data_1CXW
# 
_entry.id   1CXW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1CXW         
RCSB  RCSB009614   
WWPDB D_1000009614 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1CXW 
_pdbx_database_status.recvd_initial_deposition_date   1999-08-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Briknarova, K.' 1 
'Grishaev, A.'   2 
'Banyai, L.'     3 
'Tordai, H.'     4 
'Patthy, L.'     5 
'Llinas, M.'     6 
# 
_citation.id                        primary 
_citation.title                     
'The second type II module from human matrix metalloproteinase 2: structure, function and dynamics.' 
_citation.journal_abbrev            'Structure Fold.Des.' 
_citation.journal_volume            7 
_citation.page_first                1235 
_citation.page_last                 1245 
_citation.year                      1999 
_citation.journal_id_ASTM           FODEFH 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            1263 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10545322 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(00)80057-X' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Briknarova, K.' 1 
primary 'Grishaev, A.'   2 
primary 'Banyai, L.'     3 
primary 'Tordai, H.'     4 
primary 'Patthy, L.'     5 
primary 'Llinas, M.'     6 
# 
_cell.entry_id           1CXW 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1CXW 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'HUMAN MATRIX METALLOPROTEINASE 2' 
_entity.formula_weight             6773.364 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.4.24.24 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'THE SECOND TYPE II MODULE' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        COL-2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       TALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETA 
_entity_poly.pdbx_seq_one_letter_code_can   TALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  THR n 
1 2  ALA n 
1 3  LEU n 
1 4  PHE n 
1 5  THR n 
1 6  MET n 
1 7  GLY n 
1 8  GLY n 
1 9  ASN n 
1 10 ALA n 
1 11 GLU n 
1 12 GLY n 
1 13 GLN n 
1 14 PRO n 
1 15 CYS n 
1 16 LYS n 
1 17 PHE n 
1 18 PRO n 
1 19 PHE n 
1 20 ARG n 
1 21 PHE n 
1 22 GLN n 
1 23 GLY n 
1 24 THR n 
1 25 SER n 
1 26 TYR n 
1 27 ASP n 
1 28 SER n 
1 29 CYS n 
1 30 THR n 
1 31 THR n 
1 32 GLU n 
1 33 GLY n 
1 34 ARG n 
1 35 THR n 
1 36 ASP n 
1 37 GLY n 
1 38 TYR n 
1 39 ARG n 
1 40 TRP n 
1 41 CYS n 
1 42 GLY n 
1 43 THR n 
1 44 THR n 
1 45 GLU n 
1 46 ASP n 
1 47 TYR n 
1 48 ASP n 
1 49 ARG n 
1 50 ASP n 
1 51 LYS n 
1 52 LYS n 
1 53 TYR n 
1 54 GLY n 
1 55 PHE n 
1 56 CYS n 
1 57 PRO n 
1 58 GLU n 
1 59 THR n 
1 60 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               PLASMID 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PMED23 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MMP2_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P08253 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1CXW 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 60 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P08253 
_struct_ref_seq.db_align_beg                  278 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  336 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       60 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1CXW 
_struct_ref_seq_dif.mon_id                       THR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P08253 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'EXPRESSION ARTIFACT' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '2D NOESY' 1 
2 2 '2D NOESY' 2 
3 2 E-COSY     2 
4 1 HNHA       4 
5 1 HNHB       4 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 298 1 5.2 0 atm K 
2 298 1 5.1 0 atm K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1.3MM COL-2 NA; 90% H2O, 10% D2O'  ? 
2 '1.3MM COL-2 NA; D2O'               ? 
3 '1MM COL-2 U-15N; 90% H2O, 10% D2O' ? 
4 '4MM COL-2 U-15N; 90% H2O, 10% D2O' ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 Avance Bruker 500 ? 
2 Avance Bruker 600 ? 
# 
_pdbx_nmr_refine.entry_id           1CXW 
_pdbx_nmr_refine.method             'DISTANCE GEOMETRY AND SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1CXW 
_pdbx_nmr_ensemble.conformers_calculated_total_number            50 
_pdbx_nmr_ensemble.conformers_submitted_total_number             50 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'all calculated structures submitted' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1CXW 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'fewest violations,lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' XWINNMR 2.0   'BRUKER, GERMANY'                            1 
'structure solution' FELIX   95    'MOLECULAR SIMULATIONS, INC., SAN DIEGO, CA' 2 
'structure solution' X-PLOR  3.851 BRUNGER                                      3 
refinement           QUANTA  96    'MOLECULAR SIMULATIONS, INC., SAN DIEGO, CA' 4 
# 
_exptl.entry_id          1CXW 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1CXW 
_struct.title                     'THE SECOND TYPE II MODULE FROM HUMAN MATRIX METALLOPROTEINASE 2' 
_struct.pdbx_descriptor           'HUMAN MATRIX METALLOPROTEINASE 2 (E.C.3.4.24.24)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1CXW 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'BETA SHEET, ALPHA HELIX, HYDROLASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASP 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        46 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LYS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        51 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASP 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         46 
_struct_conf.end_auth_comp_id        LYS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         51 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 41 SG ? ? A CYS 15 A CYS 41 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 56 SG ? ? A CYS 29 A CYS 56 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 1  -18.28 
2  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 2  -10.83 
3  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 3  -7.36  
4  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 4  -8.97  
5  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 5  -6.46  
6  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 6  -7.81  
7  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 7  -12.14 
8  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 8  -8.95  
9  PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 9  -7.39  
10 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 10 -5.69  
11 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 11 -12.56 
12 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 12 -14.54 
13 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 13 -4.29  
14 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 14 -4.48  
15 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 15 -7.78  
16 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 16 -16.83 
17 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 17 -8.29  
18 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 18 -18.20 
19 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 19 -8.05  
20 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 20 -12.58 
21 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 21 -19.03 
22 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 22 -10.52 
23 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 23 -11.07 
24 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 24 -14.09 
25 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 25 -9.94  
26 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 26 -8.91  
27 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 27 -18.66 
28 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 28 -11.67 
29 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 29 -10.10 
30 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 30 -9.85  
31 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 31 -7.07  
32 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 32 -7.18  
33 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 33 -7.39  
34 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 34 -9.41  
35 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 35 -8.07  
36 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 36 -10.85 
37 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 37 -18.09 
38 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 38 -8.93  
39 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 39 -12.65 
40 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 40 -29.22 
41 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 41 -11.83 
42 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 42 -12.96 
43 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 43 -9.97  
44 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 44 -8.29  
45 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 45 -6.31  
46 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 46 -11.48 
47 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 47 -13.68 
48 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 48 -11.42 
49 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 49 -12.28 
50 PHE 17 A . ? PHE 17 A PRO 18 A ? PRO 18 A 50 -2.57  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 19 ? PHE A 21 ? PHE A 19 PHE A 21 
A 2 THR A 24 ? TYR A 26 ? THR A 24 TYR A 26 
B 1 ARG A 39 ? GLY A 42 ? ARG A 39 GLY A 42 
B 2 TYR A 53 ? CYS A 56 ? TYR A 53 CYS A 56 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 21 ? N PHE A 21 O THR A 24 ? O THR A 24 
B 1 2 O CYS A 41 ? O CYS A 41 N GLY A 54 ? N GLY A 54 
# 
_database_PDB_matrix.entry_id          1CXW 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1CXW 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . THR A 1 1  ? 11.029  2.109   9.997   1.00 0.00 ? 1  THR A N    1  
ATOM 2     C CA   . THR A 1 1  ? 11.418  3.063   8.970   1.00 0.00 ? 1  THR A CA   1  
ATOM 3     C C    . THR A 1 1  ? 10.144  3.835   8.716   1.00 0.00 ? 1  THR A C    1  
ATOM 4     O O    . THR A 1 1  ? 9.086   3.344   9.090   1.00 0.00 ? 1  THR A O    1  
ATOM 5     C CB   . THR A 1 1  ? 11.882  2.401   7.647   1.00 0.00 ? 1  THR A CB   1  
ATOM 6     O OG1  . THR A 1 1  ? 12.018  3.348   6.602   1.00 0.00 ? 1  THR A OG1  1  
ATOM 7     C CG2  . THR A 1 1  ? 11.003  1.214   7.201   1.00 0.00 ? 1  THR A CG2  1  
ATOM 8     H H1   . THR A 1 1  ? 11.839  1.523   10.247  1.00 0.00 ? 1  THR A H1   1  
ATOM 9     H H2   . THR A 1 1  ? 10.703  2.616   10.832  1.00 0.00 ? 1  THR A H2   1  
ATOM 10    H H3   . THR A 1 1  ? 10.270  1.511   9.641   1.00 0.00 ? 1  THR A H3   1  
ATOM 11    H HA   . THR A 1 1  ? 12.186  3.723   9.374   1.00 0.00 ? 1  THR A HA   1  
ATOM 12    H HB   . THR A 1 1  ? 12.887  2.006   7.810   1.00 0.00 ? 1  THR A HB   1  
ATOM 13    H HG1  . THR A 1 1  ? 11.157  3.564   6.229   1.00 0.00 ? 1  THR A HG1  1  
ATOM 14    H HG21 . THR A 1 1  ? 11.354  0.817   6.248   1.00 0.00 ? 1  THR A HG21 1  
ATOM 15    H HG22 . THR A 1 1  ? 11.038  0.395   7.918   1.00 0.00 ? 1  THR A HG22 1  
ATOM 16    H HG23 . THR A 1 1  ? 9.956   1.494   7.072   1.00 0.00 ? 1  THR A HG23 1  
ATOM 17    N N    . ALA A 1 2  ? 10.306  4.991   8.052   1.00 0.00 ? 2  ALA A N    1  
ATOM 18    C CA   . ALA A 1 2  ? 9.152   5.732   7.579   1.00 0.00 ? 2  ALA A CA   1  
ATOM 19    C C    . ALA A 1 2  ? 8.793   5.072   6.239   1.00 0.00 ? 2  ALA A C    1  
ATOM 20    O O    . ALA A 1 2  ? 9.488   4.161   5.794   1.00 0.00 ? 2  ALA A O    1  
ATOM 21    C CB   . ALA A 1 2  ? 9.508   7.214   7.430   1.00 0.00 ? 2  ALA A CB   1  
ATOM 22    H H    . ALA A 1 2  ? 11.227  5.271   7.779   1.00 0.00 ? 2  ALA A H    1  
ATOM 23    H HA   . ALA A 1 2  ? 8.328   5.599   8.284   1.00 0.00 ? 2  ALA A HA   1  
ATOM 24    H HB1  . ALA A 1 2  ? 10.375  7.349   6.788   1.00 0.00 ? 2  ALA A HB1  1  
ATOM 25    H HB2  . ALA A 1 2  ? 8.683   7.788   7.006   1.00 0.00 ? 2  ALA A HB2  1  
ATOM 26    H HB3  . ALA A 1 2  ? 9.747   7.652   8.400   1.00 0.00 ? 2  ALA A HB3  1  
ATOM 27    N N    . LEU A 1 3  ? 7.680   5.553   5.660   1.00 0.00 ? 3  LEU A N    1  
ATOM 28    C CA   . LEU A 1 3  ? 7.165   4.995   4.420   1.00 0.00 ? 3  LEU A CA   1  
ATOM 29    C C    . LEU A 1 3  ? 7.338   6.056   3.320   1.00 0.00 ? 3  LEU A C    1  
ATOM 30    O O    . LEU A 1 3  ? 7.076   7.234   3.523   1.00 0.00 ? 3  LEU A O    1  
ATOM 31    C CB   . LEU A 1 3  ? 5.678   4.604   4.569   1.00 0.00 ? 3  LEU A CB   1  
ATOM 32    C CG   . LEU A 1 3  ? 5.380   3.398   5.494   1.00 0.00 ? 3  LEU A CG   1  
ATOM 33    C CD1  . LEU A 1 3  ? 5.945   2.077   4.972   1.00 0.00 ? 3  LEU A CD1  1  
ATOM 34    C CD2  . LEU A 1 3  ? 5.748   3.609   6.968   1.00 0.00 ? 3  LEU A CD2  1  
ATOM 35    H H    . LEU A 1 3  ? 7.197   6.320   6.070   1.00 0.00 ? 3  LEU A H    1  
ATOM 36    H HA   . LEU A 1 3  ? 7.753   4.115   4.150   1.00 0.00 ? 3  LEU A HA   1  
ATOM 37    H HB2  . LEU A 1 3  ? 5.075   5.466   4.973   1.00 0.00 ? 3  LEU A HB2  1  
ATOM 38    H HB3  . LEU A 1 3  ? 5.402   4.273   3.538   1.00 0.00 ? 3  LEU A HB3  1  
ATOM 39    H HG   . LEU A 1 3  ? 4.300   3.269   5.477   1.00 0.00 ? 3  LEU A HG   1  
ATOM 40    H HD11 . LEU A 1 3  ? 5.632   1.892   3.945   1.00 0.00 ? 3  LEU A HD11 1  
ATOM 41    H HD12 . LEU A 1 3  ? 7.032   2.074   5.010   1.00 0.00 ? 3  LEU A HD12 1  
ATOM 42    H HD13 . LEU A 1 3  ? 5.576   1.246   5.575   1.00 0.00 ? 3  LEU A HD13 1  
ATOM 43    H HD21 . LEU A 1 3  ? 5.426   4.586   7.327   1.00 0.00 ? 3  LEU A HD21 1  
ATOM 44    H HD22 . LEU A 1 3  ? 5.270   2.852   7.591   1.00 0.00 ? 3  LEU A HD22 1  
ATOM 45    H HD23 . LEU A 1 3  ? 6.820   3.512   7.134   1.00 0.00 ? 3  LEU A HD23 1  
ATOM 46    N N    . PHE A 1 4  ? 7.820   5.549   2.172   1.00 0.00 ? 4  PHE A N    1  
ATOM 47    C CA   . PHE A 1 4  ? 8.125   6.302   0.959   1.00 0.00 ? 4  PHE A CA   1  
ATOM 48    C C    . PHE A 1 4  ? 7.538   5.420   -0.165  1.00 0.00 ? 4  PHE A C    1  
ATOM 49    O O    . PHE A 1 4  ? 7.085   4.327   0.145   1.00 0.00 ? 4  PHE A O    1  
ATOM 50    C CB   . PHE A 1 4  ? 9.670   6.431   0.886   1.00 0.00 ? 4  PHE A CB   1  
ATOM 51    C CG   . PHE A 1 4  ? 10.273  7.031   2.129   1.00 0.00 ? 4  PHE A CG   1  
ATOM 52    C CD1  . PHE A 1 4  ? 10.173  8.397   2.370   1.00 0.00 ? 4  PHE A CD1  1  
ATOM 53    C CD2  . PHE A 1 4  ? 10.951  6.231   3.047   1.00 0.00 ? 4  PHE A CD2  1  
ATOM 54    C CE1  . PHE A 1 4  ? 10.754  8.960   3.499   1.00 0.00 ? 4  PHE A CE1  1  
ATOM 55    C CE2  . PHE A 1 4  ? 11.533  6.790   4.176   1.00 0.00 ? 4  PHE A CE2  1  
ATOM 56    C CZ   . PHE A 1 4  ? 11.439  8.157   4.400   1.00 0.00 ? 4  PHE A CZ   1  
ATOM 57    H H    . PHE A 1 4  ? 7.961   4.563   2.086   1.00 0.00 ? 4  PHE A H    1  
ATOM 58    H HA   . PHE A 1 4  ? 7.612   7.265   1.012   1.00 0.00 ? 4  PHE A HA   1  
ATOM 59    H HB2  . PHE A 1 4  ? 10.106  5.434   0.760   1.00 0.00 ? 4  PHE A HB2  1  
ATOM 60    H HB3  . PHE A 1 4  ? 10.016  7.053   0.055   1.00 0.00 ? 4  PHE A HB3  1  
ATOM 61    H HD1  . PHE A 1 4  ? 9.641   9.030   1.674   1.00 0.00 ? 4  PHE A HD1  1  
ATOM 62    H HD2  . PHE A 1 4  ? 11.033  5.166   2.886   1.00 0.00 ? 4  PHE A HD2  1  
ATOM 63    H HE1  . PHE A 1 4  ? 10.673  10.022  3.675   1.00 0.00 ? 4  PHE A HE1  1  
ATOM 64    H HE2  . PHE A 1 4  ? 12.059  6.158   4.878   1.00 0.00 ? 4  PHE A HE2  1  
ATOM 65    H HZ   . PHE A 1 4  ? 11.896  8.596   5.275   1.00 0.00 ? 4  PHE A HZ   1  
ATOM 66    N N    . THR A 1 5  ? 7.572   5.839   -1.454  1.00 0.00 ? 5  THR A N    1  
ATOM 67    C CA   . THR A 1 5  ? 6.995   4.945   -2.455  1.00 0.00 ? 5  THR A CA   1  
ATOM 68    C C    . THR A 1 5  ? 8.012   3.856   -2.827  1.00 0.00 ? 5  THR A C    1  
ATOM 69    O O    . THR A 1 5  ? 7.705   2.669   -2.863  1.00 0.00 ? 5  THR A O    1  
ATOM 70    C CB   . THR A 1 5  ? 6.680   5.769   -3.713  1.00 0.00 ? 5  THR A CB   1  
ATOM 71    O OG1  . THR A 1 5  ? 7.853   6.523   -4.013  1.00 0.00 ? 5  THR A OG1  1  
ATOM 72    C CG2  . THR A 1 5  ? 5.494   6.725   -3.513  1.00 0.00 ? 5  THR A CG2  1  
ATOM 73    H H    . THR A 1 5  ? 7.869   6.714   -1.838  1.00 0.00 ? 5  THR A H    1  
ATOM 74    H HA   . THR A 1 5  ? 6.103   4.476   -2.059  1.00 0.00 ? 5  THR A HA   1  
ATOM 75    H HB   . THR A 1 5  ? 6.438   5.051   -4.507  1.00 0.00 ? 5  THR A HB   1  
ATOM 76    H HG1  . THR A 1 5  ? 7.863   6.818   -4.923  1.00 0.00 ? 5  THR A HG1  1  
ATOM 77    H HG21 . THR A 1 5  ? 5.734   7.496   -2.781  1.00 0.00 ? 5  THR A HG21 1  
ATOM 78    H HG22 . THR A 1 5  ? 5.207   7.222   -4.440  1.00 0.00 ? 5  THR A HG22 1  
ATOM 79    H HG23 . THR A 1 5  ? 4.604   6.204   -3.155  1.00 0.00 ? 5  THR A HG23 1  
ATOM 80    N N    . MET A 1 6  ? 9.225   4.382   -3.079  1.00 0.00 ? 6  MET A N    1  
ATOM 81    C CA   . MET A 1 6  ? 10.461  3.675   -3.432  1.00 0.00 ? 6  MET A CA   1  
ATOM 82    C C    . MET A 1 6  ? 10.191  2.325   -4.136  1.00 0.00 ? 6  MET A C    1  
ATOM 83    O O    . MET A 1 6  ? 10.375  1.246   -3.591  1.00 0.00 ? 6  MET A O    1  
ATOM 84    C CB   . MET A 1 6  ? 11.386  3.558   -2.201  1.00 0.00 ? 6  MET A CB   1  
ATOM 85    C CG   . MET A 1 6  ? 10.678  3.100   -0.920  1.00 0.00 ? 6  MET A CG   1  
ATOM 86    S SD   . MET A 1 6  ? 11.809  2.978   0.476   1.00 0.00 ? 6  MET A SD   1  
ATOM 87    C CE   . MET A 1 6  ? 10.609  2.493   1.731   1.00 0.00 ? 6  MET A CE   1  
ATOM 88    H H    . MET A 1 6  ? 9.152   5.378   -3.009  1.00 0.00 ? 6  MET A H    1  
ATOM 89    H HA   . MET A 1 6  ? 10.947  4.320   -4.165  1.00 0.00 ? 6  MET A HA   1  
ATOM 90    H HB2  . MET A 1 6  ? 12.218  2.887   -2.419  1.00 0.00 ? 6  MET A HB2  1  
ATOM 91    H HB3  . MET A 1 6  ? 11.833  4.534   -2.008  1.00 0.00 ? 6  MET A HB3  1  
ATOM 92    H HG2  . MET A 1 6  ? 9.890   3.799   -0.646  1.00 0.00 ? 6  MET A HG2  1  
ATOM 93    H HG3  . MET A 1 6  ? 10.202  2.133   -1.067  1.00 0.00 ? 6  MET A HG3  1  
ATOM 94    H HE1  . MET A 1 6  ? 9.765   3.182   1.730   1.00 0.00 ? 6  MET A HE1  1  
ATOM 95    H HE2  . MET A 1 6  ? 10.222  1.496   1.517   1.00 0.00 ? 6  MET A HE2  1  
ATOM 96    H HE3  . MET A 1 6  ? 11.064  2.505   2.722   1.00 0.00 ? 6  MET A HE3  1  
ATOM 97    N N    . GLY A 1 7  ? 9.722   2.497   -5.388  1.00 0.00 ? 7  GLY A N    1  
ATOM 98    C CA   . GLY A 1 7  ? 9.323   1.386   -6.251  1.00 0.00 ? 7  GLY A CA   1  
ATOM 99    C C    . GLY A 1 7  ? 7.841   1.562   -6.609  1.00 0.00 ? 7  GLY A C    1  
ATOM 100   O O    . GLY A 1 7  ? 7.394   1.322   -7.722  1.00 0.00 ? 7  GLY A O    1  
ATOM 101   H H    . GLY A 1 7  ? 9.607   3.429   -5.730  1.00 0.00 ? 7  GLY A H    1  
ATOM 102   H HA2  . GLY A 1 7  ? 9.934   1.437   -7.154  1.00 0.00 ? 7  GLY A HA2  1  
ATOM 103   H HA3  . GLY A 1 7  ? 9.487   0.436   -5.737  1.00 0.00 ? 7  GLY A HA3  1  
ATOM 104   N N    . GLY A 1 8  ? 7.144   2.059   -5.569  1.00 0.00 ? 8  GLY A N    1  
ATOM 105   C CA   . GLY A 1 8  ? 5.732   2.424   -5.590  1.00 0.00 ? 8  GLY A CA   1  
ATOM 106   C C    . GLY A 1 8  ? 5.380   3.359   -6.749  1.00 0.00 ? 8  GLY A C    1  
ATOM 107   O O    . GLY A 1 8  ? 6.248   3.956   -7.372  1.00 0.00 ? 8  GLY A O    1  
ATOM 108   H H    . GLY A 1 8  ? 7.662   2.091   -4.714  1.00 0.00 ? 8  GLY A H    1  
ATOM 109   H HA2  . GLY A 1 8  ? 5.143   1.508   -5.625  1.00 0.00 ? 8  GLY A HA2  1  
ATOM 110   H HA3  . GLY A 1 8  ? 5.548   2.951   -4.662  1.00 0.00 ? 8  GLY A HA3  1  
ATOM 111   N N    . ASN A 1 9  ? 4.056   3.428   -7.005  1.00 0.00 ? 9  ASN A N    1  
ATOM 112   C CA   . ASN A 1 9  ? 3.573   4.184   -8.168  1.00 0.00 ? 9  ASN A CA   1  
ATOM 113   C C    . ASN A 1 9  ? 2.720   5.403   -7.776  1.00 0.00 ? 9  ASN A C    1  
ATOM 114   O O    . ASN A 1 9  ? 2.246   6.143   -8.634  1.00 0.00 ? 9  ASN A O    1  
ATOM 115   C CB   . ASN A 1 9  ? 2.793   3.230   -9.109  1.00 0.00 ? 9  ASN A CB   1  
ATOM 116   C CG   . ASN A 1 9  ? 1.438   2.763   -8.542  1.00 0.00 ? 9  ASN A CG   1  
ATOM 117   O OD1  . ASN A 1 9  ? 1.020   3.173   -7.472  1.00 0.00 ? 9  ASN A OD1  1  
ATOM 118   N ND2  . ASN A 1 9  ? 0.709   1.978   -9.344  1.00 0.00 ? 9  ASN A ND2  1  
ATOM 119   H H    . ASN A 1 9  ? 3.410   2.958   -6.391  1.00 0.00 ? 9  ASN A H    1  
ATOM 120   H HA   . ASN A 1 9  ? 4.441   4.573   -8.707  1.00 0.00 ? 9  ASN A HA   1  
ATOM 121   H HB2  . ASN A 1 9  ? 2.597   3.740   -10.052 1.00 0.00 ? 9  ASN A HB2  1  
ATOM 122   H HB3  . ASN A 1 9  ? 3.403   2.359   -9.353  1.00 0.00 ? 9  ASN A HB3  1  
ATOM 123   H HD21 . ASN A 1 9  ? 1.062   1.618   -10.212 1.00 0.00 ? 9  ASN A HD21 1  
ATOM 124   H HD22 . ASN A 1 9  ? -0.226  1.781   -9.023  1.00 0.00 ? 9  ASN A HD22 1  
ATOM 125   N N    . ALA A 1 10 ? 2.532   5.582   -6.458  1.00 0.00 ? 10 ALA A N    1  
ATOM 126   C CA   . ALA A 1 10 ? 1.669   6.650   -5.966  1.00 0.00 ? 10 ALA A CA   1  
ATOM 127   C C    . ALA A 1 10 ? 2.309   8.053   -5.938  1.00 0.00 ? 10 ALA A C    1  
ATOM 128   O O    . ALA A 1 10 ? 2.346   8.696   -4.900  1.00 0.00 ? 10 ALA A O    1  
ATOM 129   C CB   . ALA A 1 10 ? 1.218   6.264   -4.564  1.00 0.00 ? 10 ALA A CB   1  
ATOM 130   H H    . ALA A 1 10 ? 2.901   4.918   -5.805  1.00 0.00 ? 10 ALA A H    1  
ATOM 131   H HA   . ALA A 1 10 ? 0.799   6.679   -6.615  1.00 0.00 ? 10 ALA A HA   1  
ATOM 132   H HB1  . ALA A 1 10 ? 0.747   5.285   -4.590  1.00 0.00 ? 10 ALA A HB1  1  
ATOM 133   H HB2  . ALA A 1 10 ? 2.064   6.214   -3.879  1.00 0.00 ? 10 ALA A HB2  1  
ATOM 134   H HB3  . ALA A 1 10 ? 0.494   6.977   -4.166  1.00 0.00 ? 10 ALA A HB3  1  
ATOM 135   N N    . GLU A 1 11 ? 2.784   8.499   -7.118  1.00 0.00 ? 11 GLU A N    1  
ATOM 136   C CA   . GLU A 1 11 ? 3.328   9.846   -7.330  1.00 0.00 ? 11 GLU A CA   1  
ATOM 137   C C    . GLU A 1 11 ? 4.155   10.441  -6.146  1.00 0.00 ? 11 GLU A C    1  
ATOM 138   O O    . GLU A 1 11 ? 4.055   11.617  -5.822  1.00 0.00 ? 11 GLU A O    1  
ATOM 139   C CB   . GLU A 1 11 ? 2.231   10.805  -7.866  1.00 0.00 ? 11 GLU A CB   1  
ATOM 140   C CG   . GLU A 1 11 ? 0.791   10.569  -7.354  1.00 0.00 ? 11 GLU A CG   1  
ATOM 141   C CD   . GLU A 1 11 ? 0.083   9.378   -8.030  1.00 0.00 ? 11 GLU A CD   1  
ATOM 142   O OE1  . GLU A 1 11 ? 0.165   9.221   -9.249  1.00 0.00 ? 11 GLU A OE1  1  
ATOM 143   O OE2  . GLU A 1 11 ? -0.536  8.573   -7.337  1.00 0.00 ? 11 GLU A OE2  1  
ATOM 144   H H    . GLU A 1 11 ? 2.685   7.898   -7.912  1.00 0.00 ? 11 GLU A H    1  
ATOM 145   H HA   . GLU A 1 11 ? 4.044   9.717   -8.142  1.00 0.00 ? 11 GLU A HA   1  
ATOM 146   H HB2  . GLU A 1 11 ? 2.506   11.841  -7.656  1.00 0.00 ? 11 GLU A HB2  1  
ATOM 147   H HB3  . GLU A 1 11 ? 2.220   10.747  -8.955  1.00 0.00 ? 11 GLU A HB3  1  
ATOM 148   H HG2  . GLU A 1 11 ? 0.782   10.442  -6.271  1.00 0.00 ? 11 GLU A HG2  1  
ATOM 149   H HG3  . GLU A 1 11 ? 0.187   11.451  -7.562  1.00 0.00 ? 11 GLU A HG3  1  
ATOM 150   N N    . GLY A 1 12 ? 5.016   9.579   -5.557  1.00 0.00 ? 12 GLY A N    1  
ATOM 151   C CA   . GLY A 1 12 ? 5.941   10.030  -4.499  1.00 0.00 ? 12 GLY A CA   1  
ATOM 152   C C    . GLY A 1 12 ? 5.304   10.131  -3.095  1.00 0.00 ? 12 GLY A C    1  
ATOM 153   O O    . GLY A 1 12 ? 5.997   10.405  -2.123  1.00 0.00 ? 12 GLY A O    1  
ATOM 154   H H    . GLY A 1 12 ? 4.989   8.634   -5.884  1.00 0.00 ? 12 GLY A H    1  
ATOM 155   H HA2  . GLY A 1 12 ? 6.744   9.236   -4.420  1.00 0.00 ? 12 GLY A HA2  1  
ATOM 156   H HA3  . GLY A 1 12 ? 6.252   11.081  -4.777  1.00 0.00 ? 12 GLY A HA3  1  
ATOM 157   N N    . GLN A 1 13 ? 3.980   9.907   -3.012  1.00 0.00 ? 13 GLN A N    1  
ATOM 158   C CA   . GLN A 1 13 ? 3.307   9.988   -1.718  1.00 0.00 ? 13 GLN A CA   1  
ATOM 159   C C    . GLN A 1 13 ? 3.742   8.823   -0.792  1.00 0.00 ? 13 GLN A C    1  
ATOM 160   O O    . GLN A 1 13 ? 3.867   7.685   -1.226  1.00 0.00 ? 13 GLN A O    1  
ATOM 161   C CB   . GLN A 1 13 ? 1.776   9.959   -1.893  1.00 0.00 ? 13 GLN A CB   1  
ATOM 162   C CG   . GLN A 1 13 ? 1.197   11.225  -2.558  1.00 0.00 ? 13 GLN A CG   1  
ATOM 163   C CD   . GLN A 1 13 ? 1.339   12.439  -1.629  1.00 0.00 ? 13 GLN A CD   1  
ATOM 164   O OE1  . GLN A 1 13 ? 2.365   13.100  -1.581  1.00 0.00 ? 13 GLN A OE1  1  
ATOM 165   N NE2  . GLN A 1 13 ? 0.258   12.687  -0.881  1.00 0.00 ? 13 GLN A NE2  1  
ATOM 166   H H    . GLN A 1 13 ? 3.457   9.653   -3.824  1.00 0.00 ? 13 GLN A H    1  
ATOM 167   H HA   . GLN A 1 13 ? 3.620   10.931  -1.272  1.00 0.00 ? 13 GLN A HA   1  
ATOM 168   H HB2  . GLN A 1 13 ? 1.488   9.074   -2.462  1.00 0.00 ? 13 GLN A HB2  1  
ATOM 169   H HB3  . GLN A 1 13 ? 1.301   9.868   -0.913  1.00 0.00 ? 13 GLN A HB3  1  
ATOM 170   H HG2  . GLN A 1 13 ? 1.679   11.464  -3.505  1.00 0.00 ? 13 GLN A HG2  1  
ATOM 171   H HG3  . GLN A 1 13 ? 0.141   11.074  -2.784  1.00 0.00 ? 13 GLN A HG3  1  
ATOM 172   H HE21 . GLN A 1 13 ? -0.566  12.127  -0.940  1.00 0.00 ? 13 GLN A HE21 1  
ATOM 173   H HE22 . GLN A 1 13 ? 0.303   13.460  -0.252  1.00 0.00 ? 13 GLN A HE22 1  
ATOM 174   N N    . PRO A 1 14 ? 3.940   9.140   0.518   1.00 0.00 ? 14 PRO A N    1  
ATOM 175   C CA   . PRO A 1 14 ? 4.203   8.117   1.527   1.00 0.00 ? 14 PRO A CA   1  
ATOM 176   C C    . PRO A 1 14 ? 2.914   7.315   1.782   1.00 0.00 ? 14 PRO A C    1  
ATOM 177   O O    . PRO A 1 14 ? 1.819   7.806   1.538   1.00 0.00 ? 14 PRO A O    1  
ATOM 178   C CB   . PRO A 1 14 ? 4.608   8.926   2.766   1.00 0.00 ? 14 PRO A CB   1  
ATOM 179   C CG   . PRO A 1 14 ? 3.900   10.275  2.606   1.00 0.00 ? 14 PRO A CG   1  
ATOM 180   C CD   . PRO A 1 14 ? 3.840   10.485  1.091   1.00 0.00 ? 14 PRO A CD   1  
ATOM 181   H HA   . PRO A 1 14 ? 5.001   7.445   1.206   1.00 0.00 ? 14 PRO A HA   1  
ATOM 182   H HB2  . PRO A 1 14 ? 4.364   8.430   3.711   1.00 0.00 ? 14 PRO A HB2  1  
ATOM 183   H HB3  . PRO A 1 14 ? 5.689   9.100   2.729   1.00 0.00 ? 14 PRO A HB3  1  
ATOM 184   H HG2  . PRO A 1 14 ? 2.845   10.138  2.967   1.00 0.00 ? 14 PRO A HG2  1  
ATOM 185   H HG3  . PRO A 1 14 ? 4.507   11.093  3.075   1.00 0.00 ? 14 PRO A HG3  1  
ATOM 186   H HD2  . PRO A 1 14 ? 2.909   10.978  0.804   1.00 0.00 ? 14 PRO A HD2  1  
ATOM 187   H HD3  . PRO A 1 14 ? 4.681   11.088  0.747   1.00 0.00 ? 14 PRO A HD3  1  
ATOM 188   N N    . CYS A 1 15 ? 3.108   6.071   2.272   1.00 0.00 ? 15 CYS A N    1  
ATOM 189   C CA   . CYS A 1 15 ? 1.981   5.178   2.571   1.00 0.00 ? 15 CYS A CA   1  
ATOM 190   C C    . CYS A 1 15 ? 0.865   5.884   3.353   1.00 0.00 ? 15 CYS A C    1  
ATOM 191   O O    . CYS A 1 15 ? 1.110   6.743   4.192   1.00 0.00 ? 15 CYS A O    1  
ATOM 192   C CB   . CYS A 1 15 ? 2.447   4.079   3.531   1.00 0.00 ? 15 CYS A CB   1  
ATOM 193   S SG   . CYS A 1 15 ? 3.496   2.814   2.782   1.00 0.00 ? 15 CYS A SG   1  
ATOM 194   H H    . CYS A 1 15 ? 4.044   5.761   2.436   1.00 0.00 ? 15 CYS A H    1  
ATOM 195   H HA   . CYS A 1 15 ? 1.570   4.776   1.642   1.00 0.00 ? 15 CYS A HA   1  
ATOM 196   H HB2  . CYS A 1 15 ? 2.966   4.534   4.372   1.00 0.00 ? 15 CYS A HB2  1  
ATOM 197   H HB3  . CYS A 1 15 ? 1.596   3.559   3.965   1.00 0.00 ? 15 CYS A HB3  1  
ATOM 198   N N    . LYS A 1 16 ? -0.366  5.427   3.045   1.00 0.00 ? 16 LYS A N    1  
ATOM 199   C CA   . LYS A 1 16 ? -1.539  5.939   3.725   1.00 0.00 ? 16 LYS A CA   1  
ATOM 200   C C    . LYS A 1 16 ? -2.117  4.802   4.563   1.00 0.00 ? 16 LYS A C    1  
ATOM 201   O O    . LYS A 1 16 ? -2.346  3.696   4.095   1.00 0.00 ? 16 LYS A O    1  
ATOM 202   C CB   . LYS A 1 16 ? -2.595  6.396   2.708   1.00 0.00 ? 16 LYS A CB   1  
ATOM 203   C CG   . LYS A 1 16 ? -3.753  7.231   3.330   1.00 0.00 ? 16 LYS A CG   1  
ATOM 204   C CD   . LYS A 1 16 ? -3.237  8.559   3.922   1.00 0.00 ? 16 LYS A CD   1  
ATOM 205   C CE   . LYS A 1 16 ? -2.980  8.634   5.438   1.00 0.00 ? 16 LYS A CE   1  
ATOM 206   N NZ   . LYS A 1 16 ? -4.151  8.355   6.273   1.00 0.00 ? 16 LYS A NZ   1  
ATOM 207   H H    . LYS A 1 16 ? -0.500  4.700   2.366   1.00 0.00 ? 16 LYS A H    1  
ATOM 208   H HA   . LYS A 1 16 ? -1.201  6.764   4.354   1.00 0.00 ? 16 LYS A HA   1  
ATOM 209   H HB2  . LYS A 1 16 ? -2.101  7.026   1.969   1.00 0.00 ? 16 LYS A HB2  1  
ATOM 210   H HB3  . LYS A 1 16 ? -2.927  5.503   2.160   1.00 0.00 ? 16 LYS A HB3  1  
ATOM 211   H HG2  . LYS A 1 16 ? -4.464  7.535   2.552   1.00 0.00 ? 16 LYS A HG2  1  
ATOM 212   H HG3  . LYS A 1 16 ? -4.370  6.660   4.031   1.00 0.00 ? 16 LYS A HG3  1  
ATOM 213   H HD2  . LYS A 1 16 ? -2.345  8.867   3.364   1.00 0.00 ? 16 LYS A HD2  1  
ATOM 214   H HD3  . LYS A 1 16 ? -3.981  9.316   3.716   1.00 0.00 ? 16 LYS A HD3  1  
ATOM 215   H HE2  . LYS A 1 16 ? -2.168  7.989   5.764   1.00 0.00 ? 16 LYS A HE2  1  
ATOM 216   H HE3  . LYS A 1 16 ? -2.657  9.650   5.676   1.00 0.00 ? 16 LYS A HE3  1  
ATOM 217   H HZ1  . LYS A 1 16 ? -5.000  8.841   5.922   1.00 0.00 ? 16 LYS A HZ1  1  
ATOM 218   H HZ2  . LYS A 1 16 ? -4.330  7.327   6.337   1.00 0.00 ? 16 LYS A HZ2  1  
ATOM 219   H HZ3  . LYS A 1 16 ? -3.964  8.639   7.256   1.00 0.00 ? 16 LYS A HZ3  1  
ATOM 220   N N    . PHE A 1 17 ? -2.332  5.165   5.830   1.00 0.00 ? 17 PHE A N    1  
ATOM 221   C CA   . PHE A 1 17 ? -2.916  4.256   6.801   1.00 0.00 ? 17 PHE A CA   1  
ATOM 222   C C    . PHE A 1 17 ? -4.075  5.054   7.431   1.00 0.00 ? 17 PHE A C    1  
ATOM 223   O O    . PHE A 1 17 ? -3.948  6.269   7.570   1.00 0.00 ? 17 PHE A O    1  
ATOM 224   C CB   . PHE A 1 17 ? -1.850  3.887   7.857   1.00 0.00 ? 17 PHE A CB   1  
ATOM 225   C CG   . PHE A 1 17 ? -0.658  3.141   7.295   1.00 0.00 ? 17 PHE A CG   1  
ATOM 226   C CD1  . PHE A 1 17 ? -0.815  1.908   6.671   1.00 0.00 ? 17 PHE A CD1  1  
ATOM 227   C CD2  . PHE A 1 17 ? 0.632   3.652   7.417   1.00 0.00 ? 17 PHE A CD2  1  
ATOM 228   C CE1  . PHE A 1 17 ? 0.281   1.196   6.207   1.00 0.00 ? 17 PHE A CE1  1  
ATOM 229   C CE2  . PHE A 1 17 ? 1.730   2.939   6.960   1.00 0.00 ? 17 PHE A CE2  1  
ATOM 230   C CZ   . PHE A 1 17 ? 1.562   1.699   6.362   1.00 0.00 ? 17 PHE A CZ   1  
ATOM 231   H H    . PHE A 1 17 ? -2.132  6.105   6.100   1.00 0.00 ? 17 PHE A H    1  
ATOM 232   H HA   . PHE A 1 17 ? -3.295  3.382   6.269   1.00 0.00 ? 17 PHE A HA   1  
ATOM 233   H HB2  . PHE A 1 17 ? -1.495  4.801   8.348   1.00 0.00 ? 17 PHE A HB2  1  
ATOM 234   H HB3  . PHE A 1 17 ? -2.284  3.241   8.629   1.00 0.00 ? 17 PHE A HB3  1  
ATOM 235   H HD1  . PHE A 1 17 ? -1.791  1.478   6.545   1.00 0.00 ? 17 PHE A HD1  1  
ATOM 236   H HD2  . PHE A 1 17 ? 0.814   4.606   7.877   1.00 0.00 ? 17 PHE A HD2  1  
ATOM 237   H HE1  . PHE A 1 17 ? 0.128   0.247   5.727   1.00 0.00 ? 17 PHE A HE1  1  
ATOM 238   H HE2  . PHE A 1 17 ? 2.712   3.364   7.083   1.00 0.00 ? 17 PHE A HE2  1  
ATOM 239   H HZ   . PHE A 1 17 ? 2.416   1.120   6.031   1.00 0.00 ? 17 PHE A HZ   1  
ATOM 240   N N    . PRO A 1 18 ? -5.212  4.390   7.773   1.00 0.00 ? 18 PRO A N    1  
ATOM 241   C CA   . PRO A 1 18 ? -5.614  3.076   7.280   1.00 0.00 ? 18 PRO A CA   1  
ATOM 242   C C    . PRO A 1 18 ? -6.095  3.215   5.822   1.00 0.00 ? 18 PRO A C    1  
ATOM 243   O O    . PRO A 1 18 ? -6.804  4.159   5.495   1.00 0.00 ? 18 PRO A O    1  
ATOM 244   C CB   . PRO A 1 18 ? -6.779  2.673   8.195   1.00 0.00 ? 18 PRO A CB   1  
ATOM 245   C CG   . PRO A 1 18 ? -7.392  4.007   8.634   1.00 0.00 ? 18 PRO A CG   1  
ATOM 246   C CD   . PRO A 1 18 ? -6.216  4.994   8.647   1.00 0.00 ? 18 PRO A CD   1  
ATOM 247   H HA   . PRO A 1 18 ? -4.797  2.371   7.358   1.00 0.00 ? 18 PRO A HA   1  
ATOM 248   H HB2  . PRO A 1 18 ? -7.501  1.988   7.740   1.00 0.00 ? 18 PRO A HB2  1  
ATOM 249   H HB3  . PRO A 1 18 ? -6.374  2.166   9.072   1.00 0.00 ? 18 PRO A HB3  1  
ATOM 250   H HG2  . PRO A 1 18 ? -8.125  4.328   7.893   1.00 0.00 ? 18 PRO A HG2  1  
ATOM 251   H HG3  . PRO A 1 18 ? -7.897  3.942   9.598   1.00 0.00 ? 18 PRO A HG3  1  
ATOM 252   H HD2  . PRO A 1 18 ? -6.515  5.982   8.286   1.00 0.00 ? 18 PRO A HD2  1  
ATOM 253   H HD3  . PRO A 1 18 ? -5.800  5.081   9.655   1.00 0.00 ? 18 PRO A HD3  1  
ATOM 254   N N    . PHE A 1 19 ? -5.670  2.257   4.977   1.00 0.00 ? 19 PHE A N    1  
ATOM 255   C CA   . PHE A 1 19 ? -6.103  2.246   3.580   1.00 0.00 ? 19 PHE A CA   1  
ATOM 256   C C    . PHE A 1 19 ? -7.063  1.058   3.423   1.00 0.00 ? 19 PHE A C    1  
ATOM 257   O O    . PHE A 1 19 ? -6.906  0.021   4.054   1.00 0.00 ? 19 PHE A O    1  
ATOM 258   C CB   . PHE A 1 19 ? -4.947  2.136   2.564   1.00 0.00 ? 19 PHE A CB   1  
ATOM 259   C CG   . PHE A 1 19 ? -4.138  0.837   2.674   1.00 0.00 ? 19 PHE A CG   1  
ATOM 260   C CD1  . PHE A 1 19 ? -3.166  0.580   3.663   1.00 0.00 ? 19 PHE A CD1  1  
ATOM 261   C CD2  . PHE A 1 19 ? -4.376  -0.158  1.714   1.00 0.00 ? 19 PHE A CD2  1  
ATOM 262   C CE1  . PHE A 1 19 ? -2.430  -0.598  3.645   1.00 0.00 ? 19 PHE A CE1  1  
ATOM 263   C CE2  . PHE A 1 19 ? -3.632  -1.360  1.710   1.00 0.00 ? 19 PHE A CE2  1  
ATOM 264   C CZ   . PHE A 1 19 ? -2.654  -1.557  2.670   1.00 0.00 ? 19 PHE A CZ   1  
ATOM 265   H H    . PHE A 1 19 ? -5.119  1.500   5.335   1.00 0.00 ? 19 PHE A H    1  
ATOM 266   H HA   . PHE A 1 19 ? -6.660  3.162   3.368   1.00 0.00 ? 19 PHE A HA   1  
ATOM 267   H HB2  . PHE A 1 19 ? -5.432  2.124   1.573   1.00 0.00 ? 19 PHE A HB2  1  
ATOM 268   H HB3  . PHE A 1 19 ? -4.343  3.067   2.555   1.00 0.00 ? 19 PHE A HB3  1  
ATOM 269   H HD1  . PHE A 1 19 ? -2.917  1.212   4.510   1.00 0.00 ? 19 PHE A HD1  1  
ATOM 270   H HD2  . PHE A 1 19 ? -5.171  0.096   1.004   1.00 0.00 ? 19 PHE A HD2  1  
ATOM 271   H HE1  . PHE A 1 19 ? -1.684  -0.767  4.411   1.00 0.00 ? 19 PHE A HE1  1  
ATOM 272   H HE2  . PHE A 1 19 ? -3.721  -2.206  1.018   1.00 0.00 ? 19 PHE A HE2  1  
ATOM 273   H HZ   . PHE A 1 19 ? -2.070  -2.469  2.651   1.00 0.00 ? 19 PHE A HZ   1  
ATOM 274   N N    . ARG A 1 20 ? -8.071  1.275   2.566   1.00 0.00 ? 20 ARG A N    1  
ATOM 275   C CA   . ARG A 1 20 ? -9.087  0.259   2.317   1.00 0.00 ? 20 ARG A CA   1  
ATOM 276   C C    . ARG A 1 20 ? -8.701  -0.509  1.039   1.00 0.00 ? 20 ARG A C    1  
ATOM 277   O O    . ARG A 1 20 ? -8.343  0.086   0.033   1.00 0.00 ? 20 ARG A O    1  
ATOM 278   C CB   . ARG A 1 20 ? -10.438 1.001   2.193   1.00 0.00 ? 20 ARG A CB   1  
ATOM 279   C CG   . ARG A 1 20 ? -11.662 0.187   1.747   1.00 0.00 ? 20 ARG A CG   1  
ATOM 280   C CD   . ARG A 1 20 ? -12.196 -0.801  2.824   1.00 0.00 ? 20 ARG A CD   1  
ATOM 281   N NE   . ARG A 1 20 ? -12.128 -0.229  4.192   1.00 0.00 ? 20 ARG A NE   1  
ATOM 282   C CZ   . ARG A 1 20 ? -12.969 0.745   4.602   1.00 0.00 ? 20 ARG A CZ   1  
ATOM 283   N NH1  . ARG A 1 20 ? -13.877 1.251   3.773   1.00 0.00 ? 20 ARG A NH1  1  
ATOM 284   N NH2  . ARG A 1 20 ? -12.868 1.192   5.849   1.00 0.00 ? 20 ARG A NH2  1  
ATOM 285   H H    . ARG A 1 20 ? -8.126  2.159   2.095   1.00 0.00 ? 20 ARG A H    1  
ATOM 286   H HA   . ARG A 1 20 ? -9.083  -0.425  3.168   1.00 0.00 ? 20 ARG A HA   1  
ATOM 287   H HB2  . ARG A 1 20 ? -10.650 1.526   3.124   1.00 0.00 ? 20 ARG A HB2  1  
ATOM 288   H HB3  . ARG A 1 20 ? -10.339 1.794   1.460   1.00 0.00 ? 20 ARG A HB3  1  
ATOM 289   H HG2  . ARG A 1 20 ? -12.452 0.905   1.526   1.00 0.00 ? 20 ARG A HG2  1  
ATOM 290   H HG3  . ARG A 1 20 ? -11.449 -0.250  0.756   1.00 0.00 ? 20 ARG A HG3  1  
ATOM 291   H HD2  . ARG A 1 20 ? -13.241 -1.108  2.632   1.00 0.00 ? 20 ARG A HD2  1  
ATOM 292   H HD3  . ARG A 1 20 ? -11.607 -1.719  2.827   1.00 0.00 ? 20 ARG A HD3  1  
ATOM 293   H HE   . ARG A 1 20 ? -11.455 -0.482  4.912   1.00 0.00 ? 20 ARG A HE   1  
ATOM 294   H HH11 . ARG A 1 20 ? -13.915 0.901   2.836   1.00 0.00 ? 20 ARG A HH11 1  
ATOM 295   H HH12 . ARG A 1 20 ? -14.515 1.967   4.051   1.00 0.00 ? 20 ARG A HH12 1  
ATOM 296   H HH21 . ARG A 1 20 ? -12.196 0.741   6.458   1.00 0.00 ? 20 ARG A HH21 1  
ATOM 297   H HH22 . ARG A 1 20 ? -13.425 1.939   6.207   1.00 0.00 ? 20 ARG A HH22 1  
ATOM 298   N N    . PHE A 1 21 ? -8.789  -1.847  1.138   1.00 0.00 ? 21 PHE A N    1  
ATOM 299   C CA   . PHE A 1 21 ? -8.504  -2.730  0.007   1.00 0.00 ? 21 PHE A CA   1  
ATOM 300   C C    . PHE A 1 21 ? -9.362  -3.984  0.236   1.00 0.00 ? 21 PHE A C    1  
ATOM 301   O O    . PHE A 1 21 ? -9.549  -4.415  1.362   1.00 0.00 ? 21 PHE A O    1  
ATOM 302   C CB   . PHE A 1 21 ? -7.000  -3.038  -0.021  1.00 0.00 ? 21 PHE A CB   1  
ATOM 303   C CG   . PHE A 1 21 ? -6.643  -4.202  -0.908  1.00 0.00 ? 21 PHE A CG   1  
ATOM 304   C CD1  . PHE A 1 21 ? -6.967  -4.200  -2.254  1.00 0.00 ? 21 PHE A CD1  1  
ATOM 305   C CD2  . PHE A 1 21 ? -5.970  -5.295  -0.389  1.00 0.00 ? 21 PHE A CD2  1  
ATOM 306   C CE1  . PHE A 1 21 ? -6.564  -5.232  -3.091  1.00 0.00 ? 21 PHE A CE1  1  
ATOM 307   C CE2  . PHE A 1 21 ? -5.573  -6.341  -1.209  1.00 0.00 ? 21 PHE A CE2  1  
ATOM 308   C CZ   . PHE A 1 21 ? -5.854  -6.305  -2.568  1.00 0.00 ? 21 PHE A CZ   1  
ATOM 309   H H    . PHE A 1 21 ? -9.042  -2.278  2.017   1.00 0.00 ? 21 PHE A H    1  
ATOM 310   H HA   . PHE A 1 21 ? -8.814  -2.274  -0.942  1.00 0.00 ? 21 PHE A HA   1  
ATOM 311   H HB2  . PHE A 1 21 ? -6.447  -2.156  -0.361  1.00 0.00 ? 21 PHE A HB2  1  
ATOM 312   H HB3  . PHE A 1 21 ? -6.660  -3.284  0.983   1.00 0.00 ? 21 PHE A HB3  1  
ATOM 313   H HD1  . PHE A 1 21 ? -7.573  -3.392  -2.621  1.00 0.00 ? 21 PHE A HD1  1  
ATOM 314   H HD2  . PHE A 1 21 ? -5.780  -5.330  0.670   1.00 0.00 ? 21 PHE A HD2  1  
ATOM 315   H HE1  . PHE A 1 21 ? -6.815  -5.204  -4.142  1.00 0.00 ? 21 PHE A HE1  1  
ATOM 316   H HE2  . PHE A 1 21 ? -5.061  -7.185  -0.774  1.00 0.00 ? 21 PHE A HE2  1  
ATOM 317   H HZ   . PHE A 1 21 ? -5.536  -7.117  -3.206  1.00 0.00 ? 21 PHE A HZ   1  
ATOM 318   N N    . GLN A 1 22 ? -9.911  -4.540  -0.849  1.00 0.00 ? 22 GLN A N    1  
ATOM 319   C CA   . GLN A 1 22 ? -10.810 -5.685  -0.756  1.00 0.00 ? 22 GLN A CA   1  
ATOM 320   C C    . GLN A 1 22 ? -11.943 -5.417  0.282   1.00 0.00 ? 22 GLN A C    1  
ATOM 321   O O    . GLN A 1 22 ? -12.354 -6.316  1.009   1.00 0.00 ? 22 GLN A O    1  
ATOM 322   C CB   . GLN A 1 22 ? -10.088 -7.015  -0.384  1.00 0.00 ? 22 GLN A CB   1  
ATOM 323   C CG   . GLN A 1 22 ? -8.971  -7.483  -1.349  1.00 0.00 ? 22 GLN A CG   1  
ATOM 324   C CD   . GLN A 1 22 ? -8.059  -8.572  -0.750  1.00 0.00 ? 22 GLN A CD   1  
ATOM 325   O OE1  . GLN A 1 22 ? -7.735  -9.542  -1.421  1.00 0.00 ? 22 GLN A OE1  1  
ATOM 326   N NE2  . GLN A 1 22 ? -7.650  -8.392  0.510   1.00 0.00 ? 22 GLN A NE2  1  
ATOM 327   H H    . GLN A 1 22 ? -9.763  -4.089  -1.734  1.00 0.00 ? 22 GLN A H    1  
ATOM 328   H HA   . GLN A 1 22 ? -11.243 -5.721  -1.753  1.00 0.00 ? 22 GLN A HA   1  
ATOM 329   H HB2  . GLN A 1 22 ? -9.691  -6.896  0.625   1.00 0.00 ? 22 GLN A HB2  1  
ATOM 330   H HB3  . GLN A 1 22 ? -10.820 -7.822  -0.325  1.00 0.00 ? 22 GLN A HB3  1  
ATOM 331   H HG2  . GLN A 1 22 ? -9.364  -7.996  -2.251  1.00 0.00 ? 22 GLN A HG2  1  
ATOM 332   H HG3  . GLN A 1 22 ? -8.367  -6.604  -1.612  1.00 0.00 ? 22 GLN A HG3  1  
ATOM 333   H HE21 . GLN A 1 22 ? -7.862  -7.628  1.126   1.00 0.00 ? 22 GLN A HE21 1  
ATOM 334   H HE22 . GLN A 1 22 ? -7.040  -9.080  0.915   1.00 0.00 ? 22 GLN A HE22 1  
ATOM 335   N N    . GLY A 1 23 ? -12.403 -4.143  0.362   1.00 0.00 ? 23 GLY A N    1  
ATOM 336   C CA   . GLY A 1 23 ? -13.473 -3.825  1.316   1.00 0.00 ? 23 GLY A CA   1  
ATOM 337   C C    . GLY A 1 23 ? -13.075 -3.992  2.805   1.00 0.00 ? 23 GLY A C    1  
ATOM 338   O O    . GLY A 1 23 ? -13.913 -3.920  3.693   1.00 0.00 ? 23 GLY A O    1  
ATOM 339   H H    . GLY A 1 23 ? -12.036 -3.410  -0.226  1.00 0.00 ? 23 GLY A H    1  
ATOM 340   H HA2  . GLY A 1 23 ? -13.784 -2.793  1.119   1.00 0.00 ? 23 GLY A HA2  1  
ATOM 341   H HA3  . GLY A 1 23 ? -14.310 -4.496  1.099   1.00 0.00 ? 23 GLY A HA3  1  
ATOM 342   N N    . THR A 1 24 ? -11.766 -4.211  3.024   1.00 0.00 ? 24 THR A N    1  
ATOM 343   C CA   . THR A 1 24 ? -11.168 -4.432  4.330   1.00 0.00 ? 24 THR A CA   1  
ATOM 344   C C    . THR A 1 24 ? -10.191 -3.272  4.605   1.00 0.00 ? 24 THR A C    1  
ATOM 345   O O    . THR A 1 24 ? -9.543  -2.786  3.690   1.00 0.00 ? 24 THR A O    1  
ATOM 346   C CB   . THR A 1 24 ? -10.440 -5.784  4.213   1.00 0.00 ? 24 THR A CB   1  
ATOM 347   O OG1  . THR A 1 24 ? -11.324 -6.760  3.680   1.00 0.00 ? 24 THR A OG1  1  
ATOM 348   C CG2  . THR A 1 24 ? -9.934  -6.296  5.565   1.00 0.00 ? 24 THR A CG2  1  
ATOM 349   H H    . THR A 1 24 ? -11.112 -4.240  2.269   1.00 0.00 ? 24 THR A H    1  
ATOM 350   H HA   . THR A 1 24 ? -11.956 -4.459  5.085   1.00 0.00 ? 24 THR A HA   1  
ATOM 351   H HB   . THR A 1 24 ? -9.574  -5.692  3.546   1.00 0.00 ? 24 THR A HB   1  
ATOM 352   H HG1  . THR A 1 24 ? -11.664 -6.488  2.822   1.00 0.00 ? 24 THR A HG1  1  
ATOM 353   H HG21 . THR A 1 24 ? -9.444  -7.262  5.448   1.00 0.00 ? 24 THR A HG21 1  
ATOM 354   H HG22 . THR A 1 24 ? -9.209  -5.611  6.006   1.00 0.00 ? 24 THR A HG22 1  
ATOM 355   H HG23 . THR A 1 24 ? -10.756 -6.422  6.270   1.00 0.00 ? 24 THR A HG23 1  
ATOM 356   N N    . SER A 1 25 ? -10.126 -2.811  5.873   1.00 0.00 ? 25 SER A N    1  
ATOM 357   C CA   . SER A 1 25 ? -9.226  -1.704  6.194   1.00 0.00 ? 25 SER A CA   1  
ATOM 358   C C    . SER A 1 25 ? -7.918  -2.267  6.772   1.00 0.00 ? 25 SER A C    1  
ATOM 359   O O    . SER A 1 25 ? -7.927  -3.171  7.598   1.00 0.00 ? 25 SER A O    1  
ATOM 360   C CB   . SER A 1 25 ? -9.913  -0.740  7.166   1.00 0.00 ? 25 SER A CB   1  
ATOM 361   O OG   . SER A 1 25 ? -11.297 -0.609  6.863   1.00 0.00 ? 25 SER A OG   1  
ATOM 362   H H    . SER A 1 25 ? -10.633 -3.231  6.620   1.00 0.00 ? 25 SER A H    1  
ATOM 363   H HA   . SER A 1 25 ? -9.003  -1.158  5.276   1.00 0.00 ? 25 SER A HA   1  
ATOM 364   H HB2  . SER A 1 25 ? -9.753  -1.006  8.218   1.00 0.00 ? 25 SER A HB2  1  
ATOM 365   H HB3  . SER A 1 25 ? -9.455  0.239   7.055   1.00 0.00 ? 25 SER A HB3  1  
ATOM 366   H HG   . SER A 1 25 ? -11.740 -1.429  7.088   1.00 0.00 ? 25 SER A HG   1  
ATOM 367   N N    . TYR A 1 26 ? -6.817  -1.690  6.267   1.00 0.00 ? 26 TYR A N    1  
ATOM 368   C CA   . TYR A 1 26 ? -5.461  -2.089  6.606   1.00 0.00 ? 26 TYR A CA   1  
ATOM 369   C C    . TYR A 1 26 ? -4.724  -0.890  7.199   1.00 0.00 ? 26 TYR A C    1  
ATOM 370   O O    . TYR A 1 26 ? -4.754  0.197   6.639   1.00 0.00 ? 26 TYR A O    1  
ATOM 371   C CB   . TYR A 1 26 ? -4.729  -2.439  5.308   1.00 0.00 ? 26 TYR A CB   1  
ATOM 372   C CG   . TYR A 1 26 ? -5.306  -3.638  4.619   1.00 0.00 ? 26 TYR A CG   1  
ATOM 373   C CD1  . TYR A 1 26 ? -6.398  -3.518  3.770   1.00 0.00 ? 26 TYR A CD1  1  
ATOM 374   C CD2  . TYR A 1 26 ? -4.737  -4.889  4.809   1.00 0.00 ? 26 TYR A CD2  1  
ATOM 375   C CE1  . TYR A 1 26 ? -6.895  -4.640  3.136   1.00 0.00 ? 26 TYR A CE1  1  
ATOM 376   C CE2  . TYR A 1 26 ? -5.244  -6.007  4.165   1.00 0.00 ? 26 TYR A CE2  1  
ATOM 377   C CZ   . TYR A 1 26 ? -6.340  -5.884  3.330   1.00 0.00 ? 26 TYR A CZ   1  
ATOM 378   O OH   . TYR A 1 26 ? -6.890  -6.965  2.673   1.00 0.00 ? 26 TYR A OH   1  
ATOM 379   H H    . TYR A 1 26 ? -6.902  -0.952  5.596   1.00 0.00 ? 26 TYR A H    1  
ATOM 380   H HA   . TYR A 1 26 ? -5.474  -2.922  7.311   1.00 0.00 ? 26 TYR A HA   1  
ATOM 381   H HB2  . TYR A 1 26 ? -4.802  -1.593  4.618   1.00 0.00 ? 26 TYR A HB2  1  
ATOM 382   H HB3  . TYR A 1 26 ? -3.672  -2.640  5.514   1.00 0.00 ? 26 TYR A HB3  1  
ATOM 383   H HD1  . TYR A 1 26 ? -6.876  -2.564  3.577   1.00 0.00 ? 26 TYR A HD1  1  
ATOM 384   H HD2  . TYR A 1 26 ? -3.888  -4.992  5.457   1.00 0.00 ? 26 TYR A HD2  1  
ATOM 385   H HE1  . TYR A 1 26 ? -7.698  -4.545  2.442   1.00 0.00 ? 26 TYR A HE1  1  
ATOM 386   H HE2  . TYR A 1 26 ? -4.766  -6.961  4.292   1.00 0.00 ? 26 TYR A HE2  1  
ATOM 387   H HH   . TYR A 1 26 ? -6.198  -7.607  2.475   1.00 0.00 ? 26 TYR A HH   1  
ATOM 388   N N    . ASP A 1 27 ? -4.043  -1.161  8.326   1.00 0.00 ? 27 ASP A N    1  
ATOM 389   C CA   . ASP A 1 27 ? -3.246  -0.140  9.004   1.00 0.00 ? 27 ASP A CA   1  
ATOM 390   C C    . ASP A 1 27 ? -1.782  -0.618  9.076   1.00 0.00 ? 27 ASP A C    1  
ATOM 391   O O    . ASP A 1 27 ? -1.027  -0.297  9.983   1.00 0.00 ? 27 ASP A O    1  
ATOM 392   C CB   . ASP A 1 27 ? -3.876  0.131   10.385  1.00 0.00 ? 27 ASP A CB   1  
ATOM 393   C CG   . ASP A 1 27 ? -3.615  1.569   10.864  1.00 0.00 ? 27 ASP A CG   1  
ATOM 394   O OD1  . ASP A 1 27 ? -4.033  2.498   10.173  1.00 0.00 ? 27 ASP A OD1  1  
ATOM 395   O OD2  . ASP A 1 27 ? -3.017  1.747   11.923  1.00 0.00 ? 27 ASP A OD2  1  
