1.00 17.00 ? 449 LYS B HZ2  1 
ATOM   9602  H  HZ3  . LYS B 1 418 ? 79.965  43.803  -0.561  1.00 17.00 ? 449 LYS B HZ3  1 
ATOM   9603  N  N    . ALA B 1 419 ? 77.310  38.046  0.731   1.00 7.62  ? 450 ALA B N    1 
ATOM   9604  C  CA   . ALA B 1 419 ? 75.875  38.363  0.866   1.00 5.66  ? 450 ALA B CA   1 
ATOM   9605  C  C    . ALA B 1 419 ? 75.315  37.662  2.067   1.00 2.00  ? 450 ALA B C    1 
ATOM   9606  O  O    . ALA B 1 419 ? 74.926  38.301  3.010   1.00 3.63  ? 450 ALA B O    1 
ATOM   9607  C  CB   . ALA B 1 419 ? 75.104  37.950  -0.371  1.00 5.54  ? 450 ALA B CB   1 
ATOM   9608  H  H    . ALA B 1 419 ? 77.668  37.999  -0.180  1.00 17.00 ? 450 ALA B H    1 
ATOM   9609  N  N    . SER B 1 420 ? 75.382  36.347  2.062   1.00 2.03  ? 451 SER B N    1 
ATOM   9610  C  CA   . SER B 1 420 ? 74.925  35.546  3.177   1.00 2.41  ? 451 SER B CA   1 
ATOM   9611  C  C    . SER B 1 420 ? 75.248  36.198  4.522   1.00 4.17  ? 451 SER B C    1 
ATOM   9612  O  O    . SER B 1 420 ? 74.348  36.439  5.322   1.00 7.53  ? 451 SER B O    1 
ATOM   9613  C  CB   . SER B 1 420 ? 75.585  34.186  3.117   1.00 2.00  ? 451 SER B CB   1 
ATOM   9614  O  OG   . SER B 1 420 ? 75.505  33.667  1.807   1.00 2.24  ? 451 SER B OG   1 
ATOM   9615  H  H    . SER B 1 420 ? 75.733  35.922  1.257   1.00 17.00 ? 451 SER B H    1 
ATOM   9616  H  HG   . SER B 1 420 ? 75.938  34.249  1.178   1.00 17.00 ? 451 SER B HG   1 
ATOM   9617  N  N    . ILE B 1 421 ? 76.511  36.552  4.745   1.00 4.86  ? 452 ILE B N    1 
ATOM   9618  C  CA   . ILE B 1 421 ? 76.920  37.183  6.005   1.00 4.75  ? 452 ILE B CA   1 
ATOM   9619  C  C    . ILE B 1 421 ? 76.197  38.510  6.272   1.00 4.18  ? 452 ILE B C    1 
ATOM   9620  O  O    . ILE B 1 421 ? 75.475  38.640  7.257   1.00 4.37  ? 452 ILE B O    1 
ATOM   9621  C  CB   . ILE B 1 421 ? 78.449  37.439  6.055   1.00 3.78  ? 452 ILE B CB   1 
ATOM   9622  C  CG1  . ILE B 1 421 ? 79.203  36.194  5.603   1.00 4.37  ? 452 ILE B CG1  1 
ATOM   9623  C  CG2  . ILE B 1 421 ? 78.882  37.776  7.476   1.00 2.01  ? 452 ILE B CG2  1 
ATOM   9624  C  CD1  . ILE B 1 421 ? 80.730  36.352  5.580   1.00 4.55  ? 452 ILE B CD1  1 
ATOM   9625  H  H    . ILE B 1 421 ? 77.179  36.368  4.054   1.00 17.00 ? 452 ILE B H    1 
ATOM   9626  N  N    . ASP B 1 422 ? 76.370  39.468  5.367   1.00 2.00  ? 453 ASP B N    1 
ATOM   9627  C  CA   . ASP B 1 422 ? 75.761  40.778  5.484   1.00 2.00  ? 453 ASP B CA   1 
ATOM   9628  C  C    . ASP B 1 422 ? 74.245  40.873  5.184   1.00 2.00  ? 453 ASP B C    1 
ATOM   9629  O  O    . ASP B 1 422 ? 73.591  41.836  5.505   1.00 2.00  ? 453 ASP B O    1 
ATOM   9630  C  CB   . ASP B 1 422 ? 76.612  41.843  4.719   1.00 5.24  ? 453 ASP B CB   1 
ATOM   9631  C  CG   . ASP B 1 422 ? 76.918  41.481  3.231   1.00 2.00  ? 453 ASP B CG   1 
ATOM   9632  O  OD1  . ASP B 1 422 ? 77.328  40.365  2.949   1.00 2.01  ? 453 ASP B OD1  1 
ATOM   9633  O  OD2  . ASP B 1 422 ? 76.810  42.339  2.328   1.00 2.00  ? 453 ASP B OD2  1 
ATOM   9634  H  H    . ASP B 1 422 ? 76.909  39.227  4.586   1.00 17.00 ? 453 ASP B H    1 
ATOM   9635  N  N    . GLN B 1 423 ? 73.677  39.820  4.644   1.00 2.76  ? 454 GLN B N    1 
ATOM   9636  C  CA   . GLN B 1 423 ? 72.251  39.765  4.333   1.00 2.06  ? 454 GLN B CA   1 
ATOM   9637  C  C    . GLN B 1 423 ? 71.537  39.253  5.559   1.00 2.00  ? 454 GLN B C    1 
ATOM   9638  O  O    . GLN B 1 423 ? 70.527  39.801  5.972   1.00 2.24  ? 454 GLN B O    1 
ATOM   9639  C  CB   . GLN B 1 423 ? 71.992  38.798  3.197   1.00 2.44  ? 454 GLN B CB   1 
ATOM   9640  C  CG   . GLN B 1 423 ? 70.913  39.243  2.272   1.00 2.00  ? 454 GLN B CG   1 
ATOM   9641  C  CD   . GLN B 1 423 ? 71.081  38.655  0.877   1.00 4.08  ? 454 GLN B CD   1 
ATOM   9642  O  OE1  . GLN B 1 423 ? 71.020  39.385  -0.117  1.00 7.80  ? 454 GLN B OE1  1 
ATOM   9643  N  NE2  . GLN B 1 423 ? 71.301  37.339  0.793   1.00 3.70  ? 454 GLN B NE2  1 
ATOM   9644  H  H    . GLN B 1 423 ? 74.243  39.045  4.489   1.00 17.00 ? 454 GLN B H    1 
ATOM   9645  H  HE21 . GLN B 1 423 ? 71.453  36.990  -0.115  1.00 17.00 ? 454 GLN B HE21 1 
ATOM   9646  H  HE22 . GLN B 1 423 ? 71.331  36.778  1.586   1.00 17.00 ? 454 GLN B HE22 1 
ATOM   9647  N  N    . SER B 1 424 ? 72.058  38.184  6.136   1.00 2.00  ? 455 SER B N    1 
ATOM   9648  C  CA   . SER B 1 424 ? 71.474  37.644  7.347   1.00 2.66  ? 455 SER B CA   1 
ATOM   9649  C  C    . SER B 1 424 ? 71.547  38.674  8.473   1.00 3.59  ? 455 SER B C    1 
ATOM   9650  O  O    . SER B 1 424 ? 70.826  38.580  9.468   1.00 5.15  ? 455 SER B O    1 
ATOM   9651  C  CB   . SER B 1 424 ? 72.168  36.358  7.742   1.00 2.00  ? 455 SER B CB   1 
ATOM   9652  O  OG   . SER B 1 424 ? 71.943  35.415  6.717   1.00 3.22  ? 455 SER B OG   1 
ATOM   9653  H  H    . SER B 1 424 ? 72.855  37.747  5.769   1.00 17.00 ? 455 SER B H    1 
ATOM   9654  H  HG   . SER B 1 424 ? 72.529  35.646  5.984   1.00 17.00 ? 455 SER B HG   1 
ATOM   9655  N  N    . ARG B 1 425 ? 72.380  39.687  8.274   1.00 2.79  ? 456 ARG B N    1 
ATOM   9656  C  CA   . ARG B 1 425 ? 72.561  40.758  9.228   1.00 2.00  ? 456 ARG B CA   1 
ATOM   9657  C  C    . ARG B 1 425 ? 71.476  41.779  8.992   1.00 2.00  ? 456 ARG B C    1 
ATOM   9658  O  O    . ARG B 1 425 ? 71.017  42.443  9.913   1.00 2.00  ? 456 ARG B O    1 
ATOM   9659  C  CB   . ARG B 1 425 ? 73.914  41.420  8.993   1.00 3.68  ? 456 ARG B CB   1 
ATOM   9660  C  CG   . ARG B 1 425 ? 75.140  40.550  9.311   1.00 4.14  ? 456 ARG B CG   1 
ATOM   9661  C  CD   . ARG B 1 425 ? 76.453  41.188  8.870   1.00 2.47  ? 456 ARG B CD   1 
ATOM   9662  N  NE   . ARG B 1 425 ? 77.586  40.703  9.656   1.00 2.94  ? 456 ARG B NE   1 
ATOM   9663  C  CZ   . ARG B 1 425 ? 78.837  41.139  9.518   1.00 4.91  ? 456 ARG B CZ   1 
ATOM   9664  N  NH1  . ARG B 1 425 ? 79.121  42.082  8.624   1.00 8.97  ? 456 ARG B NH1  1 
ATOM   9665  N  NH2  . ARG B 1 425 ? 79.810  40.632  10.254  1.00 2.00  ? 456 ARG B NH2  1 
ATOM   9666  H  H    . ARG B 1 425 ? 72.937  39.696  7.476   1.00 17.00 ? 456 ARG B H    1 
ATOM   9667  H  HE   . ARG B 1 425 ? 77.403  40.015  10.325  1.00 17.00 ? 456 ARG B HE   1 
ATOM   9668  H  HH11 . ARG B 1 425 ? 78.398  42.463  8.050   1.00 17.00 ? 456 ARG B HH11 1 
ATOM   9669  H  HH12 . ARG B 1 425 ? 80.063  42.404  8.526   1.00 17.00 ? 456 ARG B HH12 1 
ATOM   9670  H  HH21 . ARG B 1 425 ? 79.648  39.918  10.925  1.00 17.00 ? 456 ARG B HH21 1 
ATOM   9671  H  HH22 . ARG B 1 425 ? 80.740  40.983  10.128  1.00 17.00 ? 456 ARG B HH22 1 
ATOM   9672  N  N    . GLU B 1 426 ? 71.124  41.943  7.723   1.00 5.13  ? 457 GLU B N    1 
ATOM   9673  C  CA   . GLU B 1 426 ? 70.091  42.894  7.288   1.00 7.23  ? 457 GLU B CA   1 
ATOM   9674  C  C    . GLU B 1 426 ? 68.793  42.406  7.901   1.00 7.77  ? 457 GLU B C    1 
ATOM   9675  O  O    . GLU B 1 426 ? 68.124  43.163  8.612   1.00 8.30  ? 457 GLU B O    1 
ATOM   9676  C  CB   . GLU B 1 426 ? 69.990  42.906  5.763   1.00 7.19  ? 457 GLU B CB   1 
ATOM   9677  C  CG   . GLU B 1 426 ? 69.061  43.935  5.200   1.00 13.12 ? 457 GLU B CG   1 
ATOM   9678  C  CD   . GLU B 1 426 ? 68.799  43.755  3.678   1.00 20.06 ? 457 GLU B CD   1 
ATOM   9679  O  OE1  . GLU B 1 426 ? 69.401  42.835  3.023   1.00 21.93 ? 457 GLU B OE1  1 
ATOM   9680  O  OE2  . GLU B 1 426 ? 67.969  44.540  3.137   1.00 17.73 ? 457 GLU B OE2  1 
ATOM   9681  H  H    . GLU B 1 426 ? 71.580  41.428  7.028   1.00 17.00 ? 457 GLU B H    1 
ATOM   9682  N  N    . MET B 1 427 ? 68.542  41.099  7.750   1.00 5.46  ? 458 MET B N    1 
ATOM   9683  C  CA   . MET B 1 427 ? 67.360  40.437  8.281   1.00 2.39  ? 458 MET B CA   1 
ATOM   9684  C  C    . MET B 1 427 ? 67.357  40.385  9.784   1.00 2.00  ? 458 MET B C    1 
ATOM   9685  O  O    . MET B 1 427 ? 66.595  39.631  10.360  1.00 5.84  ? 458 MET B O    1 
ATOM   9686  C  CB   . MET B 1 427 ? 67.282  39.008  7.759   1.00 2.31  ? 458 MET B CB   1 
ATOM   9687  C  CG   . MET B 1 427 ? 67.079  38.924  6.277   1.00 2.13  ? 458 MET B CG   1 
ATOM   9688  S  SD   . MET B 1 427 ? 66.176  37.496  5.820   1.00 2.06  ? 458 MET B SD   1 
ATOM   9689  C  CE   . MET B 1 427 ? 67.459  36.234  5.940   1.00 2.31  ? 458 MET B CE   1 
ATOM   9690  H  H    . MET B 1 427 ? 69.199  40.582  7.241   1.00 17.00 ? 458 MET B H    1 
ATOM   9691  N  N    . LYS B 1 428 ? 68.247  41.135  10.415  1.00 2.00  ? 459 LYS B N    1 
ATOM   9692  C  CA   . LYS B 1 428 ? 68.387  41.183  11.864  1.00 2.00  ? 459 LYS B CA   1 
ATOM   9693  C  C    . LYS B 1 428 ? 68.388  39.862  12.627  1.00 2.35  ? 459 LYS B C    1 
ATOM   9694  O  O    . LYS B 1 428 ? 67.607  39.715  13.573  1.00 2.00  ? 459 LYS B O    1 
ATOM   9695  C  CB   . LYS B 1 428 ? 67.364  42.134  12.461  1.00 2.04  ? 459 LYS B CB   1 
ATOM   9696  C  CG   . LYS B 1 428 ? 67.484  43.556  11.901  1.00 4.67  ? 459 LYS B CG   1 
ATOM   9697  C  CD   . LYS B 1 428 ? 67.753  44.607  12.975  1.00 4.63  ? 459 LYS B CD   1 
ATOM   9698  C  CE   . LYS B 1 428 ? 69.171  44.529  13.519  1.00 6.63  ? 459 LYS B CE   1 
ATOM   9699  N  NZ   . LYS B 1 428 ? 69.467  43.351  14.405  1.00 9.16  ? 459 LYS B NZ   1 
ATOM   9700  H  H    . LYS B 1 428 ? 68.864  41.715  9.946   1.00 17.00 ? 459 LYS B H    1 
ATOM   9701  H  HZ1  . LYS B 1 428 ? 68.822  43.380  15.219  1.00 17.00 ? 459 LYS B HZ1  1 
ATOM   9702  H  HZ2  . LYS B 1 428 ? 69.355  42.464  13.877  1.00 17.00 ? 459 LYS B HZ2  1 
ATOM   9703  H  HZ3  . LYS B 1 428 ? 70.449  43.416  14.743  1.00 17.00 ? 459 LYS B HZ3  1 
ATOM   9704  N  N    . TYR B 1 429 ? 69.262  38.920  12.229  1.00 2.43  ? 460 TYR B N    1 
ATOM   9705  C  CA   . TYR B 1 429 ? 69.378  37.611  12.907  1.00 3.23  ? 460 TYR B CA   1 
ATOM   9706  C  C    . TYR B 1 429 ? 69.946  37.706  14.324  1.00 3.95  ? 460 TYR B C    1 
ATOM   9707  O  O    . TYR B 1 429 ? 70.466  38.746  14.736  1.00 4.89  ? 460 TYR B O    1 
ATOM   9708  C  CB   . TYR B 1 429 ? 70.266  36.620  12.143  1.00 2.00  ? 460 TYR B CB   1 
ATOM   9709  C  CG   . TYR B 1 429 ? 69.584  35.763  11.105  1.00 3.27  ? 460 TYR B CG   1 
ATOM   9710  C  CD1  . TYR B 1 429 ? 68.716  36.337  10.160  1.00 4.51  ? 460 TYR B CD1  1 
ATOM   9711  C  CD2  . TYR B 1 429 ? 69.913  34.404  10.967  1.00 2.00  ? 460 TYR B CD2  1 
ATOM   9712  C  CE1  . TYR B 1 429 ? 68.205  35.583  9.096   1.00 4.42  ? 460 TYR B CE1  1 
ATOM   9713  C  CE2  . TYR B 1 429 ? 69.415  33.644  9.889   1.00 2.05  ? 460 TYR B CE2  1 
ATOM   9714  C  CZ   . TYR B 1 429 ? 68.567  34.254  8.960   1.00 2.77  ? 460 TYR B CZ   1 
ATOM   9715  O  OH   . TYR B 1 429 ? 68.123  33.600  7.850   1.00 2.00  ? 460 TYR B OH   1 
ATOM   9716  H  H    . TYR B 1 429 ? 69.841  39.108  11.462  1.00 17.00 ? 460 TYR B H    1 
ATOM   9717  H  HH   . TYR B 1 429 ? 68.581  32.763  7.752   1.00 17.00 ? 460 TYR B HH   1 
ATOM   9718  N  N    . GLN B 1 430 ? 69.912  36.577  15.034  1.00 5.07  ? 461 GLN B N    1 
ATOM   9719  C  CA   . GLN B 1 430 ? 70.415  36.504  16.397  1.00 4.92  ? 461 GLN B CA   1 
ATOM   9720  C  C    . GLN B 1 430 ? 71.746  35.762  16.487  1.00 5.37  ? 461 GLN B C    1 
ATOM   9721  O  O    . GLN B 1 430 ? 72.119  35.028  15.574  1.00 4.14  ? 461 GLN B O    1 
ATOM   9722  C  CB   . GLN B 1 430 ? 69.410  35.790  17.302  1.00 4.83  ? 461 GLN B CB   1 
ATOM   9723  C  CG   . GLN B 1 430 ? 68.046  36.454  17.437  1.00 7.04  ? 461 GLN B CG   1 
ATOM   9724  C  CD   . GLN B 1 430 ? 67.325  36.051  18.711  1.00 5.03  ? 461 GLN B CD   1 
ATOM   9725  O  OE1  . GLN B 1 430 ? 67.397  34.901  19.135  1.00 5.17  ? 461 GLN B OE1  1 
ATOM   9726  N  NE2  . GLN B 1 430 ? 66.643  37.010  19.337  1.00 4.90  ? 461 GLN B NE2  1 
ATOM   9727  H  H    . GLN B 1 430 ? 69.577  35.757  14.630  1.00 17.00 ? 461 GLN B H    1 
ATOM   9728  H  HE21 . GLN B 1 430 ? 66.269  36.767  20.208  1.00 17.00 ? 461 GLN B HE21 1 
ATOM   9729  H  HE22 . GLN B 1 430 ? 66.570  37.901  18.947  1.00 17.00 ? 461 GLN B HE22 1 
ATOM   9730  N  N    . SER B 1 431 ? 72.428  35.961  17.617  1.00 6.65  ? 462 SER B N    1 
ATOM   9731  C  CA   . SER B 1 431 ? 73.710  35.335  17.958  1.00 6.98  ? 462 SER B CA   1 
ATOM   9732  C  C    . SER B 1 431 ? 73.678  33.813  17.807  1.00 8.92  ? 462 SER B C    1 
ATOM   9733  O  O    . SER B 1 431 ? 72.654  33.168  18.115  1.00 11.37 ? 462 SER B O    1 
ATOM   9734  C  CB   . SER B 1 431 ? 74.092  35.670  19.404  1.00 7.35  ? 462 SER B CB   1 
ATOM   9735  O  OG   . SER B 1 431 ? 74.819  34.613  20.032  1.00 7.30  ? 462 SER B OG   1 
ATOM   9736  H  H    . SER B 1 431 ? 72.042  36.573  18.273  1.00 17.00 ? 462 SER B H    1 
ATOM   9737  H  HG   . SER B 1 431 ? 75.309  35.051  20.749  1.00 17.00 ? 462 SER B HG   1 
ATOM   9738  N  N    . LEU B 1 432 ? 74.832  33.256  17.435  1.00 6.67  ? 463 LEU B N    1 
ATOM   9739  C  CA   . LEU B 1 432 ? 75.010  31.834  17.216  1.00 5.50  ? 463 LEU B CA   1 
ATOM   9740  C  C    . LEU B 1 432 ? 74.634  30.998  18.420  1.00 4.90  ? 463 LEU B C    1 
ATOM   9741  O  O    . LEU B 1 432 ? 74.260  29.836  18.293  1.00 4.81  ? 463 LEU B O    1 
ATOM   9742  C  CB   . LEU B 1 432 ? 76.464  31.534  16.863  1.00 9.08  ? 463 LEU B CB   1 
ATOM   9743  C  CG   . LEU B 1 432 ? 76.810  30.032  16.804  1.00 8.36  ? 463 LEU B CG   1 
ATOM   9744  C  CD1  . LEU B 1 432 ? 76.328  29.437  15.475  1.00 6.71  ? 463 LEU B CD1  1 
ATOM   9745  C  CD2  . LEU B 1 432 ? 78.304  29.843  16.995  1.00 5.53  ? 463 LEU B CD2  1 
ATOM   9746  H  H    . LEU B 1 432 ? 75.598  33.847  17.331  1.00 17.00 ? 463 LEU B H    1 
ATOM   9747  N  N    . ASN B 1 433 ? 74.781  31.550  19.606  1.00 5.11  ? 464 ASN B N    1 
ATOM   9748  C  CA   . ASN B 1 433 ? 74.428  30.755  20.767  1.00 9.66  ? 464 ASN B CA   1 