ATOM 396   H H    . ASP A 1 27 ? -4.072  -2.080  8.718   1.00 0.00 ? 27 ASP A H    1  
ATOM 397   H HA   . ASP A 1 27 ? -3.249  0.769   8.404   1.00 0.00 ? 27 ASP A HA   1  
ATOM 398   H HB2  . ASP A 1 27 ? -4.958  0.016   10.329  1.00 0.00 ? 27 ASP A HB2  1  
ATOM 399   H HB3  . ASP A 1 27 ? -3.525  -0.583  11.132  1.00 0.00 ? 27 ASP A HB3  1  
ATOM 400   N N    . SER A 1 28 ? -1.426  -1.433  8.060   1.00 0.00 ? 28 SER A N    1  
ATOM 401   C CA   . SER A 1 28 ? -0.089  -1.997  8.018   1.00 0.00 ? 28 SER A CA   1  
ATOM 402   C C    . SER A 1 28 ? 0.152   -2.566  6.609   1.00 0.00 ? 28 SER A C    1  
ATOM 403   O O    . SER A 1 28 ? -0.767  -2.747  5.818   1.00 0.00 ? 28 SER A O    1  
ATOM 404   C CB   . SER A 1 28 ? 0.006   -3.102  9.100   1.00 0.00 ? 28 SER A CB   1  
ATOM 405   O OG   . SER A 1 28 ? -1.066  -4.017  8.894   1.00 0.00 ? 28 SER A OG   1  
ATOM 406   H H    . SER A 1 28 ? -2.034  -1.717  7.318   1.00 0.00 ? 28 SER A H    1  
ATOM 407   H HA   . SER A 1 28 ? 0.628   -1.182  8.164   1.00 0.00 ? 28 SER A HA   1  
ATOM 408   H HB2  . SER A 1 28 ? 0.975   -3.634  9.010   1.00 0.00 ? 28 SER A HB2  1  
ATOM 409   H HB3  . SER A 1 28 ? -0.121  -2.652  10.109  1.00 0.00 ? 28 SER A HB3  1  
ATOM 410   H HG   . SER A 1 28 ? -1.039  -4.733  9.525   1.00 0.00 ? 28 SER A HG   1  
ATOM 411   N N    . CYS A 1 29 ? 1.449   -2.829  6.372   1.00 0.00 ? 29 CYS A N    1  
ATOM 412   C CA   . CYS A 1 29 ? 1.952   -3.410  5.130   1.00 0.00 ? 29 CYS A CA   1  
ATOM 413   C C    . CYS A 1 29 ? 1.296   -4.779  4.806   1.00 0.00 ? 29 CYS A C    1  
ATOM 414   O O    . CYS A 1 29 ? 1.217   -5.646  5.673   1.00 0.00 ? 29 CYS A O    1  
ATOM 415   C CB   . CYS A 1 29 ? 3.442   -3.647  5.379   1.00 0.00 ? 29 CYS A CB   1  
ATOM 416   S SG   . CYS A 1 29 ? 4.300   -2.146  5.908   1.00 0.00 ? 29 CYS A SG   1  
ATOM 417   H H    . CYS A 1 29 ? 2.127   -2.590  7.070   1.00 0.00 ? 29 CYS A H    1  
ATOM 418   H HA   . CYS A 1 29 ? 1.810   -2.683  4.329   1.00 0.00 ? 29 CYS A HA   1  
ATOM 419   H HB2  . CYS A 1 29 ? 3.575   -4.377  6.182   1.00 0.00 ? 29 CYS A HB2  1  
ATOM 420   H HB3  . CYS A 1 29 ? 3.919   -4.042  4.477   1.00 0.00 ? 29 CYS A HB3  1  
ATOM 421   N N    . THR A 1 30 ? 0.869   -4.959  3.532   1.00 0.00 ? 30 THR A N    1  
ATOM 422   C CA   . THR A 1 30 ? 0.287   -6.237  3.109   1.00 0.00 ? 30 THR A CA   1  
ATOM 423   C C    . THR A 1 30 ? 1.124   -6.815  1.956   1.00 0.00 ? 30 THR A C    1  
ATOM 424   O O    . THR A 1 30 ? 1.911   -6.123  1.327   1.00 0.00 ? 30 THR A O    1  
ATOM 425   C CB   . THR A 1 30 ? -1.196  -6.089  2.723   1.00 0.00 ? 30 THR A CB   1  
ATOM 426   O OG1  . THR A 1 30 ? -1.673  -7.399  2.450   1.00 0.00 ? 30 THR A OG1  1  
ATOM 427   C CG2  . THR A 1 30 ? -1.415  -5.182  1.494   1.00 0.00 ? 30 THR A CG2  1  
ATOM 428   H H    . THR A 1 30 ? 0.957   -4.254  2.820   1.00 0.00 ? 30 THR A H    1  
ATOM 429   H HA   . THR A 1 30 ? 0.342   -6.941  3.939   1.00 0.00 ? 30 THR A HA   1  
ATOM 430   H HB   . THR A 1 30 ? -1.717  -5.689  3.608   1.00 0.00 ? 30 THR A HB   1  
ATOM 431   H HG1  . THR A 1 30 ? -2.623  -7.377  2.288   1.00 0.00 ? 30 THR A HG1  1  
ATOM 432   H HG21 . THR A 1 30 ? -0.980  -5.633  0.601   1.00 0.00 ? 30 THR A HG21 1  
ATOM 433   H HG22 . THR A 1 30 ? -2.473  -5.014  1.284   1.00 0.00 ? 30 THR A HG22 1  
ATOM 434   H HG23 . THR A 1 30 ? -0.949  -4.204  1.614   1.00 0.00 ? 30 THR A HG23 1  
ATOM 435   N N    . THR A 1 31 ? 0.898   -8.125  1.739   1.00 0.00 ? 31 THR A N    1  
ATOM 436   C CA   . THR A 1 31 ? 1.555   -8.876  0.664   1.00 0.00 ? 31 THR A CA   1  
ATOM 437   C C    . THR A 1 31 ? 0.518   -9.400  -0.351  1.00 0.00 ? 31 THR A C    1  
ATOM 438   O O    . THR A 1 31 ? 0.851   -10.085 -1.310  1.00 0.00 ? 31 THR A O    1  
ATOM 439   C CB   . THR A 1 31 ? 2.380   -10.057 1.233   1.00 0.00 ? 31 THR A CB   1  
ATOM 440   O OG1  . THR A 1 31 ? 2.733   -9.794  2.590   1.00 0.00 ? 31 THR A OG1  1  
ATOM 441   C CG2  . THR A 1 31 ? 3.638   -10.287 0.384   1.00 0.00 ? 31 THR A CG2  1  
ATOM 442   H H    . THR A 1 31 ? 0.218   -8.536  2.346   1.00 0.00 ? 31 THR A H    1  
ATOM 443   H HA   . THR A 1 31 ? 2.205   -8.191  0.121   1.00 0.00 ? 31 THR A HA   1  
ATOM 444   H HB   . THR A 1 31 ? 1.785   -10.983 1.181   1.00 0.00 ? 31 THR A HB   1  
ATOM 445   H HG1  . THR A 1 31 ? 3.173   -10.563 2.955   1.00 0.00 ? 31 THR A HG1  1  
ATOM 446   H HG21 . THR A 1 31 ? 4.286   -9.412  0.392   1.00 0.00 ? 31 THR A HG21 1  
ATOM 447   H HG22 . THR A 1 31 ? 4.217   -11.143 0.728   1.00 0.00 ? 31 THR A HG22 1  
ATOM 448   H HG23 . THR A 1 31 ? 3.367   -10.477 -0.655  1.00 0.00 ? 31 THR A HG23 1  
ATOM 449   N N    . GLU A 1 32 ? -0.762  -9.078  -0.086  1.00 0.00 ? 32 GLU A N    1  
ATOM 450   C CA   . GLU A 1 32 ? -1.823  -9.587  -0.945  1.00 0.00 ? 32 GLU A CA   1  
ATOM 451   C C    . GLU A 1 32 ? -1.641  -9.105  -2.394  1.00 0.00 ? 32 GLU A C    1  
ATOM 452   O O    . GLU A 1 32 ? -1.598  -7.913  -2.670  1.00 0.00 ? 32 GLU A O    1  
ATOM 453   C CB   . GLU A 1 32 ? -3.156  -9.087  -0.390  1.00 0.00 ? 32 GLU A CB   1  
ATOM 454   C CG   . GLU A 1 32 ? -3.518  -9.743  0.956   1.00 0.00 ? 32 GLU A CG   1  
ATOM 455   C CD   . GLU A 1 32 ? -4.553  -8.897  1.701   1.00 0.00 ? 32 GLU A CD   1  
ATOM 456   O OE1  . GLU A 1 32 ? -4.358  -7.691  1.812   1.00 0.00 ? 32 GLU A OE1  1  
ATOM 457   O OE2  . GLU A 1 32 ? -5.555  -9.427  2.167   1.00 0.00 ? 32 GLU A OE2  1  
ATOM 458   H H    . GLU A 1 32 ? -1.030  -8.493  0.683   1.00 0.00 ? 32 GLU A H    1  
ATOM 459   H HA   . GLU A 1 32 ? -1.777  -10.677 -0.905  1.00 0.00 ? 32 GLU A HA   1  
ATOM 460   H HB2  . GLU A 1 32 ? -3.078  -8.003  -0.289  1.00 0.00 ? 32 GLU A HB2  1  
ATOM 461   H HB3  . GLU A 1 32 ? -3.969  -9.269  -1.094  1.00 0.00 ? 32 GLU A HB3  1  
ATOM 462   H HG2  . GLU A 1 32 ? -3.916  -10.745 0.791   1.00 0.00 ? 32 GLU A HG2  1  
ATOM 463   H HG3  . GLU A 1 32 ? -2.649  -9.858  1.604   1.00 0.00 ? 32 GLU A HG3  1  
ATOM 464   N N    . GLY A 1 33 ? -1.545  -10.104 -3.288  1.00 0.00 ? 33 GLY A N    1  
ATOM 465   C CA   . GLY A 1 33 ? -1.410  -9.811  -4.710  1.00 0.00 ? 33 GLY A CA   1  
ATOM 466   C C    . GLY A 1 33 ? 0.047   -9.762  -5.189  1.00 0.00 ? 33 GLY A C    1  
ATOM 467   O O    . GLY A 1 33 ? 0.288   -9.639  -6.383  1.00 0.00 ? 33 GLY A O    1  
ATOM 468   H H    . GLY A 1 33 ? -1.573  -11.050 -2.968  1.00 0.00 ? 33 GLY A H    1  
ATOM 469   H HA2  . GLY A 1 33 ? -1.925  -10.616 -5.240  1.00 0.00 ? 33 GLY A HA2  1  
ATOM 470   H HA3  . GLY A 1 33 ? -1.902  -8.859  -4.935  1.00 0.00 ? 33 GLY A HA3  1  
ATOM 471   N N    . ARG A 1 34 ? 1.001   -9.874  -4.240  1.00 0.00 ? 34 ARG A N    1  
ATOM 472   C CA   . ARG A 1 34 ? 2.409   -9.855  -4.683  1.00 0.00 ? 34 ARG A CA   1  
ATOM 473   C C    . ARG A 1 34 ? 3.066   -11.203 -4.370  1.00 0.00 ? 34 ARG A C    1  
ATOM 474   O O    . ARG A 1 34 ? 3.182   -11.621 -3.226  1.00 0.00 ? 34 ARG A O    1  
ATOM 475   C CB   . ARG A 1 34 ? 3.188   -8.756  -3.954  1.00 0.00 ? 34 ARG A CB   1  
ATOM 476   C CG   . ARG A 1 34 ? 2.660   -7.354  -4.306  1.00 0.00 ? 34 ARG A CG   1  
ATOM 477   C CD   . ARG A 1 34 ? 3.733   -6.254  -4.140  1.00 0.00 ? 34 ARG A CD   1  
ATOM 478   N NE   . ARG A 1 34 ? 4.608   -6.257  -5.327  1.00 0.00 ? 34 ARG A NE   1  
ATOM 479   C CZ   . ARG A 1 34 ? 4.520   -5.342  -6.325  1.00 0.00 ? 34 ARG A CZ   1  
ATOM 480   N NH1  . ARG A 1 34 ? 3.638   -4.349  -6.270  1.00 0.00 ? 34 ARG A NH1  1  
ATOM 481   N NH2  . ARG A 1 34 ? 5.324   -5.447  -7.374  1.00 0.00 ? 34 ARG A NH2  1  
ATOM 482   H H    . ARG A 1 34 ? 0.742   -9.972  -3.260  1.00 0.00 ? 34 ARG A H    1  
ATOM 483   H HA   . ARG A 1 34 ? 2.514   -9.671  -5.776  1.00 0.00 ? 34 ARG A HA   1  
ATOM 484   H HB2  . ARG A 1 34 ? 3.102   -8.916  -2.850  1.00 0.00 ? 34 ARG A HB2  1  
ATOM 485   H HB3  . ARG A 1 34 ? 4.230   -8.842  -4.331  1.00 0.00 ? 34 ARG A HB3  1  
ATOM 486   H HG2  . ARG A 1 34 ? 2.313   -7.340  -5.341  1.00 0.00 ? 34 ARG A HG2  1  
ATOM 487   H HG3  . ARG A 1 34 ? 1.759   -7.164  -3.718  1.00 0.00 ? 34 ARG A HG3  1  
ATOM 488   H HD2  . ARG A 1 34 ? 3.276   -5.263  -4.031  1.00 0.00 ? 34 ARG A HD2  1  
ATOM 489   H HD3  . ARG A 1 34 ? 4.373   -6.414  -3.259  1.00 0.00 ? 34 ARG A HD3  1  
ATOM 490   H HE   . ARG A 1 34 ? 5.283   -7.006  -5.456  1.00 0.00 ? 34 ARG A HE   1  
ATOM 491   H HH11 . ARG A 1 34 ? 3.001   -4.309  -5.503  1.00 0.00 ? 34 ARG A HH11 1  
ATOM 492   H HH12 . ARG A 1 34 ? 3.576   -3.620  -6.969  1.00 0.00 ? 34 ARG A HH12 1  
ATOM 493   H HH21 . ARG A 1 34 ? 5.951   -6.240  -7.412  1.00 0.00 ? 34 ARG A HH21 1  
ATOM 494   H HH22 . ARG A 1 34 ? 5.322   -4.788  -8.123  1.00 0.00 ? 34 ARG A HH22 1  
ATOM 495   N N    . THR A 1 35 ? 3.534   -11.816 -5.470  1.00 0.00 ? 35 THR A N    1  
ATOM 496   C CA   . THR A 1 35 ? 4.229   -13.096 -5.402  1.00 0.00 ? 35 THR A CA   1  
ATOM 497   C C    . THR A 1 35 ? 5.713   -12.887 -5.765  1.00 0.00 ? 35 THR A C    1  
ATOM 498   O O    . THR A 1 35 ? 6.412   -13.814 -6.150  1.00 0.00 ? 35 THR A O    1  
ATOM 499   C CB   . THR A 1 35 ? 3.541   -14.076 -6.374  1.00 0.00 ? 35 THR A CB   1  
ATOM 500   O OG1  . THR A 1 35 ? 2.152   -13.779 -6.359  1.00 0.00 ? 35 THR A OG1  1  
ATOM 501   C CG2  . THR A 1 35 ? 3.785   -15.543 -5.981  1.00 0.00 ? 35 THR A CG2  1  
ATOM 502   H H    . THR A 1 35 ? 3.359   -11.411 -6.366  1.00 0.00 ? 35 THR A H    1  
ATOM 503   H HA   . THR A 1 35 ? 4.169   -13.476 -4.381  1.00 0.00 ? 35 THR A HA   1  
ATOM 504   H HB   . THR A 1 35 ? 3.929   -13.897 -7.385  1.00 0.00 ? 35 THR A HB   1  
ATOM 505   H HG1  . THR A 1 35 ? 1.672   -14.367 -6.933  1.00 0.00 ? 35 THR A HG1  1  
ATOM 506   H HG21 . THR A 1 35 ? 3.352   -15.763 -5.005  1.00 0.00 ? 35 THR A HG21 1  
ATOM 507   H HG22 . THR A 1 35 ? 3.358   -16.239 -6.703  1.00 0.00 ? 35 THR A HG22 1  
ATOM 508   H HG23 . THR A 1 35 ? 4.852   -15.762 -5.923  1.00 0.00 ? 35 THR A HG23 1  
ATOM 509   N N    . ASP A 1 36 ? 6.144   -11.616 -5.613  1.00 0.00 ? 36 ASP A N    1  
ATOM 510   C CA   . ASP A 1 36 ? 7.512   -11.216 -5.934  1.00 0.00 ? 36 ASP A CA   1  
ATOM 511   C C    . ASP A 1 36 ? 8.348   -10.944 -4.664  1.00 0.00 ? 36 ASP A C    1  
ATOM 512   O O    . ASP A 1 36 ? 9.521   -10.603 -4.747  1.00 0.00 ? 36 ASP A O    1  
ATOM 513   C CB   . ASP A 1 36 ? 7.473   -9.982  -6.858  1.00 0.00 ? 36 ASP A CB   1  
ATOM 514   C CG   . ASP A 1 36 ? 6.769   -8.750  -6.262  1.00 0.00 ? 36 ASP A CG   1  
ATOM 515   O OD1  . ASP A 1 36 ? 6.464   -8.725  -5.072  1.00 0.00 ? 36 ASP A OD1  1  
ATOM 516   O OD2  . ASP A 1 36 ? 6.528   -7.799  -6.997  1.00 0.00 ? 36 ASP A OD2  1  
ATOM 517   H H    . ASP A 1 36 ? 5.534   -10.876 -5.322  1.00 0.00 ? 36 ASP A H    1  
ATOM 518   H HA   . ASP A 1 36 ? 8.003   -12.033 -6.465  1.00 0.00 ? 36 ASP A HA   1  
ATOM 519   H HB2  . ASP A 1 36 ? 8.486   -9.691  -7.137  1.00 0.00 ? 36 ASP A HB2  1  
ATOM 520   H HB3  . ASP A 1 36 ? 6.956   -10.242 -7.782  1.00 0.00 ? 36 ASP A HB3  1  
ATOM 521   N N    . GLY A 1 37 ? 7.702   -11.146 -3.492  1.00 0.00 ? 37 GLY A N    1  
ATOM 522   C CA   . GLY A 1 37 ? 8.401   -10.999 -2.220  1.00 0.00 ? 37 GLY A CA   1  
ATOM 523   C C    . GLY A 1 37 ? 8.123   -9.677  -1.502  1.00 0.00 ? 37 GLY A C    1  
ATOM 524   O O    . GLY A 1 37 ? 8.360   -9.564  -0.306  1.00 0.00 ? 37 GLY A O    1  
ATOM 525   H H    . GLY A 1 37 ? 6.743   -11.418 -3.477  1.00 0.00 ? 37 GLY A H    1  
ATOM 526   H HA2  . GLY A 1 37 ? 8.086   -11.830 -1.585  1.00 0.00 ? 37 GLY A HA2  1  
ATOM 527   H HA3  . GLY A 1 37 ? 9.482   -11.058 -2.394  1.00 0.00 ? 37 GLY A HA3  1  
ATOM 528   N N    . TYR A 1 38 ? 7.661   -8.677  -2.276  1.00 0.00 ? 38 TYR A N    1  
ATOM 529   C CA   . TYR A 1 38 ? 7.521   -7.340  -1.698  1.00 0.00 ? 38 TYR A CA   1  
ATOM 530   C C    . TYR A 1 38 ? 6.147   -7.122  -1.055  1.00 0.00 ? 38 TYR A C    1  
ATOM 531   O O    . TYR A 1 38 ? 5.158   -7.761  -1.394  1.00 0.00 ? 38 TYR A O    1  
ATOM 532   C CB   . TYR A 1 38 ? 7.881   -6.296  -2.767  1.00 0.00 ? 38 TYR A CB   1  
ATOM 533   C CG   . TYR A 1 38 ? 9.177   -6.695  -3.424  1.00 0.00 ? 38 TYR A CG   1  
ATOM 534   C CD1  . TYR A 1 38 ? 10.342  -6.840  -2.687  1.00 0.00 ? 38 TYR A CD1  1  
ATOM 535   C CD2  . TYR A 1 38 ? 9.233   -7.002  -4.772  1.00 0.00 ? 38 TYR A CD2  1  
ATOM 536   C CE1  . TYR A 1 38 ? 11.494  -7.330  -3.260  1.00 0.00 ? 38 TYR A CE1  1  
ATOM 537   C CE2  . TYR A 1 38 ? 10.381  -7.495  -5.349  1.00 0.00 ? 38 TYR A CE2  1  
ATOM 538   C CZ   . TYR A 1 38 ? 11.525  -7.676  -4.596  1.00 0.00 ? 38 TYR A CZ   1  
ATOM 539   O OH   . TYR A 1 38 ? 12.673  -8.200  -5.152  1.00 0.00 ? 38 TYR A OH   1  
ATOM 540   H H    . TYR A 1 38 ? 7.457   -8.817  -3.249  1.00 0.00 ? 38 TYR A H    1  
ATOM 541   H HA   . TYR A 1 38 ? 8.258   -7.264  -0.900  1.00 0.00 ? 38 TYR A HA   1  
ATOM 542   H HB2  . TYR A 1 38 ? 7.091   -6.224  -3.516  1.00 0.00 ? 38 TYR A HB2  1  
ATOM 543   H HB3  . TYR A 1 38 ? 7.989   -5.311  -2.315  1.00 0.00 ? 38 TYR A HB3  1  
ATOM 544   H HD1  . TYR A 1 38 ? 10.398  -6.604  -1.649  1.00 0.00 ? 38 TYR A HD1  1  
ATOM 545   H HD2  . TYR A 1 38 ? 8.395   -6.892  -5.419  1.00 0.00 ? 38 TYR A HD2  1  
ATOM 546   H HE1  . TYR A 1 38 ? 12.334  -7.446  -2.617  1.00 0.00 ? 38 TYR A HE1  1  
ATOM 547   H HE2  . TYR A 1 38 ? 10.306  -7.737  -6.383  1.00 0.00 ? 38 TYR A HE2  1  
ATOM 548   H HH   . TYR A 1 38 ? 12.449  -8.977  -5.647  1.00 0.00 ? 38 TYR A HH   1  
ATOM 549   N N    . ARG A 1 39 ? 6.169   -6.185  -0.088  1.00 0.00 ? 39 ARG A N    1  
ATOM 550   C CA   . ARG A 1 39 ? 4.938   -5.847  0.665   1.00 0.00 ? 39 ARG A CA   1  
ATOM 551   C C    . ARG A 1 39 ? 4.626   -4.377  0.346   1.00 0.00 ? 39 ARG A C    1  
ATOM 552   O O    . ARG A 1 39 ? 5.523   -3.548  0.273   1.00 0.00 ? 39 ARG A O    1  
ATOM 553   C CB   . ARG A 1 39 ? 5.205   -6.149  2.165   1.00 0.00 ? 39 ARG A CB   1  
ATOM 554   C CG   . ARG A 1 39 ? 5.242   -7.675  2.395   1.00 0.00 ? 39 ARG A CG   1  
ATOM 555   C CD   . ARG A 1 39 ? 5.712   -8.161  3.786   1.00 0.00 ? 39 ARG A CD   1  
ATOM 556   N NE   . ARG A 1 39 ? 5.088   -7.493  4.922   1.00 0.00 ? 39 ARG A NE   1  
ATOM 557   C CZ   . ARG A 1 39 ? 3.774   -7.443  5.224   1.00 0.00 ? 39 ARG A CZ   1  
ATOM 558   N NH1  . ARG A 1 39 ? 2.836   -7.951  4.436   1.00 0.00 ? 39 ARG A NH1  1  
ATOM 559   N NH2  . ARG A 1 39 ? 3.410   -6.868  6.359   1.00 0.00 ? 39 ARG A NH2  1  
ATOM 560   H H    . ARG A 1 39 ? 7.080   -5.736  0.059   1.00 0.00 ? 39 ARG A H    1  
ATOM 561   H HA   . ARG A 1 39 ? 4.046   -6.405  0.306   1.00 0.00 ? 39 ARG A HA   1  
ATOM 562   H HB2  . ARG A 1 39 ? 6.148   -5.694  2.472   1.00 0.00 ? 39 ARG A HB2  1  
ATOM 563   H HB3  . ARG A 1 39 ? 4.431   -5.736  2.815   1.00 0.00 ? 39 ARG A HB3  1  
ATOM 564   H HG2  . ARG A 1 39 ? 4.231   -8.056  2.240   1.00 0.00 ? 39 ARG A HG2  1  
ATOM 565   H HG3  . ARG A 1 39 ? 5.883   -8.125  1.620   1.00 0.00 ? 39 ARG A HG3  1  
ATOM 566   H HD2  . ARG A 1 39 ? 5.536   -9.230  3.931   1.00 0.00 ? 39 ARG A HD2  1  
ATOM 567   H HD3  . ARG A 1 39 ? 6.781   -7.996  3.925   1.00 0.00 ? 39 ARG A HD3  1  
ATOM 568   H HE   . ARG A 1 39 ? 5.686   -7.131  5.647   1.00 0.00 ? 39 ARG A HE   1  
ATOM 569   H HH11 . ARG A 1 39 ? 3.052   -8.459  3.589   1.00 0.00 ? 39 ARG A HH11 1  
ATOM 570   H HH12 . ARG A 1 39 ? 1.878   -7.844  4.695   1.00 0.00 ? 39 ARG A HH12 1  
ATOM 571   H HH21 . ARG A 1 39 ? 4.116   -6.684  7.072   1.00 0.00 ? 39 ARG A HH21 1  
ATOM 572   H HH22 . ARG A 1 39 ? 2.455   -6.597  6.527   1.00 0.00 ? 39 ARG A HH22 1  
ATOM 573   N N    . TRP A 1 40 ? 3.325   -4.111  0.088   1.00 0.00 ? 40 TRP A N    1  
ATOM 574   C CA   . TRP A 1 40 ? 2.867   -2.796  -0.341  1.00 0.00 ? 40 TRP A CA   1  
ATOM 575   C C    . TRP A 1 40 ? 1.823   -2.230  0.639   1.00 0.00 ? 40 TRP A C    1  
ATOM 576   O O    . TRP A 1 40 ? 1.255   -2.946  1.458   1.00 0.00 ? 40 TRP A O    1  
ATOM 577   C CB   . TRP A 1 40 ? 2.287   -2.914  -1.768  1.00 0.00 ? 40 TRP A CB   1  
ATOM 578   C CG   . TRP A 1 40 ? 1.017   -3.753  -1.816  1.00 0.00 ? 40 TRP A CG   1  
ATOM 579   C CD1  . TRP A 1 40 ? 0.963   -5.148  -1.915  1.00 0.00 ? 40 TRP A CD1  1  
ATOM 580   C CD2  . TRP A 1 40 ? -0.355  -3.301  -1.804  1.00 0.00 ? 40 TRP A CD2  1  
ATOM 581   N NE1  . TRP A 1 40 ? -0.326  -5.548  -1.973  1.00 0.00 ? 40 TRP A NE1  1  
ATOM 582   C CE2  . TRP A 1 40 ? -1.171  -4.452  -1.907  1.00 0.00 ? 40 TRP A CE2  1  
ATOM 583   C CE3  . TRP A 1 40 ? -0.946  -2.066  -1.715  1.00 0.00 ? 40 TRP A CE3  1  
ATOM 584   C CZ2  . TRP A 1 40 ? -2.529  -4.340  -1.921  1.00 0.00 ? 40 TRP A CZ2  1  
ATOM 585   C CZ3  . TRP A 1 40 ? -2.340  -1.941  -1.727  1.00 0.00 ? 40 TRP A CZ3  1  
ATOM 586   C CH2  . TRP A 1 40 ? -3.132  -3.086  -1.832  1.00 0.00 ? 40 TRP A CH2  1  
ATOM 587   H H    . TRP A 1 40 ? 2.622   -4.818  0.190   1.00 0.00 ? 40 TRP A H    1  
ATOM 588   H HA   . TRP A 1 40 ? 3.736   -2.142  -0.345  1.00 0.00 ? 40 TRP A HA   1  
ATOM 589   H HB2  . TRP A 1 40 ? 2.088   -1.934  -2.188  1.00 0.00 ? 40 TRP A HB2  1  
ATOM 590   H HB3  . TRP A 1 40 ? 3.026   -3.345  -2.441  1.00 0.00 ? 40 TRP A HB3  1  
ATOM 591   H HD1  . TRP A 1 40 ? 1.805   -5.818  -1.932  1.00 0.00 ? 40 TRP A HD1  1  
ATOM 592   H HE1  . TRP A 1 40 ? -0.640  -6.477  -2.066  1.00 0.00 ? 40 TRP A HE1  1  
ATOM 593   H HE3  . TRP A 1 40 ? -0.304  -1.204  -1.630  1.00 0.00 ? 40 TRP A HE3  1  
ATOM 594   H HZ2  . TRP A 1 40 ? -3.136  -5.230  -2.003  1.00 0.00 ? 40 TRP A HZ2  1  
ATOM 595   H HZ3  . TRP A 1 40 ? -2.828  -0.972  -1.657  1.00 0.00 ? 40 TRP A HZ3  1  
ATOM 596   H HH2  . TRP A 1 40 ? -4.210  -3.020  -1.846  1.00 0.00 ? 40 TRP A HH2  1  
ATOM 597   N N    . CYS A 1 41 ? 1.599   -0.909  0.483   1.00 0.00 ? 41 CYS A N    1  
ATOM 598   C CA   . CYS A 1 41 ? 0.596   -0.179  1.237   1.00 0.00 ? 41 CYS A CA   1  
ATOM 599   C C    . CYS A 1 41 ? -0.211  0.677   0.246   1.00 0.00 ? 41 CYS A C    1  
ATOM 600   O O    . CYS A 1 41 ? 0.315   1.113   -0.774  1.00 0.00 ? 41 CYS A O    1  
ATOM 601   C CB   . CYS A 1 41 ? 1.311   0.730   2.236   1.00 0.00 ? 41 CYS A CB   1  
ATOM 602   S SG   . CYS A 1 41 ? 2.304   1.979   1.362   1.00 0.00 ? 41 CYS A SG   1  
ATOM 603   H H    . CYS A 1 41 ? 2.091   -0.335  -0.177  1.00 0.00 ? 41 CYS A H    1  
ATOM 604   H HA   . CYS A 1 41 ? -0.053  -0.898  1.740   1.00 0.00 ? 41 CYS A HA   1  
ATOM 605   H HB2  . CYS A 1 41 ? 0.497   1.262   2.793   1.00 0.00 ? 41 CYS A HB2  1  
ATOM 606   H HB3  . CYS A 1 41 ? 2.009   0.097   2.848   1.00 0.00 ? 41 CYS A HB3  1  
ATOM 607   N N    . GLY A 1 42 ? -1.491  0.919   0.586   1.00 0.00 ? 42 GLY A N    1  
ATOM 608   C CA   . GLY A 1 42 ? -2.283  1.828   -0.235  1.00 0.00 ? 42 GLY A CA   1  
ATOM 609   C C    . GLY A 1 42 ? -1.826  3.259   0.081   1.00 0.00 ? 42 GLY A C    1  
ATOM 610   O O    . GLY A 1 42 ? -1.222  3.504   1.119   1.00 0.00 ? 42 GLY A O    1  
ATOM 611   H H    . GLY A 1 42 ? -1.904  0.542   1.416   1.00 0.00 ? 42 GLY A H    1  
ATOM 612   H HA2  . GLY A 1 42 ? -2.150  1.572   -1.289  1.00 0.00 ? 42 GLY A HA2  1  
ATOM 613   H HA3  . GLY A 1 42 ? -3.330  1.711   0.046   1.00 0.00 ? 42 GLY A HA3  1  
ATOM 614   N N    . THR A 1 43 ? -2.135  4.181   -0.849  1.00 0.00 ? 43 THR A N    1  
ATOM 615   C CA   . THR A 1 43 ? -1.718  5.575   -0.651  1.00 0.00 ? 43 THR A CA   1  
ATOM 616   C C    . THR A 1 43 ? -2.905  6.540   -0.684  1.00 0.00 ? 43 THR A C    1  
ATOM 617   O O    . THR A 1 43 ? -2.753  7.729   -0.929  1.00 0.00 ? 43 THR A O    1  
ATOM 618   C CB   . THR A 1 43 ? -0.646  5.947   -1.695  1.00 0.00 ? 43 THR A CB   1  
ATOM 619   O OG1  . THR A 1 43 ? -0.564  4.946   -2.689  1.00 0.00 ? 43 THR A OG1  1  
ATOM 620   C CG2  . THR A 1 43 ? 0.733   6.073   -1.043  1.00 0.00 ? 43 THR A CG2  1  
ATOM 621   H H    . THR A 1 43 ? -2.608  3.899   -1.684  1.00 0.00 ? 43 THR A H    1  
ATOM 622   H HA   . THR A 1 43 ? -1.312  5.682   0.354   1.00 0.00 ? 43 THR A HA   1  
ATOM 623   H HB   . THR A 1 43 ? -0.856  6.911   -2.173  1.00 0.00 ? 43 THR A HB   1  
ATOM 624   H HG1  . THR A 1 43 ? -1.424  4.801   -3.084  1.00 0.00 ? 43 THR A HG1  1  
ATOM 625   H HG21 . THR A 1 43 ? 1.049   5.132   -0.595  1.00 0.00 ? 43 THR A HG21 1  
ATOM 626   H HG22 . THR A 1 43 ? 1.495   6.379   -1.757  1.00 0.00 ? 43 THR A HG22 1  
ATOM 627   H HG23 . THR A 1 43 ? 0.704   6.829   -0.261  1.00 0.00 ? 43 THR A HG23 1  
ATOM 628   N N    . THR A 1 44 ? -4.087  5.968   -0.419  1.00 0.00 ? 44 THR A N    1  
ATOM 629   C CA   . THR A 1 44 ? -5.297  6.765   -0.387  1.00 0.00 ? 44 THR A CA   1  
ATOM 630   C C    . THR A 1 44 ? -6.176  6.145   0.697   1.00 0.00 ? 44 THR A C    1  
ATOM 631   O O    . THR A 1 44 ? -5.818  5.146   1.312   1.00 0.00 ? 44 THR A O    1  
ATOM 632   C CB   . THR A 1 44 ? -6.005  6.740   -1.760  1.00 0.00 ? 44 THR A CB   1  
ATOM 633   O OG1  . THR A 1 44 ? -6.562  5.448   -1.959  1.00 0.00 ? 44 THR A OG1  1  
ATOM 634   C CG2  . THR A 1 44 ? -5.062  7.086   -2.924  1.00 0.00 ? 44 THR A CG2  1  
ATOM 635   H H    . THR A 1 44 ? -4.195  4.999   -0.199  1.00 0.00 ? 44 THR A H    1  
ATOM 636   H HA   . THR A 1 44 ? -5.042  7.784   -0.087  1.00 0.00 ? 44 THR A HA   1  
ATOM 637   H HB   . THR A 1 44 ? -6.799  7.498   -1.730  1.00 0.00 ? 44 THR A HB   1  
ATOM 638   H HG1  . THR A 1 44 ? -7.247  5.471   -2.643  1.00 0.00 ? 44 THR A HG1  1  
ATOM 639   H HG21 . THR A 1 44 ? -4.329  6.299   -3.096  1.00 0.00 ? 44 THR A HG21 1  
ATOM 640   H HG22 . THR A 1 44 ? -5.606  7.227   -3.856  1.00 0.00 ? 44 THR A HG22 1  
ATOM 641   H HG23 . THR A 1 44 ? -4.526  8.015   -2.730  1.00 0.00 ? 44 THR A HG23 1  
ATOM 642   N N    . GLU A 1 45 ? -7.351  6.778   0.861   1.00 0.00 ? 45 GLU A N    1  
ATOM 643   C CA   . GLU A 1 45 ? -8.354  6.262   1.774   1.00 0.00 ? 45 GLU A CA   1  
ATOM 644   C C    . GLU A 1 45 ? -8.823  4.881   1.271   1.00 0.00 ? 45 GLU A C    1  
ATOM 645   O O    . GLU A 1 45 ? -8.942  3.920   2.023   1.00 0.00 ? 45 GLU A O    1  
ATOM 646   C CB   . GLU A 1 45 ? -9.505  7.285   1.812   1.00 0.00 ? 45 GLU A CB   1  
ATOM 647   C CG   . GLU A 1 45 ? -10.680 6.834   2.684   1.00 0.00 ? 45 GLU A CG   1  
ATOM 648   C CD   . GLU A 1 45 ? -11.801 7.885   2.663   1.00 0.00 ? 45 GLU A CD   1  
ATOM 649   O OE1  . GLU A 1 45 ? -12.277 8.211   1.575   1.00 0.00 ? 45 GLU A OE1  1  
ATOM 650   O OE2  . GLU A 1 45 ? -12.180 8.366   3.729   1.00 0.00 ? 45 GLU A OE2  1  
ATOM 651   H H    . GLU A 1 45 ? -7.566  7.588   0.323   1.00 0.00 ? 45 GLU A H    1  
ATOM 652   H HA   . GLU A 1 45 ? -7.890  6.148   2.756   1.00 0.00 ? 45 GLU A HA   1  
ATOM 653   H HB2  . GLU A 1 45 ? -9.106  8.219   2.294   1.00 0.00 ? 45 GLU A HB2  1  
ATOM 654   H HB3  . GLU A 1 45 ? -9.907  7.391   0.767   1.00 0.00 ? 45 GLU A HB3  1  
ATOM 655   H HG2  . GLU A 1 45 ? -11.090 5.893   2.318   1.00 0.00 ? 45 GLU A HG2  1  
ATOM 656   H HG3  . GLU A 1 45 ? -10.340 6.670   3.706   1.00 0.00 ? 45 GLU A HG3  1  
ATOM 657   N N    . ASP A 1 46 ? -9.080  4.869   -0.057  1.00 0.00 ? 46 ASP A N    1  
ATOM 658   C CA   . ASP A 1 46 ? -9.551  3.657   -0.725  1.00 0.00 ? 46 ASP A CA   1  
ATOM 659   C C    . ASP A 1 46 ? -8.659  3.289   -1.929  1.00 0.00 ? 46 ASP A C    1  
ATOM 660   O O    . ASP A 1 46 ? -8.630  3.961   -2.954  1.00 0.00 ? 46 ASP A O    1  
ATOM 661   C CB   . ASP A 1 46 ? -11.042 3.740   -1.118  1.00 0.00 ? 46 ASP A CB   1  
ATOM 662   C CG   . ASP A 1 46 ? -11.498 2.412   -1.747  1.00 0.00 ? 46 ASP A CG   1  
ATOM 663   O OD1  . ASP A 1 46 ? -11.001 1.366   -1.340  1.00 0.00 ? 46 ASP A OD1  1  
ATOM 664   O OD2  . ASP A 1 46 ? -12.316 2.441   -2.661  1.00 0.00 ? 46 ASP A OD2  1  
ATOM 665   H H    . ASP A 1 46 ? -8.888  5.708   -0.564  1.00 0.00 ? 46 ASP A H    1  
ATOM 666   H HA   . ASP A 1 46 ? -9.464  2.856   0.000   1.00 0.00 ? 46 ASP A HA   1  
ATOM 667   H HB2  . ASP A 1 46 ? -11.653 3.926   -0.235  1.00 0.00 ? 46 ASP A HB2  1  
ATOM 668   H HB3  . ASP A 1 46 ? -11.251 4.541   -1.827  1.00 0.00 ? 46 ASP A HB3  1  
ATOM 669   N N    . TYR A 1 47 ? -7.949  2.160   -1.746  1.00 0.00 ? 47 TYR A N    1  
ATOM 670   C CA   . TYR A 1 47 ? -7.101  1.645   -2.815  1.00 0.00 ? 47 TYR A CA   1  
ATOM 671   C C    . TYR A 1 47 ? -7.969  1.014   -3.907  1.00 0.00 ? 47 TYR A C    1  
ATOM 672   O O    . TYR A 1 47 ? -7.620  1.049   -5.081  1.00 0.00 ? 47 TYR A O    1  
ATOM 673   C CB   . TYR A 1 47 ? -6.170  0.560   -2.248  1.00 0.00 ? 47 TYR A CB   1  
ATOM 674   C CG   . TYR A 1 47 ? -5.322  -0.051  -3.325  1.00 0.00 ? 47 TYR A CG   1  
ATOM 675   C CD1  . TYR A 1 47 ? -4.231  0.627   -3.839  1.00 0.00 ? 47 TYR A CD1  1  
ATOM 676   C CD2  . TYR A 1 47 ? -5.623  -1.308  -3.827  1.00 0.00 ? 47 TYR A CD2  1  
ATOM 677   C CE1  . TYR A 1 47 ? -3.437  0.038   -4.806  1.00 0.00 ? 47 TYR A CE1  1  
ATOM 678   C CE2  . TYR A 1 47 ? -4.809  -1.914  -4.767  1.00 0.00 ? 47 TYR A CE2  1  
ATOM 679   C CZ   . TYR A 1 47 ? -3.704  -1.239  -5.262  1.00 0.00 ? 47 TYR A CZ   1  
ATOM 680   O OH   . TYR A 1 47 ? -2.866  -1.808  -6.198  1.00 0.00 ? 47 TYR A OH   1  
ATOM 681   H H    . TYR A 1 47 ? -8.067  1.640   -0.890  1.00 0.00 ? 47 TYR A H    1  
ATOM 682   H HA   . TYR A 1 47 ? -6.526  2.466   -3.273  1.00 0.00 ? 47 TYR A HA   1  
ATOM 683   H HB2  . TYR A 1 47 ? -5.525  0.984   -1.478  1.00 0.00 ? 47 TYR A HB2  1  
ATOM 684   H HB3  . TYR A 1 47 ? -6.731  -0.254  -1.776  1.00 0.00 ? 47 TYR A HB3  1  
ATOM 685   H HD1  . TYR A 1 47 ? -4.005  1.620   -3.500  1.00 0.00 ? 47 TYR A HD1  1  
ATOM 686   H HD2  . TYR A 1 47 ? -6.520  -1.810  -3.512  1.00 0.00 ? 47 TYR A HD2  1  
ATOM 687   H HE1  . TYR A 1 47 ? -2.605  0.583   -5.203  1.00 0.00 ? 47 TYR A HE1  1  
ATOM 688   H HE2  . TYR A 1 47 ? -5.065  -2.908  -5.080  1.00 0.00 ? 47 TYR A HE2  1  
ATOM 689   H HH   . TYR A 1 47 ? -2.699  -2.715  -5.977  1.00 0.00 ? 47 TYR A HH   1  
ATOM 690   N N    . ASP A 1 48 ? -9.094  0.414   -3.466  1.00 0.00 ? 48 ASP A N    1  
ATOM 691   C CA   . ASP A 1 48 ? -9.934  -0.276  -4.440  1.00 0.00 ? 48 ASP A CA   1  
ATOM 692   C C    . ASP A 1 48 ? -10.392 0.698   -5.542  1.00 0.00 ? 48 ASP A C    1  
ATOM 693   O O    . ASP A 1 48 ? -10.402 0.383   -6.728  1.00 0.00 ? 48 ASP A O    1  
ATOM 694   C CB   . ASP A 1 48 ? -11.157 -0.962  -3.786  1.00 0.00 ? 48 ASP A CB   1  
ATOM 695   C CG   . ASP A 1 48 ? -10.759 -2.135  -2.874  1.00 0.00 ? 48 ASP A CG   1  
ATOM 696   O OD1  . ASP A 1 48 ? -9.871  -2.900  -3.251  1.00 0.00 ? 48 ASP A OD1  1  
ATOM 697   O OD2  . ASP A 1 48 ? -11.339 -2.298  -1.799  1.00 0.00 ? 48 ASP A OD2  1  
ATOM 698   H H    . ASP A 1 48 ? -9.367  0.440   -2.499  1.00 0.00 ? 48 ASP A H    1  
ATOM 699   H HA   . ASP A 1 48 ? -9.311  -1.043  -4.912  1.00 0.00 ? 48 ASP A HA   1  
ATOM 700   H HB2  . ASP A 1 48 ? -11.762 -0.249  -3.214  1.00 0.00 ? 48 ASP A HB2  1  
ATOM 701   H HB3  . ASP A 1 48 ? -11.785 -1.401  -4.568  1.00 0.00 ? 48 ASP A HB3  1  
ATOM 702   N N    . ARG A 1 49 ? -10.750 1.911   -5.092  1.00 0.00 ? 49 ARG A N    1  
ATOM 703   C CA   . ARG A 1 49 ? -11.138 2.954   -6.031  1.00 0.00 ? 49 ARG A CA   1  
ATOM 704   C C    . ARG A 1 49 ? -9.924  3.488   -6.842  1.00 0.00 ? 49 ARG A C    1  
ATOM 705   O O    . ARG A 1 49 ? -9.956  3.457   -8.069  1.00 0.00 ? 49 ARG A O    1  
ATOM 706   C CB   . ARG A 1 49 ? -11.882 4.063   -5.265  1.00 0.00 ? 49 ARG A CB   1  
ATOM 707   C CG   . ARG A 1 49 ? -12.224 5.322   -6.083  1.00 0.00 ? 49 ARG A CG   1  
ATOM 708   C CD   . ARG A 1 49 ? -11.332 6.518   -5.679  1.00 0.00 ? 49 ARG A CD   1  
ATOM 709   N NE   . ARG A 1 49 ? -12.068 7.419   -4.798  1.00 0.00 ? 49 ARG A NE   1  
ATOM 710   C CZ   . ARG A 1 49 ? -11.472 8.401   -4.081  1.00 0.00 ? 49 ARG A CZ   1  
ATOM 711   N NH1  . ARG A 1 49 ? -10.151 8.558   -4.090  1.00 0.00 ? 49 ARG A NH1  1  
ATOM 712   N NH2  . ARG A 1 49 ? -12.224 9.223   -3.354  1.00 0.00 ? 49 ARG A NH2  1  
ATOM 713   H H    . ARG A 1 49 ? -10.762 2.081   -4.101  1.00 0.00 ? 49 ARG A H    1  
ATOM 714   H HA   . ARG A 1 49 ? -11.836 2.502   -6.738  1.00 0.00 ? 49 ARG A HA   1  
ATOM 715   H HB2  . ARG A 1 49 ? -12.806 3.642   -4.865  1.00 0.00 ? 49 ARG A HB2  1  
ATOM 716   H HB3  . ARG A 1 49 ? -11.299 4.352   -4.395  1.00 0.00 ? 49 ARG A HB3  1  
ATOM 717   H HG2  . ARG A 1 49 ? -12.138 5.112   -7.153  1.00 0.00 ? 49 ARG A HG2  1  
ATOM 718   H HG3  . ARG A 1 49 ? -13.281 5.570   -5.943  1.00 0.00 ? 49 ARG A HG3  1  
ATOM 719   H HD2  . ARG A 1 49 ? -10.431 6.199   -5.144  1.00 0.00 ? 49 ARG A HD2  1  
ATOM 720   H HD3  . ARG A 1 49 ? -11.032 7.101   -6.551  1.00 0.00 ? 49 ARG A HD3  1  
ATOM 721   H HE   . ARG A 1 49 ? -13.059 7.284   -4.770  1.00 0.00 ? 49 ARG A HE   1  
ATOM 722   H HH11 . ARG A 1 49 ? -9.553  7.908   -4.593  1.00 0.00 ? 49 ARG A HH11 1  
ATOM 723   H HH12 . ARG A 1 49 ? -9.685  9.293   -3.607  1.00 0.00 ? 49 ARG A HH12 1  
ATOM 724   H HH21 . ARG A 1 49 ? -13.219 9.123   -3.343  1.00 0.00 ? 49 ARG A HH21 1  
ATOM 725   H HH22 . ARG A 1 49 ? -11.814 9.949   -2.804  1.00 0.00 ? 49 ARG A HH22 1  
ATOM 726   N N    . ASP A 1 50 ? -8.905  3.994   -6.116  1.00 0.00 ? 50 ASP A N    1  
ATOM 727   C CA   . ASP A 1 50 ? -7.761  4.689   -6.735  1.00 0.00 ? 50 ASP A CA   1  
ATOM 728   C C    . ASP A 1 50 ? -6.718  3.836   -7.513  1.00 0.00 ? 50 ASP A C    1  
ATOM 729   O O    . ASP A 1 50 ? -6.242  4.248   -8.562  1.00 0.00 ? 50 ASP A O    1  
ATOM 730   C CB   . ASP A 1 50 ? -7.023  5.482   -5.641  1.00 0.00 ? 50 ASP A CB   1  
ATOM 731   C CG   . ASP A 1 50 ? -7.906  6.597   -5.061  1.00 0.00 ? 50 ASP A CG   1  
ATOM 732   O OD1  . ASP A 1 50 ? -8.341  7.467   -5.811  1.00 0.00 ? 50 ASP A OD1  1  
ATOM 733   O OD2  . ASP A 1 50 ? -8.173  6.615   -3.863  1.00 0.00 ? 50 ASP A OD2  1  
ATOM 734   H H    . ASP A 1 50 ? -8.959  3.979   -5.112  1.00 0.00 ? 50 ASP A H    1  
ATOM 735   H HA   . ASP A 1 50 ? -8.157  5.415   -7.449  1.00 0.00 ? 50 ASP A HA   1  
ATOM 736   H HB2  . ASP A 1 50 ? -6.696  4.784   -4.852  1.00 0.00 ? 50 ASP A HB2  1  
ATOM 737   H HB3  . ASP A 1 50 ? -6.179  6.025   -6.088  1.00 0.00 ? 50 ASP A HB3  1  
ATOM 738   N N    . LYS A 1 51 ? -6.323  2.688   -6.931  1.00 0.00 ? 51 LYS A N    1  
ATOM 739   C CA   . LYS A 1 51 ? -5.293  1.793   -7.476  1.00 0.00 ? 51 LYS A CA   1  
ATOM 740   C C    . LYS A 1 51 ? -3.875  2.389   -7.503  1.00 0.00 ? 51 LYS A C    1  
ATOM 741   O O    . LYS A 1 51 ? -3.072  2.044   -8.364  1.00 0.00 ? 51 LYS A O    1  
ATOM 742   C CB   . LYS A 1 51 ? -5.594  1.223   -8.880  1.00 0.00 ? 51 LYS A CB   1  
ATOM 743   C CG   . LYS A 1 51 ? -6.874  0.367   -8.941  1.00 0.00 ? 51 LYS A CG   1  
ATOM 744   C CD   . LYS A 1 51 ? -8.161  1.171   -8.772  1.00 0.00 ? 51 LYS A CD   1  
ATOM 745   C CE   . LYS A 1 51 ? -9.362  0.529   -9.472  1.00 0.00 ? 51 LYS A CE   1  
ATOM 746   N NZ   . LYS A 1 51 ? -10.588 1.239   -9.132  1.00 0.00 ? 51 LYS A NZ   1  
ATOM 747   H H    . LYS A 1 51 ? -6.801  2.365   -6.116  1.00 0.00 ? 51 LYS A H    1  
ATOM 748   H HA   . LYS A 1 51 ? -5.238  0.988   -6.745  1.00 0.00 ? 51 LYS A HA   1  
ATOM 749   H HB2  . LYS A 1 51 ? -5.716  2.089   -9.588  1.00 0.00 ? 51 LYS A HB2  1  
ATOM 750   H HB3  . LYS A 1 51 ? -4.719  0.537   -9.091  1.00 0.00 ? 51 LYS A HB3  1  
ATOM 751   H HG2  . LYS A 1 51 ? -6.972  -0.148  -9.895  1.00 0.00 ? 51 LYS A HG2  1  
ATOM 752   H HG3  . LYS A 1 51 ? -6.793  -0.416  -8.190  1.00 0.00 ? 51 LYS A HG3  1  
ATOM 753   H HD2  . LYS A 1 51 ? -8.359  1.295   -7.708  1.00 0.00 ? 51 LYS A HD2  1  
ATOM 754   H HD3  . LYS A 1 51 ? -8.027  2.168   -9.191  1.00 0.00 ? 51 LYS A HD3  1  
ATOM 755   H HE2  . LYS A 1 51 ? -9.233  0.561   -10.555 1.00 0.00 ? 51 LYS A HE2  1  
ATOM 756   H HE3  . LYS A 1 51 ? -9.483  -0.514  -9.172  1.00 0.00 ? 51 LYS A HE3  1  
ATOM 757   H HZ1  . LYS A 1 51 ? -10.402 2.270   -9.113  1.00 0.00 ? 51 LYS A HZ1  1  
ATOM 758   H HZ2  . LYS A 1 51 ? -11.373 1.007   -9.769  1.00 0.00 ? 51 LYS A HZ2  1  
ATOM 759   H HZ3  . LYS A 1 51 ? -10.827 0.956   -8.156  1.00 0.00 ? 51 LYS A HZ3  1  
ATOM 760   N N    . LYS A 1 52 ? -3.573  3.253   -6.517  1.00 0.00 ? 52 LYS A N    1  
ATOM 761   C CA   . LYS A 1 52 ? -2.208  3.769   -6.434  1.00 0.00 ? 52 LYS A CA   1  
ATOM 762   C C    . LYS A 1 52 ? -1.651  3.349   -5.062  1.00 0.00 ? 52 LYS A C    1  
ATOM 763   O O    . LYS A 1 52 ? -2.322  3.489   -4.041  1.00 0.00 ? 52 LYS A O    1  
ATOM 764   C CB   . LYS A 1 52 ? -2.162  5.296   -6.644  1.00 0.00 ? 52 LYS A CB   1  
ATOM 765   C CG   . LYS A 1 52 ? -2.787  5.836   -7.960  1.00 0.00 ? 52 LYS A CG   1  
ATOM 766   C CD   . LYS A 1 52 ? -2.233  5.290   -9.290  1.00 0.00 ? 52 LYS A CD   1  
ATOM 767   C CE   . LYS A 1 52 ? -0.710  5.388   -9.367  1.00 0.00 ? 52 LYS A CE   1  
ATOM 768   N NZ   . LYS A 1 52 ? -0.194  6.741   -9.186  1.00 0.00 ? 52 LYS A NZ   1  
ATOM 769   H H    . LYS A 1 52 ? -4.255  3.496   -5.829  1.00 0.00 ? 52 LYS A H    1  
ATOM 770   H HA   . LYS A 1 52 ? -1.613  3.242   -7.180  1.00 0.00 ? 52 LYS A HA   1  
ATOM 771   H HB2  . LYS A 1 52 ? -2.661  5.774   -5.796  1.00 0.00 ? 52 LYS A HB2  1  
ATOM 772   H HB3  . LYS A 1 52 ? -1.126  5.624   -6.576  1.00 0.00 ? 52 LYS A HB3  1  
ATOM 773   H HG2  . LYS A 1 52 ? -3.863  5.665   -7.965  1.00 0.00 ? 52 LYS A HG2  1  
ATOM 774   H HG3  . LYS A 1 52 ? -2.657  6.922   -7.978  1.00 0.00 ? 52 LYS A HG3  1  
ATOM 775   H HD2  . LYS A 1 52 ? -2.521  4.201   -9.367  1.00 0.00 ? 52 LYS A HD2  1  
ATOM 776   H HD3  . LYS A 1 52 ? -2.620  5.968   -10.105 1.00 0.00 ? 52 LYS A HD3  1  
ATOM 777   H HE2  . LYS A 1 52 ? -0.269  4.778   -8.584  1.00 0.00 ? 52 LYS A HE2  1  
ATOM 778   H HE3  . LYS A 1 52 ? -0.338  5.006   -10.318 1.00 0.00 ? 52 LYS A HE3  1  
ATOM 779   H HZ1  . LYS A 1 52 ? -0.496  7.167   -8.282  1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 780   H HZ2  . LYS A 1 52 ? 0.848   6.743   -9.166  1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 781   H HZ3  . LYS A 1 52 ? -0.472  7.465   -9.883  1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 782   N N    . TYR A 1 53 ? -0.428  2.778   -5.113  1.00 0.00 ? 53 TYR A N    1  
ATOM 783   C CA   . TYR A 1 53 ? 0.213   2.207   -3.939  1.00 0.00 ? 53 TYR A CA   1  
ATOM 784   C C    . TYR A 1 53 ? 1.687   2.617   -3.856  1.00 0.00 ? 53 TYR A C    1  
ATOM 785   O O    . TYR A 1 53 ? 2.283   3.208   -4.755  1.00 0.00 ? 53 TYR A O    1  
ATOM 786   C CB   . TYR A 1 53 ? 0.092   0.669   -3.972  1.00 0.00 ? 53 TYR A CB   1  
ATOM 787   C CG   . TYR A 1 53 ? 0.945   -0.008  -5.017  1.00 0.00 ? 53 TYR A CG   1  
ATOM 788   C CD1  . TYR A 1 53 ? 0.515   -0.155  -6.330  1.00 0.00 ? 53 TYR A CD1  1  
ATOM 789   C CD2  . TYR A 1 53 ? 2.179   -0.531  -4.661  1.00 0.00 ? 53 TYR A CD2  1  
ATOM 790   C CE1  . TYR A 1 53 ? 1.282   -0.859  -7.253  1.00 0.00 ? 53 TYR A CE1  1  
ATOM 791   C CE2  . TYR A 1 53 ? 2.945   -1.236  -5.571  1.00 0.00 ? 53 TYR A CE2  1  
ATOM 792   C CZ   . TYR A 1 53 ? 2.496   -1.418  -6.867  1.00 0.00 ? 53 TYR A CZ   1  
ATOM 793   O OH   . TYR A 1 53 ? 3.265   -2.174  -7.736  1.00 0.00 ? 53 TYR A OH   1  
ATOM 794   H H    . TYR A 1 53 ? 0.110   2.741   -5.959  1.00 0.00 ? 53 TYR A H    1  
ATOM 795   H HA   . TYR A 1 53 ? -0.285  2.592   -3.052  1.00 0.00 ? 53 TYR A HA   1  
ATOM 796   H HB2  . TYR A 1 53 ? 0.370   0.259   -3.007  1.00 0.00 ? 53 TYR A HB2  1  
ATOM 797   H HB3  . TYR A 1 53 ? -0.938  0.347   -4.083  1.00 0.00 ? 53 TYR A HB3  1  
ATOM 798   H HD1  . TYR A 1 53 ? -0.421  0.283   -6.634  1.00 0.00 ? 53 TYR A HD1  1  
ATOM 799   H HD2  . TYR A 1 53 ? 2.552   -0.386  -3.663  1.00 0.00 ? 53 TYR A HD2  1  
ATOM 800   H HE1  . TYR A 1 53 ? 0.902   -0.967  -8.256  1.00 0.00 ? 53 TYR A HE1  1  
ATOM 801   H HE2  . TYR A 1 53 ? 3.887   -1.645  -5.252  1.00 0.00 ? 53 TYR A HE2  1  
ATOM 802   H HH   . TYR A 1 53 ? 3.308   -1.729  -8.577  1.00 0.00 ? 53 TYR A HH   1  
ATOM 803   N N    . GLY A 1 54 ? 2.221   2.198   -2.700  1.00 0.00 ? 54 GLY A N    1  
ATOM 804   C CA   . GLY A 1 54 ? 3.626   2.393   -2.369  1.00 0.00 ? 54 GLY A CA   1  
ATOM 805   C C    . GLY A 1 54 ? 4.195   1.085   -1.809  1.00 0.00 ? 54 GLY A C    1  
ATOM 806   O O    . GLY A 1 54 ? 3.434   0.160   -1.537  1.00 0.00 ? 54 GLY A O    1  
ATOM 807   H H    . GLY A 1 54 ? 1.588   1.712   -2.085  1.00 0.00 ? 54 GLY A H    1  
ATOM 808   H HA2  . GLY A 1 54 ? 4.143   2.708   -3.271  1.00 0.00 ? 54 GLY A HA2  1  
ATOM 809   H HA3  . GLY A 1 54 ? 3.672   3.170   -1.613  1.00 0.00 ? 54 GLY A HA3  1  
ATOM 810   N N    . PHE A 1 55 ? 5.542   1.034   -1.639  1.00 0.00 ? 55 PHE A N    1  
ATOM 811   C CA   . PHE A 1 55 ? 6.118   -0.195  -1.079  1.00 0.00 ? 55 PHE A CA   1  
ATOM 812   C C    . PHE A 1 55 ? 6.305   0.055   0.421   1.00 0.00 ? 55 PHE A C    1  
ATOM 813   O O    . PHE A 1 55 ? 6.313   1.177   0.907   1.00 0.00 ? 55 PHE A O    1  
ATOM 814   C CB   . PHE A 1 55 ? 7.449   -0.653  -1.718  1.00 0.00 ? 55 PHE A CB   1  
ATOM 815   C CG   . PHE A 1 55 ? 7.288   -1.290  -3.076  1.00 0.00 ? 55 PHE A CG   1  
ATOM 816   C CD1  . PHE A 1 55 ? 6.643   -0.622  -4.105  1.00 0.00 ? 55 PHE A CD1  1  
ATOM 817   C CD2  . PHE A 1 55 ? 7.808   -2.555  -3.332  1.00 0.00 ? 55 PHE A CD2  1  
ATOM 818   C CE1  . PHE A 1 55 ? 6.532   -1.182  -5.368  1.00 0.00 ? 55 PHE A CE1  1  
ATOM 819   C CE2  . PHE A 1 55 ? 7.693   -3.126  -4.593  1.00 0.00 ? 55 PHE A CE2  1  
ATOM 820   C CZ   . PHE A 1 55 ? 7.057   -2.439  -5.616  1.00 0.00 ? 55 PHE A CZ   1  
ATOM 821   H H    . PHE A 1 55 ? 6.173   1.793   -1.844  1.00 0.00 ? 55 PHE A H    1  
ATOM 822   H HA   . PHE A 1 55 ? 5.413   -1.018  -1.184  1.00 0.00 ? 55 PHE A HA   1  
ATOM 823   H HB2  . PHE A 1 55 ? 8.164   0.164   -1.812  1.00 0.00 ? 55 PHE A HB2  1  
ATOM 824   H HB3  . PHE A 1 55 ? 7.891   -1.429  -1.080  1.00 0.00 ? 55 PHE A HB3  1  
ATOM 825   H HD1  . PHE A 1 55 ? 6.230   0.353   -3.923  1.00 0.00 ? 55 PHE A HD1  1  
ATOM 826   H HD2  . PHE A 1 55 ? 8.317   -3.099  -2.548  1.00 0.00 ? 55 PHE A HD2  1  
ATOM 827   H HE1  . PHE A 1 55 ? 6.046   -0.620  -6.153  1.00 0.00 ? 55 PHE A HE1  1  
ATOM 828   H HE2  . PHE A 1 55 ? 8.109   -4.102  -4.778  1.00 0.00 ? 55 PHE A HE2  1  
ATOM 829   H HZ   . PHE A 1 55 ? 6.978   -2.875  -6.600  1.00 0.00 ? 55 PHE A HZ   1  
ATOM 830   N N    . CYS A 1 56 ? 6.378   -1.088  1.103   1.00 0.00 ? 56 CYS A N    1  
ATOM 831   C CA   . CYS A 1 56 ? 6.453   -1.125  2.571   1.00 0.00 ? 56 CYS A CA   1  
ATOM 832   C C    . CYS A 1 56 ? 7.724   -1.933  2.861   1.00 0.00 ? 56 CYS A C    1  
ATOM 833   O O    . CYS A 1 56 ? 8.261   -2.565  1.965   1.00 0.00 ? 56 CYS A O    1  
ATOM 834   C CB   . CYS A 1 56 ? 5.190   -1.865  3.086   1.00 0.00 ? 56 CYS A CB   1  
ATOM 835   S SG   . CYS A 1 56 ? 4.162   -0.956  4.266   1.00 0.00 ? 56 CYS A SG   1  
ATOM 836   H H    . CYS A 1 56 ? 6.440   -1.930  0.527   1.00 0.00 ? 56 CYS A H    1  
ATOM 837   H HA   . CYS A 1 56 ? 6.548   -0.113  3.025   1.00 0.00 ? 56 CYS A HA   1  
ATOM 838   H HB2  . CYS A 1 56 ? 4.501   -2.123  2.268   1.00 0.00 ? 56 CYS A HB2  1  
ATOM 839   H HB3  . CYS A 1 56 ? 5.486   -2.809  3.562   1.00 0.00 ? 56 CYS A HB3  1  
ATOM 840   N N    . PRO A 1 57 ? 8.206   -1.909  4.127   1.00 0.00 ? 57 PRO A N    1  
ATOM 841   C CA   . PRO A 1 57 ? 9.372   -2.709  4.485   1.00 0.00 ? 57 PRO A CA   1  
ATOM 842   C C    . PRO A 1 57 ? 9.021   -4.206  4.582   1.00 0.00 ? 57 PRO A C    1  
ATOM 843   O O    . PRO A 1 57 ? 8.151   -4.603  5.347   1.00 0.00 ? 57 PRO A O    1  
ATOM 844   C CB   . PRO A 1 57 ? 9.764   -2.170  5.867   1.00 0.00 ? 57 PRO A CB   1  
ATOM 845   C CG   . PRO A 1 57 ? 8.462   -1.614  6.452   1.00 0.00 ? 57 PRO A CG   1  
ATOM 846   C CD   . PRO A 1 57 ? 7.666   -1.123  5.236   1.00 0.00 ? 57 PRO A CD   1  
ATOM 847   H HA   . PRO A 1 57 ? 10.179  -2.568  3.764   1.00 0.00 ? 57 PRO A HA   1  
ATOM 848   H HB2  . PRO A 1 57 ? 10.233  -2.914  6.514   1.00 0.00 ? 57 PRO A HB2  1  
ATOM 849   H HB3  . PRO A 1 57 ? 10.477  -1.355  5.741   1.00 0.00 ? 57 PRO A HB3  1  
ATOM 850   H HG2  . PRO A 1 57 ? 7.917   -2.425  6.938   1.00 0.00 ? 57 PRO A HG2  1  
ATOM 851   H HG3  . PRO A 1 57 ? 8.631   -0.837  7.198   1.00 0.00 ? 57 PRO A HG3  1  
ATOM 852   H HD2  . PRO A 1 57 ? 6.588   -1.318  5.371   1.00 0.00 ? 57 PRO A HD2  1  
ATOM 853   H HD3  . PRO A 1 57 ? 7.891   -0.059  5.052   1.00 0.00 ? 57 PRO A HD3  1  
ATOM 854   N N    . GLU A 1 58 ? 9.760   -5.019  3.805   1.00 0.00 ? 58 GLU A N    1  
ATOM 855   C CA   . GLU A 1 58 ? 9.579   -6.460  3.923   1.00 0.00 ? 58 GLU A CA   1  
ATOM 856   C C    . GLU A 1 58 ? 10.115  -6.893  5.302   1.00 0.00 ? 58 GLU A C    1  
ATOM 857   O O    . GLU A 1 58 ? 10.876  -6.176  5.942   1.00 0.00 ? 58 GLU A O    1  
ATOM 858   C CB   . GLU A 1 58 ? 10.314  -7.199  2.792   1.00 0.00 ? 58 GLU A CB   1  
ATOM 859   C CG   . GLU A 1 58 ? 9.673   -6.989  1.407   1.00 0.00 ? 58 GLU A CG   1  
ATOM 860   C CD   . GLU A 1 58 ? 9.846   -5.569  0.841   1.00 0.00 ? 58 GLU A CD   1  
ATOM 861   O OE1  . GLU A 1 58 ? 10.856  -4.929  1.133   1.00 0.00 ? 58 GLU A OE1  1  
ATOM 862   O OE2  . GLU A 1 58 ? 8.966   -5.128  0.104   1.00 0.00 ? 58 GLU A OE2  1  
ATOM 863   H H    . GLU A 1 58 ? 10.434  -4.671  3.148   1.00 0.00 ? 58 GLU A H    1  
ATOM 864   H HA   . GLU A 1 58 ? 8.508   -6.657  3.874   1.00 0.00 ? 58 GLU A HA   1  
ATOM 865   H HB2  . GLU A 1 58 ? 11.368  -6.893  2.768   1.00 0.00 ? 58 GLU A HB2  1  
ATOM 866   H HB3  . GLU A 1 58 ? 10.283  -8.275  2.998   1.00 0.00 ? 58 GLU A HB3  1  
ATOM 867   H HG2  . GLU A 1 58 ? 10.118  -7.680  0.691   1.00 0.00 ? 58 GLU A HG2  1  
ATOM 868   H HG3  . GLU A 1 58 ? 8.610   -7.232  1.450   1.00 0.00 ? 58 GLU A HG3  1  
ATOM 869   N N    . THR A 1 59 ? 9.650   -8.084  5.728   1.00 0.00 ? 59 THR A N    1  
ATOM 870   C CA   . THR A 1 59 ? 10.045  -8.610  7.036   1.00 0.00 ? 59 THR A CA   1  
ATOM 871   C C    . THR A 1 59 ? 9.479   -7.719  8.166   1.00 0.00 ? 59 THR A C    1  
ATOM 872   O O    . THR A 1 59 ? 10.126  -7.406  9.158   1.00 0.00 ? 59 THR A O    1  
ATOM 873   C CB   . THR A 1 59 ? 11.573  -8.807  7.109   1.00 0.00 ? 59 THR A CB   1  
ATOM 874   O OG1  . THR A 1 59 ? 11.971  -9.346  5.855   1.00 0.00 ? 59 THR A OG1  1  
ATOM 875   C CG2  . THR A 1 59 ? 11.986  -9.762  8.242   1.00 0.00 ? 59 THR A CG2  1  
ATOM 876   H H    . THR A 1 59 ? 9.053   -8.612  5.130   1.00 0.00 ? 59 THR A H    1  
ATOM 877   H HA   . THR A 1 59 ? 9.553   -9.581  7.101   1.00 0.00 ? 59 THR A HA   1  
ATOM 878   H HB   . THR A 1 59 ? 12.044  -7.828  7.264   1.00 0.00 ? 59 THR A HB   1  
ATOM 879   H HG1  . THR A 1 59 ? 12.918  -9.422  5.809   1.00 0.00 ? 59 THR A HG1  1  
ATOM 880   H HG21 . THR A 1 59 ? 11.566  -10.757 8.088   1.00 0.00 ? 59 THR A HG21 1  
ATOM 881   H HG22 . THR A 1 59 ? 13.069  -9.863  8.314   1.00 0.00 ? 59 THR A HG22 1  
ATOM 882   H HG23 . THR A 1 59 ? 11.635  -9.402  9.209   1.00 0.00 ? 59 THR A HG23 1  
ATOM 883   N N    . ALA A 1 60 ? 8.216   -7.351  7.902   1.00 0.00 ? 60 ALA A N    1  
ATOM 884   C CA   . ALA A 1 60 ? 7.369   -6.527  8.745   1.00 0.00 ? 60 ALA A CA   1  
ATOM 885   C C    . ALA A 1 60 ? 5.947   -6.678  8.165   1.00 0.00 ? 60 ALA A C    1  
ATOM 886   O O    . ALA A 1 60 ? 5.111   -5.724  8.215   1.00 0.00 ? 60 ALA A O    1  
ATOM 887   C CB   . ALA A 1 60 ? 7.855   -5.070  8.742   1.00 0.00 ? 60 ALA A CB   1  
ATOM 888   O OXT  . ALA A 1 60 ? 5.607   -7.777  7.628   1.00 0.00 ? 60 ALA A OXT  1  
ATOM 889   H H    . ALA A 1 60 ? 7.758   -7.672  7.075   1.00 0.00 ? 60 ALA A H    1  
ATOM 890   H HA   . ALA A 1 60 ? 7.395   -6.954  9.749   1.00 0.00 ? 60 ALA A HA   1  
ATOM 891   H HB1  . ALA A 1 60 ? 8.877   -4.996  9.111   1.00 0.00 ? 60 ALA A HB1  1  
ATOM 892   H HB2  . ALA A 1 60 ? 7.830   -4.650  7.738   1.00 0.00 ? 60 ALA A HB2  1  
ATOM 893   H HB3  . ALA A 1 60 ? 7.224   -4.447  9.377   1.00 0.00 ? 60 ALA A HB3  1  
ATOM 894   N N    . THR A 1 1  ? 4.745   7.018   10.542  1.00 0.00 ? 1  THR A N    2  
ATOM 895   C CA   . THR A 1 1  ? 5.424   8.043   9.772   1.00 0.00 ? 1  THR A CA   2  
ATOM 896   C C    . THR A 1 1  ? 5.080   7.695   8.331   1.00 0.00 ? 1  THR A C    2  
ATOM 897   O O    . THR A 1 1  ? 4.358   6.725   8.135   1.00 0.00 ? 1  THR A O    2  
ATOM 898   C CB   . THR A 1 1  ? 6.932   7.930   10.085  1.00 0.00 ? 1  THR A CB   2  
ATOM 899   O OG1  . THR A 1 1  ? 7.123   6.645   10.672  1.00 0.00 ? 1  THR A OG1  2  
ATOM 900   C CG2  . THR A 1 1  ? 7.382   9.026   11.063  1.00 0.00 ? 1  THR A CG2  2  
ATOM 901   H H1   . THR A 1 1  ? 5.531   6.398   10.848  1.00 0.00 ? 1  THR A H1   2  
ATOM 902   H H2   . THR A 1 1  ? 4.144   6.509   9.851   1.00 0.00 ? 1  THR A H2   2  