ATOM   9749  C  C    . ASN B 1 433 ? 72.932  30.764  21.105  1.00 8.83  ? 464 ASN B C    1 
ATOM   9750  O  O    . ASN B 1 433 ? 72.388  29.774  21.576  1.00 3.46  ? 464 ASN B O    1 
ATOM   9751  C  CB   . ASN B 1 433 ? 75.292  31.151  21.951  1.00 10.14 ? 464 ASN B CB   1 
ATOM   9752  C  CG   . ASN B 1 433 ? 76.719  30.776  21.746  1.00 8.19  ? 464 ASN B CG   1 
ATOM   9753  O  OD1  . ASN B 1 433 ? 77.592  31.614  21.842  1.00 10.73 ? 464 ASN B OD1  1 
ATOM   9754  N  ND2  . ASN B 1 433 ? 76.965  29.516  21.422  1.00 4.93  ? 464 ASN B ND2  1 
ATOM   9755  H  H    . ASN B 1 433 ? 75.116  32.471  19.684  1.00 17.00 ? 464 ASN B H    1 
ATOM   9756  H  HD21 . ASN B 1 433 ? 77.916  29.366  21.248  1.00 17.00 ? 464 ASN B HD21 1 
ATOM   9757  H  HD22 . ASN B 1 433 ? 76.241  28.864  21.349  1.00 17.00 ? 464 ASN B HD22 1 
ATOM   9758  N  N    . GLU B 1 434 ? 72.272  31.895  20.872  1.00 11.30 ? 465 GLU B N    1 
ATOM   9759  C  CA   . GLU B 1 434 ? 70.850  31.968  21.131  1.00 12.34 ? 465 GLU B CA   1 
ATOM   9760  C  C    . GLU B 1 434 ? 70.221  30.866  20.290  1.00 11.23 ? 465 GLU B C    1 
ATOM   9761  O  O    . GLU B 1 434 ? 69.361  30.141  20.785  1.00 13.94 ? 465 GLU B O    1 
ATOM   9762  C  CB   . GLU B 1 434 ? 70.271  33.358  20.800  1.00 12.29 ? 465 GLU B CB   1 
ATOM   9763  C  CG   . GLU B 1 434 ? 70.275  34.315  22.015  1.00 16.38 ? 465 GLU B CG   1 
ATOM   9764  C  CD   . GLU B 1 434 ? 69.678  33.683  23.315  1.00 19.57 ? 465 GLU B CD   1 
ATOM   9765  O  OE1  . GLU B 1 434 ? 68.544  33.122  23.262  1.00 21.31 ? 465 GLU B OE1  1 
ATOM   9766  O  OE2  . GLU B 1 434 ? 70.347  33.739  24.388  1.00 15.80 ? 465 GLU B OE2  1 
ATOM   9767  H  H    . GLU B 1 434 ? 72.737  32.676  20.506  1.00 17.00 ? 465 GLU B H    1 
ATOM   9768  N  N    . TYR B 1 435 ? 70.750  30.659  19.078  1.00 7.81  ? 466 TYR B N    1 
ATOM   9769  C  CA   . TYR B 1 435 ? 70.240  29.623  18.178  1.00 5.60  ? 466 TYR B CA   1 
ATOM   9770  C  C    . TYR B 1 435 ? 70.558  28.261  18.675  1.00 3.44  ? 466 TYR B C    1 
ATOM   9771  O  O    . TYR B 1 435 ? 69.726  27.366  18.616  1.00 2.00  ? 466 TYR B O    1 
ATOM   9772  C  CB   . TYR B 1 435 ? 70.754  29.793  16.749  1.00 5.03  ? 466 TYR B CB   1 
ATOM   9773  C  CG   . TYR B 1 435 ? 69.876  30.727  15.947  1.00 5.00  ? 466 TYR B CG   1 
ATOM   9774  C  CD1  . TYR B 1 435 ? 70.066  32.107  15.998  1.00 4.42  ? 466 TYR B CD1  1 
ATOM   9775  C  CD2  . TYR B 1 435 ? 68.797  30.233  15.219  1.00 4.37  ? 466 TYR B CD2  1 
ATOM   9776  C  CE1  . TYR B 1 435 ? 69.199  32.957  15.357  1.00 7.40  ? 466 TYR B CE1  1 
ATOM   9777  C  CE2  . TYR B 1 435 ? 67.925  31.065  14.580  1.00 4.01  ? 466 TYR B CE2  1 
ATOM   9778  C  CZ   . TYR B 1 435 ? 68.114  32.430  14.650  1.00 7.34  ? 466 TYR B CZ   1 
ATOM   9779  O  OH   . TYR B 1 435 ? 67.184  33.303  14.064  1.00 9.60  ? 466 TYR B OH   1 
ATOM   9780  H  H    . TYR B 1 435 ? 71.475  31.247  18.776  1.00 17.00 ? 466 TYR B H    1 
ATOM   9781  H  HH   . TYR B 1 435 ? 67.365  34.215  14.311  1.00 17.00 ? 466 TYR B HH   1 
ATOM   9782  N  N    . ARG B 1 436 ? 71.761  28.115  19.199  1.00 4.68  ? 467 ARG B N    1 
ATOM   9783  C  CA   . ARG B 1 436 ? 72.180  26.818  19.726  1.00 6.33  ? 467 ARG B CA   1 
ATOM   9784  C  C    . ARG B 1 436 ? 71.274  26.467  20.888  1.00 4.10  ? 467 ARG B C    1 
ATOM   9785  O  O    . ARG B 1 436 ? 70.765  25.366  20.958  1.00 6.31  ? 467 ARG B O    1 
ATOM   9786  C  CB   . ARG B 1 436 ? 73.655  26.822  20.163  1.00 7.20  ? 467 ARG B CB   1 
ATOM   9787  C  CG   . ARG B 1 436 ? 74.658  26.705  19.011  1.00 6.95  ? 467 ARG B CG   1 
ATOM   9788  C  CD   . ARG B 1 436 ? 76.092  26.697  19.516  1.00 8.26  ? 467 ARG B CD   1 
ATOM   9789  N  NE   . ARG B 1 436 ? 76.367  25.557  20.390  1.00 4.90  ? 467 ARG B NE   1 
ATOM   9790  C  CZ   . ARG B 1 436 ? 76.347  24.294  19.987  1.00 2.75  ? 467 ARG B CZ   1 
ATOM   9791  N  NH1  . ARG B 1 436 ? 76.077  24.009  18.720  1.00 2.00  ? 467 ARG B NH1  1 
ATOM   9792  N  NH2  . ARG B 1 436 ? 76.527  23.316  20.866  1.00 2.95  ? 467 ARG B NH2  1 
ATOM   9793  H  H    . ARG B 1 436 ? 72.373  28.877  19.207  1.00 17.00 ? 467 ARG B H    1 
ATOM   9794  H  HE   . ARG B 1 436 ? 76.581  25.738  21.326  1.00 17.00 ? 467 ARG B HE   1 
ATOM   9795  H  HH11 . ARG B 1 436 ? 75.886  24.757  18.094  1.00 17.00 ? 467 ARG B HH11 1 
ATOM   9796  H  HH12 . ARG B 1 436 ? 76.062  23.067  18.393  1.00 17.00 ? 467 ARG B HH12 1 
ATOM   9797  H  HH21 . ARG B 1 436 ? 76.674  23.521  21.831  1.00 17.00 ? 467 ARG B HH21 1 
ATOM   9798  H  HH22 . ARG B 1 436 ? 76.504  22.365  20.560  1.00 17.00 ? 467 ARG B HH22 1 
ATOM   9799  N  N    . LYS B 1 437 ? 71.001  27.441  21.740  1.00 2.67  ? 468 LYS B N    1 
ATOM   9800  C  CA   . LYS B 1 437 ? 70.148  27.232  22.887  1.00 2.61  ? 468 LYS B CA   1 
ATOM   9801  C  C    . LYS B 1 437 ? 68.788  26.867  22.373  1.00 4.16  ? 468 LYS B C    1 
ATOM   9802  O  O    . LYS B 1 437 ? 68.233  25.847  22.770  1.00 8.68  ? 468 LYS B O    1 
ATOM   9803  C  CB   . LYS B 1 437 ? 70.070  28.493  23.738  1.00 2.17  ? 468 LYS B CB   1 
ATOM   9804  C  CG   . LYS B 1 437 ? 71.369  28.833  24.418  1.00 2.01  ? 468 LYS B CG   1 
ATOM   9805  C  CD   . LYS B 1 437 ? 71.560  30.318  24.504  1.00 4.56  ? 468 LYS B CD   1 
ATOM   9806  C  CE   . LYS B 1 437 ? 70.689  30.947  25.576  1.00 6.72  ? 468 LYS B CE   1 
ATOM   9807  N  NZ   . LYS B 1 437 ? 71.153  30.612  26.949  1.00 6.23  ? 468 LYS B NZ   1 
ATOM   9808  H  H    . LYS B 1 437 ? 71.354  28.323  21.581  1.00 17.00 ? 468 LYS B H    1 
ATOM   9809  H  HZ1  . LYS B 1 437 ? 72.134  30.939  27.062  1.00 17.00 ? 468 LYS B HZ1  1 
ATOM   9810  H  HZ2  . LYS B 1 437 ? 70.553  31.087  27.648  1.00 17.00 ? 468 LYS B HZ2  1 
ATOM   9811  H  HZ3  . LYS B 1 437 ? 71.108  29.587  27.113  1.00 17.00 ? 468 LYS B HZ3  1 
ATOM   9812  N  N    . ARG B 1 438 ? 68.268  27.697  21.474  1.00 3.58  ? 469 ARG B N    1 
ATOM   9813  C  CA   . ARG B 1 438 ? 66.971  27.500  20.827  1.00 2.41  ? 469 ARG B CA   1 
ATOM   9814  C  C    . ARG B 1 438 ? 66.826  26.036  20.339  1.00 2.28  ? 469 ARG B C    1 
ATOM   9815  O  O    . ARG B 1 438 ? 65.826  25.381  20.616  1.00 2.00  ? 469 ARG B O    1 
ATOM   9816  C  CB   . ARG B 1 438 ? 66.840  28.513  19.675  1.00 2.01  ? 469 ARG B CB   1 
ATOM   9817  C  CG   . ARG B 1 438 ? 65.721  28.283  18.688  1.00 2.54  ? 469 ARG B CG   1 
ATOM   9818  C  CD   . ARG B 1 438 ? 64.312  28.485  19.284  1.00 2.61  ? 469 ARG B CD   1 
ATOM   9819  N  NE   . ARG B 1 438 ? 63.466  27.302  19.120  1.00 2.01  ? 469 ARG B NE   1 
ATOM   9820  C  CZ   . ARG B 1 438 ? 62.766  26.996  18.038  1.00 2.04  ? 469 ARG B CZ   1 
ATOM   9821  N  NH1  . ARG B 1 438 ? 62.760  27.769  16.986  1.00 2.00  ? 469 ARG B NH1  1 
ATOM   9822  N  NH2  . ARG B 1 438 ? 62.103  25.865  17.998  1.00 4.90  ? 469 ARG B NH2  1 
ATOM   9823  H  H    . ARG B 1 438 ? 68.793  28.478  21.244  1.00 17.00 ? 469 ARG B H    1 
ATOM   9824  H  HE   . ARG B 1 438 ? 63.422  26.670  19.867  1.00 17.00 ? 469 ARG B HE   1 
ATOM   9825  H  HH11 . ARG B 1 438 ? 63.294  28.614  16.989  1.00 17.00 ? 469 ARG B HH11 1 
ATOM   9826  H  HH12 . ARG B 1 438 ? 62.229  27.509  16.178  1.00 17.00 ? 469 ARG B HH12 1 
ATOM   9827  H  HH21 . ARG B 1 438 ? 62.119  25.228  18.768  1.00 17.00 ? 469 ARG B HH21 1 
ATOM   9828  H  HH22 . ARG B 1 438 ? 61.568  25.660  17.183  1.00 17.00 ? 469 ARG B HH22 1 
ATOM   9829  N  N    . PHE B 1 439 ? 67.844  25.490  19.687  1.00 2.84  ? 470 PHE B N    1 
ATOM   9830  C  CA   . PHE B 1 439 ? 67.733  24.107  19.268  1.00 3.25  ? 470 PHE B CA   1 
ATOM   9831  C  C    . PHE B 1 439 ? 68.325  23.103  20.260  1.00 4.80  ? 470 PHE B C    1 
ATOM   9832  O  O    . PHE B 1 439 ? 68.983  22.133  19.878  1.00 5.53  ? 470 PHE B O    1 
ATOM   9833  C  CB   . PHE B 1 439 ? 68.231  23.885  17.848  1.00 2.00  ? 470 PHE B CB   1 
ATOM   9834  C  CG   . PHE B 1 439 ? 67.304  24.407  16.823  1.00 2.00  ? 470 PHE B CG   1 
ATOM   9835  C  CD1  . PHE B 1 439 ? 67.186  25.778  16.620  1.00 3.08  ? 470 PHE B CD1  1 
ATOM   9836  C  CD2  . PHE B 1 439 ? 66.515  23.551  16.093  1.00 2.00  ? 470 PHE B CD2  1 
ATOM   9837  C  CE1  . PHE B 1 439 ? 66.284  26.290  15.698  1.00 2.20  ? 470 PHE B CE1  1 
ATOM   9838  C  CE2  . PHE B 1 439 ? 65.608  24.046  15.172  1.00 2.14  ? 470 PHE B CE2  1 
ATOM   9839  C  CZ   . PHE B 1 439 ? 65.491  25.428  14.975  1.00 2.00  ? 470 PHE B CZ   1 
ATOM   9840  H  H    . PHE B 1 439 ? 68.667  25.992  19.514  1.00 17.00 ? 470 PHE B H    1 
ATOM   9841  N  N    . SER B 1 440 ? 68.074  23.349  21.540  1.00 4.01  ? 471 SER B N    1 
ATOM   9842  C  CA   . SER B 1 440 ? 68.496  22.459  22.601  1.00 6.27  ? 471 SER B CA   1 
ATOM   9843  C  C    . SER B 1 440 ? 69.973  22.006  22.552  1.00 9.15  ? 471 SER B C    1 
ATOM   9844  O  O    . SER B 1 440 ? 70.326  20.848  22.878  1.00 11.43 ? 471 SER B O    1 
ATOM   9845  C  CB   . SER B 1 440 ? 67.554  21.263  22.616  1.00 6.32  ? 471 SER B CB   1 
ATOM   9846  O  OG   . SER B 1 440 ? 66.208  21.694  22.608  1.00 6.04  ? 471 SER B OG   1 
ATOM   9847  H  H    . SER B 1 440 ? 67.575  24.150  21.795  1.00 17.00 ? 471 SER B H    1 
ATOM   9848  H  HG   . SER B 1 440 ? 65.677  20.910  22.433  1.00 17.00 ? 471 SER B HG   1 
ATOM   9849  N  N    . LEU B 1 441 ? 70.837  22.933  22.159  1.00 8.11  ? 472 LEU B N    1 
ATOM   9850  C  CA   . LEU B 1 441 ? 72.260  22.686  22.096  1.00 6.49  ? 472 LEU B CA   1 
ATOM   9851  C  C    . LEU B 1 441 ? 72.823  23.575  23.194  1.00 8.00  ? 472 LEU B C    1 
ATOM   9852  O  O    . LEU B 1 441 ? 72.111  24.459  23.670  1.00 6.55  ? 472 LEU B O    1 
ATOM   9853  C  CB   . LEU B 1 441 ? 72.796  23.137  20.749  1.00 3.71  ? 472 LEU B CB   1 
ATOM   9854  C  CG   . LEU B 1 441 ? 72.127  22.594  19.502  1.00 2.03  ? 472 LEU B CG   1 
ATOM   9855  C  CD1  . LEU B 1 441 ? 72.745  23.222  18.260  1.00 5.87  ? 472 LEU B CD1  1 
ATOM   9856  C  CD2  . LEU B 1 441 ? 72.278  21.119  19.470  1.00 2.54  ? 472 LEU B CD2  1 
ATOM   9857  H  H    . LEU B 1 441 ? 70.500  23.823  21.943  1.00 17.00 ? 472 LEU B H    1 
ATOM   9858  N  N    . LYS B 1 442 ? 74.065  23.323  23.636  1.00 11.10 ? 473 LYS B N    1 
ATOM   9859  C  CA   . LYS B 1 442 ? 74.701  24.164  24.671  1.00 10.35 ? 473 LYS B CA   1 
ATOM   9860  C  C    . LYS B 1 442 ? 75.578  25.216  24.011  1.00 7.85  ? 473 LYS B C    1 
ATOM   9861  O  O    . LYS B 1 442 ? 76.439  24.901  23.199  1.00 5.20  ? 473 LYS B O    1 
ATOM   9862  C  CB   . LYS B 1 442 ? 75.542  23.361  25.659  1.00 13.52 ? 473 LYS B CB   1 
ATOM   9863  C  CG   . LYS B 1 442 ? 76.051  24.222  26.831  1.00 19.05 ? 473 LYS B CG   1 
ATOM   9864  C  CD   . LYS B 1 442 ? 77.094  23.468  27.729  1.00 23.90 ? 473 LYS B CD   1 
ATOM   9865  C  CE   . LYS B 1 442 ? 76.493  22.354  28.619  1.00 23.81 ? 473 LYS B CE   1 
ATOM   9866  N  NZ   . LYS B 1 442 ? 75.461  22.841  29.601  1.00 23.69 ? 473 LYS B NZ   1 
ATOM   9867  H  H    . LYS B 1 442 ? 74.573  22.581  23.257  1.00 17.00 ? 473 LYS B H    1 
ATOM   9868  H  HZ1  . LYS B 1 442 ? 75.894  23.549  30.227  1.00 17.00 ? 473 LYS B HZ1  1 
ATOM   9869  H  HZ2  . LYS B 1 442 ? 74.670  23.270  29.080  1.00 17.00 ? 473 LYS B HZ2  1 
ATOM   9870  H  HZ3  . LYS B 1 442 ? 75.110  22.045  30.170  1.00 17.00 ? 473 LYS B HZ3  1 
ATOM   9871  N  N    . PRO B 1 443 ? 75.353  26.489  24.340  1.00 7.86  ? 474 PRO B N    1 
ATOM   9872  C  CA   . PRO B 1 443 ? 76.162  27.539  23.733  1.00 6.77  ? 474 PRO B CA   1 
ATOM   9873  C  C    . PRO B 1 443 ? 77.670  27.324  23.947  1.00 7.78  ? 474 PRO B C    1 
ATOM   9874  O  O    . PRO B 1 443 ? 78.105  26.675  24.919  1.00 8.77  ? 474 PRO B O    1 
ATOM   9875  C  CB   . PRO B 1 443 ? 75.622  28.813  24.406  1.00 5.52  ? 474 PRO B CB   1 
ATOM   9876  C  CG   . PRO B 1 443 ? 75.127  28.347  25.716  1.00 6.72  ? 474 PRO B CG   1 
ATOM   9877  C  CD   . PRO B 1 443 ? 74.457  27.041  25.373  1.00 7.08  ? 474 PRO B CD   1 
ATOM   9878  N  N    . TYR B 1 444 ? 78.451  27.807  22.989  1.00 7.72  ? 475 TYR B N    1 
ATOM   9879  C  CA   . TYR B 1 444 ? 79.906  27.703  23.035  1.00 7.48  ? 475 TYR B CA   1 
ATOM   9880  C  C    . TYR B 1 444 ? 80.579  28.676  24.003  1.00 7.97  ? 475 TYR B C    1 
ATOM   9881  O  O    . TYR B 1 444 ? 80.140  29.827  24.147  1.00 5.36  ? 475 TYR B O    1 
ATOM   9882  C  CB   . TYR B 1 444 ? 80.473  27.901  21.648  1.00 5.24  ? 475 TYR B CB   1 
ATOM   9883  C  CG   . TYR B 1 444 ? 80.183  26.742  20.740  1.00 2.02  ? 475 TYR B CG   1 
ATOM   9884  C  CD1  . TYR B 1 444 ? 80.300  25.434  21.187  1.00 2.00  ? 475 TYR B CD1  1 
ATOM   9885  C  CD2  . TYR B 1 444 ? 79.842  26.949  19.420  1.00 2.41  ? 475 TYR B CD2  1 
ATOM   9886  C  CE1  . TYR B 1 444 ? 80.092  24.342  20.331  1.00 2.00  ? 475 TYR B CE1  1 
ATOM   9887  C  CE2  . TYR B 1 444 ? 79.634  25.882  18.557  1.00 2.73  ? 475 TYR B CE2  1 
ATOM   9888  C  CZ   . TYR B 1 444 ? 79.763  24.579  19.016  1.00 2.67  ? 475 TYR B CZ   1 
ATOM   9889  O  OH   . TYR B 1 444 ? 79.588  23.533  18.135  1.00 2.63  ? 475 TYR B OH   1 
ATOM   9890  H  H    . TYR B 1 444 ? 78.044  28.235  22.232  1.00 17.00 ? 475 TYR B H    1 
ATOM   9891  H  HH   . TYR B 1 444 ? 79.511  23.942  17.275  1.00 17.00 ? 475 TYR B HH   1 
ATOM   9892  N  N    . THR B 1 445 ? 81.662  28.209  24.639  1.00 8.06  ? 476 THR B N    1 
ATOM   9893  C  CA   . THR B 1 445 ? 82.420  29.007  25.612  1.00 6.47  ? 476 THR B CA   1 
ATOM   9894  C  C    . THR B 1 445 ? 83.566  29.786  24.990  1.00 2.93  ? 476 THR B C    1 
ATOM   9895  O  O    . THR B 1 445 ? 84.101  30.688  25.615  1.00 2.00  ? 476 THR B O    1 