ATOM 903   H H3   . THR A 1 1  ? 4.217   7.392   11.352  1.00 0.00 ? 1  THR A H3   2  
ATOM 904   H HA   . THR A 1 1  ? 4.997   9.017   10.015  1.00 0.00 ? 1  THR A HA   2  
ATOM 905   H HB   . THR A 1 1  ? 7.523   8.017   9.163   1.00 0.00 ? 1  THR A HB   2  
ATOM 906   H HG1  . THR A 1 1  ? 8.054   6.488   10.838  1.00 0.00 ? 1  THR A HG1  2  
ATOM 907   H HG21 . THR A 1 1  ? 6.864   8.943   12.019  1.00 0.00 ? 1  THR A HG21 2  
ATOM 908   H HG22 . THR A 1 1  ? 7.175   10.018  10.659  1.00 0.00 ? 1  THR A HG22 2  
ATOM 909   H HG23 . THR A 1 1  ? 8.454   8.981   11.260  1.00 0.00 ? 1  THR A HG23 2  
ATOM 910   N N    . ALA A 1 2  ? 5.600   8.497   7.386   1.00 0.00 ? 2  ALA A N    2  
ATOM 911   C CA   . ALA A 1 2  ? 5.384   8.246   5.968   1.00 0.00 ? 2  ALA A CA   2  
ATOM 912   C C    . ALA A 1 2  ? 6.565   7.394   5.479   1.00 0.00 ? 2  ALA A C    2  
ATOM 913   O O    . ALA A 1 2  ? 7.693   7.612   5.902   1.00 0.00 ? 2  ALA A O    2  
ATOM 914   C CB   . ALA A 1 2  ? 5.343   9.598   5.247   1.00 0.00 ? 2  ALA A CB   2  
ATOM 915   H H    . ALA A 1 2  ? 6.195   9.264   7.623   1.00 0.00 ? 2  ALA A H    2  
ATOM 916   H HA   . ALA A 1 2  ? 4.444   7.705   5.838   1.00 0.00 ? 2  ALA A HA   2  
ATOM 917   H HB1  . ALA A 1 2  ? 6.274   10.150  5.378   1.00 0.00 ? 2  ALA A HB1  2  
ATOM 918   H HB2  . ALA A 1 2  ? 4.531   10.217  5.630   1.00 0.00 ? 2  ALA A HB2  2  
ATOM 919   H HB3  . ALA A 1 2  ? 5.180   9.477   4.180   1.00 0.00 ? 2  ALA A HB3  2  
ATOM 920   N N    . LEU A 1 3  ? 6.249   6.416   4.607   1.00 0.00 ? 3  LEU A N    2  
ATOM 921   C CA   . LEU A 1 3  ? 7.258   5.498   4.102   1.00 0.00 ? 3  LEU A CA   2  
ATOM 922   C C    . LEU A 1 3  ? 7.460   5.717   2.583   1.00 0.00 ? 3  LEU A C    2  
ATOM 923   O O    . LEU A 1 3  ? 6.545   6.097   1.865   1.00 0.00 ? 3  LEU A O    2  
ATOM 924   C CB   . LEU A 1 3  ? 6.805   4.037   4.243   1.00 0.00 ? 3  LEU A CB   2  
ATOM 925   C CG   . LEU A 1 3  ? 6.270   3.455   5.571   1.00 0.00 ? 3  LEU A CG   2  
ATOM 926   C CD1  . LEU A 1 3  ? 7.337   3.237   6.645   1.00 0.00 ? 3  LEU A CD1  2  
ATOM 927   C CD2  . LEU A 1 3  ? 5.026   4.146   6.117   1.00 0.00 ? 3  LEU A CD2  2  
ATOM 928   H H    . LEU A 1 3  ? 5.313   6.264   4.303   1.00 0.00 ? 3  LEU A H    2  
ATOM 929   H HA   . LEU A 1 3  ? 8.198   5.662   4.634   1.00 0.00 ? 3  LEU A HA   2  
ATOM 930   H HB2  . LEU A 1 3  ? 5.976   3.870   3.504   1.00 0.00 ? 3  LEU A HB2  2  
ATOM 931   H HB3  . LEU A 1 3  ? 7.763   3.497   4.060   1.00 0.00 ? 3  LEU A HB3  2  
ATOM 932   H HG   . LEU A 1 3  ? 5.931   2.448   5.325   1.00 0.00 ? 3  LEU A HG   2  
ATOM 933   H HD11 . LEU A 1 3  ? 8.138   2.601   6.268   1.00 0.00 ? 3  LEU A HD11 2  
ATOM 934   H HD12 . LEU A 1 3  ? 6.903   2.720   7.503   1.00 0.00 ? 3  LEU A HD12 2  
ATOM 935   H HD13 . LEU A 1 3  ? 7.759   4.179   6.988   1.00 0.00 ? 3  LEU A HD13 2  
ATOM 936   H HD21 . LEU A 1 3  ? 4.608   3.568   6.937   1.00 0.00 ? 3  LEU A HD21 2  
ATOM 937   H HD22 . LEU A 1 3  ? 4.260   4.233   5.347   1.00 0.00 ? 3  LEU A HD22 2  
ATOM 938   H HD23 . LEU A 1 3  ? 5.256   5.129   6.509   1.00 0.00 ? 3  LEU A HD23 2  
ATOM 939   N N    . PHE A 1 4  ? 8.703   5.408   2.164   1.00 0.00 ? 4  PHE A N    2  
ATOM 940   C CA   . PHE A 1 4  ? 9.173   5.473   0.772   1.00 0.00 ? 4  PHE A CA   2  
ATOM 941   C C    . PHE A 1 4  ? 8.275   4.628   -0.178  1.00 0.00 ? 4  PHE A C    2  
ATOM 942   O O    . PHE A 1 4  ? 7.557   3.749   0.271   1.00 0.00 ? 4  PHE A O    2  
ATOM 943   C CB   . PHE A 1 4  ? 10.626  4.927   0.781   1.00 0.00 ? 4  PHE A CB   2  
ATOM 944   C CG   . PHE A 1 4  ? 11.471  5.607   1.827   1.00 0.00 ? 4  PHE A CG   2  
ATOM 945   C CD1  . PHE A 1 4  ? 11.809  6.951   1.693   1.00 0.00 ? 4  PHE A CD1  2  
ATOM 946   C CD2  . PHE A 1 4  ? 11.920  4.906   2.944   1.00 0.00 ? 4  PHE A CD2  2  
ATOM 947   C CE1  . PHE A 1 4  ? 12.575  7.586   2.662   1.00 0.00 ? 4  PHE A CE1  2  
ATOM 948   C CE2  . PHE A 1 4  ? 12.686  5.539   3.914   1.00 0.00 ? 4  PHE A CE2  2  
ATOM 949   C CZ   . PHE A 1 4  ? 13.013  6.881   3.774   1.00 0.00 ? 4  PHE A CZ   2  
ATOM 950   H H    . PHE A 1 4  ? 9.343   5.124   2.876   1.00 0.00 ? 4  PHE A H    2  
ATOM 951   H HA   . PHE A 1 4  ? 9.128   6.525   0.487   1.00 0.00 ? 4  PHE A HA   2  
ATOM 952   H HB2  . PHE A 1 4  ? 10.596  3.851   1.002   1.00 0.00 ? 4  PHE A HB2  2  
ATOM 953   H HB3  . PHE A 1 4  ? 11.149  5.047   -0.175  1.00 0.00 ? 4  PHE A HB3  2  
ATOM 954   H HD1  . PHE A 1 4  ? 11.473  7.510   0.832   1.00 0.00 ? 4  PHE A HD1  2  
ATOM 955   H HD2  . PHE A 1 4  ? 11.676  3.861   3.066   1.00 0.00 ? 4  PHE A HD2  2  
ATOM 956   H HE1  . PHE A 1 4  ? 12.830  8.630   2.550   1.00 0.00 ? 4  PHE A HE1  2  
ATOM 957   H HE2  . PHE A 1 4  ? 13.028  4.988   4.778   1.00 0.00 ? 4  PHE A HE2  2  
ATOM 958   H HZ   . PHE A 1 4  ? 13.608  7.375   4.528   1.00 0.00 ? 4  PHE A HZ   2  
ATOM 959   N N    . THR A 1 5  ? 8.381   4.894   -1.502  1.00 0.00 ? 5  THR A N    2  
ATOM 960   C CA   . THR A 1 5  ? 7.595   4.168   -2.503  1.00 0.00 ? 5  THR A CA   2  
ATOM 961   C C    . THR A 1 5  ? 8.368   2.968   -3.094  1.00 0.00 ? 5  THR A C    2  
ATOM 962   O O    . THR A 1 5  ? 7.821   1.912   -3.389  1.00 0.00 ? 5  THR A O    2  
ATOM 963   C CB   . THR A 1 5  ? 7.364   5.152   -3.652  1.00 0.00 ? 5  THR A CB   2  
ATOM 964   O OG1  . THR A 1 5  ? 8.621   5.792   -3.873  1.00 0.00 ? 5  THR A OG1  2  
ATOM 965   C CG2  . THR A 1 5  ? 6.265   6.179   -3.329  1.00 0.00 ? 5  THR A CG2  2  
ATOM 966   H H    . THR A 1 5  ? 8.904   5.644   -1.912  1.00 0.00 ? 5  THR A H    2  
ATOM 967   H HA   . THR A 1 5  ? 6.675   3.810   -2.058  1.00 0.00 ? 5  THR A HA   2  
ATOM 968   H HB   . THR A 1 5  ? 7.071   4.544   -4.515  1.00 0.00 ? 5  THR A HB   2  
ATOM 969   H HG1  . THR A 1 5  ? 8.637   6.264   -4.705  1.00 0.00 ? 5  THR A HG1  2  
ATOM 970   H HG21 . THR A 1 5  ? 6.033   6.828   -4.174  1.00 0.00 ? 5  THR A HG21 2  
ATOM 971   H HG22 . THR A 1 5  ? 6.527   6.819   -2.483  1.00 0.00 ? 5  THR A HG22 2  
ATOM 972   H HG23 . THR A 1 5  ? 5.334   5.671   -3.067  1.00 0.00 ? 5  THR A HG23 2  
ATOM 973   N N    . MET A 1 6  ? 9.672   3.249   -3.227  1.00 0.00 ? 6  MET A N    2  
ATOM 974   C CA   . MET A 1 6  ? 10.744  2.351   -3.657  1.00 0.00 ? 6  MET A CA   2  
ATOM 975   C C    . MET A 1 6  ? 10.302  1.155   -4.545  1.00 0.00 ? 6  MET A C    2  
ATOM 976   O O    . MET A 1 6  ? 10.411  -0.005  -4.173  1.00 0.00 ? 6  MET A O    2  
ATOM 977   C CB   . MET A 1 6  ? 11.524  1.915   -2.399  1.00 0.00 ? 6  MET A CB   2  
ATOM 978   C CG   . MET A 1 6  ? 10.651  1.627   -1.162  1.00 0.00 ? 6  MET A CG   2  
ATOM 979   S SD   . MET A 1 6  ? 9.590   0.184   -1.341  1.00 0.00 ? 6  MET A SD   2  
ATOM 980   C CE   . MET A 1 6  ? 10.821  -1.116  -1.158  1.00 0.00 ? 6  MET A CE   2  
ATOM 981   H H    . MET A 1 6  ? 9.837   4.196   -2.957  1.00 0.00 ? 6  MET A H    2  
ATOM 982   H HA   . MET A 1 6  ? 11.398  2.967   -4.275  1.00 0.00 ? 6  MET A HA   2  
ATOM 983   H HB2  . MET A 1 6  ? 12.171  1.065   -2.619  1.00 0.00 ? 6  MET A HB2  2  
ATOM 984   H HB3  . MET A 1 6  ? 12.201  2.727   -2.130  1.00 0.00 ? 6  MET A HB3  2  
ATOM 985   H HG2  . MET A 1 6  ? 11.294  1.470   -0.301  1.00 0.00 ? 6  MET A HG2  2  
ATOM 986   H HG3  . MET A 1 6  ? 10.026  2.479   -0.894  1.00 0.00 ? 6  MET A HG3  2  
ATOM 987   H HE1  . MET A 1 6  ? 11.357  -0.996  -0.217  1.00 0.00 ? 6  MET A HE1  2  
ATOM 988   H HE2  . MET A 1 6  ? 11.545  -1.068  -1.971  1.00 0.00 ? 6  MET A HE2  2  
ATOM 989   H HE3  . MET A 1 6  ? 10.338  -2.093  -1.165  1.00 0.00 ? 6  MET A HE3  2  
ATOM 990   N N    . GLY A 1 7  ? 9.831   1.522   -5.755  1.00 0.00 ? 7  GLY A N    2  
ATOM 991   C CA   . GLY A 1 7  ? 9.389   0.529   -6.741  1.00 0.00 ? 7  GLY A CA   2  
ATOM 992   C C    . GLY A 1 7  ? 7.986   0.888   -7.249  1.00 0.00 ? 7  GLY A C    2  
ATOM 993   O O    . GLY A 1 7  ? 7.663   0.787   -8.424  1.00 0.00 ? 7  GLY A O    2  
ATOM 994   H H    . GLY A 1 7  ? 9.772   2.494   -5.978  1.00 0.00 ? 7  GLY A H    2  
ATOM 995   H HA2  . GLY A 1 7  ? 10.098  0.563   -7.571  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 996   H HA3  . GLY A 1 7  ? 9.395   -0.464  -6.289  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 997   N N    . GLY A 1 8  ? 7.233   1.385   -6.253  1.00 0.00 ? 8  GLY A N    2  
ATOM 998   C CA   . GLY A 1 8  ? 5.889   1.941   -6.360  1.00 0.00 ? 8  GLY A CA   2  
ATOM 999   C C    . GLY A 1 8  ? 5.627   2.838   -7.583  1.00 0.00 ? 8  GLY A C    2  
ATOM 1000  O O    . GLY A 1 8  ? 6.538   3.298   -8.257  1.00 0.00 ? 8  GLY A O    2  
ATOM 1001  H H    . GLY A 1 8  ? 7.658   1.264   -5.356  1.00 0.00 ? 8  GLY A H    2  
ATOM 1002  H HA2  . GLY A 1 8  ? 5.182   1.114   -6.285  1.00 0.00 ? 8  GLY A HA2  2  
ATOM 1003  H HA3  . GLY A 1 8  ? 5.808   2.602   -5.504  1.00 0.00 ? 8  GLY A HA3  2  
ATOM 1004  N N    . ASN A 1 9  ? 4.311   3.063   -7.809  1.00 0.00 ? 9  ASN A N    2  
ATOM 1005  C CA   . ASN A 1 9  ? 3.863   3.871   -8.953  1.00 0.00 ? 9  ASN A CA   2  
ATOM 1006  C C    . ASN A 1 9  ? 3.073   5.119   -8.515  1.00 0.00 ? 9  ASN A C    2  
ATOM 1007  O O    . ASN A 1 9  ? 2.568   5.864   -9.345  1.00 0.00 ? 9  ASN A O    2  
ATOM 1008  C CB   . ASN A 1 9  ? 3.044   3.016   -9.952  1.00 0.00 ? 9  ASN A CB   2  
ATOM 1009  C CG   . ASN A 1 9  ? 1.644   2.613   -9.446  1.00 0.00 ? 9  ASN A CG   2  
ATOM 1010  O OD1  . ASN A 1 9  ? 1.165   3.097   -8.432  1.00 0.00 ? 9  ASN A OD1  2  
ATOM 1011  N ND2  . ASN A 1 9  ? 0.999   1.706   -10.194 1.00 0.00 ? 9  ASN A ND2  2  
ATOM 1012  H H    . ASN A 1 9  ? 3.644   2.696   -7.151  1.00 0.00 ? 9  ASN A H    2  
ATOM 1013  H HA   . ASN A 1 9  ? 4.756   4.240   -9.465  1.00 0.00 ? 9  ASN A HA   2  
ATOM 1014  H HB2  . ASN A 1 9  ? 2.900   3.584   -10.871 1.00 0.00 ? 9  ASN A HB2  2  
ATOM 1015  H HB3  . ASN A 1 9  ? 3.610   2.126   -10.230 1.00 0.00 ? 9  ASN A HB3  2  
ATOM 1016  H HD21 . ASN A 1 9  ? 1.393   1.303   -11.025 1.00 0.00 ? 9  ASN A HD21 2  
ATOM 1017  H HD22 . ASN A 1 9  ? 0.079   1.458   -9.867  1.00 0.00 ? 9  ASN A HD22 2  
ATOM 1018  N N    . ALA A 1 10 ? 3.000   5.332   -7.187  1.00 0.00 ? 10 ALA A N    2  
ATOM 1019  C CA   . ALA A 1 10 ? 2.233   6.454   -6.647  1.00 0.00 ? 10 ALA A CA   2  
ATOM 1020  C C    . ALA A 1 10 ? 2.889   7.847   -6.821  1.00 0.00 ? 10 ALA A C    2  
ATOM 1021  O O    . ALA A 1 10 ? 2.683   8.730   -6.001  1.00 0.00 ? 10 ALA A O    2  
ATOM 1022  C CB   . ALA A 1 10 ? 1.959   6.183   -5.167  1.00 0.00 ? 10 ALA A CB   2  
ATOM 1023  H H    . ALA A 1 10 ? 3.399   4.669   -6.551  1.00 0.00 ? 10 ALA A H    2  
ATOM 1024  H HA   . ALA A 1 10 ? 1.283   6.467   -7.177  1.00 0.00 ? 10 ALA A HA   2  
ATOM 1025  H HB1  . ALA A 1 10 ? 1.258   6.913   -4.761  1.00 0.00 ? 10 ALA A HB1  2  
ATOM 1026  H HB2  . ALA A 1 10 ? 2.873   6.224   -4.572  1.00 0.00 ? 10 ALA A HB2  2  
ATOM 1027  H HB3  . ALA A 1 10 ? 1.511   5.201   -5.026  1.00 0.00 ? 10 ALA A HB3  2  
ATOM 1028  N N    . GLU A 1 11 ? 3.683   8.014   -7.898  1.00 0.00 ? 11 GLU A N    2  
ATOM 1029  C CA   . GLU A 1 11 ? 4.313   9.295   -8.230  1.00 0.00 ? 11 GLU A CA   2  
ATOM 1030  C C    . GLU A 1 11 ? 5.068   9.955   -7.051  1.00 0.00 ? 11 GLU A C    2  
ATOM 1031  O O    . GLU A 1 11 ? 5.076   11.167  -6.887  1.00 0.00 ? 11 GLU A O    2  
ATOM 1032  C CB   . GLU A 1 11 ? 3.249   10.227  -8.835  1.00 0.00 ? 11 GLU A CB   2  
ATOM 1033  C CG   . GLU A 1 11 ? 2.690   9.673   -10.168 1.00 0.00 ? 11 GLU A CG   2  
ATOM 1034  C CD   . GLU A 1 11 ? 1.180   9.869   -10.360 1.00 0.00 ? 11 GLU A CD   2  
ATOM 1035  O OE1  . GLU A 1 11 ? 0.456   10.126  -9.398  1.00 0.00 ? 11 GLU A OE1  2  
ATOM 1036  O OE2  . GLU A 1 11 ? 0.690   9.672   -11.471 1.00 0.00 ? 11 GLU A OE2  2  
ATOM 1037  H H    . GLU A 1 11 ? 3.764   7.262   -8.551  1.00 0.00 ? 11 GLU A H    2  
ATOM 1038  H HA   . GLU A 1 11 ? 5.057   9.061   -8.991  1.00 0.00 ? 11 GLU A HA   2  
ATOM 1039  H HB2  . GLU A 1 11 ? 2.466   10.373  -8.091  1.00 0.00 ? 11 GLU A HB2  2  
ATOM 1040  H HB3  . GLU A 1 11 ? 3.663   11.220  -9.016  1.00 0.00 ? 11 GLU A HB3  2  
ATOM 1041  H HG2  . GLU A 1 11 ? 3.214   10.131  -11.007 1.00 0.00 ? 11 GLU A HG2  2  
ATOM 1042  H HG3  . GLU A 1 11 ? 2.869   8.602   -10.255 1.00 0.00 ? 11 GLU A HG3  2  
ATOM 1043  N N    . GLY A 1 12 ? 5.723   9.081   -6.259  1.00 0.00 ? 12 GLY A N    2  
ATOM 1044  C CA   . GLY A 1 12 ? 6.536   9.562   -5.132  1.00 0.00 ? 12 GLY A CA   2  
ATOM 1045  C C    . GLY A 1 12 ? 5.720   9.728   -3.836  1.00 0.00 ? 12 GLY A C    2  
ATOM 1046  O O    . GLY A 1 12 ? 6.290   9.964   -2.779  1.00 0.00 ? 12 GLY A O    2  
ATOM 1047  H H    . GLY A 1 12 ? 5.622   8.115   -6.494  1.00 0.00 ? 12 GLY A H    2  
ATOM 1048  H HA2  . GLY A 1 12 ? 7.283   8.740   -4.923  1.00 0.00 ? 12 GLY A HA2  2  
ATOM 1049  H HA3  . GLY A 1 12 ? 6.925   10.588  -5.410  1.00 0.00 ? 12 GLY A HA3  2  
ATOM 1050  N N    . GLN A 1 13 ? 4.382   9.588   -3.941  1.00 0.00 ? 13 GLN A N    2  
ATOM 1051  C CA   . GLN A 1 13 ? 3.560   9.695   -2.738  1.00 0.00 ? 13 GLN A CA   2  
ATOM 1052  C C    . GLN A 1 13 ? 3.895   8.500   -1.811  1.00 0.00 ? 13 GLN A C    2  
ATOM 1053  O O    . GLN A 1 13 ? 3.872   7.359   -2.251  1.00 0.00 ? 13 GLN A O    2  
ATOM 1054  C CB   . GLN A 1 13 ? 2.055   9.677   -3.069  1.00 0.00 ? 13 GLN A CB   2  
ATOM 1055  C CG   . GLN A 1 13 ? 1.547   10.923  -3.822  1.00 0.00 ? 13 GLN A CG   2  
ATOM 1056  C CD   . GLN A 1 13 ? 1.577   12.154  -2.909  1.00 0.00 ? 13 GLN A CD   2  
ATOM 1057  O OE1  . GLN A 1 13 ? 2.531   12.916  -2.879  1.00 0.00 ? 13 GLN A OE1  2  
ATOM 1058  N NE2  . GLN A 1 13 ? 0.483   12.294  -2.152  1.00 0.00 ? 13 GLN A NE2  2  
ATOM 1059  H H    . GLN A 1 13 ? 3.953   9.364   -4.816  1.00 0.00 ? 13 GLN A H    2  
ATOM 1060  H HA   . GLN A 1 13 ? 3.827   10.636  -2.259  1.00 0.00 ? 13 GLN A HA   2  
ATOM 1061  H HB2  . GLN A 1 13 ? 1.815   8.779   -3.637  1.00 0.00 ? 13 GLN A HB2  2  
ATOM 1062  H HB3  . GLN A 1 13 ? 1.487   9.617   -2.139  1.00 0.00 ? 13 GLN A HB3  2  
ATOM 1063  H HG2  . GLN A 1 13 ? 2.126   11.146  -4.717  1.00 0.00 ? 13 GLN A HG2  2  
ATOM 1064  H HG3  . GLN A 1 13 ? 0.522   10.762  -4.156  1.00 0.00 ? 13 GLN A HG3  2  
ATOM 1065  H HE21 . GLN A 1 13 ? -0.278  11.649  -2.200  1.00 0.00 ? 13 GLN A HE21 2  
ATOM 1066  H HE22 . GLN A 1 13 ? 0.449   13.071  -1.526  1.00 0.00 ? 13 GLN A HE22 2  
ATOM 1067  N N    . PRO A 1 14 ? 4.219   8.790   -0.524  1.00 0.00 ? 14 PRO A N    2  
ATOM 1068  C CA   . PRO A 1 14 ? 4.626   7.750   0.417   1.00 0.00 ? 14 PRO A CA   2  
ATOM 1069  C C    . PRO A 1 14 ? 3.442   6.849   0.803   1.00 0.00 ? 14 PRO A C    2  
ATOM 1070  O O    . PRO A 1 14 ? 2.300   7.290   0.779   1.00 0.00 ? 14 PRO A O    2  
ATOM 1071  C CB   . PRO A 1 14 ? 5.128   8.539   1.632   1.00 0.00 ? 14 PRO A CB   2  
ATOM 1072  C CG   . PRO A 1 14 ? 4.397   9.884   1.571   1.00 0.00 ? 14 PRO A CG   2  
ATOM 1073  C CD   . PRO A 1 14 ? 4.196   10.125  0.074   1.00 0.00 ? 14 PRO A CD   2  
ATOM 1074  H HA   . PRO A 1 14 ? 5.417   7.139   -0.020  1.00 0.00 ? 14 PRO A HA   2  
ATOM 1075  H HB2  . PRO A 1 14 ? 4.958   8.010   2.576   1.00 0.00 ? 14 PRO A HB2  2  
ATOM 1076  H HB3  . PRO A 1 14 ? 6.202   8.714   1.515   1.00 0.00 ? 14 PRO A HB3  2  
ATOM 1077  H HG2  . PRO A 1 14 ? 3.381   9.726   2.023   1.00 0.00 ? 14 PRO A HG2  2  
ATOM 1078  H HG3  . PRO A 1 14 ? 5.036   10.697  2.003   1.00 0.00 ? 14 PRO A HG3  2  
ATOM 1079  H HD2  . PRO A 1 14 ? 3.251   10.636  -0.119  1.00 0.00 ? 14 PRO A HD2  2  
ATOM 1080  H HD3  . PRO A 1 14 ? 5.014   10.719  -0.336  1.00 0.00 ? 14 PRO A HD3  2  
ATOM 1081  N N    . CYS A 1 15 ? 3.769   5.584   1.162   1.00 0.00 ? 15 CYS A N    2  
ATOM 1082  C CA   . CYS A 1 15 ? 2.732   4.620   1.567   1.00 0.00 ? 15 CYS A CA   2  
ATOM 1083  C C    . CYS A 1 15 ? 1.717   5.244   2.541   1.00 0.00 ? 15 CYS A C    2  
ATOM 1084  O O    . CYS A 1 15 ? 2.061   6.025   3.422   1.00 0.00 ? 15 CYS A O    2  
ATOM 1085  C CB   . CYS A 1 15 ? 3.325   3.467   2.385   1.00 0.00 ? 15 CYS A CB   2  
ATOM 1086  S SG   . CYS A 1 15 ? 4.226   2.218   1.448   1.00 0.00 ? 15 CYS A SG   2  
ATOM 1087  H H    . CYS A 1 15 ? 4.743   5.337   1.138   1.00 0.00 ? 15 CYS A H    2  
ATOM 1088  H HA   . CYS A 1 15 ? 2.213   4.264   0.675   1.00 0.00 ? 15 CYS A HA   2  
ATOM 1089  H HB2  . CYS A 1 15 ? 3.958   3.871   3.166   1.00 0.00 ? 15 CYS A HB2  2  
ATOM 1090  H HB3  . CYS A 1 15 ? 2.544   2.927   2.916   1.00 0.00 ? 15 CYS A HB3  2  
ATOM 1091  N N    . LYS A 1 16 ? 0.458   4.819   2.326   1.00 0.00 ? 16 LYS A N    2  
ATOM 1092  C CA   . LYS A 1 16 ? -0.654  5.292   3.122   1.00 0.00 ? 16 LYS A CA   2  
ATOM 1093  C C    . LYS A 1 16 ? -1.234  4.108   3.904   1.00 0.00 ? 16 LYS A C    2  
ATOM 1094  O O    . LYS A 1 16 ? -1.775  3.160   3.354   1.00 0.00 ? 16 LYS A O    2  
ATOM 1095  C CB   . LYS A 1 16 ? -1.690  5.916   2.171   1.00 0.00 ? 16 LYS A CB   2  
ATOM 1096  C CG   . LYS A 1 16 ? -2.868  6.682   2.823   1.00 0.00 ? 16 LYS A CG   2  
ATOM 1097  C CD   . LYS A 1 16 ? -2.437  7.691   3.901   1.00 0.00 ? 16 LYS A CD   2  
ATOM 1098  C CE   . LYS A 1 16 ? -2.236  7.030   5.270   1.00 0.00 ? 16 LYS A CE   2  
ATOM 1099  N NZ   . LYS A 1 16 ? -2.787  7.650   6.469   1.00 0.00 ? 16 LYS A NZ   2  
ATOM 1100  H H    . LYS A 1 16 ? 0.246   4.157   1.603   1.00 0.00 ? 16 LYS A H    2  
ATOM 1101  H HA   . LYS A 1 16 ? -0.259  6.035   3.808   1.00 0.00 ? 16 LYS A HA   2  
ATOM 1102  H HB2  . LYS A 1 16 ? -1.164  6.624   1.531   1.00 0.00 ? 16 LYS A HB2  2  
ATOM 1103  H HB3  . LYS A 1 16 ? -2.051  5.106   1.527   1.00 0.00 ? 16 LYS A HB3  2  
ATOM 1104  H HG2  . LYS A 1 16 ? -3.409  7.264   2.069   1.00 0.00 ? 16 LYS A HG2  2  
ATOM 1105  H HG3  . LYS A 1 16 ? -3.601  5.975   3.216   1.00 0.00 ? 16 LYS A HG3  2  
ATOM 1106  H HD2  . LYS A 1 16 ? -1.556  8.233   3.534   1.00 0.00 ? 16 LYS A HD2  2  
ATOM 1107  H HD3  . LYS A 1 16 ? -3.226  8.416   4.025   1.00 0.00 ? 16 LYS A HD3  2  
ATOM 1108  H HE2  . LYS A 1 16 ? -2.737  6.068   5.223   1.00 0.00 ? 16 LYS A HE2  2  
ATOM 1109  H HE3  . LYS A 1 16 ? -1.178  6.878   5.471   1.00 0.00 ? 16 LYS A HE3  2  
ATOM 1110  H HZ1  . LYS A 1 16 ? -2.649  6.936   7.229   1.00 0.00 ? 16 LYS A HZ1  2  
ATOM 1111  H HZ2  . LYS A 1 16 ? -3.805  7.827   6.356   1.00 0.00 ? 16 LYS A HZ2  2  
ATOM 1112  H HZ3  . LYS A 1 16 ? -2.287  8.529   6.710   1.00 0.00 ? 16 LYS A HZ3  2  
ATOM 1113  N N    . PHE A 1 17 ? -1.097  4.259   5.230   1.00 0.00 ? 17 PHE A N    2  
ATOM 1114  C CA   . PHE A 1 17 ? -1.644  3.322   6.198   1.00 0.00 ? 17 PHE A CA   2  
ATOM 1115  C C    . PHE A 1 17 ? -2.645  4.148   7.044   1.00 0.00 ? 17 PHE A C    2  
ATOM 1116  O O    . PHE A 1 17 ? -2.327  5.274   7.438   1.00 0.00 ? 17 PHE A O    2  
ATOM 1117  C CB   . PHE A 1 17 ? -0.522  2.774   7.110   1.00 0.00 ? 17 PHE A CB   2  
ATOM 1118  C CG   . PHE A 1 17 ? 0.564   1.996   6.402   1.00 0.00 ? 17 PHE A CG   2  
ATOM 1119  C CD1  . PHE A 1 17 ? 0.296   1.148   5.332   1.00 0.00 ? 17 PHE A CD1  2  
ATOM 1120  C CD2  . PHE A 1 17 ? 1.879   2.103   6.838   1.00 0.00 ? 17 PHE A CD2  2  
ATOM 1121  C CE1  . PHE A 1 17 ? 1.316   0.440   4.711   1.00 0.00 ? 17 PHE A CE1  2  
ATOM 1122  C CE2  . PHE A 1 17 ? 2.898   1.392   6.224   1.00 0.00 ? 17 PHE A CE2  2  
ATOM 1123  C CZ   . PHE A 1 17 ? 2.625   0.563   5.152   1.00 0.00 ? 17 PHE A CZ   2  
ATOM 1124  H H    . PHE A 1 17 ? -0.660  5.095   5.557   1.00 0.00 ? 17 PHE A H    2  
ATOM 1125  H HA   . PHE A 1 17 ? -2.153  2.532   5.647   1.00 0.00 ? 17 PHE A HA   2  
ATOM 1126  H HB2  . PHE A 1 17 ? -0.054  3.619   7.631   1.00 0.00 ? 17 PHE A HB2  2  
ATOM 1127  H HB3  . PHE A 1 17 ? -0.936  2.101   7.871   1.00 0.00 ? 17 PHE A HB3  2  
ATOM 1128  H HD1  . PHE A 1 17 ? -0.708  1.021   4.973   1.00 0.00 ? 17 PHE A HD1  2  
ATOM 1129  H HD2  . PHE A 1 17 ? 2.125   2.737   7.670   1.00 0.00 ? 17 PHE A HD2  2  
ATOM 1130  H HE1  . PHE A 1 17 ? 1.074   -0.207  3.887   1.00 0.00 ? 17 PHE A HE1  2  
ATOM 1131  H HE2  . PHE A 1 17 ? 3.905   1.481   6.593   1.00 0.00 ? 17 PHE A HE2  2  
ATOM 1132  H HZ   . PHE A 1 17 ? 3.441   0.032   4.680   1.00 0.00 ? 17 PHE A HZ   2  
ATOM 1133  N N    . PRO A 1 18 ? -3.872  3.616   7.281   1.00 0.00 ? 18 PRO A N    2  
ATOM 1134  C CA   . PRO A 1 18 ? -4.449  2.431   6.643   1.00 0.00 ? 18 PRO A CA   2  
ATOM 1135  C C    . PRO A 1 18 ? -4.988  2.754   5.231   1.00 0.00 ? 18 PRO A C    2  
ATOM 1136  O O    . PRO A 1 18 ? -5.523  3.832   4.998   1.00 0.00 ? 18 PRO A O    2  
ATOM 1137  C CB   . PRO A 1 18 ? -5.621  2.062   7.561   1.00 0.00 ? 18 PRO A CB   2  
ATOM 1138  C CG   . PRO A 1 18 ? -6.058  3.395   8.176   1.00 0.00 ? 18 PRO A CG   2  
ATOM 1139  C CD   . PRO A 1 18 ? -4.772  4.222   8.260   1.00 0.00 ? 18 PRO A CD   2  
ATOM 1140  H HA   . PRO A 1 18 ? -3.732  1.618   6.602   1.00 0.00 ? 18 PRO A HA   2  
ATOM 1141  H HB2  . PRO A 1 18 ? -6.433  1.537   7.056   1.00 0.00 ? 18 PRO A HB2  2  
ATOM 1142  H HB3  . PRO A 1 18 ? -5.256  1.406   8.353   1.00 0.00 ? 18 PRO A HB3  2  
ATOM 1143  H HG2  . PRO A 1 18 ? -6.764  3.887   7.506   1.00 0.00 ? 18 PRO A HG2  2  
ATOM 1144  H HG3  . PRO A 1 18 ? -6.545  3.273   9.144   1.00 0.00 ? 18 PRO A HG3  2  
ATOM 1145  H HD2  . PRO A 1 18 ? -4.954  5.276   8.032   1.00 0.00 ? 18 PRO A HD2  2  
ATOM 1146  H HD3  . PRO A 1 18 ? -4.324  4.134   9.255   1.00 0.00 ? 18 PRO A HD3  2  
ATOM 1147  N N    . PHE A 1 19 ? -4.829  1.767   4.328   1.00 0.00 ? 19 PHE A N    2  
ATOM 1148  C CA   . PHE A 1 19 ? -5.391  1.848   2.979   1.00 0.00 ? 19 PHE A CA   2  
ATOM 1149  C C    . PHE A 1 19 ? -6.437  0.727   2.893   1.00 0.00 ? 19 PHE A C    2  
ATOM 1150  O O    . PHE A 1 19 ? -6.228  -0.367  3.399   1.00 0.00 ? 19 PHE A O    2  
ATOM 1151  C CB   . PHE A 1 19 ? -4.359  1.713   1.839   1.00 0.00 ? 19 PHE A CB   2  
ATOM 1152  C CG   . PHE A 1 19 ? -3.588  0.365   1.852   1.00 0.00 ? 19 PHE A CG   2  
ATOM 1153  C CD1  . PHE A 1 19 ? -2.601  0.114   2.833   1.00 0.00 ? 19 PHE A CD1  2  
ATOM 1154  C CD2  . PHE A 1 19 ? -3.806  -0.658  0.897   1.00 0.00 ? 19 PHE A CD2  2  
ATOM 1155  C CE1  . PHE A 1 19 ? -1.820  -1.066  2.800   1.00 0.00 ? 19 PHE A CE1  2  
ATOM 1156  C CE2  . PHE A 1 19 ? -3.037  -1.813  0.884   1.00 0.00 ? 19 PHE A CE2  2  
ATOM 1157  C CZ   . PHE A 1 19 ? -2.037  -2.010  1.815   1.00 0.00 ? 19 PHE A CZ   2  
ATOM 1158  H H    . PHE A 1 19 ? -4.389  0.909   4.609   1.00 0.00 ? 19 PHE A H    2  
ATOM 1159  H HA   . PHE A 1 19 ? -5.907  2.806   2.874   1.00 0.00 ? 19 PHE A HA   2  
ATOM 1160  H HB2  . PHE A 1 19 ? -4.955  1.909   0.928   1.00 0.00 ? 19 PHE A HB2  2  
ATOM 1161  H HB3  . PHE A 1 19 ? -3.671  2.585   1.861   1.00 0.00 ? 19 PHE A HB3  2  
ATOM 1162  H HD1  . PHE A 1 19 ? -2.484  0.847   3.640   1.00 0.00 ? 19 PHE A HD1  2  
ATOM 1163  H HD2  . PHE A 1 19 ? -4.546  -0.698  0.105   1.00 0.00 ? 19 PHE A HD2  2  
ATOM 1164  H HE1  . PHE A 1 19 ? -1.017  -1.380  3.480   1.00 0.00 ? 19 PHE A HE1  2  
ATOM 1165  H HE2  . PHE A 1 19 ? -3.228  -2.568  0.133   1.00 0.00 ? 19 PHE A HE2  2  
ATOM 1166  H HZ   . PHE A 1 19 ? -1.410  -2.893  1.786   1.00 0.00 ? 19 PHE A HZ   2  
ATOM 1167  N N    . ARG A 1 20 ? -7.578  1.060   2.269   1.00 0.00 ? 20 ARG A N    2  
ATOM 1168  C CA   . ARG A 1 20 ? -8.699  0.133   2.159   1.00 0.00 ? 20 ARG A CA   2  
ATOM 1169  C C    . ARG A 1 20 ? -8.692  -0.468  0.741   1.00 0.00 ? 20 ARG A C    2  
ATOM 1170  O O    . ARG A 1 20 ? -8.851  0.244   -0.246  1.00 0.00 ? 20 ARG A O    2  
ATOM 1171  C CB   . ARG A 1 20 ? -10.002 0.939   2.423   1.00 0.00 ? 20 ARG A CB   2  
ATOM 1172  C CG   . ARG A 1 20 ? -11.304 0.125   2.606   1.00 0.00 ? 20 ARG A CG   2  
ATOM 1173  C CD   . ARG A 1 20 ? -12.578 0.865   2.055   1.00 0.00 ? 20 ARG A CD   2  
ATOM 1174  N NE   . ARG A 1 20 ? -12.417 1.307   0.641   1.00 0.00 ? 20 ARG A NE   2  
ATOM 1175  C CZ   . ARG A 1 20 ? -12.248 0.421   -0.363  1.00 0.00 ? 20 ARG A CZ   2  
ATOM 1176  N NH1  . ARG A 1 20 ? -12.243 -0.879  -0.141  1.00 0.00 ? 20 ARG A NH1  2  
ATOM 1177  N NH2  . ARG A 1 20 ? -12.074 0.819   -1.608  1.00 0.00 ? 20 ARG A NH2  2  
ATOM 1178  H H    . ARG A 1 20 ? -7.671  1.976   1.877   1.00 0.00 ? 20 ARG A H    2  
ATOM 1179  H HA   . ARG A 1 20 ? -8.525  -0.655  2.895   1.00 0.00 ? 20 ARG A HA   2  
ATOM 1180  H HB2  . ARG A 1 20 ? -9.875  1.562   3.310   1.00 0.00 ? 20 ARG A HB2  2  
ATOM 1181  H HB3  . ARG A 1 20 ? -10.128 1.651   1.609   1.00 0.00 ? 20 ARG A HB3  2  
ATOM 1182  H HG2  . ARG A 1 20 ? -11.199 -0.835  2.111   1.00 0.00 ? 20 ARG A HG2  2  
ATOM 1183  H HG3  . ARG A 1 20 ? -11.390 -0.155  3.671   1.00 0.00 ? 20 ARG A HG3  2  
ATOM 1184  H HD2  . ARG A 1 20 ? -13.478 0.226   2.099   1.00 0.00 ? 20 ARG A HD2  2  
ATOM 1185  H HD3  . ARG A 1 20 ? -12.820 1.762   2.645   1.00 0.00 ? 20 ARG A HD3  2  
ATOM 1186  H HE   . ARG A 1 20 ? -12.383 2.269   0.300   1.00 0.00 ? 20 ARG A HE   2  
ATOM 1187  H HH11 . ARG A 1 20 ? -12.427 -1.237  0.769   1.00 0.00 ? 20 ARG A HH11 2  
ATOM 1188  H HH12 . ARG A 1 20 ? -12.035 -1.477  -0.928  1.00 0.00 ? 20 ARG A HH12 2  
ATOM 1189  H HH21 . ARG A 1 20 ? -12.162 1.791   -1.878  1.00 0.00 ? 20 ARG A HH21 2  
ATOM 1190  H HH22 . ARG A 1 20 ? -11.836 0.138   -2.310  1.00 0.00 ? 20 ARG A HH22 2  
ATOM 1191  N N    . PHE A 1 21 ? -8.502  -1.802  0.697   1.00 0.00 ? 21 PHE A N    2  
ATOM 1192  C CA   . PHE A 1 21 ? -8.481  -2.535  -0.567  1.00 0.00 ? 21 PHE A CA   2  
ATOM 1193  C C    . PHE A 1 21 ? -9.335  -3.796  -0.355  1.00 0.00 ? 21 PHE A C    2  
ATOM 1194  O O    . PHE A 1 21 ? -9.350  -4.370  0.724   1.00 0.00 ? 21 PHE A O    2  
ATOM 1195  C CB   . PHE A 1 21 ? -7.020  -2.870  -0.918  1.00 0.00 ? 21 PHE A CB   2  
ATOM 1196  C CG   . PHE A 1 21 ? -6.875  -3.858  -2.049  1.00 0.00 ? 21 PHE A CG   2  
ATOM 1197  C CD1  . PHE A 1 21 ? -7.556  -3.646  -3.230  1.00 0.00 ? 21 PHE A CD1  2  
ATOM 1198  C CD2  . PHE A 1 21 ? -6.066  -4.981  -1.948  1.00 0.00 ? 21 PHE A CD2  2  
ATOM 1199  C CE1  . PHE A 1 21 ? -7.411  -4.484  -4.324  1.00 0.00 ? 21 PHE A CE1  2  
ATOM 1200  C CE2  . PHE A 1 21 ? -5.911  -5.835  -3.036  1.00 0.00 ? 21 PHE A CE2  2  
ATOM 1201  C CZ   . PHE A 1 21 ? -6.572  -5.584  -4.230  1.00 0.00 ? 21 PHE A CZ   2  
ATOM 1202  H H    . PHE A 1 21 ? -8.377  -2.349  1.541   1.00 0.00 ? 21 PHE A H    2  
ATOM 1203  H HA   . PHE A 1 21 ? -8.935  -1.941  -1.370  1.00 0.00 ? 21 PHE A HA   2  
ATOM 1204  H HB2  . PHE A 1 21 ? -6.485  -1.958  -1.189  1.00 0.00 ? 21 PHE A HB2  2  
ATOM 1205  H HB3  . PHE A 1 21 ? -6.530  -3.280  -0.043  1.00 0.00 ? 21 PHE A HB3  2  
ATOM 1206  H HD1  . PHE A 1 21 ? -8.225  -2.811  -3.243  1.00 0.00 ? 21 PHE A HD1  2  
ATOM 1207  H HD2  . PHE A 1 21 ? -5.583  -5.201  -1.008  1.00 0.00 ? 21 PHE A HD2  2  
ATOM 1208  H HE1  . PHE A 1 21 ? -7.958  -4.279  -5.233  1.00 0.00 ? 21 PHE A HE1  2  
ATOM 1209  H HE2  . PHE A 1 21 ? -5.272  -6.700  -2.956  1.00 0.00 ? 21 PHE A HE2  2  
ATOM 1210  H HZ   . PHE A 1 21 ? -6.440  -6.245  -5.074  1.00 0.00 ? 21 PHE A HZ   2  
ATOM 1211  N N    . GLN A 1 22 ? -10.077 -4.169  -1.417  1.00 0.00 ? 22 GLN A N    2  
ATOM 1212  C CA   . GLN A 1 22 ? -10.961 -5.341  -1.407  1.00 0.00 ? 22 GLN A CA   2  
ATOM 1213  C C    . GLN A 1 22 ? -12.125 -5.220  -0.390  1.00 0.00 ? 22 GLN A C    2  
ATOM 1214  O O    . GLN A 1 22 ? -12.853 -6.175  -0.156  1.00 0.00 ? 22 GLN A O    2  
ATOM 1215  C CB   . GLN A 1 22 ? -10.218 -6.682  -1.135  1.00 0.00 ? 22 GLN A CB   2  
ATOM 1216  C CG   . GLN A 1 22 ? -9.089  -7.048  -2.122  1.00 0.00 ? 22 GLN A CG   2  
ATOM 1217  C CD   . GLN A 1 22 ? -8.036  -7.939  -1.446  1.00 0.00 ? 22 GLN A CD   2  
ATOM 1218  O OE1  . GLN A 1 22 ? -7.204  -7.476  -0.677  1.00 0.00 ? 22 GLN A OE1  2  
ATOM 1219  N NE2  . GLN A 1 22 ? -8.100  -9.229  -1.787  1.00 0.00 ? 22 GLN A NE2  2  
ATOM 1220  H H    . GLN A 1 22 ? -10.030 -3.619  -2.261  1.00 0.00 ? 22 GLN A H    2  
ATOM 1221  H HA   . GLN A 1 22 ? -11.411 -5.309  -2.397  1.00 0.00 ? 22 GLN A HA   2  
ATOM 1222  H HB2  . GLN A 1 22 ? -9.826  -6.647  -0.117  1.00 0.00 ? 22 GLN A HB2  2  
ATOM 1223  H HB3  . GLN A 1 22 ? -10.932 -7.507  -1.141  1.00 0.00 ? 22 GLN A HB3  2  
ATOM 1224  H HG2  . GLN A 1 22 ? -9.461  -7.610  -3.002  1.00 0.00 ? 22 GLN A HG2  2  
ATOM 1225  H HG3  . GLN A 1 22 ? -8.578  -6.122  -2.410  1.00 0.00 ? 22 GLN A HG3  2  
ATOM 1226  H HE21 . GLN A 1 22 ? -8.783  -9.598  -2.411  1.00 0.00 ? 22 GLN A HE21 2  
ATOM 1227  H HE22 . GLN A 1 22 ? -7.423  -9.870  -1.406  1.00 0.00 ? 22 GLN A HE22 2  
ATOM 1228  N N    . GLY A 1 23 ? -12.261 -4.017  0.201   1.00 0.00 ? 23 GLY A N    2  
ATOM 1229  C CA   . GLY A 1 23 ? -13.301 -3.788  1.201   1.00 0.00 ? 23 GLY A CA   2  
ATOM 1230  C C    . GLY A 1 23 ? -12.764 -3.888  2.638   1.00 0.00 ? 23 GLY A C    2  
ATOM 1231  O O    . GLY A 1 23 ? -13.511 -3.709  3.589   1.00 0.00 ? 23 GLY A O    2  
ATOM 1232  H H    . GLY A 1 23 ? -11.608 -3.316  -0.066  1.00 0.00 ? 23 GLY A H    2  
ATOM 1233  H HA2  . GLY A 1 23 ? -13.699 -2.785  1.035   1.00 0.00 ? 23 GLY A HA2  2  
ATOM 1234  H HA3  . GLY A 1 23 ? -14.107 -4.518  1.068   1.00 0.00 ? 23 GLY A HA3  2  
ATOM 1235  N N    . THR A 1 24 ? -11.450 -4.167  2.755   1.00 0.00 ? 24 THR A N    2  
ATOM 1236  C CA   . THR A 1 24 ? -10.824 -4.310  4.065   1.00 0.00 ? 24 THR A CA   2  
ATOM 1237  C C    . THR A 1 24 ? -9.682  -3.293  4.207   1.00 0.00 ? 24 THR A C    2  
ATOM 1238  O O    . THR A 1 24 ? -9.003  -2.945  3.250   1.00 0.00 ? 24 THR A O    2  
ATOM 1239  C CB   . THR A 1 24 ? -10.327 -5.764  4.177   1.00 0.00 ? 24 THR A CB   2  
ATOM 1240  O OG1  . THR A 1 24 ? -11.356 -6.664  3.810   1.00 0.00 ? 24 THR A OG1  2  
ATOM 1241  C CG2  . THR A 1 24 ? -9.786  -6.124  5.569   1.00 0.00 ? 24 THR A CG2  2  
ATOM 1242  H H    . THR A 1 24 ? -10.845 -4.319  1.970   1.00 0.00 ? 24 THR A H    2  
ATOM 1243  H HA   . THR A 1 24 ? -11.560 -4.095  4.843   1.00 0.00 ? 24 THR A HA   2  
ATOM 1244  H HB   . THR A 1 24 ? -9.529  -5.913  3.446   1.00 0.00 ? 24 THR A HB   2  
ATOM 1245  H HG1  . THR A 1 24 ? -12.128 -6.505  4.340   1.00 0.00 ? 24 THR A HG1  2  
ATOM 1246  H HG21 . THR A 1 24 ? -9.501  -7.175  5.611   1.00 0.00 ? 24 THR A HG21 2  
ATOM 1247  H HG22 . THR A 1 24 ? -10.524 -5.945  6.352   1.00 0.00 ? 24 THR A HG22 2  
ATOM 1248  H HG23 . THR A 1 24 ? -8.898  -5.539  5.813   1.00 0.00 ? 24 THR A HG23 2  
ATOM 1249  N N    . SER A 1 25 ? -9.531  -2.834  5.462   1.00 0.00 ? 25 SER A N    2  
ATOM 1250  C CA   . SER A 1 25 ? -8.499  -1.885  5.837   1.00 0.00 ? 25 SER A CA   2  
ATOM 1251  C C    . SER A 1 25 ? -7.206  -2.661  6.149   1.00 0.00 ? 25 SER A C    2  
ATOM 1252  O O    . SER A 1 25 ? -7.195  -3.631  6.895   1.00 0.00 ? 25 SER A O    2  
ATOM 1253  C CB   . SER A 1 25 ? -9.020  -1.112  7.058   1.00 0.00 ? 25 SER A CB   2  
ATOM 1254  O OG   . SER A 1 25 ? -9.930  -1.940  7.780   1.00 0.00 ? 25 SER A OG   2  
ATOM 1255  H H    . SER A 1 25 ? -10.095 -3.126  6.237   1.00 0.00 ? 25 SER A H    2  
ATOM 1256  H HA   . SER A 1 25 ? -8.328  -1.205  5.002   1.00 0.00 ? 25 SER A HA   2  
ATOM 1257  H HB2  . SER A 1 25 ? -8.191  -0.778  7.694   1.00 0.00 ? 25 SER A HB2  2  
ATOM 1258  H HB3  . SER A 1 25 ? -9.549  -0.219  6.707   1.00 0.00 ? 25 SER A HB3  2  
ATOM 1259  H HG   . SER A 1 25 ? -10.229 -1.512  8.580   1.00 0.00 ? 25 SER A HG   2  
ATOM 1260  N N    . TYR A 1 26 ? -6.127  -2.173  5.517   1.00 0.00 ? 26 TYR A N    2  
ATOM 1261  C CA   . TYR A 1 26 ? -4.801  -2.753  5.637   1.00 0.00 ? 26 TYR A CA   2  
ATOM 1262  C C    . TYR A 1 26 ? -3.855  -1.660  6.154   1.00 0.00 ? 26 TYR A C    2  
ATOM 1263  O O    . TYR A 1 26 ? -3.833  -0.550  5.638   1.00 0.00 ? 26 TYR A O    2  
ATOM 1264  C CB   . TYR A 1 26 ? -4.364  -3.231  4.243   1.00 0.00 ? 26 TYR A CB   2  
ATOM 1265  C CG   . TYR A 1 26 ? -5.286  -4.258  3.627   1.00 0.00 ? 26 TYR A CG   2  
ATOM 1266  C CD1  . TYR A 1 26 ? -5.804  -5.308  4.375   1.00 0.00 ? 26 TYR A CD1  2  
ATOM 1267  C CD2  . TYR A 1 26 ? -5.633  -4.185  2.282   1.00 0.00 ? 26 TYR A CD2  2  
ATOM 1268  C CE1  . TYR A 1 26 ? -6.615  -6.258  3.782   1.00 0.00 ? 26 TYR A CE1  2  
ATOM 1269  C CE2  . TYR A 1 26 ? -6.450  -5.149  1.695   1.00 0.00 ? 26 TYR A CE2  2  
ATOM 1270  C CZ   . TYR A 1 26 ? -6.939  -6.195  2.451   1.00 0.00 ? 26 TYR A CZ   2  
ATOM 1271  O OH   . TYR A 1 26 ? -7.748  -7.181  1.930   1.00 0.00 ? 26 TYR A OH   2  
ATOM 1272  H H    . TYR A 1 26 ? -6.213  -1.379  4.914   1.00 0.00 ? 26 TYR A H    2  
ATOM 1273  H HA   . TYR A 1 26 ? -4.826  -3.569  6.360   1.00 0.00 ? 26 TYR A HA   2  
ATOM 1274  H HB2  . TYR A 1 26 ? -4.336  -2.361  3.580   1.00 0.00 ? 26 TYR A HB2  2  
ATOM 1275  H HB3  . TYR A 1 26 ? -3.361  -3.665  4.300   1.00 0.00 ? 26 TYR A HB3  2  
ATOM 1276  H HD1  . TYR A 1 26 ? -5.598  -5.391  5.425   1.00 0.00 ? 26 TYR A HD1  2  
ATOM 1277  H HD2  . TYR A 1 26 ? -5.280  -3.360  1.687   1.00 0.00 ? 26 TYR A HD2  2  
ATOM 1278  H HE1  . TYR A 1 26 ? -7.028  -7.074  4.321   1.00 0.00 ? 26 TYR A HE1  2  
ATOM 1279  H HE2  . TYR A 1 26 ? -6.726  -5.081  0.657   1.00 0.00 ? 26 TYR A HE2  2  
ATOM 1280  H HH   . TYR A 1 26 ? -7.508  -7.364  1.026   1.00 0.00 ? 26 TYR A HH   2  
ATOM 1281  N N    . ASP A 1 27 ? -3.095  -2.035  7.204   1.00 0.00 ? 27 ASP A N    2  
ATOM 1282  C CA   . ASP A 1 27 ? -2.173  -1.107  7.866   1.00 0.00 ? 27 ASP A CA   2  
ATOM 1283  C C    . ASP A 1 27 ? -0.723  -1.635  7.790   1.00 0.00 ? 27 ASP A C    2  
ATOM 1284  O O    . ASP A 1 27 ? 0.104   -1.418  8.663   1.00 0.00 ? 27 ASP A O    2  
ATOM 1285  C CB   . ASP A 1 27 ? -2.667  -0.912  9.314   1.00 0.00 ? 27 ASP A CB   2  
ATOM 1286  C CG   . ASP A 1 27 ? -2.313  0.480   9.860   1.00 0.00 ? 27 ASP A CG   2  
ATOM 1287  O OD1  . ASP A 1 27 ? -2.808  1.463   9.310   1.00 0.00 ? 27 ASP A OD1  2  
ATOM 1288  O OD2  . ASP A 1 27 ? -1.566  0.570   10.831  1.00 0.00 ? 27 ASP A OD2  2  
ATOM 1289  H H    . ASP A 1 27 ? -3.192  -2.959  7.568   1.00 0.00 ? 27 ASP A H    2  
ATOM 1290  H HA   . ASP A 1 27 ? -2.190  -0.154  7.338   1.00 0.00 ? 27 ASP A HA   2  
ATOM 1291  H HB2  . ASP A 1 27 ? -3.754  -0.990  9.351   1.00 0.00 ? 27 ASP A HB2  2  
ATOM 1292  H HB3  . ASP A 1 27 ? -2.279  -1.685  9.979   1.00 0.00 ? 27 ASP A HB3  2  
ATOM 1293  N N    . SER A 1 28 ? -0.462  -2.366  6.689   1.00 0.00 ? 28 SER A N    2  
ATOM 1294  C CA   . SER A 1 28 ? 0.865   -2.920  6.462   1.00 0.00 ? 28 SER A CA   2  
ATOM 1295  C C    . SER A 1 28 ? 0.875   -3.381  5.002   1.00 0.00 ? 28 SER A C    2  
ATOM 1296  O O    . SER A 1 28 ? -0.174  -3.443  4.370   1.00 0.00 ? 28 SER A O    2  
ATOM 1297  C CB   . SER A 1 28 ? 1.129   -4.086  7.443   1.00 0.00 ? 28 SER A CB   2  
ATOM 1298  O OG   . SER A 1 28 ? 0.115   -5.070  7.337   1.00 0.00 ? 28 SER A OG   2  
ATOM 1299  H H    . SER A 1 28 ? -1.129  -2.548  5.963   1.00 0.00 ? 28 SER A H    2  
ATOM 1300  H HA   . SER A 1 28 ? 1.592   -2.107  6.557   1.00 0.00 ? 28 SER A HA   2  
ATOM 1301  H HB2  . SER A 1 28 ? 2.084   -4.581  7.181   1.00 0.00 ? 28 SER A HB2  2  
ATOM 1302  H HB3  . SER A 1 28 ? 1.151   -3.724  8.497   1.00 0.00 ? 28 SER A HB3  2  
ATOM 1303  H HG   . SER A 1 28 ? -0.738  -4.668  7.468   1.00 0.00 ? 28 SER A HG   2  
ATOM 1304  N N    . CYS A 1 29 ? 2.086   -3.678  4.493   1.00 0.00 ? 29 CYS A N    2  
ATOM 1305  C CA   . CYS A 1 29 ? 2.178   -4.109  3.101   1.00 0.00 ? 29 CYS A CA   2  
ATOM 1306  C C    . CYS A 1 29 ? 1.369   -5.420  2.873   1.00 0.00 ? 29 CYS A C    2  
ATOM 1307  O O    . CYS A 1 29 ? 1.512   -6.351  3.662   1.00 0.00 ? 29 CYS A O    2  
ATOM 1308  C CB   . CYS A 1 29 ? 3.636   -4.407  2.777   1.00 0.00 ? 29 CYS A CB   2  
ATOM 1309  S SG   . CYS A 1 29 ? 4.821   -3.196  3.390   1.00 0.00 ? 29 CYS A SG   2  
ATOM 1310  H H    . CYS A 1 29 ? 2.919   -3.601  5.044   1.00 0.00 ? 29 CYS A H    2  
ATOM 1311  H HA   . CYS A 1 29 ? 1.864   -3.245  2.509   1.00 0.00 ? 29 CYS A HA   2  
ATOM 1312  H HB2  . CYS A 1 29 ? 3.929   -5.373  3.204   1.00 0.00 ? 29 CYS A HB2  2  
ATOM 1313  H HB3  . CYS A 1 29 ? 3.713   -4.465  1.690   1.00 0.00 ? 29 CYS A HB3  2  
ATOM 1314  N N    . THR A 1 30 ? 0.560   -5.488  1.794   1.00 0.00 ? 30 THR A N    2  
ATOM 1315  C CA   . THR A 1 30 ? -0.209  -6.698  1.484   1.00 0.00 ? 30 THR A CA   2  
ATOM 1316  C C    . THR A 1 30 ? 0.331   -7.307  0.182   1.00 0.00 ? 30 THR A C    2  
ATOM 1317  O O    . THR A 1 30 ? 0.924   -6.624  -0.641  1.00 0.00 ? 30 THR A O    2  
ATOM 1318  C CB   . THR A 1 30 ? -1.715  -6.378  1.359   1.00 0.00 ? 30 THR A CB   2  
ATOM 1319  O OG1  . THR A 1 30 ? -2.401  -7.612  1.194   1.00 0.00 ? 30 THR A OG1  2  
ATOM 1320  C CG2  . THR A 1 30 ? -2.040  -5.448  0.167   1.00 0.00 ? 30 THR A CG2  2  
ATOM 1321  H H    . THR A 1 30 ? 0.480   -4.724  1.149   1.00 0.00 ? 30 THR A H    2  
ATOM 1322  H HA   . THR A 1 30 ? -0.067  -7.424  2.285   1.00 0.00 ? 30 THR A HA   2  
ATOM 1323  H HB   . THR A 1 30 ? -2.026  -5.917  2.310   1.00 0.00 ? 30 THR A HB   2  
ATOM 1324  H HG1  . THR A 1 30 ? -3.347  -7.473  1.203   1.00 0.00 ? 30 THR A HG1  2  
ATOM 1325  H HG21 . THR A 1 30 ? -1.409  -4.558  0.151   1.00 0.00 ? 30 THR A HG21 2  
ATOM 1326  H HG22 . THR A 1 30 ? -3.077  -5.109  0.175   1.00 0.00 ? 30 THR A HG22 2  
ATOM 1327  H HG23 . THR A 1 30 ? -1.881  -5.959  -0.785  1.00 0.00 ? 30 THR A HG23 2  
ATOM 1328  N N    . THR A 1 31 ? 0.082   -8.622  0.048   1.00 0.00 ? 31 THR A N    2  
ATOM 1329  C CA   . THR A 1 31 ? 0.486   -9.365  -1.145  1.00 0.00 ? 31 THR A CA   2  
ATOM 1330  C C    . THR A 1 31 ? -0.705  -9.580  -2.086  1.00 0.00 ? 31 THR A C    2  
ATOM 1331  O O    . THR A 1 31 ? -0.549  -10.091 -3.187  1.00 0.00 ? 31 THR A O    2  
ATOM 1332  C CB   . THR A 1 31 ? 1.134   -10.712 -0.755  1.00 0.00 ? 31 THR A CB   2  
ATOM 1333  O OG1  . THR A 1 31 ? 1.305   -10.757 0.658   1.00 0.00 ? 31 THR A OG1  2  
ATOM 1334  C CG2  . THR A 1 31 ? 2.480   -10.907 -1.472  1.00 0.00 ? 31 THR A CG2  2  
ATOM 1335  H H    . THR A 1 31 ? -0.398  -9.102  0.782   1.00 0.00 ? 31 THR A H    2  
ATOM 1336  H HA   . THR A 1 31 ? 1.188   -8.763  -1.713  1.00 0.00 ? 31 THR A HA   2  
ATOM 1337  H HB   . THR A 1 31 ? 0.474   -11.530 -1.076  1.00 0.00 ? 31 THR A HB   2  
ATOM 1338  H HG1  . THR A 1 31 ? 1.634   -11.614 0.910   1.00 0.00 ? 31 THR A HG1  2  
ATOM 1339  H HG21 . THR A 1 31 ? 3.188   -10.118 -1.230  1.00 0.00 ? 31 THR A HG21 2  
ATOM 1340  H HG22 . THR A 1 31 ? 2.335   -10.877 -2.551  1.00 0.00 ? 31 THR A HG22 2  
ATOM 1341  H HG23 . THR A 1 31 ? 2.941   -11.866 -1.235  1.00 0.00 ? 31 THR A HG23 2  
ATOM 1342  N N    . GLU A 1 32 ? -1.900  -9.177  -1.616  1.00 0.00 ? 32 GLU A N    2  
ATOM 1343  C CA   . GLU A 1 32 ? -3.079  -9.377  -2.451  1.00 0.00 ? 32 GLU A CA   2  
ATOM 1344  C C    . GLU A 1 32 ? -2.922  -8.623  -3.790  1.00 0.00 ? 32 GLU A C    2  
ATOM 1345  O O    . GLU A 1 32 ? -2.942  -7.399  -3.836  1.00 0.00 ? 32 GLU A O    2  
ATOM 1346  C CB   . GLU A 1 32 ? -4.327  -8.909  -1.683  1.00 0.00 ? 32 GLU A CB   2  
ATOM 1347  C CG   . GLU A 1 32 ? -4.661  -9.783  -0.461  1.00 0.00 ? 32 GLU A CG   2  
ATOM 1348  C CD   . GLU A 1 32 ? -5.077  -11.195 -0.899  1.00 0.00 ? 32 GLU A CD   2  
ATOM 1349  O OE1  . GLU A 1 32 ? -6.249  -11.388 -1.218  1.00 0.00 ? 32 GLU A OE1  2  
ATOM 1350  O OE2  . GLU A 1 32 ? -4.223  -12.078 -0.928  1.00 0.00 ? 32 GLU A OE2  2  
ATOM 1351  H H    . GLU A 1 32 ? -1.990  -8.754  -0.713  1.00 0.00 ? 32 GLU A H    2  
ATOM 1352  H HA   . GLU A 1 32 ? -3.143  -10.448 -2.651  1.00 0.00 ? 32 GLU A HA   2  
ATOM 1353  H HB2  . GLU A 1 32 ? -4.188  -7.878  -1.359  1.00 0.00 ? 32 GLU A HB2  2  
ATOM 1354  H HB3  . GLU A 1 32 ? -5.191  -8.906  -2.349  1.00 0.00 ? 32 GLU A HB3  2  
ATOM 1355  H HG2  . GLU A 1 32 ? -3.815  -9.861  0.222   1.00 0.00 ? 32 GLU A HG2  2  
ATOM 1356  H HG3  . GLU A 1 32 ? -5.483  -9.342  0.104   1.00 0.00 ? 32 GLU A HG3  2  
ATOM 1357  N N    . GLY A 1 33 ? -2.756  -9.427  -4.862  1.00 0.00 ? 33 GLY A N    2  
ATOM 1358  C CA   . GLY A 1 33 ? -2.611  -8.889  -6.213  1.00 0.00 ? 33 GLY A CA   2  
ATOM 1359  C C    . GLY A 1 33 ? -1.232  -9.158  -6.839  1.00 0.00 ? 33 GLY A C    2  
ATOM 1360  O O    . GLY A 1 33 ? -1.086  -9.088  -8.052  1.00 0.00 ? 33 GLY A O    2  
ATOM 1361  H H    . GLY A 1 33 ? -2.728  -10.415 -4.706  1.00 0.00 ? 33 GLY A H    2  
ATOM 1362  H HA2  . GLY A 1 33 ? -3.374  -9.381  -6.822  1.00 0.00 ? 33 GLY A HA2  2  
ATOM 1363  H HA3  . GLY A 1 33 ? -2.795  -7.810  -6.207  1.00 0.00 ? 33 GLY A HA3  2  
ATOM 1364  N N    . ARG A 1 34 ? -0.232  -9.450  -5.982  1.00 0.00 ? 34 ARG A N    2  
ATOM 1365  C CA   . ARG A 1 34 ? 1.121   -9.697  -6.519  1.00 0.00 ? 34 ARG A CA   2  
ATOM 1366  C C    . ARG A 1 34 ? 1.638   -11.053 -6.019  1.00 0.00 ? 34 ARG A C    2  
ATOM 1367  O O    . ARG A 1 34 ? 1.724   -11.304 -4.825  1.00 0.00 ? 34 ARG A O    2  
ATOM 1368  C CB   . ARG A 1 34 ? 2.055   -8.583  -6.033  1.00 0.00 ? 34 ARG A CB   2  
ATOM 1369  C CG   . ARG A 1 34 ? 1.640   -7.215  -6.609  1.00 0.00 ? 34 ARG A CG   2  
ATOM 1370  C CD   . ARG A 1 34 ? 2.829   -6.242  -6.755  1.00 0.00 ? 34 ARG A CD   2  
ATOM 1371  N NE   . ARG A 1 34 ? 3.667   -6.670  -7.892  1.00 0.00 ? 34 ARG A NE   2  
ATOM 1372  C CZ   . ARG A 1 34 ? 3.397   -6.318  -9.175  1.00 0.00 ? 34 ARG A CZ   2  
ATOM 1373  N NH1  . ARG A 1 34 ? 2.576   -5.317  -9.475  1.00 0.00 ? 34 ARG A NH1  2  
ATOM 1374  N NH2  . ARG A 1 34 ? 3.969   -6.989  -10.166 1.00 0.00 ? 34 ARG A NH2  2  
ATOM 1375  H H    . ARG A 1 34 ? -0.420  -9.505  -4.986  1.00 0.00 ? 34 ARG A H    2  
ATOM 1376  H HA   . ARG A 1 34 ? 1.148   -9.711  -7.631  1.00 0.00 ? 34 ARG A HA   2  
ATOM 1377  H HB2  . ARG A 1 34 ? 2.022   -8.550  -4.914  1.00 0.00 ? 34 ARG A HB2  2  
ATOM 1378  H HB3  . ARG A 1 34 ? 3.057   -8.834  -6.438  1.00 0.00 ? 34 ARG A HB3  2  
ATOM 1379  H HG2  . ARG A 1 34 ? 1.186   -7.358  -7.591  1.00 0.00 ? 34 ARG A HG2  2  
ATOM 1380  H HG3  . ARG A 1 34 ? 0.841   -6.791  -5.994  1.00 0.00 ? 34 ARG A HG3  2  
ATOM 1381  H HD2  . ARG A 1 34 ? 2.486   -5.219  -6.940  1.00 0.00 ? 34 ARG A HD2  2  
ATOM 1382  H HD3  . ARG A 1 34 ? 3.440   -6.231  -5.841  1.00 0.00 ? 34 ARG A HD3  2  
ATOM 1383  H HE   . ARG A 1 34 ? 4.387   -7.377  -7.779  1.00 0.00 ? 34 ARG A HE   2  
ATOM 1384  H HH11 . ARG A 1 34 ? 2.313   -4.630  -8.782  1.00 0.00 ? 34 ARG A HH11 2  
ATOM 1385  H HH12 . ARG A 1 34 ? 2.224   -5.186  -10.399 1.00 0.00 ? 34 ARG A HH12 2  
ATOM 1386  H HH21 . ARG A 1 34 ? 4.609   -7.732  -9.923  1.00 0.00 ? 34 ARG A HH21 2  
ATOM 1387  H HH22 . ARG A 1 34 ? 3.804   -6.793  -11.129 1.00 0.00 ? 34 ARG A HH22 2  
ATOM 1388  N N    . THR A 1 35 ? 2.011   -11.889 -7.003  1.00 0.00 ? 35 THR A N    2  
ATOM 1389  C CA   . THR A 1 35 ? 2.526   -13.226 -6.713  1.00 0.00 ? 35 THR A CA   2  
ATOM 1390  C C    . THR A 1 35 ? 4.009   -13.319 -7.122  1.00 0.00 ? 35 THR A C    2  
ATOM 1391  O O    . THR A 1 35 ? 4.515   -14.382 -7.452  1.00 0.00 ? 35 THR A O    2  
ATOM 1392  C CB   . THR A 1 35 ? 1.664   -14.252 -7.478  1.00 0.00 ? 35 THR A CB   2  
ATOM 1393  O OG1  . THR A 1 35 ? 0.332   -13.756 -7.493  1.00 0.00 ? 35 THR A OG1  2  
ATOM 1394  C CG2  . THR A 1 35 ? 1.716   -15.646 -6.828  1.00 0.00 ? 35 THR A CG2  2  
ATOM 1395  H H    . THR A 1 35 ? 1.882   -11.618 -7.954  1.00 0.00 ? 35 THR A H    2  
ATOM 1396  H HA   . THR A 1 35 ? 2.453   -13.409 -5.639  1.00 0.00 ? 35 THR A HA   2  
ATOM 1397  H HB   . THR A 1 35 ? 2.029   -14.315 -8.510  1.00 0.00 ? 35 THR A HB   2  
ATOM 1398  H HG1  . THR A 1 35 ? -0.251  -14.365 -7.935  1.00 0.00 ? 35 THR A HG1  2  
ATOM 1399  H HG21 . THR A 1 35 ? 2.742   -16.004 -6.748  1.00 0.00 ? 35 THR A HG21 2  
ATOM 1400  H HG22 . THR A 1 35 ? 1.166   -16.389 -7.406  1.00 0.00 ? 35 THR A HG22 2  
ATOM 1401  H HG23 . THR A 1 35 ? 1.296   -15.624 -5.822  1.00 0.00 ? 35 THR A HG23 2  
ATOM 1402  N N    . ASP A 1 36 ? 4.665   -12.141 -7.083  1.00 0.00 ? 36 ASP A N    2  
ATOM 1403  C CA   . ASP A 1 36 ? 6.068   -12.013 -7.482  1.00 0.00 ? 36 ASP A CA   2  
ATOM 1404  C C    . ASP A 1 36 ? 6.998   -11.696 -6.291  1.00 0.00 ? 36 ASP A C    2  
ATOM 1405  O O    . ASP A 1 36 ? 8.190   -11.472 -6.466  1.00 0.00 ? 36 ASP A O    2  
ATOM 1406  C CB   . ASP A 1 36 ? 6.169   -10.914 -8.554  1.00 0.00 ? 36 ASP A CB   2  
ATOM 1407  C CG   . ASP A 1 36 ? 5.678   -9.533  -8.089  1.00 0.00 ? 36 ASP A CG   2  
ATOM 1408  O OD1  . ASP A 1 36 ? 5.337   -9.352  -6.922  1.00 0.00 ? 36 ASP A OD1  2  
ATOM 1409  O OD2  . ASP A 1 36 ? 5.631   -8.630  -8.915  1.00 0.00 ? 36 ASP A OD2  2  
ATOM 1410  H H    . ASP A 1 36 ? 4.206   -11.285 -6.834  1.00 0.00 ? 36 ASP A H    2  