ATOM   9896  C  CB   . THR B 1 445 ? 82.992  28.139  26.796  1.00 7.82  ? 476 THR B CB   1 
ATOM   9897  O  OG1  . THR B 1 445 ? 83.897  27.149  26.292  1.00 8.25  ? 476 THR B OG1  1 
ATOM   9898  C  CG2  . THR B 1 445 ? 81.878  27.432  27.556  1.00 7.12  ? 476 THR B CG2  1 
ATOM   9899  H  H    . THR B 1 445 ? 81.974  27.300  24.485  1.00 17.00 ? 476 THR B H    1 
ATOM   9900  H  HG1  . THR B 1 445 ? 84.252  26.659  27.042  1.00 17.00 ? 476 THR B HG1  1 
ATOM   9901  N  N    . SER B 1 446 ? 83.928  29.457  23.759  1.00 2.00  ? 477 SER B N    1 
ATOM   9902  C  CA   . SER B 1 446 ? 85.021  30.149  23.113  1.00 2.49  ? 477 SER B CA   1 
ATOM   9903  C  C    . SER B 1 446 ? 84.971  29.963  21.622  1.00 2.75  ? 477 SER B C    1 
ATOM   9904  O  O    . SER B 1 446 ? 84.370  29.000  21.144  1.00 3.03  ? 477 SER B O    1 
ATOM   9905  C  CB   . SER B 1 446 ? 86.337  29.583  23.643  1.00 5.77  ? 477 SER B CB   1 
ATOM   9906  O  OG   . SER B 1 446 ? 86.389  28.164  23.540  1.00 4.32  ? 477 SER B OG   1 
ATOM   9907  H  H    . SER B 1 446 ? 83.459  28.768  23.255  1.00 17.00 ? 477 SER B H    1 
ATOM   9908  H  HG   . SER B 1 446 ? 85.891  27.788  24.281  1.00 17.00 ? 477 SER B HG   1 
ATOM   9909  N  N    . PHE B 1 447 ? 85.616  30.858  20.876  1.00 2.93  ? 478 PHE B N    1 
ATOM   9910  C  CA   . PHE B 1 447 ? 85.661  30.725  19.405  1.00 3.87  ? 478 PHE B CA   1 
ATOM   9911  C  C    . PHE B 1 447 ? 86.381  29.418  19.111  1.00 5.33  ? 478 PHE B C    1 
ATOM   9912  O  O    . PHE B 1 447 ? 86.202  28.765  18.079  1.00 5.16  ? 478 PHE B O    1 
ATOM   9913  C  CB   . PHE B 1 447 ? 86.437  31.885  18.787  1.00 2.33  ? 478 PHE B CB   1 
ATOM   9914  C  CG   . PHE B 1 447 ? 85.655  33.155  18.714  1.00 3.61  ? 478 PHE B CG   1 
ATOM   9915  C  CD1  . PHE B 1 447 ? 85.537  33.975  19.816  1.00 3.70  ? 478 PHE B CD1  1 
ATOM   9916  C  CD2  . PHE B 1 447 ? 84.985  33.509  17.552  1.00 2.86  ? 478 PHE B CD2  1 
ATOM   9917  C  CE1  . PHE B 1 447 ? 84.766  35.112  19.754  1.00 3.17  ? 478 PHE B CE1  1 
ATOM   9918  C  CE2  . PHE B 1 447 ? 84.217  34.642  17.495  1.00 2.00  ? 478 PHE B CE2  1 
ATOM   9919  C  CZ   . PHE B 1 447 ? 84.110  35.436  18.593  1.00 2.00  ? 478 PHE B CZ   1 
ATOM   9920  H  H    . PHE B 1 447 ? 86.047  31.633  21.296  1.00 17.00 ? 478 PHE B H    1 
ATOM   9921  N  N    . GLU B 1 448 ? 87.201  29.064  20.086  1.00 7.20  ? 479 GLU B N    1 
ATOM   9922  C  CA   . GLU B 1 448 ? 87.995  27.883  20.092  1.00 7.90  ? 479 GLU B CA   1 
ATOM   9923  C  C    . GLU B 1 448 ? 87.025  26.703  20.220  1.00 8.26  ? 479 GLU B C    1 
ATOM   9924  O  O    . GLU B 1 448 ? 87.196  25.685  19.537  1.00 10.28 ? 479 GLU B O    1 
ATOM   9925  C  CB   . GLU B 1 448 ? 88.987  28.035  21.248  1.00 12.45 ? 479 GLU B CB   1 
ATOM   9926  C  CG   . GLU B 1 448 ? 89.840  29.352  21.099  1.00 22.24 ? 479 GLU B CG   1 
ATOM   9927  C  CD   . GLU B 1 448 ? 89.588  30.463  22.178  1.00 29.75 ? 479 GLU B CD   1 
ATOM   9928  O  OE1  . GLU B 1 448 ? 88.700  31.344  21.983  1.00 32.31 ? 479 GLU B OE1  1 
ATOM   9929  O  OE2  . GLU B 1 448 ? 90.324  30.492  23.207  1.00 33.49 ? 479 GLU B OE2  1 
ATOM   9930  H  H    . GLU B 1 448 ? 87.295  29.655  20.853  1.00 17.00 ? 479 GLU B H    1 
ATOM   9931  N  N    . GLU B 1 449 ? 85.965  26.880  21.023  1.00 6.49  ? 480 GLU B N    1 
ATOM   9932  C  CA   . GLU B 1 449 ? 84.919  25.860  21.231  1.00 6.03  ? 480 GLU B CA   1 
ATOM   9933  C  C    . GLU B 1 449 ? 84.242  25.613  19.908  1.00 3.96  ? 480 GLU B C    1 
ATOM   9934  O  O    . GLU B 1 449 ? 83.991  24.463  19.514  1.00 2.59  ? 480 GLU B O    1 
ATOM   9935  C  CB   . GLU B 1 449 ? 83.847  26.371  22.197  1.00 5.94  ? 480 GLU B CB   1 
ATOM   9936  C  CG   . GLU B 1 449 ? 83.935  25.820  23.596  1.00 11.62 ? 480 GLU B CG   1 
ATOM   9937  C  CD   . GLU B 1 449 ? 82.850  24.795  23.916  1.00 13.24 ? 480 GLU B CD   1 
ATOM   9938  O  OE1  . GLU B 1 449 ? 81.718  25.209  24.246  1.00 14.85 ? 480 GLU B OE1  1 
ATOM   9939  O  OE2  . GLU B 1 449 ? 83.136  23.577  23.866  1.00 12.80 ? 480 GLU B OE2  1 
ATOM   9940  H  H    . GLU B 1 449 ? 85.898  27.710  21.526  1.00 17.00 ? 480 GLU B H    1 
ATOM   9941  N  N    . LEU B 1 450 ? 83.947  26.722  19.243  1.00 2.00  ? 481 LEU B N    1 
ATOM   9942  C  CA   . LEU B 1 450 ? 83.296  26.697  17.967  1.00 2.00  ? 481 LEU B CA   1 
ATOM   9943  C  C    . LEU B 1 450 ? 84.131  25.952  16.942  1.00 3.50  ? 481 LEU B C    1 
ATOM   9944  O  O    . LEU B 1 450 ? 83.638  24.972  16.355  1.00 5.20  ? 481 LEU B O    1 
ATOM   9945  C  CB   . LEU B 1 450 ? 83.020  28.128  17.489  1.00 2.28  ? 481 LEU B CB   1 
ATOM   9946  C  CG   . LEU B 1 450 ? 82.593  28.312  16.030  1.00 2.59  ? 481 LEU B CG   1 
ATOM   9947  C  CD1  . LEU B 1 450 ? 81.216  27.795  15.851  1.00 2.00  ? 481 LEU B CD1  1 
ATOM   9948  C  CD2  . LEU B 1 450 ? 82.689  29.764  15.594  1.00 2.00  ? 481 LEU B CD2  1 
ATOM   9949  H  H    . LEU B 1 450 ? 84.197  27.582  19.637  1.00 17.00 ? 481 LEU B H    1 
ATOM   9950  N  N    . THR B 1 451 ? 85.405  26.344  16.802  1.00 2.20  ? 482 THR B N    1 
ATOM   9951  C  CA   . THR B 1 451 ? 86.278  25.768  15.780  1.00 3.80  ? 482 THR B CA   1 
ATOM   9952  C  C    . THR B 1 451 ? 87.069  24.488  15.963  1.00 2.00  ? 482 THR B C    1 
ATOM   9953  O  O    . THR B 1 451 ? 87.363  23.810  14.978  1.00 2.00  ? 482 THR B O    1 
ATOM   9954  C  CB   . THR B 1 451 ? 87.214  26.822  15.187  1.00 8.77  ? 482 THR B CB   1 
ATOM   9955  O  OG1  . THR B 1 451 ? 87.948  27.473  16.239  1.00 12.30 ? 482 THR B OG1  1 
ATOM   9956  C  CG2  . THR B 1 451 ? 86.412  27.873  14.425  1.00 9.91  ? 482 THR B CG2  1 
ATOM   9957  H  H    . THR B 1 451 ? 85.769  27.016  17.405  1.00 17.00 ? 482 THR B H    1 
ATOM   9958  H  HG1  . THR B 1 451 ? 87.333  28.024  16.741  1.00 17.00 ? 482 THR B HG1  1 
ATOM   9959  N  N    . GLY B 1 452 ? 87.430  24.153  17.188  1.00 2.48  ? 483 GLY B N    1 
ATOM   9960  C  CA   . GLY B 1 452 ? 88.178  22.932  17.382  1.00 6.58  ? 483 GLY B CA   1 
ATOM   9961  C  C    . GLY B 1 452 ? 89.611  23.029  16.885  1.00 9.00  ? 483 GLY B C    1 
ATOM   9962  O  O    . GLY B 1 452 ? 90.275  21.998  16.649  1.00 8.76  ? 483 GLY B O    1 
ATOM   9963  H  H    . GLY B 1 452 ? 87.189  24.710  17.951  1.00 17.00 ? 483 GLY B H    1 
ATOM   9964  N  N    . GLU B 1 453 ? 90.084  24.265  16.727  1.00 7.24  ? 484 GLU B N    1 
ATOM   9965  C  CA   . GLU B 1 453 ? 91.453  24.555  16.301  1.00 7.03  ? 484 GLU B CA   1 
ATOM   9966  C  C    . GLU B 1 453 ? 91.743  25.930  16.880  1.00 7.81  ? 484 GLU B C    1 
ATOM   9967  O  O    . GLU B 1 453 ? 90.823  26.592  17.340  1.00 7.97  ? 484 GLU B O    1 
ATOM   9968  C  CB   . GLU B 1 453 ? 91.572  24.566  14.777  1.00 4.16  ? 484 GLU B CB   1 
ATOM   9969  C  CG   . GLU B 1 453 ? 90.611  25.509  14.087  1.00 3.67  ? 484 GLU B CG   1 
ATOM   9970  C  CD   . GLU B 1 453 ? 91.154  26.870  13.907  1.00 2.00  ? 484 GLU B CD   1 
ATOM   9971  O  OE1  . GLU B 1 453 ? 92.089  27.022  13.107  1.00 9.04  ? 484 GLU B OE1  1 
ATOM   9972  O  OE2  . GLU B 1 453 ? 90.646  27.780  14.552  1.00 2.00  ? 484 GLU B OE2  1 
ATOM   9973  H  H    . GLU B 1 453 ? 89.501  25.028  16.927  1.00 17.00 ? 484 GLU B H    1 
ATOM   9974  N  N    . LYS B 1 454 ? 92.997  26.382  16.852  1.00 8.31  ? 485 LYS B N    1 
ATOM   9975  C  CA   . LYS B 1 454 ? 93.303  27.692  17.422  1.00 8.66  ? 485 LYS B CA   1 
ATOM   9976  C  C    . LYS B 1 454 ? 93.475  28.899  16.500  1.00 7.08  ? 485 LYS B C    1 
ATOM   9977  O  O    . LYS B 1 454 ? 93.115  30.021  16.856  1.00 2.03  ? 485 LYS B O    1 
ATOM   9978  C  CB   . LYS B 1 454 ? 94.500  27.592  18.353  1.00 14.12 ? 485 LYS B CB   1 
ATOM   9979  C  CG   . LYS B 1 454 ? 94.123  27.626  19.843  1.00 17.76 ? 485 LYS B CG   1 
ATOM   9980  C  CD   . LYS B 1 454 ? 93.256  28.848  20.213  1.00 20.18 ? 485 LYS B CD   1 
ATOM   9981  C  CE   . LYS B 1 454 ? 92.858  28.760  21.681  1.00 19.54 ? 485 LYS B CE   1 
ATOM   9982  N  NZ   . LYS B 1 454 ? 92.219  27.440  21.989  1.00 22.32 ? 485 LYS B NZ   1 
ATOM   9983  H  H    . LYS B 1 454 ? 93.694  25.822  16.461  1.00 17.00 ? 485 LYS B H    1 
ATOM   9984  H  HZ1  . LYS B 1 454 ? 91.371  27.324  21.400  1.00 17.00 ? 485 LYS B HZ1  1 
ATOM   9985  H  HZ2  . LYS B 1 454 ? 92.881  26.662  21.789  1.00 17.00 ? 485 LYS B HZ2  1 
ATOM   9986  H  HZ3  . LYS B 1 454 ? 91.951  27.412  22.995  1.00 17.00 ? 485 LYS B HZ3  1 
ATOM   9987  N  N    . GLU B 1 455 ? 94.012  28.651  15.315  1.00 8.72  ? 486 GLU B N    1 
ATOM   9988  C  CA   . GLU B 1 455 ? 94.270  29.699  14.328  1.00 12.01 ? 486 GLU B CA   1 
ATOM   9989  C  C    . GLU B 1 455 ? 93.061  30.586  14.016  1.00 11.26 ? 486 GLU B C    1 
ATOM   9990  O  O    . GLU B 1 455 ? 93.074  31.778  14.354  1.00 11.68 ? 486 GLU B O    1 
ATOM   9991  C  CB   . GLU B 1 455 ? 94.836  29.077  13.047  1.00 16.34 ? 486 GLU B CB   1 
ATOM   9992  C  CG   . GLU B 1 455 ? 95.965  29.865  12.402  1.00 18.50 ? 486 GLU B CG   1 
ATOM   9993  C  CD   . GLU B 1 455 ? 95.646  30.187  10.967  1.00 22.66 ? 486 GLU B CD   1 
ATOM   9994  O  OE1  . GLU B 1 455 ? 94.487  30.608  10.726  1.00 24.39 ? 486 GLU B OE1  1 
ATOM   9995  O  OE2  . GLU B 1 455 ? 96.526  30.003  10.087  1.00 21.88 ? 486 GLU B OE2  1 
ATOM   9996  H  H    . GLU B 1 455 ? 94.250  27.731  15.096  1.00 17.00 ? 486 GLU B H    1 
ATOM   9997  N  N    . MET B 1 456 ? 92.049  30.021  13.344  1.00 9.59  ? 487 MET B N    1 
ATOM   9998  C  CA   . MET B 1 456 ? 90.815  30.748  13.016  1.00 7.23  ? 487 MET B CA   1 
ATOM   9999  C  C    . MET B 1 456 ? 90.181  31.309  14.282  1.00 6.92  ? 487 MET B C    1 
ATOM   10000 O  O    . MET B 1 456 ? 89.884  32.486  14.335  1.00 6.49  ? 487 MET B O    1 
ATOM   10001 C  CB   . MET B 1 456 ? 89.805  29.837  12.329  1.00 5.20  ? 487 MET B CB   1 
ATOM   10002 C  CG   . MET B 1 456 ? 90.254  29.386  10.986  1.00 4.86  ? 487 MET B CG   1 
ATOM   10003 S  SD   . MET B 1 456 ? 89.033  28.404  10.198  1.00 2.14  ? 487 MET B SD   1 
ATOM   10004 C  CE   . MET B 1 456 ? 89.851  26.832  10.028  1.00 2.00  ? 487 MET B CE   1 
ATOM   10005 H  H    . MET B 1 456 ? 92.142  29.099  13.056  1.00 17.00 ? 487 MET B H    1 
ATOM   10006 N  N    . ALA B 1 457 ? 90.026  30.465  15.302  1.00 7.26  ? 488 ALA B N    1 
ATOM   10007 C  CA   . ALA B 1 457 ? 89.446  30.849  16.581  1.00 7.45  ? 488 ALA B CA   1 
ATOM   10008 C  C    . ALA B 1 457 ? 89.958  32.207  16.993  1.00 6.45  ? 488 ALA B C    1 
ATOM   10009 O  O    . ALA B 1 457 ? 89.194  33.152  17.203  1.00 7.49  ? 488 ALA B O    1 
ATOM   10010 C  CB   . ALA B 1 457 ? 89.783  29.827  17.656  1.00 7.85  ? 488 ALA B CB   1 
ATOM   10011 H  H    . ALA B 1 457 ? 90.314  29.551  15.226  1.00 17.00 ? 488 ALA B H    1 
ATOM   10012 N  N    . ALA B 1 458 ? 91.262  32.332  17.033  1.00 6.27  ? 489 ALA B N    1 
ATOM   10013 C  CA   . ALA B 1 458 ? 91.816  33.596  17.434  1.00 9.45  ? 489 ALA B CA   1 
ATOM   10014 C  C    . ALA B 1 458 ? 91.534  34.687  16.419  1.00 8.96  ? 489 ALA B C    1 
ATOM   10015 O  O    . ALA B 1 458 ? 91.419  35.866  16.808  1.00 9.47  ? 489 ALA B O    1 
ATOM   10016 C  CB   . ALA B 1 458 ? 93.300  33.475  17.683  1.00 14.19 ? 489 ALA B CB   1 
ATOM   10017 H  H    . ALA B 1 458 ? 91.860  31.589  16.798  1.00 17.00 ? 489 ALA B H    1 
ATOM   10018 N  N    . GLU B 1 459 ? 91.449  34.325  15.132  1.00 7.65  ? 490 GLU B N    1 
ATOM   10019 C  CA   . GLU B 1 459 ? 91.178  35.331  14.101  1.00 6.86  ? 490 GLU B CA   1 
ATOM   10020 C  C    . GLU B 1 459 ? 89.788  35.896  14.278  1.00 7.51  ? 490 GLU B C    1 
ATOM   10021 O  O    . GLU B 1 459 ? 89.576  37.136  14.223  1.00 8.06  ? 490 GLU B O    1 
ATOM   10022 C  CB   . GLU B 1 459 ? 91.309  34.788  12.687  1.00 5.39  ? 490 GLU B CB   1 
ATOM   10023 C  CG   . GLU B 1 459 ? 90.926  35.834  11.603  1.00 9.29  ? 490 GLU B CG   1 
ATOM   10024 C  CD   . GLU B 1 459 ? 91.692  37.203  11.700  1.00 11.46 ? 490 GLU B CD   1 
ATOM   10025 O  OE1  . GLU B 1 459 ? 92.921  37.217  12.015  1.00 15.45 ? 490 GLU B OE1  1 
ATOM   10026 O  OE2  . GLU B 1 459 ? 91.057  38.268  11.444  1.00 5.84  ? 490 GLU B OE2  1 
ATOM   10027 H  H    . GLU B 1 459 ? 91.591  33.390  14.885  1.00 17.00 ? 490 GLU B H    1 
ATOM   10028 N  N    . LEU B 1 460 ? 88.846  34.982  14.524  1.00 8.26  ? 491 LEU B N    1 
ATOM   10029 C  CA   . LEU B 1 460 ? 87.428  35.324  14.747  1.00 6.59  ? 491 LEU B CA   1 
ATOM   10030 C  C    . LEU B 1 460 ? 87.310  36.047  16.078  1.00 5.02  ? 491 LEU B C    1 
ATOM   10031 O  O    . LEU B 1 460 ? 86.748  37.142  16.138  1.00 5.99  ? 491 LEU B O    1 
ATOM   10032 C  CB   . LEU B 1 460 ? 86.539  34.063  14.766  1.00 4.49  ? 491 LEU B CB   1 
ATOM   10033 C  CG   . LEU B 1 460 ? 86.086  33.343  13.480  1.00 3.05  ? 491 LEU B CG   1 
ATOM   10034 C  CD1  . LEU B 1 460 ? 85.456  32.033  13.846  1.00 2.01  ? 491 LEU B CD1  1 
ATOM   10035 C  CD2  . LEU B 1 460 ? 85.105  34.199  12.681  1.00 4.01  ? 491 LEU B CD2  1 
ATOM   10036 H  H    . LEU B 1 460 ? 89.114  34.057  14.596  1.00 17.00 ? 491 LEU B H    1 
ATOM   10037 N  N    . LYS B 1 461 ? 87.887  35.451  17.121  1.00 2.00  ? 492 LYS B N    1 
ATOM   10038 C  CA   . LYS B 1 461 ? 87.880  36.033  18.440  1.00 2.00  ? 492 LYS B CA   1 
ATOM   10039 C  C    . LYS B 1 461 ? 88.364  37.448  18.371  1.00 2.00  ? 492 LYS B C    1 
ATOM   10040 O  O    . LYS B 1 461 ? 87.922  38.296  19.138  1.00 2.83  ? 492 LYS B O    1 
ATOM   10041 C  CB   . LYS B 1 461 ? 88.792  35.279  19.382  1.00 4.91  ? 492 LYS B CB   1 
ATOM   10042 C  CG   . LYS B 1 461 ? 88.833  35.946  20.755  1.00 11.95 ? 492 LYS B CG   1 
ATOM   10043 C  CD   . LYS B 1 461 ? 89.930  35.424  21.673  1.00 14.98 ? 492 LYS B CD   1 
ATOM   10044 C  CE   . LYS B 1 461 ? 90.010  36.284  22.950  1.00 14.04 ? 492 LYS B CE   1 
ATOM   10045 N  NZ   . LYS B 1 461 ? 91.054  35.848  23.936  1.00 13.46 ? 492 LYS B NZ   1 
ATOM   10046 H  H    . LYS B 1 461 ? 88.286  34.597  16.963  1.00 17.00 ? 492 LYS B H    1 
ATOM   10047 H  HZ1  . LYS B 1 461 ? 91.993  35.890  23.490  1.00 17.00 ? 492 LYS B HZ1  1 
ATOM   10048 H  HZ2  . LYS B 1 461 ? 91.037  36.487  24.758  1.00 17.00 ? 492 LYS B HZ2  1 
ATOM   10049 H  HZ3  . LYS B 1 461 ? 90.857  34.876  24.251  1.00 17.00 ? 492 LYS B HZ3  1 
ATOM   10050 N  N    . ALA B 1 462 ? 89.329  37.681  17.489  1.00 3.57  ? 493 ALA B N    1 
ATOM   10051 C  CA   . ALA B 1 462 ? 89.892  39.011  17.281  1.00 5.04  ? 493 ALA B CA   1 
ATOM   10052 C  C    . ALA B 1 462 ? 88.769  39.938  16.822  1.00 5.43  ? 493 ALA B C    1 
ATOM   10053 O  O    . ALA B 1 462 ? 88.486  40.989  17.438  1.00 5.70  ? 493 ALA B O    1 
ATOM   10054 C  CB   . ALA B 1 462 ? 90.969  38.955  16.232  1.00 3.36  ? 493 ALA B CB   1 
ATOM   10055 H  H    . ALA B 1 462 ? 89.698  36.933  16.974  1.00 17.00 ? 493 ALA B H    1 
ATOM   10056 N  N    . LEU B 1 463 ? 88.114  39.508  15.758  1.00 2.97  ? 494 LEU B N    1 
ATOM   10057 C  CA   . LEU B 1 463 ? 87.021  40.249  15.193  1.00 5.18  ? 494 LEU B CA   1 
ATOM   10058 C  C    . LEU B 1 463 ? 85.780  40.381  16.098  1.00 8.79  ? 494 LEU B C    1 
ATOM   10059 O  O    . LEU B 1 463 ? 85.364  41.498  16.453  1.00 10.81 ? 494 LEU B O    1 
ATOM   10060 C  CB   . LEU B 1 463 ? 86.624  39.561  13.911  1.00 4.80  ? 494 LEU B CB   1 
ATOM   10061 C  CG   . LEU B 1 463 ? 87.658  39.614  12.814  1.00 2.14  ? 494 LEU B CG   1 
ATOM   10062 C  CD1  . LEU B 1 463 ? 87.432  38.458  11.909  1.00 2.00  ? 494 LEU B CD1  1 
ATOM   10063 C  CD2  . LEU B 1 463 ? 87.517  40.916  12.083  1.00 2.00  ? 494 LEU B CD2  1 
ATOM   10064 H  H    . LEU B 1 463 ? 88.387  38.653  15.355  1.00 17.00 ? 494 LEU B H    1 
ATOM   10065 N  N    . TYR B 1 464 ? 85.159  39.243  16.418  1.00 8.85  ? 495 TYR B N    1 
ATOM   10066 C  CA   . TYR B 1 464 ? 83.944  39.199  17.228  1.00 6.18  ? 495 TYR B CA   1 
ATOM   10067 C  C    . TYR B 1 464 ? 84.081  39.505  18.699  1.00 6.28  ? 495 TYR B C    1 
ATOM   10068 O  O    . TYR B 1 464 ? 83.126  39.993  19.292  1.00 8.51  ? 495 TYR B O    1 
ATOM   10069 C  CB   . TYR B 1 464 ? 83.219  37.866  17.044  1.00 4.73  ? 495 TYR B CB   1 
ATOM   10070 C  CG   . TYR B 1 464 ? 82.576  37.709  15.686  1.00 4.96  ? 495 TYR B CG   1 
ATOM   10071 C  CD1  . TYR B 1 464 ? 83.335  37.384  14.562  1.00 3.60  ? 495 TYR B CD1  1 
ATOM   10072 C  CD2  . TYR B 1 464 ? 81.211  37.922  15.518  1.00 5.40  ? 495 TYR B CD2  1 
ATOM   10073 C  CE1  . TYR B 1 464 ? 82.751  37.281  13.309  1.00 2.65  ? 495 TYR B CE1  1 
ATOM   10074 C  CE2  . TYR B 1 464 ? 80.623  37.822  14.273  1.00 4.93  ? 495 TYR B CE2  1 
ATOM   10075 C  CZ   . TYR B 1 464 ? 81.403  37.499  13.178  1.00 2.62  ? 495 TYR B CZ   1 
ATOM   10076 O  OH   . TYR B 1 464 ? 80.820  37.377  11.956  1.00 2.97  ? 495 TYR B OH   1 
ATOM   10077 H  H    . TYR B 1 464 ? 85.518  38.415  16.074  1.00 17.00 ? 495 TYR B H    1 
ATOM   10078 H  HH   . TYR B 1 464 ? 79.931  37.707  11.998  1.00 17.00 ? 495 TYR B HH   1 
ATOM   10079 N  N    . SER B 1 465 ? 85.259  39.275  19.272  1.00 3.88  ? 496 SER B N    1 
ATOM   10080 C  CA   . SER B 1 465 ? 85.508  39.511  20.690  1.00 5.93  ? 496 SER B CA   1 
ATOM   10081 C  C    . SER B 1 465 ? 84.730  38.506  21.517  1.00 8.67  ? 496 SER B C    1 
ATOM   10082 O  O    . SER B 1 465 ? 85.297  37.521  21.979  1.00 14.44 ? 496 SER B O    1 
ATOM   10083 C  CB   . SER B 1 465 ? 85.136  40.938  21.121  1.00 7.81  ? 496 SER B CB   1 
ATOM   10084 O  OG   . SER B 1 465 ? 85.983  41.922  20.535  1.00 15.60 ? 496 SER B OG   1 
ATOM   10085 H  H    . SER B 1 465 ? 86.006  38.937  18.741  1.00 17.00 ? 496 SER B H    1 
ATOM   10086 H  HG   . SER B 1 465 ? 86.045  41.777  19.580  1.00 17.00 ? 496 SER B HG   1 
ATOM   10087 N  N    . ASP B 1 466 ? 83.421  38.701  21.655  1.00 7.59  ? 497 ASP B N    1 
ATOM   10088 C  CA   . ASP B 1 466 ? 82.604  37.802  22.441  1.00 4.65  ? 497 ASP B CA   1 
ATOM   10089 C  C    . ASP B 1 466 ? 82.126  36.633  21.623  1.00 2.00  ? 497 ASP B C    1 
ATOM   10090 O  O    . ASP B 1 466 ? 81.744  36.792  20.484  1.00 2.00  ? 497 ASP B O    1 
ATOM   10091 C  CB   . ASP B 1 466 ? 81.402  38.525  23.022  1.00 7.83  ? 497 ASP B CB   1 
ATOM   10092 C  CG   . ASP B 1 466 ? 80.609  37.643  23.990  1.00 13.73 ? 497 ASP B CG   1 
ATOM   10093 O  OD1  . ASP B 1 466 ? 81.184  36.642  24.512  1.00 10.07 ? 497 ASP B OD1  1 
ATOM   10094 O  OD2  . ASP B 1 466 ? 79.423  37.959  24.250  1.00 15.89 ? 497 ASP B OD2  1 
ATOM   10095 H  H    . ASP B 1 466 ? 82.993  39.436  21.166  1.00 17.00 ? 497 ASP B H    1 
ATOM   10096 N  N    . ILE B 1 467 ? 82.171  35.449  22.215  1.00 2.33  ? 498 ILE B N    1 
ATOM   10097 C  CA   . ILE B 1 467 ? 81.708  34.240  21.541  1.00 2.93  ? 498 ILE B CA   1 
ATOM   10098 C  C    . ILE B 1 467 ? 80.197  34.381  21.315  1.00 2.23  ? 498 ILE B C    1 
ATOM   10099 O  O    . ILE B 1 467 ? 79.636  34.009  20.267  1.00 2.00  ? 498 ILE B O    1 
ATOM   10100 C  CB   . ILE B 1 467 ? 82.059  32.955  22.380  1.00 2.00  ? 498 ILE B CB   1 
ATOM   10101 C  CG1  . ILE B 1 467 ? 81.439  31.670  21.768  1.00 3.64  ? 498 ILE B CG1  1 
ATOM   10102 C  CG2  . ILE B 1 467 ? 81.632  33.131  23.820  1.00 2.00  ? 498 ILE B CG2  1 
ATOM   10103 C  CD1  . ILE B 1 467 ? 81.982  31.223  20.411  1.00 2.00  ? 498 ILE B CD1  1 
ATOM   10104 H  H    . ILE B 1 467 ? 82.561  35.402  23.111  1.00 17.00 ? 498 ILE B H    1 
ATOM   10105 N  N    . ASP B 1 468 ? 79.574  35.042  22.276  1.00 3.77  ? 499 ASP B N    1 
ATOM   10106 C  CA   . ASP B 1 468 ? 78.148  35.280  22.261  1.00 3.31  ? 499 ASP B CA   1 
ATOM   10107 C  C    . ASP B 1 468 ? 77.762  36.328  21.232  1.00 2.41  ? 499 ASP B C    1 
ATOM   10108 O  O    . ASP B 1 468 ? 76.671  36.849  21.285  1.00 4.62  ? 499 ASP B O    1 
ATOM   10109 C  CB   . ASP B 1 468 ? 77.661  35.684  23.655  1.00 2.00  ? 499 ASP B CB   1 
ATOM   10110 C  CG   . ASP B 1 468 ? 77.872  34.591  24.701  1.00 2.00  ? 499 ASP B CG   1 
ATOM   10111 O  OD1  . ASP B 1 468 ? 77.747  33.385  24.390  1.00 2.00  ? 499 ASP B OD1  1 
ATOM   10112 O  OD2  . ASP B 1 468 ? 78.150  34.948  25.858  1.00 2.01  ? 499 ASP B OD2  1 
ATOM   10113 H  H    . ASP B 1 468 ? 80.087  35.360  23.039  1.00 17.00 ? 499 ASP B H    1 
ATOM   10114 N  N    . VAL B 1 469 ? 78.665  36.652  20.319  1.00 2.00  ? 500 VAL B N    1 
ATOM   10115 C  CA   . VAL B 1 469 ? 78.380  37.614  19.277  1.00 2.69  ? 500 VAL B CA   1 
ATOM   10116 C  C    . VAL B 1 469 ? 78.743  36.959  17.943  1.00 2.04  ? 500 VAL B C    1 
ATOM   10117 O  O    . VAL B 1 469 ? 78.678  37.553  16.865  1.00 4.16  ? 500 VAL B O    1 
ATOM   10118 C  CB   . VAL B 1 469 ? 79.153  38.934  19.493  1.00 2.48  ? 500 VAL B CB   1 
ATOM   10119 C  CG1  . VAL B 1 469 ? 78.651  40.003  18.544  1.00 2.73  ? 500 VAL B CG1  1 
ATOM   10120 C  CG2  . VAL B 1 469 ? 78.951  39.430  20.901  1.00 4.69  ? 500 VAL B CG2  1 
ATOM   10121 H  H    . VAL B 1 469 ? 79.560  36.268  20.291  1.00 17.00 ? 500 VAL B H    1 
ATOM   10122 N  N    . MET B 1 470 ? 79.088  35.695  18.010  1.00 2.34  ? 501 MET B N    1 
ATOM   10123 C  CA   . MET B 1 470 ? 79.431  35.001  16.799  1.00 4.16  ? 501 MET B CA   1 
ATOM   10124 C  C    . MET B 1 470 ? 78.113  34.838  16.093  1.00 5.19  ? 501 MET B C    1 
ATOM   10125 O  O    . MET B 1 470 ? 77.066  34.718  16.745  1.00 5.41  ? 501 MET B O    1 
ATOM   10126 C  CB   . MET B 1 470 ? 80.061  33.643  17.109  1.00 2.93  ? 501 MET B CB   1 
ATOM   10127 C  CG   . MET B 1 470 ? 80.598  32.913  15.884  1.00 2.56  ? 501 MET B CG   1 
ATOM   10128 S  SD   . MET B 1 470 ? 81.798  33.824  14.914  1.00 2.00  ? 501 MET B SD   1 
ATOM   10129 C  CE   . MET B 1 470 ? 81.366  33.321  13.265  1.00 2.20  ? 501 MET B CE   1 
ATOM   10130 H  H    . MET B 1 470 ? 79.077  35.201  18.852  1.00 17.00 ? 501 MET B H    1 
ATOM   10131 N  N    . GLU B 1 471 ? 78.170  34.863  14.769  1.00 6.54  ? 502 GLU B N    1 
ATOM   10132 C  CA   . GLU B 1 471 ? 76.980  34.738  13.932  1.00 10.48 ? 502 GLU B CA   1 
ATOM   10133 C  C    . GLU B 1 471 ? 76.566  33.285  13.531  1.00 11.52 ? 502 GLU B C    1 
ATOM   10134 O  O    . GLU B 1 471 ? 77.408  32.375  13.436  1.00 13.01 ? 502 GLU B O    1 
ATOM   10135 C  CB   . GLU B 1 471 ? 77.145  35.648  12.699  1.00 10.79 ? 502 GLU B CB   1 
ATOM   10136 C  CG   . GLU B 1 471 ? 77.451  37.108  13.060  1.00 7.47  ? 502 GLU B CG   1 
ATOM   10137 C  CD   . GLU B 1 471 ? 77.538  38.003  11.852  1.00 7.86  ? 502 GLU B CD   1 
ATOM   10138 O  OE1  . GLU B 1 471 ? 76.760  37.818  10.905  1.00 9.05  ? 502 GLU B OE1  1 
ATOM   10139 O  OE2  . GLU B 1 471 ? 78.381  38.912  11.843  1.00 11.24 ? 502 GLU B OE2  1 
ATOM   10140 H  H    . GLU B 1 471 ? 79.046  34.975  14.351  1.00 17.00 ? 502 GLU B H    1 
ATOM   10141 N  N    . LEU B 1 472 ? 75.270  33.059  13.325  1.00 8.73  ? 503 LEU B N    1 
ATOM   10142 C  CA   . LEU B 1 472 ? 74.832  31.746  12.937  1.00 6.19  ? 503 LEU B CA   1 
ATOM   10143 C  C    . LEU B 1 472 ? 75.513  31.314  11.643  1.00 7.70  ? 503 LEU B C    1 
ATOM   10144 O  O    . LEU B 1 472 ? 76.159  30.291  11.625  1.00 8.89  ? 503 LEU B O    1 
ATOM   10145 C  CB   . LEU B 1 472 ? 73.317  31.710  12.763  1.00 6.54  ? 503 LEU B CB   1 
ATOM   10146 C  CG   . LEU B 1 472 ? 72.670  30.472  12.109  1.00 3.53  ? 503 LEU B CG   1 
ATOM   10147 C  CD1  . LEU B 1 472 ? 72.753  29.288  13.013  1.00 2.18  ? 503 LEU B CD1  1 
ATOM   10148 C  CD2  . LEU B 1 472 ? 71.222  30.769  11.784  1.00 3.90  ? 503 LEU B CD2  1 
ATOM   10149 H  H    . LEU B 1 472 ? 74.616  33.776  13.452  1.00 17.00 ? 503 LEU B H    1 
ATOM   10150 N  N    . TYR B 1 473 ? 75.435  32.117  10.587  1.00 7.14  ? 504 TYR B N    1 
ATOM   10151 C  CA   . TYR B 1 473 ? 76.020  31.723  9.303   1.00 6.45  ? 504 TYR B CA   1 
ATOM   10152 C  C    . TYR B 1 473 ? 77.499  31.325  9.214   1.00 6.43  ? 504 TYR B C    1 
ATOM   10153 O  O    . TYR B 1 473 ? 77.813  30.231  8.741   1.00 4.62  ? 504 TYR B O    1 
ATOM   10154 C  CB   . TYR B 1 473 ? 75.727  32.774  8.224   1.00 7.96  ? 504 TYR B CB   1 
ATOM   10155 C  CG   . TYR B 1 473 ? 76.290  32.413  6.859   1.00 8.83  ? 504 TYR B CG   1 
ATOM   10156 C  CD1  . TYR B 1 473 ? 75.692  31.420  6.089   1.00 6.37  ? 504 TYR B CD1  1 
ATOM   10157 C  CD2  . TYR B 1 473 ? 77.450  33.035  6.364   1.00 8.62  ? 504 TYR B CD2  1 
ATOM   10158 C  CE1  . TYR B 1 473 ? 76.221  31.045  4.879   1.00 7.74  ? 504 TYR B CE1  1 
ATOM   10159 C  CE2  . TYR B 1 473 ? 77.992  32.663  5.141   1.00 8.32  ? 504 TYR B CE2  1 
ATOM   10160 C  CZ   . TYR B 1 473 ? 77.371  31.667  4.403   1.00 9.77  ? 504 TYR B CZ   1 
ATOM   10161 O  OH   . TYR B 1 473 ? 77.883  31.299  3.176   1.00 11.63 ? 504 TYR B OH   1 
ATOM   10162 H  H    . TYR B 1 473 ? 74.977  32.973  10.673  1.00 17.00 ? 504 TYR B H    1 
ATOM   10163 H  HH   . TYR B 1 473 ? 78.679  31.810  3.022   1.00 17.00 ? 504 TYR B HH   1 
ATOM   10164 N  N    . PRO B 1 474 ? 78.432  32.233  9.585   1.00 7.52  ? 505 PRO B N    1 
ATOM   10165 C  CA   . PRO B 1 474 ? 79.860  31.922  9.510   1.00 6.73  ? 505 PRO B CA   1 
ATOM   10166 C  C    . PRO B 1 474 ? 80.213  30.778  10.419  1.00 6.39  ? 505 PRO B C    1 
ATOM   10167 O  O    . PRO B 1 474 ? 80.795  29.764  9.986   1.00 7.68  ? 505 PRO B O    1 
ATOM   10168 C  CB   . PRO B 1 474 ? 80.517  33.217  9.986   1.00 7.49  ? 505 PRO B CB   1 
ATOM   10169 C  CG   . PRO B 1 474 ? 79.525  34.260  9.637   1.00 7.92  ? 505 PRO B CG   1 
ATOM   10170 C  CD   . PRO B 1 474 ? 78.259  33.602  10.100  1.00 9.49  ? 505 PRO B CD   1 
ATOM   10171 N  N    . ALA B 1 475 ? 79.821  30.922  11.675  1.00 3.46  ? 506 ALA B N    1 
ATOM   10172 C  CA   . ALA B 1 475 ? 80.074  29.895  12.668  1.00 4.48  ? 506 ALA B CA   1 
ATOM   10173 C  C    . ALA B 1 475 ? 79.713  28.477  12.164  1.00 4.26  ? 506 ALA B C    1 
ATOM   10174 O  O    . ALA B 1 475 ? 80.221  27.481  12.659  1.00 2.93  ? 506 ALA B O    1 
ATOM   10175 C  CB   . ALA B 1 475 ? 79.289  30.215  13.910  1.00 3.06  ? 506 ALA B CB   1 
ATOM   10176 H  H    . ALA B 1 475 ? 79.320  31.712  11.957  1.00 17.00 ? 506 ALA B H    1 
ATOM   10177 N  N    . LEU B 1 476 ? 78.841  28.415  11.166  1.00 3.56  ? 507 LEU B N    1 
ATOM   10178 C  CA   . LEU B 1 476 ? 78.375  27.179  10.599  1.00 2.71  ? 507 LEU B CA   1 
ATOM   10179 C  C    . LEU B 1 476 ? 79.374  26.530  9.657   1.00 2.52  ? 507 LEU B C    1 
ATOM   10180 O  O    . LEU B 1 476 ? 79.480  25.296  9.612   1.00 2.02  ? 507 LEU B O    1 
ATOM   10181 C  CB   . LEU B 1 476 ? 77.034  27.417  9.891   1.00 5.17  ? 507 LEU B CB   1 
ATOM   10182 C  CG   . LEU B 1 476 ? 75.742  27.276  10.696  1.00 3.04  ? 507 LEU B CG   1 
ATOM   10183 C  CD1  . LEU B 1 476 ? 74.647  28.131  10.073  1.00 3.49  ? 507 LEU B CD1  1 
ATOM   10184 C  CD2  . LEU B 1 476 ? 75.344  25.829  10.737  1.00 2.00  ? 507 LEU B CD2  1 
ATOM   10185 H  H    . LEU B 1 476 ? 78.450  29.235  10.809  1.00 17.00 ? 507 LEU B H    1 
ATOM   10186 N  N    . LEU B 1 477 ? 80.059  27.338  8.856   1.00 3.45  ? 508 LEU B N    1 
ATOM   10187 C  CA   . LEU B 1 477 ? 81.045  26.795  7.914   1.00 4.85  ? 508 LEU B CA   1 
ATOM   10188 C  C    . LEU B 1 477 ? 82.409  26.667  8.589   1.00 7.38  ? 508 LEU B C    1 
ATOM   10189 O  O    . LEU B 1 477 ? 83.238  25.841  8.189   1.00 6.65  ? 508 LEU B O    1 