ATOM 1411  H HA   . ASP A 1 36 ? 6.406   -12.960 -7.908  1.00 0.00 ? 36 ASP A HA   2  
ATOM 1412  H HB2  . ASP A 1 36 ? 7.201   -10.813 -8.895  1.00 0.00 ? 36 ASP A HB2  2  
ATOM 1413  H HB3  . ASP A 1 36 ? 5.577   -11.201 -9.423  1.00 0.00 ? 36 ASP A HB3  2  
ATOM 1414  N N    . GLY A 1 37 ? 6.404   -11.708 -5.078  1.00 0.00 ? 37 GLY A N    2  
ATOM 1415  C CA   . GLY A 1 37 ? 7.181   -11.473 -3.863  1.00 0.00 ? 37 GLY A CA   2  
ATOM 1416  C C    . GLY A 1 37 ? 7.018   -10.064 -3.286  1.00 0.00 ? 37 GLY A C    2  
ATOM 1417  O O    . GLY A 1 37 ? 7.280   -9.834  -2.111  1.00 0.00 ? 37 GLY A O    2  
ATOM 1418  H H    . GLY A 1 37 ? 5.429   -11.900 -5.014  1.00 0.00 ? 37 GLY A H    2  
ATOM 1419  H HA2  . GLY A 1 37 ? 6.853   -12.210 -3.127  1.00 0.00 ? 37 GLY A HA2  2  
ATOM 1420  H HA3  . GLY A 1 37 ? 8.245   -11.618 -4.083  1.00 0.00 ? 37 GLY A HA3  2  
ATOM 1421  N N    . TYR A 1 38 ? 6.619   -9.117  -4.154  1.00 0.00 ? 38 TYR A N    2  
ATOM 1422  C CA   . TYR A 1 38 ? 6.592   -7.728  -3.697  1.00 0.00 ? 38 TYR A CA   2  
ATOM 1423  C C    . TYR A 1 38 ? 5.260   -7.369  -3.022  1.00 0.00 ? 38 TYR A C    2  
ATOM 1424  O O    . TYR A 1 38 ? 4.255   -7.089  -3.663  1.00 0.00 ? 38 TYR A O    2  
ATOM 1425  C CB   . TYR A 1 38 ? 6.973   -6.801  -4.868  1.00 0.00 ? 38 TYR A CB   2  
ATOM 1426  C CG   . TYR A 1 38 ? 8.175   -7.368  -5.584  1.00 0.00 ? 38 TYR A CG   2  
ATOM 1427  C CD1  . TYR A 1 38 ? 9.335   -7.707  -4.902  1.00 0.00 ? 38 TYR A CD1  2  
ATOM 1428  C CD2  . TYR A 1 38 ? 8.131   -7.640  -6.939  1.00 0.00 ? 38 TYR A CD2  2  
ATOM 1429  C CE1  . TYR A 1 38 ? 10.376  -8.348  -5.537  1.00 0.00 ? 38 TYR A CE1  2  
ATOM 1430  C CE2  . TYR A 1 38 ? 9.168   -8.282  -7.576  1.00 0.00 ? 38 TYR A CE2  2  
ATOM 1431  C CZ   . TYR A 1 38 ? 10.300  -8.655  -6.880  1.00 0.00 ? 38 TYR A CZ   2  
ATOM 1432  O OH   . TYR A 1 38 ? 11.330  -9.329  -7.500  1.00 0.00 ? 38 TYR A OH   2  
ATOM 1433  H H    . TYR A 1 38 ? 6.393   -9.331  -5.109  1.00 0.00 ? 38 TYR A H    2  
ATOM 1434  H HA   . TYR A 1 38 ? 7.378   -7.611  -2.947  1.00 0.00 ? 38 TYR A HA   2  
ATOM 1435  H HB2  . TYR A 1 38 ? 6.141   -6.715  -5.570  1.00 0.00 ? 38 TYR A HB2  2  
ATOM 1436  H HB3  . TYR A 1 38 ? 7.193   -5.790  -4.522  1.00 0.00 ? 38 TYR A HB3  2  
ATOM 1437  H HD1  . TYR A 1 38 ? 9.475   -7.521  -3.862  1.00 0.00 ? 38 TYR A HD1  2  
ATOM 1438  H HD2  . TYR A 1 38 ? 7.291   -7.391  -7.544  1.00 0.00 ? 38 TYR A HD2  2  
ATOM 1439  H HE1  . TYR A 1 38 ? 11.215  -8.612  -4.937  1.00 0.00 ? 38 TYR A HE1  2  
ATOM 1440  H HE2  . TYR A 1 38 ? 9.019   -8.482  -8.611  1.00 0.00 ? 38 TYR A HE2  2  
ATOM 1441  H HH   . TYR A 1 38 ? 10.976  -10.107 -7.913  1.00 0.00 ? 38 TYR A HH   2  
ATOM 1442  N N    . ARG A 1 39 ? 5.343   -7.355  -1.673  1.00 0.00 ? 39 ARG A N    2  
ATOM 1443  C CA   . ARG A 1 39 ? 4.163   -6.876  -0.909  1.00 0.00 ? 39 ARG A CA   2  
ATOM 1444  C C    . ARG A 1 39 ? 4.112   -5.354  -1.155  1.00 0.00 ? 39 ARG A C    2  
ATOM 1445  O O    . ARG A 1 39 ? 5.150   -4.703  -1.148  1.00 0.00 ? 39 ARG A O    2  
ATOM 1446  C CB   . ARG A 1 39 ? 4.351   -7.187  0.594   1.00 0.00 ? 39 ARG A CB   2  
ATOM 1447  C CG   . ARG A 1 39 ? 4.422   -8.677  0.951   1.00 0.00 ? 39 ARG A CG   2  
ATOM 1448  C CD   . ARG A 1 39 ? 4.583   -8.864  2.476   1.00 0.00 ? 39 ARG A CD   2  
ATOM 1449  N NE   . ARG A 1 39 ? 3.352   -8.487  3.188   1.00 0.00 ? 39 ARG A NE   2  
ATOM 1450  C CZ   . ARG A 1 39 ? 2.415   -9.362  3.615   1.00 0.00 ? 39 ARG A CZ   2  
ATOM 1451  N NH1  . ARG A 1 39 ? 2.572   -10.670 3.441   1.00 0.00 ? 39 ARG A NH1  2  
ATOM 1452  N NH2  . ARG A 1 39 ? 1.330   -8.890  4.219   1.00 0.00 ? 39 ARG A NH2  2  
ATOM 1453  H H    . ARG A 1 39 ? 6.268   -7.594  -1.314  1.00 0.00 ? 39 ARG A H    2  
ATOM 1454  H HA   . ARG A 1 39 ? 3.206   -7.292  -1.284  1.00 0.00 ? 39 ARG A HA   2  
ATOM 1455  H HB2  . ARG A 1 39 ? 5.255   -6.698  0.953   1.00 0.00 ? 39 ARG A HB2  2  
ATOM 1456  H HB3  . ARG A 1 39 ? 3.532   -6.774  1.176   1.00 0.00 ? 39 ARG A HB3  2  
ATOM 1457  H HG2  . ARG A 1 39 ? 3.490   -9.161  0.645   1.00 0.00 ? 39 ARG A HG2  2  
ATOM 1458  H HG3  . ARG A 1 39 ? 5.251   -9.146  0.396   1.00 0.00 ? 39 ARG A HG3  2  
ATOM 1459  H HD2  . ARG A 1 39 ? 4.859   -9.886  2.741   1.00 0.00 ? 39 ARG A HD2  2  
ATOM 1460  H HD3  . ARG A 1 39 ? 5.368   -8.218  2.875   1.00 0.00 ? 39 ARG A HD3  2  
ATOM 1461  H HE   . ARG A 1 39 ? 3.160   -7.521  3.397   1.00 0.00 ? 39 ARG A HE   2  
ATOM 1462  H HH11 . ARG A 1 39 ? 3.395   -10.997 2.977   1.00 0.00 ? 39 ARG A HH11 2  
ATOM 1463  H HH12 . ARG A 1 39 ? 1.894   -11.331 3.759   1.00 0.00 ? 39 ARG A HH12 2  
ATOM 1464  H HH21 . ARG A 1 39 ? 1.225   -7.886  4.288   1.00 0.00 ? 39 ARG A HH21 2  
ATOM 1465  H HH22 . ARG A 1 39 ? 0.617   -9.478  4.598   1.00 0.00 ? 39 ARG A HH22 2  
ATOM 1466  N N    . TRP A 1 40 ? 2.897   -4.833  -1.418  1.00 0.00 ? 40 TRP A N    2  
ATOM 1467  C CA   . TRP A 1 40 ? 2.719   -3.426  -1.748  1.00 0.00 ? 40 TRP A CA   2  
ATOM 1468  C C    . TRP A 1 40 ? 1.816   -2.743  -0.703  1.00 0.00 ? 40 TRP A C    2  
ATOM 1469  O O    . TRP A 1 40 ? 1.138   -3.402  0.075   1.00 0.00 ? 40 TRP A O    2  
ATOM 1470  C CB   . TRP A 1 40 ? 2.119   -3.349  -3.166  1.00 0.00 ? 40 TRP A CB   2  
ATOM 1471  C CG   . TRP A 1 40 ? 0.763   -4.029  -3.227  1.00 0.00 ? 40 TRP A CG   2  
ATOM 1472  C CD1  . TRP A 1 40 ? 0.525   -5.372  -3.542  1.00 0.00 ? 40 TRP A CD1  2  
ATOM 1473  C CD2  . TRP A 1 40 ? -0.531  -3.429  -2.998  1.00 0.00 ? 40 TRP A CD2  2  
ATOM 1474  N NE1  . TRP A 1 40 ? -0.811  -5.601  -3.518  1.00 0.00 ? 40 TRP A NE1  2  
ATOM 1475  C CE2  . TRP A 1 40 ? -1.488  -4.442  -3.192  1.00 0.00 ? 40 TRP A CE2  2  
ATOM 1476  C CE3  . TRP A 1 40 ? -0.940  -2.168  -2.662  1.00 0.00 ? 40 TRP A CE3  2  
ATOM 1477  C CZ2  . TRP A 1 40 ? -2.814  -4.167  -3.052  1.00 0.00 ? 40 TRP A CZ2  2  
ATOM 1478  C CZ3  . TRP A 1 40 ? -2.300  -1.875  -2.512  1.00 0.00 ? 40 TRP A CZ3  2  
ATOM 1479  C CH2  . TRP A 1 40 ? -3.240  -2.887  -2.710  1.00 0.00 ? 40 TRP A CH2  2  
ATOM 1480  H H    . TRP A 1 40 ? 2.062   -5.391  -1.425  1.00 0.00 ? 40 TRP A H    2  
ATOM 1481  H HA   . TRP A 1 40 ? 3.698   -2.952  -1.725  1.00 0.00 ? 40 TRP A HA   2  
ATOM 1482  H HB2  . TRP A 1 40 ? 2.032   -2.320  -3.509  1.00 0.00 ? 40 TRP A HB2  2  
ATOM 1483  H HB3  . TRP A 1 40 ? 2.783   -3.837  -3.881  1.00 0.00 ? 40 TRP A HB3  2  
ATOM 1484  H HD1  . TRP A 1 40 ? 1.288   -6.106  -3.759  1.00 0.00 ? 40 TRP A HD1  2  
ATOM 1485  H HE1  . TRP A 1 40 ? -1.284  -6.444  -3.693  1.00 0.00 ? 40 TRP A HE1  2  
ATOM 1486  H HE3  . TRP A 1 40 ? -0.177  -1.418  -2.532  1.00 0.00 ? 40 TRP A HE3  2  
ATOM 1487  H HZ2  . TRP A 1 40 ? -3.516  -4.963  -3.222  1.00 0.00 ? 40 TRP A HZ2  2  
ATOM 1488  H HZ3  . TRP A 1 40 ? -2.646  -0.882  -2.248  1.00 0.00 ? 40 TRP A HZ3  2  
ATOM 1489  H HH2  . TRP A 1 40 ? -4.298  -2.695  -2.606  1.00 0.00 ? 40 TRP A HH2  2  
ATOM 1490  N N    . CYS A 1 41 ? 1.834   -1.397  -0.728  1.00 0.00 ? 41 CYS A N    2  
ATOM 1491  C CA   . CYS A 1 41 ? 1.001   -0.586  0.151   1.00 0.00 ? 41 CYS A CA   2  
ATOM 1492  C C    . CYS A 1 41 ? 0.168   0.374   -0.711  1.00 0.00 ? 41 CYS A C    2  
ATOM 1493  O O    . CYS A 1 41 ? 0.636   0.855   -1.733  1.00 0.00 ? 41 CYS A O    2  
ATOM 1494  C CB   . CYS A 1 41 ? 1.893   0.238   1.077   1.00 0.00 ? 41 CYS A CB   2  
ATOM 1495  S SG   . CYS A 1 41 ? 2.859   1.465   0.143   1.00 0.00 ? 41 CYS A SG   2  
ATOM 1496  H H    . CYS A 1 41 ? 2.408   -0.896  -1.378  1.00 0.00 ? 41 CYS A H    2  
ATOM 1497  H HA   . CYS A 1 41 ? 0.352   -1.247  0.724   1.00 0.00 ? 41 CYS A HA   2  
ATOM 1498  H HB2  . CYS A 1 41 ? 1.169   0.795   1.728   1.00 0.00 ? 41 CYS A HB2  2  
ATOM 1499  H HB3  . CYS A 1 41 ? 2.608   -0.457  1.595   1.00 0.00 ? 41 CYS A HB3  2  
ATOM 1500  N N    . GLY A 1 42 ? -1.075  0.643   -0.278  1.00 0.00 ? 42 GLY A N    2  
ATOM 1501  C CA   . GLY A 1 42 ? -1.874  1.611   -1.027  1.00 0.00 ? 42 GLY A CA   2  
ATOM 1502  C C    . GLY A 1 42 ? -1.380  3.014   -0.668  1.00 0.00 ? 42 GLY A C    2  
ATOM 1503  O O    . GLY A 1 42 ? -0.631  3.181   0.288   1.00 0.00 ? 42 GLY A O    2  
ATOM 1504  H H    . GLY A 1 42 ? -1.425  0.237   0.567   1.00 0.00 ? 42 GLY A H    2  
ATOM 1505  H HA2  . GLY A 1 42 ? -1.764  1.421   -2.099  1.00 0.00 ? 42 GLY A HA2  2  
ATOM 1506  H HA3  . GLY A 1 42 ? -2.916  1.492   -0.728  1.00 0.00 ? 42 GLY A HA3  2  
ATOM 1507  N N    . THR A 1 43 ? -1.826  4.003   -1.471  1.00 0.00 ? 43 THR A N    2  
ATOM 1508  C CA   . THR A 1 43 ? -1.383  5.379   -1.222  1.00 0.00 ? 43 THR A CA   2  
ATOM 1509  C C    . THR A 1 43 ? -2.544  6.348   -0.979  1.00 0.00 ? 43 THR A C    2  
ATOM 1510  O O    . THR A 1 43 ? -2.383  7.559   -1.060  1.00 0.00 ? 43 THR A O    2  
ATOM 1511  C CB   . THR A 1 43 ? -0.436  5.857   -2.343  1.00 0.00 ? 43 THR A CB   2  
ATOM 1512  O OG1  . THR A 1 43 ? -0.308  4.891   -3.369  1.00 0.00 ? 43 THR A OG1  2  
ATOM 1513  C CG2  . THR A 1 43 ? 0.966   6.100   -1.782  1.00 0.00 ? 43 THR A CG2  2  
ATOM 1514  H H    . THR A 1 43 ? -2.421  3.793   -2.245  1.00 0.00 ? 43 THR A H    2  
ATOM 1515  H HA   . THR A 1 43 ? -0.852  5.390   -0.272  1.00 0.00 ? 43 THR A HA   2  
ATOM 1516  H HB   . THR A 1 43 ? -0.773  6.802   -2.785  1.00 0.00 ? 43 THR A HB   2  
ATOM 1517  H HG1  . THR A 1 43 ? -1.166  4.674   -3.734  1.00 0.00 ? 43 THR A HG1  2  
ATOM 1518  H HG21 . THR A 1 43 ? 0.940   6.911   -1.057  1.00 0.00 ? 43 THR A HG21 2  
ATOM 1519  H HG22 . THR A 1 43 ? 1.669   6.380   -2.560  1.00 0.00 ? 43 THR A HG22 2  
ATOM 1520  H HG23 . THR A 1 43 ? 1.362   5.213   -1.287  1.00 0.00 ? 43 THR A HG23 2  
ATOM 1521  N N    . THR A 1 44 ? -3.703  5.758   -0.654  1.00 0.00 ? 44 THR A N    2  
ATOM 1522  C CA   . THR A 1 44 ? -4.881  6.548   -0.351  1.00 0.00 ? 44 THR A CA   2  
ATOM 1523  C C    . THR A 1 44 ? -5.708  5.723   0.632   1.00 0.00 ? 44 THR A C    2  
ATOM 1524  O O    . THR A 1 44 ? -5.450  4.542   0.842   1.00 0.00 ? 44 THR A O    2  
ATOM 1525  C CB   . THR A 1 44 ? -5.684  6.825   -1.635  1.00 0.00 ? 44 THR A CB   2  
ATOM 1526  O OG1  . THR A 1 44 ? -5.972  5.571   -2.234  1.00 0.00 ? 44 THR A OG1  2  
ATOM 1527  C CG2  . THR A 1 44 ? -4.916  7.738   -2.604  1.00 0.00 ? 44 THR A CG2  2  
ATOM 1528  H H    . THR A 1 44 ? -3.825  4.769   -0.581  1.00 0.00 ? 44 THR A H    2  
ATOM 1529  H HA   . THR A 1 44 ? -4.573  7.474   0.137   1.00 0.00 ? 44 THR A HA   2  
ATOM 1530  H HB   . THR A 1 44 ? -6.610  7.341   -1.352  1.00 0.00 ? 44 THR A HB   2  
ATOM 1531  H HG1  . THR A 1 44 ? -6.678  5.665   -2.890  1.00 0.00 ? 44 THR A HG1  2  
ATOM 1532  H HG21 . THR A 1 44 ? -4.113  7.203   -3.109  1.00 0.00 ? 44 THR A HG21 2  
ATOM 1533  H HG22 . THR A 1 44 ? -4.479  8.586   -2.078  1.00 0.00 ? 44 THR A HG22 2  
ATOM 1534  H HG23 . THR A 1 44 ? -5.565  8.155   -3.370  1.00 0.00 ? 44 THR A HG23 2  
ATOM 1535  N N    . GLU A 1 45 ? -6.721  6.409   1.197   1.00 0.00 ? 45 GLU A N    2  
ATOM 1536  C CA   . GLU A 1 45 ? -7.652  5.744   2.094   1.00 0.00 ? 45 GLU A CA   2  
ATOM 1537  C C    . GLU A 1 45 ? -8.423  4.668   1.301   1.00 0.00 ? 45 GLU A C    2  
ATOM 1538  O O    . GLU A 1 45 ? -8.593  3.546   1.752   1.00 0.00 ? 45 GLU A O    2  
ATOM 1539  C CB   . GLU A 1 45 ? -8.546  6.826   2.727   1.00 0.00 ? 45 GLU A CB   2  
ATOM 1540  C CG   . GLU A 1 45 ? -9.570  6.274   3.727   1.00 0.00 ? 45 GLU A CG   2  
ATOM 1541  C CD   . GLU A 1 45 ? -10.799 5.617   3.071   1.00 0.00 ? 45 GLU A CD   2  
ATOM 1542  O OE1  . GLU A 1 45 ? -11.297 6.157   2.085   1.00 0.00 ? 45 GLU A OE1  2  
ATOM 1543  O OE2  . GLU A 1 45 ? -11.242 4.576   3.554   1.00 0.00 ? 45 GLU A OE2  2  
ATOM 1544  H H    . GLU A 1 45 ? -6.880  7.372   0.996   1.00 0.00 ? 45 GLU A H    2  
ATOM 1545  H HA   . GLU A 1 45 ? -7.060  5.244   2.865   1.00 0.00 ? 45 GLU A HA   2  
ATOM 1546  H HB2  . GLU A 1 45 ? -7.868  7.461   3.360   1.00 0.00 ? 45 GLU A HB2  2  
ATOM 1547  H HB3  . GLU A 1 45 ? -9.101  7.356   1.905   1.00 0.00 ? 45 GLU A HB3  2  
ATOM 1548  H HG2  . GLU A 1 45 ? -9.078  5.563   4.389   1.00 0.00 ? 45 GLU A HG2  2  
ATOM 1549  H HG3  . GLU A 1 45 ? -9.930  7.096   4.343   1.00 0.00 ? 45 GLU A HG3  2  
ATOM 1550  N N    . ASP A 1 46 ? -8.822  5.072   0.075   1.00 0.00 ? 46 ASP A N    2  
ATOM 1551  C CA   . ASP A 1 46 ? -9.548  4.162   -0.820  1.00 0.00 ? 46 ASP A CA   2  
ATOM 1552  C C    . ASP A 1 46 ? -8.606  3.730   -1.952  1.00 0.00 ? 46 ASP A C    2  
ATOM 1553  O O    . ASP A 1 46 ? -8.376  4.460   -2.908  1.00 0.00 ? 46 ASP A O    2  
ATOM 1554  C CB   . ASP A 1 46 ? -10.817 4.824   -1.412  1.00 0.00 ? 46 ASP A CB   2  
ATOM 1555  C CG   . ASP A 1 46 ? -11.721 3.735   -1.976  1.00 0.00 ? 46 ASP A CG   2  
ATOM 1556  O OD1  . ASP A 1 46 ? -11.372 3.115   -2.976  1.00 0.00 ? 46 ASP A OD1  2  
ATOM 1557  O OD2  . ASP A 1 46 ? -12.749 3.436   -1.378  1.00 0.00 ? 46 ASP A OD2  2  
ATOM 1558  H H    . ASP A 1 46 ? -8.589  6.014   -0.158  1.00 0.00 ? 46 ASP A H    2  
ATOM 1559  H HA   . ASP A 1 46 ? -9.849  3.300   -0.220  1.00 0.00 ? 46 ASP A HA   2  
ATOM 1560  H HB2  . ASP A 1 46 ? -11.362 5.347   -0.624  1.00 0.00 ? 46 ASP A HB2  2  
ATOM 1561  H HB3  . ASP A 1 46 ? -10.627 5.559   -2.200  1.00 0.00 ? 46 ASP A HB3  2  
ATOM 1562  N N    . TYR A 1 47 ? -8.059  2.510   -1.793  1.00 0.00 ? 47 TYR A N    2  
ATOM 1563  C CA   . TYR A 1 47 ? -7.127  2.061   -2.832  1.00 0.00 ? 47 TYR A CA   2  
ATOM 1564  C C    . TYR A 1 47 ? -7.873  1.618   -4.102  1.00 0.00 ? 47 TYR A C    2  
ATOM 1565  O O    . TYR A 1 47 ? -7.413  1.862   -5.213  1.00 0.00 ? 47 TYR A O    2  
ATOM 1566  C CB   . TYR A 1 47 ? -6.247  0.902   -2.323  1.00 0.00 ? 47 TYR A CB   2  
ATOM 1567  C CG   . TYR A 1 47 ? -5.397  0.373   -3.449  1.00 0.00 ? 47 TYR A CG   2  
ATOM 1568  C CD1  . TYR A 1 47 ? -4.265  1.053   -3.869  1.00 0.00 ? 47 TYR A CD1  2  
ATOM 1569  C CD2  . TYR A 1 47 ? -5.766  -0.781  -4.128  1.00 0.00 ? 47 TYR A CD2  2  
ATOM 1570  C CE1  . TYR A 1 47 ? -3.528  0.588   -4.944  1.00 0.00 ? 47 TYR A CE1  2  
ATOM 1571  C CE2  . TYR A 1 47 ? -5.017  -1.257  -5.190  1.00 0.00 ? 47 TYR A CE2  2  
ATOM 1572  C CZ   . TYR A 1 47 ? -3.897  -0.568  -5.610  1.00 0.00 ? 47 TYR A CZ   2  
ATOM 1573  O OH   . TYR A 1 47 ? -3.176  -1.028  -6.693  1.00 0.00 ? 47 TYR A OH   2  
ATOM 1574  H H    . TYR A 1 47 ? -8.326  1.955   -0.992  1.00 0.00 ? 47 TYR A H    2  
ATOM 1575  H HA   . TYR A 1 47 ? -6.479  2.897   -3.138  1.00 0.00 ? 47 TYR A HA   2  
ATOM 1576  H HB2  . TYR A 1 47 ? -5.608  1.232   -1.502  1.00 0.00 ? 47 TYR A HB2  2  
ATOM 1577  H HB3  . TYR A 1 47 ? -6.855  0.081   -1.939  1.00 0.00 ? 47 TYR A HB3  2  
ATOM 1578  H HD1  . TYR A 1 47 ? -3.962  1.964   -3.386  1.00 0.00 ? 47 TYR A HD1  2  
ATOM 1579  H HD2  . TYR A 1 47 ? -6.665  -1.300  -3.859  1.00 0.00 ? 47 TYR A HD2  2  
ATOM 1580  H HE1  . TYR A 1 47 ? -2.680  1.158   -5.257  1.00 0.00 ? 47 TYR A HE1  2  
ATOM 1581  H HE2  . TYR A 1 47 ? -5.311  -2.162  -5.686  1.00 0.00 ? 47 TYR A HE2  2  
ATOM 1582  H HH   . TYR A 1 47 ? -2.256  -1.091  -6.478  1.00 0.00 ? 47 TYR A HH   2  
ATOM 1583  N N    . ASP A 1 48 ? -9.009  0.921   -3.880  1.00 0.00 ? 48 ASP A N    2  
ATOM 1584  C CA   . ASP A 1 48 ? -9.723  0.328   -5.011  1.00 0.00 ? 48 ASP A CA   2  
ATOM 1585  C C    . ASP A 1 48 ? -10.044 1.362   -6.111  1.00 0.00 ? 48 ASP A C    2  
ATOM 1586  O O    . ASP A 1 48 ? -9.987  1.064   -7.296  1.00 0.00 ? 48 ASP A O    2  
ATOM 1587  C CB   . ASP A 1 48 ? -11.043 -0.353  -4.578  1.00 0.00 ? 48 ASP A CB   2  
ATOM 1588  C CG   . ASP A 1 48 ? -10.846 -1.589  -3.674  1.00 0.00 ? 48 ASP A CG   2  
ATOM 1589  O OD1  . ASP A 1 48 ? -10.384 -2.617  -4.151  1.00 0.00 ? 48 ASP A OD1  2  
ATOM 1590  O OD2  . ASP A 1 48 ? -11.175 -1.532  -2.492  1.00 0.00 ? 48 ASP A OD2  2  
ATOM 1591  H H    . ASP A 1 48 ? -9.340  0.790   -2.946  1.00 0.00 ? 48 ASP A H    2  
ATOM 1592  H HA   . ASP A 1 48 ? -9.082  -0.441  -5.449  1.00 0.00 ? 48 ASP A HA   2  
ATOM 1593  H HB2  . ASP A 1 48 ? -11.706 0.375   -4.101  1.00 0.00 ? 48 ASP A HB2  2  
ATOM 1594  H HB3  . ASP A 1 48 ? -11.547 -0.731  -5.477  1.00 0.00 ? 48 ASP A HB3  2  
ATOM 1595  N N    . ARG A 1 49 ? -10.413 2.575   -5.658  1.00 0.00 ? 49 ARG A N    2  
ATOM 1596  C CA   . ARG A 1 49 ? -10.771 3.628   -6.610  1.00 0.00 ? 49 ARG A CA   2  
ATOM 1597  C C    . ARG A 1 49 ? -9.507  4.215   -7.299  1.00 0.00 ? 49 ARG A C    2  
ATOM 1598  O O    . ARG A 1 49 ? -9.478  4.410   -8.514  1.00 0.00 ? 49 ARG A O    2  
ATOM 1599  C CB   . ARG A 1 49 ? -11.624 4.723   -5.893  1.00 0.00 ? 49 ARG A CB   2  
ATOM 1600  C CG   . ARG A 1 49 ? -12.387 5.752   -6.769  1.00 0.00 ? 49 ARG A CG   2  
ATOM 1601  C CD   . ARG A 1 49 ? -12.398 7.183   -6.115  1.00 0.00 ? 49 ARG A CD   2  
ATOM 1602  N NE   . ARG A 1 49 ? -11.325 7.950   -6.792  1.00 0.00 ? 49 ARG A NE   2  
ATOM 1603  C CZ   . ARG A 1 49 ? -10.087 8.102   -6.272  1.00 0.00 ? 49 ARG A CZ   2  
ATOM 1604  N NH1  . ARG A 1 49 ? -9.806  7.699   -5.040  1.00 0.00 ? 49 ARG A NH1  2  
ATOM 1605  N NH2  . ARG A 1 49 ? -9.126  8.637   -7.016  1.00 0.00 ? 49 ARG A NH2  2  
ATOM 1606  H H    . ARG A 1 49 ? -10.416 2.696   -4.661  1.00 0.00 ? 49 ARG A H    2  
ATOM 1607  H HA   . ARG A 1 49 ? -11.363 3.132   -7.386  1.00 0.00 ? 49 ARG A HA   2  
ATOM 1608  H HB2  . ARG A 1 49 ? -12.362 4.228   -5.253  1.00 0.00 ? 49 ARG A HB2  2  
ATOM 1609  H HB3  . ARG A 1 49 ? -10.986 5.294   -5.224  1.00 0.00 ? 49 ARG A HB3  2  
ATOM 1610  H HG2  . ARG A 1 49 ? -11.922 5.794   -7.767  1.00 0.00 ? 49 ARG A HG2  2  
ATOM 1611  H HG3  . ARG A 1 49 ? -13.404 5.373   -6.945  1.00 0.00 ? 49 ARG A HG3  2  
ATOM 1612  H HD2  . ARG A 1 49 ? -13.365 7.752   -6.132  1.00 0.00 ? 49 ARG A HD2  2  
ATOM 1613  H HD3  . ARG A 1 49 ? -12.158 7.136   -5.041  1.00 0.00 ? 49 ARG A HD3  2  
ATOM 1614  H HE   . ARG A 1 49 ? -11.363 8.207   -7.764  1.00 0.00 ? 49 ARG A HE   2  
ATOM 1615  H HH11 . ARG A 1 49 ? -10.515 7.358   -4.427  1.00 0.00 ? 49 ARG A HH11 2  
ATOM 1616  H HH12 . ARG A 1 49 ? -8.850  7.696   -4.704  1.00 0.00 ? 49 ARG A HH12 2  
ATOM 1617  H HH21 . ARG A 1 49 ? -9.287  9.015   -7.925  1.00 0.00 ? 49 ARG A HH21 2  
ATOM 1618  H HH22 . ARG A 1 49 ? -8.185  8.648   -6.646  1.00 0.00 ? 49 ARG A HH22 2  
ATOM 1619  N N    . ASP A 1 50 ? -8.469  4.507   -6.483  1.00 0.00 ? 50 ASP A N    2  
ATOM 1620  C CA   . ASP A 1 50 ? -7.243  5.100   -7.038  1.00 0.00 ? 50 ASP A CA   2  
ATOM 1621  C C    . ASP A 1 50 ? -6.438  4.152   -7.961  1.00 0.00 ? 50 ASP A C    2  
ATOM 1622  O O    . ASP A 1 50 ? -6.202  4.477   -9.120  1.00 0.00 ? 50 ASP A O    2  
ATOM 1623  C CB   . ASP A 1 50 ? -6.312  5.632   -5.931  1.00 0.00 ? 50 ASP A CB   2  
ATOM 1624  C CG   . ASP A 1 50 ? -6.916  6.863   -5.258  1.00 0.00 ? 50 ASP A CG   2  
ATOM 1625  O OD1  . ASP A 1 50 ? -6.848  7.949   -5.825  1.00 0.00 ? 50 ASP A OD1  2  
ATOM 1626  O OD2  . ASP A 1 50 ? -7.482  6.752   -4.178  1.00 0.00 ? 50 ASP A OD2  2  
ATOM 1627  H H    . ASP A 1 50 ? -8.530  4.330   -5.497  1.00 0.00 ? 50 ASP A H    2  
ATOM 1628  H HA   . ASP A 1 50 ? -7.549  5.940   -7.666  1.00 0.00 ? 50 ASP A HA   2  
ATOM 1629  H HB2  . ASP A 1 50 ? -6.118  4.842   -5.184  1.00 0.00 ? 50 ASP A HB2  2  
ATOM 1630  H HB3  . ASP A 1 50 ? -5.383  6.016   -6.384  1.00 0.00 ? 50 ASP A HB3  2  
ATOM 1631  N N    . LYS A 1 51 ? -5.993  3.007   -7.404  1.00 0.00 ? 51 LYS A N    2  
ATOM 1632  C CA   . LYS A 1 51 ? -5.117  2.062   -8.098  1.00 0.00 ? 51 LYS A CA   2  
ATOM 1633  C C    . LYS A 1 51 ? -3.693  2.612   -8.281  1.00 0.00 ? 51 LYS A C    2  
ATOM 1634  O O    . LYS A 1 51 ? -3.074  2.451   -9.326  1.00 0.00 ? 51 LYS A O    2  
ATOM 1635  C CB   . LYS A 1 51 ? -5.621  1.515   -9.451  1.00 0.00 ? 51 LYS A CB   2  
ATOM 1636  C CG   . LYS A 1 51 ? -6.962  0.744   -9.344  1.00 0.00 ? 51 LYS A CG   2  
ATOM 1637  C CD   . LYS A 1 51 ? -8.232  1.572   -9.533  1.00 0.00 ? 51 LYS A CD   2  
ATOM 1638  C CE   . LYS A 1 51 ? -8.340  2.346   -10.854 1.00 0.00 ? 51 LYS A CE   2  
ATOM 1639  N NZ   . LYS A 1 51 ? -8.111  3.778   -10.666 1.00 0.00 ? 51 LYS A NZ   2  
ATOM 1640  H H    . LYS A 1 51 ? -6.250  2.741   -6.472  1.00 0.00 ? 51 LYS A H    2  
ATOM 1641  H HA   . LYS A 1 51 ? -5.011  1.248   -7.388  1.00 0.00 ? 51 LYS A HA   2  
ATOM 1642  H HB2  . LYS A 1 51 ? -5.762  2.374   -10.159 1.00 0.00 ? 51 LYS A HB2  2  
ATOM 1643  H HB3  . LYS A 1 51 ? -4.790  0.796   -9.734  1.00 0.00 ? 51 LYS A HB3  2  
ATOM 1644  H HG2  . LYS A 1 51 ? -7.060  -0.048  -10.079 1.00 0.00 ? 51 LYS A HG2  2  
ATOM 1645  H HG3  . LYS A 1 51 ? -7.017  0.208   -8.400  1.00 0.00 ? 51 LYS A HG3  2  
ATOM 1646  H HD2  . LYS A 1 51 ? -9.032  0.843   -9.480  1.00 0.00 ? 51 LYS A HD2  2  
ATOM 1647  H HD3  . LYS A 1 51 ? -8.429  2.228   -8.698  1.00 0.00 ? 51 LYS A HD3  2  
ATOM 1648  H HE2  . LYS A 1 51 ? -7.642  1.969   -11.604 1.00 0.00 ? 51 LYS A HE2  2  
ATOM 1649  H HE3  . LYS A 1 51 ? -9.346  2.235   -11.262 1.00 0.00 ? 51 LYS A HE3  2  
ATOM 1650  H HZ1  . LYS A 1 51 ? -8.271  4.313   -11.540 1.00 0.00 ? 51 LYS A HZ1  2  
ATOM 1651  H HZ2  . LYS A 1 51 ? -7.139  3.956   -10.325 1.00 0.00 ? 51 LYS A HZ2  2  
ATOM 1652  H HZ3  . LYS A 1 51 ? -8.755  4.130   -9.922  1.00 0.00 ? 51 LYS A HZ3  2  
ATOM 1653  N N    . LYS A 1 52 ? -3.202  3.256   -7.209  1.00 0.00 ? 52 LYS A N    2  
ATOM 1654  C CA   . LYS A 1 52 ? -1.827  3.735   -7.211  1.00 0.00 ? 52 LYS A CA   2  
ATOM 1655  C C    . LYS A 1 52 ? -1.253  3.317   -5.854  1.00 0.00 ? 52 LYS A C    2  
ATOM 1656  O O    . LYS A 1 52 ? -1.932  3.424   -4.834  1.00 0.00 ? 52 LYS A O    2  
ATOM 1657  C CB   . LYS A 1 52 ? -1.752  5.254   -7.459  1.00 0.00 ? 52 LYS A CB   2  
ATOM 1658  C CG   . LYS A 1 52 ? -2.301  5.704   -8.834  1.00 0.00 ? 52 LYS A CG   2  
ATOM 1659  C CD   . LYS A 1 52 ? -1.273  5.668   -9.988  1.00 0.00 ? 52 LYS A CD   2  
ATOM 1660  C CE   . LYS A 1 52 ? -0.307  6.863   -9.966  1.00 0.00 ? 52 LYS A CE   2  
ATOM 1661  N NZ   . LYS A 1 52 ? -0.972  8.137   -10.224 1.00 0.00 ? 52 LYS A NZ   2  
ATOM 1662  H H    . LYS A 1 52 ? -3.729  3.336   -6.364  1.00 0.00 ? 52 LYS A H    2  
ATOM 1663  H HA   . LYS A 1 52 ? -1.303  3.142   -7.962  1.00 0.00 ? 52 LYS A HA   2  
ATOM 1664  H HB2  . LYS A 1 52 ? -2.310  5.760   -6.668  1.00 0.00 ? 52 LYS A HB2  2  
ATOM 1665  H HB3  . LYS A 1 52 ? -0.719  5.585   -7.364  1.00 0.00 ? 52 LYS A HB3  2  
ATOM 1666  H HG2  . LYS A 1 52 ? -3.161  5.092   -9.112  1.00 0.00 ? 52 LYS A HG2  2  
ATOM 1667  H HG3  . LYS A 1 52 ? -2.705  6.713   -8.746  1.00 0.00 ? 52 LYS A HG3  2  
ATOM 1668  H HD2  . LYS A 1 52 ? -0.630  4.752   -9.857  1.00 0.00 ? 52 LYS A HD2  2  
ATOM 1669  H HD3  . LYS A 1 52 ? -1.866  5.752   -10.947 1.00 0.00 ? 52 LYS A HD3  2  
ATOM 1670  H HE2  . LYS A 1 52 ? 0.219   6.946   -9.016  1.00 0.00 ? 52 LYS A HE2  2  
ATOM 1671  H HE3  . LYS A 1 52 ? 0.477   6.747   -10.720 1.00 0.00 ? 52 LYS A HE3  2  
ATOM 1672  H HZ1  . LYS A 1 52 ? -0.666  8.844   -9.514  1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 1673  H HZ2  . LYS A 1 52 ? -2.005  8.077   -10.258 1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 1674  H HZ3  . LYS A 1 52 ? -0.585  8.562   -11.101 1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 1675  N N    . TYR A 1 53 ? -0.029  2.759   -5.913  1.00 0.00 ? 53 TYR A N    2  
ATOM 1676  C CA   . TYR A 1 53 ? 0.569   2.130   -4.746  1.00 0.00 ? 53 TYR A CA   2  
ATOM 1677  C C    . TYR A 1 53 ? 2.079   2.380   -4.652  1.00 0.00 ? 53 TYR A C    2  
ATOM 1678  O O    . TYR A 1 53 ? 2.722   2.983   -5.509  1.00 0.00 ? 53 TYR A O    2  
ATOM 1679  C CB   . TYR A 1 53 ? 0.252   0.613   -4.824  1.00 0.00 ? 53 TYR A CB   2  
ATOM 1680  C CG   . TYR A 1 53 ? 0.889   -0.220  -5.918  1.00 0.00 ? 53 TYR A CG   2  
ATOM 1681  C CD1  . TYR A 1 53 ? 1.739   0.259   -6.910  1.00 0.00 ? 53 TYR A CD1  2  
ATOM 1682  C CD2  . TYR A 1 53 ? 0.603   -1.573  -5.916  1.00 0.00 ? 53 TYR A CD2  2  
ATOM 1683  C CE1  . TYR A 1 53 ? 2.290   -0.597  -7.857  1.00 0.00 ? 53 TYR A CE1  2  
ATOM 1684  C CE2  . TYR A 1 53 ? 1.139   -2.439  -6.851  1.00 0.00 ? 53 TYR A CE2  2  
ATOM 1685  C CZ   . TYR A 1 53 ? 1.993   -1.959  -7.827  1.00 0.00 ? 53 TYR A CZ   2  
ATOM 1686  O OH   . TYR A 1 53 ? 2.520   -2.860  -8.734  1.00 0.00 ? 53 TYR A OH   2  
ATOM 1687  H H    . TYR A 1 53 ? 0.488   2.745   -6.770  1.00 0.00 ? 53 TYR A H    2  
ATOM 1688  H HA   . TYR A 1 53 ? 0.123   2.556   -3.846  1.00 0.00 ? 53 TYR A HA   2  
ATOM 1689  H HB2  . TYR A 1 53 ? 0.506   0.121   -3.893  1.00 0.00 ? 53 TYR A HB2  2  
ATOM 1690  H HB3  . TYR A 1 53 ? -0.820  0.467   -4.896  1.00 0.00 ? 53 TYR A HB3  2  
ATOM 1691  H HD1  . TYR A 1 53 ? 1.992   1.301   -6.964  1.00 0.00 ? 53 TYR A HD1  2  
ATOM 1692  H HD2  . TYR A 1 53 ? -0.045  -1.946  -5.152  1.00 0.00 ? 53 TYR A HD2  2  
ATOM 1693  H HE1  . TYR A 1 53 ? 2.943   -0.154  -8.594  1.00 0.00 ? 53 TYR A HE1  2  
ATOM 1694  H HE2  . TYR A 1 53 ? 0.886   -3.486  -6.804  1.00 0.00 ? 53 TYR A HE2  2  
ATOM 1695  H HH   . TYR A 1 53 ? 3.130   -2.424  -9.318  1.00 0.00 ? 53 TYR A HH   2  
ATOM 1696  N N    . GLY A 1 54 ? 2.580   1.788   -3.565  1.00 0.00 ? 54 GLY A N    2  
ATOM 1697  C CA   . GLY A 1 54 ? 4.000   1.741   -3.252  1.00 0.00 ? 54 GLY A CA   2  
ATOM 1698  C C    . GLY A 1 54 ? 4.407   0.284   -2.977  1.00 0.00 ? 54 GLY A C    2  
ATOM 1699  O O    . GLY A 1 54 ? 3.543   -0.579  -2.879  1.00 0.00 ? 54 GLY A O    2  
ATOM 1700  H H    . GLY A 1 54 ? 1.881   1.367   -2.981  1.00 0.00 ? 54 GLY A H    2  
ATOM 1701  H HA2  . GLY A 1 54 ? 4.537   2.153   -4.097  1.00 0.00 ? 54 GLY A HA2  2  
ATOM 1702  H HA3  . GLY A 1 54 ? 4.154   2.360   -2.376  1.00 0.00 ? 54 GLY A HA3  2  
ATOM 1703  N N    . PHE A 1 55 ? 5.734   0.028   -2.867  1.00 0.00 ? 55 PHE A N    2  
ATOM 1704  C CA   . PHE A 1 55 ? 6.206   -1.338  -2.588  1.00 0.00 ? 55 PHE A CA   2  
ATOM 1705  C C    . PHE A 1 55 ? 6.551   -1.330  -1.101  1.00 0.00 ? 55 PHE A C    2  
ATOM 1706  O O    . PHE A 1 55 ? 6.689   -0.261  -0.530  1.00 0.00 ? 55 PHE A O    2  
ATOM 1707  C CB   . PHE A 1 55 ? 7.444   -1.759  -3.413  1.00 0.00 ? 55 PHE A CB   2  
ATOM 1708  C CG   . PHE A 1 55 ? 7.167   -2.096  -4.858  1.00 0.00 ? 55 PHE A CG   2  
ATOM 1709  C CD1  . PHE A 1 55 ? 6.067   -1.601  -5.556  1.00 0.00 ? 55 PHE A CD1  2  
ATOM 1710  C CD2  . PHE A 1 55 ? 8.050   -2.933  -5.533  1.00 0.00 ? 55 PHE A CD2  2  
ATOM 1711  C CE1  . PHE A 1 55 ? 5.870   -1.909  -6.890  1.00 0.00 ? 55 PHE A CE1  2  
ATOM 1712  C CE2  . PHE A 1 55 ? 7.844   -3.258  -6.866  1.00 0.00 ? 55 PHE A CE2  2  
ATOM 1713  C CZ   . PHE A 1 55 ? 6.756   -2.742  -7.552  1.00 0.00 ? 55 PHE A CZ   2  
ATOM 1714  H H    . PHE A 1 55 ? 6.438   0.745   -2.907  1.00 0.00 ? 55 PHE A H    2  
ATOM 1715  H HA   . PHE A 1 55 ? 5.407   -2.059  -2.748  1.00 0.00 ? 55 PHE A HA   2  
ATOM 1716  H HB2  . PHE A 1 55 ? 8.240   -1.008  -3.377  1.00 0.00 ? 55 PHE A HB2  2  
ATOM 1717  H HB3  . PHE A 1 55 ? 7.835   -2.688  -2.979  1.00 0.00 ? 55 PHE A HB3  2  
ATOM 1718  H HD1  . PHE A 1 55 ? 5.336   -0.966  -5.092  1.00 0.00 ? 55 PHE A HD1  2  
ATOM 1719  H HD2  . PHE A 1 55 ? 8.911   -3.336  -5.018  1.00 0.00 ? 55 PHE A HD2  2  
ATOM 1720  H HE1  . PHE A 1 55 ? 5.027   -1.478  -7.401  1.00 0.00 ? 55 PHE A HE1  2  
ATOM 1721  H HE2  . PHE A 1 55 ? 8.535   -3.911  -7.369  1.00 0.00 ? 55 PHE A HE2  2  
ATOM 1722  H HZ   . PHE A 1 55 ? 6.604   -2.985  -8.593  1.00 0.00 ? 55 PHE A HZ   2  
ATOM 1723  N N    . CYS A 1 56 ? 6.629   -2.541  -0.507  1.00 0.00 ? 56 CYS A N    2  
ATOM 1724  C CA   . CYS A 1 56 ? 6.840   -2.621  0.977   1.00 0.00 ? 56 CYS A CA   2  
ATOM 1725  C C    . CYS A 1 56 ? 8.106   -1.841  1.404   1.00 0.00 ? 56 CYS A C    2  
ATOM 1726  O O    . CYS A 1 56 ? 9.219   -2.297  1.164   1.00 0.00 ? 56 CYS A O    2  
ATOM 1727  C CB   . CYS A 1 56 ? 7.044   -4.091  1.469   1.00 0.00 ? 56 CYS A CB   2  
ATOM 1728  S SG   . CYS A 1 56 ? 6.563   -4.254  3.214   1.00 0.00 ? 56 CYS A SG   2  
ATOM 1729  H H    . CYS A 1 56 ? 6.530   -3.293  -1.195  1.00 0.00 ? 56 CYS A H    2  
ATOM 1730  H HA   . CYS A 1 56 ? 5.995   -2.137  1.516   1.00 0.00 ? 56 CYS A HA   2  
ATOM 1731  H HB2  . CYS A 1 56 ? 6.506   -4.876  0.903   1.00 0.00 ? 56 CYS A HB2  2  
ATOM 1732  H HB3  . CYS A 1 56 ? 8.106   -4.371  1.401   1.00 0.00 ? 56 CYS A HB3  2  
ATOM 1733  N N    . PRO A 1 57 ? 7.940   -0.653  2.051   1.00 0.00 ? 57 PRO A N    2  
ATOM 1734  C CA   . PRO A 1 57 ? 9.122   0.110   2.430   1.00 0.00 ? 57 PRO A CA   2  
ATOM 1735  C C    . PRO A 1 57 ? 9.443   -0.212  3.895   1.00 0.00 ? 57 PRO A C    2  
ATOM 1736  O O    . PRO A 1 57 ? 8.686   0.140   4.794   1.00 0.00 ? 57 PRO A O    2  
ATOM 1737  C CB   . PRO A 1 57 ? 8.646   1.547   2.280   1.00 0.00 ? 57 PRO A CB   2  
ATOM 1738  C CG   . PRO A 1 57 ? 7.131   1.489   2.513   1.00 0.00 ? 57 PRO A CG   2  
ATOM 1739  C CD   . PRO A 1 57 ? 6.677   0.049   2.357   1.00 0.00 ? 57 PRO A CD   2  
ATOM 1740  H HA   . PRO A 1 57 ? 9.978   -0.081  1.781   1.00 0.00 ? 57 PRO A HA   2  
ATOM 1741  H HB2  . PRO A 1 57 ? 9.165   2.251   2.930   1.00 0.00 ? 57 PRO A HB2  2  
ATOM 1742  H HB3  . PRO A 1 57 ? 8.829   1.863   1.253   1.00 0.00 ? 57 PRO A HB3  2  
ATOM 1743  H HG2  . PRO A 1 57 ? 6.875   1.736   3.529   1.00 0.00 ? 57 PRO A HG2  2  
ATOM 1744  H HG3  . PRO A 1 57 ? 6.619   2.164   1.830   1.00 0.00 ? 57 PRO A HG3  2  
ATOM 1745  H HD2  . PRO A 1 57 ? 6.228   -0.284  3.323   1.00 0.00 ? 57 PRO A HD2  2  
ATOM 1746  H HD3  . PRO A 1 57 ? 5.945   0.032   1.539   1.00 0.00 ? 57 PRO A HD3  2  
ATOM 1747  N N    . GLU A 1 58 ? 10.586  -0.907  4.092   1.00 0.00 ? 58 GLU A N    2  
ATOM 1748  C CA   . GLU A 1 58 ? 10.949  -1.317  5.472   1.00 0.00 ? 58 GLU A CA   2  
ATOM 1749  C C    . GLU A 1 58 ? 9.752   -2.104  6.062   1.00 0.00 ? 58 GLU A C    2  
ATOM 1750  O O    . GLU A 1 58 ? 9.343   -3.111  5.499   1.00 0.00 ? 58 GLU A O    2  
ATOM 1751  C CB   . GLU A 1 58 ? 11.389  -0.058  6.257   1.00 0.00 ? 58 GLU A CB   2  
ATOM 1752  C CG   . GLU A 1 58 ? 12.045  -0.343  7.617   1.00 0.00 ? 58 GLU A CG   2  
ATOM 1753  C CD   . GLU A 1 58 ? 13.300  -1.212  7.463   1.00 0.00 ? 58 GLU A CD   2  
ATOM 1754  O OE1  . GLU A 1 58 ? 14.364  -0.665  7.183   1.00 0.00 ? 58 GLU A OE1  2  
ATOM 1755  O OE2  . GLU A 1 58 ? 13.189  -2.427  7.617   1.00 0.00 ? 58 GLU A OE2  2  
ATOM 1756  H H    . GLU A 1 58 ? 11.077  -1.102  3.238   1.00 0.00 ? 58 GLU A H    2  
ATOM 1757  H HA   . GLU A 1 58 ? 11.782  -2.033  5.464   1.00 0.00 ? 58 GLU A HA   2  
ATOM 1758  H HB2  . GLU A 1 58 ? 12.128  0.475   5.646   1.00 0.00 ? 58 GLU A HB2  2  
ATOM 1759  H HB3  . GLU A 1 58 ? 10.537  0.617   6.408   1.00 0.00 ? 58 GLU A HB3  2  
ATOM 1760  H HG2  . GLU A 1 58 ? 12.333  0.599   8.081   1.00 0.00 ? 58 GLU A HG2  2  
ATOM 1761  H HG3  . GLU A 1 58 ? 11.360  -0.836  8.302   1.00 0.00 ? 58 GLU A HG3  2  
ATOM 1762  N N    . THR A 1 59 ? 9.178   -1.571  7.158   1.00 0.00 ? 59 THR A N    2  
ATOM 1763  C CA   . THR A 1 59 ? 7.987   -2.141  7.784   1.00 0.00 ? 59 THR A CA   2  
ATOM 1764  C C    . THR A 1 59 ? 8.266   -3.506  8.455   1.00 0.00 ? 59 THR A C    2  
ATOM 1765  O O    . THR A 1 59 ? 8.323   -3.590  9.676   1.00 0.00 ? 59 THR A O    2  
ATOM 1766  C CB   . THR A 1 59 ? 6.795   -2.135  6.796   1.00 0.00 ? 59 THR A CB   2  
ATOM 1767  O OG1  . THR A 1 59 ? 6.618   -0.827  6.275   1.00 0.00 ? 59 THR A OG1  2  
ATOM 1768  C CG2  . THR A 1 59 ? 5.470   -2.515  7.466   1.00 0.00 ? 59 THR A CG2  2  
ATOM 1769  H H    . THR A 1 59 ? 9.596   -0.748  7.538   1.00 0.00 ? 59 THR A H    2  
ATOM 1770  H HA   . THR A 1 59 ? 7.759   -1.447  8.593   1.00 0.00 ? 59 THR A HA   2  
ATOM 1771  H HB   . THR A 1 59 ? 6.958   -2.836  5.968   1.00 0.00 ? 59 THR A HB   2  
ATOM 1772  H HG1  . THR A 1 59 ? 7.417   -0.535  5.829   1.00 0.00 ? 59 THR A HG1  2  
ATOM 1773  H HG21 . THR A 1 59 ? 5.240   -1.842  8.292   1.00 0.00 ? 59 THR A HG21 2  
ATOM 1774  H HG22 . THR A 1 59 ? 5.499   -3.532  7.857   1.00 0.00 ? 59 THR A HG22 2  
ATOM 1775  H HG23 . THR A 1 59 ? 4.648   -2.459  6.752   1.00 0.00 ? 59 THR A HG23 2  
ATOM 1776  N N    . ALA A 1 60 ? 8.422   -4.528  7.590   1.00 0.00 ? 60 ALA A N    2  
ATOM 1777  C CA   . ALA A 1 60 ? 8.651   -5.920  7.963   1.00 0.00 ? 60 ALA A CA   2  
ATOM 1778  C C    . ALA A 1 60 ? 7.324   -6.595  8.377   1.00 0.00 ? 60 ALA A C    2  
ATOM 1779  O O    . ALA A 1 60 ? 7.368   -7.663  8.987   1.00 0.00 ? 60 ALA A O    2  
ATOM 1780  C CB   . ALA A 1 60 ? 9.766   -6.077  9.013   1.00 0.00 ? 60 ALA A CB   2  
ATOM 1781  O OXT  . ALA A 1 60 ? 6.260   -6.051  8.074   1.00 0.00 ? 60 ALA A OXT  2  
ATOM 1782  H H    . ALA A 1 60 ? 8.365   -4.322  6.612   1.00 0.00 ? 60 ALA A H    2  
ATOM 1783  H HA   . ALA A 1 60 ? 8.975   -6.396  7.038   1.00 0.00 ? 60 ALA A HA   2  
ATOM 1784  H HB1  . ALA A 1 60 ? 9.455   -5.708  9.990   1.00 0.00 ? 60 ALA A HB1  2  
ATOM 1785  H HB2  . ALA A 1 60 ? 10.664  -5.537  8.715   1.00 0.00 ? 60 ALA A HB2  2  
ATOM 1786  H HB3  . ALA A 1 60 ? 10.032  -7.127  9.136   1.00 0.00 ? 60 ALA A HB3  2  
ATOM 1787  N N    . THR A 1 1  ? 11.765  9.060   10.651  1.00 0.00 ? 1  THR A N    3  
ATOM 1788  C CA   . THR A 1 1  ? 11.983  8.005   9.676   1.00 0.00 ? 1  THR A CA   3  
ATOM 1789  C C    . THR A 1 1  ? 10.709  7.616   8.914   1.00 0.00 ? 1  THR A C    3  
ATOM 1790  O O    . THR A 1 1  ? 10.606  7.846   7.720   1.00 0.00 ? 1  THR A O    3  
ATOM 1791  C CB   . THR A 1 1  ? 12.658  6.837   10.415  1.00 0.00 ? 1  THR A CB   3  
ATOM 1792  O OG1  . THR A 1 1  ? 13.398  7.476   11.450  1.00 0.00 ? 1  THR A OG1  3  
ATOM 1793  C CG2  . THR A 1 1  ? 13.550  6.004   9.480   1.00 0.00 ? 1  THR A CG2  3  
ATOM 1794  H H1   . THR A 1 1  ? 11.774  9.997   10.202  1.00 0.00 ? 1  THR A H1   3  
ATOM 1795  H H2   . THR A 1 1  ? 12.592  8.925   11.283  1.00 0.00 ? 1  THR A H2   3  
ATOM 1796  H H3   . THR A 1 1  ? 10.894  8.906   11.192  1.00 0.00 ? 1  THR A H3   3  
ATOM 1797  H HA   . THR A 1 1  ? 12.689  8.410   8.950   1.00 0.00 ? 1  THR A HA   3  
ATOM 1798  H HB   . THR A 1 1  ? 11.907  6.181   10.872  1.00 0.00 ? 1  THR A HB   3  
ATOM 1799  H HG1  . THR A 1 1  ? 13.944  6.836   11.908  1.00 0.00 ? 1  THR A HG1  3  
ATOM 1800  H HG21 . THR A 1 1  ? 14.363  6.602   9.068   1.00 0.00 ? 1  THR A HG21 3  
ATOM 1801  H HG22 . THR A 1 1  ? 12.971  5.610   8.643   1.00 0.00 ? 1  THR A HG22 3  
ATOM 1802  H HG23 . THR A 1 1  ? 13.990  5.147   9.991   1.00 0.00 ? 1  THR A HG23 3  
ATOM 1803  N N    . ALA A 1 2  ? 9.752   7.033   9.671   1.00 0.00 ? 2  ALA A N    3  
ATOM 1804  C CA   . ALA A 1 2  ? 8.507   6.554   9.075   1.00 0.00 ? 2  ALA A CA   3  
ATOM 1805  C C    . ALA A 1 2  ? 8.841   5.355   8.164   1.00 0.00 ? 2  ALA A C    3  
ATOM 1806  O O    . ALA A 1 2  ? 9.739   4.583   8.475   1.00 0.00 ? 2  ALA A O    3  
ATOM 1807  C CB   . ALA A 1 2  ? 7.709   7.681   8.389   1.00 0.00 ? 2  ALA A CB   3  
ATOM 1808  H H    . ALA A 1 2  ? 9.877   6.834   10.641  1.00 0.00 ? 2  ALA A H    3  
ATOM 1809  H HA   . ALA A 1 2  ? 7.927   6.168   9.913   1.00 0.00 ? 2  ALA A HA   3  
ATOM 1810  H HB1  . ALA A 1 2  ? 7.590   8.532   9.058   1.00 0.00 ? 2  ALA A HB1  3  
ATOM 1811  H HB2  . ALA A 1 2  ? 6.708   7.346   8.116   1.00 0.00 ? 2  ALA A HB2  3  
ATOM 1812  H HB3  . ALA A 1 2  ? 8.195   8.039   7.481   1.00 0.00 ? 2  ALA A HB3  3  
ATOM 1813  N N    . LEU A 1 3  ? 8.090   5.244   7.054   1.00 0.00 ? 3  LEU A N    3  
ATOM 1814  C CA   . LEU A 1 3  ? 8.288   4.177   6.082   1.00 0.00 ? 3  LEU A CA   3  
ATOM 1815  C C    . LEU A 1 3  ? 8.521   4.912   4.741   1.00 0.00 ? 3  LEU A C    3  
ATOM 1816  O O    . LEU A 1 3  ? 7.804   5.852   4.419   1.00 0.00 ? 3  LEU A O    3  
ATOM 1817  C CB   . LEU A 1 3  ? 7.070   3.193   6.182   1.00 0.00 ? 3  LEU A CB   3  
ATOM 1818  C CG   . LEU A 1 3  ? 5.956   3.335   5.133   1.00 0.00 ? 3  LEU A CG   3  
ATOM 1819  C CD1  . LEU A 1 3  ? 5.167   4.619   5.358   1.00 0.00 ? 3  LEU A CD1  3  
ATOM 1820  C CD2  . LEU A 1 3  ? 6.428   3.155   3.678   1.00 0.00 ? 3  LEU A CD2  3  
ATOM 1821  H H    . LEU A 1 3  ? 7.387   5.918   6.824   1.00 0.00 ? 3  LEU A H    3  
ATOM 1822  H HA   . LEU A 1 3  ? 9.211   3.653   6.342   1.00 0.00 ? 3  LEU A HA   3  
ATOM 1823  H HB2  . LEU A 1 3  ? 7.399   2.129   6.053   1.00 0.00 ? 3  LEU A HB2  3  
ATOM 1824  H HB3  . LEU A 1 3  ? 6.581   3.406   7.175   1.00 0.00 ? 3  LEU A HB3  3  
ATOM 1825  H HG   . LEU A 1 3  ? 5.262   2.512   5.314   1.00 0.00 ? 3  LEU A HG   3  
ATOM 1826  H HD11 . LEU A 1 3  ? 4.470   4.492   6.184   1.00 0.00 ? 3  LEU A HD11 3  
ATOM 1827  H HD12 . LEU A 1 3  ? 4.617   4.879   4.465   1.00 0.00 ? 3  LEU A HD12 3  
ATOM 1828  H HD13 . LEU A 1 3  ? 5.807   5.461   5.593   1.00 0.00 ? 3  LEU A HD13 3  
ATOM 1829  H HD21 . LEU A 1 3  ? 6.572   4.104   3.163   1.00 0.00 ? 3  LEU A HD21 3  
ATOM 1830  H HD22 . LEU A 1 3  ? 5.713   2.594   3.084   1.00 0.00 ? 3  LEU A HD22 3  
ATOM 1831  H HD23 . LEU A 1 3  ? 7.360   2.599   3.625   1.00 0.00 ? 3  LEU A HD23 3  
ATOM 1832  N N    . PHE A 1 4  ? 9.550   4.471   3.988   1.00 0.00 ? 4  PHE A N    3  
ATOM 1833  C CA   . PHE A 1 4  ? 9.839   5.084   2.686   1.00 0.00 ? 4  PHE A CA   3  
ATOM 1834  C C    . PHE A 1 4  ? 9.119   4.247   1.621   1.00 0.00 ? 4  PHE A C    3  
ATOM 1835  O O    . PHE A 1 4  ? 8.878   3.068   1.838   1.00 0.00 ? 4  PHE A O    3  
ATOM 1836  C CB   . PHE A 1 4  ? 11.373  5.078   2.454   1.00 0.00 ? 4  PHE A CB   3  
ATOM 1837  C CG   . PHE A 1 4  ? 12.142  5.653   3.618   1.00 0.00 ? 4  PHE A CG   3  
ATOM 1838  C CD1  . PHE A 1 4  ? 11.775  6.869   4.191   1.00 0.00 ? 4  PHE A CD1  3  
ATOM 1839  C CD2  . PHE A 1 4  ? 13.238  4.970   4.140   1.00 0.00 ? 4  PHE A CD2  3  
ATOM 1840  C CE1  . PHE A 1 4  ? 12.487  7.388   5.264   1.00 0.00 ? 4  PHE A CE1  3  
ATOM 1841  C CE2  . PHE A 1 4  ? 13.953  5.489   5.211   1.00 0.00 ? 4  PHE A CE2  3  
ATOM 1842  C CZ   . PHE A 1 4  ? 13.577  6.700   5.775   1.00 0.00 ? 4  PHE A CZ   3  
ATOM 1843  H H    . PHE A 1 4  ? 10.113  3.707   4.295   1.00 0.00 ? 4  PHE A H    3  
ATOM 1844  H HA   . PHE A 1 4  ? 9.408   6.092   2.694   1.00 0.00 ? 4  PHE A HA   3  
ATOM 1845  H HB2  . PHE A 1 4  ? 11.705  4.040   2.305   1.00 0.00 ? 4  PHE A HB2  3  
ATOM 1846  H HB3  . PHE A 1 4  ? 11.668  5.633   1.552   1.00 0.00 ? 4  PHE A HB3  3  
ATOM 1847  H HD1  . PHE A 1 4  ? 10.930  7.422   3.810   1.00 0.00 ? 4  PHE A HD1  3  
ATOM 1848  H HD2  . PHE A 1 4  ? 13.544  4.027   3.711   1.00 0.00 ? 4  PHE A HD2  3  
ATOM 1849  H HE1  . PHE A 1 4  ? 12.182  8.327   5.705   1.00 0.00 ? 4  PHE A HE1  3  
ATOM 1850  H HE2  . PHE A 1 4  ? 14.802  4.950   5.607   1.00 0.00 ? 4  PHE A HE2  3  
ATOM 1851  H HZ   . PHE A 1 4  ? 14.132  7.106   6.608   1.00 0.00 ? 4  PHE A HZ   3  
ATOM 1852  N N    . THR A 1 5  ? 8.808   4.879   0.466   1.00 0.00 ? 5  THR A N    3  
ATOM 1853  C CA   . THR A 1 5  ? 8.053   4.129   -0.537  1.00 0.00 ? 5  THR A CA   3  
ATOM 1854  C C    . THR A 1 5  ? 8.996   3.219   -1.326  1.00 0.00 ? 5  THR A C    3  
ATOM 1855  O O    . THR A 1 5  ? 8.871   2.003   -1.344  1.00 0.00 ? 5  THR A O    3  
ATOM 1856  C CB   . THR A 1 5  ? 7.302   5.099   -1.474  1.00 0.00 ? 5  THR A CB   3  
ATOM 1857  O OG1  . THR A 1 5  ? 8.181   5.909   -2.251  1.00 0.00 ? 5  THR A OG1  3  
ATOM 1858  C CG2  . THR A 1 5  ? 6.257   5.952   -0.727  1.00 0.00 ? 5  THR A CG2  3  
ATOM 1859  H H    . THR A 1 5  ? 8.993   5.850   0.338   1.00 0.00 ? 5  THR A H    3  
ATOM 1860  H HA   . THR A 1 5  ? 7.341   3.495   -0.030  1.00 0.00 ? 5  THR A HA   3  
ATOM 1861  H HB   . THR A 1 5  ? 6.751   4.470   -2.188  1.00 0.00 ? 5  THR A HB   3  
ATOM 1862  H HG1  . THR A 1 5  ? 8.623   6.580   -1.737  1.00 0.00 ? 5  THR A HG1  3  
ATOM 1863  H HG21 . THR A 1 5  ? 6.689   6.620   0.023   1.00 0.00 ? 5  THR A HG21 3  
ATOM 1864  H HG22 . THR A 1 5  ? 5.515   5.335   -0.209  1.00 0.00 ? 5  THR A HG22 3  
ATOM 1865  H HG23 . THR A 1 5  ? 5.706   6.572   -1.432  1.00 0.00 ? 5  THR A HG23 3  
ATOM 1866  N N    . MET A 1 6  ? 9.976   3.900   -1.929  1.00 0.00 ? 6  MET A N    3  
ATOM 1867  C CA   . MET A 1 6  ? 11.046  3.298   -2.723  1.00 0.00 ? 6  MET A CA   3  
ATOM 1868  C C    . MET A 1 6  ? 10.499  2.915   -4.112  1.00 0.00 ? 6  MET A C    3  
ATOM 1869  O O    . MET A 1 6  ? 10.933  3.422   -5.138  1.00 0.00 ? 6  MET A O    3  
ATOM 1870  C CB   . MET A 1 6  ? 11.718  2.110   -1.990  1.00 0.00 ? 6  MET A CB   3  
ATOM 1871  C CG   . MET A 1 6  ? 11.994  2.349   -0.491  1.00 0.00 ? 6  MET A CG   3  
ATOM 1872  S SD   . MET A 1 6  ? 12.695  0.880   0.280   1.00 0.00 ? 6  MET A SD   3  
ATOM 1873  C CE   . MET A 1 6  ? 11.152  0.061   0.736   1.00 0.00 ? 6  MET A CE   3  
ATOM 1874  H H    . MET A 1 6  ? 9.818   4.875   -1.807  1.00 0.00 ? 6  MET A H    3  
ATOM 1875  H HA   . MET A 1 6  ? 11.762  4.105   -2.894  1.00 0.00 ? 6  MET A HA   3  
ATOM 1876  H HB2  . MET A 1 6  ? 11.098  1.218   -2.077  1.00 0.00 ? 6  MET A HB2  3  
ATOM 1877  H HB3  . MET A 1 6  ? 12.652  1.864   -2.495  1.00 0.00 ? 6  MET A HB3  3  
ATOM 1878  H HG2  . MET A 1 6  ? 12.667  3.190   -0.332  1.00 0.00 ? 6  MET A HG2  3  
ATOM 1879  H HG3  . MET A 1 6  ? 11.086  2.595   0.063   1.00 0.00 ? 6  MET A HG3  3  
ATOM 1880  H HE1  . MET A 1 6  ? 11.341  -0.957  1.079   1.00 0.00 ? 6  MET A HE1  3  
ATOM 1881  H HE2  . MET A 1 6  ? 10.484  0.012   -0.125  1.00 0.00 ? 6  MET A HE2  3  
ATOM 1882  H HE3  . MET A 1 6  ? 10.638  0.624   1.515   1.00 0.00 ? 6  MET A HE3  3  
ATOM 1883  N N    . GLY A 1 7  ? 9.505   2.016   -4.060  1.00 0.00 ? 7  GLY A N    3  
ATOM 1884  C CA   . GLY A 1 7  ? 8.760   1.579   -5.224  1.00 0.00 ? 7  GLY A CA   3  
ATOM 1885  C C    . GLY A 1 7  ? 7.312   2.010   -4.995  1.00 0.00 ? 7  GLY A C    3  
ATOM 1886  O O    . GLY A 1 7  ? 6.932   2.395   -3.893  1.00 0.00 ? 7  GLY A O    3  
ATOM 1887  H H    . GLY A 1 7  ? 9.212   1.679   -3.163  1.00 0.00 ? 7  GLY A H    3  
ATOM 1888  H HA2  . GLY A 1 7  ? 9.165   2.036   -6.130  1.00 0.00 ? 7  GLY A HA2  3  
ATOM 1889  H HA3  . GLY A 1 7  ? 8.837   0.493   -5.275  1.00 0.00 ? 7  GLY A HA3  3  
ATOM 1890  N N    . GLY A 1 8  ? 6.523   1.924   -6.080  1.00 0.00 ? 8  GLY A N    3  
ATOM 1891  C CA   . GLY A 1 8  ? 5.126   2.322   -5.990  1.00 0.00 ? 8  GLY A CA   3  
ATOM 1892  C C    . GLY A 1 8  ? 4.705   2.983   -7.290  1.00 0.00 ? 8  GLY A C    3  
ATOM 1893  O O    . GLY A 1 8  ? 5.537   3.276   -8.138  1.00 0.00 ? 8  GLY A O    3  
ATOM 1894  H H    . GLY A 1 8  ? 6.882   1.611   -6.959  1.00 0.00 ? 8  GLY A H    3  
ATOM 1895  H HA2  . GLY A 1 8  ? 4.517   1.444   -5.774  1.00 0.00 ? 8  GLY A HA2  3  
ATOM 1896  H HA3  . GLY A 1 8  ? 5.037   3.067   -5.201  1.00 0.00 ? 8  GLY A HA3  3  
ATOM 1897  N N    . ASN A 1 9  ? 3.382   3.229   -7.377  1.00 0.00 ? 9  ASN A N    3  
ATOM 1898  C CA   . ASN A 1 9  ? 2.834   3.951   -8.531  1.00 0.00 ? 9  ASN A CA   3  
ATOM 1899  C C    . ASN A 1 9  ? 2.164   5.262   -8.065  1.00 0.00 ? 9  ASN A C    3  
ATOM 1900  O O    . ASN A 1 9  ? 1.745   6.080   -8.878  1.00 0.00 ? 9  ASN A O    3  
ATOM 1901  C CB   . ASN A 1 9  ? 1.882   3.062   -9.375  1.00 0.00 ? 9  ASN A CB   3  
ATOM 1902  C CG   . ASN A 1 9  ? 0.517   2.807   -8.717  1.00 0.00 ? 9  ASN A CG   3  
ATOM 1903  O OD1  . ASN A 1 9  ? 0.256   3.269   -7.621  1.00 0.00 ? 9  ASN A OD1  3  
ATOM 1904  N ND2  . ASN A 1 9  ? -0.376  2.123   -9.447  1.00 0.00 ? 9  ASN A ND2  3  
ATOM 1905  H H    . ASN A 1 9  ? 2.780   2.932   -6.625  1.00 0.00 ? 9  ASN A H    3  
ATOM 1906  H HA   . ASN A 1 9  ? 3.675   4.245   -9.164  1.00 0.00 ? 9  ASN A HA   3  
ATOM 1907  H HB2  . ASN A 1 9  ? 1.691   3.562   -10.325 1.00 0.00 ? 9  ASN A HB2  3  
ATOM 1908  H HB3  . ASN A 1 9  ? 2.362   2.115   -9.624  1.00 0.00 ? 9  ASN A HB3  3  
ATOM 1909  H HD21 . ASN A 1 9  ? -0.153  1.730   -10.344 1.00 0.00 ? 9  ASN A HD21 3  
ATOM 1910  H HD22 . ASN A 1 9  ? -1.297  2.030   -9.039  1.00 0.00 ? 9  ASN A HD22 3  
ATOM 1911  N N    . ALA A 1 10 ? 2.079   5.437   -6.728  1.00 0.00 ? 10 ALA A N    3  
ATOM 1912  C CA   . ALA A 1 10 ? 1.430   6.608   -6.145  1.00 0.00 ? 10 ALA A CA   3  
ATOM 1913  C C    . ALA A 1 10 ? 2.392   7.793   -6.013  1.00 0.00 ? 10 ALA A C    3  
ATOM 1914  O O    . ALA A 1 10 ? 2.472   8.425   -4.970  1.00 0.00 ? 10 ALA A O    3  
ATOM 1915  C CB   . ALA A 1 10 ? 0.864   6.255   -4.766  1.00 0.00 ? 10 ALA A CB   3  
ATOM 1916  H H    . ALA A 1 10 ? 2.417   4.738   -6.096  1.00 0.00 ? 10 ALA A H    3  
ATOM 1917  H HA   . ALA A 1 10 ? 0.609   6.895   -6.800  1.00 0.00 ? 10 ALA A HA   3  