ATOM   10190 C  CB   . LEU B 1 477 ? 81.172  27.648  6.650   1.00 2.00  ? 508 LEU B CB   1 
ATOM   10191 C  CG   . LEU B 1 477 ? 79.912  27.837  5.824   1.00 2.00  ? 508 LEU B CG   1 
ATOM   10192 C  CD1  . LEU B 1 477 ? 80.202  28.720  4.636   1.00 2.00  ? 508 LEU B CD1  1 
ATOM   10193 C  CD2  . LEU B 1 477 ? 79.409  26.488  5.368   1.00 4.38  ? 508 LEU B CD2  1 
ATOM   10194 H  H    . LEU B 1 477 ? 79.905  28.304  8.903   1.00 17.00 ? 508 LEU B H    1 
ATOM   10195 N  N    . VAL B 1 478 ? 82.640  27.503  9.600   1.00 7.72  ? 509 VAL B N    1 
ATOM   10196 C  CA   . VAL B 1 478 ? 83.896  27.501  10.363  1.00 9.13  ? 509 VAL B CA   1 
ATOM   10197 C  C    . VAL B 1 478 ? 83.546  26.882  11.721  1.00 9.79  ? 509 VAL B C    1 
ATOM   10198 O  O    . VAL B 1 478 ? 83.795  27.469  12.802  1.00 9.90  ? 509 VAL B O    1 
ATOM   10199 C  CB   . VAL B 1 478 ? 84.453  28.968  10.565  1.00 10.67 ? 509 VAL B CB   1 
ATOM   10200 C  CG1  . VAL B 1 478 ? 83.442  29.863  11.284  1.00 10.71 ? 509 VAL B CG1  1 
ATOM   10201 C  CG2  . VAL B 1 478 ? 85.711  28.950  11.371  1.00 11.97 ? 509 VAL B CG2  1 
ATOM   10202 H  H    . VAL B 1 478 ? 81.944  28.144  9.856   1.00 17.00 ? 509 VAL B H    1 
ATOM   10203 N  N    . GLU B 1 479 ? 82.955  25.699  11.667  1.00 6.10  ? 510 GLU B N    1 
ATOM   10204 C  CA   . GLU B 1 479 ? 82.532  25.063  12.885  1.00 5.52  ? 510 GLU B CA   1 
ATOM   10205 C  C    . GLU B 1 479 ? 83.262  23.763  12.914  1.00 5.34  ? 510 GLU B C    1 
ATOM   10206 O  O    . GLU B 1 479 ? 83.611  23.244  11.855  1.00 5.66  ? 510 GLU B O    1 
ATOM   10207 C  CB   . GLU B 1 479 ? 81.023  24.826  12.834  1.00 7.41  ? 510 GLU B CB   1 
ATOM   10208 C  CG   . GLU B 1 479 ? 80.342  24.808  14.185  1.00 7.95  ? 510 GLU B CG   1 
ATOM   10209 C  CD   . GLU B 1 479 ? 79.271  23.764  14.287  1.00 7.39  ? 510 GLU B CD   1 
ATOM   10210 O  OE1  . GLU B 1 479 ? 78.758  23.336  13.218  1.00 8.24  ? 510 GLU B OE1  1 
ATOM   10211 O  OE2  . GLU B 1 479 ? 78.974  23.369  15.441  1.00 3.72  ? 510 GLU B OE2  1 
ATOM   10212 H  H    . GLU B 1 479 ? 82.863  25.199  10.828  1.00 17.00 ? 510 GLU B H    1 
ATOM   10213 N  N    . LYS B 1 480 ? 83.490  23.238  14.117  1.00 4.35  ? 511 LYS B N    1 
ATOM   10214 C  CA   . LYS B 1 480 ? 84.205  21.972  14.268  1.00 5.05  ? 511 LYS B CA   1 
ATOM   10215 C  C    . LYS B 1 480 ? 83.358  20.799  13.768  1.00 3.83  ? 511 LYS B C    1 
ATOM   10216 O  O    . LYS B 1 480 ? 82.283  20.517  14.294  1.00 4.11  ? 511 LYS B O    1 
ATOM   10217 C  CB   . LYS B 1 480 ? 84.605  21.753  15.731  1.00 4.97  ? 511 LYS B CB   1 
ATOM   10218 C  CG   . LYS B 1 480 ? 85.281  20.399  15.992  1.00 5.32  ? 511 LYS B CG   1 
ATOM   10219 C  CD   . LYS B 1 480 ? 85.254  20.047  17.477  1.00 3.92  ? 511 LYS B CD   1 
ATOM   10220 C  CE   . LYS B 1 480 ? 85.575  18.593  17.697  1.00 4.66  ? 511 LYS B CE   1 
ATOM   10221 N  NZ   . LYS B 1 480 ? 85.535  18.275  19.150  1.00 6.32  ? 511 LYS B NZ   1 
ATOM   10222 H  H    . LYS B 1 480 ? 83.179  23.708  14.921  1.00 17.00 ? 511 LYS B H    1 
ATOM   10223 H  HZ1  . LYS B 1 480 ? 84.582  18.497  19.502  1.00 17.00 ? 511 LYS B HZ1  1 
ATOM   10224 H  HZ2  . LYS B 1 480 ? 85.742  17.265  19.292  1.00 17.00 ? 511 LYS B HZ2  1 
ATOM   10225 H  HZ3  . LYS B 1 480 ? 86.231  18.851  19.662  1.00 17.00 ? 511 LYS B HZ3  1 
ATOM   10226 N  N    . PRO B 1 481 ? 83.808  20.136  12.709  1.00 2.96  ? 512 PRO B N    1 
ATOM   10227 C  CA   . PRO B 1 481 ? 83.051  19.009  12.184  1.00 4.39  ? 512 PRO B CA   1 
ATOM   10228 C  C    . PRO B 1 481 ? 82.991  17.866  13.158  1.00 6.87  ? 512 PRO B C    1 
ATOM   10229 O  O    . PRO B 1 481 ? 83.975  17.570  13.836  1.00 10.54 ? 512 PRO B O    1 
ATOM   10230 C  CB   . PRO B 1 481 ? 83.861  18.591  10.959  1.00 3.22  ? 512 PRO B CB   1 
ATOM   10231 C  CG   . PRO B 1 481 ? 84.508  19.827  10.532  1.00 2.80  ? 512 PRO B CG   1 
ATOM   10232 C  CD   . PRO B 1 481 ? 84.930  20.466  11.824  1.00 4.12  ? 512 PRO B CD   1 
ATOM   10233 N  N    . ARG B 1 482 ? 81.814  17.265  13.285  1.00 8.92  ? 513 ARG B N    1 
ATOM   10234 C  CA   . ARG B 1 482 ? 81.680  16.078  14.125  1.00 9.09  ? 513 ARG B CA   1 
ATOM   10235 C  C    . ARG B 1 482 ? 82.601  15.109  13.333  1.00 8.06  ? 513 ARG B C    1 
ATOM   10236 O  O    . ARG B 1 482 ? 82.584  15.135  12.092  1.00 6.24  ? 513 ARG B O    1 
ATOM   10237 C  CB   . ARG B 1 482 ? 80.228  15.550  14.081  1.00 8.98  ? 513 ARG B CB   1 
ATOM   10238 C  CG   . ARG B 1 482 ? 79.180  16.321  14.846  1.00 6.04  ? 513 ARG B CG   1 
ATOM   10239 C  CD   . ARG B 1 482 ? 77.809  15.777  14.455  1.00 9.44  ? 513 ARG B CD   1 
ATOM   10240 N  NE   . ARG B 1 482 ? 76.832  15.760  15.543  1.00 8.57  ? 513 ARG B NE   1 
ATOM   10241 C  CZ   . ARG B 1 482 ? 75.525  15.575  15.380  1.00 8.55  ? 513 ARG B CZ   1 
ATOM   10242 N  NH1  . ARG B 1 482 ? 75.026  15.398  14.161  1.00 8.08  ? 513 ARG B NH1  1 
ATOM   10243 N  NH2  . ARG B 1 482 ? 74.717  15.540  16.439  1.00 7.39  ? 513 ARG B NH2  1 
ATOM   10244 H  H    . ARG B 1 482 ? 81.052  17.592  12.775  1.00 17.00 ? 513 ARG B H    1 
ATOM   10245 H  HE   . ARG B 1 482 ? 77.161  15.902  16.455  1.00 17.00 ? 513 ARG B HE   1 
ATOM   10246 H  HH11 . ARG B 1 482 ? 75.631  15.401  13.365  1.00 17.00 ? 513 ARG B HH11 1 
ATOM   10247 H  HH12 . ARG B 1 482 ? 74.044  15.256  14.036  1.00 17.00 ? 513 ARG B HH12 1 
ATOM   10248 H  HH21 . ARG B 1 482 ? 75.090  15.656  17.359  1.00 17.00 ? 513 ARG B HH21 1 
ATOM   10249 H  HH22 . ARG B 1 482 ? 73.734  15.407  16.311  1.00 17.00 ? 513 ARG B HH22 1 
ATOM   10250 N  N    . PRO B 1 483 ? 83.329  14.201  14.023  1.00 6.27  ? 514 PRO B N    1 
ATOM   10251 C  CA   . PRO B 1 483 ? 84.230  13.260  13.363  1.00 9.41  ? 514 PRO B CA   1 
ATOM   10252 C  C    . PRO B 1 483 ? 84.556  13.521  11.897  1.00 9.46  ? 514 PRO B C    1 
ATOM   10253 O  O    . PRO B 1 483 ? 85.143  14.565  11.566  1.00 12.39 ? 514 PRO B O    1 
ATOM   10254 C  CB   . PRO B 1 483 ? 83.523  11.937  13.606  1.00 6.89  ? 514 PRO B CB   1 
ATOM   10255 C  CG   . PRO B 1 483 ? 83.144  12.091  15.076  1.00 5.44  ? 514 PRO B CG   1 
ATOM   10256 C  CD   . PRO B 1 483 ? 82.904  13.606  15.299  1.00 5.03  ? 514 PRO B CD   1 
ATOM   10257 N  N    . ASP B 1 484 ? 84.162  12.613  11.016  1.00 7.27  ? 515 ASP B N    1 
ATOM   10258 C  CA   . ASP B 1 484 ? 84.472  12.818  9.615   1.00 8.88  ? 515 ASP B CA   1 
ATOM   10259 C  C    . ASP B 1 484 ? 83.234  13.298  8.908   1.00 7.95  ? 515 ASP B C    1 
ATOM   10260 O  O    . ASP B 1 484 ? 82.976  12.924  7.760   1.00 8.26  ? 515 ASP B O    1 
ATOM   10261 C  CB   . ASP B 1 484 ? 85.012  11.532  8.988   1.00 11.98 ? 515 ASP B CB   1 
ATOM   10262 C  CG   . ASP B 1 484 ? 86.432  11.209  9.454   1.00 13.91 ? 515 ASP B CG   1 
ATOM   10263 O  OD1  . ASP B 1 484 ? 87.365  11.952  9.070   1.00 17.05 ? 515 ASP B OD1  1 
ATOM   10264 O  OD2  . ASP B 1 484 ? 86.609  10.231  10.214  1.00 12.98 ? 515 ASP B OD2  1 
ATOM   10265 H  H    . ASP B 1 484 ? 83.643  11.822  11.248  1.00 17.00 ? 515 ASP B H    1 
ATOM   10266 N  N    . ALA B 1 485 ? 82.495  14.154  9.608   1.00 6.11  ? 516 ALA B N    1 
ATOM   10267 C  CA   . ALA B 1 485 ? 81.251  14.714  9.130   1.00 4.24  ? 516 ALA B CA   1 
ATOM   10268 C  C    . ALA B 1 485 ? 81.499  15.794  8.122   1.00 4.41  ? 516 ALA B C    1 
ATOM   10269 O  O    . ALA B 1 485 ? 82.556  16.387  8.123   1.00 7.33  ? 516 ALA B O    1 
ATOM   10270 C  CB   . ALA B 1 485 ? 80.485  15.283  10.286  1.00 4.50  ? 516 ALA B CB   1 
ATOM   10271 H  H    . ALA B 1 485 ? 82.862  14.493  10.438  1.00 17.00 ? 516 ALA B H    1 
ATOM   10272 N  N    . ILE B 1 486 ? 80.510  16.081  7.285   1.00 3.98  ? 517 ILE B N    1 
ATOM   10273 C  CA   . ILE B 1 486 ? 80.619  17.137  6.284   1.00 3.26  ? 517 ILE B CA   1 
ATOM   10274 C  C    . ILE B 1 486 ? 80.399  18.487  6.953   1.00 2.00  ? 517 ILE B C    1 
ATOM   10275 O  O    . ILE B 1 486 ? 80.826  19.505  6.451   1.00 2.17  ? 517 ILE B O    1 
ATOM   10276 C  CB   . ILE B 1 486 ? 79.614  16.919  5.145   1.00 5.13  ? 517 ILE B CB   1 
ATOM   10277 C  CG1  . ILE B 1 486 ? 79.747  18.014  4.079   1.00 3.71  ? 517 ILE B CG1  1 
ATOM   10278 C  CG2  . ILE B 1 486 ? 78.214  16.796  5.712   1.00 5.16  ? 517 ILE B CG2  1 
ATOM   10279 C  CD1  . ILE B 1 486 ? 79.233  17.610  2.724   1.00 2.00  ? 517 ILE B CD1  1 
ATOM   10280 H  H    . ILE B 1 486 ? 79.691  15.541  7.343   1.00 17.00 ? 517 ILE B H    1 
ATOM   10281 N  N    . PHE B 1 487 ? 79.701  18.480  8.080   1.00 3.20  ? 518 PHE B N    1 
ATOM   10282 C  CA   . PHE B 1 487 ? 79.458  19.681  8.871   1.00 2.38  ? 518 PHE B CA   1 
ATOM   10283 C  C    . PHE B 1 487 ? 79.244  19.303  10.321  1.00 3.43  ? 518 PHE B C    1 
ATOM   10284 O  O    . PHE B 1 487 ? 79.072  18.119  10.646  1.00 2.01  ? 518 PHE B O    1 
ATOM   10285 C  CB   . PHE B 1 487 ? 78.303  20.529  8.351   1.00 4.96  ? 518 PHE B CB   1 
ATOM   10286 C  CG   . PHE B 1 487 ? 77.259  19.773  7.574   1.00 4.43  ? 518 PHE B CG   1 
ATOM   10287 C  CD1  . PHE B 1 487 ? 76.460  18.818  8.190   1.00 6.25  ? 518 PHE B CD1  1 
ATOM   10288 C  CD2  . PHE B 1 487 ? 77.053  20.058  6.223   1.00 2.21  ? 518 PHE B CD2  1 
ATOM   10289 C  CE1  . PHE B 1 487 ? 75.472  18.160  7.474   1.00 5.57  ? 518 PHE B CE1  1 
ATOM   10290 C  CE2  . PHE B 1 487 ? 76.081  19.417  5.502   1.00 2.00  ? 518 PHE B CE2  1 
ATOM   10291 C  CZ   . PHE B 1 487 ? 75.283  18.464  6.122   1.00 4.00  ? 518 PHE B CZ   1 
ATOM   10292 H  H    . PHE B 1 487 ? 79.341  17.637  8.426   1.00 17.00 ? 518 PHE B H    1 
ATOM   10293 N  N    . GLY B 1 488 ? 79.272  20.308  11.191  1.00 5.33  ? 519 GLY B N    1 
ATOM   10294 C  CA   . GLY B 1 488 ? 79.138  20.053  12.615  1.00 9.27  ? 519 GLY B CA   1 
ATOM   10295 C  C    . GLY B 1 488 ? 77.747  19.953  13.195  1.00 10.75 ? 519 GLY B C    1 
ATOM   10296 O  O    . GLY B 1 488 ? 76.753  20.024  12.476  1.00 13.15 ? 519 GLY B O    1 
ATOM   10297 H  H    . GLY B 1 488 ? 79.396  21.222  10.866  1.00 17.00 ? 519 GLY B H    1 
ATOM   10298 N  N    . GLU B 1 489 ? 77.690  19.800  14.516  1.00 11.23 ? 520 GLU B N    1 
ATOM   10299 C  CA   . GLU B 1 489 ? 76.445  19.695  15.266  1.00 9.47  ? 520 GLU B CA   1 
ATOM   10300 C  C    . GLU B 1 489 ? 75.519  20.867  15.003  1.00 10.24 ? 520 GLU B C    1 
ATOM   10301 O  O    . GLU B 1 489 ? 74.383  20.646  14.601  1.00 13.63 ? 520 GLU B O    1 
ATOM   10302 C  CB   . GLU B 1 489 ? 76.748  19.586  16.751  1.00 9.44  ? 520 GLU B CB   1 
ATOM   10303 C  CG   . GLU B 1 489 ? 75.757  20.263  17.662  1.00 8.11  ? 520 GLU B CG   1 
ATOM   10304 C  CD   . GLU B 1 489 ? 76.411  20.719  18.941  1.00 9.30  ? 520 GLU B CD   1 
ATOM   10305 O  OE1  . GLU B 1 489 ? 77.318  21.574  18.853  1.00 7.24  ? 520 GLU B OE1  1 
ATOM   10306 O  OE2  . GLU B 1 489 ? 76.033  20.208  20.023  1.00 11.04 ? 520 GLU B OE2  1 
ATOM   10307 H  H    . GLU B 1 489 ? 78.532  19.746  15.016  1.00 17.00 ? 520 GLU B H    1 
ATOM   10308 N  N    . THR B 1 490 ? 75.987  22.103  15.195  1.00 9.11  ? 521 THR B N    1 
ATOM   10309 C  CA   . THR B 1 490 ? 75.151  23.294  14.950  1.00 6.65  ? 521 THR B CA   1 
ATOM   10310 C  C    . THR B 1 490 ? 74.382  23.255  13.613  1.00 6.29  ? 521 THR B C    1 
ATOM   10311 O  O    . THR B 1 490 ? 73.187  23.520  13.583  1.00 5.17  ? 521 THR B O    1 
ATOM   10312 C  CB   . THR B 1 490 ? 75.998  24.579  15.045  1.00 6.33  ? 521 THR B CB   1 
ATOM   10313 O  OG1  . THR B 1 490 ? 76.437  24.742  16.398  1.00 3.78  ? 521 THR B OG1  1 
ATOM   10314 C  CG2  . THR B 1 490 ? 75.211  25.817  14.579  1.00 6.05  ? 521 THR B CG2  1 
ATOM   10315 H  H    . THR B 1 490 ? 76.897  22.234  15.533  1.00 17.00 ? 521 THR B H    1 
ATOM   10316 H  HG1  . THR B 1 490 ? 75.677  25.024  16.920  1.00 17.00 ? 521 THR B HG1  1 
ATOM   10317 N  N    . MET B 1 491 ? 75.067  22.911  12.524  1.00 5.38  ? 522 MET B N    1 
ATOM   10318 C  CA   . MET B 1 491 ? 74.432  22.810  11.214  1.00 5.14  ? 522 MET B CA   1 
ATOM   10319 C  C    . MET B 1 491 ? 73.378  21.733  11.273  1.00 4.30  ? 522 MET B C    1 
ATOM   10320 O  O    . MET B 1 491 ? 72.212  21.974  11.041  1.00 6.87  ? 522 MET B O    1 
ATOM   10321 C  CB   . MET B 1 491 ? 75.469  22.409  10.143  1.00 5.44  ? 522 MET B CB   1 
ATOM   10322 C  CG   . MET B 1 491 ? 74.901  22.033  8.759   1.00 2.00  ? 522 MET B CG   1 
ATOM   10323 S  SD   . MET B 1 491 ? 74.499  23.494  7.702   1.00 7.88  ? 522 MET B SD   1 
ATOM   10324 C  CE   . MET B 1 491 ? 75.953  23.600  6.714   1.00 4.09  ? 522 MET B CE   1 
ATOM   10325 H  H    . MET B 1 491 ? 76.016  22.694  12.604  1.00 17.00 ? 522 MET B H    1 
ATOM   10326 N  N    . VAL B 1 492 ? 73.834  20.538  11.605  1.00 5.71  ? 523 VAL B N    1 
ATOM   10327 C  CA   . VAL B 1 492 ? 73.014  19.340  11.676  1.00 7.24  ? 523 VAL B CA   1 
ATOM   10328 C  C    . VAL B 1 492 ? 71.813  19.446  12.604  1.00 3.89  ? 523 VAL B C    1 
ATOM   10329 O  O    . VAL B 1 492 ? 70.771  18.890  12.311  1.00 2.54  ? 523 VAL B O    1 
ATOM   10330 C  CB   . VAL B 1 492 ? 73.921  18.085  12.048  1.00 11.57 ? 523 VAL B CB   1 
ATOM   10331 C  CG1  . VAL B 1 492 ? 73.075  16.815  12.314  1.00 9.20  ? 523 VAL B CG1  1 
ATOM   10332 C  CG2  . VAL B 1 492 ? 74.931  17.817  10.921  1.00 10.88 ? 523 VAL B CG2  1 
ATOM   10333 H  H    . VAL B 1 492 ? 74.782  20.449  11.838  1.00 17.00 ? 523 VAL B H    1 
ATOM   10334 N  N    . GLU B 1 493 ? 71.934  20.195  13.685  1.00 2.00  ? 524 GLU B N    1 
ATOM   10335 C  CA   . GLU B 1 493 ? 70.830  20.325  14.613  1.00 2.25  ? 524 GLU B CA   1 
ATOM   10336 C  C    . GLU B 1 493 ? 69.706  21.314  14.239  1.00 2.44  ? 524 GLU B C    1 
ATOM   10337 O  O    . GLU B 1 493 ? 68.529  21.024  14.436  1.00 2.00  ? 524 GLU B O    1 
ATOM   10338 C  CB   . GLU B 1 493 ? 71.374  20.572  16.001  1.00 2.00  ? 524 GLU B CB   1 
ATOM   10339 C  CG   . GLU B 1 493 ? 72.113  19.362  16.500  1.00 4.81  ? 524 GLU B CG   1 
ATOM   10340 C  CD   . GLU B 1 493 ? 71.233  18.141  16.657  1.00 3.48  ? 524 GLU B CD   1 
ATOM   10341 O  OE1  . GLU B 1 493 ? 70.399  18.158  17.577  1.00 7.12  ? 524 GLU B OE1  1 
ATOM   10342 O  OE2  . GLU B 1 493 ? 71.387  17.176  15.886  1.00 2.00  ? 524 GLU B OE2  1 
ATOM   10343 H  H    . GLU B 1 493 ? 72.751  20.692  13.836  1.00 17.00 ? 524 GLU B H    1 
ATOM   10344 N  N    . LEU B 1 494 ? 70.060  22.472  13.692  1.00 2.31  ? 525 LEU B N    1 
ATOM   10345 C  CA   . LEU B 1 494 ? 69.063  23.447  13.270  1.00 2.00  ? 525 LEU B CA   1 
ATOM   10346 C  C    . LEU B 1 494 ? 68.300  22.917  12.049  1.00 3.49  ? 525 LEU B C    1 
ATOM   10347 O  O    . LEU B 1 494 ? 67.069  23.058  11.947  1.00 2.87  ? 525 LEU B O    1 
ATOM   10348 C  CB   . LEU B 1 494 ? 69.725  24.766  12.857  1.00 2.28  ? 525 LEU B CB   1 
ATOM   10349 C  CG   . LEU B 1 494 ? 70.491  25.737  13.755  1.00 3.11  ? 525 LEU B CG   1 
ATOM   10350 C  CD1  . LEU B 1 494 ? 70.141  27.160  13.340  1.00 2.00  ? 525 LEU B CD1  1 
ATOM   10351 C  CD2  . LEU B 1 494 ? 70.168  25.530  15.214  1.00 5.21  ? 525 LEU B CD2  1 
ATOM   10352 H  H    . LEU B 1 494 ? 71.010  22.676  13.561  1.00 17.00 ? 525 LEU B H    1 
ATOM   10353 N  N    . GLY B 1 495 ? 69.056  22.293  11.143  1.00 2.84  ? 526 GLY B N    1 
ATOM   10354 C  CA   . GLY B 1 495 ? 68.532  21.761  9.902   1.00 2.00  ? 526 GLY B CA   1 
ATOM   10355 C  C    . GLY B 1 495 ? 67.798  20.455  9.877   1.00 2.00  ? 526 GLY B C    1 
ATOM   10356 O  O    . GLY B 1 495 ? 66.927  20.299  9.040   1.00 4.31  ? 526 GLY B O    1 
ATOM   10357 H  H    . GLY B 1 495 ? 70.020  22.193  11.308  1.00 17.00 ? 526 GLY B H    1 
ATOM   10358 N  N    . ALA B 1 496 ? 68.131  19.499  10.731  1.00 4.00  ? 527 ALA B N    1 
ATOM   10359 C  CA   . ALA B 1 496 ? 67.407  18.204  10.694  1.00 6.10  ? 527 ALA B CA   1 
ATOM   10360 C  C    . ALA B 1 496 ? 65.909  18.385  10.900  1.00 5.96  ? 527 ALA B C    1 
ATOM   10361 O  O    . ALA B 1 496 ? 65.113  17.885  10.110  1.00 3.45  ? 527 ALA B O    1 
ATOM   10362 C  CB   . ALA B 1 496 ? 67.969  17.205  11.728  1.00 7.38  ? 527 ALA B CB   1 
ATOM   10363 H  H    . ALA B 1 496 ? 68.856  19.630  11.378  1.00 17.00 ? 527 ALA B H    1 
ATOM   10364 N  N    . PRO B 1 497 ? 65.518  19.116  11.965  1.00 6.58  ? 528 PRO B N    1 
ATOM   10365 C  CA   . PRO B 1 497 ? 64.127  19.394  12.309  1.00 6.85  ? 528 PRO B CA   1 
ATOM   10366 C  C    . PRO B 1 497 ? 63.421  20.093  11.159  1.00 4.65  ? 528 PRO B C    1 
ATOM   10367 O  O    . PRO B 1 497 ? 62.318  19.736  10.788  1.00 2.29  ? 528 PRO B O    1 
ATOM   10368 C  CB   . PRO B 1 497 ? 64.272  20.340  13.491  1.00 10.75 ? 528 PRO B CB   1 
ATOM   10369 C  CG   . PRO B 1 497 ? 65.522  19.881  14.138  1.00 10.16 ? 528 PRO B CG   1 
ATOM   10370 C  CD   . PRO B 1 497 ? 66.412  19.742  12.959  1.00 7.88  ? 528 PRO B CD   1 
ATOM   10371 N  N    . PHE B 1 498 ? 64.071  21.105  10.611  1.00 6.09  ? 529 PHE B N    1 
ATOM   10372 C  CA   . PHE B 1 498 ? 63.521  21.855  9.485   1.00 9.53  ? 529 PHE B CA   1 
ATOM   10373 C  C    . PHE B 1 498 ? 63.347  20.972  8.237   1.00 8.86  ? 529 PHE B C    1 
ATOM   10374 O  O    . PHE B 1 498 ? 62.327  21.059  7.545   1.00 9.52  ? 529 PHE B O    1 
ATOM   10375 C  CB   . PHE B 1 498 ? 64.406  23.074  9.122   1.00 7.21  ? 529 PHE B CB   1 
ATOM   10376 C  CG   . PHE B 1 498 ? 64.400  24.193  10.134  1.00 5.58  ? 529 PHE B CG   1 
ATOM   10377 C  CD1  . PHE B 1 498 ? 63.734  24.079  11.360  1.00 8.57  ? 529 PHE B CD1  1 
ATOM   10378 C  CD2  . PHE B 1 498 ? 65.037  25.384  9.844   1.00 7.00  ? 529 PHE B CD2  1 
ATOM   10379 C  CE1  . PHE B 1 498 ? 63.699  25.158  12.291  1.00 6.78  ? 529 PHE B CE1  1 
ATOM   10380 C  CE2  . PHE B 1 498 ? 65.015  26.469  10.762  1.00 8.42  ? 529 PHE B CE2  1 
ATOM   10381 C  CZ   . PHE B 1 498 ? 64.338  26.345  11.986  1.00 5.49  ? 529 PHE B CZ   1 
ATOM   10382 H  H    . PHE B 1 498 ? 64.933  21.379  10.989  1.00 17.00 ? 529 PHE B H    1 
ATOM   10383 N  N    . SER B 1 499 ? 64.315  20.100  7.967   1.00 10.26 ? 530 SER B N    1 
ATOM   10384 C  CA   . SER B 1 499 ? 64.239  19.252  6.776   1.00 12.94 ? 530 SER B CA   1 
ATOM   10385 C  C    . SER B 1 499 ? 63.260  18.073  6.841   1.00 13.36 ? 530 SER B C    1 
ATOM   10386 O  O    . SER B 1 499 ? 62.969  17.460  5.804   1.00 15.01 ? 530 SER B O    1 
ATOM   10387 C  CB   . SER B 1 499 ? 65.643  18.773  6.323   1.00 13.80 ? 530 SER B CB   1 
ATOM   10388 O  OG   . SER B 1 499 ? 65.744  18.635  4.891   1.00 12.97 ? 530 SER B OG   1 
ATOM   10389 H  H    . SER B 1 499 ? 65.092  20.019  8.553   1.00 17.00 ? 530 SER B H    1 
ATOM   10390 H  HG   . SER B 1 499 ? 66.657  18.455  4.647   1.00 17.00 ? 530 SER B HG   1 
ATOM   10391 N  N    . LEU B 1 500 ? 62.745  17.745  8.027   1.00 12.20 ? 531 LEU B N    1 
ATOM   10392 C  CA   . LEU B 1 500 ? 61.804  16.632  8.125   1.00 9.14  ? 531 LEU B CA   1 
ATOM   10393 C  C    . LEU B 1 500 ? 60.341  17.082  8.074   1.00 7.58  ? 531 LEU B C    1 
ATOM   10394 O  O    . LEU B 1 500 ? 59.514  16.435  7.436   1.00 8.81  ? 531 LEU B O    1 
ATOM   10395 C  CB   . LEU B 1 500 ? 62.111  15.742  9.335   1.00 9.73  ? 531 LEU B CB   1 
ATOM   10396 C  CG   . LEU B 1 500 ? 63.470  14.996  9.371   1.00 6.39  ? 531 LEU B CG   1 
ATOM   10397 C  CD1  . LEU B 1 500 ? 63.526  14.135  10.626  1.00 7.61  ? 531 LEU B CD1  1 
ATOM   10398 C  CD2  . LEU B 1 500 ? 63.671  14.136  8.162   1.00 2.00  ? 531 LEU B CD2  1 
ATOM   10399 H  H    . LEU B 1 500 ? 63.022  18.238  8.830   1.00 17.00 ? 531 LEU B H    1 
ATOM   10400 N  N    . LYS B 1 501 ? 60.030  18.229  8.665   1.00 6.57  ? 532 LYS B N    1 
ATOM   10401 C  CA   . LYS B 1 501 ? 58.662  18.751  8.627   1.00 4.40  ? 532 LYS B CA   1 
ATOM   10402 C  C    . LYS B 1 501 ? 58.266  19.242  7.243   1.00 3.09  ? 532 LYS B C    1 
ATOM   10403 O  O    . LYS B 1 501 ? 57.111  19.474  6.978   1.00 2.00  ? 532 LYS B O    1 
ATOM   10404 C  CB   . LYS B 1 501 ? 58.470  19.873  9.635   1.00 4.32  ? 532 LYS B CB   1 
ATOM   10405 C  CG   . LYS B 1 501 ? 57.988  19.369  10.977  1.00 5.53  ? 532 LYS B CG   1 
ATOM   10406 C  CD   . LYS B 1 501 ? 57.081  20.392  11.668  1.00 9.95  ? 532 LYS B CD   1 
ATOM   10407 C  CE   . LYS B 1 501 ? 55.813  20.718  10.856  1.00 8.41  ? 532 LYS B CE   1 
ATOM   10408 N  NZ   . LYS B 1 501 ? 54.917  19.544  10.743  1.00 11.46 ? 532 LYS B NZ   1 
ATOM   10409 H  H    . LYS B 1 501 ? 60.711  18.739  9.160   1.00 17.00 ? 532 LYS B H    1 
ATOM   10410 H  HZ1  . LYS B 1 501 ? 55.416  18.752  10.291  1.00 17.00 ? 532 LYS B HZ1  1 
ATOM   10411 H  HZ2  . LYS B 1 501 ? 54.589  19.254  11.686  1.00 17.00 ? 532 LYS B HZ2  1 
ATOM   10412 H  HZ3  . LYS B 1 501 ? 54.103  19.814  10.154  1.00 17.00 ? 532 LYS B HZ3  1 
ATOM   10413 N  N    . GLY B 1 502 ? 59.239  19.421  6.367   1.00 3.21  ? 533 GLY B N    1 
ATOM   10414 C  CA   . GLY B 1 502 ? 58.940  19.864  5.022   1.00 2.41  ? 533 GLY B CA   1 
ATOM   10415 C  C    . GLY B 1 502 ? 58.719  18.647  4.162   1.00 2.73  ? 533 GLY B C    1 
ATOM   10416 O  O    . GLY B 1 502 ? 58.104  18.732  3.105   1.00 3.51  ? 533 GLY B O    1 
ATOM   10417 H  H    . GLY B 1 502 ? 60.173  19.307  6.631   1.00 17.00 ? 533 GLY B H    1 
ATOM   10418 N  N    . LEU B 1 503 ? 59.261  17.515  4.593   1.00 3.18  ? 534 LEU B N    1 
ATOM   10419 C  CA   . LEU B 1 503 ? 59.104  16.281  3.839   1.00 6.21  ? 534 LEU B CA   1 
ATOM   10420 C  C    . LEU B 1 503 ? 57.843  15.610  4.344   1.00 7.35  ? 534 LEU B C    1 
ATOM   10421 O  O    . LEU B 1 503 ? 56.869  15.443  3.595   1.00 9.41  ? 534 LEU B O    1 
ATOM   10422 C  CB   . LEU B 1 503 ? 60.302  15.338  4.047   1.00 8.07  ? 534 LEU B CB   1 
ATOM   10423 C  CG   . LEU B 1 503 ? 61.664  15.457  3.343   1.00 9.14  ? 534 LEU B CG   1 
ATOM   10424 C  CD1  . LEU B 1 503 ? 61.996  16.903  2.995   1.00 12.13 ? 534 LEU B CD1  1 
ATOM   10425 C  CD2  . LEU B 1 503 ? 62.748  14.886  4.263   1.00 6.80  ? 534 LEU B CD2  1 
ATOM   10426 H  H    . LEU B 1 503 ? 59.788  17.505  5.412   1.00 17.00 ? 534 LEU B H    1 
ATOM   10427 N  N    . MET B 1 504 ? 57.854  15.254  5.624   1.00 5.30  ? 535 MET B N    1 
ATOM   10428 C  CA   . MET B 1 504 ? 56.721  14.598  6.219   1.00 5.70  ? 535 MET B CA   1 
ATOM   10429 C  C    . MET B 1 504 ? 55.458  15.469  6.295   1.00 6.13  ? 535 MET B C    1 
ATOM   10430 O  O    . MET B 1 504 ? 54.361  14.999  5.977   1.00 7.93  ? 535 MET B O    1 
ATOM   10431 C  CB   . MET B 1 504 ? 57.117  14.012  7.574   1.00 7.08  ? 535 MET B CB   1 
ATOM   10432 C  CG   . MET B 1 504 ? 58.122  12.869  7.429   1.00 6.58  ? 535 MET B CG   1 
ATOM   10433 S  SD   . MET B 1 504 ? 57.799  11.831  5.925   1.00 5.83  ? 535 MET B SD   1 
ATOM   10434 C  CE   . MET B 1 504 ? 57.450  10.184  6.791   1.00 3.87  ? 535 MET B CE   1 
ATOM   10435 H  H    . MET B 1 504 ? 58.649  15.421  6.159   1.00 17.00 ? 535 MET B H    1 
ATOM   10436 N  N    . GLY B 1 505 ? 55.607  16.738  6.681   1.00 6.03  ? 536 GLY B N    1 
ATOM   10437 C  CA   . GLY B 1 505 ? 54.465  17.648  6.768   1.00 2.99  ? 536 GLY B CA   1 
ATOM   10438 C  C    . GLY B 1 505 ? 54.056  18.097  5.380   1.00 3.24  ? 536 GLY B C    1 
ATOM   10439 O  O    . GLY B 1 505 ? 54.059  19.284  5.057   1.00 2.00  ? 536 GLY B O    1 
ATOM   10440 H  H    . GLY B 1 505 ? 56.490  17.101  6.883   1.00 17.00 ? 536 GLY B H    1 
ATOM   10441 N  N    . ASN B 1 506 ? 53.680  17.130  4.561   1.00 3.58  ? 537 ASN B N    1 
ATOM   10442 C  CA   . ASN B 1 506 ? 53.288  17.371  3.185   1.00 7.03  ? 537 ASN B CA   1 
ATOM   10443 C  C    . ASN B 1 506 ? 52.002  16.564  2.919   1.00 9.18  ? 537 ASN B C    1 
ATOM   10444 O  O    . ASN B 1 506 ? 51.982  15.343  3.137   1.00 10.99 ? 537 ASN B O    1 
ATOM   10445 C  CB   . ASN B 1 506 ? 54.410  16.873  2.281   1.00 8.12  ? 537 ASN B CB   1 
ATOM   10446 C  CG   . ASN B 1 506 ? 54.185  17.206  0.814   1.00 8.78  ? 537 ASN B CG   1 
ATOM   10447 O  OD1  . ASN B 1 506 ? 53.343  16.599  0.124   1.00 2.67  ? 537 ASN B OD1  1 
ATOM   10448 N  ND2  . ASN B 1 506 ? 54.963  18.170  0.319   1.00 10.70 ? 537 ASN B ND2  1 
ATOM   10449 H  H    . ASN B 1 506 ? 53.611  16.203  4.855   1.00 17.00 ? 537 ASN B H    1 
ATOM   10450 H  HD21 . ASN B 1 506 ? 54.862  18.387  -0.631  1.00 17.00 ? 537 ASN B HD21 1 
ATOM   10451 H  HD22 . ASN B 1 506 ? 55.609  18.598  0.918   1.00 17.00 ? 537 ASN B HD22 1 
ATOM   10452 N  N    . PRO B 1 507 ? 50.948  17.204  2.358   1.00 6.85  ? 538 PRO B N    1 
ATOM   10453 C  CA   . PRO B 1 507 ? 49.694  16.493  2.094   1.00 4.35  ? 538 PRO B CA   1 
ATOM   10454 C  C    . PRO B 1 507 ? 49.782  15.029  1.676   1.00 3.68  ? 538 PRO B C    1 
ATOM   10455 O  O    . PRO B 1 507 ? 49.107  14.197  2.274   1.00 3.80  ? 538 PRO B O    1 
ATOM   10456 C  CB   . PRO B 1 507 ? 49.019  17.344  1.019   1.00 4.35  ? 538 PRO B CB   1 
ATOM   10457 C  CG   . PRO B 1 507 ? 50.149  18.138  0.412   1.00 5.05  ? 538 PRO B CG   1 
ATOM   10458 C  CD   . PRO B 1 507 ? 50.960  18.484  1.629   1.00 7.32  ? 538 PRO B CD   1 
ATOM   10459 N  N    . ILE B 1 508 ? 50.629  14.672  0.719   1.00 2.00  ? 539 ILE B N    1 
ATOM   10460 C  CA   . ILE B 1 508 ? 50.620  13.271  0.333   1.00 2.00  ? 539 ILE B CA   1 
ATOM   10461 C  C    . ILE B 1 508 ? 50.996  12.370  1.487   1.00 2.47  ? 539 ILE B C    1 
ATOM   10462 O  O    . ILE B 1 508 ? 50.495  11.259  1.586   1.00 2.82  ? 539 ILE B O    1 
ATOM   10463 C  CB   . ILE B 1 508 ? 51.421  12.940  -0.948  1.00 2.00  ? 539 ILE B CB   1 
ATOM   10464 C  CG1  . ILE B 1 508 ? 52.877  12.613  -0.626  1.00 2.00  ? 539 ILE B CG1  1 
ATOM   10465 C  CG2  . ILE B 1 508 ? 51.311  14.057  -1.953  1.00 2.00  ? 539 ILE B CG2  1 
ATOM   10466 C  CD1  . ILE B 1 508 ? 53.579  11.926  -1.765  1.00 2.32  ? 539 ILE B CD1  1 
ATOM   10467 H  H    . ILE B 1 508 ? 51.257  15.312  0.313   1.00 17.00 ? 539 ILE B H    1 
ATOM   10468 N  N    . CYS B 1 509 ? 51.815  12.881  2.399   1.00 3.98  ? 540 CYS B N    1 
ATOM   10469 C  CA   . CYS B 1 509 ? 52.240  12.127  3.581   1.00 5.42  ? 540 CYS B CA   1 
ATOM   10470 C  C    . CYS B 1 509 ? 51.103  11.973  4.563   1.00 5.02  ? 540 CYS B C    1 
ATOM   10471 O  O    . CYS B 1 509 ? 51.253  11.278  5.563   1.00 7.05  ? 540 CYS B O    1 
ATOM   10472 C  CB   . CYS B 1 509 ? 53.363  12.841  4.315   1.00 7.26  ? 540 CYS B CB   1 
ATOM   10473 S  SG   . CYS B 1 509 ? 54.887  12.996  3.426   1.00 13.96 ? 540 CYS B SG   1 
ATOM   10474 H  H    . CYS B 1 509 ? 52.177  13.767  2.237   1.00 17.00 ? 540 CYS B H    1 
ATOM   10475 N  N    . SER B 1 510 ? 50.006  12.693  4.320   1.00 5.10  ? 541 SER B N    1 
ATOM   10476 C  CA   . SER B 1 510 ? 48.819  12.655  5.180   1.00 4.26  ? 541 SER B CA   1 
ATOM   10477 C  C    . SER B 1 510 ? 48.058  11.321  5.090   1.00 6.21  ? 541 SER B C    1 
ATOM   10478 O  O    . SER B 1 510 ? 48.016  10.659  4.037   1.00 7.80  ? 541 SER B O    1 
ATOM   10479 C  CB   . SER B 1 510 ? 47.865  13.786  4.820   1.00 2.04  ? 541 SER B CB   1 
ATOM   10480 O  OG   . SER B 1 510 ? 47.089  13.446  3.675   1.00 2.00  ? 541 SER B OG   1 
ATOM   10481 H  H    . SER B 1 510 ? 50.015  13.273  3.548   1.00 17.00 ? 541 SER B H    1 
ATOM   10482 H  HG   . SER B 1 510 ? 47.735  13.240  2.986   1.00 17.00 ? 541 SER B HG   1 
ATOM   10483 N  N    . PRO B 1 511 ? 47.402  10.931  6.184   1.00 4.21  ? 542 PRO B N    1 