ATOM 1918  H HB1  . ALA A 1 10 ? 1.648   6.014   -4.047  1.00 0.00 ? 10 ALA A HB1  3  
ATOM 1919  H HB2  . ALA A 1 10 ? 0.206   5.394   -4.842  1.00 0.00 ? 10 ALA A HB2  3  
ATOM 1920  H HB3  . ALA A 1 10 ? 0.283   7.082   -4.351  1.00 0.00 ? 10 ALA A HB3  3  
ATOM 1921  N N    . GLU A 1 11 ? 3.113   8.050   -7.118  1.00 0.00 ? 11 GLU A N    3  
ATOM 1922  C CA   . GLU A 1 11 ? 4.022   9.187   -7.238  1.00 0.00 ? 11 GLU A CA   3  
ATOM 1923  C C    . GLU A 1 11 ? 4.893   9.471   -5.975  1.00 0.00 ? 11 GLU A C    3  
ATOM 1924  O O    . GLU A 1 11 ? 5.127   10.612  -5.598  1.00 0.00 ? 11 GLU A O    3  
ATOM 1925  C CB   . GLU A 1 11 ? 3.266   10.424  -7.798  1.00 0.00 ? 11 GLU A CB   3  
ATOM 1926  C CG   . GLU A 1 11 ? 1.768   10.565  -7.423  1.00 0.00 ? 11 GLU A CG   3  
ATOM 1927  C CD   . GLU A 1 11 ? 0.834   9.550   -8.122  1.00 0.00 ? 11 GLU A CD   3  
ATOM 1928  O OE1  . GLU A 1 11 ? 1.142   9.082   -9.219  1.00 0.00 ? 11 GLU A OE1  3  
ATOM 1929  O OE2  . GLU A 1 11 ? -0.196  9.183   -7.556  1.00 0.00 ? 11 GLU A OE2  3  
ATOM 1930  H H    . GLU A 1 11 ? 2.924   7.502   -7.934  1.00 0.00 ? 11 GLU A H    3  
ATOM 1931  H HA   . GLU A 1 11 ? 4.730   8.879   -8.008  1.00 0.00 ? 11 GLU A HA   3  
ATOM 1932  H HB2  . GLU A 1 11 ? 3.788   11.337  -7.510  1.00 0.00 ? 11 GLU A HB2  3  
ATOM 1933  H HB3  . GLU A 1 11 ? 3.336   10.406  -8.887  1.00 0.00 ? 11 GLU A HB3  3  
ATOM 1934  H HG2  . GLU A 1 11 ? 1.640   10.497  -6.343  1.00 0.00 ? 11 GLU A HG2  3  
ATOM 1935  H HG3  . GLU A 1 11 ? 1.422   11.558  -7.709  1.00 0.00 ? 11 GLU A HG3  3  
ATOM 1936  N N    . GLY A 1 12 ? 5.396   8.365   -5.372  1.00 0.00 ? 12 GLY A N    3  
ATOM 1937  C CA   . GLY A 1 12 ? 6.322   8.483   -4.229  1.00 0.00 ? 12 GLY A CA   3  
ATOM 1938  C C    . GLY A 1 12 ? 5.632   8.883   -2.903  1.00 0.00 ? 12 GLY A C    3  
ATOM 1939  O O    . GLY A 1 12 ? 6.304   9.118   -1.906  1.00 0.00 ? 12 GLY A O    3  
ATOM 1940  H H    . GLY A 1 12 ? 5.123   7.480   -5.750  1.00 0.00 ? 12 GLY A H    3  
ATOM 1941  H HA2  . GLY A 1 12 ? 6.793   7.462   -4.072  1.00 0.00 ? 12 GLY A HA2  3  
ATOM 1942  H HA3  . GLY A 1 12 ? 7.002   9.349   -4.484  1.00 0.00 ? 12 GLY A HA3  3  
ATOM 1943  N N    . GLN A 1 13 ? 4.284   8.965   -2.919  1.00 0.00 ? 13 GLN A N    3  
ATOM 1944  C CA   . GLN A 1 13 ? 3.555   9.348   -1.711  1.00 0.00 ? 13 GLN A CA   3  
ATOM 1945  C C    . GLN A 1 13 ? 3.709   8.239   -0.639  1.00 0.00 ? 13 GLN A C    3  
ATOM 1946  O O    . GLN A 1 13 ? 3.486   7.070   -0.929  1.00 0.00 ? 13 GLN A O    3  
ATOM 1947  C CB   . GLN A 1 13 ? 2.055   9.566   -2.010  1.00 0.00 ? 13 GLN A CB   3  
ATOM 1948  C CG   . GLN A 1 13 ? 1.723   10.777  -2.913  1.00 0.00 ? 13 GLN A CG   3  
ATOM 1949  C CD   . GLN A 1 13 ? 2.028   12.118  -2.213  1.00 0.00 ? 13 GLN A CD   3  
ATOM 1950  O OE1  . GLN A 1 13 ? 2.523   12.164  -1.096  1.00 0.00 ? 13 GLN A OE1  3  
ATOM 1951  N NE2  . GLN A 1 13 ? 1.665   13.209  -2.904  1.00 0.00 ? 13 GLN A NE2  3  
ATOM 1952  H H    . GLN A 1 13 ? 3.768   8.729   -3.740  1.00 0.00 ? 13 GLN A H    3  
ATOM 1953  H HA   . GLN A 1 13 ? 4.015   10.269  -1.356  1.00 0.00 ? 13 GLN A HA   3  
ATOM 1954  H HB2  . GLN A 1 13 ? 1.639   8.659   -2.452  1.00 0.00 ? 13 GLN A HB2  3  
ATOM 1955  H HB3  . GLN A 1 13 ? 1.526   9.720   -1.067  1.00 0.00 ? 13 GLN A HB3  3  
ATOM 1956  H HG2  . GLN A 1 13 ? 2.228   10.730  -3.879  1.00 0.00 ? 13 GLN A HG2  3  
ATOM 1957  H HG3  . GLN A 1 13 ? 0.656   10.761  -3.137  1.00 0.00 ? 13 GLN A HG3  3  
ATOM 1958  H HE21 . GLN A 1 13 ? 1.268   13.140  -3.818  1.00 0.00 ? 13 GLN A HE21 3  
ATOM 1959  H HE22 . GLN A 1 13 ? 1.796   14.108  -2.479  1.00 0.00 ? 13 GLN A HE22 3  
ATOM 1960  N N    . PRO A 1 14 ? 4.100   8.628   0.609   1.00 0.00 ? 14 PRO A N    3  
ATOM 1961  C CA   . PRO A 1 14 ? 4.302   7.669   1.696   1.00 0.00 ? 14 PRO A CA   3  
ATOM 1962  C C    . PRO A 1 14 ? 2.998   6.935   2.033   1.00 0.00 ? 14 PRO A C    3  
ATOM 1963  O O    . PRO A 1 14 ? 1.911   7.452   1.804   1.00 0.00 ? 14 PRO A O    3  
ATOM 1964  C CB   . PRO A 1 14 ? 4.822   8.512   2.868   1.00 0.00 ? 14 PRO A CB   3  
ATOM 1965  C CG   . PRO A 1 14 ? 4.367   9.944   2.565   1.00 0.00 ? 14 PRO A CG   3  
ATOM 1966  C CD   . PRO A 1 14 ? 4.291   10.013  1.038   1.00 0.00 ? 14 PRO A CD   3  
ATOM 1967  H HA   . PRO A 1 14 ? 5.044   6.927   1.413   1.00 0.00 ? 14 PRO A HA   3  
ATOM 1968  H HB2  . PRO A 1 14 ? 4.468   8.163   3.845   1.00 0.00 ? 14 PRO A HB2  3  
ATOM 1969  H HB3  . PRO A 1 14 ? 5.918   8.477   2.861   1.00 0.00 ? 14 PRO A HB3  3  
ATOM 1970  H HG2  . PRO A 1 14 ? 3.317   10.042  2.952   1.00 0.00 ? 14 PRO A HG2  3  
ATOM 1971  H HG3  . PRO A 1 14 ? 5.125   10.683  2.933   1.00 0.00 ? 14 PRO A HG3  3  
ATOM 1972  H HD2  . PRO A 1 14 ? 3.464   10.651  0.723   1.00 0.00 ? 14 PRO A HD2  3  
ATOM 1973  H HD3  . PRO A 1 14 ? 5.220   10.398  0.613   1.00 0.00 ? 14 PRO A HD3  3  
ATOM 1974  N N    . CYS A 1 15 ? 3.169   5.700   2.564   1.00 0.00 ? 15 CYS A N    3  
ATOM 1975  C CA   . CYS A 1 15 ? 1.989   4.899   2.907   1.00 0.00 ? 15 CYS A CA   3  
ATOM 1976  C C    . CYS A 1 15 ? 0.998   5.698   3.759   1.00 0.00 ? 15 CYS A C    3  
ATOM 1977  O O    . CYS A 1 15 ? 1.357   6.527   4.587   1.00 0.00 ? 15 CYS A O    3  
ATOM 1978  C CB   . CYS A 1 15 ? 2.316   3.651   3.735   1.00 0.00 ? 15 CYS A CB   3  
ATOM 1979  S SG   . CYS A 1 15 ? 3.298   2.405   2.877   1.00 0.00 ? 15 CYS A SG   3  
ATOM 1980  H H    . CYS A 1 15 ? 4.099   5.360   2.719   1.00 0.00 ? 15 CYS A H    3  
ATOM 1981  H HA   . CYS A 1 15 ? 1.511   4.611   1.970   1.00 0.00 ? 15 CYS A HA   3  
ATOM 1982  H HB2  . CYS A 1 15 ? 2.799   3.914   4.670   1.00 0.00 ? 15 CYS A HB2  3  
ATOM 1983  H HB3  . CYS A 1 15 ? 1.391   3.173   4.047   1.00 0.00 ? 15 CYS A HB3  3  
ATOM 1984  N N    . LYS A 1 16 ? -0.268  5.365   3.481   1.00 0.00 ? 16 LYS A N    3  
ATOM 1985  C CA   . LYS A 1 16 ? -1.397  5.969   4.136   1.00 0.00 ? 16 LYS A CA   3  
ATOM 1986  C C    . LYS A 1 16 ? -1.974  4.792   4.935   1.00 0.00 ? 16 LYS A C    3  
ATOM 1987  O O    . LYS A 1 16 ? -2.454  3.815   4.378   1.00 0.00 ? 16 LYS A O    3  
ATOM 1988  C CB   . LYS A 1 16 ? -2.284  6.509   2.973   1.00 0.00 ? 16 LYS A CB   3  
ATOM 1989  C CG   . LYS A 1 16 ? -3.702  7.079   3.219   1.00 0.00 ? 16 LYS A CG   3  
ATOM 1990  C CD   . LYS A 1 16 ? -4.509  6.072   4.030   1.00 0.00 ? 16 LYS A CD   3  
ATOM 1991  C CE   . LYS A 1 16 ? -6.011  6.337   4.051   1.00 0.00 ? 16 LYS A CE   3  
ATOM 1992  N NZ   . LYS A 1 16 ? -6.575  6.621   5.370   1.00 0.00 ? 16 LYS A NZ   3  
ATOM 1993  H H    . LYS A 1 16 ? -0.508  4.645   2.825   1.00 0.00 ? 16 LYS A H    3  
ATOM 1994  H HA   . LYS A 1 16 ? -1.046  6.742   4.825   1.00 0.00 ? 16 LYS A HA   3  
ATOM 1995  H HB2  . LYS A 1 16 ? -1.710  7.224   2.381   1.00 0.00 ? 16 LYS A HB2  3  
ATOM 1996  H HB3  . LYS A 1 16 ? -2.463  5.648   2.332   1.00 0.00 ? 16 LYS A HB3  3  
ATOM 1997  H HG2  . LYS A 1 16 ? -3.778  8.081   3.642   1.00 0.00 ? 16 LYS A HG2  3  
ATOM 1998  H HG3  . LYS A 1 16 ? -4.155  7.232   2.233   1.00 0.00 ? 16 LYS A HG3  3  
ATOM 1999  H HD2  . LYS A 1 16 ? -4.280  5.093   3.581   1.00 0.00 ? 16 LYS A HD2  3  
ATOM 2000  H HD3  . LYS A 1 16 ? -4.156  6.047   5.059   1.00 0.00 ? 16 LYS A HD3  3  
ATOM 2001  H HE2  . LYS A 1 16 ? -6.293  7.151   3.384   1.00 0.00 ? 16 LYS A HE2  3  
ATOM 2002  H HE3  . LYS A 1 16 ? -6.489  5.421   3.711   1.00 0.00 ? 16 LYS A HE3  3  
ATOM 2003  H HZ1  . LYS A 1 16 ? -6.538  5.746   5.937   1.00 0.00 ? 16 LYS A HZ1  3  
ATOM 2004  H HZ2  . LYS A 1 16 ? -7.593  6.855   5.279   1.00 0.00 ? 16 LYS A HZ2  3  
ATOM 2005  H HZ3  . LYS A 1 16 ? -6.110  7.412   5.850   1.00 0.00 ? 16 LYS A HZ3  3  
ATOM 2006  N N    . PHE A 1 17 ? -1.890  4.939   6.266   1.00 0.00 ? 17 PHE A N    3  
ATOM 2007  C CA   . PHE A 1 17 ? -2.437  3.941   7.175   1.00 0.00 ? 17 PHE A CA   3  
ATOM 2008  C C    . PHE A 1 17 ? -3.501  4.705   7.984   1.00 0.00 ? 17 PHE A C    3  
ATOM 2009  O O    . PHE A 1 17 ? -3.226  5.813   8.427   1.00 0.00 ? 17 PHE A O    3  
ATOM 2010  C CB   . PHE A 1 17 ? -1.345  3.427   8.145   1.00 0.00 ? 17 PHE A CB   3  
ATOM 2011  C CG   . PHE A 1 17 ? -0.173  2.749   7.472   1.00 0.00 ? 17 PHE A CG   3  
ATOM 2012  C CD1  . PHE A 1 17 ? -0.352  1.662   6.621   1.00 0.00 ? 17 PHE A CD1  3  
ATOM 2013  C CD2  . PHE A 1 17 ? 1.127   3.185   7.720   1.00 0.00 ? 17 PHE A CD2  3  
ATOM 2014  C CE1  . PHE A 1 17 ? 0.742   1.029   6.045   1.00 0.00 ? 17 PHE A CE1  3  
ATOM 2015  C CE2  . PHE A 1 17 ? 2.220   2.549   7.150   1.00 0.00 ? 17 PHE A CE2  3  
ATOM 2016  C CZ   . PHE A 1 17 ? 2.029   1.466   6.311   1.00 0.00 ? 17 PHE A CZ   3  
ATOM 2017  H H    . PHE A 1 17 ? -1.494  5.767   6.664   1.00 0.00 ? 17 PHE A H    3  
ATOM 2018  H HA   . PHE A 1 17 ? -2.879  3.137   6.585   1.00 0.00 ? 17 PHE A HA   3  
ATOM 2019  H HB2  . PHE A 1 17 ? -0.961  4.277   8.724   1.00 0.00 ? 17 PHE A HB2  3  
ATOM 2020  H HB3  . PHE A 1 17 ? -1.771  2.708   8.859   1.00 0.00 ? 17 PHE A HB3  3  
ATOM 2021  H HD1  . PHE A 1 17 ? -1.340  1.293   6.403   1.00 0.00 ? 17 PHE A HD1  3  
ATOM 2022  H HD2  . PHE A 1 17 ? 1.306   4.023   8.369   1.00 0.00 ? 17 PHE A HD2  3  
ATOM 2023  H HE1  . PHE A 1 17 ? 0.606   0.193   5.385   1.00 0.00 ? 17 PHE A HE1  3  
ATOM 2024  H HE2  . PHE A 1 17 ? 3.222   2.893   7.357   1.00 0.00 ? 17 PHE A HE2  3  
ATOM 2025  H HZ   . PHE A 1 17 ? 2.878   0.967   5.865   1.00 0.00 ? 17 PHE A HZ   3  
ATOM 2026  N N    . PRO A 1 18 ? -4.717  4.125   8.167   1.00 0.00 ? 18 PRO A N    3  
ATOM 2027  C CA   . PRO A 1 18 ? -5.202  2.891   7.550   1.00 0.00 ? 18 PRO A CA   3  
ATOM 2028  C C    . PRO A 1 18 ? -5.699  3.132   6.115   1.00 0.00 ? 18 PRO A C    3  
ATOM 2029  O O    . PRO A 1 18 ? -6.321  4.155   5.859   1.00 0.00 ? 18 PRO A O    3  
ATOM 2030  C CB   . PRO A 1 18 ? -6.414  2.511   8.410   1.00 0.00 ? 18 PRO A CB   3  
ATOM 2031  C CG   . PRO A 1 18 ? -6.939  3.842   8.954   1.00 0.00 ? 18 PRO A CG   3  
ATOM 2032  C CD   . PRO A 1 18 ? -5.694  4.726   9.076   1.00 0.00 ? 18 PRO A CD   3  
ATOM 2033  H HA   . PRO A 1 18 ? -4.437  2.124   7.578   1.00 0.00 ? 18 PRO A HA   3  
ATOM 2034  H HB2  . PRO A 1 18 ? -7.175  1.932   7.885   1.00 0.00 ? 18 PRO A HB2  3  
ATOM 2035  H HB3  . PRO A 1 18 ? -6.078  1.901   9.243   1.00 0.00 ? 18 PRO A HB3  3  
ATOM 2036  H HG2  . PRO A 1 18 ? -7.633  4.281   8.236   1.00 0.00 ? 18 PRO A HG2  3  
ATOM 2037  H HG3  . PRO A 1 18 ? -7.467  3.727   9.902   1.00 0.00 ? 18 PRO A HG3  3  
ATOM 2038  H HD2  . PRO A 1 18 ? -5.904  5.764   8.801   1.00 0.00 ? 18 PRO A HD2  3  
ATOM 2039  H HD3  . PRO A 1 18 ? -5.299  4.691   10.096  1.00 0.00 ? 18 PRO A HD3  3  
ATOM 2040  N N    . PHE A 1 19 ? -5.423  2.168   5.218   1.00 0.00 ? 19 PHE A N    3  
ATOM 2041  C CA   . PHE A 1 19 ? -5.947  2.227   3.845   1.00 0.00 ? 19 PHE A CA   3  
ATOM 2042  C C    . PHE A 1 19 ? -6.973  1.092   3.719   1.00 0.00 ? 19 PHE A C    3  
ATOM 2043  O O    . PHE A 1 19 ? -6.840  0.060   4.366   1.00 0.00 ? 19 PHE A O    3  
ATOM 2044  C CB   . PHE A 1 19 ? -4.865  2.123   2.748   1.00 0.00 ? 19 PHE A CB   3  
ATOM 2045  C CG   . PHE A 1 19 ? -4.122  0.758   2.751   1.00 0.00 ? 19 PHE A CG   3  
ATOM 2046  C CD1  . PHE A 1 19 ? -3.009  0.520   3.598   1.00 0.00 ? 19 PHE A CD1  3  
ATOM 2047  C CD2  . PHE A 1 19 ? -4.512  -0.306  1.901   1.00 0.00 ? 19 PHE A CD2  3  
ATOM 2048  C CE1  . PHE A 1 19 ? -2.280  -0.695  3.513   1.00 0.00 ? 19 PHE A CE1  3  
ATOM 2049  C CE2  . PHE A 1 19 ? -3.791  -1.488  1.832   1.00 0.00 ? 19 PHE A CE2  3  
ATOM 2050  C CZ   . PHE A 1 19 ? -2.670  -1.675  2.618   1.00 0.00 ? 19 PHE A CZ   3  
ATOM 2051  H H    . PHE A 1 19 ? -4.923  1.362   5.547   1.00 0.00 ? 19 PHE A H    3  
ATOM 2052  H HA   . PHE A 1 19 ? -6.485  3.167   3.714   1.00 0.00 ? 19 PHE A HA   3  
ATOM 2053  H HB2  . PHE A 1 19 ? -5.401  2.344   1.802   1.00 0.00 ? 19 PHE A HB2  3  
ATOM 2054  H HB3  . PHE A 1 19 ? -4.187  3.001   2.818   1.00 0.00 ? 19 PHE A HB3  3  
ATOM 2055  H HD1  . PHE A 1 19 ? -2.738  1.280   4.346   1.00 0.00 ? 19 PHE A HD1  3  
ATOM 2056  H HD2  . PHE A 1 19 ? -5.375  -0.362  1.246   1.00 0.00 ? 19 PHE A HD2  3  
ATOM 2057  H HE1  . PHE A 1 19 ? -1.398  -1.016  4.086   1.00 0.00 ? 19 PHE A HE1  3  
ATOM 2058  H HE2  . PHE A 1 19 ? -4.117  -2.268  1.155   1.00 0.00 ? 19 PHE A HE2  3  
ATOM 2059  H HZ   . PHE A 1 19 ? -2.089  -2.586  2.541   1.00 0.00 ? 19 PHE A HZ   3  
ATOM 2060  N N    . ARG A 1 20 ? -8.010  1.340   2.889   1.00 0.00 ? 20 ARG A N    3  
ATOM 2061  C CA   . ARG A 1 20 ? -9.087  0.360   2.734   1.00 0.00 ? 20 ARG A CA   3  
ATOM 2062  C C    . ARG A 1 20 ? -8.948  -0.351  1.360   1.00 0.00 ? 20 ARG A C    3  
ATOM 2063  O O    . ARG A 1 20 ? -9.013  0.288   0.316   1.00 0.00 ? 20 ARG A O    3  
ATOM 2064  C CB   . ARG A 1 20 ? -10.428 1.138   2.862   1.00 0.00 ? 20 ARG A CB   3  
ATOM 2065  C CG   . ARG A 1 20 ? -11.657 0.328   3.348   1.00 0.00 ? 20 ARG A CG   3  
ATOM 2066  C CD   . ARG A 1 20 ? -13.016 0.709   2.659   1.00 0.00 ? 20 ARG A CD   3  
ATOM 2067  N NE   . ARG A 1 20 ? -12.899 0.981   1.200   1.00 0.00 ? 20 ARG A NE   3  
ATOM 2068  C CZ   . ARG A 1 20 ? -12.437 0.069   0.319   1.00 0.00 ? 20 ARG A CZ   3  
ATOM 2069  N NH1  . ARG A 1 20 ? -11.928 -1.082  0.712   1.00 0.00 ? 20 ARG A NH1  3  
ATOM 2070  N NH2  . ARG A 1 20 ? -12.467 0.305   -0.978  1.00 0.00 ? 20 ARG A NH2  3  
ATOM 2071  H H    . ARG A 1 20 ? -8.078  2.211   2.393   1.00 0.00 ? 20 ARG A H    3  
ATOM 2072  H HA   . ARG A 1 20 ? -8.957  -0.375  3.530   1.00 0.00 ? 20 ARG A HA   3  
ATOM 2073  H HB2  . ARG A 1 20 ? -10.296 1.956   3.572   1.00 0.00 ? 20 ARG A HB2  3  
ATOM 2074  H HB3  . ARG A 1 20 ? -10.626 1.646   1.919   1.00 0.00 ? 20 ARG A HB3  3  
ATOM 2075  H HG2  . ARG A 1 20 ? -11.482 -0.733  3.202   1.00 0.00 ? 20 ARG A HG2  3  
ATOM 2076  H HG3  . ARG A 1 20 ? -11.699 0.412   4.450   1.00 0.00 ? 20 ARG A HG3  3  
ATOM 2077  H HD2  . ARG A 1 20 ? -13.763 -0.099  2.778   1.00 0.00 ? 20 ARG A HD2  3  
ATOM 2078  H HD3  . ARG A 1 20 ? -13.473 1.600   3.114   1.00 0.00 ? 20 ARG A HD3  3  
ATOM 2079  H HE   . ARG A 1 20 ? -13.142 1.844   0.714   1.00 0.00 ? 20 ARG A HE   3  
ATOM 2080  H HH11 . ARG A 1 20 ? -11.920 -1.346  1.673   1.00 0.00 ? 20 ARG A HH11 3  
ATOM 2081  H HH12 . ARG A 1 20 ? -11.529 -1.665  -0.007  1.00 0.00 ? 20 ARG A HH12 3  
ATOM 2082  H HH21 . ARG A 1 20 ? -12.790 1.191   -1.353  1.00 0.00 ? 20 ARG A HH21 3  
ATOM 2083  H HH22 . ARG A 1 20 ? -12.144 -0.401  -1.619  1.00 0.00 ? 20 ARG A HH22 3  
ATOM 2084  N N    . PHE A 1 21 ? -8.763  -1.690  1.418   1.00 0.00 ? 21 PHE A N    3  
ATOM 2085  C CA   . PHE A 1 21 ? -8.607  -2.552  0.237   1.00 0.00 ? 21 PHE A CA   3  
ATOM 2086  C C    . PHE A 1 21 ? -9.461  -3.810  0.486   1.00 0.00 ? 21 PHE A C    3  
ATOM 2087  O O    . PHE A 1 21 ? -9.593  -4.248  1.616   1.00 0.00 ? 21 PHE A O    3  
ATOM 2088  C CB   . PHE A 1 21 ? -7.112  -2.893  0.098   1.00 0.00 ? 21 PHE A CB   3  
ATOM 2089  C CG   . PHE A 1 21 ? -6.823  -4.058  -0.811  1.00 0.00 ? 21 PHE A CG   3  
ATOM 2090  C CD1  . PHE A 1 21 ? -7.215  -4.036  -2.137  1.00 0.00 ? 21 PHE A CD1  3  
ATOM 2091  C CD2  . PHE A 1 21 ? -6.133  -5.165  -0.342  1.00 0.00 ? 21 PHE A CD2  3  
ATOM 2092  C CE1  . PHE A 1 21 ? -6.861  -5.056  -3.011  1.00 0.00 ? 21 PHE A CE1  3  
ATOM 2093  C CE2  . PHE A 1 21 ? -5.783  -6.199  -1.198  1.00 0.00 ? 21 PHE A CE2  3  
ATOM 2094  C CZ   . PHE A 1 21 ? -6.129  -6.139  -2.542  1.00 0.00 ? 21 PHE A CZ   3  
ATOM 2095  H H    . PHE A 1 21 ? -8.726  -2.160  2.312   1.00 0.00 ? 21 PHE A H    3  
ATOM 2096  H HA   . PHE A 1 21 ? -8.982  -2.068  -0.673  1.00 0.00 ? 21 PHE A HA   3  
ATOM 2097  H HB2  . PHE A 1 21 ? -6.566  -2.021  -0.273  1.00 0.00 ? 21 PHE A HB2  3  
ATOM 2098  H HB3  . PHE A 1 21 ? -6.694  -3.155  1.070   1.00 0.00 ? 21 PHE A HB3  3  
ATOM 2099  H HD1  . PHE A 1 21 ? -7.831  -3.216  -2.451  1.00 0.00 ? 21 PHE A HD1  3  
ATOM 2100  H HD2  . PHE A 1 21 ? -5.892  -5.213  0.706   1.00 0.00 ? 21 PHE A HD2  3  
ATOM 2101  H HE1  . PHE A 1 21 ? -7.166  -5.008  -4.046  1.00 0.00 ? 21 PHE A HE1  3  
ATOM 2102  H HE2  . PHE A 1 21 ? -5.248  -7.054  -0.814  1.00 0.00 ? 21 PHE A HE2  3  
ATOM 2103  H HZ   . PHE A 1 21 ? -5.844  -6.939  -3.209  1.00 0.00 ? 21 PHE A HZ   3  
ATOM 2104  N N    . GLN A 1 22 ? -10.065 -4.358  -0.583  1.00 0.00 ? 22 GLN A N    3  
ATOM 2105  C CA   . GLN A 1 22 ? -10.940 -5.531  -0.470  1.00 0.00 ? 22 GLN A CA   3  
ATOM 2106  C C    . GLN A 1 22 ? -12.023 -5.317  0.634   1.00 0.00 ? 22 GLN A C    3  
ATOM 2107  O O    . GLN A 1 22 ? -12.328 -6.222  1.402   1.00 0.00 ? 22 GLN A O    3  
ATOM 2108  C CB   . GLN A 1 22 ? -10.184 -6.859  -0.153  1.00 0.00 ? 22 GLN A CB   3  
ATOM 2109  C CG   . GLN A 1 22 ? -9.130  -7.321  -1.187  1.00 0.00 ? 22 GLN A CG   3  
ATOM 2110  C CD   . GLN A 1 22 ? -8.198  -8.436  -0.671  1.00 0.00 ? 22 GLN A CD   3  
ATOM 2111  O OE1  . GLN A 1 22 ? -7.921  -9.387  -1.387  1.00 0.00 ? 22 GLN A OE1  3  
ATOM 2112  N NE2  . GLN A 1 22 ? -7.729  -8.305  0.573   1.00 0.00 ? 22 GLN A NE2  3  
ATOM 2113  H H    . GLN A 1 22 ? -9.945  -3.918  -1.481  1.00 0.00 ? 22 GLN A H    3  
ATOM 2114  H HA   . GLN A 1 22 ? -11.420 -5.576  -1.447  1.00 0.00 ? 22 GLN A HA   3  
ATOM 2115  H HB2  . GLN A 1 22 ? -9.722  -6.745  0.829   1.00 0.00 ? 22 GLN A HB2  3  
ATOM 2116  H HB3  . GLN A 1 22 ? -10.904 -7.673  -0.055  1.00 0.00 ? 22 GLN A HB3  3  
ATOM 2117  H HG2  . GLN A 1 22 ? -9.567  -7.809  -2.083  1.00 0.00 ? 22 GLN A HG2  3  
ATOM 2118  H HG3  . GLN A 1 22 ? -8.539  -6.435  -1.452  1.00 0.00 ? 22 GLN A HG3  3  
ATOM 2119  H HE21 . GLN A 1 22 ? -7.899  -7.559  1.223   1.00 0.00 ? 22 GLN A HE21 3  
ATOM 2120  H HE22 . GLN A 1 22 ? -7.117  -9.018  0.931   1.00 0.00 ? 22 GLN A HE22 3  
ATOM 2121  N N    . GLY A 1 23 ? -12.557 -4.073  0.722   1.00 0.00 ? 23 GLY A N    3  
ATOM 2122  C CA   . GLY A 1 23 ? -13.574 -3.787  1.744   1.00 0.00 ? 23 GLY A CA   3  
ATOM 2123  C C    . GLY A 1 23 ? -13.080 -3.941  3.204   1.00 0.00 ? 23 GLY A C    3  
ATOM 2124  O O    . GLY A 1 23 ? -13.870 -3.935  4.136   1.00 0.00 ? 23 GLY A O    3  
ATOM 2125  H H    . GLY A 1 23 ? -12.290 -3.351  0.084   1.00 0.00 ? 23 GLY A H    3  
ATOM 2126  H HA2  . GLY A 1 23 ? -13.937 -2.768  1.577   1.00 0.00 ? 23 GLY A HA2  3  
ATOM 2127  H HA3  . GLY A 1 23 ? -14.399 -4.489  1.580   1.00 0.00 ? 23 GLY A HA3  3  
ATOM 2128  N N    . THR A 1 24 ? -11.750 -4.090  3.342   1.00 0.00 ? 24 THR A N    3  
ATOM 2129  C CA   . THR A 1 24 ? -11.081 -4.329  4.610   1.00 0.00 ? 24 THR A CA   3  
ATOM 2130  C C    . THR A 1 24 ? -10.094 -3.179  4.874   1.00 0.00 ? 24 THR A C    3  
ATOM 2131  O O    . THR A 1 24 ? -9.536  -2.604  3.948   1.00 0.00 ? 24 THR A O    3  
ATOM 2132  C CB   . THR A 1 24 ? -10.347 -5.676  4.448   1.00 0.00 ? 24 THR A CB   3  
ATOM 2133  O OG1  . THR A 1 24 ? -11.247 -6.662  3.966   1.00 0.00 ? 24 THR A OG1  3  
ATOM 2134  C CG2  . THR A 1 24 ? -9.759  -6.193  5.765   1.00 0.00 ? 24 THR A CG2  3  
ATOM 2135  H H    . THR A 1 24 ? -11.121 -4.084  2.567   1.00 0.00 ? 24 THR A H    3  
ATOM 2136  H HA   . THR A 1 24 ? -11.828 -4.375  5.405   1.00 0.00 ? 24 THR A HA   3  
ATOM 2137  H HB   . THR A 1 24 ? -9.519  -5.574  3.735   1.00 0.00 ? 24 THR A HB   3  
ATOM 2138  H HG1  . THR A 1 24 ? -11.628 -6.400  3.122   1.00 0.00 ? 24 THR A HG1  3  
ATOM 2139  H HG21 . THR A 1 24 ? -9.000  -5.517  6.160   1.00 0.00 ? 24 THR A HG21 3  
ATOM 2140  H HG22 . THR A 1 24 ? -9.285  -7.163  5.616   1.00 0.00 ? 24 THR A HG22 3  
ATOM 2141  H HG23 . THR A 1 24 ? -10.535 -6.313  6.521   1.00 0.00 ? 24 THR A HG23 3  
ATOM 2142  N N    . SER A 1 25 ? -9.919  -2.872  6.171   1.00 0.00 ? 25 SER A N    3  
ATOM 2143  C CA   . SER A 1 25 ? -9.007  -1.830  6.617   1.00 0.00 ? 25 SER A CA   3  
ATOM 2144  C C    . SER A 1 25 ? -7.639  -2.465  6.931   1.00 0.00 ? 25 SER A C    3  
ATOM 2145  O O    . SER A 1 25 ? -7.552  -3.532  7.526   1.00 0.00 ? 25 SER A O    3  
ATOM 2146  C CB   . SER A 1 25 ? -9.621  -1.198  7.876   1.00 0.00 ? 25 SER A CB   3  
ATOM 2147  O OG   . SER A 1 25 ? -10.424 -2.174  8.538   1.00 0.00 ? 25 SER A OG   3  
ATOM 2148  H H    . SER A 1 25 ? -10.381 -3.340  6.928   1.00 0.00 ? 25 SER A H    3  
ATOM 2149  H HA   . SER A 1 25 ? -8.895  -1.087  5.824   1.00 0.00 ? 25 SER A HA   3  
ATOM 2150  H HB2  . SER A 1 25 ? -8.839  -0.800  8.536   1.00 0.00 ? 25 SER A HB2  3  
ATOM 2151  H HB3  . SER A 1 25 ? -10.257 -0.360  7.575   1.00 0.00 ? 25 SER A HB3  3  
ATOM 2152  H HG   . SER A 1 25 ? -10.732 -1.852  9.383   1.00 0.00 ? 25 SER A HG   3  
ATOM 2153  N N    . TYR A 1 26 ? -6.590  -1.748  6.487   1.00 0.00 ? 26 TYR A N    3  
ATOM 2154  C CA   . TYR A 1 26 ? -5.216  -2.184  6.689   1.00 0.00 ? 26 TYR A CA   3  
ATOM 2155  C C    . TYR A 1 26 ? -4.400  -1.054  7.325   1.00 0.00 ? 26 TYR A C    3  
ATOM 2156  O O    . TYR A 1 26 ? -4.268  0.025   6.759   1.00 0.00 ? 26 TYR A O    3  
ATOM 2157  C CB   . TYR A 1 26 ? -4.579  -2.504  5.339   1.00 0.00 ? 26 TYR A CB   3  
ATOM 2158  C CG   . TYR A 1 26 ? -5.217  -3.687  4.684   1.00 0.00 ? 26 TYR A CG   3  
ATOM 2159  C CD1  . TYR A 1 26 ? -4.743  -4.962  4.950   1.00 0.00 ? 26 TYR A CD1  3  
ATOM 2160  C CD2  . TYR A 1 26 ? -6.270  -3.530  3.793   1.00 0.00 ? 26 TYR A CD2  3  
ATOM 2161  C CE1  . TYR A 1 26 ? -5.299  -6.063  4.324   1.00 0.00 ? 26 TYR A CE1  3  
ATOM 2162  C CE2  . TYR A 1 26 ? -6.811  -4.638  3.164   1.00 0.00 ? 26 TYR A CE2  3  
ATOM 2163  C CZ   . TYR A 1 26 ? -6.335  -5.907  3.422   1.00 0.00 ? 26 TYR A CZ   3  
ATOM 2164  O OH   . TYR A 1 26 ? -6.893  -6.982  2.761   1.00 0.00 ? 26 TYR A OH   3  
ATOM 2165  H H    . TYR A 1 26 ? -6.733  -0.891  5.987   1.00 0.00 ? 26 TYR A H    3  
ATOM 2166  H HA   . TYR A 1 26 ? -5.196  -3.059  7.341   1.00 0.00 ? 26 TYR A HA   3  
ATOM 2167  H HB2  . TYR A 1 26 ? -4.680  -1.651  4.666   1.00 0.00 ? 26 TYR A HB2  3  
ATOM 2168  H HB3  . TYR A 1 26 ? -3.516  -2.730  5.477   1.00 0.00 ? 26 TYR A HB3  3  
ATOM 2169  H HD1  . TYR A 1 26 ? -3.932  -5.102  5.642   1.00 0.00 ? 26 TYR A HD1  3  
ATOM 2170  H HD2  . TYR A 1 26 ? -6.671  -2.549  3.576   1.00 0.00 ? 26 TYR A HD2  3  
ATOM 2171  H HE1  . TYR A 1 26 ? -4.901  -7.036  4.527   1.00 0.00 ? 26 TYR A HE1  3  
ATOM 2172  H HE2  . TYR A 1 26 ? -7.580  -4.519  2.430   1.00 0.00 ? 26 TYR A HE2  3  
ATOM 2173  H HH   . TYR A 1 26 ? -6.232  -7.677  2.649   1.00 0.00 ? 26 TYR A HH   3  
ATOM 2174  N N    . ASP A 1 27 ? -3.820  -1.396  8.490   1.00 0.00 ? 27 ASP A N    3  
ATOM 2175  C CA   . ASP A 1 27 ? -2.988  -0.478  9.264   1.00 0.00 ? 27 ASP A CA   3  
ATOM 2176  C C    . ASP A 1 27 ? -1.528  -0.953  9.229   1.00 0.00 ? 27 ASP A C    3  
ATOM 2177  O O    . ASP A 1 27 ? -0.756  -0.739  10.155  1.00 0.00 ? 27 ASP A O    3  
ATOM 2178  C CB   . ASP A 1 27 ? -3.493  -0.464  10.720  1.00 0.00 ? 27 ASP A CB   3  
ATOM 2179  C CG   . ASP A 1 27 ? -4.910  0.118   10.836  1.00 0.00 ? 27 ASP A CG   3  
ATOM 2180  O OD1  . ASP A 1 27 ? -5.855  -0.518  10.365  1.00 0.00 ? 27 ASP A OD1  3  
ATOM 2181  O OD2  . ASP A 1 27 ? -5.055  1.204   11.394  1.00 0.00 ? 27 ASP A OD2  3  
ATOM 2182  H H    . ASP A 1 27 ? -4.024  -2.286  8.892   1.00 0.00 ? 27 ASP A H    3  
ATOM 2183  H HA   . ASP A 1 27 ? -3.032  0.521   8.832   1.00 0.00 ? 27 ASP A HA   3  
ATOM 2184  H HB2  . ASP A 1 27 ? -3.496  -1.469  11.141  1.00 0.00 ? 27 ASP A HB2  3  
ATOM 2185  H HB3  . ASP A 1 27 ? -2.826  0.132   11.346  1.00 0.00 ? 27 ASP A HB3  3  
ATOM 2186  N N    . SER A 1 28 ? -1.193  -1.639  8.120   1.00 0.00 ? 28 SER A N    3  
ATOM 2187  C CA   . SER A 1 28 ? 0.153   -2.171  7.988   1.00 0.00 ? 28 SER A CA   3  
ATOM 2188  C C    . SER A 1 28 ? 0.346   -2.626  6.535   1.00 0.00 ? 28 SER A C    3  
ATOM 2189  O O    . SER A 1 28 ? -0.604  -2.777  5.775   1.00 0.00 ? 28 SER A O    3  
ATOM 2190  C CB   . SER A 1 28 ? 0.326   -3.355  8.977   1.00 0.00 ? 28 SER A CB   3  
ATOM 2191  O OG   . SER A 1 28 ? -0.712  -4.304  8.799   1.00 0.00 ? 28 SER A OG   3  
ATOM 2192  H H    . SER A 1 28 ? -1.826  -1.795  7.361   1.00 0.00 ? 28 SER A H    3  
ATOM 2193  H HA   . SER A 1 28 ? 0.862   -1.356  8.165   1.00 0.00 ? 28 SER A HA   3  
ATOM 2194  H HB2  . SER A 1 28 ? 1.276   -3.887  8.780   1.00 0.00 ? 28 SER A HB2  3  
ATOM 2195  H HB3  . SER A 1 28 ? 0.282   -3.006  10.034  1.00 0.00 ? 28 SER A HB3  3  
ATOM 2196  H HG   . SER A 1 28 ? -1.558  -3.871  8.851   1.00 0.00 ? 28 SER A HG   3  
ATOM 2197  N N    . CYS A 1 29 ? 1.638   -2.827  6.225   1.00 0.00 ? 29 CYS A N    3  
ATOM 2198  C CA   . CYS A 1 29 ? 2.092   -3.311  4.928   1.00 0.00 ? 29 CYS A CA   3  
ATOM 2199  C C    . CYS A 1 29 ? 1.497   -4.706  4.619   1.00 0.00 ? 29 CYS A C    3  
ATOM 2200  O O    . CYS A 1 29 ? 1.550   -5.584  5.475   1.00 0.00 ? 29 CYS A O    3  
ATOM 2201  C CB   . CYS A 1 29 ? 3.603   -3.477  5.081   1.00 0.00 ? 29 CYS A CB   3  
ATOM 2202  S SG   . CYS A 1 29 ? 4.466   -1.948  5.516   1.00 0.00 ? 29 CYS A SG   3  
ATOM 2203  H H    . CYS A 1 29 ? 2.346   -2.651  6.911   1.00 0.00 ? 29 CYS A H    3  
ATOM 2204  H HA   . CYS A 1 29 ? 1.844   -2.572  4.166   1.00 0.00 ? 29 CYS A HA   3  
ATOM 2205  H HB2  . CYS A 1 29 ? 3.796   -4.208  5.871   1.00 0.00 ? 29 CYS A HB2  3  
ATOM 2206  H HB3  . CYS A 1 29 ? 4.034   -3.847  4.151   1.00 0.00 ? 29 CYS A HB3  3  
ATOM 2207  N N    . THR A 1 30 ? 0.958   -4.896  3.387   1.00 0.00 ? 30 THR A N    3  
ATOM 2208  C CA   . THR A 1 30 ? 0.416   -6.210  3.017   1.00 0.00 ? 30 THR A CA   3  
ATOM 2209  C C    . THR A 1 30 ? 1.168   -6.749  1.791   1.00 0.00 ? 30 THR A C    3  
ATOM 2210  O O    . THR A 1 30 ? 1.989   -6.079  1.181   1.00 0.00 ? 30 THR A O    3  
ATOM 2211  C CB   . THR A 1 30 ? -1.111  -6.161  2.781   1.00 0.00 ? 30 THR A CB   3  
ATOM 2212  O OG1  . THR A 1 30 ? -1.559  -7.504  2.633   1.00 0.00 ? 30 THR A OG1  3  
ATOM 2213  C CG2  . THR A 1 30 ? -1.509  -5.341  1.533   1.00 0.00 ? 30 THR A CG2  3  
ATOM 2214  H H    . THR A 1 30 ? 0.938   -4.184  2.676   1.00 0.00 ? 30 THR A H    3  
ATOM 2215  H HA   . THR A 1 30 ? 0.601   -6.910  3.831   1.00 0.00 ? 30 THR A HA   3  
ATOM 2216  H HB   . THR A 1 30 ? -1.554  -5.731  3.693   1.00 0.00 ? 30 THR A HB   3  
ATOM 2217  H HG1  . THR A 1 30 ? -2.524  -7.537  2.592   1.00 0.00 ? 30 THR A HG1  3  
ATOM 2218  H HG21 . THR A 1 30 ? -1.188  -5.835  0.614   1.00 0.00 ? 30 THR A HG21 3  
ATOM 2219  H HG22 . THR A 1 30 ? -1.054  -4.350  1.532   1.00 0.00 ? 30 THR A HG22 3  
ATOM 2220  H HG23 . THR A 1 30 ? -2.589  -5.204  1.458   1.00 0.00 ? 30 THR A HG23 3  
ATOM 2221  N N    . THR A 1 31 ? 0.807   -8.004  1.484   1.00 0.00 ? 31 THR A N    3  
ATOM 2222  C CA   . THR A 1 31 ? 1.338   -8.727  0.331   1.00 0.00 ? 31 THR A CA   3  
ATOM 2223  C C    . THR A 1 31 ? 0.209   -9.239  -0.589  1.00 0.00 ? 31 THR A C    3  
ATOM 2224  O O    . THR A 1 31 ? 0.478   -9.816  -1.633  1.00 0.00 ? 31 THR A O    3  
ATOM 2225  C CB   . THR A 1 31 ? 2.252   -9.879  0.815   1.00 0.00 ? 31 THR A CB   3  
ATOM 2226  O OG1  . THR A 1 31 ? 2.109   -10.090 2.219   1.00 0.00 ? 31 THR A OG1  3  
ATOM 2227  C CG2  . THR A 1 31 ? 3.719   -9.554  0.525   1.00 0.00 ? 31 THR A CG2  3  
ATOM 2228  H H    . THR A 1 31 ? 0.135   -8.378  2.125   1.00 0.00 ? 31 THR A H    3  
ATOM 2229  H HA   . THR A 1 31 ? 1.908   -8.021  -0.278  1.00 0.00 ? 31 THR A HA   3  
ATOM 2230  H HB   . THR A 1 31 ? 2.040   -10.812 0.272   1.00 0.00 ? 31 THR A HB   3  
ATOM 2231  H HG1  . THR A 1 31 ? 1.221   -10.401 2.393   1.00 0.00 ? 31 THR A HG1  3  
ATOM 2232  H HG21 . THR A 1 31 ? 3.962   -8.560  0.887   1.00 0.00 ? 31 THR A HG21 3  
ATOM 2233  H HG22 . THR A 1 31 ? 3.918   -9.555  -0.547  1.00 0.00 ? 31 THR A HG22 3  
ATOM 2234  H HG23 . THR A 1 31 ? 4.396   -10.273 0.987   1.00 0.00 ? 31 THR A HG23 3  
ATOM 2235  N N    . GLU A 1 32 ? -1.058  -9.022  -0.174  1.00 0.00 ? 32 GLU A N    3  
ATOM 2236  C CA   . GLU A 1 32 ? -2.179  -9.499  -0.978  1.00 0.00 ? 32 GLU A CA   3  
ATOM 2237  C C    . GLU A 1 32 ? -2.173  -8.809  -2.351  1.00 0.00 ? 32 GLU A C    3  
ATOM 2238  O O    . GLU A 1 32 ? -2.414  -7.615  -2.451  1.00 0.00 ? 32 GLU A O    3  
ATOM 2239  C CB   . GLU A 1 32 ? -3.474  -9.138  -0.249  1.00 0.00 ? 32 GLU A CB   3  
ATOM 2240  C CG   . GLU A 1 32 ? -3.676  -9.902  1.071   1.00 0.00 ? 32 GLU A CG   3  
ATOM 2241  C CD   . GLU A 1 32 ? -4.636  -9.106  1.956   1.00 0.00 ? 32 GLU A CD   3  
ATOM 2242  O OE1  . GLU A 1 32 ? -4.276  -8.003  2.351   1.00 0.00 ? 32 GLU A OE1  3  
ATOM 2243  O OE2  . GLU A 1 32 ? -5.741  -9.559  2.232   1.00 0.00 ? 32 GLU A OE2  3  
ATOM 2244  H H    . GLU A 1 32 ? -1.300  -8.520  0.656   1.00 0.00 ? 32 GLU A H    3  
ATOM 2245  H HA   . GLU A 1 32 ? -2.076  -10.580 -1.090  1.00 0.00 ? 32 GLU A HA   3  
ATOM 2246  H HB2  . GLU A 1 32 ? -3.447  -8.063  -0.063  1.00 0.00 ? 32 GLU A HB2  3  
ATOM 2247  H HB3  . GLU A 1 32 ? -4.342  -9.313  -0.888  1.00 0.00 ? 32 GLU A HB3  3  
ATOM 2248  H HG2  . GLU A 1 32 ? -4.079  -10.899 0.884   1.00 0.00 ? 32 GLU A HG2  3  
ATOM 2249  H HG3  . GLU A 1 32 ? -2.742  -10.034 1.617   1.00 0.00 ? 32 GLU A HG3  3  
ATOM 2250  N N    . GLY A 1 33 ? -1.882  -9.616  -3.385  1.00 0.00 ? 33 GLY A N    3  
ATOM 2251  C CA   . GLY A 1 33 ? -1.838  -9.087  -4.745  1.00 0.00 ? 33 GLY A CA   3  
ATOM 2252  C C    . GLY A 1 33 ? -0.474  -9.324  -5.396  1.00 0.00 ? 33 GLY A C    3  
ATOM 2253  O O    . GLY A 1 33 ? -0.357  -9.311  -6.614  1.00 0.00 ? 33 GLY A O    3  
ATOM 2254  H H    . GLY A 1 33 ? -1.678  -10.579 -3.208  1.00 0.00 ? 33 GLY A H    3  
ATOM 2255  H HA2  . GLY A 1 33 ? -2.605  -9.617  -5.314  1.00 0.00 ? 33 GLY A HA2  3  
ATOM 2256  H HA3  . GLY A 1 33 ? -2.053  -8.013  -4.753  1.00 0.00 ? 33 GLY A HA3  3  
ATOM 2257  N N    . ARG A 1 34 ? 0.544   -9.551  -4.539  1.00 0.00 ? 34 ARG A N    3  
ATOM 2258  C CA   . ARG A 1 34 ? 1.881   -9.828  -5.100  1.00 0.00 ? 34 ARG A CA   3  
ATOM 2259  C C    . ARG A 1 34 ? 2.278   -11.236 -4.661  1.00 0.00 ? 34 ARG A C    3  
ATOM 2260  O O    . ARG A 1 34 ? 1.728   -11.780 -3.715  1.00 0.00 ? 34 ARG A O    3  
ATOM 2261  C CB   . ARG A 1 34 ? 2.919   -8.831  -4.571  1.00 0.00 ? 34 ARG A CB   3  
ATOM 2262  C CG   . ARG A 1 34 ? 2.546   -7.367  -4.843  1.00 0.00 ? 34 ARG A CG   3  
ATOM 2263  C CD   . ARG A 1 34 ? 3.726   -6.415  -4.548  1.00 0.00 ? 34 ARG A CD   3  
ATOM 2264  N NE   . ARG A 1 34 ? 4.832   -6.678  -5.475  1.00 0.00 ? 34 ARG A NE   3  
ATOM 2265  C CZ   . ARG A 1 34 ? 5.837   -7.531  -5.326  1.00 0.00 ? 34 ARG A CZ   3  
ATOM 2266  N NH1  . ARG A 1 34 ? 5.993   -8.212  -4.210  1.00 0.00 ? 34 ARG A NH1  3  
ATOM 2267  N NH2  . ARG A 1 34 ? 6.659   -7.701  -6.354  1.00 0.00 ? 34 ARG A NH2  3  
ATOM 2268  H H    . ARG A 1 34 ? 0.360   -9.568  -3.537  1.00 0.00 ? 34 ARG A H    3  
ATOM 2269  H HA   . ARG A 1 34 ? 1.873   -9.797  -6.214  1.00 0.00 ? 34 ARG A HA   3  
ATOM 2270  H HB2  . ARG A 1 34 ? 3.023   -8.932  -3.465  1.00 0.00 ? 34 ARG A HB2  3  
ATOM 2271  H HB3  . ARG A 1 34 ? 3.850   -9.094  -5.120  1.00 0.00 ? 34 ARG A HB3  3  
ATOM 2272  H HG2  . ARG A 1 34 ? 2.175   -7.262  -5.866  1.00 0.00 ? 34 ARG A HG2  3  
ATOM 2273  H HG3  . ARG A 1 34 ? 1.697   -7.092  -4.216  1.00 0.00 ? 34 ARG A HG3  3  
ATOM 2274  H HD2  . ARG A 1 34 ? 3.429   -5.360  -4.657  1.00 0.00 ? 34 ARG A HD2  3  
ATOM 2275  H HD3  . ARG A 1 34 ? 4.104   -6.554  -3.532  1.00 0.00 ? 34 ARG A HD3  3  
ATOM 2276  H HE   . ARG A 1 34 ? 4.939   -6.413  -6.415  1.00 0.00 ? 34 ARG A HE   3  
ATOM 2277  H HH11 . ARG A 1 34 ? 5.460   -8.015  -3.374  1.00 0.00 ? 34 ARG A HH11 3  
ATOM 2278  H HH12 . ARG A 1 34 ? 6.689   -8.937  -4.216  1.00 0.00 ? 34 ARG A HH12 3  
ATOM 2279  H HH21 . ARG A 1 34 ? 6.610   -7.181  -7.205  1.00 0.00 ? 34 ARG A HH21 3  
ATOM 2280  H HH22 . ARG A 1 34 ? 7.383   -8.413  -6.307  1.00 0.00 ? 34 ARG A HH22 3  
ATOM 2281  N N    . THR A 1 35 ? 3.248   -11.792 -5.418  1.00 0.00 ? 35 THR A N    3  
ATOM 2282  C CA   . THR A 1 35 ? 3.671   -13.163 -5.151  1.00 0.00 ? 35 THR A CA   3  
ATOM 2283  C C    . THR A 1 35 ? 5.196   -13.328 -4.962  1.00 0.00 ? 35 THR A C    3  
ATOM 2284  O O    . THR A 1 35 ? 5.631   -14.451 -4.750  1.00 0.00 ? 35 THR A O    3  
ATOM 2285  C CB   . THR A 1 35 ? 3.157   -14.033 -6.321  1.00 0.00 ? 35 THR A CB   3  
ATOM 2286  O OG1  . THR A 1 35 ? 1.849   -13.648 -6.706  1.00 0.00 ? 35 THR A OG1  3  
ATOM 2287  C CG2  . THR A 1 35 ? 3.054   -15.517 -5.964  1.00 0.00 ? 35 THR A CG2  3  
ATOM 2288  H H    . THR A 1 35 ? 3.647   -11.293 -6.184  1.00 0.00 ? 35 THR A H    3  
ATOM 2289  H HA   . THR A 1 35 ? 3.208   -13.505 -4.223  1.00 0.00 ? 35 THR A HA   3  
ATOM 2290  H HB   . THR A 1 35 ? 3.820   -13.936 -7.189  1.00 0.00 ? 35 THR A HB   3  
ATOM 2291  H HG1  . THR A 1 35 ? 1.808   -12.711 -6.858  1.00 0.00 ? 35 THR A HG1  3  
ATOM 2292  H HG21 . THR A 1 35 ? 2.627   -16.081 -6.792  1.00 0.00 ? 35 THR A HG21 3  
ATOM 2293  H HG22 . THR A 1 35 ? 2.411   -15.661 -5.096  1.00 0.00 ? 35 THR A HG22 3  
ATOM 2294  H HG23 . THR A 1 35 ? 4.028   -15.949 -5.738  1.00 0.00 ? 35 THR A HG23 3  
ATOM 2295  N N    . ASP A 1 36 ? 6.007   -12.234 -5.055  1.00 0.00 ? 36 ASP A N    3  
ATOM 2296  C CA   . ASP A 1 36 ? 7.465   -12.504 -5.002  1.00 0.00 ? 36 ASP A CA   3  
ATOM 2297  C C    . ASP A 1 36 ? 8.168   -12.134 -3.678  1.00 0.00 ? 36 ASP A C    3  
ATOM 2298  O O    . ASP A 1 36 ? 9.249   -12.641 -3.404  1.00 0.00 ? 36 ASP A O    3  
ATOM 2299  C CB   . ASP A 1 36 ? 8.177   -11.829 -6.193  1.00 0.00 ? 36 ASP A CB   3  
ATOM 2300  C CG   . ASP A 1 36 ? 8.158   -10.299 -6.165  1.00 0.00 ? 36 ASP A CG   3  
ATOM 2301  O OD1  . ASP A 1 36 ? 7.976   -9.702  -5.109  1.00 0.00 ? 36 ASP A OD1  3  
ATOM 2302  O OD2  . ASP A 1 36 ? 8.287   -9.672  -7.208  1.00 0.00 ? 36 ASP A OD2  3  
ATOM 2303  H H    . ASP A 1 36 ? 5.687   -11.295 -5.239  1.00 0.00 ? 36 ASP A H    3  
ATOM 2304  H HA   . ASP A 1 36 ? 7.647   -13.571 -5.137  1.00 0.00 ? 36 ASP A HA   3  
ATOM 2305  H HB2  . ASP A 1 36 ? 9.222   -12.142 -6.221  1.00 0.00 ? 36 ASP A HB2  3  
ATOM 2306  H HB3  . ASP A 1 36 ? 7.733   -12.171 -7.129  1.00 0.00 ? 36 ASP A HB3  3  
ATOM 2307  N N    . GLY A 1 37 ? 7.557   -11.229 -2.885  1.00 0.00 ? 37 GLY A N    3  
ATOM 2308  C CA   . GLY A 1 37 ? 8.279   -10.813 -1.684  1.00 0.00 ? 37 GLY A CA   3  
ATOM 2309  C C    . GLY A 1 37 ? 7.924   -9.406  -1.206  1.00 0.00 ? 37 GLY A C    3  
ATOM 2310  O O    . GLY A 1 37 ? 7.700   -9.183  -0.023  1.00 0.00 ? 37 GLY A O    3  
ATOM 2311  H H    . GLY A 1 37 ? 6.672   -10.863 -3.155  1.00 0.00 ? 37 GLY A H    3  
ATOM 2312  H HA2  . GLY A 1 37 ? 8.085   -11.546 -0.899  1.00 0.00 ? 37 GLY A HA2  3  
ATOM 2313  H HA3  . GLY A 1 37 ? 9.352   -10.777 -1.913  1.00 0.00 ? 37 GLY A HA3  3  
ATOM 2314  N N    . TYR A 1 38 ? 7.941   -8.453  -2.166  1.00 0.00 ? 38 TYR A N    3  
ATOM 2315  C CA   . TYR A 1 38 ? 7.774   -7.058  -1.759  1.00 0.00 ? 38 TYR A CA   3  
ATOM 2316  C C    . TYR A 1 38 ? 6.340   -6.807  -1.284  1.00 0.00 ? 38 TYR A C    3  
ATOM 2317  O O    . TYR A 1 38 ? 5.395   -7.432  -1.761  1.00 0.00 ? 38 TYR A O    3  
ATOM 2318  C CB   . TYR A 1 38 ? 8.280   -6.124  -2.870  1.00 0.00 ? 38 TYR A CB   3  
ATOM 2319  C CG   . TYR A 1 38 ? 9.634   -6.611  -3.311  1.00 0.00 ? 38 TYR A CG   3  
ATOM 2320  C CD1  . TYR A 1 38 ? 10.738  -6.476  -2.488  1.00 0.00 ? 38 TYR A CD1  3  
ATOM 2321  C CD2  . TYR A 1 38 ? 9.811   -7.282  -4.509  1.00 0.00 ? 38 TYR A CD2  3  
ATOM 2322  C CE1  . TYR A 1 38 ? 11.950  -7.035  -2.822  1.00 0.00 ? 38 TYR A CE1  3  
ATOM 2323  C CE2  . TYR A 1 38 ? 11.019  -7.849  -4.845  1.00 0.00 ? 38 TYR A CE2  3  
ATOM 2324  C CZ   . TYR A 1 38 ? 12.111  -7.735  -4.000  1.00 0.00 ? 38 TYR A CZ   3  
ATOM 2325  O OH   . TYR A 1 38 ? 13.336  -8.299  -4.297  1.00 0.00 ? 38 TYR A OH   3  
ATOM 2326  H H    . TYR A 1 38 ? 8.082   -8.629  -3.147  1.00 0.00 ? 38 TYR A H    3  
ATOM 2327  H HA   . TYR A 1 38 ? 8.429   -6.931  -0.897  1.00 0.00 ? 38 TYR A HA   3  
ATOM 2328  H HB2  . TYR A 1 38 ? 7.596   -6.091  -3.716  1.00 0.00 ? 38 TYR A HB2  3  
ATOM 2329  H HB3  . TYR A 1 38 ? 8.365   -5.105  -2.493  1.00 0.00 ? 38 TYR A HB3  3  
ATOM 2330  H HD1  . TYR A 1 38 ? 10.693  -5.956  -1.559  1.00 0.00 ? 38 TYR A HD1  3  
ATOM 2331  H HD2  . TYR A 1 38 ? 9.029   -7.417  -5.217  1.00 0.00 ? 38 TYR A HD2  3  
ATOM 2332  H HE1  . TYR A 1 38 ? 12.738  -6.918  -2.116  1.00 0.00 ? 38 TYR A HE1  3  
ATOM 2333  H HE2  . TYR A 1 38 ? 11.011  -8.381  -5.769  1.00 0.00 ? 38 TYR A HE2  3  
ATOM 2334  H HH   . TYR A 1 38 ? 13.242  -8.998  -4.929  1.00 0.00 ? 38 TYR A HH   3  
ATOM 2335  N N    . ARG A 1 39 ? 6.273   -5.916  -0.283  1.00 0.00 ? 39 ARG A N    3  
ATOM 2336  C CA   . ARG A 1 39 ? 4.989   -5.629  0.390   1.00 0.00 ? 39 ARG A CA   3  
ATOM 2337  C C    . ARG A 1 39 ? 4.513   -4.258  -0.112  1.00 0.00 ? 39 ARG A C    3  
ATOM 2338  O O    . ARG A 1 39 ? 5.333   -3.380  -0.343  1.00 0.00 ? 39 ARG A O    3  
ATOM 2339  C CB   . ARG A 1 39 ? 5.295   -5.617  1.907   1.00 0.00 ? 39 ARG A CB   3  
ATOM 2340  C CG   . ARG A 1 39 ? 6.007   -6.893  2.392   1.00 0.00 ? 39 ARG A CG   3  
ATOM 2341  C CD   . ARG A 1 39 ? 6.099   -7.005  3.935   1.00 0.00 ? 39 ARG A CD   3  
ATOM 2342  N NE   . ARG A 1 39 ? 4.808   -7.037  4.614   1.00 0.00 ? 39 ARG A NE   3  
ATOM 2343  C CZ   . ARG A 1 39 ? 3.851   -7.967  4.443   1.00 0.00 ? 39 ARG A CZ   3  
ATOM 2344  N NH1  . ARG A 1 39 ? 4.029   -8.954  3.575   1.00 0.00 ? 39 ARG A NH1  3  
ATOM 2345  N NH2  . ARG A 1 39 ? 2.729   -7.885  5.145   1.00 0.00 ? 39 ARG A NH2  3  
ATOM 2346  H H    . ARG A 1 39 ? 7.161   -5.452  -0.058  1.00 0.00 ? 39 ARG A H    3  
ATOM 2347  H HA   . ARG A 1 39 ? 4.202   -6.384  0.159   1.00 0.00 ? 39 ARG A HA   3  
ATOM 2348  H HB2  . ARG A 1 39 ? 5.931   -4.762  2.147   1.00 0.00 ? 39 ARG A HB2  3  
ATOM 2349  H HB3  . ARG A 1 39 ? 4.386   -5.472  2.481   1.00 0.00 ? 39 ARG A HB3  3  
ATOM 2350  H HG2  . ARG A 1 39 ? 5.485   -7.761  1.989   1.00 0.00 ? 39 ARG A HG2  3  
ATOM 2351  H HG3  . ARG A 1 39 ? 7.018   -6.912  1.957   1.00 0.00 ? 39 ARG A HG3  3  
ATOM 2352  H HD2  . ARG A 1 39 ? 6.650   -7.888  4.266   1.00 0.00 ? 39 ARG A HD2  3  
ATOM 2353  H HD3  . ARG A 1 39 ? 6.595   -6.135  4.370   1.00 0.00 ? 39 ARG A HD3  3  
ATOM 2354  H HE   . ARG A 1 39 ? 4.730   -6.397  5.393   1.00 0.00 ? 39 ARG A HE   3  
ATOM 2355  H HH11 . ARG A 1 39 ? 4.935   -9.070  3.173   1.00 0.00 ? 39 ARG A HH11 3  
ATOM 2356  H HH12 . ARG A 1 39 ? 3.285   -9.569  3.275   1.00 0.00 ? 39 ARG A HH12 3  
ATOM 2357  H HH21 . ARG A 1 39 ? 2.559   -7.067  5.718   1.00 0.00 ? 39 ARG A HH21 3  
ATOM 2358  H HH22 . ARG A 1 39 ? 2.037   -8.600  5.128   1.00 0.00 ? 39 ARG A HH22 3  
ATOM 2359  N N    . TRP A 1 40 ? 3.182   -4.096  -0.294  1.00 0.00 ? 40 TRP A N    3  
ATOM 2360  C CA   . TRP A 1 40 ? 2.645   -2.819  -0.750  1.00 0.00 ? 40 TRP A CA   3  
ATOM 2361  C C    . TRP A 1 40 ? 1.632   -2.289  0.282   1.00 0.00 ? 40 TRP A C    3  
ATOM 2362  O O    . TRP A 1 40 ? 1.124   -3.027  1.122   1.00 0.00 ? 40 TRP A O    3  
ATOM 2363  C CB   . TRP A 1 40 ? 2.011   -2.965  -2.145  1.00 0.00 ? 40 TRP A CB   3  
ATOM 2364  C CG   . TRP A 1 40 ? 0.745   -3.801  -2.102  1.00 0.00 ? 40 TRP A CG   3  
ATOM 2365  C CD1  . TRP A 1 40 ? 0.684   -5.197  -2.170  1.00 0.00 ? 40 TRP A CD1  3  
ATOM 2366  C CD2  . TRP A 1 40 ? -0.621  -3.339  -1.998  1.00 0.00 ? 40 TRP A CD2  3  
ATOM 2367  N NE1  . TRP A 1 40 ? -0.609  -5.589  -2.121  1.00 0.00 ? 40 TRP A NE1  3  
ATOM 2368  C CE2  . TRP A 1 40 ? -1.439  -4.485  -2.014  1.00 0.00 ? 40 TRP A CE2  3  
ATOM 2369  C CE3  . TRP A 1 40 ? -1.199  -2.097  -1.889  1.00 0.00 ? 40 TRP A CE3  3  
ATOM 2370  C CZ2  . TRP A 1 40 ? -2.795  -4.368  -1.931  1.00 0.00 ? 40 TRP A CZ2  3  
ATOM 2371  C CZ3  . TRP A 1 40 ? -2.590  -1.967  -1.800  1.00 0.00 ? 40 TRP A CZ3  3  
ATOM 2372  C CH2  . TRP A 1 40 ? -3.387  -3.111  -1.823  1.00 0.00 ? 40 TRP A CH2  3  
ATOM 2373  H H    . TRP A 1 40 ? 2.506   -4.813  -0.106  1.00 0.00 ? 40 TRP A H    3  
ATOM 2374  H HA   . TRP A 1 40 ? 3.478   -2.125  -0.807  1.00 0.00 ? 40 TRP A HA   3  
ATOM 2375  H HB2  . TRP A 1 40 ? 1.787   -1.984  -2.551  1.00 0.00 ? 40 TRP A HB2  3  
ATOM 2376  H HB3  . TRP A 1 40 ? 2.714   -3.386  -2.861  1.00 0.00 ? 40 TRP A HB3  3  
ATOM 2377  H HD1  . TRP A 1 40 ? 1.529   -5.860  -2.237  1.00 0.00 ? 40 TRP A HD1  3  
ATOM 2378  H HE1  . TRP A 1 40 ? -0.949  -6.509  -2.165  1.00 0.00 ? 40 TRP A HE1  3  
ATOM 2379  H HE3  . TRP A 1 40 ? -0.556  -1.234  -1.869  1.00 0.00 ? 40 TRP A HE3  3  
ATOM 2380  H HZ2  . TRP A 1 40 ? -3.398  -5.261  -1.955  1.00 0.00 ? 40 TRP A HZ2  3  
ATOM 2381  H HZ3  . TRP A 1 40 ? -3.070  -0.995  -1.715  1.00 0.00 ? 40 TRP A HZ3  3  
ATOM 2382  H HH2  . TRP A 1 40 ? -4.463  -3.042  -1.764  1.00 0.00 ? 40 TRP A HH2  3  
ATOM 2383  N N    . CYS A 1 41 ? 1.364   -0.974  0.158   1.00 0.00 ? 41 CYS A N    3  
ATOM 2384  C CA   . CYS A 1 41 ? 0.367   -0.306  0.975   1.00 0.00 ? 41 CYS A CA   3  
ATOM 2385  C C    . CYS A 1 41 ? -0.457  0.611   0.060   1.00 0.00 ? 41 CYS A C    3  
ATOM 2386  O O    . CYS A 1 41 ? 0.051   1.143   -0.922  1.00 0.00 ? 41 CYS A O    3  
ATOM 2387  C CB   . CYS A 1 41 ? 1.068   0.506   2.062   1.00 0.00 ? 41 CYS A CB   3  
ATOM 2388  S SG   . CYS A 1 41 ? 2.105   1.810   1.341   1.00 0.00 ? 41 CYS A SG   3  
ATOM 2389  H H    . CYS A 1 41 ? 1.802   -0.382  -0.522  1.00 0.00 ? 41 CYS A H    3  
ATOM 2390  H HA   . CYS A 1 41 ? -0.280  -1.067  1.409   1.00 0.00 ? 41 CYS A HA   3  
ATOM 2391  H HB2  . CYS A 1 41 ? 0.259   1.002   2.661   1.00 0.00 ? 41 CYS A HB2  3  
ATOM 2392  H HB3  . CYS A 1 41 ? 1.740   -0.198  2.621   1.00 0.00 ? 41 CYS A HB3  3  
ATOM 2393  N N    . GLY A 1 42 ? -1.740  0.778   0.430   1.00 0.00 ? 42 GLY A N    3  
ATOM 2394  C CA   . GLY A 1 42 ? -2.584  1.713   -0.298  1.00 0.00 ? 42 GLY A CA   3  
ATOM 2395  C C    . GLY A 1 42 ? -2.169  3.132   0.112   1.00 0.00 ? 42 GLY A C    3  
ATOM 2396  O O    . GLY A 1 42 ? -1.694  3.353   1.222   1.00 0.00 ? 42 GLY A O    3  
ATOM 2397  H H    . GLY A 1 42 ? -2.123  0.319   1.231   1.00 0.00 ? 42 GLY A H    3  
ATOM 2398  H HA2  . GLY A 1 42 ? -2.472  1.537   -1.370  1.00 0.00 ? 42 GLY A HA2  3  
ATOM 2399  H HA3  . GLY A 1 42 ? -3.617  1.532   0.002   1.00 0.00 ? 42 GLY A HA3  3  
ATOM 2400  N N    . THR A 1 43 ? -2.362  4.069   -0.832  1.00 0.00 ? 43 THR A N    3  
ATOM 2401  C CA   . THR A 1 43 ? -1.974  5.453   -0.561  1.00 0.00 ? 43 THR A CA   3  
ATOM 2402  C C    . THR A 1 43 ? -3.167  6.400   -0.675  1.00 0.00 ? 43 THR A C    3  
ATOM 2403  O O    . THR A 1 43 ? -3.026  7.576   -0.982  1.00 0.00 ? 43 THR A O    3  
ATOM 2404  C CB   . THR A 1 43 ? -0.784  5.834   -1.458  1.00 0.00 ? 43 THR A CB   3  
ATOM 2405  O OG1  . THR A 1 43 ? -0.749  5.036   -2.624  1.00 0.00 ? 43 THR A OG1  3  
ATOM 2406  C CG2  . THR A 1 43 ? 0.530   5.586   -0.713  1.00 0.00 ? 43 THR A CG2  3  
ATOM 2407  H H    . THR A 1 43 ? -2.733  3.824   -1.729  1.00 0.00 ? 43 THR A H    3  
ATOM 2408  H HA   . THR A 1 43 ? -1.665  5.545   0.475   1.00 0.00 ? 43 THR A HA   3  
ATOM 2409  H HB   . THR A 1 43 ? -0.808  6.892   -1.742  1.00 0.00 ? 43 THR A HB   3  
ATOM 2410  H HG1  . THR A 1 43 ? -1.615  5.014   -3.032  1.00 0.00 ? 43 THR A HG1  3  
ATOM 2411  H HG21 . THR A 1 43 ? 0.586   6.212   0.178   1.00 0.00 ? 43 THR A HG21 3  
ATOM 2412  H HG22 . THR A 1 43 ? 1.391   5.819   -1.337  1.00 0.00 ? 43 THR A HG22 3  
ATOM 2413  H HG23 . THR A 1 43 ? 0.611   4.548   -0.392  1.00 0.00 ? 43 THR A HG23 3  
ATOM 2414  N N    . THR A 1 44 ? -4.345  5.822   -0.388  1.00 0.00 ? 44 THR A N    3  
ATOM 2415  C CA   . THR A 1 44 ? -5.570  6.599   -0.391  1.00 0.00 ? 44 THR A CA   3  
ATOM 2416  C C    . THR A 1 44 ? -6.477  5.984   0.675   1.00 0.00 ? 44 THR A C    3  
ATOM 2417  O O    . THR A 1 44 ? -6.209  4.914   1.212   1.00 0.00 ? 44 THR A O    3  
ATOM 2418  C CB   . THR A 1 44 ? -6.268  6.591   -1.771  1.00 0.00 ? 44 THR A CB   3  
ATOM 2419  O OG1  . THR A 1 44 ? -6.918  5.341   -1.971  1.00 0.00 ? 44 THR A OG1  3  
ATOM 2420  C CG2  . THR A 1 44 ? -5.305  6.864   -2.936  1.00 0.00 ? 44 THR A CG2  3  
ATOM 2421  H H    . THR A 1 44 ? -4.432  4.860   -0.125  1.00 0.00 ? 44 THR A H    3  
ATOM 2422  H HA   . THR A 1 44 ? -5.323  7.619   -0.087  1.00 0.00 ? 44 THR A HA   3  
ATOM 2423  H HB   . THR A 1 44 ? -7.004  7.407   -1.749  1.00 0.00 ? 44 THR A HB   3  
ATOM 2424  H HG1  . THR A 1 44 ? -7.651  5.430   -2.600  1.00 0.00 ? 44 THR A HG1  3  
ATOM 2425  H HG21 . THR A 1 44 ? -5.841  7.002   -3.872  1.00 0.00 ? 44 THR A HG21 3  
ATOM 2426  H HG22 . THR A 1 44 ? -4.603  6.043   -3.081  1.00 0.00 ? 44 THR A HG22 3  
ATOM 2427  H HG23 . THR A 1 44 ? -4.735  7.777   -2.767  1.00 0.00 ? 44 THR A HG23 3  
ATOM 2428  N N    . GLU A 1 45 ? -7.574  6.721   0.918   1.00 0.00 ? 45 GLU A N    3  
ATOM 2429  C CA   . GLU A 1 45 ? -8.607  6.261   1.833   1.00 0.00 ? 45 GLU A CA   3  
ATOM 2430  C C    . GLU A 1 45 ? -9.246  4.961   1.308   1.00 0.00 ? 45 GLU A C    3  
ATOM 2431  O O    . GLU A 1 45 ? -9.412  3.976   2.019   1.00 0.00 ? 45 GLU A O    3  
ATOM 2432  C CB   . GLU A 1 45 ? -9.628  7.391   2.106   1.00 0.00 ? 45 GLU A CB   3  
ATOM 2433  C CG   . GLU A 1 45 ? -10.372 7.146   3.417   1.00 0.00 ? 45 GLU A CG   3  
ATOM 2434  C CD   . GLU A 1 45 ? -9.391  7.159   4.602   1.00 0.00 ? 45 GLU A CD   3  
ATOM 2435  O OE1  . GLU A 1 45 ? -8.699  8.151   4.816   1.00 0.00 ? 45 GLU A OE1  3  
ATOM 2436  O OE2  . GLU A 1 45 ? -9.219  6.148   5.274   1.00 0.00 ? 45 GLU A OE2  3  
ATOM 2437  H H    . GLU A 1 45 ? -7.646  7.591   0.446   1.00 0.00 ? 45 GLU A H    3  
ATOM 2438  H HA   . GLU A 1 45 ? -8.117  5.991   2.751   1.00 0.00 ? 45 GLU A HA   3  
ATOM 2439  H HB2  . GLU A 1 45 ? -9.106  8.369   2.306   1.00 0.00 ? 45 GLU A HB2  3  
ATOM 2440  H HB3  . GLU A 1 45 ? -10.384 7.393   1.275   1.00 0.00 ? 45 GLU A HB3  3  
ATOM 2441  H HG2  . GLU A 1 45 ? -11.110 7.930   3.555   1.00 0.00 ? 45 GLU A HG2  3  
ATOM 2442  H HG3  . GLU A 1 45 ? -10.882 6.188   3.363   1.00 0.00 ? 45 GLU A HG3  3  
ATOM 2443  N N    . ASP A 1 46 ? -9.579  5.050   0.008   1.00 0.00 ? 46 ASP A N    3  
ATOM 2444  C CA   . ASP A 1 46 ? -10.231 3.947   -0.698  1.00 0.00 ? 46 ASP A CA   3  
ATOM 2445  C C    . ASP A 1 46 ? -9.302  3.472   -1.828  1.00 0.00 ? 46 ASP A C    3  
ATOM 2446  O O    . ASP A 1 46 ? -9.224  4.056   -2.904  1.00 0.00 ? 46 ASP A O    3  
ATOM 2447  C CB   . ASP A 1 46 ? -11.624 4.397   -1.195  1.00 0.00 ? 46 ASP A CB   3  
ATOM 2448  C CG   . ASP A 1 46 ? -12.445 3.179   -1.606  1.00 0.00 ? 46 ASP A CG   3  
ATOM 2449  O OD1  . ASP A 1 46 ? -12.072 2.486   -2.547  1.00 0.00 ? 46 ASP A OD1  3  
ATOM 2450  O OD2  . ASP A 1 46 ? -13.432 2.868   -0.947  1.00 0.00 ? 46 ASP A OD2  3  
ATOM 2451  H H    . ASP A 1 46 ? -9.311  5.904   -0.438  1.00 0.00 ? 46 ASP A H    3  
ATOM 2452  H HA   . ASP A 1 46 ? -10.358 3.134   0.022   1.00 0.00 ? 46 ASP A HA   3  
ATOM 2453  H HB2  . ASP A 1 46 ? -12.146 4.898   -0.379  1.00 0.00 ? 46 ASP A HB2  3  
ATOM 2454  H HB3  . ASP A 1 46 ? -11.607 5.110   -2.019  1.00 0.00 ? 46 ASP A HB3  3  
ATOM 2455  N N    . TYR A 1 47 ? -8.569  2.389   -1.500  1.00 0.00 ? 47 TYR A N    3  
ATOM 2456  C CA   . TYR A 1 47 ? -7.597  1.894   -2.480  1.00 0.00 ? 47 TYR A CA   3  
ATOM 2457  C C    . TYR A 1 47 ? -8.295  1.273   -3.695  1.00 0.00 ? 47 TYR A C    3  
ATOM 2458  O O    . TYR A 1 47 ? -7.855  1.439   -4.828  1.00 0.00 ? 47 TYR A O    3  
ATOM 2459  C CB   . TYR A 1 47 ? -6.645  0.852   -1.852  1.00 0.00 ? 47 TYR A CB   3  
ATOM 2460  C CG   . TYR A 1 47 ? -5.733  0.297   -2.912  1.00 0.00 ? 47 TYR A CG   3  
ATOM 2461  C CD1  . TYR A 1 47 ? -4.706  1.058   -3.443  1.00 0.00 ? 47 TYR A CD1  3  
ATOM 2462  C CD2  . TYR A 1 47 ? -5.939  -0.980  -3.411  1.00 0.00 ? 47 TYR A CD2  3  
ATOM 2463  C CE1  . TYR A 1 47 ? -3.902  0.538   -4.440  1.00 0.00 ? 47 TYR A CE1  3  
ATOM 2464  C CE2  . TYR A 1 47 ? -5.120  -1.514  -4.389  1.00 0.00 ? 47 TYR A CE2  3  
ATOM 2465  C CZ   . TYR A 1 47 ? -4.088  -0.749  -4.910  1.00 0.00 ? 47 TYR A CZ   3  
ATOM 2466  O OH   . TYR A 1 47 ? -3.241  -1.238  -5.882  1.00 0.00 ? 47 TYR A OH   3  
ATOM 2467  H H    . TYR A 1 47 ? -8.734  1.950   -0.604  1.00 0.00 ? 47 TYR A H    3  
ATOM 2468  H HA   . TYR A 1 47 ? -7.009  2.740   -2.871  1.00 0.00 ? 47 TYR A HA   3  
ATOM 2469  H HB2  . TYR A 1 47 ? -6.050  1.310   -1.062  1.00 0.00 ? 47 TYR A HB2  3  
ATOM 2470  H HB3  . TYR A 1 47 ? -7.176  0.007   -1.399  1.00 0.00 ? 47 TYR A HB3  3  
ATOM 2471  H HD1  . TYR A 1 47 ? -4.536  2.064   -3.105  1.00 0.00 ? 47 TYR A HD1  3  
ATOM 2472  H HD2  . TYR A 1 47 ? -6.773  -1.556  -3.064  1.00 0.00 ? 47 TYR A HD2  3  
ATOM 2473  H HE1  . TYR A 1 47 ? -3.128  1.147   -4.856  1.00 0.00 ? 47 TYR A HE1  3  
ATOM 2474  H HE2  . TYR A 1 47 ? -5.321  -2.520  -4.715  1.00 0.00 ? 47 TYR A HE2  3  
ATOM 2475  H HH   . TYR A 1 47 ? -2.996  -2.132  -5.681  1.00 0.00 ? 47 TYR A HH   3  
ATOM 2476  N N    . ASP A 1 48 ? -9.374  0.524   -3.397  1.00 0.00 ? 48 ASP A N    3  
ATOM 2477  C CA   . ASP A 1 48 ? -10.048 -0.209  -4.463  1.00 0.00 ? 48 ASP A CA   3  
ATOM 2478  C C    . ASP A 1 48 ? -10.466 0.743   -5.606  1.00 0.00 ? 48 ASP A C    3  
ATOM 2479  O O    . ASP A 1 48 ? -10.326 0.452   -6.791  1.00 0.00 ? 48 ASP A O    3  
ATOM 2480  C CB   . ASP A 1 48 ? -11.267 -0.992  -3.918  1.00 0.00 ? 48 ASP A CB   3  
ATOM 2481  C CG   . ASP A 1 48 ? -10.867 -2.051  -2.871  1.00 0.00 ? 48 ASP A CG   3  
ATOM 2482  O OD1  . ASP A 1 48 ? -10.069 -2.925  -3.183  1.00 0.00 ? 48 ASP A OD1  3  
ATOM 2483  O OD2  . ASP A 1 48 ? -11.355 -2.004  -1.740  1.00 0.00 ? 48 ASP A OD2  3  
ATOM 2484  H H    . ASP A 1 48 ? -9.696  0.462   -2.453  1.00 0.00 ? 48 ASP A H    3  
ATOM 2485  H HA   . ASP A 1 48 ? -9.331  -0.932  -4.863  1.00 0.00 ? 48 ASP A HA   3  
ATOM 2486  H HB2  . ASP A 1 48 ? -12.015 -0.316  -3.493  1.00 0.00 ? 48 ASP A HB2  3  
ATOM 2487  H HB3  . ASP A 1 48 ? -11.733 -1.539  -4.746  1.00 0.00 ? 48 ASP A HB3  3  
ATOM 2488  N N    . ARG A 1 49 ? -10.983 1.905   -5.172  1.00 0.00 ? 49 ARG A N    3  
ATOM 2489  C CA   . ARG A 1 49 ? -11.403 2.935   -6.104  1.00 0.00 ? 49 ARG A CA   3  
ATOM 2490  C C    . ARG A 1 49 ? -10.195 3.559   -6.845  1.00 0.00 ? 49 ARG A C    3  
ATOM 2491  O O    . ARG A 1 49 ? -10.136 3.493   -8.069  1.00 0.00 ? 49 ARG A O    3  
ATOM 2492  C CB   . ARG A 1 49 ? -12.239 3.975   -5.336  1.00 0.00 ? 49 ARG A CB   3  
ATOM 2493  C CG   . ARG A 1 49 ? -12.599 5.244   -6.127  1.00 0.00 ? 49 ARG A CG   3  
ATOM 2494  C CD   . ARG A 1 49 ? -11.809 6.464   -5.599  1.00 0.00 ? 49 ARG A CD   3  
ATOM 2495  N NE   . ARG A 1 49 ? -12.602 7.180   -4.607  1.00 0.00 ? 49 ARG A NE   3  
ATOM 2496  C CZ   . ARG A 1 49 ? -12.088 8.151   -3.816  1.00 0.00 ? 49 ARG A CZ   3  
ATOM 2497  N NH1  . ARG A 1 49 ? -10.787 8.429   -3.821  1.00 0.00 ? 49 ARG A NH1  3  
ATOM 2498  N NH2  . ARG A 1 49 ? -12.904 8.839   -3.024  1.00 0.00 ? 49 ARG A NH2  3  
ATOM 2499  H H    . ARG A 1 49 ? -11.067 2.083   -4.188  1.00 0.00 ? 49 ARG A H    3  
ATOM 2500  H HA   . ARG A 1 49 ? -12.038 2.449   -6.846  1.00 0.00 ? 49 ARG A HA   3  
ATOM 2501  H HB2  . ARG A 1 49 ? -13.150 3.497   -4.974  1.00 0.00 ? 49 ARG A HB2  3  
ATOM 2502  H HB3  . ARG A 1 49 ? -11.698 4.269   -4.442  1.00 0.00 ? 49 ARG A HB3  3  
ATOM 2503  H HG2  . ARG A 1 49 ? -12.418 5.086   -7.194  1.00 0.00 ? 49 ARG A HG2  3  
ATOM 2504  H HG3  . ARG A 1 49 ? -13.678 5.422   -6.061  1.00 0.00 ? 49 ARG A HG3  3  
ATOM 2505  H HD2  . ARG A 1 49 ? -10.868 6.170   -5.118  1.00 0.00 ? 49 ARG A HD2  3  
ATOM 2506  H HD3  . ARG A 1 49 ? -11.588 7.174   -6.397  1.00 0.00 ? 49 ARG A HD3  3  
ATOM 2507  H HE   . ARG A 1 49 ? -13.572 6.937   -4.572  1.00 0.00 ? 49 ARG A HE   3  
ATOM 2508  H HH11 . ARG A 1 49 ? -10.139 7.881   -4.378  1.00 0.00 ? 49 ARG A HH11 3  
ATOM 2509  H HH12 . ARG A 1 49 ? -10.384 9.163   -3.282  1.00 0.00 ? 49 ARG A HH12 3  
ATOM 2510  H HH21 . ARG A 1 49 ? -13.884 8.640   -3.013  1.00 0.00 ? 49 ARG A HH21 3  
ATOM 2511  H HH22 . ARG A 1 49 ? -12.559 9.564   -2.429  1.00 0.00 ? 49 ARG A HH22 3  
ATOM 2512  N N    . ASP A 1 50 ? -9.282  4.178   -6.070  1.00 0.00 ? 50 ASP A N    3  
ATOM 2513  C CA   . ASP A 1 50 ? -8.176  4.935   -6.674  1.00 0.00 ? 50 ASP A CA   3  
ATOM 2514  C C    . ASP A 1 50 ? -7.149  4.095   -7.472  1.00 0.00 ? 50 ASP A C    3  
ATOM 2515  O O    . ASP A 1 50 ? -6.788  4.439   -8.589  1.00 0.00 ? 50 ASP A O    3  
ATOM 2516  C CB   . ASP A 1 50 ? -7.443  5.738   -5.590  1.00 0.00 ? 50 ASP A CB   3  
ATOM 2517  C CG   . ASP A 1 50 ? -8.363  6.767   -4.916  1.00 0.00 ? 50 ASP A CG   3  
ATOM 2518  O OD1  . ASP A 1 50 ? -8.886  7.640   -5.603  1.00 0.00 ? 50 ASP A OD1  3  
ATOM 2519  O OD2  . ASP A 1 50 ? -8.573  6.709   -3.708  1.00 0.00 ? 50 ASP A OD2  3  
ATOM 2520  H H    . ASP A 1 50 ? -9.386  4.186   -5.070  1.00 0.00 ? 50 ASP A H    3  
ATOM 2521  H HA   . ASP A 1 50 ? -8.619  5.648   -7.373  1.00 0.00 ? 50 ASP A HA   3  
ATOM 2522  H HB2  . ASP A 1 50 ? -7.019  5.041   -4.847  1.00 0.00 ? 50 ASP A HB2  3  
ATOM 2523  H HB3  . ASP A 1 50 ? -6.669  6.348   -6.074  1.00 0.00 ? 50 ASP A HB3  3  
ATOM 2524  N N    . LYS A 1 51 ? -6.668  3.018   -6.821  1.00 0.00 ? 51 LYS A N    3  
ATOM 2525  C CA   . LYS A 1 51 ? -5.674  2.088   -7.379  1.00 0.00 ? 51 LYS A CA   3  
ATOM 2526  C C    . LYS A 1 51 ? -4.241  2.641   -7.390  1.00 0.00 ? 51 LYS A C    3  
ATOM 2527  O O    . LYS A 1 51 ? -3.411  2.226   -8.196  1.00 0.00 ? 51 LYS A O    3  
ATOM 2528  C CB   . LYS A 1 51 ? -6.023  1.541   -8.763  1.00 0.00 ? 51 LYS A CB   3  
ATOM 2529  C CG   . LYS A 1 51 ? -7.488  1.001   -8.770  1.00 0.00 ? 51 LYS A CG   3  
ATOM 2530  C CD   . LYS A 1 51 ? -8.204  1.598   -9.973  1.00 0.00 ? 51 LYS A CD   3  
ATOM 2531  C CE   . LYS A 1 51 ? -9.559  0.963   -10.286 1.00 0.00 ? 51 LYS A CE   3  
ATOM 2532  N NZ   . LYS A 1 51 ? -10.518 1.244   -9.228  1.00 0.00 ? 51 LYS A NZ   3  
ATOM 2533  H H    . LYS A 1 51 ? -7.071  2.801   -5.931  1.00 0.00 ? 51 LYS A H    3  
ATOM 2534  H HA   . LYS A 1 51 ? -5.707  1.232   -6.714  1.00 0.00 ? 51 LYS A HA   3  
ATOM 2535  H HB2  . LYS A 1 51 ? -5.925  2.414   -9.481  1.00 0.00 ? 51 LYS A HB2  3  
ATOM 2536  H HB3  . LYS A 1 51 ? -5.266  0.719   -8.959  1.00 0.00 ? 51 LYS A HB3  3  
ATOM 2537  H HG2  . LYS A 1 51 ? -7.587  -0.092  -8.805  1.00 0.00 ? 51 LYS A HG2  3  
ATOM 2538  H HG3  . LYS A 1 51 ? -8.018  1.268   -7.851  1.00 0.00 ? 51 LYS A HG3  3  
ATOM 2539  H HD2  . LYS A 1 51 ? -8.308  2.676   -9.845  1.00 0.00 ? 51 LYS A HD2  3  
ATOM 2540  H HD3  . LYS A 1 51 ? -7.514  1.461   -10.797 1.00 0.00 ? 51 LYS A HD3  3  
ATOM 2541  H HE2  . LYS A 1 51 ? -9.956  1.372   -11.217 1.00 0.00 ? 51 LYS A HE2  3  
ATOM 2542  H HE3  . LYS A 1 51 ? -9.476  -0.119  -10.405 1.00 0.00 ? 51 LYS A HE3  3  
ATOM 2543  H HZ1  . LYS A 1 51 ? -11.474 0.918   -9.464  1.00 0.00 ? 51 LYS A HZ1  3  
ATOM 2544  H HZ2  . LYS A 1 51 ? -10.526 2.271   -9.038  1.00 0.00 ? 51 LYS A HZ2  3  
ATOM 2545  H HZ3  . LYS A 1 51 ? -10.215 0.782   -8.342  1.00 0.00 ? 51 LYS A HZ3  3  
ATOM 2546  N N    . LYS A 1 52 ? -3.977  3.572   -6.450  1.00 0.00 ? 52 LYS A N    3  
ATOM 2547  C CA   . LYS A 1 52 ? -2.619  4.094   -6.345  1.00 0.00 ? 52 LYS A CA   3  
ATOM 2548  C C    . LYS A 1 52 ? -2.038  3.580   -5.014  1.00 0.00 ? 52 LYS A C    3  
ATOM 2549  O O    . LYS A 1 52 ? -2.622  3.783   -3.950  1.00 0.00 ? 52 LYS A O    3  
ATOM 2550  C CB   . LYS A 1 52 ? -2.562  5.640   -6.398  1.00 0.00 ? 52 LYS A CB   3  
ATOM 2551  C CG   . LYS A 1 52 ? -3.147  6.346   -7.652  1.00 0.00 ? 52 LYS A CG   3  
ATOM 2552  C CD   . LYS A 1 52 ? -2.661  5.865   -9.033  1.00 0.00 ? 52 LYS A CD   3  
ATOM 2553  C CE   . LYS A 1 52 ? -1.131  5.857   -9.154  1.00 0.00 ? 52 LYS A CE   3  
ATOM 2554  N NZ   . LYS A 1 52 ? -0.534  7.191   -9.211  1.00 0.00 ? 52 LYS A NZ   3  
ATOM 2555  H H    . LYS A 1 52 ? -4.691  3.860   -5.814  1.00 0.00 ? 52 LYS A H    3  
ATOM 2556  H HA   . LYS A 1 52 ? -2.047  3.649   -7.152  1.00 0.00 ? 52 LYS A HA   3  
ATOM 2557  H HB2  . LYS A 1 52 ? -3.056  6.035   -5.507  1.00 0.00 ? 52 LYS A HB2  3  
ATOM 2558  H HB3  . LYS A 1 52 ? -1.521  5.946   -6.298  1.00 0.00 ? 52 LYS A HB3  3  
ATOM 2559  H HG2  . LYS A 1 52 ? -4.234  6.271   -7.648  1.00 0.00 ? 52 LYS A HG2  3  
ATOM 2560  H HG3  . LYS A 1 52 ? -2.917  7.413   -7.579  1.00 0.00 ? 52 LYS A HG3  3  
ATOM 2561  H HD2  . LYS A 1 52 ? -3.056  4.817   -9.172  1.00 0.00 ? 52 LYS A HD2  3  
ATOM 2562  H HD3  . LYS A 1 52 ? -3.017  6.626   -9.787  1.00 0.00 ? 52 LYS A HD3  3  
ATOM 2563  H HE2  . LYS A 1 52 ? -0.679  5.331   -8.316  1.00 0.00 ? 52 LYS A HE2  3  
ATOM 2564  H HE3  . LYS A 1 52 ? -0.822  5.327   -10.057 1.00 0.00 ? 52 LYS A HE3  3  
ATOM 2565  H HZ1  . LYS A 1 52 ? -0.738  7.790   -8.378  1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 2566  H HZ2  . LYS A 1 52 ? -0.800  7.749   -10.041 1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 2567  H HZ3  . LYS A 1 52 ? 0.517   7.153   -9.222  1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 2568  N N    . TYR A 1 53 ? -0.892  2.877   -5.148  1.00 0.00 ? 53 TYR A N    3  
ATOM 2569  C CA   . TYR A 1 53 ? -0.194  2.256   -4.035  1.00 0.00 ? 53 TYR A CA   3  
ATOM 2570  C C    . TYR A 1 53 ? 1.286   2.657   -4.053  1.00 0.00 ? 53 TYR A C    3  
ATOM 2571  O O    . TYR A 1 53 ? 1.820   3.248   -4.988  1.00 0.00 ? 53 TYR A O    3  
ATOM 2572  C CB   . TYR A 1 53 ? -0.298  0.714   -4.097  1.00 0.00 ? 53 TYR A CB   3  
ATOM 2573  C CG   . TYR A 1 53 ? 0.476   0.101   -5.235  1.00 0.00 ? 53 TYR A CG   3  
ATOM 2574  C CD1  . TYR A 1 53 ? -0.024  0.093   -6.530  1.00 0.00 ? 53 TYR A CD1  3  
ATOM 2575  C CD2  . TYR A 1 53 ? 1.714   -0.476  -4.996  1.00 0.00 ? 53 TYR A CD2  3  
ATOM 2576  C CE1  . TYR A 1 53 ? 0.695   -0.499  -7.562  1.00 0.00 ? 53 TYR A CE1  3  
ATOM 2577  C CE2  . TYR A 1 53 ? 2.428   -1.078  -6.016  1.00 0.00 ? 53 TYR A CE2  3  
ATOM 2578  C CZ   . TYR A 1 53 ? 1.926   -1.090  -7.304  1.00 0.00 ? 53 TYR A CZ   3  
ATOM 2579  O OH   . TYR A 1 53 ? 2.669   -1.687  -8.303  1.00 0.00 ? 53 TYR A OH   3  
ATOM 2580  H H    . TYR A 1 53 ? -0.433  2.777   -6.032  1.00 0.00 ? 53 TYR A H    3  
ATOM 2581  H HA   . TYR A 1 53 ? -0.635  2.628   -3.115  1.00 0.00 ? 53 TYR A HA   3  
ATOM 2582  H HB2  . TYR A 1 53 ? 0.086   0.287   -3.172  1.00 0.00 ? 53 TYR A HB2  3  
ATOM 2583  H HB3  . TYR A 1 53 ? -1.324  0.363   -4.135  1.00 0.00 ? 53 TYR A HB3  3  
ATOM 2584  H HD1  . TYR A 1 53 ? -0.974  0.561   -6.732  1.00 0.00 ? 53 TYR A HD1  3  
ATOM 2585  H HD2  . TYR A 1 53 ? 2.135   -0.446  -4.007  1.00 0.00 ? 53 TYR A HD2  3  
ATOM 2586  H HE1  . TYR A 1 53 ? 0.280   -0.478  -8.554  1.00 0.00 ? 53 TYR A HE1  3  
ATOM 2587  H HE2  . TYR A 1 53 ? 3.370   -1.547  -5.795  1.00 0.00 ? 53 TYR A HE2  3  
ATOM 2588  H HH   . TYR A 1 53 ? 2.105   -2.112  -8.935  1.00 0.00 ? 53 TYR A HH   3  
ATOM 2589  N N    . GLY A 1 54 ? 1.898   2.228   -2.949  1.00 0.00 ? 54 GLY A N    3  
ATOM 2590  C CA   . GLY A 1 54 ? 3.322   2.410   -2.709  1.00 0.00 ? 54 GLY A CA   3  
ATOM 2591  C C    . GLY A 1 54 ? 3.904   1.075   -2.227  1.00 0.00 ? 54 GLY A C    3  
ATOM 2592  O O    . GLY A 1 54 ? 3.147   0.155   -1.925  1.00 0.00 ? 54 GLY A O    3  
ATOM 2593  H H    . GLY A 1 54 ? 1.295   1.746   -2.300  1.00 0.00 ? 54 GLY A H    3  
ATOM 2594  H HA2  . GLY A 1 54 ? 3.828   2.836   -3.581  1.00 0.00 ? 54 GLY A HA2  3  
ATOM 2595  H HA3  . GLY A 1 54 ? 3.375   3.123   -1.899  1.00 0.00 ? 54 GLY A HA3  3  
ATOM 2596  N N    . PHE A 1 55 ? 5.253   1.008   -2.127  1.00 0.00 ? 55 PHE A N    3  
ATOM 2597  C CA   . PHE A 1 55 ? 5.865   -0.196  -1.570  1.00 0.00 ? 55 PHE A CA   3  
ATOM 2598  C C    . PHE A 1 55 ? 6.050   0.169   -0.091  1.00 0.00 ? 55 PHE A C    3  
ATOM 2599  O O    . PHE A 1 55 ? 6.114   1.335   0.277   1.00 0.00 ? 55 PHE A O    3  
ATOM 2600  C CB   . PHE A 1 55 ? 7.190   -0.644  -2.229  1.00 0.00 ? 55 PHE A CB   3  
ATOM 2601  C CG   . PHE A 1 55 ? 7.036   -1.356  -3.558  1.00 0.00 ? 55 PHE A CG   3  
ATOM 2602  C CD1  . PHE A 1 55 ? 6.146   -0.924  -4.539  1.00 0.00 ? 55 PHE A CD1  3  
ATOM 2603  C CD2  . PHE A 1 55 ? 7.823   -2.472  -3.831  1.00 0.00 ? 55 PHE A CD2  3  
ATOM 2604  C CE1  . PHE A 1 55 ? 6.063   -1.571  -5.767  1.00 0.00 ? 55 PHE A CE1  3  
ATOM 2605  C CE2  . PHE A 1 55 ? 7.730   -3.133  -5.049  1.00 0.00 ? 55 PHE A CE2  3  
ATOM 2606  C CZ   . PHE A 1 55 ? 6.854   -2.679  -6.022  1.00 0.00 ? 55 PHE A CZ   3  
ATOM 2607  H H    . PHE A 1 55 ? 5.880   1.759   -2.352  1.00 0.00 ? 55 PHE A H    3  
ATOM 2608  H HA   . PHE A 1 55 ? 5.170   -1.031  -1.627  1.00 0.00 ? 55 PHE A HA   3  
ATOM 2609  H HB2  . PHE A 1 55 ? 7.897   0.177   -2.359  1.00 0.00 ? 55 PHE A HB2  3  
ATOM 2610  H HB3  . PHE A 1 55 ? 7.644   -1.385  -1.558  1.00 0.00 ? 55 PHE A HB3  3  
ATOM 2611  H HD1  . PHE A 1 55 ? 5.511   -0.072  -4.369  1.00 0.00 ? 55 PHE A HD1  3  
ATOM 2612  H HD2  . PHE A 1 55 ? 8.521   -2.830  -3.088  1.00 0.00 ? 55 PHE A HD2  3  
ATOM 2613  H HE1  . PHE A 1 55 ? 5.387   -1.209  -6.529  1.00 0.00 ? 55 PHE A HE1  3  
ATOM 2614  H HE2  . PHE A 1 55 ? 8.341   -3.999  -5.244  1.00 0.00 ? 55 PHE A HE2  3  
ATOM 2615  H HZ   . PHE A 1 55 ? 6.787   -3.183  -6.976  1.00 0.00 ? 55 PHE A HZ   3  
ATOM 2616  N N    . CYS A 1 56 ? 6.004   -0.895  0.715   1.00 0.00 ? 56 CYS A N    3  
ATOM 2617  C CA   . CYS A 1 56 ? 5.958   -0.743  2.178   1.00 0.00 ? 56 CYS A CA   3  
ATOM 2618  C C    . CYS A 1 56 ? 7.063   -1.654  2.724   1.00 0.00 ? 56 CYS A C    3  
ATOM 2619  O O    . CYS A 1 56 ? 7.383   -2.645  2.084   1.00 0.00 ? 56 CYS A O    3  
ATOM 2620  C CB   . CYS A 1 56 ? 4.569   -1.319  2.577   1.00 0.00 ? 56 CYS A CB   3  
ATOM 2621  S SG   . CYS A 1 56 ? 3.810   -0.666  4.084   1.00 0.00 ? 56 CYS A SG   3  
ATOM 2622  H H    . CYS A 1 56 ? 6.003   -1.802  0.252   1.00 0.00 ? 56 CYS A H    3  
ATOM 2623  H HA   . CYS A 1 56 ? 6.152   0.317   2.484   1.00 0.00 ? 56 CYS A HA   3  
ATOM 2624  H HB2  . CYS A 1 56 ? 3.821   -1.188  1.770   1.00 0.00 ? 56 CYS A HB2  3  
ATOM 2625  H HB3  . CYS A 1 56 ? 4.658   -2.406  2.713   1.00 0.00 ? 56 CYS A HB3  3  
ATOM 2626  N N    . PRO A 1 57 ? 7.663   -1.324  3.900   1.00 0.00 ? 57 PRO A N    3  
ATOM 2627  C CA   . PRO A 1 57 ? 8.849   -2.064  4.340   1.00 0.00 ? 57 PRO A CA   3  
ATOM 2628  C C    . PRO A 1 57 ? 8.645   -3.584  4.513   1.00 0.00 ? 57 PRO A C    3  
ATOM 2629  O O    . PRO A 1 57 ? 7.870   -4.036  5.343   1.00 0.00 ? 57 PRO A O    3  
ATOM 2630  C CB   . PRO A 1 57 ? 9.228   -1.411  5.681   1.00 0.00 ? 57 PRO A CB   3  
ATOM 2631  C CG   . PRO A 1 57 ? 7.978   -0.640  6.115   1.00 0.00 ? 57 PRO A CG   3  
ATOM 2632  C CD   . PRO A 1 57 ? 7.291   -0.232  4.809   1.00 0.00 ? 57 PRO A CD   3  
ATOM 2633  H HA   . PRO A 1 57 ? 9.652   -1.906  3.618   1.00 0.00 ? 57 PRO A HA   3  
ATOM 2634  H HB2  . PRO A 1 57 ? 9.559   -2.119  6.443   1.00 0.00 ? 57 PRO A HB2  3  
ATOM 2635  H HB3  . PRO A 1 57 ? 10.048  -0.710  5.522   1.00 0.00 ? 57 PRO A HB3  3  
ATOM 2636  H HG2  . PRO A 1 57 ? 7.320   -1.313  6.667   1.00 0.00 ? 57 PRO A HG2  3  
ATOM 2637  H HG3  . PRO A 1 57 ? 8.210   0.201   6.768   1.00 0.00 ? 57 PRO A HG3  3  
ATOM 2638  H HD2  . PRO A 1 57 ? 6.201   -0.106  4.980   1.00 0.00 ? 57 PRO A HD2  3  
ATOM 2639  H HD3  . PRO A 1 57 ? 7.763   0.682   4.421   1.00 0.00 ? 57 PRO A HD3  3  
ATOM 2640  N N    . GLU A 1 58 ? 9.445   -4.339  3.731   1.00 0.00 ? 58 GLU A N    3  
ATOM 2641  C CA   . GLU A 1 58 ? 9.455   -5.805  3.748   1.00 0.00 ? 58 GLU A CA   3  
ATOM 2642  C C    . GLU A 1 58 ? 9.650   -6.412  5.157   1.00 0.00 ? 58 GLU A C    3  
ATOM 2643  O O    . GLU A 1 58 ? 9.389   -7.585  5.386   1.00 0.00 ? 58 GLU A O    3  
ATOM 2644  C CB   . GLU A 1 58 ? 10.551  -6.329  2.800   1.00 0.00 ? 58 GLU A CB   3  
ATOM 2645  C CG   . GLU A 1 58 ? 10.168  -6.267  1.310   1.00 0.00 ? 58 GLU A CG   3  
ATOM 2646  C CD   . GLU A 1 58 ? 9.926   -4.844  0.782   1.00 0.00 ? 58 GLU A CD   3  
ATOM 2647  O OE1  . GLU A 1 58 ? 10.674  -3.938  1.152   1.00 0.00 ? 58 GLU A OE1  3  
ATOM 2648  O OE2  . GLU A 1 58 ? 8.993   -4.664  0.002   1.00 0.00 ? 58 GLU A OE2  3  
ATOM 2649  H H    . GLU A 1 58 ? 10.021  -3.892  3.040   1.00 0.00 ? 58 GLU A H    3  
ATOM 2650  H HA   . GLU A 1 58 ? 8.484   -6.116  3.382   1.00 0.00 ? 58 GLU A HA   3  
ATOM 2651  H HB2  . GLU A 1 58 ? 11.482  -5.776  2.970   1.00 0.00 ? 58 GLU A HB2  3  
ATOM 2652  H HB3  . GLU A 1 58 ? 10.742  -7.386  3.024   1.00 0.00 ? 58 GLU A HB3  3  
ATOM 2653  H HG2  . GLU A 1 58 ? 10.959  -6.715  0.709   1.00 0.00 ? 58 GLU A HG2  3  
ATOM 2654  H HG3  . GLU A 1 58 ? 9.275   -6.870  1.144   1.00 0.00 ? 58 GLU A HG3  3  
ATOM 2655  N N    . THR A 1 59 ? 10.127  -5.553  6.073   1.00 0.00 ? 59 THR A N    3  
ATOM 2656  C CA   . THR A 1 59 ? 10.389  -5.894  7.459   1.00 0.00 ? 59 THR A CA   3  
ATOM 2657  C C    . THR A 1 59 ? 9.194   -6.570  8.175   1.00 0.00 ? 59 THR A C    3  
ATOM 2658  O O    . THR A 1 59 ? 9.394   -7.398  9.056   1.00 0.00 ? 59 THR A O    3  
ATOM 2659  C CB   . THR A 1 59 ? 10.777  -4.571  8.144   1.00 0.00 ? 59 THR A CB   3  
ATOM 2660  O OG1  . THR A 1 59 ? 11.477  -3.754  7.221   1.00 0.00 ? 59 THR A OG1  3  
ATOM 2661  C CG2  . THR A 1 59 ? 11.576  -4.770  9.441   1.00 0.00 ? 59 THR A CG2  3  
ATOM 2662  H H    . THR A 1 59 ? 10.327  -4.605  5.829   1.00 0.00 ? 59 THR A H    3  
ATOM 2663  H HA   . THR A 1 59 ? 11.227  -6.592  7.443   1.00 0.00 ? 59 THR A HA   3  
ATOM 2664  H HB   . THR A 1 59 ? 9.865   -4.020  8.388   1.00 0.00 ? 59 THR A HB   3  
ATOM 2665  H HG1  . THR A 1 59 ? 12.322  -4.148  7.030   1.00 0.00 ? 59 THR A HG1  3  
ATOM 2666  H HG21 . THR A 1 59 ? 11.865  -3.811  9.872   1.00 0.00 ? 59 THR A HG21 3  
ATOM 2667  H HG22 . THR A 1 59 ? 12.483  -5.353  9.279   1.00 0.00 ? 59 THR A HG22 3  
ATOM 2668  H HG23 . THR A 1 59 ? 10.980  -5.299  10.185  1.00 0.00 ? 59 THR A HG23 3  
ATOM 2669  N N    . ALA A 1 60 ? 7.968   -6.170  7.774   1.00 0.00 ? 60 ALA A N    3  
ATOM 2670  C CA   . ALA A 1 60 ? 6.767   -6.737  8.383   1.00 0.00 ? 60 ALA A CA   3  
ATOM 2671  C C    . ALA A 1 60 ? 5.554   -6.376  7.509   1.00 0.00 ? 60 ALA A C    3  
ATOM 2672  O O    . ALA A 1 60 ? 5.612   -5.362  6.822   1.00 0.00 ? 60 ALA A O    3  
ATOM 2673  C CB   . ALA A 1 60 ? 6.571   -6.183  9.802   1.00 0.00 ? 60 ALA A CB   3  
ATOM 2674  O OXT  . ALA A 1 60 ? 4.565   -7.107  7.497   1.00 0.00 ? 60 ALA A OXT  3  
ATOM 2675  H H    . ALA A 1 60 ? 7.802   -5.497  7.045   1.00 0.00 ? 60 ALA A H    3  
ATOM 2676  H HA   . ALA A 1 60 ? 6.886   -7.822  8.392   1.00 0.00 ? 60 ALA A HA   3  
ATOM 2677  H HB1  . ALA A 1 60 ? 6.491   -5.096  9.791   1.00 0.00 ? 60 ALA A HB1  3  
ATOM 2678  H HB2  . ALA A 1 60 ? 7.404   -6.453  10.450  1.00 0.00 ? 60 ALA A HB2  3  
ATOM 2679  H HB3  . ALA A 1 60 ? 5.661   -6.581  10.252  1.00 0.00 ? 60 ALA A HB3  3  
ATOM 2680  N N    . THR A 1 1  ? 6.026   8.183   9.501   1.00 0.00 ? 1  THR A N    4  
ATOM 2681  C CA   . THR A 1 1  ? 6.467   9.217   8.577   1.00 0.00 ? 1  THR A CA   4  
ATOM 2682  C C    . THR A 1 1  ? 6.485   8.490   7.236   1.00 0.00 ? 1  THR A C    4  
ATOM 2683  O O    . THR A 1 1  ? 5.778   7.494   7.127   1.00 0.00 ? 1  THR A O    4  
ATOM 2684  C CB   . THR A 1 1  ? 7.795   9.908   8.976   1.00 0.00 ? 1  THR A CB   4  
ATOM 2685  O OG1  . THR A 1 1  ? 8.145   10.912  8.036   1.00 0.00 ? 1  THR A OG1  4  
ATOM 2686  C CG2  . THR A 1 1  ? 8.980   8.936   9.057   1.00 0.00 ? 1  THR A CG2  4  
ATOM 2687  H H1   . THR A 1 1  ? 6.836   7.607   9.804   1.00 0.00 ? 1  THR A H1   4  
ATOM 2688  H H2   . THR A 1 1  ? 5.409   7.579   8.906   1.00 0.00 ? 1  THR A H2   4  
ATOM 2689  H H3   . THR A 1 1  ? 5.507   8.567   10.316  1.00 0.00 ? 1  THR A H3   4  
ATOM 2690  H HA   . THR A 1 1  ? 5.663   9.952   8.525   1.00 0.00 ? 1  THR A HA   4  
ATOM 2691  H HB   . THR A 1 1  ? 7.689   10.355  9.974   1.00 0.00 ? 1  THR A HB   4  
ATOM 2692  H HG1  . THR A 1 1  ? 7.599   11.693  8.123   1.00 0.00 ? 1  THR A HG1  4  
ATOM 2693  H HG21 . THR A 1 1  ? 8.821   8.160   9.805   1.00 0.00 ? 1  THR A HG21 4  
ATOM 2694  H HG22 . THR A 1 1  ? 9.888   9.471   9.337   1.00 0.00 ? 1  THR A HG22 4  
ATOM 2695  H HG23 . THR A 1 1  ? 9.182   8.450   8.102   1.00 0.00 ? 1  THR A HG23 4  
ATOM 2696  N N    . ALA A 1 2  ? 7.284   8.984   6.275   1.00 0.00 ? 2  ALA A N    4  
ATOM 2697  C CA   . ALA A 1 2  ? 7.377   8.355   4.963   1.00 0.00 ? 2  ALA A CA   4  
ATOM 2698  C C    . ALA A 1 2  ? 8.041   6.965   5.059   1.00 0.00 ? 2  ALA A C    4  
ATOM 2699  O O    . ALA A 1 2  ? 9.245   6.816   4.910   1.00 0.00 ? 2  ALA A O    4  
ATOM 2700  C CB   . ALA A 1 2  ? 8.189   9.269   4.036   1.00 0.00 ? 2  ALA A CB   4  
ATOM 2701  H H    . ALA A 1 2  ? 7.832   9.797   6.495   1.00 0.00 ? 2  ALA A H    4  
ATOM 2702  H HA   . ALA A 1 2  ? 6.359   8.249   4.585   1.00 0.00 ? 2  ALA A HA   4  
ATOM 2703  H HB1  . ALA A 1 2  ? 7.715   10.245  3.934   1.00 0.00 ? 2  ALA A HB1  4  
ATOM 2704  H HB2  . ALA A 1 2  ? 8.282   8.838   3.038   1.00 0.00 ? 2  ALA A HB2  4  
ATOM 2705  H HB3  . ALA A 1 2  ? 9.198   9.428   4.420   1.00 0.00 ? 2  ALA A HB3  4  
ATOM 2706  N N    . LEU A 1 3  ? 7.167   5.966   5.277   1.00 0.00 ? 3  LEU A N    4  
ATOM 2707  C CA   . LEU A 1 3  ? 7.650   4.575   5.437   1.00 0.00 ? 3  LEU A CA   4  
ATOM 2708  C C    . LEU A 1 3  ? 7.530   3.735   4.123   1.00 0.00 ? 3  LEU A C    4  
ATOM 2709  O O    . LEU A 1 3  ? 7.550   2.514   4.212   1.00 0.00 ? 3  LEU A O    4  
ATOM 2710  C CB   . LEU A 1 3  ? 6.758   3.841   6.527   1.00 0.00 ? 3  LEU A CB   4  
ATOM 2711  C CG   . LEU A 1 3  ? 7.453   2.960   7.579   1.00 0.00 ? 3  LEU A CG   4  
ATOM 2712  C CD1  . LEU A 1 3  ? 6.450   2.613   8.689   1.00 0.00 ? 3  LEU A CD1  4  
ATOM 2713  C CD2  . LEU A 1 3  ? 7.859   1.610   7.000   1.00 0.00 ? 3  LEU A CD2  4  
ATOM 2714  H H    . LEU A 1 3  ? 6.238   6.324   5.453   1.00 0.00 ? 3  LEU A H    4  
ATOM 2715  H HA   . LEU A 1 3  ? 8.700   4.604   5.705   1.00 0.00 ? 3  LEU A HA   4  
ATOM 2716  H HB2  . LEU A 1 3  ? 6.074   4.512   7.130   1.00 0.00 ? 3  LEU A HB2  4  
ATOM 2717  H HB3  . LEU A 1 3  ? 6.204   3.058   5.967   1.00 0.00 ? 3  LEU A HB3  4  
ATOM 2718  H HG   . LEU A 1 3  ? 8.314   3.480   8.000   1.00 0.00 ? 3  LEU A HG   4  
ATOM 2719  H HD11 . LEU A 1 3  ? 6.068   3.498   9.189   1.00 0.00 ? 3  LEU A HD11 4  
ATOM 2720  H HD12 . LEU A 1 3  ? 6.898   1.951   9.428   1.00 0.00 ? 3  LEU A HD12 4  
ATOM 2721  H HD13 . LEU A 1 3  ? 5.598   2.074   8.268   1.00 0.00 ? 3  LEU A HD13 4  
ATOM 2722  H HD21 . LEU A 1 3  ? 6.946   1.104   6.679   1.00 0.00 ? 3  LEU A HD21 4  
ATOM 2723  H HD22 . LEU A 1 3  ? 8.323   0.984   7.756   1.00 0.00 ? 3  LEU A HD22 4  
ATOM 2724  H HD23 . LEU A 1 3  ? 8.527   1.689   6.150   1.00 0.00 ? 3  LEU A HD23 4  
ATOM 2725  N N    . PHE A 1 4  ? 7.270   4.370   2.943   1.00 0.00 ? 4  PHE A N    4  
ATOM 2726  C CA   . PHE A 1 4  ? 6.667   3.505   1.906   1.00 0.00 ? 4  PHE A CA   4  
ATOM 2727  C C    . PHE A 1 4  ? 6.960   3.684   0.404   1.00 0.00 ? 4  PHE A C    4  
ATOM 2728  O O    . PHE A 1 4  ? 6.283   3.022   -0.379  1.00 0.00 ? 4  PHE A O    4  
ATOM 2729  C CB   . PHE A 1 4  ? 5.141   3.646   2.063   1.00 0.00 ? 4  PHE A CB   4  
ATOM 2730  C CG   . PHE A 1 4  ? 4.630   3.278   3.430   1.00 0.00 ? 4  PHE A CG   4  
ATOM 2731  C CD1  . PHE A 1 4  ? 4.696   1.959   3.861   1.00 0.00 ? 4  PHE A CD1  4  
ATOM 2732  C CD2  . PHE A 1 4  ? 4.096   4.241   4.287   1.00 0.00 ? 4  PHE A CD2  4  
ATOM 2733  C CE1  . PHE A 1 4  ? 4.298   1.619   5.142   1.00 0.00 ? 4  PHE A CE1  4  
ATOM 2734  C CE2  . PHE A 1 4  ? 3.685   3.908   5.564   1.00 0.00 ? 4  PHE A CE2  4  
ATOM 2735  C CZ   . PHE A 1 4  ? 3.815   2.602   5.998   1.00 0.00 ? 4  PHE A CZ   4  
ATOM 2736  H H    . PHE A 1 4  ? 7.368   5.353   2.862   1.00 0.00 ? 4  PHE A H    4  
ATOM 2737  H HA   . PHE A 1 4  ? 6.976   2.488   2.078   1.00 0.00 ? 4  PHE A HA   4  
ATOM 2738  H HB2  . PHE A 1 4  ? 4.948   4.700   1.897   1.00 0.00 ? 4  PHE A HB2  4  
ATOM 2739  H HB3  . PHE A 1 4  ? 4.581   3.049   1.332   1.00 0.00 ? 4  PHE A HB3  4  
ATOM 2740  H HD1  . PHE A 1 4  ? 5.071   1.193   3.199   1.00 0.00 ? 4  PHE A HD1  4  
ATOM 2741  H HD2  . PHE A 1 4  ? 3.959   5.260   3.986   1.00 0.00 ? 4  PHE A HD2  4  
ATOM 2742  H HE1  . PHE A 1 4  ? 4.387   0.594   5.471   1.00 0.00 ? 4  PHE A HE1  4  
ATOM 2743  H HE2  . PHE A 1 4  ? 3.275   4.663   6.220   1.00 0.00 ? 4  PHE A HE2  4  
ATOM 2744  H HZ   . PHE A 1 4  ? 3.574   2.369   7.020   1.00 0.00 ? 4  PHE A HZ   4  
ATOM 2745  N N    . THR A 1 5  ? 7.923   4.519   -0.046  1.00 0.00 ? 5  THR A N    4  
ATOM 2746  C CA   . THR A 1 5  ? 8.176   4.465   -1.502  1.00 0.00 ? 5  THR A CA   4  
ATOM 2747  C C    . THR A 1 5  ? 9.689   4.394   -1.783  1.00 0.00 ? 5  THR A C    4  
ATOM 2748  O O    . THR A 1 5  ? 10.492  4.969   -1.062  1.00 0.00 ? 5  THR A O    4  
ATOM 2749  C CB   . THR A 1 5  ? 7.384   5.473   -2.382  1.00 0.00 ? 5  THR A CB   4  
ATOM 2750  O OG1  . THR A 1 5  ? 8.217   6.417   -3.029  1.00 0.00 ? 5  THR A OG1  4  
ATOM 2751  C CG2  . THR A 1 5  ? 6.179   6.173   -1.728  1.00 0.00 ? 5  THR A CG2  4  
ATOM 2752  H H    . THR A 1 5  ? 8.507   5.063   0.555   1.00 0.00 ? 5  THR A H    4  
ATOM 2753  H HA   . THR A 1 5  ? 7.849   3.467   -1.801  1.00 0.00 ? 5  THR A HA   4  
ATOM 2754  H HB   . THR A 1 5  ? 6.944   4.865   -3.184  1.00 0.00 ? 5  THR A HB   4  
ATOM 2755  H HG1  . THR A 1 5  ? 8.739   6.890   -2.384  1.00 0.00 ? 5  THR A HG1  4  
ATOM 2756  H HG21 . THR A 1 5  ? 5.630   6.754   -2.470  1.00 0.00 ? 5  THR A HG21 4  
ATOM 2757  H HG22 . THR A 1 5  ? 6.445   6.859   -0.920  1.00 0.00 ? 5  THR A HG22 4  
ATOM 2758  H HG23 . THR A 1 5  ? 5.456   5.451   -1.351  1.00 0.00 ? 5  THR A HG23 4  
ATOM 2759  N N    . MET A 1 6  ? 9.989   3.604   -2.844  1.00 0.00 ? 6  MET A N    4  
ATOM 2760  C CA   . MET A 1 6  ? 11.312  3.239   -3.344  1.00 0.00 ? 6  MET A CA   4  
ATOM 2761  C C    . MET A 1 6  ? 11.082  2.011   -4.252  1.00 0.00 ? 6  MET A C    4  
ATOM 2762  O O    . MET A 1 6  ? 11.680  0.956   -4.097  1.00 0.00 ? 6  MET A O    4  
ATOM 2763  C CB   . MET A 1 6  ? 12.295  2.905   -2.197  1.00 0.00 ? 6  MET A CB   4  
ATOM 2764  C CG   . MET A 1 6  ? 11.743  1.910   -1.158  1.00 0.00 ? 6  MET A CG   4  
ATOM 2765  S SD   . MET A 1 6  ? 12.933  1.614   0.163   1.00 0.00 ? 6  MET A SD   4  
ATOM 2766  C CE   . MET A 1 6  ? 12.682  3.132   1.104   1.00 0.00 ? 6  MET A CE   4  
ATOM 2767  H H    . MET A 1 6  ? 9.253   3.203   -3.379  1.00 0.00 ? 6  MET A H    4  
ATOM 2768  H HA   . MET A 1 6  ? 11.664  4.076   -3.950  1.00 0.00 ? 6  MET A HA   4  
ATOM 2769  H HB2  . MET A 1 6  ? 13.224  2.506   -2.609  1.00 0.00 ? 6  MET A HB2  4  
ATOM 2770  H HB3  . MET A 1 6  ? 12.575  3.829   -1.693  1.00 0.00 ? 6  MET A HB3  4  
ATOM 2771  H HG2  . MET A 1 6  ? 10.823  2.282   -0.708  1.00 0.00 ? 6  MET A HG2  4  
ATOM 2772  H HG3  . MET A 1 6  ? 11.478  0.958   -1.617  1.00 0.00 ? 6  MET A HG3  4  
ATOM 2773  H HE1  . MET A 1 6  ? 13.073  3.019   2.114   1.00 0.00 ? 6  MET A HE1  4  
ATOM 2774  H HE2  . MET A 1 6  ? 11.619  3.360   1.181   1.00 0.00 ? 6  MET A HE2  4  
ATOM 2775  H HE3  . MET A 1 6  ? 13.173  3.973   0.612   1.00 0.00 ? 6  MET A HE3  4  
ATOM 2776  N N    . GLY A 1 7  ? 10.098  2.210   -5.153  1.00 0.00 ? 7  GLY A N    4  
ATOM 2777  C CA   . GLY A 1 7  ? 9.622   1.131   -6.018  1.00 0.00 ? 7  GLY A CA   4  
ATOM 2778  C C    . GLY A 1 7  ? 8.144   1.381   -6.354  1.00 0.00 ? 7  GLY A C    4  
ATOM 2779  O O    . GLY A 1 7  ? 7.679   1.190   -7.468  1.00 0.00 ? 7  GLY A O    4  
ATOM 2780  H H    . GLY A 1 7  ? 9.685   3.116   -5.257  1.00 0.00 ? 7  GLY A H    4  
ATOM 2781  H HA2  . GLY A 1 7  ? 10.229  1.127   -6.924  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 2782  H HA3  . GLY A 1 7  ? 9.721   0.182   -5.483  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 2783  N N    . GLY A 1 8  ? 7.472   1.872   -5.289  1.00 0.00 ? 8  GLY A N    4  
ATOM 2784  C CA   . GLY A 1 8  ? 6.070   2.292   -5.299  1.00 0.00 ? 8  GLY A CA   4  
ATOM 2785  C C    . GLY A 1 8  ? 5.741   3.204   -6.493  1.00 0.00 ? 8  GLY A C    4  
ATOM 2786  O O    . GLY A 1 8  ? 6.628   3.804   -7.085  1.00 0.00 ? 8  GLY A O    4  
ATOM 2787  H H    . GLY A 1 8  ? 7.991   1.862   -4.443  1.00 0.00 ? 8  GLY A H    4  
ATOM 2788  H HA2  . GLY A 1 8  ? 5.456   1.391   -5.300  1.00 0.00 ? 8  GLY A HA2  4  
ATOM 2789  H HA3  . GLY A 1 8  ? 5.912   2.850   -4.379  1.00 0.00 ? 8  GLY A HA3  4  
ATOM 2790  N N    . ASN A 1 9  ? 4.431   3.242   -6.827  1.00 0.00 ? 9  ASN A N    4  
ATOM 2791  C CA   . ASN A 1 9  ? 4.005   3.974   -8.031  1.00 0.00 ? 9  ASN A CA   4  
ATOM 2792  C C    . ASN A 1 9  ? 3.083   5.161   -7.725  1.00 0.00 ? 9  ASN A C    4  
ATOM 2793  O O    . ASN A 1 9  ? 2.670   5.878   -8.629  1.00 0.00 ? 9  ASN A O    4  
ATOM 2794  C CB   . ASN A 1 9  ? 3.342   3.008   -9.043  1.00 0.00 ? 9  ASN A CB   4  
ATOM 2795  C CG   . ASN A 1 9  ? 1.956   2.482   -8.617  1.00 0.00 ? 9  ASN A CG   4  
ATOM 2796  O OD1  . ASN A 1 9  ? 1.369   2.911   -7.637  1.00 0.00 ? 9  ASN A OD1  4  
ATOM 2797  N ND2  . ASN A 1 9  ? 1.434   1.543   -9.416  1.00 0.00 ? 9  ASN A ND2  4  
ATOM 2798  H H    . ASN A 1 9  ? 3.765   2.776   -6.231  1.00 0.00 ? 9  ASN A H    4  
ATOM 2799  H HA   . ASN A 1 9  ? 4.896   4.402   -8.499  1.00 0.00 ? 9  ASN A HA   4  
ATOM 2800  H HB2  . ASN A 1 9  ? 3.212   3.525   -9.994  1.00 0.00 ? 9  ASN A HB2  4  
ATOM 2801  H HB3  . ASN A 1 9  ? 4.005   2.166   -9.244  1.00 0.00 ? 9  ASN A HB3  4  
ATOM 2802  H HD21 . ASN A 1 9  ? 1.912   1.184   -10.222 1.00 0.00 ? 9  ASN A HD21 4  
ATOM 2803  H HD22 . ASN A 1 9  ? 0.523   1.221   -9.139  1.00 0.00 ? 9  ASN A HD22 4  
ATOM 2804  N N    . ALA A 1 10 ? 2.779   5.348   -6.430  1.00 0.00 ? 10 ALA A N    4  
ATOM 2805  C CA   . ALA A 1 10 ? 1.869   6.421   -6.046  1.00 0.00 ? 10 ALA A CA   4  
ATOM 2806  C C    . ALA A 1 10 ? 2.543   7.804   -6.013  1.00 0.00 ? 10 ALA A C    4  
ATOM 2807  O O    . ALA A 1 10 ? 2.545   8.452   -4.982  1.00 0.00 ? 10 ALA A O    4  
ATOM 2808  C CB   . ALA A 1 10 ? 1.310   6.083   -4.659  1.00 0.00 ? 10 ALA A CB   4  
ATOM 2809  H H    . ALA A 1 10 ? 3.126   4.715   -5.735  1.00 0.00 ? 10 ALA A H    4  
ATOM 2810  H HA   . ALA A 1 10 ? 1.064   6.459   -6.780  1.00 0.00 ? 10 ALA A HA   4  
ATOM 2811  H HB1  . ALA A 1 10 ? 0.539   6.797   -4.365  1.00 0.00 ? 10 ALA A HB1  4  
ATOM 2812  H HB2  . ALA A 1 10 ? 2.093   6.103   -3.898  1.00 0.00 ? 10 ALA A HB2  4  
ATOM 2813  H HB3  . ALA A 1 10 ? 0.868   5.090   -4.641  1.00 0.00 ? 10 ALA A HB3  4  
ATOM 2814  N N    . GLU A 1 11 ? 3.110   8.225   -7.164  1.00 0.00 ? 11 GLU A N    4  
ATOM 2815  C CA   . GLU A 1 11 ? 3.775   9.527   -7.323  1.00 0.00 ? 11 GLU A CA   4  
ATOM 2816  C C    . GLU A 1 11 ? 4.783   9.882   -6.192  1.00 0.00 ? 11 GLU A C    4  
ATOM 2817  O O    . GLU A 1 11 ? 5.004   11.043  -5.876  1.00 0.00 ? 11 GLU A O    4  
ATOM 2818  C CB   . GLU A 1 11 ? 2.753   10.662  -7.575  1.00 0.00 ? 11 GLU A CB   4  
ATOM 2819  C CG   . GLU A 1 11 ? 1.727   10.863  -6.445  1.00 0.00 ? 11 GLU A CG   4  
ATOM 2820  C CD   . GLU A 1 11 ? 0.992   12.213  -6.522  1.00 0.00 ? 11 GLU A CD   4  
ATOM 2821  O OE1  . GLU A 1 11 ? 0.510   12.560  -7.599  1.00 0.00 ? 11 GLU A OE1  4  
ATOM 2822  O OE2  . GLU A 1 11 ? 0.906   12.900  -5.501  1.00 0.00 ? 11 GLU A OE2  4  
ATOM 2823  H H    . GLU A 1 11 ? 3.043   7.623   -7.963  1.00 0.00 ? 11 GLU A H    4  
ATOM 2824  H HA   . GLU A 1 11 ? 4.372   9.412   -8.227  1.00 0.00 ? 11 GLU A HA   4  
ATOM 2825  H HB2  . GLU A 1 11 ? 3.298   11.594  -7.735  1.00 0.00 ? 11 GLU A HB2  4  
ATOM 2826  H HB3  . GLU A 1 11 ? 2.217   10.475  -8.506  1.00 0.00 ? 11 GLU A HB3  4  
ATOM 2827  H HG2  . GLU A 1 11 ? 0.982   10.068  -6.446  1.00 0.00 ? 11 GLU A HG2  4  
ATOM 2828  H HG3  . GLU A 1 11 ? 2.246   10.814  -5.495  1.00 0.00 ? 11 GLU A HG3  4  
ATOM 2829  N N    . GLY A 1 12 ? 5.390   8.827   -5.608  1.00 0.00 ? 12 GLY A N    4  
ATOM 2830  C CA   . GLY A 1 12 ? 6.377   9.037   -4.534  1.00 0.00 ? 12 GLY A CA   4  
ATOM 2831  C C    . GLY A 1 12 ? 5.706   9.266   -3.159  1.00 0.00 ? 12 GLY A C    4  
ATOM 2832  O O    . GLY A 1 12 ? 6.381   9.356   -2.141  1.00 0.00 ? 12 GLY A O    4  
ATOM 2833  H H    . GLY A 1 12 ? 5.127   7.920   -5.936  1.00 0.00 ? 12 GLY A H    4  
ATOM 2834  H HA2  . GLY A 1 12 ? 6.962   8.071   -4.451  1.00 0.00 ? 12 GLY A HA2  4  
ATOM 2835  H HA3  . GLY A 1 12 ? 6.938   9.986   -4.786  1.00 0.00 ? 12 GLY A HA3  4  
ATOM 2836  N N    . GLN A 1 13 ? 4.361   9.352   -3.165  1.00 0.00 ? 13 GLN A N    4  
ATOM 2837  C CA   . GLN A 1 13 ? 3.603   9.510   -1.931  1.00 0.00 ? 13 GLN A CA   4  
ATOM 2838  C C    . GLN A 1 13 ? 3.616   8.158   -1.176  1.00 0.00 ? 13 GLN A C    4  
ATOM 2839  O O    . GLN A 1 13 ? 3.237   7.132   -1.730  1.00 0.00 ? 13 GLN A O    4  
ATOM 2840  C CB   . GLN A 1 13 ? 2.143   9.903   -2.201  1.00 0.00 ? 13 GLN A CB   4  
ATOM 2841  C CG   . GLN A 1 13 ? 1.966   11.250  -2.937  1.00 0.00 ? 13 GLN A CG   4  
ATOM 2842  C CD   . GLN A 1 13 ? 1.749   12.441  -1.996  1.00 0.00 ? 13 GLN A CD   4  
ATOM 2843  O OE1  . GLN A 1 13 ? 2.062   12.404  -0.813  1.00 0.00 ? 13 GLN A OE1  4  
ATOM 2844  N NE2  . GLN A 1 13 ? 1.159   13.486  -2.594  1.00 0.00 ? 13 GLN A NE2  4  
ATOM 2845  H H    . GLN A 1 13 ? 3.847   9.223   -4.012  1.00 0.00 ? 13 GLN A H    4  
ATOM 2846  H HA   . GLN A 1 13 ? 4.083   10.307  -1.366  1.00 0.00 ? 13 GLN A HA   4  
ATOM 2847  H HB2  . GLN A 1 13 ? 1.664   9.112   -2.781  1.00 0.00 ? 13 GLN A HB2  4  
ATOM 2848  H HB3  . GLN A 1 13 ? 1.617   9.937   -1.244  1.00 0.00 ? 13 GLN A HB3  4  
ATOM 2849  H HG2  . GLN A 1 13 ? 2.813   11.494  -3.577  1.00 0.00 ? 13 GLN A HG2  4  
ATOM 2850  H HG3  . GLN A 1 13 ? 1.087   11.183  -3.579  1.00 0.00 ? 13 GLN A HG3  4  
ATOM 2851  H HE21 . GLN A 1 13 ? 0.957   13.415  -3.580  1.00 0.00 ? 13 GLN A HE21 4  
ATOM 2852  H HE22 . GLN A 1 13 ? 0.923   14.312  -2.084  1.00 0.00 ? 13 GLN A HE22 4  
ATOM 2853  N N    . PRO A 1 14 ? 4.064   8.171   0.103   1.00 0.00 ? 14 PRO A N    4  
ATOM 2854  C CA   . PRO A 1 14 ? 4.071   6.966   0.919   1.00 0.00 ? 14 PRO A CA   4  
ATOM 2855  C C    . PRO A 1 14 ? 2.637   6.537   1.298   1.00 0.00 ? 14 PRO A C    4  
ATOM 2856  O O    . PRO A 1 14 ? 1.719   7.347   1.333   1.00 0.00 ? 14 PRO A O    4  
ATOM 2857  C CB   . PRO A 1 14 ? 4.988   7.315   2.099   1.00 0.00 ? 14 PRO A CB   4  
ATOM 2858  C CG   . PRO A 1 14 ? 4.987   8.849   2.187   1.00 0.00 ? 14 PRO A CG   4  
ATOM 2859  C CD   . PRO A 1 14 ? 4.578   9.345   0.797   1.00 0.00 ? 14 PRO A CD   4  
ATOM 2860  H HA   . PRO A 1 14 ? 4.503   6.147   0.353   1.00 0.00 ? 14 PRO A HA   4  
ATOM 2861  H HB2  . PRO A 1 14 ? 4.652   6.899   3.047   1.00 0.00 ? 14 PRO A HB2  4  
ATOM 2862  H HB3  . PRO A 1 14 ? 5.994   6.916   1.879   1.00 0.00 ? 14 PRO A HB3  4  
ATOM 2863  H HG2  . PRO A 1 14 ? 4.163   9.138   2.893   1.00 0.00 ? 14 PRO A HG2  4  
ATOM 2864  H HG3  . PRO A 1 14 ? 6.020   9.218   2.420   1.00 0.00 ? 14 PRO A HG3  4  
ATOM 2865  H HD2  . PRO A 1 14 ? 3.807   10.117  0.854   1.00 0.00 ? 14 PRO A HD2  4  
ATOM 2866  H HD3  . PRO A 1 14 ? 5.436   9.746   0.257   1.00 0.00 ? 14 PRO A HD3  4  
ATOM 2867  N N    . CYS A 1 15 ? 2.505   5.209   1.531   1.00 0.00 ? 15 CYS A N    4  
ATOM 2868  C CA   . CYS A 1 15 ? 1.224   4.591   1.861   1.00 0.00 ? 15 CYS A CA   4  
ATOM 2869  C C    . CYS A 1 15 ? 0.511   5.329   2.983   1.00 0.00 ? 15 CYS A C    4  
ATOM 2870  O O    . CYS A 1 15 ? 1.111   5.950   3.854   1.00 0.00 ? 15 CYS A O    4  
ATOM 2871  C CB   . CYS A 1 15 ? 1.425   3.161   2.361   1.00 0.00 ? 15 CYS A CB   4  
ATOM 2872  S SG   . CYS A 1 15 ? 2.058   2.070   1.077   1.00 0.00 ? 15 CYS A SG   4  
ATOM 2873  H H    . CYS A 1 15 ? 3.299   4.603   1.503   1.00 0.00 ? 15 CYS A H    4  
ATOM 2874  H HA   . CYS A 1 15 ? 0.597   4.597   0.971   1.00 0.00 ? 15 CYS A HA   4  
ATOM 2875  H HB2  . CYS A 1 15 ? 2.079   3.125   3.220   1.00 0.00 ? 15 CYS A HB2  4  
ATOM 2876  H HB3  . CYS A 1 15 ? 0.505   2.743   2.753   1.00 0.00 ? 15 CYS A HB3  4  
ATOM 2877  N N    . LYS A 1 16 ? -0.820  5.195   2.885   1.00 0.00 ? 16 LYS A N    4  
ATOM 2878  C CA   . LYS A 1 16 ? -1.703  5.808   3.838   1.00 0.00 ? 16 LYS A CA   4  
ATOM 2879  C C    . LYS A 1 16 ? -2.328  4.680   4.640   1.00 0.00 ? 16 LYS A C    4  
ATOM 2880  O O    . LYS A 1 16 ? -2.805  3.698   4.091   1.00 0.00 ? 16 LYS A O    4  
ATOM 2881  C CB   . LYS A 1 16 ? -2.782  6.560   3.046   1.00 0.00 ? 16 LYS A CB   4  
ATOM 2882  C CG   . LYS A 1 16 ? -3.625  7.543   3.895   1.00 0.00 ? 16 LYS A CG   4  
ATOM 2883  C CD   . LYS A 1 16 ? -2.738  8.625   4.535   1.00 0.00 ? 16 LYS A CD   4  
ATOM 2884  C CE   . LYS A 1 16 ? -2.350  8.373   6.005   1.00 0.00 ? 16 LYS A CE   4  
ATOM 2885  N NZ   . LYS A 1 16 ? -1.774  9.556   6.645   1.00 0.00 ? 16 LYS A NZ   4  
ATOM 2886  H H    . LYS A 1 16 ? -1.244  4.644   2.163   1.00 0.00 ? 16 LYS A H    4  
ATOM 2887  H HA   . LYS A 1 16 ? -1.088  6.447   4.470   1.00 0.00 ? 16 LYS A HA   4  
ATOM 2888  H HB2  . LYS A 1 16 ? -2.285  7.142   2.270   1.00 0.00 ? 16 LYS A HB2  4  
ATOM 2889  H HB3  . LYS A 1 16 ? -3.377  5.808   2.508   1.00 0.00 ? 16 LYS A HB3  4  
ATOM 2890  H HG2  . LYS A 1 16 ? -4.345  8.084   3.267   1.00 0.00 ? 16 LYS A HG2  4  
ATOM 2891  H HG3  . LYS A 1 16 ? -4.249  7.028   4.632   1.00 0.00 ? 16 LYS A HG3  4  
ATOM 2892  H HD2  . LYS A 1 16 ? -1.876  8.817   3.878   1.00 0.00 ? 16 LYS A HD2  4  
ATOM 2893  H HD3  . LYS A 1 16 ? -3.320  9.537   4.543   1.00 0.00 ? 16 LYS A HD3  4  
ATOM 2894  H HE2  . LYS A 1 16 ? -3.229  8.080   6.584   1.00 0.00 ? 16 LYS A HE2  4  
ATOM 2895  H HE3  . LYS A 1 16 ? -1.621  7.576   6.109   1.00 0.00 ? 16 LYS A HE3  4  
ATOM 2896  H HZ1  . LYS A 1 16 ? -0.901  9.837   6.152   1.00 0.00 ? 16 LYS A HZ1  4  
ATOM 2897  H HZ2  . LYS A 1 16 ? -1.550  9.343   7.640   1.00 0.00 ? 16 LYS A HZ2  4  
ATOM 2898  H HZ3  . LYS A 1 16 ? -2.453  10.343  6.613   1.00 0.00 ? 16 LYS A HZ3  4  
ATOM 2899  N N    . PHE A 1 17 ? -2.282  4.876   5.963   1.00 0.00 ? 17 PHE A N    4  
ATOM 2900  C CA   . PHE A 1 17 ? -2.898  3.927   6.875   1.00 0.00 ? 17 PHE A CA   4  
ATOM 2901  C C    . PHE A 1 17 ? -3.944  4.787   7.599   1.00 0.00 ? 17 PHE A C    4  
ATOM 2902  O O    . PHE A 1 17 ? -3.625  5.908   7.987   1.00 0.00 ? 17 PHE A O    4  
ATOM 2903  C CB   . PHE A 1 17 ? -1.914  3.352   7.931   1.00 0.00 ? 17 PHE A CB   4  
ATOM 2904  C CG   . PHE A 1 17 ? -0.762  2.508   7.422   1.00 0.00 ? 17 PHE A CG   4  
ATOM 2905  C CD1  . PHE A 1 17 ? -0.664  2.050   6.111   1.00 0.00 ? 17 PHE A CD1  4  
ATOM 2906  C CD2  . PHE A 1 17 ? 0.262   2.173   8.305   1.00 0.00 ? 17 PHE A CD2  4  
ATOM 2907  C CE1  . PHE A 1 17 ? 0.427   1.297   5.704   1.00 0.00 ? 17 PHE A CE1  4  
ATOM 2908  C CE2  . PHE A 1 17 ? 1.344   1.405   7.899   1.00 0.00 ? 17 PHE A CE2  4  
ATOM 2909  C CZ   . PHE A 1 17 ? 1.412   0.944   6.597   1.00 0.00 ? 17 PHE A CZ   4  
ATOM 2910  H H    . PHE A 1 17 ? -1.916  5.734   6.320   1.00 0.00 ? 17 PHE A H    4  
ATOM 2911  H HA   . PHE A 1 17 ? -3.363  3.136   6.286   1.00 0.00 ? 17 PHE A HA   4  
ATOM 2912  H HB2  . PHE A 1 17 ? -1.479  4.184   8.496   1.00 0.00 ? 17 PHE A HB2  4  
ATOM 2913  H HB3  . PHE A 1 17 ? -2.460  2.718   8.645   1.00 0.00 ? 17 PHE A HB3  4  
ATOM 2914  H HD1  . PHE A 1 17 ? -1.418  2.260   5.380   1.00 0.00 ? 17 PHE A HD1  4  
ATOM 2915  H HD2  . PHE A 1 17 ? 0.231   2.509   9.326   1.00 0.00 ? 17 PHE A HD2  4  
ATOM 2916  H HE1  . PHE A 1 17 ? 0.577   1.017   4.683   1.00 0.00 ? 17 PHE A HE1  4  
ATOM 2917  H HE2  . PHE A 1 17 ? 2.170   1.214   8.567   1.00 0.00 ? 17 PHE A HE2  4  
ATOM 2918  H HZ   . PHE A 1 17 ? 2.248   0.353   6.243   1.00 0.00 ? 17 PHE A HZ   4  
ATOM 2919  N N    . PRO A 1 18 ? -5.186  4.262   7.763   1.00 0.00 ? 18 PRO A N    4  
ATOM 2920  C CA   . PRO A 1 18 ? -5.682  3.027   7.156   1.00 0.00 ? 18 PRO A CA   4  
ATOM 2921  C C    . PRO A 1 18 ? -6.098  3.256   5.684   1.00 0.00 ? 18 PRO A C    4  
ATOM 2922  O O    . PRO A 1 18 ? -6.730  4.256   5.370   1.00 0.00 ? 18 PRO A O    4  
ATOM 2923  C CB   . PRO A 1 18 ? -6.917  2.692   8.000   1.00 0.00 ? 18 PRO A CB   4  
ATOM 2924  C CG   . PRO A 1 18 ? -7.435  4.052   8.481   1.00 0.00 ? 18 PRO A CG   4  
ATOM 2925  C CD   . PRO A 1 18 ? -6.185  4.932   8.593   1.00 0.00 ? 18 PRO A CD   4  
ATOM 2926  H HA   . PRO A 1 18 ? -4.941  2.236   7.233   1.00 0.00 ? 18 PRO A HA   4  
ATOM 2927  H HB2  . PRO A 1 18 ? -7.672  2.113   7.465   1.00 0.00 ? 18 PRO A HB2  4  
ATOM 2928  H HB3  . PRO A 1 18 ? -6.608  2.101   8.863   1.00 0.00 ? 18 PRO A HB3  4  
ATOM 2929  H HG2  . PRO A 1 18 ? -8.104  4.471   7.728   1.00 0.00 ? 18 PRO A HG2  4  
ATOM 2930  H HG3  . PRO A 1 18 ? -7.990  3.986   9.417   1.00 0.00 ? 18 PRO A HG3  4  
ATOM 2931  H HD2  . PRO A 1 18 ? -6.373  5.948   8.233   1.00 0.00 ? 18 PRO A HD2  4  
ATOM 2932  H HD3  . PRO A 1 18 ? -5.827  4.970   9.626   1.00 0.00 ? 18 PRO A HD3  4  