ATOM   10484 C  CA   . PRO B 1 511 ? 46.647  9.689   6.215   1.00 3.54  ? 542 PRO B CA   1 
ATOM   10485 C  C    . PRO B 1 511 ? 45.468  9.738   5.277   1.00 4.62  ? 542 PRO B C    1 
ATOM   10486 O  O    . PRO B 1 511 ? 44.890  8.706   4.955   1.00 6.76  ? 542 PRO B O    1 
ATOM   10487 C  CB   . PRO B 1 511 ? 46.226  9.599   7.663   1.00 2.25  ? 542 PRO B CB   1 
ATOM   10488 C  CG   . PRO B 1 511 ? 46.110  11.023  8.063   1.00 4.78  ? 542 PRO B CG   1 
ATOM   10489 C  CD   . PRO B 1 511 ? 47.314  11.632  7.468   1.00 4.22  ? 542 PRO B CD   1 
ATOM   10490 N  N    . GLN B 1 512 ? 45.112  10.940  4.845   1.00 5.03  ? 543 GLN B N    1 
ATOM   10491 C  CA   . GLN B 1 512 ? 44.005  11.104  3.920   1.00 8.38  ? 543 GLN B CA   1 
ATOM   10492 C  C    . GLN B 1 512 ? 44.462  10.859  2.459   1.00 8.89  ? 543 GLN B C    1 
ATOM   10493 O  O    . GLN B 1 512 ? 43.666  10.417  1.621   1.00 10.08 ? 543 GLN B O    1 
ATOM   10494 C  CB   . GLN B 1 512 ? 43.388  12.495  4.062   1.00 8.57  ? 543 GLN B CB   1 
ATOM   10495 C  CG   . GLN B 1 512 ? 43.509  13.114  5.422   1.00 5.43  ? 543 GLN B CG   1 
ATOM   10496 C  CD   . GLN B 1 512 ? 44.414  14.341  5.381   1.00 10.73 ? 543 GLN B CD   1 
ATOM   10497 O  OE1  . GLN B 1 512 ? 45.125  14.640  6.347   1.00 8.33  ? 543 GLN B OE1  1 
ATOM   10498 N  NE2  . GLN B 1 512 ? 44.392  15.058  4.257   1.00 8.63  ? 543 GLN B NE2  1 
ATOM   10499 H  H    . GLN B 1 512 ? 45.602  11.737  5.129   1.00 17.00 ? 543 GLN B H    1 
ATOM   10500 H  HE21 . GLN B 1 512 ? 45.029  15.787  4.205   1.00 17.00 ? 543 GLN B HE21 1 
ATOM   10501 H  HE22 . GLN B 1 512 ? 43.778  14.853  3.521   1.00 17.00 ? 543 GLN B HE22 1 
ATOM   10502 N  N    . TYR B 1 513 ? 45.726  11.182  2.164   1.00 7.39  ? 544 TYR B N    1 
ATOM   10503 C  CA   . TYR B 1 513 ? 46.311  10.999  0.826   1.00 4.30  ? 544 TYR B CA   1 
ATOM   10504 C  C    . TYR B 1 513 ? 47.133  9.730   0.674   1.00 3.83  ? 544 TYR B C    1 
ATOM   10505 O  O    . TYR B 1 513 ? 47.180  9.182   -0.422  1.00 4.38  ? 544 TYR B O    1 
ATOM   10506 C  CB   . TYR B 1 513 ? 47.264  12.139  0.475   1.00 3.01  ? 544 TYR B CB   1 
ATOM   10507 C  CG   . TYR B 1 513 ? 46.627  13.403  0.047   1.00 2.17  ? 544 TYR B CG   1 
ATOM   10508 C  CD1  . TYR B 1 513 ? 45.923  14.195  0.959   1.00 2.00  ? 544 TYR B CD1  1 
ATOM   10509 C  CD2  . TYR B 1 513 ? 46.697  13.804  -1.279  1.00 2.00  ? 544 TYR B CD2  1 
ATOM   10510 C  CE1  . TYR B 1 513 ? 45.293  15.364  0.561   1.00 2.02  ? 544 TYR B CE1  1 
ATOM   10511 C  CE2  . TYR B 1 513 ? 46.063  14.967  -1.694  1.00 4.97  ? 544 TYR B CE2  1 
ATOM   10512 C  CZ   . TYR B 1 513 ? 45.356  15.751  -0.764  1.00 2.00  ? 544 TYR B CZ   1 
ATOM   10513 O  OH   . TYR B 1 513 ? 44.719  16.904  -1.177  1.00 2.00  ? 544 TYR B OH   1 
ATOM   10514 H  H    . TYR B 1 513 ? 46.294  11.544  2.875   1.00 17.00 ? 544 TYR B H    1 
ATOM   10515 H  HH   . TYR B 1 513 ? 44.371  17.399  -0.428  1.00 17.00 ? 544 TYR B HH   1 
ATOM   10516 N  N    . TRP B 1 514 ? 47.822  9.298   1.738   1.00 2.31  ? 545 TRP B N    1 
ATOM   10517 C  CA   . TRP B 1 514 ? 48.678  8.112   1.683   1.00 4.01  ? 545 TRP B CA   1 
ATOM   10518 C  C    . TRP B 1 514 ? 48.005  6.721   1.474   1.00 5.36  ? 545 TRP B C    1 
ATOM   10519 O  O    . TRP B 1 514 ? 48.015  5.839   2.356   1.00 5.05  ? 545 TRP B O    1 
ATOM   10520 C  CB   . TRP B 1 514 ? 49.617  8.082   2.884   1.00 3.50  ? 545 TRP B CB   1 
ATOM   10521 C  CG   . TRP B 1 514 ? 50.758  7.105   2.713   1.00 5.39  ? 545 TRP B CG   1 
ATOM   10522 C  CD1  . TRP B 1 514 ? 51.104  6.094   3.566   1.00 5.60  ? 545 TRP B CD1  1 
ATOM   10523 C  CD2  . TRP B 1 514 ? 51.755  7.108   1.671   1.00 4.46  ? 545 TRP B CD2  1 
ATOM   10524 N  NE1  . TRP B 1 514 ? 52.261  5.490   3.134   1.00 7.77  ? 545 TRP B NE1  1 
ATOM   10525 C  CE2  . TRP B 1 514 ? 52.687  6.097   1.979   1.00 5.75  ? 545 TRP B CE2  1 
ATOM   10526 C  CE3  . TRP B 1 514 ? 51.959  7.880   0.523   1.00 4.23  ? 545 TRP B CE3  1 
ATOM   10527 C  CZ2  . TRP B 1 514 ? 53.817  5.839   1.181   1.00 4.80  ? 545 TRP B CZ2  1 
ATOM   10528 C  CZ3  . TRP B 1 514 ? 53.086  7.624   -0.270  1.00 5.61  ? 545 TRP B CZ3  1 
ATOM   10529 C  CH2  . TRP B 1 514 ? 54.000  6.615   0.068   1.00 2.75  ? 545 TRP B CH2  1 
ATOM   10530 H  H    . TRP B 1 514 ? 47.740  9.776   2.563   1.00 17.00 ? 545 TRP B H    1 
ATOM   10531 H  HE1  . TRP B 1 514 ? 52.700  4.720   3.547   1.00 17.00 ? 545 TRP B HE1  1 
ATOM   10532 N  N    . LYS B 1 515 ? 47.515  6.501   0.261   1.00 3.37  ? 546 LYS B N    1 
ATOM   10533 C  CA   . LYS B 1 515 ? 46.874  5.267   -0.072  1.00 2.00  ? 546 LYS B CA   1 
ATOM   10534 C  C    . LYS B 1 515 ? 47.053  5.158   -1.556  1.00 2.00  ? 546 LYS B C    1 
ATOM   10535 O  O    . LYS B 1 515 ? 47.335  6.152   -2.222  1.00 2.00  ? 546 LYS B O    1 
ATOM   10536 C  CB   . LYS B 1 515 ? 45.386  5.354   0.285   1.00 6.00  ? 546 LYS B CB   1 
ATOM   10537 C  CG   . LYS B 1 515 ? 44.589  6.462   -0.436  1.00 8.58  ? 546 LYS B CG   1 
ATOM   10538 C  CD   . LYS B 1 515 ? 43.129  6.526   0.036   1.00 11.41 ? 546 LYS B CD   1 
ATOM   10539 C  CE   . LYS B 1 515 ? 43.028  6.825   1.540   1.00 15.33 ? 546 LYS B CE   1 
ATOM   10540 N  NZ   . LYS B 1 515 ? 41.676  6.567   2.142   1.00 16.10 ? 546 LYS B NZ   1 
ATOM   10541 H  H    . LYS B 1 515 ? 47.581  7.197   -0.433  1.00 17.00 ? 546 LYS B H    1 
ATOM   10542 H  HZ1  . LYS B 1 515 ? 40.978  7.169   1.661   1.00 17.00 ? 546 LYS B HZ1  1 
ATOM   10543 H  HZ2  . LYS B 1 515 ? 41.427  5.565   2.019   1.00 17.00 ? 546 LYS B HZ2  1 
ATOM   10544 H  HZ3  . LYS B 1 515 ? 41.699  6.795   3.155   1.00 17.00 ? 546 LYS B HZ3  1 
ATOM   10545 N  N    . PRO B 1 516 ? 46.936  3.940   -2.100  1.00 2.00  ? 547 PRO B N    1 
ATOM   10546 C  CA   . PRO B 1 516 ? 47.081  3.722   -3.535  1.00 2.00  ? 547 PRO B CA   1 
ATOM   10547 C  C    . PRO B 1 516 ? 46.065  4.601   -4.163  1.00 3.89  ? 547 PRO B C    1 
ATOM   10548 O  O    . PRO B 1 516 ? 45.491  5.435   -3.480  1.00 9.10  ? 547 PRO B O    1 
ATOM   10549 C  CB   . PRO B 1 516 ? 46.663  2.277   -3.679  1.00 3.44  ? 547 PRO B CB   1 
ATOM   10550 C  CG   . PRO B 1 516 ? 47.119  1.657   -2.402  1.00 2.00  ? 547 PRO B CG   1 
ATOM   10551 C  CD   . PRO B 1 516 ? 46.724  2.665   -1.385  1.00 2.00  ? 547 PRO B CD   1 
ATOM   10552 N  N    . SER B 1 517 ? 45.763  4.410   -5.436  1.00 5.36  ? 548 SER B N    1 
ATOM   10553 C  CA   . SER B 1 517 ? 44.721  5.248   -6.084  1.00 7.61  ? 548 SER B CA   1 
ATOM   10554 C  C    . SER B 1 517 ? 45.006  6.773   -6.141  1.00 5.26  ? 548 SER B C    1 
ATOM   10555 O  O    . SER B 1 517 ? 44.861  7.369   -7.202  1.00 5.77  ? 548 SER B O    1 
ATOM   10556 C  CB   . SER B 1 517 ? 43.295  4.966   -5.489  1.00 7.27  ? 548 SER B CB   1 
ATOM   10557 O  OG   . SER B 1 517 ? 43.018  5.648   -4.258  1.00 2.02  ? 548 SER B OG   1 
ATOM   10558 H  H    . SER B 1 517 ? 46.232  3.725   -5.934  1.00 17.00 ? 548 SER B H    1 
ATOM   10559 H  HG   . SER B 1 517 ? 43.636  5.430   -3.548  1.00 17.00 ? 548 SER B HG   1 
ATOM   10560 N  N    . THR B 1 518 ? 45.398  7.395   -5.024  1.00 4.79  ? 549 THR B N    1 
ATOM   10561 C  CA   . THR B 1 518 ? 45.724  8.828   -4.984  1.00 2.84  ? 549 THR B CA   1 
ATOM   10562 C  C    . THR B 1 518 ? 46.784  9.013   -6.039  1.00 2.89  ? 549 THR B C    1 
ATOM   10563 O  O    . THR B 1 518 ? 46.928  10.089  -6.631  1.00 2.00  ? 549 THR B O    1 
ATOM   10564 C  CB   . THR B 1 518 ? 46.373  9.220   -3.649  1.00 2.00  ? 549 THR B CB   1 
ATOM   10565 O  OG1  . THR B 1 518 ? 45.619  8.692   -2.561  1.00 2.00  ? 549 THR B OG1  1 
ATOM   10566 C  CG2  . THR B 1 518 ? 46.464  10.693  -3.513  1.00 2.03  ? 549 THR B CG2  1 
ATOM   10567 H  H    . THR B 1 518 ? 45.430  7.036   -4.125  1.00 17.00 ? 549 THR B H    1 
ATOM   10568 H  HG1  . THR B 1 518 ? 46.161  8.706   -1.778  1.00 17.00 ? 549 THR B HG1  1 
ATOM   10569 N  N    . PHE B 1 519 ? 47.524  7.929   -6.263  1.00 3.11  ? 550 PHE B N    1 
ATOM   10570 C  CA   . PHE B 1 519 ? 48.590  7.901   -7.235  1.00 4.31  ? 550 PHE B CA   1 
ATOM   10571 C  C    . PHE B 1 519 ? 48.225  7.088   -8.481  1.00 4.82  ? 550 PHE B C    1 
ATOM   10572 O  O    . PHE B 1 519 ? 49.071  6.526   -9.167  1.00 5.22  ? 550 PHE B O    1 
ATOM   10573 C  CB   . PHE B 1 519 ? 49.829  7.377   -6.537  1.00 3.85  ? 550 PHE B CB   1 
ATOM   10574 C  CG   . PHE B 1 519 ? 50.124  8.104   -5.255  1.00 3.89  ? 550 PHE B CG   1 
ATOM   10575 C  CD1  . PHE B 1 519 ? 50.358  9.481   -5.253  1.00 3.78  ? 550 PHE B CD1  1 
ATOM   10576 C  CD2  . PHE B 1 519 ? 50.091  7.438   -4.040  1.00 3.65  ? 550 PHE B CD2  1 
ATOM   10577 C  CE1  . PHE B 1 519 ? 50.546  10.167  -4.057  1.00 2.02  ? 550 PHE B CE1  1 
ATOM   10578 C  CE2  . PHE B 1 519 ? 50.280  8.118   -2.836  1.00 2.00  ? 550 PHE B CE2  1 
ATOM   10579 C  CZ   . PHE B 1 519 ? 50.505  9.486   -2.853  1.00 2.00  ? 550 PHE B CZ   1 
ATOM   10580 H  H    . PHE B 1 519 ? 47.367  7.135   -5.715  1.00 17.00 ? 550 PHE B H    1 
ATOM   10581 N  N    . GLY B 1 520 ? 46.946  7.100   -8.811  1.00 5.63  ? 551 GLY B N    1 
ATOM   10582 C  CA   . GLY B 1 520 ? 46.476  6.368   -9.961  1.00 4.79  ? 551 GLY B CA   1 
ATOM   10583 C  C    . GLY B 1 520 ? 46.214  4.888   -9.738  1.00 3.18  ? 551 GLY B C    1 
ATOM   10584 O  O    . GLY B 1 520 ? 45.443  4.267   -10.476 1.00 2.00  ? 551 GLY B O    1 
ATOM   10585 H  H    . GLY B 1 520 ? 46.317  7.652   -8.307  1.00 17.00 ? 551 GLY B H    1 
ATOM   10586 N  N    . GLY B 1 521 ? 46.852  4.313   -8.737  1.00 2.00  ? 552 GLY B N    1 
ATOM   10587 C  CA   . GLY B 1 521 ? 46.647  2.914   -8.499  1.00 2.02  ? 552 GLY B CA   1 
ATOM   10588 C  C    . GLY B 1 521 ? 47.561  2.402   -7.433  1.00 2.53  ? 552 GLY B C    1 
ATOM   10589 O  O    . GLY B 1 521 ? 47.992  3.160   -6.593  1.00 2.92  ? 552 GLY B O    1 
ATOM   10590 H  H    . GLY B 1 521 ? 47.482  4.816   -8.182  1.00 17.00 ? 552 GLY B H    1 
ATOM   10591 N  N    . GLU B 1 522 ? 47.715  1.088   -7.388  1.00 5.57  ? 553 GLU B N    1 
ATOM   10592 C  CA   . GLU B 1 522 ? 48.599  0.414   -6.439  1.00 8.50  ? 553 GLU B CA   1 
ATOM   10593 C  C    . GLU B 1 522 ? 49.967  0.565   -7.114  1.00 7.06  ? 553 GLU B C    1 
ATOM   10594 O  O    . GLU B 1 522 ? 50.997  0.757   -6.471  1.00 7.29  ? 553 GLU B O    1 
ATOM   10595 C  CB   . GLU B 1 522 ? 48.212  -1.076  -6.358  1.00 9.06  ? 553 GLU B CB   1 
ATOM   10596 C  CG   . GLU B 1 522 ? 48.876  -1.842  -5.241  1.00 12.19 ? 553 GLU B CG   1 
ATOM   10597 C  CD   . GLU B 1 522 ? 48.401  -1.391  -3.866  1.00 12.50 ? 553 GLU B CD   1 
ATOM   10598 O  OE1  . GLU B 1 522 ? 47.278  -1.760  -3.482  1.00 11.02 ? 553 GLU B OE1  1 
ATOM   10599 O  OE2  . GLU B 1 522 ? 49.151  -0.666  -3.178  1.00 12.25 ? 553 GLU B OE2  1 
ATOM   10600 H  H    . GLU B 1 522 ? 47.185  0.536   -7.998  1.00 17.00 ? 553 GLU B H    1 
ATOM   10601 N  N    . VAL B 1 523 ? 49.893  0.566   -8.442  1.00 5.54  ? 554 VAL B N    1 
ATOM   10602 C  CA   . VAL B 1 523 ? 51.000  0.684   -9.351  1.00 2.51  ? 554 VAL B CA   1 
ATOM   10603 C  C    . VAL B 1 523 ? 51.710  1.956   -9.003  1.00 2.00  ? 554 VAL B C    1 
ATOM   10604 O  O    . VAL B 1 523 ? 52.786  1.914   -8.442  1.00 5.02  ? 554 VAL B O    1 
ATOM   10605 C  CB   . VAL B 1 523 ? 50.485  0.751   -10.802 1.00 2.74  ? 554 VAL B CB   1 
ATOM   10606 C  CG1  . VAL B 1 523 ? 51.613  0.555   -11.782 1.00 3.08  ? 554 VAL B CG1  1 
ATOM   10607 C  CG2  . VAL B 1 523 ? 49.412  -0.295  -11.013 1.00 4.20  ? 554 VAL B CG2  1 
ATOM   10608 H  H    . VAL B 1 523 ? 49.002  0.463   -8.812  1.00 17.00 ? 554 VAL B H    1 
ATOM   10609 N  N    . GLY B 1 524 ? 51.091  3.093   -9.278  1.00 2.00  ? 555 GLY B N    1 
ATOM   10610 C  CA   . GLY B 1 524 ? 51.737  4.361   -8.982  1.00 2.23  ? 555 GLY B CA   1 
ATOM   10611 C  C    . GLY B 1 524 ? 52.290  4.429   -7.579  1.00 2.24  ? 555 GLY B C    1 
ATOM   10612 O  O    . GLY B 1 524 ? 53.401  4.877   -7.376  1.00 2.00  ? 555 GLY B O    1 
ATOM   10613 H  H    . GLY B 1 524 ? 50.218  3.126   -9.709  1.00 17.00 ? 555 GLY B H    1 
ATOM   10614 N  N    . PHE B 1 525 ? 51.517  3.926   -6.623  1.00 3.44  ? 556 PHE B N    1 
ATOM   10615 C  CA   . PHE B 1 525 ? 51.899  3.908   -5.221  1.00 3.56  ? 556 PHE B CA   1 
ATOM   10616 C  C    . PHE B 1 525 ? 53.189  3.133   -5.047  1.00 6.76  ? 556 PHE B C    1 
ATOM   10617 O  O    . PHE B 1 525 ? 54.042  3.478   -4.212  1.00 6.86  ? 556 PHE B O    1 
ATOM   10618 C  CB   . PHE B 1 525 ? 50.830  3.234   -4.388  1.00 2.00  ? 556 PHE B CB   1 
ATOM   10619 C  CG   . PHE B 1 525 ? 50.988  3.449   -2.940  1.00 2.00  ? 556 PHE B CG   1 
ATOM   10620 C  CD1  . PHE B 1 525 ? 51.312  4.700   -2.437  1.00 2.00  ? 556 PHE B CD1  1 
ATOM   10621 C  CD2  . PHE B 1 525 ? 50.762  2.431   -2.063  1.00 2.00  ? 556 PHE B CD2  1 
ATOM   10622 C  CE1  . PHE B 1 525 ? 51.402  4.937   -1.062  1.00 2.00  ? 556 PHE B CE1  1 
ATOM   10623 C  CE2  . PHE B 1 525 ? 50.848  2.642   -0.682  1.00 2.46  ? 556 PHE B CE2  1 
ATOM   10624 C  CZ   . PHE B 1 525 ? 51.168  3.904   -0.177  1.00 2.00  ? 556 PHE B CZ   1 
ATOM   10625 H  H    . PHE B 1 525 ? 50.666  3.526   -6.871  1.00 17.00 ? 556 PHE B H    1 
ATOM   10626 N  N    . LYS B 1 526 ? 53.323  2.052   -5.803  1.00 7.74  ? 557 LYS B N    1 
ATOM   10627 C  CA   . LYS B 1 526 ? 54.530  1.244   -5.708  1.00 9.45  ? 557 LYS B CA   1 
ATOM   10628 C  C    . LYS B 1 526 ? 55.648  1.688   -6.660  1.00 7.95  ? 557 LYS B C    1 
ATOM   10629 O  O    . LYS B 1 526 ? 56.371  0.876   -7.219  1.00 8.92  ? 557 LYS B O    1 
ATOM   10630 C  CB   . LYS B 1 526 ? 54.218  -0.253  -5.805  1.00 9.25  ? 557 LYS B CB   1 
ATOM   10631 C  CG   . LYS B 1 526 ? 53.304  -0.740  -4.695  1.00 13.38 ? 557 LYS B CG   1 