ATOM 2933  N N    . PHE A 1 19 ? -5.728  2.292   4.814   1.00 0.00 ? 19 PHE A N    4  
ATOM 2934  C CA   . PHE A 1 19 ? -6.154  2.344   3.415   1.00 0.00 ? 19 PHE A CA   4  
ATOM 2935  C C    . PHE A 1 19 ? -7.209  1.242   3.254   1.00 0.00 ? 19 PHE A C    4  
ATOM 2936  O O    . PHE A 1 19 ? -7.122  0.179   3.853   1.00 0.00 ? 19 PHE A O    4  
ATOM 2937  C CB   . PHE A 1 19 ? -5.026  2.165   2.375   1.00 0.00 ? 19 PHE A CB   4  
ATOM 2938  C CG   . PHE A 1 19 ? -4.337  0.794   2.407   1.00 0.00 ? 19 PHE A CG   4  
ATOM 2939  C CD1  . PHE A 1 19 ? -3.411  0.386   3.388   1.00 0.00 ? 19 PHE A CD1  4  
ATOM 2940  C CD2  . PHE A 1 19 ? -4.650  -0.109  1.382   1.00 0.00 ? 19 PHE A CD2  4  
ATOM 2941  C CE1  . PHE A 1 19 ? -2.789  -0.854  3.300   1.00 0.00 ? 19 PHE A CE1  4  
ATOM 2942  C CE2  . PHE A 1 19 ? -4.023  -1.373  1.304   1.00 0.00 ? 19 PHE A CE2  4  
ATOM 2943  C CZ   . PHE A 1 19 ? -3.087  -1.724  2.262   1.00 0.00 ? 19 PHE A CZ   4  
ATOM 2944  H H    . PHE A 1 19 ? -5.245  1.480   5.149   1.00 0.00 ? 19 PHE A H    4  
ATOM 2945  H HA   . PHE A 1 19 ? -6.636  3.306   3.227   1.00 0.00 ? 19 PHE A HA   4  
ATOM 2946  H HB2  . PHE A 1 19 ? -5.532  2.241   1.397   1.00 0.00 ? 19 PHE A HB2  4  
ATOM 2947  H HB3  . PHE A 1 19 ? -4.338  3.033   2.386   1.00 0.00 ? 19 PHE A HB3  4  
ATOM 2948  H HD1  . PHE A 1 19 ? -3.125  0.941   4.277   1.00 0.00 ? 19 PHE A HD1  4  
ATOM 2949  H HD2  . PHE A 1 19 ? -5.407  0.262   0.684   1.00 0.00 ? 19 PHE A HD2  4  
ATOM 2950  H HE1  . PHE A 1 19 ? -2.076  -1.145  4.063   1.00 0.00 ? 19 PHE A HE1  4  
ATOM 2951  H HE2  . PHE A 1 19 ? -4.179  -2.160  0.556   1.00 0.00 ? 19 PHE A HE2  4  
ATOM 2952  H HZ   . PHE A 1 19 ? -2.600  -2.688  2.187   1.00 0.00 ? 19 PHE A HZ   4  
ATOM 2953  N N    . ARG A 1 20 ? -8.224  1.565   2.442   1.00 0.00 ? 20 ARG A N    4  
ATOM 2954  C CA   . ARG A 1 20 ? -9.340  0.657   2.219   1.00 0.00 ? 20 ARG A CA   4  
ATOM 2955  C C    . ARG A 1 20 ? -9.125  -0.012  0.851   1.00 0.00 ? 20 ARG A C    4  
ATOM 2956  O O    . ARG A 1 20 ? -8.951  0.664   -0.158  1.00 0.00 ? 20 ARG A O    4  
ATOM 2957  C CB   . ARG A 1 20 ? -10.620 1.513   2.280   1.00 0.00 ? 20 ARG A CB   4  
ATOM 2958  C CG   . ARG A 1 20 ? -11.906 0.775   2.671   1.00 0.00 ? 20 ARG A CG   4  
ATOM 2959  C CD   . ARG A 1 20 ? -12.418 -0.281  1.647   1.00 0.00 ? 20 ARG A CD   4  
ATOM 2960  N NE   . ARG A 1 20 ? -12.164 0.039   0.217   1.00 0.00 ? 20 ARG A NE   4  
ATOM 2961  C CZ   . ARG A 1 20 ? -12.563 1.173   -0.390  1.00 0.00 ? 20 ARG A CZ   4  
ATOM 2962  N NH1  . ARG A 1 20 ? -13.175 2.155   0.257   1.00 0.00 ? 20 ARG A NH1  4  
ATOM 2963  N NH2  . ARG A 1 20 ? -12.306 1.313   -1.674  1.00 0.00 ? 20 ARG A NH2  4  
ATOM 2964  H H    . ARG A 1 20 ? -8.226  2.459   1.988   1.00 0.00 ? 20 ARG A H    4  
ATOM 2965  H HA   . ARG A 1 20 ? -9.332  -0.090  3.017   1.00 0.00 ? 20 ARG A HA   4  
ATOM 2966  H HB2  . ARG A 1 20 ? -10.482 2.270   3.054   1.00 0.00 ? 20 ARG A HB2  4  
ATOM 2967  H HB3  . ARG A 1 20 ? -10.749 2.081   1.360   1.00 0.00 ? 20 ARG A HB3  4  
ATOM 2968  H HG2  . ARG A 1 20 ? -11.735 0.311   3.649   1.00 0.00 ? 20 ARG A HG2  4  
ATOM 2969  H HG3  . ARG A 1 20 ? -12.666 1.539   2.886   1.00 0.00 ? 20 ARG A HG3  4  
ATOM 2970  H HD2  . ARG A 1 20 ? -11.922 -1.238  1.840   1.00 0.00 ? 20 ARG A HD2  4  
ATOM 2971  H HD3  . ARG A 1 20 ? -13.497 -0.455  1.783   1.00 0.00 ? 20 ARG A HD3  4  
ATOM 2972  H HE   . ARG A 1 20 ? -11.639 -0.514  -0.464  1.00 0.00 ? 20 ARG A HE   4  
ATOM 2973  H HH11 . ARG A 1 20 ? -13.423 2.068   1.219   1.00 0.00 ? 20 ARG A HH11 4  
ATOM 2974  H HH12 . ARG A 1 20 ? -13.366 3.009   -0.251  1.00 0.00 ? 20 ARG A HH12 4  
ATOM 2975  H HH21 . ARG A 1 20 ? -11.933 0.542   -2.204  1.00 0.00 ? 20 ARG A HH21 4  
ATOM 2976  H HH22 . ARG A 1 20 ? -12.448 2.202   -2.143  1.00 0.00 ? 20 ARG A HH22 4  
ATOM 2977  N N    . PHE A 1 21 ? -9.120  -1.358  0.882   1.00 0.00 ? 21 PHE A N    4  
ATOM 2978  C CA   . PHE A 1 21 ? -8.878  -2.173  -0.306  1.00 0.00 ? 21 PHE A CA   4  
ATOM 2979  C C    . PHE A 1 21 ? -9.848  -3.359  -0.225  1.00 0.00 ? 21 PHE A C    4  
ATOM 2980  O O    . PHE A 1 21 ? -10.120 -3.865  0.851   1.00 0.00 ? 21 PHE A O    4  
ATOM 2981  C CB   . PHE A 1 21 ? -7.415  -2.641  -0.238  1.00 0.00 ? 21 PHE A CB   4  
ATOM 2982  C CG   . PHE A 1 21 ? -7.042  -3.703  -1.237  1.00 0.00 ? 21 PHE A CG   4  
ATOM 2983  C CD1  . PHE A 1 21 ? -7.387  -3.595  -2.574  1.00 0.00 ? 21 PHE A CD1  4  
ATOM 2984  C CD2  . PHE A 1 21 ? -6.324  -4.814  -0.825  1.00 0.00 ? 21 PHE A CD2  4  
ATOM 2985  C CE1  . PHE A 1 21 ? -6.975  -4.542  -3.503  1.00 0.00 ? 21 PHE A CE1  4  
ATOM 2986  C CE2  . PHE A 1 21 ? -5.915  -5.775  -1.739  1.00 0.00 ? 21 PHE A CE2  4  
ATOM 2987  C CZ   . PHE A 1 21 ? -6.228  -5.635  -3.085  1.00 0.00 ? 21 PHE A CZ   4  
ATOM 2988  H H    . PHE A 1 21 ? -9.287  -1.857  1.746   1.00 0.00 ? 21 PHE A H    4  
ATOM 2989  H HA   . PHE A 1 21 ? -9.066  -1.603  -1.225  1.00 0.00 ? 21 PHE A HA   4  
ATOM 2990  H HB2  . PHE A 1 21 ? -6.749  -1.786  -0.381  1.00 0.00 ? 21 PHE A HB2  4  
ATOM 2991  H HB3  . PHE A 1 21 ? -7.225  -3.063  0.749   1.00 0.00 ? 21 PHE A HB3  4  
ATOM 2992  H HD1  . PHE A 1 21 ? -8.012  -2.773  -2.869  1.00 0.00 ? 21 PHE A HD1  4  
ATOM 2993  H HD2  . PHE A 1 21 ? -6.125  -4.946  0.227   1.00 0.00 ? 21 PHE A HD2  4  
ATOM 2994  H HE1  . PHE A 1 21 ? -7.247  -4.430  -4.542  1.00 0.00 ? 21 PHE A HE1  4  
ATOM 2995  H HE2  . PHE A 1 21 ? -5.370  -6.637  -1.385  1.00 0.00 ? 21 PHE A HE2  4  
ATOM 2996  H HZ   . PHE A 1 21 ? -5.901  -6.379  -3.795  1.00 0.00 ? 21 PHE A HZ   4  
ATOM 2997  N N    . GLN A 1 22 ? -10.383 -3.755  -1.389  1.00 0.00 ? 22 GLN A N    4  
ATOM 2998  C CA   . GLN A 1 22 ? -11.338 -4.858  -1.503  1.00 0.00 ? 22 GLN A CA   4  
ATOM 2999  C C    . GLN A 1 22 ? -12.617 -4.644  -0.650  1.00 0.00 ? 22 GLN A C    4  
ATOM 3000  O O    . GLN A 1 22 ? -13.351 -5.585  -0.378  1.00 0.00 ? 22 GLN A O    4  
ATOM 3001  C CB   . GLN A 1 22 ? -10.747 -6.235  -1.104  1.00 0.00 ? 22 GLN A CB   4  
ATOM 3002  C CG   . GLN A 1 22 ? -9.557  -6.741  -1.946  1.00 0.00 ? 22 GLN A CG   4  
ATOM 3003  C CD   . GLN A 1 22 ? -8.590  -7.503  -1.036  1.00 0.00 ? 22 GLN A CD   4  
ATOM 3004  O OE1  . GLN A 1 22 ? -8.120  -6.967  -0.048  1.00 0.00 ? 22 GLN A OE1  4  
ATOM 3005  N NE2  . GLN A 1 22 ? -8.319  -8.761  -1.392  1.00 0.00 ? 22 GLN A NE2  4  
ATOM 3006  H H    . GLN A 1 22 ? -10.132 -3.241  -2.215  1.00 0.00 ? 22 GLN A H    4  
ATOM 3007  H HA   . GLN A 1 22 ? -11.608 -4.828  -2.553  1.00 0.00 ? 22 GLN A HA   4  
ATOM 3008  H HB2  . GLN A 1 22 ? -10.489 -6.190  -0.042  1.00 0.00 ? 22 GLN A HB2  4  
ATOM 3009  H HB3  . GLN A 1 22 ? -11.518 -7.003  -1.181  1.00 0.00 ? 22 GLN A HB3  4  
ATOM 3010  H HG2  . GLN A 1 22 ? -9.893  -7.434  -2.741  1.00 0.00 ? 22 GLN A HG2  4  
ATOM 3011  H HG3  . GLN A 1 22 ? -8.998  -5.886  -2.348  1.00 0.00 ? 22 GLN A HG3  4  
ATOM 3012  H HE21 . GLN A 1 22 ? -8.688  -9.223  -2.193  1.00 0.00 ? 22 GLN A HE21 4  
ATOM 3013  H HE22 . GLN A 1 22 ? -7.690  -9.223  -0.756  1.00 0.00 ? 22 GLN A HE22 4  
ATOM 3014  N N    . GLY A 1 23 ? -12.839 -3.390  -0.214  1.00 0.00 ? 23 GLY A N    4  
ATOM 3015  C CA   . GLY A 1 23 ? -13.989 -3.130  0.653   1.00 0.00 ? 23 GLY A CA   4  
ATOM 3016  C C    . GLY A 1 23 ? -13.685 -3.369  2.152   1.00 0.00 ? 23 GLY A C    4  
ATOM 3017  O O    . GLY A 1 23 ? -14.570 -3.270  2.991   1.00 0.00 ? 23 GLY A O    4  
ATOM 3018  H H    . GLY A 1 23 ? -12.207 -2.672  -0.504  1.00 0.00 ? 23 GLY A H    4  
ATOM 3019  H HA2  . GLY A 1 23 ? -14.270 -2.086  0.496   1.00 0.00 ? 23 GLY A HA2  4  
ATOM 3020  H HA3  . GLY A 1 23 ? -14.823 -3.772  0.346   1.00 0.00 ? 23 GLY A HA3  4  
ATOM 3021  N N    . THR A 1 24 ? -12.404 -3.663  2.453   1.00 0.00 ? 24 THR A N    4  
ATOM 3022  C CA   . THR A 1 24 ? -11.930 -3.902  3.813   1.00 0.00 ? 24 THR A CA   4  
ATOM 3023  C C    . THR A 1 24 ? -10.849 -2.859  4.170   1.00 0.00 ? 24 THR A C    4  
ATOM 3024  O O    . THR A 1 24 ? -10.160 -2.326  3.311   1.00 0.00 ? 24 THR A O    4  
ATOM 3025  C CB   . THR A 1 24 ? -11.383 -5.344  3.864   1.00 0.00 ? 24 THR A CB   4  
ATOM 3026  O OG1  . THR A 1 24 ? -12.295 -6.239  3.259   1.00 0.00 ? 24 THR A OG1  4  
ATOM 3027  C CG2  . THR A 1 24 ? -11.045 -5.824  5.283   1.00 0.00 ? 24 THR A CG2  4  
ATOM 3028  H H    . THR A 1 24 ? -11.709 -3.745  1.738   1.00 0.00 ? 24 THR A H    4  
ATOM 3029  H HA   . THR A 1 24 ? -12.767 -3.774  4.503   1.00 0.00 ? 24 THR A HA   4  
ATOM 3030  H HB   . THR A 1 24 ? -10.475 -5.397  3.260   1.00 0.00 ? 24 THR A HB   4  
ATOM 3031  H HG1  . THR A 1 24 ? -13.157 -6.135  3.646   1.00 0.00 ? 24 THR A HG1  4  
ATOM 3032  H HG21 . THR A 1 24 ? -11.898 -5.739  5.956   1.00 0.00 ? 24 THR A HG21 4  
ATOM 3033  H HG22 . THR A 1 24 ? -10.222 -5.250  5.712   1.00 0.00 ? 24 THR A HG22 4  
ATOM 3034  H HG23 . THR A 1 24 ? -10.733 -6.869  5.268   1.00 0.00 ? 24 THR A HG23 4  
ATOM 3035  N N    . SER A 1 25 ? -10.758 -2.584  5.483   1.00 0.00 ? 25 SER A N    4  
ATOM 3036  C CA   . SER A 1 25 ? -9.816  -1.613  6.025   1.00 0.00 ? 25 SER A CA   4  
ATOM 3037  C C    . SER A 1 25 ? -8.485  -2.299  6.376   1.00 0.00 ? 25 SER A C    4  
ATOM 3038  O O    . SER A 1 25 ? -8.482  -3.300  7.084   1.00 0.00 ? 25 SER A O    4  
ATOM 3039  C CB   . SER A 1 25 ? -10.453 -1.139  7.335   1.00 0.00 ? 25 SER A CB   4  
ATOM 3040  O OG   . SER A 1 25 ? -10.885 -2.270  8.076   1.00 0.00 ? 25 SER A OG   4  
ATOM 3041  H H    . SER A 1 25 ? -11.333 -3.036  6.168   1.00 0.00 ? 25 SER A H    4  
ATOM 3042  H HA   . SER A 1 25 ? -9.672  -0.799  5.312   1.00 0.00 ? 25 SER A HA   4  
ATOM 3043  H HB2  . SER A 1 25 ? -9.776  -0.519  7.935   1.00 0.00 ? 25 SER A HB2  4  
ATOM 3044  H HB3  . SER A 1 25 ? -11.333 -0.528  7.126   1.00 0.00 ? 25 SER A HB3  4  
ATOM 3045  H HG   . SER A 1 25 ? -10.143 -2.873  8.187   1.00 0.00 ? 25 SER A HG   4  
ATOM 3046  N N    . TYR A 1 26 ? -7.389  -1.696  5.881   1.00 0.00 ? 26 TYR A N    4  
ATOM 3047  C CA   . TYR A 1 26 ? -6.030  -2.170  6.119   1.00 0.00 ? 26 TYR A CA   4  
ATOM 3048  C C    . TYR A 1 26 ? -5.241  -1.067  6.836   1.00 0.00 ? 26 TYR A C    4  
ATOM 3049  O O    . TYR A 1 26 ? -5.259  0.090   6.440   1.00 0.00 ? 26 TYR A O    4  
ATOM 3050  C CB   . TYR A 1 26 ? -5.317  -2.445  4.788   1.00 0.00 ? 26 TYR A CB   4  
ATOM 3051  C CG   . TYR A 1 26 ? -5.883  -3.633  4.067   1.00 0.00 ? 26 TYR A CG   4  
ATOM 3052  C CD1  . TYR A 1 26 ? -7.096  -3.551  3.393   1.00 0.00 ? 26 TYR A CD1  4  
ATOM 3053  C CD2  . TYR A 1 26 ? -5.198  -4.842  4.069   1.00 0.00 ? 26 TYR A CD2  4  
ATOM 3054  C CE1  . TYR A 1 26 ? -7.637  -4.676  2.791   1.00 0.00 ? 26 TYR A CE1  4  
ATOM 3055  C CE2  . TYR A 1 26 ? -5.747  -5.958  3.459   1.00 0.00 ? 26 TYR A CE2  4  
ATOM 3056  C CZ   . TYR A 1 26 ? -6.990  -5.893  2.869   1.00 0.00 ? 26 TYR A CZ   4  
ATOM 3057  O OH   . TYR A 1 26 ? -7.589  -7.041  2.405   1.00 0.00 ? 26 TYR A OH   4  
ATOM 3058  H H    . TYR A 1 26 ? -7.472  -0.876  5.311   1.00 0.00 ? 26 TYR A H    4  
ATOM 3059  H HA   . TYR A 1 26 ? -6.052  -3.064  6.747   1.00 0.00 ? 26 TYR A HA   4  
ATOM 3060  H HB2  . TYR A 1 26 ? -5.386  -1.571  4.134   1.00 0.00 ? 26 TYR A HB2  4  
ATOM 3061  H HB3  . TYR A 1 26 ? -4.262  -2.656  4.993   1.00 0.00 ? 26 TYR A HB3  4  
ATOM 3062  H HD1  . TYR A 1 26 ? -7.628  -2.613  3.330   1.00 0.00 ? 26 TYR A HD1  4  
ATOM 3063  H HD2  . TYR A 1 26 ? -4.237  -4.923  4.549   1.00 0.00 ? 26 TYR A HD2  4  
ATOM 3064  H HE1  . TYR A 1 26 ? -8.545  -4.600  2.226   1.00 0.00 ? 26 TYR A HE1  4  
ATOM 3065  H HE2  . TYR A 1 26 ? -5.219  -6.887  3.402   1.00 0.00 ? 26 TYR A HE2  4  
ATOM 3066  H HH   . TYR A 1 26 ? -7.204  -7.317  1.564   1.00 0.00 ? 26 TYR A HH   4  
ATOM 3067  N N    . ASP A 1 27 ? -4.540  -1.509  7.889   1.00 0.00 ? 27 ASP A N    4  
ATOM 3068  C CA   . ASP A 1 27 ? -3.710  -0.658  8.739   1.00 0.00 ? 27 ASP A CA   4  
ATOM 3069  C C    . ASP A 1 27 ? -2.223  -1.054  8.659   1.00 0.00 ? 27 ASP A C    4  
ATOM 3070  O O    . ASP A 1 27 ? -1.385  -0.517  9.372   1.00 0.00 ? 27 ASP A O    4  
ATOM 3071  C CB   . ASP A 1 27 ? -4.201  -0.841  10.190  1.00 0.00 ? 27 ASP A CB   4  
ATOM 3072  C CG   . ASP A 1 27 ? -4.032  -2.282  10.736  1.00 0.00 ? 27 ASP A CG   4  
ATOM 3073  O OD1  . ASP A 1 27 ? -3.851  -3.215  9.947   1.00 0.00 ? 27 ASP A OD1  4  
ATOM 3074  O OD2  . ASP A 1 27 ? -4.080  -2.453  11.951  1.00 0.00 ? 27 ASP A OD2  4  
ATOM 3075  H H    . ASP A 1 27 ? -4.587  -2.466  8.187   1.00 0.00 ? 27 ASP A H    4  
ATOM 3076  H HA   . ASP A 1 27 ? -3.803  0.383   8.426   1.00 0.00 ? 27 ASP A HA   4  
ATOM 3077  H HB2  . ASP A 1 27 ? -3.660  -0.162  10.851  1.00 0.00 ? 27 ASP A HB2  4  
ATOM 3078  H HB3  . ASP A 1 27 ? -5.255  -0.573  10.265  1.00 0.00 ? 27 ASP A HB3  4  
ATOM 3079  N N    . SER A 1 28 ? -1.944  -2.045  7.791   1.00 0.00 ? 28 SER A N    4  
ATOM 3080  C CA   . SER A 1 28 ? -0.597  -2.580  7.732   1.00 0.00 ? 28 SER A CA   4  
ATOM 3081  C C    . SER A 1 28 ? -0.412  -3.284  6.373   1.00 0.00 ? 28 SER A C    4  
ATOM 3082  O O    . SER A 1 28 ? -1.353  -3.451  5.604   1.00 0.00 ? 28 SER A O    4  
ATOM 3083  C CB   . SER A 1 28 ? -0.450  -3.536  8.949   1.00 0.00 ? 28 SER A CB   4  
ATOM 3084  O OG   . SER A 1 28 ? -1.522  -4.468  8.962   1.00 0.00 ? 28 SER A OG   4  
ATOM 3085  H H    . SER A 1 28 ? -2.626  -2.477  7.203   1.00 0.00 ? 28 SER A H    4  
ATOM 3086  H HA   . SER A 1 28 ? 0.118   -1.749  7.743   1.00 0.00 ? 28 SER A HA   4  
ATOM 3087  H HB2  . SER A 1 28 ? 0.477   -4.135  8.885   1.00 0.00 ? 28 SER A HB2  4  
ATOM 3088  H HB3  . SER A 1 28 ? -0.474  -2.961  9.907   1.00 0.00 ? 28 SER A HB3  4  
ATOM 3089  H HG   . SER A 1 28 ? -2.347  -4.043  9.227   1.00 0.00 ? 28 SER A HG   4  
ATOM 3090  N N    . CYS A 1 29 ? 0.862   -3.667  6.145   1.00 0.00 ? 29 CYS A N    4  
ATOM 3091  C CA   . CYS A 1 29 ? 1.319   -4.332  4.927   1.00 0.00 ? 29 CYS A CA   4  
ATOM 3092  C C    . CYS A 1 29 ? 0.471   -5.543  4.480   1.00 0.00 ? 29 CYS A C    4  
ATOM 3093  O O    . CYS A 1 29 ? 0.143   -6.398  5.291   1.00 0.00 ? 29 CYS A O    4  
ATOM 3094  C CB   . CYS A 1 29 ? 2.707   -4.898  5.231   1.00 0.00 ? 29 CYS A CB   4  
ATOM 3095  S SG   . CYS A 1 29 ? 3.844   -3.718  5.989   1.00 0.00 ? 29 CYS A SG   4  
ATOM 3096  H H    . CYS A 1 29 ? 1.574   -3.421  6.805   1.00 0.00 ? 29 CYS A H    4  
ATOM 3097  H HA   . CYS A 1 29 ? 1.393   -3.570  4.162   1.00 0.00 ? 29 CYS A HA   4  
ATOM 3098  H HB2  . CYS A 1 29 ? 2.625   -5.755  5.910   1.00 0.00 ? 29 CYS A HB2  4  
ATOM 3099  H HB3  . CYS A 1 29 ? 3.148   -5.245  4.293   1.00 0.00 ? 29 CYS A HB3  4  
ATOM 3100  N N    . THR A 1 30 ? 0.205   -5.613  3.152   1.00 0.00 ? 30 THR A N    4  
ATOM 3101  C CA   . THR A 1 30 ? -0.437  -6.801  2.593   1.00 0.00 ? 30 THR A CA   4  
ATOM 3102  C C    . THR A 1 30 ? 0.449   -7.304  1.447   1.00 0.00 ? 30 THR A C    4  
ATOM 3103  O O    . THR A 1 30 ? 1.323   -6.602  0.956   1.00 0.00 ? 30 THR A O    4  
ATOM 3104  C CB   . THR A 1 30 ? -1.886  -6.534  2.137   1.00 0.00 ? 30 THR A CB   4  
ATOM 3105  O OG1  . THR A 1 30 ? -2.432  -7.778  1.723   1.00 0.00 ? 30 THR A OG1  4  
ATOM 3106  C CG2  . THR A 1 30 ? -1.985  -5.525  0.973   1.00 0.00 ? 30 THR A CG2  4  
ATOM 3107  H H    . THR A 1 30 ? 0.477   -4.918  2.475   1.00 0.00 ? 30 THR A H    4  
ATOM 3108  H HA   . THR A 1 30 ? -0.448  -7.585  3.353   1.00 0.00 ? 30 THR A HA   4  
ATOM 3109  H HB   . THR A 1 30 ? -2.429  -6.172  3.024   1.00 0.00 ? 30 THR A HB   4  
ATOM 3110  H HG1  . THR A 1 30 ? -3.379  -7.687  1.553   1.00 0.00 ? 30 THR A HG1  4  
ATOM 3111  H HG21 . THR A 1 30 ? -1.516  -5.922  0.071   1.00 0.00 ? 30 THR A HG21 4  
ATOM 3112  H HG22 . THR A 1 30 ? -1.488  -4.583  1.206   1.00 0.00 ? 30 THR A HG22 4  
ATOM 3113  H HG23 . THR A 1 30 ? -3.021  -5.293  0.715   1.00 0.00 ? 30 THR A HG23 4  
ATOM 3114  N N    . THR A 1 31 ? 0.153   -8.554  1.052   1.00 0.00 ? 31 THR A N    4  
ATOM 3115  C CA   . THR A 1 31 ? 0.841   -9.180  -0.075  1.00 0.00 ? 31 THR A CA   4  
ATOM 3116  C C    . THR A 1 31 ? -0.179  -9.658  -1.128  1.00 0.00 ? 31 THR A C    4  
ATOM 3117  O O    . THR A 1 31 ? 0.160   -10.338 -2.089  1.00 0.00 ? 31 THR A O    4  
ATOM 3118  C CB   . THR A 1 31 ? 1.755   -10.316 0.435   1.00 0.00 ? 31 THR A CB   4  
ATOM 3119  O OG1  . THR A 1 31 ? 2.157   -10.075 1.773   1.00 0.00 ? 31 THR A OG1  4  
ATOM 3120  C CG2  . THR A 1 31 ? 3.040   -10.412 -0.387  1.00 0.00 ? 31 THR A CG2  4  
ATOM 3121  H H    . THR A 1 31 ? -0.586  -8.998  1.559   1.00 0.00 ? 31 THR A H    4  
ATOM 3122  H HA   . THR A 1 31 ? 1.440   -8.417  -0.573  1.00 0.00 ? 31 THR A HA   4  
ATOM 3123  H HB   . THR A 1 31 ? 1.255   -11.291 0.379   1.00 0.00 ? 31 THR A HB   4  
ATOM 3124  H HG1  . THR A 1 31 ? 1.392   -9.947  2.322   1.00 0.00 ? 31 THR A HG1  4  
ATOM 3125  H HG21 . THR A 1 31 ? 3.602   -9.482  -0.331  1.00 0.00 ? 31 THR A HG21 4  
ATOM 3126  H HG22 . THR A 1 31 ? 2.824   -10.612 -1.436  1.00 0.00 ? 31 THR A HG22 4  
ATOM 3127  H HG23 . THR A 1 31 ? 3.683   -11.206 -0.011  1.00 0.00 ? 31 THR A HG23 4  
ATOM 3128  N N    . GLU A 1 32 ? -1.452  -9.266  -0.908  1.00 0.00 ? 32 GLU A N    4  
ATOM 3129  C CA   . GLU A 1 32 ? -2.516  -9.652  -1.824  1.00 0.00 ? 32 GLU A CA   4  
ATOM 3130  C C    . GLU A 1 32 ? -2.239  -9.117  -3.240  1.00 0.00 ? 32 GLU A C    4  
ATOM 3131  O O    . GLU A 1 32 ? -2.294  -7.921  -3.489  1.00 0.00 ? 32 GLU A O    4  
ATOM 3132  C CB   . GLU A 1 32 ? -3.822  -9.062  -1.279  1.00 0.00 ? 32 GLU A CB   4  
ATOM 3133  C CG   . GLU A 1 32 ? -4.320  -9.817  -0.038  1.00 0.00 ? 32 GLU A CG   4  
ATOM 3134  C CD   . GLU A 1 32 ? -5.419  -9.008  0.658   1.00 0.00 ? 32 GLU A CD   4  
ATOM 3135  O OE1  . GLU A 1 32 ? -5.147  -7.876  1.056   1.00 0.00 ? 32 GLU A OE1  4  
ATOM 3136  O OE2  . GLU A 1 32 ? -6.531  -9.509  0.785   1.00 0.00 ? 32 GLU A OE2  4  
ATOM 3137  H H    . GLU A 1 32 ? -1.737  -8.699  -0.132  1.00 0.00 ? 32 GLU A H    4  
ATOM 3138  H HA   . GLU A 1 32 ? -2.559  -10.742 -1.837  1.00 0.00 ? 32 GLU A HA   4  
ATOM 3139  H HB2  . GLU A 1 32 ? -3.656  -8.008  -1.043  1.00 0.00 ? 32 GLU A HB2  4  
ATOM 3140  H HB3  . GLU A 1 32 ? -4.615  -9.073  -2.028  1.00 0.00 ? 32 GLU A HB3  4  
ATOM 3141  H HG2  . GLU A 1 32 ? -4.712  -10.793 -0.327  1.00 0.00 ? 32 GLU A HG2  4  
ATOM 3142  H HG3  . GLU A 1 32 ? -3.518  -10.009 0.674   1.00 0.00 ? 32 GLU A HG3  4  
ATOM 3143  N N    . GLY A 1 33 ? -1.953  -10.075 -4.142  1.00 0.00 ? 33 GLY A N    4  
ATOM 3144  C CA   . GLY A 1 33 ? -1.718  -9.737  -5.542  1.00 0.00 ? 33 GLY A CA   4  
ATOM 3145  C C    . GLY A 1 33 ? -0.240  -9.786  -5.951  1.00 0.00 ? 33 GLY A C    4  
ATOM 3146  O O    . GLY A 1 33 ? 0.061   -9.685  -7.133  1.00 0.00 ? 33 GLY A O    4  
ATOM 3147  H H    . GLY A 1 33 ? -1.909  -11.025 -3.835  1.00 0.00 ? 33 GLY A H    4  
ATOM 3148  H HA2  . GLY A 1 33 ? -2.265  -10.479 -6.130  1.00 0.00 ? 33 GLY A HA2  4  
ATOM 3149  H HA3  . GLY A 1 33 ? -2.119  -8.741  -5.759  1.00 0.00 ? 33 GLY A HA3  4  
ATOM 3150  N N    . ARG A 1 34 ? 0.664   -9.952  -4.961  1.00 0.00 ? 34 ARG A N    4  
ATOM 3151  C CA   . ARG A 1 34 ? 2.091   -10.018 -5.347  1.00 0.00 ? 34 ARG A CA   4  
ATOM 3152  C C    . ARG A 1 34 ? 2.664   -11.392 -4.989  1.00 0.00 ? 34 ARG A C    4  
ATOM 3153  O O    . ARG A 1 34 ? 2.648   -11.832 -3.848  1.00 0.00 ? 34 ARG A O    4  
ATOM 3154  C CB   . ARG A 1 34 ? 2.907   -8.951  -4.611  1.00 0.00 ? 34 ARG A CB   4  
ATOM 3155  C CG   . ARG A 1 34 ? 2.488   -7.531  -5.016  1.00 0.00 ? 34 ARG A CG   4  
ATOM 3156  C CD   . ARG A 1 34 ? 3.587   -6.489  -4.714  1.00 0.00 ? 34 ARG A CD   4  
ATOM 3157  N NE   . ARG A 1 34 ? 4.575   -6.507  -5.807  1.00 0.00 ? 34 ARG A NE   4  
ATOM 3158  C CZ   . ARG A 1 34 ? 4.605   -5.574  -6.789  1.00 0.00 ? 34 ARG A CZ   4  
ATOM 3159  N NH1  . ARG A 1 34 ? 3.719   -4.584  -6.809  1.00 0.00 ? 34 ARG A NH1  4  
ATOM 3160  N NH2  . ARG A 1 34 ? 5.525   -5.658  -7.741  1.00 0.00 ? 34 ARG A NH2  4  
ATOM 3161  H H    . ARG A 1 34 ? 0.349   -10.035 -3.996  1.00 0.00 ? 34 ARG A H    4  
ATOM 3162  H HA   . ARG A 1 34 ? 2.249   -9.861  -6.436  1.00 0.00 ? 34 ARG A HA   4  
ATOM 3163  H HB2  . ARG A 1 34 ? 2.762   -9.072  -3.510  1.00 0.00 ? 34 ARG A HB2  4  
ATOM 3164  H HB3  . ARG A 1 34 ? 3.959   -9.103  -4.940  1.00 0.00 ? 34 ARG A HB3  4  
ATOM 3165  H HG2  . ARG A 1 34 ? 2.266   -7.500  -6.084  1.00 0.00 ? 34 ARG A HG2  4  
ATOM 3166  H HG3  . ARG A 1 34 ? 1.536   -7.303  -4.531  1.00 0.00 ? 34 ARG A HG3  4  
ATOM 3167  H HD2  . ARG A 1 34 ? 3.171   -5.478  -4.615  1.00 0.00 ? 34 ARG A HD2  4  
ATOM 3168  H HD3  . ARG A 1 34 ? 4.131   -6.705  -3.783  1.00 0.00 ? 34 ARG A HD3  4  
ATOM 3169  H HE   . ARG A 1 34 ? 5.247   -7.266  -5.880  1.00 0.00 ? 34 ARG A HE   4  
ATOM 3170  H HH11 . ARG A 1 34 ? 2.998   -4.570  -6.121  1.00 0.00 ? 34 ARG A HH11 4  
ATOM 3171  H HH12 . ARG A 1 34 ? 3.733   -3.830  -7.484  1.00 0.00 ? 34 ARG A HH12 4  
ATOM 3172  H HH21 . ARG A 1 34 ? 6.158   -6.446  -7.715  1.00 0.00 ? 34 ARG A HH21 4  
ATOM 3173  H HH22 . ARG A 1 34 ? 5.606   -4.988  -8.475  1.00 0.00 ? 34 ARG A HH22 4  
ATOM 3174  N N    . THR A 1 35 ? 3.214   -12.010 -6.045  1.00 0.00 ? 35 THR A N    4  
ATOM 3175  C CA   . THR A 1 35 ? 3.859   -13.307 -5.956  1.00 0.00 ? 35 THR A CA   4  
ATOM 3176  C C    . THR A 1 35 ? 5.367   -13.153 -6.235  1.00 0.00 ? 35 THR A C    4  
ATOM 3177  O O    . THR A 1 35 ? 6.054   -14.117 -6.545  1.00 0.00 ? 35 THR A O    4  
ATOM 3178  C CB   . THR A 1 35 ? 3.186   -14.193 -7.014  1.00 0.00 ? 35 THR A CB   4  
ATOM 3179  O OG1  . THR A 1 35 ? 3.035   -13.392 -8.179  1.00 0.00 ? 35 THR A OG1  4  
ATOM 3180  C CG2  . THR A 1 35 ? 1.811   -14.681 -6.530  1.00 0.00 ? 35 THR A CG2  4  
ATOM 3181  H H    . THR A 1 35 ? 3.171   -11.637 -6.974  1.00 0.00 ? 35 THR A H    4  
ATOM 3182  H HA   . THR A 1 35 ? 3.736   -13.719 -4.953  1.00 0.00 ? 35 THR A HA   4  
ATOM 3183  H HB   . THR A 1 35 ? 3.827   -15.059 -7.221  1.00 0.00 ? 35 THR A HB   4  
ATOM 3184  H HG1  . THR A 1 35 ? 2.646   -13.900 -8.885  1.00 0.00 ? 35 THR A HG1  4  
ATOM 3185  H HG21 . THR A 1 35 ? 1.346   -15.364 -7.241  1.00 0.00 ? 35 THR A HG21 4  
ATOM 3186  H HG22 . THR A 1 35 ? 1.128   -13.846 -6.371  1.00 0.00 ? 35 THR A HG22 4  
ATOM 3187  H HG23 . THR A 1 35 ? 1.901   -15.215 -5.583  1.00 0.00 ? 35 THR A HG23 4  
ATOM 3188  N N    . ASP A 1 36 ? 5.840   -11.894 -6.089  1.00 0.00 ? 36 ASP A N    4  
ATOM 3189  C CA   . ASP A 1 36 ? 7.243   -11.566 -6.340  1.00 0.00 ? 36 ASP A CA   4  
ATOM 3190  C C    . ASP A 1 36 ? 8.037   -11.406 -5.027  1.00 0.00 ? 36 ASP A C    4  
ATOM 3191  O O    . ASP A 1 36 ? 9.240   -11.173 -5.042  1.00 0.00 ? 36 ASP A O    4  
ATOM 3192  C CB   . ASP A 1 36 ? 7.325   -10.292 -7.204  1.00 0.00 ? 36 ASP A CB   4  
ATOM 3193  C CG   . ASP A 1 36 ? 6.736   -9.024  -6.560  1.00 0.00 ? 36 ASP A CG   4  
ATOM 3194  O OD1  . ASP A 1 36 ? 6.298   -9.055  -5.413  1.00 0.00 ? 36 ASP A OD1  4  
ATOM 3195  O OD2  . ASP A 1 36 ? 6.718   -7.989  -7.218  1.00 0.00 ? 36 ASP A OD2  4  
ATOM 3196  H H    . ASP A 1 36 ? 5.247   -11.123 -5.852  1.00 0.00 ? 36 ASP A H    4  
ATOM 3197  H HA   . ASP A 1 36 ? 7.699   -12.389 -6.893  1.00 0.00 ? 36 ASP A HA   4  
ATOM 3198  H HB2  . ASP A 1 36 ? 8.366   -10.085 -7.455  1.00 0.00 ? 36 ASP A HB2  4  
ATOM 3199  H HB3  . ASP A 1 36 ? 6.805   -10.460 -8.147  1.00 0.00 ? 36 ASP A HB3  4  
ATOM 3200  N N    . GLY A 1 37 ? 7.314   -11.585 -3.898  1.00 0.00 ? 37 GLY A N    4  
ATOM 3201  C CA   . GLY A 1 37 ? 7.955   -11.556 -2.589  1.00 0.00 ? 37 GLY A CA   4  
ATOM 3202  C C    . GLY A 1 37 ? 7.730   -10.263 -1.808  1.00 0.00 ? 37 GLY A C    4  
ATOM 3203  O O    . GLY A 1 37 ? 7.941   -10.239 -0.604  1.00 0.00 ? 37 GLY A O    4  
ATOM 3204  H H    . GLY A 1 37 ? 6.334   -11.759 -3.951  1.00 0.00 ? 37 GLY A H    4  
ATOM 3205  H HA2  . GLY A 1 37 ? 7.549   -12.396 -2.021  1.00 0.00 ? 37 GLY A HA2  4  
ATOM 3206  H HA3  . GLY A 1 37 ? 9.036   -11.682 -2.710  1.00 0.00 ? 37 GLY A HA3  4  
ATOM 3207  N N    . TYR A 1 38 ? 7.338   -9.193  -2.525  1.00 0.00 ? 38 TYR A N    4  
ATOM 3208  C CA   . TYR A 1 38 ? 7.229   -7.896  -1.852  1.00 0.00 ? 38 TYR A CA   4  
ATOM 3209  C C    . TYR A 1 38 ? 5.803   -7.641  -1.359  1.00 0.00 ? 38 TYR A C    4  
ATOM 3210  O O    . TYR A 1 38 ? 4.818   -8.030  -1.975  1.00 0.00 ? 38 TYR A O    4  
ATOM 3211  C CB   . TYR A 1 38 ? 7.750   -6.793  -2.787  1.00 0.00 ? 38 TYR A CB   4  
ATOM 3212  C CG   . TYR A 1 38 ? 9.060   -7.238  -3.378  1.00 0.00 ? 38 TYR A CG   4  
ATOM 3213  C CD1  . TYR A 1 38 ? 10.161  -7.487  -2.574  1.00 0.00 ? 38 TYR A CD1  4  
ATOM 3214  C CD2  . TYR A 1 38 ? 9.188   -7.483  -4.733  1.00 0.00 ? 38 TYR A CD2  4  
ATOM 3215  C CE1  . TYR A 1 38 ? 11.323  -8.006  -3.099  1.00 0.00 ? 38 TYR A CE1  4  
ATOM 3216  C CE2  . TYR A 1 38 ? 10.346  -8.007  -5.261  1.00 0.00 ? 38 TYR A CE2  4  
ATOM 3217  C CZ   . TYR A 1 38 ? 11.429  -8.284  -4.447  1.00 0.00 ? 38 TYR A CZ   4  
ATOM 3218  O OH   . TYR A 1 38 ? 12.588  -8.832  -4.953  1.00 0.00 ? 38 TYR A OH   4  
ATOM 3219  H H    . TYR A 1 38 ? 7.153   -9.258  -3.510  1.00 0.00 ? 38 TYR A H    4  
ATOM 3220  H HA   . TYR A 1 38 ? 7.882   -7.919  -0.976  1.00 0.00 ? 38 TYR A HA   4  
ATOM 3221  H HB2  . TYR A 1 38 ? 7.033   -6.588  -3.584  1.00 0.00 ? 38 TYR A HB2  4  
ATOM 3222  H HB3  . TYR A 1 38 ? 7.890   -5.860  -2.239  1.00 0.00 ? 38 TYR A HB3  4  
ATOM 3223  H HD1  . TYR A 1 38 ? 10.152  -7.317  -1.522  1.00 0.00 ? 38 TYR A HD1  4  
ATOM 3224  H HD2  . TYR A 1 38 ? 8.399   -7.303  -5.425  1.00 0.00 ? 38 TYR A HD2  4  
ATOM 3225  H HE1  . TYR A 1 38 ? 12.113  -8.200  -2.412  1.00 0.00 ? 38 TYR A HE1  4  
ATOM 3226  H HE2  . TYR A 1 38 ? 10.325  -8.191  -6.310  1.00 0.00 ? 38 TYR A HE2  4  
ATOM 3227  H HH   . TYR A 1 38 ? 12.367  -9.529  -5.557  1.00 0.00 ? 38 TYR A HH   4  
ATOM 3228  N N    . ARG A 1 39 ? 5.773   -6.963  -0.203  1.00 0.00 ? 39 ARG A N    4  
ATOM 3229  C CA   . ARG A 1 39 ? 4.486   -6.608  0.427   1.00 0.00 ? 39 ARG A CA   4  
ATOM 3230  C C    . ARG A 1 39 ? 4.241   -5.129  0.082   1.00 0.00 ? 39 ARG A C    4  
ATOM 3231  O O    . ARG A 1 39 ? 5.164   -4.323  0.125   1.00 0.00 ? 39 ARG A O    4  
ATOM 3232  C CB   . ARG A 1 39 ? 4.655   -6.831  1.940   1.00 0.00 ? 39 ARG A CB   4  
ATOM 3233  C CG   . ARG A 1 39 ? 5.104   -8.260  2.296   1.00 0.00 ? 39 ARG A CG   4  
ATOM 3234  C CD   . ARG A 1 39 ? 5.112   -8.566  3.818   1.00 0.00 ? 39 ARG A CD   4  
ATOM 3235  N NE   . ARG A 1 39 ? 5.084   -7.380  4.682   1.00 0.00 ? 39 ARG A NE   4  
ATOM 3236  C CZ   . ARG A 1 39 ? 6.157   -6.576  4.862   1.00 0.00 ? 39 ARG A CZ   4  
ATOM 3237  N NH1  . ARG A 1 39 ? 7.296   -6.786  4.227   1.00 0.00 ? 39 ARG A NH1  4  
ATOM 3238  N NH2  . ARG A 1 39 ? 6.099   -5.536  5.685   1.00 0.00 ? 39 ARG A NH2  4  
ATOM 3239  H H    . ARG A 1 39 ? 6.690   -6.708  0.177   1.00 0.00 ? 39 ARG A H    4  
ATOM 3240  H HA   . ARG A 1 39 ? 3.632   -7.211  0.044   1.00 0.00 ? 39 ARG A HA   4  
ATOM 3241  H HB2  . ARG A 1 39 ? 5.390   -6.115  2.310   1.00 0.00 ? 39 ARG A HB2  4  
ATOM 3242  H HB3  . ARG A 1 39 ? 3.726   -6.622  2.462   1.00 0.00 ? 39 ARG A HB3  4  
ATOM 3243  H HG2  . ARG A 1 39 ? 4.420   -8.959  1.794   1.00 0.00 ? 39 ARG A HG2  4  
ATOM 3244  H HG3  . ARG A 1 39 ? 6.106   -8.445  1.877   1.00 0.00 ? 39 ARG A HG3  4  
ATOM 3245  H HD2  . ARG A 1 39 ? 4.221   -9.131  4.097   1.00 0.00 ? 39 ARG A HD2  4  
ATOM 3246  H HD3  . ARG A 1 39 ? 5.974   -9.174  4.110   1.00 0.00 ? 39 ARG A HD3  4  
ATOM 3247  H HE   . ARG A 1 39 ? 4.245   -7.219  5.207   1.00 0.00 ? 39 ARG A HE   4  
ATOM 3248  H HH11 . ARG A 1 39 ? 7.448   -7.521  3.546   1.00 0.00 ? 39 ARG A HH11 4  
ATOM 3249  H HH12 . ARG A 1 39 ? 8.072   -6.175  4.413   1.00 0.00 ? 39 ARG A HH12 4  
ATOM 3250  H HH21 . ARG A 1 39 ? 5.262   -5.243  6.151   1.00 0.00 ? 39 ARG A HH21 4  
ATOM 3251  H HH22 . ARG A 1 39 ? 6.952   -5.015  5.831   1.00 0.00 ? 39 ARG A HH22 4  
ATOM 3252  N N    . TRP A 1 40 ? 2.987   -4.812  -0.299  1.00 0.00 ? 40 TRP A N    4  
ATOM 3253  C CA   . TRP A 1 40 ? 2.632   -3.457  -0.705  1.00 0.00 ? 40 TRP A CA   4  
ATOM 3254  C C    . TRP A 1 40 ? 1.549   -2.913  0.238   1.00 0.00 ? 40 TRP A C    4  
ATOM 3255  O O    . TRP A 1 40 ? 0.906   -3.650  0.981   1.00 0.00 ? 40 TRP A O    4  
ATOM 3256  C CB   . TRP A 1 40 ? 2.141   -3.464  -2.168  1.00 0.00 ? 40 TRP A CB   4  
ATOM 3257  C CG   . TRP A 1 40 ? 0.831   -4.219  -2.321  1.00 0.00 ? 40 TRP A CG   4  
ATOM 3258  C CD1  . TRP A 1 40 ? 0.698   -5.597  -2.512  1.00 0.00 ? 40 TRP A CD1  4  
ATOM 3259  C CD2  . TRP A 1 40 ? -0.513  -3.681  -2.320  1.00 0.00 ? 40 TRP A CD2  4  
ATOM 3260  N NE1  . TRP A 1 40 ? -0.611  -5.910  -2.638  1.00 0.00 ? 40 TRP A NE1  4  
ATOM 3261  C CE2  . TRP A 1 40 ? -1.386  -4.771  -2.525  1.00 0.00 ? 40 TRP A CE2  4  
ATOM 3262  C CE3  . TRP A 1 40 ? -1.029  -2.422  -2.163  1.00 0.00 ? 40 TRP A CE3  4  
ATOM 3263  C CZ2  . TRP A 1 40 ? -2.735  -4.578  -2.564  1.00 0.00 ? 40 TRP A CZ2  4  
ATOM 3264  C CZ3  . TRP A 1 40 ? -2.415  -2.214  -2.196  1.00 0.00 ? 40 TRP A CZ3  4  
ATOM 3265  C CH2  . TRP A 1 40 ? -3.267  -3.301  -2.401  1.00 0.00 ? 40 TRP A CH2  4  
ATOM 3266  H H    . TRP A 1 40 ? 2.250   -5.492  -0.277  1.00 0.00 ? 40 TRP A H    4  
ATOM 3267  H HA   . TRP A 1 40 ? 3.526   -2.839  -0.625  1.00 0.00 ? 40 TRP A HA   4  
ATOM 3268  H HB2  . TRP A 1 40 ? 2.026   -2.451  -2.546  1.00 0.00 ? 40 TRP A HB2  4  
ATOM 3269  H HB3  . TRP A 1 40 ? 2.894   -3.904  -2.821  1.00 0.00 ? 40 TRP A HB3  4  
ATOM 3270  H HD1  . TRP A 1 40 ? 1.500   -6.314  -2.529  1.00 0.00 ? 40 TRP A HD1  4  
ATOM 3271  H HE1  . TRP A 1 40 ? -0.985  -6.802  -2.815  1.00 0.00 ? 40 TRP A HE1  4  
ATOM 3272  H HE3  . TRP A 1 40 ? -0.341  -1.606  -2.011  1.00 0.00 ? 40 TRP A HE3  4  
ATOM 3273  H HZ2  . TRP A 1 40 ? -3.379  -5.429  -2.727  1.00 0.00 ? 40 TRP A HZ2  4  
ATOM 3274  H HZ3  . TRP A 1 40 ? -2.847  -1.227  -2.066  1.00 0.00 ? 40 TRP A HZ3  4  
ATOM 3275  H HH2  . TRP A 1 40 ? -4.340  -3.171  -2.433  1.00 0.00 ? 40 TRP A HH2  4  
ATOM 3276  N N    . CYS A 1 41 ? 1.381   -1.582  0.156   1.00 0.00 ? 41 CYS A N    4  
ATOM 3277  C CA   . CYS A 1 41 ? 0.341   -0.908  0.909   1.00 0.00 ? 41 CYS A CA   4  
ATOM 3278  C C    . CYS A 1 41 ? -0.243  0.202   0.001   1.00 0.00 ? 41 CYS A C    4  
ATOM 3279  O O    . CYS A 1 41 ? 0.412   0.657   -0.931  1.00 0.00 ? 41 CYS A O    4  
ATOM 3280  C CB   . CYS A 1 41 ? 0.927   -0.527  2.268   1.00 0.00 ? 41 CYS A CB   4  
ATOM 3281  S SG   . CYS A 1 41 ? 2.472   0.414   2.170   1.00 0.00 ? 41 CYS A SG   4  
ATOM 3282  H H    . CYS A 1 41 ? 1.927   -0.983  -0.435  1.00 0.00 ? 41 CYS A H    4  
ATOM 3283  H HA   . CYS A 1 41 ? -0.470  -1.617  1.074   1.00 0.00 ? 41 CYS A HA   4  
ATOM 3284  H HB2  . CYS A 1 41 ? 0.145   0.024   2.846   1.00 0.00 ? 41 CYS A HB2  4  
ATOM 3285  H HB3  . CYS A 1 41 ? 1.263   -1.489  2.728   1.00 0.00 ? 41 CYS A HB3  4  
ATOM 3286  N N    . GLY A 1 42 ? -1.521  0.558   0.254   1.00 0.00 ? 42 GLY A N    4  
ATOM 3287  C CA   . GLY A 1 42 ? -2.213  1.520   -0.602  1.00 0.00 ? 42 GLY A CA   4  
ATOM 3288  C C    . GLY A 1 42 ? -1.927  2.979   -0.210  1.00 0.00 ? 42 GLY A C    4  
ATOM 3289  O O    . GLY A 1 42 ? -1.450  3.265   0.882   1.00 0.00 ? 42 GLY A O    4  
ATOM 3290  H H    . GLY A 1 42 ? -2.041  0.172   1.017   1.00 0.00 ? 42 GLY A H    4  
ATOM 3291  H HA2  . GLY A 1 42 ? -1.963  1.307   -1.642  1.00 0.00 ? 42 GLY A HA2  4  
ATOM 3292  H HA3  . GLY A 1 42 ? -3.281  1.340   -0.455  1.00 0.00 ? 42 GLY A HA3  4  
ATOM 3293  N N    . THR A 1 43 ? -2.302  3.882   -1.144  1.00 0.00 ? 43 THR A N    4  
ATOM 3294  C CA   . THR A 1 43 ? -2.252  5.321   -0.877  1.00 0.00 ? 43 THR A CA   4  
ATOM 3295  C C    . THR A 1 43 ? -3.704  5.815   -0.894  1.00 0.00 ? 43 THR A C    4  
ATOM 3296  O O    . THR A 1 43 ? -4.567  5.285   -1.586  1.00 0.00 ? 43 THR A O    4  
ATOM 3297  C CB   . THR A 1 43 ? -1.346  6.100   -1.859  1.00 0.00 ? 43 THR A CB   4  
ATOM 3298  O OG1  . THR A 1 43 ? -1.498  5.668   -3.193  1.00 0.00 ? 43 THR A OG1  4  
ATOM 3299  C CG2  . THR A 1 43 ? 0.133   6.107   -1.434  1.00 0.00 ? 43 THR A CG2  4  
ATOM 3300  H H    . THR A 1 43 ? -2.694  3.588   -2.018  1.00 0.00 ? 43 THR A H    4  
ATOM 3301  H HA   . THR A 1 43 ? -1.893  5.481   0.137   1.00 0.00 ? 43 THR A HA   4  
ATOM 3302  H HB   . THR A 1 43 ? -1.648  7.151   -1.850  1.00 0.00 ? 43 THR A HB   4  
ATOM 3303  H HG1  . THR A 1 43 ? -1.449  4.715   -3.226  1.00 0.00 ? 43 THR A HG1  4  
ATOM 3304  H HG21 . THR A 1 43 ? 0.236   6.500   -0.422  1.00 0.00 ? 43 THR A HG21 4  
ATOM 3305  H HG22 . THR A 1 43 ? 0.729   6.768   -2.063  1.00 0.00 ? 43 THR A HG22 4  
ATOM 3306  H HG23 . THR A 1 43 ? 0.593   5.121   -1.460  1.00 0.00 ? 43 THR A HG23 4  
ATOM 3307  N N    . THR A 1 44 ? -3.894  6.842   -0.044  1.00 0.00 ? 44 THR A N    4  
ATOM 3308  C CA   . THR A 1 44 ? -5.190  7.447   0.223   1.00 0.00 ? 44 THR A CA   4  
ATOM 3309  C C    . THR A 1 44 ? -6.024  6.484   1.086   1.00 0.00 ? 44 THR A C    4  
ATOM 3310  O O    . THR A 1 44 ? -5.633  5.360   1.377   1.00 0.00 ? 44 THR A O    4  
ATOM 3311  C CB   . THR A 1 44 ? -5.960  7.881   -1.047  1.00 0.00 ? 44 THR A CB   4  
ATOM 3312  O OG1  . THR A 1 44 ? -6.726  6.819   -1.572  1.00 0.00 ? 44 THR A OG1  4  
ATOM 3313  C CG2  . THR A 1 44 ? -5.081  8.553   -2.116  1.00 0.00 ? 44 THR A CG2  4  
ATOM 3314  H H    . THR A 1 44 ? -3.106  7.177   0.466   1.00 0.00 ? 44 THR A H    4  
ATOM 3315  H HA   . THR A 1 44 ? -4.958  8.326   0.825   1.00 0.00 ? 44 THR A HA   4  
ATOM 3316  H HB   . THR A 1 44 ? -6.692  8.630   -0.743  1.00 0.00 ? 44 THR A HB   4  
ATOM 3317  H HG1  . THR A 1 44 ? -6.130  6.145   -1.911  1.00 0.00 ? 44 THR A HG1  4  
ATOM 3318  H HG21 . THR A 1 44 ? -4.531  9.395   -1.695  1.00 0.00 ? 44 THR A HG21 4  
ATOM 3319  H HG22 . THR A 1 44 ? -5.697  8.938   -2.928  1.00 0.00 ? 44 THR A HG22 4  
ATOM 3320  H HG23 . THR A 1 44 ? -4.355  7.873   -2.562  1.00 0.00 ? 44 THR A HG23 4  
ATOM 3321  N N    . GLU A 1 45 ? -7.204  7.004   1.458   1.00 0.00 ? 45 GLU A N    4  
ATOM 3322  C CA   . GLU A 1 45 ? -8.156  6.218   2.216   1.00 0.00 ? 45 GLU A CA   4  
ATOM 3323  C C    . GLU A 1 45 ? -8.788  5.120   1.328   1.00 0.00 ? 45 GLU A C    4  
ATOM 3324  O O    . GLU A 1 45 ? -9.210  4.084   1.822   1.00 0.00 ? 45 GLU A O    4  
ATOM 3325  C CB   . GLU A 1 45 ? -9.215  7.187   2.772   1.00 0.00 ? 45 GLU A CB   4  
ATOM 3326  C CG   . GLU A 1 45 ? -10.264 6.484   3.638   1.00 0.00 ? 45 GLU A CG   4  
ATOM 3327  C CD   . GLU A 1 45 ? -11.262 7.505   4.201   1.00 0.00 ? 45 GLU A CD   4  
ATOM 3328  O OE1  . GLU A 1 45 ? -11.001 8.057   5.268   1.00 0.00 ? 45 GLU A OE1  4  
ATOM 3329  O OE2  . GLU A 1 45 ? -12.286 7.740   3.561   1.00 0.00 ? 45 GLU A OE2  4  
ATOM 3330  H H    . GLU A 1 45 ? -7.476  7.924   1.186   1.00 0.00 ? 45 GLU A H    4  
ATOM 3331  H HA   . GLU A 1 45 ? -7.614  5.738   3.034   1.00 0.00 ? 45 GLU A HA   4  
ATOM 3332  H HB2  . GLU A 1 45 ? -8.683  7.899   3.462   1.00 0.00 ? 45 GLU A HB2  4  
ATOM 3333  H HB3  . GLU A 1 45 ? -9.758  7.642   1.899   1.00 0.00 ? 45 GLU A HB3  4  
ATOM 3334  H HG2  . GLU A 1 45 ? -10.808 5.742   3.055   1.00 0.00 ? 45 GLU A HG2  4  
ATOM 3335  H HG3  . GLU A 1 45 ? -9.776  5.961   4.460   1.00 0.00 ? 45 GLU A HG3  4  
ATOM 3336  N N    . ASP A 1 46 ? -8.874  5.417   0.009   1.00 0.00 ? 46 ASP A N    4  
ATOM 3337  C CA   . ASP A 1 46 ? -9.567  4.511   -0.923  1.00 0.00 ? 46 ASP A CA   4  
ATOM 3338  C C    . ASP A 1 46 ? -8.603  4.020   -2.019  1.00 0.00 ? 46 ASP A C    4  
ATOM 3339  O O    . ASP A 1 46 ? -8.374  4.668   -3.034  1.00 0.00 ? 46 ASP A O    4  
ATOM 3340  C CB   . ASP A 1 46 ? -10.823 5.208   -1.501  1.00 0.00 ? 46 ASP A CB   4  
ATOM 3341  C CG   . ASP A 1 46 ? -11.786 4.184   -2.106  1.00 0.00 ? 46 ASP A CG   4  
ATOM 3342  O OD1  . ASP A 1 46 ? -11.401 3.457   -3.015  1.00 0.00 ? 46 ASP A OD1  4  
ATOM 3343  O OD2  . ASP A 1 46 ? -12.914 4.056   -1.634  1.00 0.00 ? 46 ASP A OD2  4  
ATOM 3344  H H    . ASP A 1 46 ? -8.429  6.255   -0.318  1.00 0.00 ? 46 ASP A H    4  
ATOM 3345  H HA   . ASP A 1 46 ? -9.900  3.647   -0.344  1.00 0.00 ? 46 ASP A HA   4  
ATOM 3346  H HB2  . ASP A 1 46 ? -11.344 5.722   -0.691  1.00 0.00 ? 46 ASP A HB2  4  
ATOM 3347  H HB3  . ASP A 1 46 ? -10.602 5.975   -2.245  1.00 0.00 ? 46 ASP A HB3  4  
ATOM 3348  N N    . TYR A 1 47 ? -8.044  2.823   -1.745  1.00 0.00 ? 47 TYR A N    4  
ATOM 3349  C CA   . TYR A 1 47 ? -7.088  2.267   -2.710  1.00 0.00 ? 47 TYR A CA   4  
ATOM 3350  C C    . TYR A 1 47 ? -7.798  1.807   -3.989  1.00 0.00 ? 47 TYR A C    4  
ATOM 3351  O O    . TYR A 1 47 ? -7.283  1.967   -5.088  1.00 0.00 ? 47 TYR A O    4  
ATOM 3352  C CB   . TYR A 1 47 ? -6.320  1.075   -2.102  1.00 0.00 ? 47 TYR A CB   4  
ATOM 3353  C CG   . TYR A 1 47 ? -5.429  0.438   -3.135  1.00 0.00 ? 47 TYR A CG   4  
ATOM 3354  C CD1  . TYR A 1 47 ? -4.233  1.031   -3.498  1.00 0.00 ? 47 TYR A CD1  4  
ATOM 3355  C CD2  . TYR A 1 47 ? -5.802  -0.741  -3.768  1.00 0.00 ? 47 TYR A CD2  4  
ATOM 3356  C CE1  . TYR A 1 47 ? -3.423  0.441   -4.450  1.00 0.00 ? 47 TYR A CE1  4  
ATOM 3357  C CE2  . TYR A 1 47 ? -4.980  -1.341  -4.708  1.00 0.00 ? 47 TYR A CE2  4  
ATOM 3358  C CZ   . TYR A 1 47 ? -3.778  -0.748  -5.053  1.00 0.00 ? 47 TYR A CZ   4  
ATOM 3359  O OH   . TYR A 1 47 ? -2.928  -1.313  -5.979  1.00 0.00 ? 47 TYR A OH   4  
ATOM 3360  H H    . TYR A 1 47 ? -8.331  2.338   -0.906  1.00 0.00 ? 47 TYR A H    4  
ATOM 3361  H HA   . TYR A 1 47 ? -6.379  3.052   -3.022  1.00 0.00 ? 47 TYR A HA   4  
ATOM 3362  H HB2  . TYR A 1 47 ? -5.713  1.414   -1.263  1.00 0.00 ? 47 TYR A HB2  4  
ATOM 3363  H HB3  . TYR A 1 47 ? -6.984  0.295   -1.715  1.00 0.00 ? 47 TYR A HB3  4  
ATOM 3364  H HD1  . TYR A 1 47 ? -3.930  1.964   -3.060  1.00 0.00 ? 47 TYR A HD1  4  
ATOM 3365  H HD2  . TYR A 1 47 ? -6.757  -1.184  -3.557  1.00 0.00 ? 47 TYR A HD2  4  
ATOM 3366  H HE1  . TYR A 1 47 ? -2.506  0.913   -4.723  1.00 0.00 ? 47 TYR A HE1  4  
ATOM 3367  H HE2  . TYR A 1 47 ? -5.296  -2.266  -5.154  1.00 0.00 ? 47 TYR A HE2  4  
ATOM 3368  H HH   . TYR A 1 47 ? -2.803  -2.233  -5.780  1.00 0.00 ? 47 TYR A HH   4  
ATOM 3369  N N    . ASP A 1 48 ? -8.980  1.198   -3.789  1.00 0.00 ? 48 ASP A N    4  
ATOM 3370  C CA   . ASP A 1 48 ? -9.680  0.620   -4.932  1.00 0.00 ? 48 ASP A CA   4  
ATOM 3371  C C    . ASP A 1 48 ? -9.926  1.662   -6.044  1.00 0.00 ? 48 ASP A C    4  
ATOM 3372  O O    . ASP A 1 48 ? -9.829  1.378   -7.234  1.00 0.00 ? 48 ASP A O    4  
ATOM 3373  C CB   . ASP A 1 48 ? -11.011 -0.015  -4.484  1.00 0.00 ? 48 ASP A CB   4  
ATOM 3374  C CG   . ASP A 1 48 ? -10.786 -1.151  -3.468  1.00 0.00 ? 48 ASP A CG   4  
ATOM 3375  O OD1  . ASP A 1 48 ? -10.127 -2.126  -3.811  1.00 0.00 ? 48 ASP A OD1  4  
ATOM 3376  O OD2  . ASP A 1 48 ? -11.266 -1.058  -2.337  1.00 0.00 ? 48 ASP A OD2  4  
ATOM 3377  H H    . ASP A 1 48 ? -9.362  1.116   -2.869  1.00 0.00 ? 48 ASP A H    4  
ATOM 3378  H HA   . ASP A 1 48 ? -9.050  -0.176  -5.338  1.00 0.00 ? 48 ASP A HA   4  
ATOM 3379  H HB2  . ASP A 1 48 ? -11.677 0.747   -4.070  1.00 0.00 ? 48 ASP A HB2  4  
ATOM 3380  H HB3  . ASP A 1 48 ? -11.506 -0.465  -5.354  1.00 0.00 ? 48 ASP A HB3  4  
ATOM 3381  N N    . ARG A 1 49 ? -10.258 2.880   -5.587  1.00 0.00 ? 49 ARG A N    4  
ATOM 3382  C CA   . ARG A 1 49 ? -10.524 3.998   -6.482  1.00 0.00 ? 49 ARG A CA   4  
ATOM 3383  C C    . ARG A 1 49 ? -9.263  4.402   -7.293  1.00 0.00 ? 49 ARG A C    4  
ATOM 3384  O O    . ARG A 1 49 ? -9.250  4.264   -8.513  1.00 0.00 ? 49 ARG A O    4  
ATOM 3385  C CB   . ARG A 1 49 ? -11.141 5.138   -5.637  1.00 0.00 ? 49 ARG A CB   4  
ATOM 3386  C CG   . ARG A 1 49 ? -11.313 6.509   -6.319  1.00 0.00 ? 49 ARG A CG   4  
ATOM 3387  C CD   . ARG A 1 49 ? -11.356 7.682   -5.269  1.00 0.00 ? 49 ARG A CD   4  
ATOM 3388  N NE   . ARG A 1 49 ? -10.120 8.441   -5.403  1.00 0.00 ? 49 ARG A NE   4  
ATOM 3389  C CZ   . ARG A 1 49 ? -9.912  9.709   -4.999  1.00 0.00 ? 49 ARG A CZ   4  
ATOM 3390  N NH1  . ARG A 1 49 ? -10.905 10.447  -4.513  1.00 0.00 ? 49 ARG A NH1  4  
ATOM 3391  N NH2  . ARG A 1 49 ? -8.682  10.194  -5.095  1.00 0.00 ? 49 ARG A NH2  4  
ATOM 3392  H H    . ARG A 1 49 ? -10.323 3.017   -4.594  1.00 0.00 ? 49 ARG A H    4  
ATOM 3393  H HA   . ARG A 1 49 ? -11.260 3.626   -7.199  1.00 0.00 ? 49 ARG A HA   4  
ATOM 3394  H HB2  . ARG A 1 49 ? -12.110 4.768   -5.281  1.00 0.00 ? 49 ARG A HB2  4  
ATOM 3395  H HB3  . ARG A 1 49 ? -10.540 5.316   -4.748  1.00 0.00 ? 49 ARG A HB3  4  
ATOM 3396  H HG2  . ARG A 1 49 ? -10.474 6.658   -7.014  1.00 0.00 ? 49 ARG A HG2  4  
ATOM 3397  H HG3  . ARG A 1 49 ? -12.192 6.457   -6.970  1.00 0.00 ? 49 ARG A HG3  4  
ATOM 3398  H HD2  . ARG A 1 49 ? -12.215 8.373   -5.332  1.00 0.00 ? 49 ARG A HD2  4  
ATOM 3399  H HD3  . ARG A 1 49 ? -11.306 7.336   -4.226  1.00 0.00 ? 49 ARG A HD3  4  
ATOM 3400  H HE   . ARG A 1 49 ? -9.301  7.967   -5.749  1.00 0.00 ? 49 ARG A HE   4  
ATOM 3401  H HH11 . ARG A 1 49 ? -11.817 10.044  -4.448  1.00 0.00 ? 49 ARG A HH11 4  
ATOM 3402  H HH12 . ARG A 1 49 ? -10.762 11.388  -4.212  1.00 0.00 ? 49 ARG A HH12 4  
ATOM 3403  H HH21 . ARG A 1 49 ? -7.970  9.538   -5.412  1.00 0.00 ? 49 ARG A HH21 4  
ATOM 3404  H HH22 . ARG A 1 49 ? -8.421  11.129  -4.871  1.00 0.00 ? 49 ARG A HH22 4  
ATOM 3405  N N    . ASP A 1 50 ? -8.246  4.921   -6.578  1.00 0.00 ? 50 ASP A N    4  
ATOM 3406  C CA   . ASP A 1 50 ? -7.042  5.462   -7.230  1.00 0.00 ? 50 ASP A CA   4  
ATOM 3407  C C    . ASP A 1 50 ? -6.099  4.401   -7.848  1.00 0.00 ? 50 ASP A C    4  
ATOM 3408  O O    . ASP A 1 50 ? -5.488  4.602   -8.895  1.00 0.00 ? 50 ASP A O    4  
ATOM 3409  C CB   . ASP A 1 50 ? -6.279  6.329   -6.210  1.00 0.00 ? 50 ASP A CB   4  
ATOM 3410  C CG   . ASP A 1 50 ? -7.080  7.587   -5.848  1.00 0.00 ? 50 ASP A CG   4  
ATOM 3411  O OD1  . ASP A 1 50 ? -7.528  8.305   -6.737  1.00 0.00 ? 50 ASP A OD1  4  
ATOM 3412  O OD2  . ASP A 1 50 ? -7.284  7.869   -4.678  1.00 0.00 ? 50 ASP A OD2  4  
ATOM 3413  H H    . ASP A 1 50 ? -8.327  4.992   -5.581  1.00 0.00 ? 50 ASP A H    4  
ATOM 3414  H HA   . ASP A 1 50 ? -7.341  6.119   -8.050  1.00 0.00 ? 50 ASP A HA   4  
ATOM 3415  H HB2  . ASP A 1 50 ? -6.073  5.751   -5.289  1.00 0.00 ? 50 ASP A HB2  4  
ATOM 3416  H HB3  . ASP A 1 50 ? -5.361  6.720   -6.671  1.00 0.00 ? 50 ASP A HB3  4  
ATOM 3417  N N    . LYS A 1 51 ? -5.978  3.278   -7.124  1.00 0.00 ? 51 LYS A N    4  
ATOM 3418  C CA   . LYS A 1 51 ? -5.136  2.152   -7.537  1.00 0.00 ? 51 LYS A CA   4  
ATOM 3419  C C    . LYS A 1 51 ? -3.663  2.547   -7.590  1.00 0.00 ? 51 LYS A C    4  
ATOM 3420  O O    . LYS A 1 51 ? -2.977  2.270   -8.569  1.00 0.00 ? 51 LYS A O    4  
ATOM 3421  C CB   . LYS A 1 51 ? -5.513  1.545   -8.894  1.00 0.00 ? 51 LYS A CB   4  
ATOM 3422  C CG   . LYS A 1 51 ? -7.048  1.293   -8.984  1.00 0.00 ? 51 LYS A CG   4  
ATOM 3423  C CD   . LYS A 1 51 ? -7.566  1.999   -10.234 1.00 0.00 ? 51 LYS A CD   4  
ATOM 3424  C CE   . LYS A 1 51 ? -8.988  1.623   -10.655 1.00 0.00 ? 51 LYS A CE   4  
ATOM 3425  N NZ   . LYS A 1 51 ? -9.966  2.120   -9.699  1.00 0.00 ? 51 LYS A NZ   4  
ATOM 3426  H H    . LYS A 1 51 ? -6.524  3.188   -6.289  1.00 0.00 ? 51 LYS A H    4  
ATOM 3427  H HA   . LYS A 1 51 ? -5.312  1.382   -6.798  1.00 0.00 ? 51 LYS A HA   4  
ATOM 3428  H HB2  . LYS A 1 51 ? -5.219  2.312   -9.677  1.00 0.00 ? 51 LYS A HB2  4  
ATOM 3429  H HB3  . LYS A 1 51 ? -4.909  0.587   -8.959  1.00 0.00 ? 51 LYS A HB3  4  
ATOM 3430  H HG2  . LYS A 1 51 ? -7.351  0.239   -9.026  1.00 0.00 ? 51 LYS A HG2  4  
ATOM 3431  H HG3  . LYS A 1 51 ? -7.544  1.669   -8.085  1.00 0.00 ? 51 LYS A HG3  4  
ATOM 3432  H HD2  . LYS A 1 51 ? -7.477  3.080   -10.116 1.00 0.00 ? 51 LYS A HD2  4  
ATOM 3433  H HD3  . LYS A 1 51 ? -6.866  1.725   -11.015 1.00 0.00 ? 51 LYS A HD3  4  
ATOM 3434  H HE2  . LYS A 1 51 ? -9.217  2.063   -11.626 1.00 0.00 ? 51 LYS A HE2  4  
ATOM 3435  H HE3  . LYS A 1 51 ? -9.104  0.541   -10.744 1.00 0.00 ? 51 LYS A HE3  4  
ATOM 3436  H HZ1  . LYS A 1 51 ? -10.942 1.971   -10.015 1.00 0.00 ? 51 LYS A HZ1  4  
ATOM 3437  H HZ2  . LYS A 1 51 ? -9.795  3.135   -9.520  1.00 0.00 ? 51 LYS A HZ2  4  
ATOM 3438  H HZ3  . LYS A 1 51 ? -9.825  1.635   -8.787  1.00 0.00 ? 51 LYS A HZ3  4  
ATOM 3439  N N    . LYS A 1 52 ? -3.214  3.236   -6.536  1.00 0.00 ? 52 LYS A N    4  
ATOM 3440  C CA   . LYS A 1 52 ? -1.815  3.631   -6.485  1.00 0.00 ? 52 LYS A CA   4  