ATOM   10632 C  CD   . LYS B 1 526 ? 53.735  -0.226  -3.311  1.00 19.79 ? 557 LYS B CD   1 
ATOM   10633 C  CE   . LYS B 1 526 ? 52.765  -0.733  -2.193  1.00 25.76 ? 557 LYS B CE   1 
ATOM   10634 N  NZ   . LYS B 1 526 ? 53.057  -0.240  -0.786  1.00 25.03 ? 557 LYS B NZ   1 
ATOM   10635 H  H    . LYS B 1 526 ? 52.631  1.780   -6.440  1.00 17.00 ? 557 LYS B H    1 
ATOM   10636 H  HZ1  . LYS B 1 526 ? 54.019  -0.533  -0.513  1.00 17.00 ? 557 LYS B HZ1  1 
ATOM   10637 H  HZ2  . LYS B 1 526 ? 52.982  0.797   -0.747  1.00 17.00 ? 557 LYS B HZ2  1 
ATOM   10638 H  HZ3  . LYS B 1 526 ? 52.370  -0.668  -0.132  1.00 17.00 ? 557 LYS B HZ3  1 
ATOM   10639 N  N    . ILE B 1 527 ? 55.715  2.991   -6.891  1.00 6.40  ? 558 ILE B N    1 
ATOM   10640 C  CA   . ILE B 1 527 ? 56.757  3.599   -7.698  1.00 6.34  ? 558 ILE B CA   1 
ATOM   10641 C  C    . ILE B 1 527 ? 57.427  4.479   -6.639  1.00 5.66  ? 558 ILE B C    1 
ATOM   10642 O  O    . ILE B 1 527 ? 58.626  4.468   -6.469  1.00 6.80  ? 558 ILE B O    1 
ATOM   10643 C  CB   . ILE B 1 527 ? 56.177  4.442   -8.829  1.00 5.47  ? 558 ILE B CB   1 
ATOM   10644 C  CG1  . ILE B 1 527 ? 55.713  3.528   -9.964  1.00 3.74  ? 558 ILE B CG1  1 
ATOM   10645 C  CG2  . ILE B 1 527 ? 57.194  5.511   -9.258  1.00 4.66  ? 558 ILE B CG2  1 
ATOM   10646 C  CD1  . ILE B 1 527 ? 55.256  4.266   -11.218 1.00 8.19  ? 558 ILE B CD1  1 
ATOM   10647 H  H    . ILE B 1 527 ? 55.003  3.569   -6.552  1.00 17.00 ? 558 ILE B H    1 
ATOM   10648 N  N    . ILE B 1 528 ? 56.612  5.183   -5.872  1.00 6.14  ? 559 ILE B N    1 
ATOM   10649 C  CA   . ILE B 1 528 ? 57.104  5.998   -4.786  1.00 5.46  ? 559 ILE B CA   1 
ATOM   10650 C  C    . ILE B 1 528 ? 57.900  5.024   -3.904  1.00 4.38  ? 559 ILE B C    1 
ATOM   10651 O  O    . ILE B 1 528 ? 59.090  5.180   -3.711  1.00 5.22  ? 559 ILE B O    1 
ATOM   10652 C  CB   . ILE B 1 528 ? 55.900  6.601   -3.931  1.00 7.29  ? 559 ILE B CB   1 
ATOM   10653 C  CG1  . ILE B 1 528 ? 55.179  7.712   -4.697  1.00 5.66  ? 559 ILE B CG1  1 
ATOM   10654 C  CG2  . ILE B 1 528 ? 56.366  7.129   -2.556  1.00 4.88  ? 559 ILE B CG2  1 
ATOM   10655 C  CD1  . ILE B 1 528 ? 54.436  7.251   -5.905  1.00 4.55  ? 559 ILE B CD1  1 
ATOM   10656 H  H    . ILE B 1 528 ? 55.656  5.131   -6.065  1.00 17.00 ? 559 ILE B H    1 
ATOM   10657 N  N    . ASN B 1 529 ? 57.279  3.933   -3.493  1.00 4.73  ? 560 ASN B N    1 
ATOM   10658 C  CA   . ASN B 1 529 ? 57.981  3.031   -2.600  1.00 7.48  ? 560 ASN B CA   1 
ATOM   10659 C  C    . ASN B 1 529 ? 58.977  2.019   -3.202  1.00 8.01  ? 560 ASN B C    1 
ATOM   10660 O  O    . ASN B 1 529 ? 59.177  0.903   -2.704  1.00 9.67  ? 560 ASN B O    1 
ATOM   10661 C  CB   . ASN B 1 529 ? 57.004  2.393   -1.617  1.00 11.46 ? 560 ASN B CB   1 
ATOM   10662 C  CG   . ASN B 1 529 ? 56.134  3.421   -0.922  1.00 12.69 ? 560 ASN B CG   1 
ATOM   10663 O  OD1  . ASN B 1 529 ? 56.585  4.119   -0.024  1.00 10.23 ? 560 ASN B OD1  1 
ATOM   10664 N  ND2  . ASN B 1 529 ? 54.883  3.529   -1.358  1.00 14.04 ? 560 ASN B ND2  1 
ATOM   10665 H  H    . ASN B 1 529 ? 56.365  3.744   -3.797  1.00 17.00 ? 560 ASN B H    1 
ATOM   10666 H  HD21 . ASN B 1 529 ? 54.316  4.188   -0.909  1.00 17.00 ? 560 ASN B HD21 1 
ATOM   10667 H  HD22 . ASN B 1 529 ? 54.575  2.962   -2.097  1.00 17.00 ? 560 ASN B HD22 1 
ATOM   10668 N  N    . THR B 1 530 ? 59.622  2.430   -4.277  1.00 5.94  ? 561 THR B N    1 
ATOM   10669 C  CA   . THR B 1 530 ? 60.653  1.630   -4.904  1.00 4.94  ? 561 THR B CA   1 
ATOM   10670 C  C    . THR B 1 530 ? 61.659  2.637   -5.477  1.00 6.99  ? 561 THR B C    1 
ATOM   10671 O  O    . THR B 1 530 ? 62.666  2.263   -6.097  1.00 9.55  ? 561 THR B O    1 
ATOM   10672 C  CB   . THR B 1 530 ? 60.097  0.749   -6.002  1.00 2.11  ? 561 THR B CB   1 
ATOM   10673 O  OG1  . THR B 1 530 ? 59.282  1.524   -6.884  1.00 4.37  ? 561 THR B OG1  1 
ATOM   10674 C  CG2  . THR B 1 530 ? 59.306  -0.353  -5.415  1.00 2.03  ? 561 THR B CG2  1 
ATOM   10675 H  H    . THR B 1 530 ? 59.395  3.274   -4.717  1.00 17.00 ? 561 THR B H    1 
ATOM   10676 H  HG1  . THR B 1 530 ? 58.830  0.943   -7.507  1.00 17.00 ? 561 THR B HG1  1 
ATOM   10677 N  N    . ALA B 1 531 ? 61.418  3.915   -5.180  1.00 6.36  ? 562 ALA B N    1 
ATOM   10678 C  CA   . ALA B 1 531 ? 62.254  4.997   -5.661  1.00 5.03  ? 562 ALA B CA   1 
ATOM   10679 C  C    . ALA B 1 531 ? 63.656  4.979   -5.063  1.00 5.59  ? 562 ALA B C    1 
ATOM   10680 O  O    . ALA B 1 531 ? 63.881  4.505   -3.952  1.00 7.39  ? 562 ALA B O    1 
ATOM   10681 C  CB   . ALA B 1 531 ? 61.577  6.361   -5.402  1.00 5.73  ? 562 ALA B CB   1 
ATOM   10682 H  H    . ALA B 1 531 ? 60.676  4.164   -4.595  1.00 17.00 ? 562 ALA B H    1 
ATOM   10683 N  N    . SER B 1 532 ? 64.589  5.536   -5.825  1.00 6.98  ? 563 SER B N    1 
ATOM   10684 C  CA   . SER B 1 532 ? 65.994  5.643   -5.474  1.00 4.28  ? 563 SER B CA   1 
ATOM   10685 C  C    . SER B 1 532 ? 66.659  6.514   -6.543  1.00 3.53  ? 563 SER B C    1 
ATOM   10686 O  O    . SER B 1 532 ? 66.206  6.571   -7.695  1.00 2.00  ? 563 SER B O    1 
ATOM   10687 C  CB   . SER B 1 532 ? 66.623  4.256   -5.479  1.00 6.69  ? 563 SER B CB   1 
ATOM   10688 O  OG   . SER B 1 532 ? 66.605  3.685   -6.779  1.00 3.26  ? 563 SER B OG   1 
ATOM   10689 H  H    . SER B 1 532 ? 64.327  5.890   -6.700  1.00 17.00 ? 563 SER B H    1 
ATOM   10690 H  HG   . SER B 1 532 ? 66.106  2.854   -6.770  1.00 17.00 ? 563 SER B HG   1 
ATOM   10691 N  N    . ILE B 1 533 ? 67.732  7.197   -6.172  1.00 3.14  ? 564 ILE B N    1 
ATOM   10692 C  CA   . ILE B 1 533 ? 68.406  8.061   -7.129  1.00 4.55  ? 564 ILE B CA   1 
ATOM   10693 C  C    . ILE B 1 533 ? 69.045  7.153   -8.166  1.00 4.64  ? 564 ILE B C    1 
ATOM   10694 O  O    . ILE B 1 533 ? 69.114  7.496   -9.355  1.00 4.63  ? 564 ILE B O    1 
ATOM   10695 C  CB   . ILE B 1 533 ? 69.411  9.034   -6.425  1.00 3.98  ? 564 ILE B CB   1 
ATOM   10696 C  CG1  . ILE B 1 533 ? 69.509  10.371  -7.194  1.00 2.72  ? 564 ILE B CG1  1 
ATOM   10697 C  CG2  . ILE B 1 533 ? 70.729  8.348   -6.129  1.00 2.00  ? 564 ILE B CG2  1 
ATOM   10698 C  CD1  . ILE B 1 533 ? 69.855  10.272  -8.650  1.00 2.00  ? 564 ILE B CD1  1 
ATOM   10699 H  H    . ILE B 1 533 ? 68.061  7.123   -5.257  1.00 17.00 ? 564 ILE B H    1 
ATOM   10700 N  N    . GLN B 1 534 ? 69.401  5.950   -7.715  1.00 5.48  ? 565 GLN B N    1 
ATOM   10701 C  CA   . GLN B 1 534 ? 69.990  4.904   -8.557  1.00 6.42  ? 565 GLN B CA   1 
ATOM   10702 C  C    . GLN B 1 534 ? 69.043  4.551   -9.733  1.00 5.19  ? 565 GLN B C    1 
ATOM   10703 O  O    . GLN B 1 534 ? 69.447  4.441   -10.888 1.00 2.01  ? 565 GLN B O    1 
ATOM   10704 C  CB   . GLN B 1 534 ? 70.220  3.674   -7.681  1.00 9.53  ? 565 GLN B CB   1 
ATOM   10705 C  CG   . GLN B 1 534 ? 70.572  2.417   -8.436  1.00 15.18 ? 565 GLN B CG   1 
ATOM   10706 C  CD   . GLN B 1 534 ? 71.853  2.565   -9.216  1.00 16.99 ? 565 GLN B CD   1 
ATOM   10707 O  OE1  . GLN B 1 534 ? 72.943  2.510   -8.643  1.00 16.36 ? 565 GLN B OE1  1 
ATOM   10708 N  NE2  . GLN B 1 534 ? 71.734  2.761   -10.531 1.00 16.90 ? 565 GLN B NE2  1 
ATOM   10709 H  H    . GLN B 1 534 ? 69.263  5.747   -6.774  1.00 17.00 ? 565 GLN B H    1 
ATOM   10710 H  HE21 . GLN B 1 534 ? 72.541  2.877   -11.072 1.00 17.00 ? 565 GLN B HE21 1 
ATOM   10711 H  HE22 . GLN B 1 534 ? 70.834  2.797   -10.914 1.00 17.00 ? 565 GLN B HE22 1 
ATOM   10712 N  N    . SER B 1 535 ? 67.774  4.350   -9.407  1.00 7.11  ? 566 SER B N    1 
ATOM   10713 C  CA   . SER B 1 535 ? 66.750  4.037   -10.393 1.00 5.88  ? 566 SER B CA   1 
ATOM   10714 C  C    . SER B 1 535 ? 66.398  5.270   -11.225 1.00 4.65  ? 566 SER B C    1 
ATOM   10715 O  O    . SER B 1 535 ? 66.228  5.187   -12.438 1.00 5.64  ? 566 SER B O    1 
ATOM   10716 C  CB   . SER B 1 535 ? 65.492  3.550   -9.679  1.00 4.33  ? 566 SER B CB   1 
ATOM   10717 O  OG   . SER B 1 535 ? 65.831  2.572   -8.725  1.00 6.55  ? 566 SER B OG   1 
ATOM   10718 H  H    . SER B 1 535 ? 67.476  4.370   -8.470  1.00 17.00 ? 566 SER B H    1 
ATOM   10719 H  HG   . SER B 1 535 ? 65.013  2.152   -8.427  1.00 17.00 ? 566 SER B HG   1 
ATOM   10720 N  N    . LEU B 1 536 ? 66.254  6.409   -10.564 1.00 2.10  ? 567 LEU B N    1 
ATOM   10721 C  CA   . LEU B 1 536 ? 65.918  7.643   -11.246 1.00 2.00  ? 567 LEU B CA   1 
ATOM   10722 C  C    . LEU B 1 536 ? 66.765  7.817   -12.490 1.00 2.22  ? 567 LEU B C    1 
ATOM   10723 O  O    . LEU B 1 536 ? 66.263  8.213   -13.542 1.00 2.00  ? 567 LEU B O    1 
ATOM   10724 C  CB   . LEU B 1 536 ? 66.112  8.822   -10.309 1.00 2.00  ? 567 LEU B CB   1 
ATOM   10725 C  CG   . LEU B 1 536 ? 65.507  10.093  -10.873 1.00 2.89  ? 567 LEU B CG   1 
ATOM   10726 C  CD1  . LEU B 1 536 ? 64.008  9.930   -10.896 1.00 3.20  ? 567 LEU B CD1  1 
ATOM   10727 C  CD2  . LEU B 1 536 ? 65.893  11.294  -10.048 1.00 3.10  ? 567 LEU B CD2  1 
ATOM   10728 H  H    . LEU B 1 536 ? 66.391  6.428   -9.597  1.00 17.00 ? 567 LEU B H    1 
ATOM   10729 N  N    . ILE B 1 537 ? 68.051  7.494   -12.358 1.00 5.14  ? 568 ILE B N    1 
ATOM   10730 C  CA   . ILE B 1 537 ? 69.016  7.571   -13.456 1.00 5.23  ? 568 ILE B CA   1 
ATOM   10731 C  C    . ILE B 1 537 ? 68.926  6.351   -14.396 1.00 5.12  ? 568 ILE B C    1 
ATOM   10732 O  O    . ILE B 1 537 ? 68.764  6.520   -15.593 1.00 3.20  ? 568 ILE B O    1 
ATOM   10733 C  CB   . ILE B 1 537 ? 70.463  7.796   -12.921 1.00 3.32  ? 568 ILE B CB   1 
ATOM   10734 C  CG1  . ILE B 1 537 ? 70.869  9.259   -13.071 1.00 2.72  ? 568 ILE B CG1  1 
ATOM   10735 C  CG2  . ILE B 1 537 ? 71.464  6.934   -13.660 1.00 6.16  ? 568 ILE B CG2  1 
ATOM   10736 C  CD1  . ILE B 1 537 ? 70.268  10.184  -12.088 1.00 3.00  ? 568 ILE B CD1  1 
ATOM   10737 H  H    . ILE B 1 537 ? 68.376  7.219   -11.471 1.00 17.00 ? 568 ILE B H    1 
ATOM   10738 N  N    . CYS B 1 538 ? 68.954  5.130   -13.860 1.00 8.35  ? 569 CYS B N    1 
ATOM   10739 C  CA   . CYS B 1 538 ? 68.857  3.941   -14.712 1.00 9.75  ? 569 CYS B CA   1 
ATOM   10740 C  C    . CYS B 1 538 ? 67.596  3.887   -15.536 1.00 11.37 ? 569 CYS B C    1 
ATOM   10741 O  O    . CYS B 1 538 ? 67.543  3.171   -16.537 1.00 12.01 ? 569 CYS B O    1 
ATOM   10742 C  CB   . CYS B 1 538 ? 68.961  2.663   -13.916 1.00 10.82 ? 569 CYS B CB   1 
ATOM   10743 S  SG   . CYS B 1 538 ? 70.543  1.825   -14.251 1.00 15.24 ? 569 CYS B SG   1 
ATOM   10744 H  H    . CYS B 1 538 ? 69.062  5.023   -12.890 1.00 17.00 ? 569 CYS B H    1 
ATOM   10745 N  N    . ASN B 1 539 ? 66.580  4.634   -15.099 1.00 10.19 ? 570 ASN B N    1 
ATOM   10746 C  CA   . ASN B 1 539 ? 65.308  4.689   -15.790 1.00 6.19  ? 570 ASN B CA   1 
ATOM   10747 C  C    . ASN B 1 539 ? 65.282  5.788   -16.805 1.00 5.24  ? 570 ASN B C    1 
ATOM   10748 O  O    . ASN B 1 539 ? 64.718  5.627   -17.883 1.00 5.34  ? 570 ASN B O    1 
ATOM   10749 C  CB   . ASN B 1 539 ? 64.163  4.871   -14.804 1.00 4.16  ? 570 ASN B CB   1 
ATOM   10750 C  CG   . ASN B 1 539 ? 63.583  3.557   -14.354 1.00 2.19  ? 570 ASN B CG   1 
ATOM   10751 O  OD1  . ASN B 1 539 ? 63.562  2.573   -15.094 1.00 3.63  ? 570 ASN B OD1  1 
ATOM   10752 N  ND2  . ASN B 1 539 ? 63.118  3.524   -13.141 1.00 2.19  ? 570 ASN B ND2  1 
ATOM   10753 H  H    . ASN B 1 539 ? 66.693  5.151   -14.283 1.00 17.00 ? 570 ASN B H    1 
ATOM   10754 H  HD21 . ASN B 1 539 ? 62.776  2.656   -12.848 1.00 17.00 ? 570 ASN B HD21 1 
ATOM   10755 H  HD22 . ASN B 1 539 ? 63.147  4.335   -12.602 1.00 17.00 ? 570 ASN B HD22 1 
ATOM   10756 N  N    . ASN B 1 540 ? 65.995  6.861   -16.496 1.00 6.01  ? 571 ASN B N    1 
ATOM   10757 C  CA   . ASN B 1 540 ? 66.028  8.025   -17.362 1.00 7.21  ? 571 ASN B CA   1 
ATOM   10758 C  C    . ASN B 1 540 ? 67.272  8.383   -18.170 1.00 7.53  ? 571 ASN B C    1 
ATOM   10759 O  O    . ASN B 1 540 ? 67.164  9.129   -19.148 1.00 9.69  ? 571 ASN B O    1 
ATOM   10760 C  CB   . ASN B 1 540 ? 65.578  9.234   -16.563 1.00 5.79  ? 571 ASN B CB   1 
ATOM   10761 C  CG   . ASN B 1 540 ? 64.096  9.196   -16.277 1.00 6.99  ? 571 ASN B CG   1 
ATOM   10762 O  OD1  . ASN B 1 540 ? 63.267  9.434   -17.169 1.00 6.87  ? 571 ASN B OD1  1 
ATOM   10763 N  ND2  . ASN B 1 540 ? 63.746  8.873   -15.041 1.00 4.17  ? 571 ASN B ND2  1 
ATOM   10764 H  H    . ASN B 1 540 ? 66.532  6.868   -15.678 1.00 17.00 ? 571 ASN B H    1 
ATOM   10765 H  HD21 . ASN B 1 540 ? 62.796  8.870   -14.874 1.00 17.00 ? 571 ASN B HD21 1 
ATOM   10766 H  HD22 . ASN B 1 540 ? 64.449  8.679   -14.382 1.00 17.00 ? 571 ASN B HD22 1 
ATOM   10767 N  N    . VAL B 1 541 ? 68.434  7.838   -17.822 1.00 6.10  ? 572 VAL B N    1 
ATOM   10768 C  CA   . VAL B 1 541 ? 69.660  8.194   -18.540 1.00 4.99  ? 572 VAL B CA   1 
ATOM   10769 C  C    . VAL B 1 541 ? 70.223  7.151   -19.539 1.00 4.07  ? 572 VAL B C    1 
ATOM   10770 O  O    . VAL B 1 541 ? 70.520  6.007   -19.187 1.00 2.00  ? 572 VAL B O    1 
ATOM   10771 C  CB   . VAL B 1 541 ? 70.756  8.681   -17.569 1.00 3.00  ? 572 VAL B CB   1 
ATOM   10772 C  CG1  . VAL B 1 541 ? 71.660  9.621   -18.277 1.00 2.43  ? 572 VAL B CG1  1 
ATOM   10773 C  CG2  . VAL B 1 541 ? 70.150  9.350   -16.364 1.00 2.02  ? 572 VAL B CG2  1 
ATOM   10774 H  H    . VAL B 1 541 ? 68.451  7.123   -17.183 1.00 17.00 ? 572 VAL B H    1 
ATOM   10775 N  N    . LYS B 1 542 ? 70.456  7.635   -20.755 1.00 5.78  ? 573 LYS B N    1 
ATOM   10776 C  CA   . LYS B 1 542 ? 70.930  6.866   -21.902 1.00 9.13  ? 573 LYS B CA   1 
ATOM   10777 C  C    . LYS B 1 542 ? 71.610  5.541   -21.730 1.00 10.20 ? 573 LYS B C    1 
ATOM   10778 O  O    . LYS B 1 542 ? 71.613  4.720   -22.642 1.00 8.93