ATOM 3441  C C    . LYS A 1 52 ? -1.261  3.125   -5.156  1.00 0.00 ? 52 LYS A C    4  
ATOM 3442  O O    . LYS A 1 52 ? -1.920  3.222   -4.122  1.00 0.00 ? 52 LYS A O    4  
ATOM 3443  C CB   . LYS A 1 52 ? -1.657  5.145   -6.609  1.00 0.00 ? 52 LYS A CB   4  
ATOM 3444  C CG   . LYS A 1 52 ? -1.849  5.665   -8.044  1.00 0.00 ? 52 LYS A CG   4  
ATOM 3445  C CD   . LYS A 1 52 ? -0.745  5.243   -9.039  1.00 0.00 ? 52 LYS A CD   4  
ATOM 3446  C CE   . LYS A 1 52 ? -1.055  4.012   -9.908  1.00 0.00 ? 52 LYS A CE   4  
ATOM 3447  N NZ   . LYS A 1 52 ? -2.438  3.932   -10.380 1.00 0.00 ? 52 LYS A NZ   4  
ATOM 3448  H H    . LYS A 1 52 ? -3.811  3.433   -5.758  1.00 0.00 ? 52 LYS A H    4  
ATOM 3449  H HA   . LYS A 1 52 ? -1.274  3.118   -7.279  1.00 0.00 ? 52 LYS A HA   4  
ATOM 3450  H HB2  . LYS A 1 52 ? -2.326  5.653   -5.912  1.00 0.00 ? 52 LYS A HB2  4  
ATOM 3451  H HB3  . LYS A 1 52 ? -0.648  5.409   -6.319  1.00 0.00 ? 52 LYS A HB3  4  
ATOM 3452  H HG2  . LYS A 1 52 ? -2.841  5.427   -8.423  1.00 0.00 ? 52 LYS A HG2  4  
ATOM 3453  H HG3  . LYS A 1 52 ? -1.804  6.755   -7.987  1.00 0.00 ? 52 LYS A HG3  4  
ATOM 3454  H HD2  . LYS A 1 52 ? -0.696  6.085   -9.781  1.00 0.00 ? 52 LYS A HD2  4  
ATOM 3455  H HD3  . LYS A 1 52 ? 0.190   5.009   -8.448  1.00 0.00 ? 52 LYS A HD3  4  
ATOM 3456  H HE2  . LYS A 1 52 ? -0.400  4.017   -10.782 1.00 0.00 ? 52 LYS A HE2  4  
ATOM 3457  H HE3  . LYS A 1 52 ? -0.836  3.088   -9.376  1.00 0.00 ? 52 LYS A HE3  4  
ATOM 3458  H HZ1  . LYS A 1 52 ? -2.806  4.858   -10.677 1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 3459  H HZ2  . LYS A 1 52 ? -3.015  3.567   -9.589  1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 3460  H HZ3  . LYS A 1 52 ? -2.520  3.243   -11.153 1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 3461  N N    . TYR A 1 53 ? -0.057  2.530   -5.243  1.00 0.00 ? 53 TYR A N    4  
ATOM 3462  C CA   . TYR A 1 53 ? 0.521   1.901   -4.070  1.00 0.00 ? 53 TYR A CA   4  
ATOM 3463  C C    . TYR A 1 53 ? 1.992   2.269   -3.878  1.00 0.00 ? 53 TYR A C    4  
ATOM 3464  O O    . TYR A 1 53 ? 2.653   2.908   -4.692  1.00 0.00 ? 53 TYR A O    4  
ATOM 3465  C CB   . TYR A 1 53 ? 0.330   0.367   -4.152  1.00 0.00 ? 53 TYR A CB   4  
ATOM 3466  C CG   . TYR A 1 53 ? 1.156   -0.298  -5.220  1.00 0.00 ? 53 TYR A CG   4  
ATOM 3467  C CD1  . TYR A 1 53 ? 0.664   -0.451  -6.507  1.00 0.00 ? 53 TYR A CD1  4  
ATOM 3468  C CD2  . TYR A 1 53 ? 2.417   -0.795  -4.923  1.00 0.00 ? 53 TYR A CD2  4  
ATOM 3469  C CE1  . TYR A 1 53 ? 1.406   -1.117  -7.476  1.00 0.00 ? 53 TYR A CE1  4  
ATOM 3470  C CE2  . TYR A 1 53 ? 3.165   -1.456  -5.883  1.00 0.00 ? 53 TYR A CE2  4  
ATOM 3471  C CZ   . TYR A 1 53 ? 2.660   -1.628  -7.161  1.00 0.00 ? 53 TYR A CZ   4  
ATOM 3472  O OH   . TYR A 1 53 ? 3.412   -2.321  -8.094  1.00 0.00 ? 53 TYR A OH   4  
ATOM 3473  H H    . TYR A 1 53 ? 0.462   2.508   -6.101  1.00 0.00 ? 53 TYR A H    4  
ATOM 3474  H HA   . TYR A 1 53 ? 0.013   2.315   -3.203  1.00 0.00 ? 53 TYR A HA   4  
ATOM 3475  H HB2  . TYR A 1 53 ? 0.574   -0.102  -3.204  1.00 0.00 ? 53 TYR A HB2  4  
ATOM 3476  H HB3  . TYR A 1 53 ? -0.710  0.095   -4.317  1.00 0.00 ? 53 TYR A HB3  4  
ATOM 3477  H HD1  . TYR A 1 53 ? -0.307  -0.046  -6.739  1.00 0.00 ? 53 TYR A HD1  4  
ATOM 3478  H HD2  . TYR A 1 53 ? 2.818   -0.666  -3.933  1.00 0.00 ? 53 TYR A HD2  4  
ATOM 3479  H HE1  . TYR A 1 53 ? 0.984   -1.238  -8.459  1.00 0.00 ? 53 TYR A HE1  4  
ATOM 3480  H HE2  . TYR A 1 53 ? 4.136   -1.840  -5.621  1.00 0.00 ? 53 TYR A HE2  4  
ATOM 3481  H HH   . TYR A 1 53 ? 3.460   -1.806  -8.894  1.00 0.00 ? 53 TYR A HH   4  
ATOM 3482  N N    . GLY A 1 54 ? 2.421   1.777   -2.709  1.00 0.00 ? 54 GLY A N    4  
ATOM 3483  C CA   . GLY A 1 54 ? 3.778   1.915   -2.209  1.00 0.00 ? 54 GLY A CA   4  
ATOM 3484  C C    . GLY A 1 54 ? 4.237   0.538   -1.706  1.00 0.00 ? 54 GLY A C    4  
ATOM 3485  O O    . GLY A 1 54 ? 3.448   -0.404  -1.699  1.00 0.00 ? 54 GLY A O    4  
ATOM 3486  H H    . GLY A 1 54 ? 1.735   1.266   -2.174  1.00 0.00 ? 54 GLY A H    4  
ATOM 3487  H HA2  . GLY A 1 54 ? 4.429   2.317   -2.991  1.00 0.00 ? 54 GLY A HA2  4  
ATOM 3488  H HA3  . GLY A 1 54 ? 3.703   2.616   -1.387  1.00 0.00 ? 54 GLY A HA3  4  
ATOM 3489  N N    . PHE A 1 55 ? 5.527   0.445   -1.305  1.00 0.00 ? 55 PHE A N    4  
ATOM 3490  C CA   . PHE A 1 55 ? 6.036   -0.841  -0.822  1.00 0.00 ? 55 PHE A CA   4  
ATOM 3491  C C    . PHE A 1 55 ? 6.084   -0.717  0.701   1.00 0.00 ? 55 PHE A C    4  
ATOM 3492  O O    . PHE A 1 55 ? 6.267   0.363   1.243   1.00 0.00 ? 55 PHE A O    4  
ATOM 3493  C CB   . PHE A 1 55 ? 7.433   -1.203  -1.376  1.00 0.00 ? 55 PHE A CB   4  
ATOM 3494  C CG   . PHE A 1 55 ? 7.384   -1.693  -2.806  1.00 0.00 ? 55 PHE A CG   4  
ATOM 3495  C CD1  . PHE A 1 55 ? 6.862   -0.902  -3.822  1.00 0.00 ? 55 PHE A CD1  4  
ATOM 3496  C CD2  . PHE A 1 55 ? 7.862   -2.959  -3.138  1.00 0.00 ? 55 PHE A CD2  4  
ATOM 3497  C CE1  . PHE A 1 55 ? 6.801   -1.359  -5.130  1.00 0.00 ? 55 PHE A CE1  4  
ATOM 3498  C CE2  . PHE A 1 55 ? 7.806   -3.421  -4.447  1.00 0.00 ? 55 PHE A CE2  4  
ATOM 3499  C CZ   . PHE A 1 55 ? 7.274   -2.621  -5.447  1.00 0.00 ? 55 PHE A CZ   4  
ATOM 3500  H H    . PHE A 1 55 ? 6.142   1.240   -1.252  1.00 0.00 ? 55 PHE A H    4  
ATOM 3501  H HA   . PHE A 1 55 ? 5.338   -1.639  -1.081  1.00 0.00 ? 55 PHE A HA   4  
ATOM 3502  H HB2  . PHE A 1 55 ? 8.143   -0.373  -1.294  1.00 0.00 ? 55 PHE A HB2  4  
ATOM 3503  H HB3  . PHE A 1 55 ? 7.820   -2.043  -0.786  1.00 0.00 ? 55 PHE A HB3  4  
ATOM 3504  H HD1  . PHE A 1 55 ? 6.501   0.085   -3.601  1.00 0.00 ? 55 PHE A HD1  4  
ATOM 3505  H HD2  . PHE A 1 55 ? 8.287   -3.596  -2.378  1.00 0.00 ? 55 PHE A HD2  4  
ATOM 3506  H HE1  . PHE A 1 55 ? 6.384   -0.721  -5.898  1.00 0.00 ? 55 PHE A HE1  4  
ATOM 3507  H HE2  . PHE A 1 55 ? 8.180   -4.403  -4.685  1.00 0.00 ? 55 PHE A HE2  4  
ATOM 3508  H HZ   . PHE A 1 55 ? 7.234   -2.978  -6.465  1.00 0.00 ? 55 PHE A HZ   4  
ATOM 3509  N N    . CYS A 1 56 ? 5.851   -1.870  1.344   1.00 0.00 ? 56 CYS A N    4  
ATOM 3510  C CA   . CYS A 1 56 ? 5.802   -1.886  2.819   1.00 0.00 ? 56 CYS A CA   4  
ATOM 3511  C C    . CYS A 1 56 ? 7.165   -2.449  3.253   1.00 0.00 ? 56 CYS A C    4  
ATOM 3512  O O    . CYS A 1 56 ? 7.814   -3.135  2.473   1.00 0.00 ? 56 CYS A O    4  
ATOM 3513  C CB   . CYS A 1 56 ? 4.617   -2.793  3.259   1.00 0.00 ? 56 CYS A CB   4  
ATOM 3514  S SG   . CYS A 1 56 ? 3.694   -2.168  4.686   1.00 0.00 ? 56 CYS A SG   4  
ATOM 3515  H H    . CYS A 1 56 ? 5.817   -2.702  0.756   1.00 0.00 ? 56 CYS A H    4  
ATOM 3516  H HA   . CYS A 1 56 ? 5.723   -0.856  3.240   1.00 0.00 ? 56 CYS A HA   4  
ATOM 3517  H HB2  . CYS A 1 56 ? 3.851   -2.933  2.474   1.00 0.00 ? 56 CYS A HB2  4  
ATOM 3518  H HB3  . CYS A 1 56 ? 4.996   -3.794  3.504   1.00 0.00 ? 56 CYS A HB3  4  
ATOM 3519  N N    . PRO A 1 57 ? 7.625   -2.133  4.496   1.00 0.00 ? 57 PRO A N    4  
ATOM 3520  C CA   . PRO A 1 57 ? 8.997   -2.473  4.886   1.00 0.00 ? 57 PRO A CA   4  
ATOM 3521  C C    . PRO A 1 57 ? 9.289   -3.980  4.775   1.00 0.00 ? 57 PRO A C    4  
ATOM 3522  O O    . PRO A 1 57 ? 8.603   -4.804  5.374   1.00 0.00 ? 57 PRO A O    4  
ATOM 3523  C CB   . PRO A 1 57 ? 9.125   -1.967  6.331   1.00 0.00 ? 57 PRO A CB   4  
ATOM 3524  C CG   . PRO A 1 57 ? 7.684   -1.754  6.798   1.00 0.00 ? 57 PRO A CG   4  
ATOM 3525  C CD   . PRO A 1 57 ? 6.913   -1.381  5.531   1.00 0.00 ? 57 PRO A CD   4  
ATOM 3526  H HA   . PRO A 1 57 ? 9.691   -1.926  4.246   1.00 0.00 ? 57 PRO A HA   4  
ATOM 3527  H HB2  . PRO A 1 57 ? 9.682   -2.637  6.988   1.00 0.00 ? 57 PRO A HB2  4  
ATOM 3528  H HB3  . PRO A 1 57 ? 9.645   -1.008  6.333   1.00 0.00 ? 57 PRO A HB3  4  
ATOM 3529  H HG2  . PRO A 1 57 ? 7.297   -2.699  7.181   1.00 0.00 ? 57 PRO A HG2  4  
ATOM 3530  H HG3  . PRO A 1 57 ? 7.586   -1.027  7.601   1.00 0.00 ? 57 PRO A HG3  4  
ATOM 3531  H HD2  . PRO A 1 57 ? 5.855   -1.653  5.682   1.00 0.00 ? 57 PRO A HD2  4  
ATOM 3532  H HD3  . PRO A 1 57 ? 7.040   -0.319  5.267   1.00 0.00 ? 57 PRO A HD3  4  
ATOM 3533  N N    . GLU A 1 58 ? 10.320  -4.280  3.962   1.00 0.00 ? 58 GLU A N    4  
ATOM 3534  C CA   . GLU A 1 58 ? 10.759  -5.651  3.725   1.00 0.00 ? 58 GLU A CA   4  
ATOM 3535  C C    . GLU A 1 58 ? 12.052  -5.861  4.527   1.00 0.00 ? 58 GLU A C    4  
ATOM 3536  O O    . GLU A 1 58 ? 12.327  -5.140  5.478   1.00 0.00 ? 58 GLU A O    4  
ATOM 3537  C CB   . GLU A 1 58 ? 10.928  -5.867  2.201   1.00 0.00 ? 58 GLU A CB   4  
ATOM 3538  C CG   . GLU A 1 58 ? 10.576  -7.292  1.732   1.00 0.00 ? 58 GLU A CG   4  
ATOM 3539  C CD   . GLU A 1 58 ? 9.085   -7.587  1.955   1.00 0.00 ? 58 GLU A CD   4  
ATOM 3540  O OE1  . GLU A 1 58 ? 8.248   -6.911  1.363   1.00 0.00 ? 58 GLU A OE1  4  
ATOM 3541  O OE2  . GLU A 1 58 ? 8.760   -8.460  2.757   1.00 0.00 ? 58 GLU A OE2  4  
ATOM 3542  H H    . GLU A 1 58 ? 10.820  -3.535  3.524   1.00 0.00 ? 58 GLU A H    4  
ATOM 3543  H HA   . GLU A 1 58 ? 10.007  -6.328  4.129   1.00 0.00 ? 58 GLU A HA   4  
ATOM 3544  H HB2  . GLU A 1 58 ? 10.254  -5.178  1.674   1.00 0.00 ? 58 GLU A HB2  4  
ATOM 3545  H HB3  . GLU A 1 58 ? 11.952  -5.627  1.886   1.00 0.00 ? 58 GLU A HB3  4  
ATOM 3546  H HG2  . GLU A 1 58 ? 10.787  -7.400  0.669   1.00 0.00 ? 58 GLU A HG2  4  
ATOM 3547  H HG3  . GLU A 1 58 ? 11.174  -8.046  2.243   1.00 0.00 ? 58 GLU A HG3  4  
ATOM 3548  N N    . THR A 1 59 ? 12.832  -6.862  4.095   1.00 0.00 ? 59 THR A N    4  
ATOM 3549  C CA   . THR A 1 59 ? 14.095  -7.151  4.749   1.00 0.00 ? 59 THR A CA   4  
ATOM 3550  C C    . THR A 1 59 ? 15.131  -6.099  4.323   1.00 0.00 ? 59 THR A C    4  
ATOM 3551  O O    . THR A 1 59 ? 15.685  -6.185  3.231   1.00 0.00 ? 59 THR A O    4  
ATOM 3552  C CB   . THR A 1 59 ? 14.534  -8.535  4.245   1.00 0.00 ? 59 THR A CB   4  
ATOM 3553  O OG1  . THR A 1 59 ? 14.461  -8.550  2.830   1.00 0.00 ? 59 THR A OG1  4  
ATOM 3554  C CG2  . THR A 1 59 ? 13.623  -9.652  4.764   1.00 0.00 ? 59 THR A CG2  4  
ATOM 3555  H H    . THR A 1 59 ? 12.589  -7.429  3.306   1.00 0.00 ? 59 THR A H    4  
ATOM 3556  H HA   . THR A 1 59 ? 13.950  -7.139  5.831   1.00 0.00 ? 59 THR A HA   4  
ATOM 3557  H HB   . THR A 1 59 ? 15.558  -8.756  4.570   1.00 0.00 ? 59 THR A HB   4  
ATOM 3558  H HG1  . THR A 1 59 ? 14.988  -7.820  2.489   1.00 0.00 ? 59 THR A HG1  4  
ATOM 3559  H HG21 . THR A 1 59 ? 13.964  -10.624 4.407   1.00 0.00 ? 59 THR A HG21 4  
ATOM 3560  H HG22 . THR A 1 59 ? 12.595  -9.522  4.425   1.00 0.00 ? 59 THR A HG22 4  
ATOM 3561  H HG23 . THR A 1 59 ? 13.616  -9.680  5.853   1.00 0.00 ? 59 THR A HG23 4  
ATOM 3562  N N    . ALA A 1 60 ? 15.347  -5.135  5.231   1.00 0.00 ? 60 ALA A N    4  
ATOM 3563  C CA   . ALA A 1 60 ? 16.296  -4.056  5.020   1.00 0.00 ? 60 ALA A CA   4  
ATOM 3564  C C    . ALA A 1 60 ? 16.690  -3.495  6.397   1.00 0.00 ? 60 ALA A C    4  
ATOM 3565  O O    . ALA A 1 60 ? 17.687  -2.780  6.479   1.00 0.00 ? 60 ALA A O    4  
ATOM 3566  C CB   . ALA A 1 60 ? 15.656  -2.961  4.155   1.00 0.00 ? 60 ALA A CB   4  
ATOM 3567  O OXT  . ALA A 1 60 ? 15.993  -3.785  7.371   1.00 0.00 ? 60 ALA A OXT  4  
ATOM 3568  H H    . ALA A 1 60 ? 14.874  -5.090  6.114   1.00 0.00 ? 60 ALA A H    4  
ATOM 3569  H HA   . ALA A 1 60 ? 17.182  -4.476  4.540   1.00 0.00 ? 60 ALA A HA   4  
ATOM 3570  H HB1  . ALA A 1 60 ? 15.379  -3.350  3.176   1.00 0.00 ? 60 ALA A HB1  4  
ATOM 3571  H HB2  . ALA A 1 60 ? 16.348  -2.133  4.002   1.00 0.00 ? 60 ALA A HB2  4  
ATOM 3572  H HB3  . ALA A 1 60 ? 14.757  -2.564  4.628   1.00 0.00 ? 60 ALA A HB3  4  
ATOM 3573  N N    . THR A 1 1  ? 11.701  6.318   9.244   1.00 0.00 ? 1  THR A N    5  
ATOM 3574  C CA   . THR A 1 1  ? 10.405  6.869   9.573   1.00 0.00 ? 1  THR A CA   5  
ATOM 3575  C C    . THR A 1 1  ? 9.753   7.125   8.231   1.00 0.00 ? 1  THR A C    5  
ATOM 3576  O O    . THR A 1 1  ? 10.495  7.397   7.297   1.00 0.00 ? 1  THR A O    5  
ATOM 3577  C CB   . THR A 1 1  ? 10.692  8.164   10.350  1.00 0.00 ? 1  THR A CB   5  
ATOM 3578  O OG1  . THR A 1 1  ? 11.889  7.884   11.070  1.00 0.00 ? 1  THR A OG1  5  
ATOM 3579  C CG2  . THR A 1 1  ? 9.528   8.558   11.271  1.00 0.00 ? 1  THR A CG2  5  
ATOM 3580  H H1   . THR A 1 1  ? 11.929  6.741   8.315   1.00 0.00 ? 1  THR A H1   5  
ATOM 3581  H H2   . THR A 1 1  ? 11.687  5.283   9.190   1.00 0.00 ? 1  THR A H2   5  
ATOM 3582  H H3   . THR A 1 1  ? 12.319  6.685   10.006  1.00 0.00 ? 1  THR A H3   5  
ATOM 3583  H HA   . THR A 1 1  ? 9.857   6.135   10.166  1.00 0.00 ? 1  THR A HA   5  
ATOM 3584  H HB   . THR A 1 1  ? 10.893  8.982   9.645   1.00 0.00 ? 1  THR A HB   5  
ATOM 3585  H HG1  . THR A 1 1  ? 12.094  8.607   11.665  1.00 0.00 ? 1  THR A HG1  5  
ATOM 3586  H HG21 . THR A 1 1  ? 8.608   8.690   10.701  1.00 0.00 ? 1  THR A HG21 5  
ATOM 3587  H HG22 . THR A 1 1  ? 9.718   9.501   11.786  1.00 0.00 ? 1  THR A HG22 5  
ATOM 3588  H HG23 . THR A 1 1  ? 9.343   7.795   12.028  1.00 0.00 ? 1  THR A HG23 5  
ATOM 3589  N N    . ALA A 1 2  ? 8.411   6.996   8.186   1.00 0.00 ? 2  ALA A N    5  
ATOM 3590  C CA   . ALA A 1 2  ? 7.654   7.151   6.944   1.00 0.00 ? 2  ALA A CA   5  
ATOM 3591  C C    . ALA A 1 2  ? 8.034   6.043   5.939   1.00 0.00 ? 2  ALA A C    5  
ATOM 3592  O O    . ALA A 1 2  ? 8.937   5.246   6.167   1.00 0.00 ? 2  ALA A O    5  
ATOM 3593  C CB   . ALA A 1 2  ? 7.809   8.562   6.353   1.00 0.00 ? 2  ALA A CB   5  
ATOM 3594  H H    . ALA A 1 2  ? 7.906   6.762   9.015   1.00 0.00 ? 2  ALA A H    5  
ATOM 3595  H HA   . ALA A 1 2  ? 6.614   6.993   7.230   1.00 0.00 ? 2  ALA A HA   5  
ATOM 3596  H HB1  . ALA A 1 2  ? 7.553   9.323   7.091   1.00 0.00 ? 2  ALA A HB1  5  
ATOM 3597  H HB2  . ALA A 1 2  ? 7.157   8.710   5.492   1.00 0.00 ? 2  ALA A HB2  5  
ATOM 3598  H HB3  . ALA A 1 2  ? 8.830   8.752   6.024   1.00 0.00 ? 2  ALA A HB3  5  
ATOM 3599  N N    . LEU A 1 3  ? 7.260   6.039   4.839   1.00 0.00 ? 3  LEU A N    5  
ATOM 3600  C CA   . LEU A 1 3  ? 7.449   5.104   3.738   1.00 0.00 ? 3  LEU A CA   5  
ATOM 3601  C C    . LEU A 1 3  ? 7.593   5.980   2.485   1.00 0.00 ? 3  LEU A C    5  
ATOM 3602  O O    . LEU A 1 3  ? 6.897   6.978   2.330   1.00 0.00 ? 3  LEU A O    5  
ATOM 3603  C CB   . LEU A 1 3  ? 6.270   4.114   3.625   1.00 0.00 ? 3  LEU A CB   5  
ATOM 3604  C CG   . LEU A 1 3  ? 6.501   2.786   4.375   1.00 0.00 ? 3  LEU A CG   5  
ATOM 3605  C CD1  . LEU A 1 3  ? 6.326   2.905   5.894   1.00 0.00 ? 3  LEU A CD1  5  
ATOM 3606  C CD2  . LEU A 1 3  ? 5.549   1.713   3.845   1.00 0.00 ? 3  LEU A CD2  5  
ATOM 3607  H H    . LEU A 1 3  ? 6.568   6.747   4.706   1.00 0.00 ? 3  LEU A H    5  
ATOM 3608  H HA   . LEU A 1 3  ? 8.390   4.570   3.889   1.00 0.00 ? 3  LEU A HA   5  
ATOM 3609  H HB2  . LEU A 1 3  ? 5.347   4.577   4.066   1.00 0.00 ? 3  LEU A HB2  5  
ATOM 3610  H HB3  . LEU A 1 3  ? 6.213   3.835   2.538   1.00 0.00 ? 3  LEU A HB3  5  
ATOM 3611  H HG   . LEU A 1 3  ? 7.516   2.442   4.172   1.00 0.00 ? 3  LEU A HG   5  
ATOM 3612  H HD11 . LEU A 1 3  ? 6.437   1.930   6.371   1.00 0.00 ? 3  LEU A HD11 5  
ATOM 3613  H HD12 . LEU A 1 3  ? 5.336   3.283   6.150   1.00 0.00 ? 3  LEU A HD12 5  
ATOM 3614  H HD13 . LEU A 1 3  ? 7.070   3.562   6.337   1.00 0.00 ? 3  LEU A HD13 5  
ATOM 3615  H HD21 . LEU A 1 3  ? 5.701   1.553   2.777   1.00 0.00 ? 3  LEU A HD21 5  
ATOM 3616  H HD22 . LEU A 1 3  ? 4.509   2.003   3.999   1.00 0.00 ? 3  LEU A HD22 5  
ATOM 3617  H HD23 . LEU A 1 3  ? 5.708   0.762   4.350   1.00 0.00 ? 3  LEU A HD23 5  
ATOM 3618  N N    . PHE A 1 4  ? 8.566   5.566   1.652   1.00 0.00 ? 4  PHE A N    5  
ATOM 3619  C CA   . PHE A 1 4  ? 8.967   6.281   0.443   1.00 0.00 ? 4  PHE A CA   5  
ATOM 3620  C C    . PHE A 1 4  ? 8.748   5.327   -0.739  1.00 0.00 ? 4  PHE A C    5  
ATOM 3621  O O    . PHE A 1 4  ? 8.694   4.118   -0.549  1.00 0.00 ? 4  PHE A O    5  
ATOM 3622  C CB   . PHE A 1 4  ? 10.459  6.664   0.609   1.00 0.00 ? 4  PHE A CB   5  
ATOM 3623  C CG   . PHE A 1 4  ? 10.680  7.418   1.894   1.00 0.00 ? 4  PHE A CG   5  
ATOM 3624  C CD1  . PHE A 1 4  ? 10.382  8.775   1.975   1.00 0.00 ? 4  PHE A CD1  5  
ATOM 3625  C CD2  . PHE A 1 4  ? 11.171  6.766   3.023   1.00 0.00 ? 4  PHE A CD2  5  
ATOM 3626  C CE1  . PHE A 1 4  ? 10.566  9.468   3.164   1.00 0.00 ? 4  PHE A CE1  5  
ATOM 3627  C CE2  . PHE A 1 4  ? 11.351  7.456   4.213   1.00 0.00 ? 4  PHE A CE2  5  
ATOM 3628  C CZ   . PHE A 1 4  ? 11.050  8.808   4.285   1.00 0.00 ? 4  PHE A CZ   5  
ATOM 3629  H H    . PHE A 1 4  ? 9.040   4.711   1.860   1.00 0.00 ? 4  PHE A H    5  
ATOM 3630  H HA   . PHE A 1 4  ? 8.324   7.158   0.335   1.00 0.00 ? 4  PHE A HA   5  
ATOM 3631  H HB2  . PHE A 1 4  ? 11.066  5.750   0.632   1.00 0.00 ? 4  PHE A HB2  5  
ATOM 3632  H HB3  . PHE A 1 4  ? 10.843  7.285   -0.211  1.00 0.00 ? 4  PHE A HB3  5  
ATOM 3633  H HD1  . PHE A 1 4  ? 9.997   9.295   1.110   1.00 0.00 ? 4  PHE A HD1  5  
ATOM 3634  H HD2  . PHE A 1 4  ? 11.410  5.714   2.982   1.00 0.00 ? 4  PHE A HD2  5  
ATOM 3635  H HE1  . PHE A 1 4  ? 10.329  10.521  3.219   1.00 0.00 ? 4  PHE A HE1  5  
ATOM 3636  H HE2  . PHE A 1 4  ? 11.717  6.939   5.088   1.00 0.00 ? 4  PHE A HE2  5  
ATOM 3637  H HZ   . PHE A 1 4  ? 11.188  9.338   5.215   1.00 0.00 ? 4  PHE A HZ   5  
ATOM 3638  N N    . THR A 1 5  ? 8.624   5.905   -1.951  1.00 0.00 ? 5  THR A N    5  
ATOM 3639  C CA   . THR A 1 5  ? 8.379   5.086   -3.130  1.00 0.00 ? 5  THR A CA   5  
ATOM 3640  C C    . THR A 1 5  ? 9.715   4.913   -3.872  1.00 0.00 ? 5  THR A C    5  
ATOM 3641  O O    . THR A 1 5  ? 10.725  5.505   -3.518  1.00 0.00 ? 5  THR A O    5  
ATOM 3642  C CB   . THR A 1 5  ? 7.331   5.793   -4.027  1.00 0.00 ? 5  THR A CB   5  
ATOM 3643  O OG1  . THR A 1 5  ? 7.911   6.816   -4.817  1.00 0.00 ? 5  THR A OG1  5  
ATOM 3644  C CG2  . THR A 1 5  ? 6.230   6.504   -3.227  1.00 0.00 ? 5  THR A CG2  5  
ATOM 3645  H H    . THR A 1 5  ? 8.661   6.890   -2.114  1.00 0.00 ? 5  THR A H    5  
ATOM 3646  H HA   . THR A 1 5  ? 8.003   4.109   -2.819  1.00 0.00 ? 5  THR A HA   5  
ATOM 3647  H HB   . THR A 1 5  ? 6.835   5.052   -4.669  1.00 0.00 ? 5  THR A HB   5  
ATOM 3648  H HG1  . THR A 1 5  ? 8.564   6.466   -5.417  1.00 0.00 ? 5  THR A HG1  5  
ATOM 3649  H HG21 . THR A 1 5  ? 5.424   6.825   -3.889  1.00 0.00 ? 5  THR A HG21 5  
ATOM 3650  H HG22 . THR A 1 5  ? 6.607   7.404   -2.736  1.00 0.00 ? 5  THR A HG22 5  
ATOM 3651  H HG23 . THR A 1 5  ? 5.795   5.862   -2.464  1.00 0.00 ? 5  THR A HG23 5  
ATOM 3652  N N    . MET A 1 6  ? 9.640   4.082   -4.929  1.00 0.00 ? 6  MET A N    5  
ATOM 3653  C CA   . MET A 1 6  ? 10.792  3.823   -5.792  1.00 0.00 ? 6  MET A CA   5  
ATOM 3654  C C    . MET A 1 6  ? 10.311  2.985   -6.985  1.00 0.00 ? 6  MET A C    5  
ATOM 3655  O O    . MET A 1 6  ? 10.407  3.384   -8.135  1.00 0.00 ? 6  MET A O    5  
ATOM 3656  C CB   . MET A 1 6  ? 11.988  3.189   -5.038  1.00 0.00 ? 6  MET A CB   5  
ATOM 3657  C CG   . MET A 1 6  ? 11.651  2.009   -4.111  1.00 0.00 ? 6  MET A CG   5  
ATOM 3658  S SD   . MET A 1 6  ? 13.078  1.536   -3.119  1.00 0.00 ? 6  MET A SD   5  
ATOM 3659  C CE   . MET A 1 6  ? 12.223  0.531   -1.892  1.00 0.00 ? 6  MET A CE   5  
ATOM 3660  H H    . MET A 1 6  ? 8.763   3.660   -5.146  1.00 0.00 ? 6  MET A H    5  
ATOM 3661  H HA   . MET A 1 6  ? 11.085  4.797   -6.193  1.00 0.00 ? 6  MET A HA   5  
ATOM 3662  H HB2  . MET A 1 6  ? 12.758  2.878   -5.747  1.00 0.00 ? 6  MET A HB2  5  
ATOM 3663  H HB3  . MET A 1 6  ? 12.456  3.965   -4.432  1.00 0.00 ? 6  MET A HB3  5  
ATOM 3664  H HG2  . MET A 1 6  ? 10.848  2.285   -3.428  1.00 0.00 ? 6  MET A HG2  5  
ATOM 3665  H HG3  . MET A 1 6  ? 11.321  1.132   -4.665  1.00 0.00 ? 6  MET A HG3  5  
ATOM 3666  H HE1  . MET A 1 6  ? 11.622  -0.232  -2.387  1.00 0.00 ? 6  MET A HE1  5  
ATOM 3667  H HE2  . MET A 1 6  ? 11.551  1.151   -1.299  1.00 0.00 ? 6  MET A HE2  5  
ATOM 3668  H HE3  . MET A 1 6  ? 12.940  0.040   -1.235  1.00 0.00 ? 6  MET A HE3  5  
ATOM 3669  N N    . GLY A 1 7  ? 9.744   1.821   -6.617  1.00 0.00 ? 7  GLY A N    5  
ATOM 3670  C CA   . GLY A 1 7  ? 9.168   0.914   -7.608  1.00 0.00 ? 7  GLY A CA   5  
ATOM 3671  C C    . GLY A 1 7  ? 7.667   1.199   -7.815  1.00 0.00 ? 7  GLY A C    5  
ATOM 3672  O O    . GLY A 1 7  ? 7.090   0.964   -8.868  1.00 0.00 ? 7  GLY A O    5  
ATOM 3673  H H    . GLY A 1 7  ? 9.748   1.584   -5.648  1.00 0.00 ? 7  GLY A H    5  
ATOM 3674  H HA2  . GLY A 1 7  ? 9.706   1.013   -8.555  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 3675  H HA3  . GLY A 1 7  ? 9.312   -0.088  -7.202  1.00 0.00 ? 7  GLY A HA3  5  
ATOM 3676  N N    . GLY A 1 8  ? 7.093   1.733   -6.719  1.00 0.00 ? 8  GLY A N    5  
ATOM 3677  C CA   . GLY A 1 8  ? 5.688   2.129   -6.655  1.00 0.00 ? 8  GLY A CA   5  
ATOM 3678  C C    . GLY A 1 8  ? 5.371   3.273   -7.632  1.00 0.00 ? 8  GLY A C    5  
ATOM 3679  O O    . GLY A 1 8  ? 6.250   3.776   -8.320  1.00 0.00 ? 8  GLY A O    5  
ATOM 3680  H H    . GLY A 1 8  ? 7.686   1.792   -5.925  1.00 0.00 ? 8  GLY A H    5  
ATOM 3681  H HA2  . GLY A 1 8  ? 5.073   1.257   -6.877  1.00 0.00 ? 8  GLY A HA2  5  
ATOM 3682  H HA3  . GLY A 1 8  ? 5.517   2.450   -5.630  1.00 0.00 ? 8  GLY A HA3  5  
ATOM 3683  N N    . ASN A 1 9  ? 4.070   3.633   -7.665  1.00 0.00 ? 9  ASN A N    5  
ATOM 3684  C CA   . ASN A 1 9  ? 3.587   4.661   -8.586  1.00 0.00 ? 9  ASN A CA   5  
ATOM 3685  C C    . ASN A 1 9  ? 3.038   5.858   -7.763  1.00 0.00 ? 9  ASN A C    5  
ATOM 3686  O O    . ASN A 1 9  ? 3.765   6.432   -6.958  1.00 0.00 ? 9  ASN A O    5  
ATOM 3687  C CB   . ASN A 1 9  ? 2.694   3.980   -9.671  1.00 0.00 ? 9  ASN A CB   5  
ATOM 3688  C CG   . ASN A 1 9  ? 1.322   3.415   -9.234  1.00 0.00 ? 9  ASN A CG   5  
ATOM 3689  O OD1  . ASN A 1 9  ? 0.787   3.774   -8.201  1.00 0.00 ? 9  ASN A OD1  5  
ATOM 3690  N ND2  . ASN A 1 9  ? 0.701   2.613   -10.112 1.00 0.00 ? 9  ASN A ND2  5  
ATOM 3691  H H    . ASN A 1 9  ? 3.399   3.226   -7.036  1.00 0.00 ? 9  ASN A H    5  
ATOM 3692  H HA   . ASN A 1 9  ? 4.461   5.068   -9.101  1.00 0.00 ? 9  ASN A HA   5  
ATOM 3693  H HB2  . ASN A 1 9  ? 2.517   4.682   -10.486 1.00 0.00 ? 9  ASN A HB2  5  
ATOM 3694  H HB3  . ASN A 1 9  ? 3.267   3.149   -10.090 1.00 0.00 ? 9  ASN A HB3  5  
ATOM 3695  H HD21 . ASN A 1 9  ? 1.118   2.274   -10.961 1.00 0.00 ? 9  ASN A HD21 5  
ATOM 3696  H HD22 . ASN A 1 9  ? -0.250  2.383   -9.868  1.00 0.00 ? 9  ASN A HD22 5  
ATOM 3697  N N    . ALA A 1 10 ? 1.760   6.223   -7.997  1.00 0.00 ? 10 ALA A N    5  
ATOM 3698  C CA   . ALA A 1 10 ? 1.077   7.283   -7.220  1.00 0.00 ? 10 ALA A CA   5  
ATOM 3699  C C    . ALA A 1 10 ? 1.898   8.578   -7.059  1.00 0.00 ? 10 ALA A C    5  
ATOM 3700  O O    . ALA A 1 10 ? 1.876   9.227   -6.021  1.00 0.00 ? 10 ALA A O    5  
ATOM 3701  C CB   . ALA A 1 10 ? 0.710   6.693   -5.853  1.00 0.00 ? 10 ALA A CB   5  
ATOM 3702  H H    . ALA A 1 10 ? 1.315   5.609   -8.653  1.00 0.00 ? 10 ALA A H    5  
ATOM 3703  H HA   . ALA A 1 10 ? 0.159   7.592   -7.730  1.00 0.00 ? 10 ALA A HA   5  
ATOM 3704  H HB1  . ALA A 1 10 ? 0.125   5.783   -5.972  1.00 0.00 ? 10 ALA A HB1  5  
ATOM 3705  H HB2  . ALA A 1 10 ? 0.128   7.391   -5.252  1.00 0.00 ? 10 ALA A HB2  5  
ATOM 3706  H HB3  . ALA A 1 10 ? 1.603   6.423   -5.287  1.00 0.00 ? 10 ALA A HB3  5  
ATOM 3707  N N    . GLU A 1 11 ? 2.620   8.898   -8.146  1.00 0.00 ? 11 GLU A N    5  
ATOM 3708  C CA   . GLU A 1 11 ? 3.435   10.101  -8.256  1.00 0.00 ? 11 GLU A CA   5  
ATOM 3709  C C    . GLU A 1 11 ? 4.369   10.353  -7.050  1.00 0.00 ? 11 GLU A C    5  
ATOM 3710  O O    . GLU A 1 11 ? 4.672   11.492  -6.714  1.00 0.00 ? 11 GLU A O    5  
ATOM 3711  C CB   . GLU A 1 11 ? 2.546   11.324  -8.556  1.00 0.00 ? 11 GLU A CB   5  
ATOM 3712  C CG   . GLU A 1 11 ? 1.763   11.209  -9.878  1.00 0.00 ? 11 GLU A CG   5  
ATOM 3713  C CD   . GLU A 1 11 ? 0.556   10.269  -9.769  1.00 0.00 ? 11 GLU A CD   5  
ATOM 3714  O OE1  . GLU A 1 11 ? -0.480  10.681  -9.248  1.00 0.00 ? 11 GLU A OE1  5  
ATOM 3715  O OE2  . GLU A 1 11 ? 0.633   9.121   -10.213 1.00 0.00 ? 11 GLU A OE2  5  
ATOM 3716  H H    . GLU A 1 11 ? 2.506   8.314   -8.949  1.00 0.00 ? 11 GLU A H    5  
ATOM 3717  H HA   . GLU A 1 11 ? 4.081   9.919   -9.114  1.00 0.00 ? 11 GLU A HA   5  
ATOM 3718  H HB2  . GLU A 1 11 ? 1.864   11.511  -7.725  1.00 0.00 ? 11 GLU A HB2  5  
ATOM 3719  H HB3  . GLU A 1 11 ? 3.181   12.209  -8.624  1.00 0.00 ? 11 GLU A HB3  5  
ATOM 3720  H HG2  . GLU A 1 11 ? 1.393   12.192  -10.169 1.00 0.00 ? 11 GLU A HG2  5  
ATOM 3721  H HG3  . GLU A 1 11 ? 2.416   10.874  -10.685 1.00 0.00 ? 11 GLU A HG3  5  
ATOM 3722  N N    . GLY A 1 12 ? 4.839   9.244   -6.441  1.00 0.00 ? 12 GLY A N    5  
ATOM 3723  C CA   . GLY A 1 12 ? 5.798   9.393   -5.336  1.00 0.00 ? 12 GLY A CA   5  
ATOM 3724  C C    . GLY A 1 12 ? 5.114   9.653   -3.978  1.00 0.00 ? 12 GLY A C    5  
ATOM 3725  O O    . GLY A 1 12 ? 5.791   9.917   -2.991  1.00 0.00 ? 12 GLY A O    5  
ATOM 3726  H H    . GLY A 1 12 ? 4.518   8.346   -6.765  1.00 0.00 ? 12 GLY A H    5  
ATOM 3727  H HA2  . GLY A 1 12 ? 6.342   8.407   -5.261  1.00 0.00 ? 12 GLY A HA2  5  
ATOM 3728  H HA3  . GLY A 1 12 ? 6.410   10.319  -5.553  1.00 0.00 ? 12 GLY A HA3  5  
ATOM 3729  N N    . GLN A 1 13 ? 3.764   9.580   -3.946  1.00 0.00 ? 13 GLN A N    5  
ATOM 3730  C CA   . GLN A 1 13 ? 3.074   9.815   -2.681  1.00 0.00 ? 13 GLN A CA   5  
ATOM 3731  C C    . GLN A 1 13 ? 3.441   8.717   -1.649  1.00 0.00 ? 13 GLN A C    5  
ATOM 3732  O O    . GLN A 1 13 ? 3.605   7.553   -1.994  1.00 0.00 ? 13 GLN A O    5  
ATOM 3733  C CB   . GLN A 1 13 ? 1.545   9.844   -2.883  1.00 0.00 ? 13 GLN A CB   5  
ATOM 3734  C CG   . GLN A 1 13 ? 1.032   11.105  -3.611  1.00 0.00 ? 13 GLN A CG   5  
ATOM 3735  C CD   . GLN A 1 13 ? 1.017   12.324  -2.674  1.00 0.00 ? 13 GLN A CD   5  
ATOM 3736  O OE1  . GLN A 1 13 ? 2.003   12.669  -2.042  1.00 0.00 ? 13 GLN A OE1  5  
ATOM 3737  N NE2  . GLN A 1 13 ? -0.167  12.944  -2.597  1.00 0.00 ? 13 GLN A NE2  5  
ATOM 3738  H H    . GLN A 1 13 ? 3.217   9.354   -4.754  1.00 0.00 ? 13 GLN A H    5  
ATOM 3739  H HA   . GLN A 1 13 ? 3.432   10.771  -2.306  1.00 0.00 ? 13 GLN A HA   5  
ATOM 3740  H HB2  . GLN A 1 13 ? 1.235   8.949   -3.426  1.00 0.00 ? 13 GLN A HB2  5  
ATOM 3741  H HB3  . GLN A 1 13 ? 1.042   9.815   -1.914  1.00 0.00 ? 13 GLN A HB3  5  
ATOM 3742  H HG2  . GLN A 1 13 ? 1.630   11.354  -4.487  1.00 0.00 ? 13 GLN A HG2  5  
ATOM 3743  H HG3  . GLN A 1 13 ? 0.017   10.933  -3.969  1.00 0.00 ? 13 GLN A HG3  5  
ATOM 3744  H HE21 . GLN A 1 13 ? -0.960  12.642  -3.122  1.00 0.00 ? 13 GLN A HE21 5  
ATOM 3745  H HE22 . GLN A 1 13 ? -0.235  13.730  -1.986  1.00 0.00 ? 13 GLN A HE22 5  
ATOM 3746  N N    . PRO A 1 14 ? 3.554   9.128   -0.355  1.00 0.00 ? 14 PRO A N    5  
ATOM 3747  C CA   . PRO A 1 14 ? 3.862   8.199   0.725   1.00 0.00 ? 14 PRO A CA   5  
ATOM 3748  C C    . PRO A 1 14 ? 2.658   7.294   1.047   1.00 0.00 ? 14 PRO A C    5  
ATOM 3749  O O    . PRO A 1 14 ? 1.502   7.726   1.027   1.00 0.00 ? 14 PRO A O    5  
ATOM 3750  C CB   . PRO A 1 14 ? 4.196   9.108   1.914   1.00 0.00 ? 14 PRO A CB   5  
ATOM 3751  C CG   . PRO A 1 14 ? 3.435   10.411  1.643   1.00 0.00 ? 14 PRO A CG   5  
ATOM 3752  C CD   . PRO A 1 14 ? 3.387   10.505  0.115   1.00 0.00 ? 14 PRO A CD   5  
ATOM 3753  H HA   . PRO A 1 14 ? 4.722   7.581   0.459   1.00 0.00 ? 14 PRO A HA   5  
ATOM 3754  H HB2  . PRO A 1 14 ? 3.943   8.668   2.886   1.00 0.00 ? 14 PRO A HB2  5  
ATOM 3755  H HB3  . PRO A 1 14 ? 5.271   9.317   1.896   1.00 0.00 ? 14 PRO A HB3  5  
ATOM 3756  H HG2  . PRO A 1 14 ? 2.382   10.262  2.000   1.00 0.00 ? 14 PRO A HG2  5  
ATOM 3757  H HG3  . PRO A 1 14 ? 4.003   11.285  2.057   1.00 0.00 ? 14 PRO A HG3  5  
ATOM 3758  H HD2  . PRO A 1 14 ? 2.445   10.936  -0.225  1.00 0.00 ? 14 PRO A HD2  5  
ATOM 3759  H HD3  . PRO A 1 14 ? 4.210   11.119  -0.257  1.00 0.00 ? 14 PRO A HD3  5  
ATOM 3760  N N    . CYS A 1 15 ? 3.021   6.027   1.369   1.00 0.00 ? 15 CYS A N    5  
ATOM 3761  C CA   . CYS A 1 15 ? 2.063   4.976   1.738   1.00 0.00 ? 15 CYS A CA   5  
ATOM 3762  C C    . CYS A 1 15 ? 0.967   5.535   2.643   1.00 0.00 ? 15 CYS A C    5  
ATOM 3763  O O    . CYS A 1 15 ? 1.180   6.455   3.429   1.00 0.00 ? 15 CYS A O    5  
ATOM 3764  C CB   . CYS A 1 15 ? 2.778   3.913   2.572   1.00 0.00 ? 15 CYS A CB   5  
ATOM 3765  S SG   . CYS A 1 15 ? 3.803   2.812   1.575   1.00 0.00 ? 15 CYS A SG   5  
ATOM 3766  H H    . CYS A 1 15 ? 4.001   5.814   1.353   1.00 0.00 ? 15 CYS A H    5  
ATOM 3767  H HA   . CYS A 1 15 ? 1.590   4.562   0.842   1.00 0.00 ? 15 CYS A HA   5  
ATOM 3768  H HB2  . CYS A 1 15 ? 3.379   4.390   3.339   1.00 0.00 ? 15 CYS A HB2  5  
ATOM 3769  H HB3  . CYS A 1 15 ? 2.072   3.290   3.114   1.00 0.00 ? 15 CYS A HB3  5  
ATOM 3770  N N    . LYS A 1 16 ? -0.240  4.993   2.435   1.00 0.00 ? 16 LYS A N    5  
ATOM 3771  C CA   . LYS A 1 16 ? -1.413  5.503   3.121   1.00 0.00 ? 16 LYS A CA   5  
ATOM 3772  C C    . LYS A 1 16 ? -2.043  4.391   3.945   1.00 0.00 ? 16 LYS A C    5  
ATOM 3773  O O    . LYS A 1 16 ? -2.149  3.247   3.527   1.00 0.00 ? 16 LYS A O    5  
ATOM 3774  C CB   . LYS A 1 16 ? -2.384  6.015   2.043   1.00 0.00 ? 16 LYS A CB   5  
ATOM 3775  C CG   . LYS A 1 16 ? -3.422  7.074   2.517   1.00 0.00 ? 16 LYS A CG   5  
ATOM 3776  C CD   . LYS A 1 16 ? -2.814  8.485   2.616   1.00 0.00 ? 16 LYS A CD   5  
ATOM 3777  C CE   . LYS A 1 16 ? -1.553  8.761   3.457   1.00 0.00 ? 16 LYS A CE   5  
ATOM 3778  N NZ   . LYS A 1 16 ? -0.260  8.462   2.819   1.00 0.00 ? 16 LYS A NZ   5  
ATOM 3779  H H    . LYS A 1 16 ? -0.357  4.225   1.798   1.00 0.00 ? 16 LYS A H    5  
ATOM 3780  H HA   . LYS A 1 16 ? -1.050  6.279   3.797   1.00 0.00 ? 16 LYS A HA   5  
ATOM 3781  H HB2  . LYS A 1 16 ? -1.795  6.501   1.266   1.00 0.00 ? 16 LYS A HB2  5  
ATOM 3782  H HB3  . LYS A 1 16 ? -2.792  5.124   1.542   1.00 0.00 ? 16 LYS A HB3  5  
ATOM 3783  H HG2  . LYS A 1 16 ? -4.211  7.229   1.772   1.00 0.00 ? 16 LYS A HG2  5  
ATOM 3784  H HG3  . LYS A 1 16 ? -4.028  6.792   3.388   1.00 0.00 ? 16 LYS A HG3  5  
ATOM 3785  H HD2  . LYS A 1 16 ? -2.610  8.816   1.603   1.00 0.00 ? 16 LYS A HD2  5  
ATOM 3786  H HD3  . LYS A 1 16 ? -3.606  9.118   3.007   1.00 0.00 ? 16 LYS A HD3  5  
ATOM 3787  H HE2  . LYS A 1 16 ? -1.538  9.833   3.667   1.00 0.00 ? 16 LYS A HE2  5  
ATOM 3788  H HE3  . LYS A 1 16 ? -1.600  8.275   4.432   1.00 0.00 ? 16 LYS A HE3  5  
ATOM 3789  H HZ1  . LYS A 1 16 ? -0.203  8.687   1.802   1.00 0.00 ? 16 LYS A HZ1  5  
ATOM 3790  H HZ2  . LYS A 1 16 ? -0.008  7.456   2.904   1.00 0.00 ? 16 LYS A HZ2  5  
ATOM 3791  H HZ3  . LYS A 1 16 ? 0.514   8.960   3.299   1.00 0.00 ? 16 LYS A HZ3  5  
ATOM 3792  N N    . PHE A 1 17 ? -2.407  4.826   5.156   1.00 0.00 ? 17 PHE A N    5  
ATOM 3793  C CA   . PHE A 1 17 ? -3.035  3.949   6.131   1.00 0.00 ? 17 PHE A CA   5  
ATOM 3794  C C    . PHE A 1 17 ? -4.173  4.775   6.746   1.00 0.00 ? 17 PHE A C    5  
ATOM 3795  O O    . PHE A 1 17 ? -3.933  5.920   7.112   1.00 0.00 ? 17 PHE A O    5  
ATOM 3796  C CB   . PHE A 1 17 ? -2.015  3.555   7.223   1.00 0.00 ? 17 PHE A CB   5  
ATOM 3797  C CG   . PHE A 1 17 ? -0.809  2.832   6.671   1.00 0.00 ? 17 PHE A CG   5  
ATOM 3798  C CD1  . PHE A 1 17 ? -0.946  1.604   6.038   1.00 0.00 ? 17 PHE A CD1  5  
ATOM 3799  C CD2  . PHE A 1 17 ? 0.469   3.370   6.794   1.00 0.00 ? 17 PHE A CD2  5  
ATOM 3800  C CE1  . PHE A 1 17 ? 0.161   0.920   5.562   1.00 0.00 ? 17 PHE A CE1  5  
ATOM 3801  C CE2  . PHE A 1 17 ? 1.580   2.689   6.316   1.00 0.00 ? 17 PHE A CE2  5  
ATOM 3802  C CZ   . PHE A 1 17 ? 1.430   1.452   5.708   1.00 0.00 ? 17 PHE A CZ   5  
ATOM 3803  H H    . PHE A 1 17 ? -2.318  5.806   5.349   1.00 0.00 ? 17 PHE A H    5  
ATOM 3804  H HA   . PHE A 1 17 ? -3.422  3.081   5.596   1.00 0.00 ? 17 PHE A HA   5  
ATOM 3805  H HB2  . PHE A 1 17 ? -1.673  4.461   7.738   1.00 0.00 ? 17 PHE A HB2  5  
ATOM 3806  H HB3  . PHE A 1 17 ? -2.482  2.902   7.975   1.00 0.00 ? 17 PHE A HB3  5  
ATOM 3807  H HD1  . PHE A 1 17 ? -1.921  1.169   5.906   1.00 0.00 ? 17 PHE A HD1  5  
ATOM 3808  H HD2  . PHE A 1 17 ? 0.617   4.323   7.268   1.00 0.00 ? 17 PHE A HD2  5  
ATOM 3809  H HE1  . PHE A 1 17 ? 0.030   -0.029  5.076   1.00 0.00 ? 17 PHE A HE1  5  
ATOM 3810  H HE2  . PHE A 1 17 ? 2.556   3.131   6.424   1.00 0.00 ? 17 PHE A HE2  5  
ATOM 3811  H HZ   . PHE A 1 17 ? 2.289   0.895   5.359   1.00 0.00 ? 17 PHE A HZ   5  
ATOM 3812  N N    . PRO A 1 18 ? -5.403  4.207   6.853   1.00 0.00 ? 18 PRO A N    5  
ATOM 3813  C CA   . PRO A 1 18 ? -5.815  2.906   6.319   1.00 0.00 ? 18 PRO A CA   5  
ATOM 3814  C C    . PRO A 1 18 ? -6.066  2.992   4.802   1.00 0.00 ? 18 PRO A C    5  
ATOM 3815  O O    . PRO A 1 18 ? -6.754  3.895   4.344   1.00 0.00 ? 18 PRO A O    5  
ATOM 3816  C CB   . PRO A 1 18 ? -7.171  2.653   6.999   1.00 0.00 ? 18 PRO A CB   5  
ATOM 3817  C CG   . PRO A 1 18 ? -7.725  4.045   7.310   1.00 0.00 ? 18 PRO A CG   5  
ATOM 3818  C CD   . PRO A 1 18 ? -6.484  4.910   7.542   1.00 0.00 ? 18 PRO A CD   5  
ATOM 3819  H HA   . PRO A 1 18 ? -5.093  2.122   6.561   1.00 0.00 ? 18 PRO A HA   5  
ATOM 3820  H HB2  . PRO A 1 18 ? -7.860  2.044   6.410   1.00 0.00 ? 18 PRO A HB2  5  
ATOM 3821  H HB3  . PRO A 1 18 ? -7.023  2.128   7.939   1.00 0.00 ? 18 PRO A HB3  5  
ATOM 3822  H HG2  . PRO A 1 18 ? -8.273  4.418   6.445   1.00 0.00 ? 18 PRO A HG2  5  
ATOM 3823  H HG3  . PRO A 1 18 ? -8.403  4.044   8.164   1.00 0.00 ? 18 PRO A HG3  5  
ATOM 3824  H HD2  . PRO A 1 18 ? -6.616  5.919   7.141   1.00 0.00 ? 18 PRO A HD2  5  
ATOM 3825  H HD3  . PRO A 1 18 ? -6.247  4.967   8.608   1.00 0.00 ? 18 PRO A HD3  5  
ATOM 3826  N N    . PHE A 1 19 ? -5.515  2.013   4.058   1.00 0.00 ? 19 PHE A N    5  
ATOM 3827  C CA   . PHE A 1 19 ? -5.812  1.935   2.631   1.00 0.00 ? 19 PHE A CA   5  
ATOM 3828  C C    . PHE A 1 19 ? -6.746  0.726   2.464   1.00 0.00 ? 19 PHE A C    5  
ATOM 3829  O O    . PHE A 1 19 ? -6.443  -0.385  2.885   1.00 0.00 ? 19 PHE A O    5  
ATOM 3830  C CB   . PHE A 1 19 ? -4.586  1.800   1.705   1.00 0.00 ? 19 PHE A CB   5  
ATOM 3831  C CG   . PHE A 1 19 ? -3.794  0.495   1.860   1.00 0.00 ? 19 PHE A CG   5  
ATOM 3832  C CD1  . PHE A 1 19 ? -2.918  0.221   2.927   1.00 0.00 ? 19 PHE A CD1  5  
ATOM 3833  C CD2  . PHE A 1 19 ? -3.938  -0.478  0.861   1.00 0.00 ? 19 PHE A CD2  5  
ATOM 3834  C CE1  . PHE A 1 19 ? -2.165  -0.944  2.943   1.00 0.00 ? 19 PHE A CE1  5  
ATOM 3835  C CE2  . PHE A 1 19 ? -3.175  -1.667  0.888   1.00 0.00 ? 19 PHE A CE2  5  
ATOM 3836  C CZ   . PHE A 1 19 ? -2.279  -1.875  1.924   1.00 0.00 ? 19 PHE A CZ   5  
ATOM 3837  H H    . PHE A 1 19 ? -4.984  1.282   4.492   1.00 0.00 ? 19 PHE A H    5  
ATOM 3838  H HA   . PHE A 1 19 ? -6.333  2.844   2.325   1.00 0.00 ? 19 PHE A HA   5  
ATOM 3839  H HB2  . PHE A 1 19 ? -5.015  1.784   0.689   1.00 0.00 ? 19 PHE A HB2  5  
ATOM 3840  H HB3  . PHE A 1 19 ? -3.971  2.724   1.723   1.00 0.00 ? 19 PHE A HB3  5  
ATOM 3841  H HD1  . PHE A 1 19 ? -2.768  0.834   3.810   1.00 0.00 ? 19 PHE A HD1  5  
ATOM 3842  H HD2  . PHE A 1 19 ? -4.675  -0.218  0.094   1.00 0.00 ? 19 PHE A HD2  5  
ATOM 3843  H HE1  . PHE A 1 19 ? -1.492  -1.125  3.769   1.00 0.00 ? 19 PHE A HE1  5  
ATOM 3844  H HE2  . PHE A 1 19 ? -3.187  -2.493  0.168   1.00 0.00 ? 19 PHE A HE2  5  
ATOM 3845  H HZ   . PHE A 1 19 ? -1.669  -2.769  1.926   1.00 0.00 ? 19 PHE A HZ   5  
ATOM 3846  N N    . ARG A 1 20 ? -7.909  0.990   1.850   1.00 0.00 ? 20 ARG A N    5  
ATOM 3847  C CA   . ARG A 1 20 ? -8.868  -0.083  1.637   1.00 0.00 ? 20 ARG A CA   5  
ATOM 3848  C C    . ARG A 1 20 ? -8.532  -0.775  0.306   1.00 0.00 ? 20 ARG A C    5  
ATOM 3849  O O    . ARG A 1 20 ? -8.170  -0.119  -0.662  1.00 0.00 ? 20 ARG A O    5  
ATOM 3850  C CB   . ARG A 1 20 ? -10.300 0.503   1.701   1.00 0.00 ? 20 ARG A CB   5  
ATOM 3851  C CG   . ARG A 1 20 ? -11.042 0.645   0.358   1.00 0.00 ? 20 ARG A CG   5  
ATOM 3852  C CD   . ARG A 1 20 ? -11.848 -0.630  -0.036  1.00 0.00 ? 20 ARG A CD   5  
ATOM 3853  N NE   . ARG A 1 20 ? -12.862 -0.962  0.986   1.00 0.00 ? 20 ARG A NE   5  
ATOM 3854  C CZ   . ARG A 1 20 ? -14.069 -0.369  0.962   1.00 0.00 ? 20 ARG A CZ   5  
ATOM 3855  N NH1  . ARG A 1 20 ? -14.295 0.711   0.206   1.00 0.00 ? 20 ARG A NH1  5  
ATOM 3856  N NH2  . ARG A 1 20 ? -15.025 -0.915  1.711   1.00 0.00 ? 20 ARG A NH2  5  
ATOM 3857  H H    . ARG A 1 20 ? -8.128  1.920   1.550   1.00 0.00 ? 20 ARG A H    5  
ATOM 3858  H HA   . ARG A 1 20 ? -8.713  -0.801  2.443   1.00 0.00 ? 20 ARG A HA   5  
ATOM 3859  H HB2  . ARG A 1 20 ? -10.911 -0.077  2.393   1.00 0.00 ? 20 ARG A HB2  5  
ATOM 3860  H HB3  . ARG A 1 20 ? -10.258 1.495   2.158   1.00 0.00 ? 20 ARG A HB3  5  
ATOM 3861  H HG2  . ARG A 1 20 ? -11.693 1.515   0.453   1.00 0.00 ? 20 ARG A HG2  5  
ATOM 3862  H HG3  . ARG A 1 20 ? -10.353 0.961   -0.435  1.00 0.00 ? 20 ARG A HG3  5  
ATOM 3863  H HD2  . ARG A 1 20 ? -12.360 -0.520  -1.010  1.00 0.00 ? 20 ARG A HD2  5  
ATOM 3864  H HD3  . ARG A 1 20 ? -11.218 -1.524  -0.146  1.00 0.00 ? 20 ARG A HD3  5  
ATOM 3865  H HE   . ARG A 1 20 ? -12.768 -1.681  1.704   1.00 0.00 ? 20 ARG A HE   5  
ATOM 3866  H HH11 . ARG A 1 20 ? -13.557 1.130   -0.353  1.00 0.00 ? 20 ARG A HH11 5  
ATOM 3867  H HH12 . ARG A 1 20 ? -15.189 1.150   0.160   1.00 0.00 ? 20 ARG A HH12 5  
ATOM 3868  H HH21 . ARG A 1 20 ? -14.831 -1.792  2.177   1.00 0.00 ? 20 ARG A HH21 5  
ATOM 3869  H HH22 . ARG A 1 20 ? -15.927 -0.499  1.815   1.00 0.00 ? 20 ARG A HH22 5  
ATOM 3870  N N    . PHE A 1 21 ? -8.672  -2.108  0.312   1.00 0.00 ? 21 PHE A N    5  
ATOM 3871  C CA   . PHE A 1 21 ? -8.433  -2.908  -0.887  1.00 0.00 ? 21 PHE A CA   5  
ATOM 3872  C C    . PHE A 1 21 ? -9.289  -4.172  -0.726  1.00 0.00 ? 21 PHE A C    5  
ATOM 3873  O O    . PHE A 1 21 ? -9.546  -4.609  0.389   1.00 0.00 ? 21 PHE A O    5  
ATOM 3874  C CB   . PHE A 1 21 ? -6.928  -3.200  -1.009  1.00 0.00 ? 21 PHE A CB   5  
ATOM 3875  C CG   . PHE A 1 21 ? -6.608  -4.228  -2.057  1.00 0.00 ? 21 PHE A CG   5  
ATOM 3876  C CD1  . PHE A 1 21 ? -7.045  -4.057  -3.356  1.00 0.00 ? 21 PHE A CD1  5  
ATOM 3877  C CD2  . PHE A 1 21 ? -5.866  -5.354  -1.746  1.00 0.00 ? 21 PHE A CD2  5  
ATOM 3878  C CE1  . PHE A 1 21 ? -6.705  -4.948  -4.362  1.00 0.00 ? 21 PHE A CE1  5  
ATOM 3879  C CE2  . PHE A 1 21 ? -5.514  -6.254  -2.747  1.00 0.00 ? 21 PHE A CE2  5  
ATOM 3880  C CZ   . PHE A 1 21 ? -5.920  -6.049  -4.058  1.00 0.00 ? 21 PHE A CZ   5  
ATOM 3881  H H    . PHE A 1 21 ? -8.974  -2.561  1.165   1.00 0.00 ? 21 PHE A H    5  
ATOM 3882  H HA   . PHE A 1 21 ? -8.780  -2.379  -1.783  1.00 0.00 ? 21 PHE A HA   5  
ATOM 3883  H HB2  . PHE A 1 21 ? -6.397  -2.277  -1.260  1.00 0.00 ? 21 PHE A HB2  5  
ATOM 3884  H HB3  . PHE A 1 21 ? -6.527  -3.565  -0.068  1.00 0.00 ? 21 PHE A HB3  5  
ATOM 3885  H HD1  . PHE A 1 21 ? -7.684  -3.218  -3.539  1.00 0.00 ? 21 PHE A HD1  5  
ATOM 3886  H HD2  . PHE A 1 21 ? -5.601  -5.528  -0.711  1.00 0.00 ? 21 PHE A HD2  5  
ATOM 3887  H HE1  . PHE A 1 21 ? -7.056  -4.784  -5.371  1.00 0.00 ? 21 PHE A HE1  5  
ATOM 3888  H HE2  . PHE A 1 21 ? -4.923  -7.120  -2.506  1.00 0.00 ? 21 PHE A HE2  5  
ATOM 3889  H HZ   . PHE A 1 21 ? -5.634  -6.749  -4.830  1.00 0.00 ? 21 PHE A HZ   5  
ATOM 3890  N N    . GLN A 1 22 ? -9.746  -4.728  -1.864  1.00 0.00 ? 22 GLN A N    5  
ATOM 3891  C CA   . GLN A 1 22 ? -10.611 -5.907  -1.853  1.00 0.00 ? 22 GLN A CA   5  
ATOM 3892  C C    . GLN A 1 22 ? -11.836 -5.645  -0.933  1.00 0.00 ? 22 GLN A C    5  
ATOM 3893  O O    . GLN A 1 22 ? -12.295 -6.527  -0.213  1.00 0.00 ? 22 GLN A O    5  
ATOM 3894  C CB   . GLN A 1 22 ? -9.882  -7.205  -1.389  1.00 0.00 ? 22 GLN A CB   5  
ATOM 3895  C CG   . GLN A 1 22 ? -8.743  -7.711  -2.308  1.00 0.00 ? 22 GLN A CG   5  
ATOM 3896  C CD   . GLN A 1 22 ? -7.686  -8.484  -1.502  1.00 0.00 ? 22 GLN A CD   5  
ATOM 3897  O OE1  . GLN A 1 22 ? -6.928  -7.906  -0.739  1.00 0.00 ? 22 GLN A OE1  5  
ATOM 3898  N NE2  . GLN A 1 22 ? -7.651  -9.804  -1.718  1.00 0.00 ? 22 GLN A NE2  5  
ATOM 3899  H H    . GLN A 1 22 ? -9.541  -4.258  -2.729  1.00 0.00 ? 22 GLN A H    5  
ATOM 3900  H HA   . GLN A 1 22 ? -10.956 -5.998  -2.884  1.00 0.00 ? 22 GLN A HA   5  
ATOM 3901  H HB2  . GLN A 1 22 ? -9.510  -7.045  -0.375  1.00 0.00 ? 22 GLN A HB2  5  
ATOM 3902  H HB3  . GLN A 1 22 ? -10.603 -8.021  -1.319  1.00 0.00 ? 22 GLN A HB3  5  
ATOM 3903  H HG2  . GLN A 1 22 ? -9.103  -8.414  -3.086  1.00 0.00 ? 22 GLN A HG2  5  
ATOM 3904  H HG3  . GLN A 1 22 ? -8.243  -6.833  -2.742  1.00 0.00 ? 22 GLN A HG3  5  
ATOM 3905  H HE21 . GLN A 1 22 ? -8.270  -10.279 -2.337  1.00 0.00 ? 22 GLN A HE21 5  
ATOM 3906  H HE22 . GLN A 1 22 ? -6.954  -10.344 -1.229  1.00 0.00 ? 22 GLN A HE22 5  
ATOM 3907  N N    . GLY A 1 23 ? -12.312 -4.377  -0.938  1.00 0.00 ? 23 GLY A N    5  
ATOM 3908  C CA   . GLY A 1 23 ? -13.453 -4.011  -0.103  1.00 0.00 ? 23 GLY A CA   5  
ATOM 3909  C C    . GLY A 1 23 ? -13.131 -3.913  1.404   1.00 0.00 ? 23 GLY A C    5  
ATOM 3910  O O    . GLY A 1 23 ? -13.935 -3.400  2.180   1.00 0.00 ? 23 GLY A O    5  
ATOM 3911  H H    . GLY A 1 23 ? -11.908 -3.649  -1.504  1.00 0.00 ? 23 GLY A H    5  
ATOM 3912  H HA2  . GLY A 1 23 ? -13.800 -3.042  -0.469  1.00 0.00 ? 23 GLY A HA2  5  
ATOM 3913  H HA3  . GLY A 1 23 ? -14.236 -4.760  -0.259  1.00 0.00 ? 23 GLY A HA3  5  
ATOM 3914  N N    . THR A 1 24 ? -11.931 -4.399  1.765   1.00 0.00 ? 24 THR A N    5  
ATOM 3915  C CA   . THR A 1 24 ? -11.452 -4.524  3.132   1.00 0.00 ? 24 THR A CA   5  
ATOM 3916  C C    . THR A 1 24 ? -10.514 -3.345  3.446   1.00 0.00 ? 24 THR A C    5  
ATOM 3917  O O    . THR A 1 24 ? -10.197 -2.558  2.567   1.00 0.00 ? 24 THR A O    5  
ATOM 3918  C CB   . THR A 1 24 ? -10.732 -5.893  3.155   1.00 0.00 ? 24 THR A CB   5  
ATOM 3919  O OG1  . THR A 1 24 ? -11.574 -6.879  2.571   1.00 0.00 ? 24 THR A OG1  5  
ATOM 3920  C CG2  . THR A 1 24 ? -10.389 -6.390  4.565   1.00 0.00 ? 24 THR A CG2  5  
ATOM 3921  H H    . THR A 1 24 ? -11.285 -4.740  1.081   1.00 0.00 ? 24 THR A H    5  
ATOM 3922  H HA   . THR A 1 24 ? -12.313 -4.513  3.804   1.00 0.00 ? 24 THR A HA   5  
ATOM 3923  H HB   . THR A 1 24 ? -9.793  -5.847  2.588   1.00 0.00 ? 24 THR A HB   5  
ATOM 3924  H HG1  . THR A 1 24 ? -11.798 -6.662  1.662   1.00 0.00 ? 24 THR A HG1  5  
ATOM 3925  H HG21 . THR A 1 24 ? -9.619  -5.782  5.038   1.00 0.00 ? 24 THR A HG21 5  
ATOM 3926  H HG22 . THR A 1 24 ? -10.003 -7.409  4.521   1.00 0.00 ? 24 THR A HG22 5  
ATOM 3927  H HG23 . THR A 1 24 ? -11.269 -6.398  5.207   1.00 0.00 ? 24 THR A HG23 5  
ATOM 3928  N N    . SER A 1 25 ? -10.122 -3.240  4.730   1.00 0.00 ? 25 SER A N    5  
ATOM 3929  C CA   . SER A 1 25 ? -9.274  -2.164  5.236   1.00 0.00 ? 25 SER A CA   5  
ATOM 3930  C C    . SER A 1 25 ? -7.902  -2.722  5.649   1.00 0.00 ? 25 SER A C    5  
ATOM 3931  O O    . SER A 1 25 ? -7.851  -3.674  6.420   1.00 0.00 ? 25 SER A O    5  
ATOM 3932  C CB   . SER A 1 25 ? -9.965  -1.677  6.515   1.00 0.00 ? 25 SER A CB   5  
ATOM 3933  O OG   . SER A 1 25 ? -10.297 -2.795  7.325   1.00 0.00 ? 25 SER A OG   5  
ATOM 3934  H H    . SER A 1 25 ? -10.417 -3.896  5.426   1.00 0.00 ? 25 SER A H    5  
ATOM 3935  H HA   . SER A 1 25 ? -9.175  -1.371  4.495   1.00 0.00 ? 25 SER A HA   5  
ATOM 3936  H HB2  . SER A 1 25 ? -9.353  -0.960  7.078   1.00 0.00 ? 25 SER A HB2  5  
ATOM 3937  H HB3  . SER A 1 25 ? -10.895 -1.164  6.266   1.00 0.00 ? 25 SER A HB3  5  
ATOM 3938  H HG   . SER A 1 25 ? -9.499  -3.305  7.491   1.00 0.00 ? 25 SER A HG   5  
ATOM 3939  N N    . TYR A 1 26 ? -6.828  -2.082  5.141   1.00 0.00 ? 26 TYR A N    5  
ATOM 3940  C CA   . TYR A 1 26 ? -5.464  -2.477  5.483   1.00 0.00 ? 26 TYR A CA   5  
ATOM 3941  C C    . TYR A 1 26 ? -4.726  -1.281  6.109   1.00 0.00 ? 26 TYR A C    5  
ATOM 3942  O O    . TYR A 1 26 ? -4.690  -0.190  5.555   1.00 0.00 ? 26 TYR A O    5  
ATOM 3943  C CB   . TYR A 1 26 ? -4.702  -2.892  4.217   1.00 0.00 ? 26 TYR A CB   5  
ATOM 3944  C CG   . TYR A 1 26 ? -5.300  -4.097  3.548   1.00 0.00 ? 26 TYR A CG   5  
ATOM 3945  C CD1  . TYR A 1 26 ? -4.899  -5.375  3.913   1.00 0.00 ? 26 TYR A CD1  5  
ATOM 3946  C CD2  . TYR A 1 26 ? -6.259  -3.957  2.552   1.00 0.00 ? 26 TYR A CD2  5  
ATOM 3947  C CE1  . TYR A 1 26 ? -5.473  -6.484  3.314   1.00 0.00 ? 26 TYR A CE1  5  
ATOM 3948  C CE2  . TYR A 1 26 ? -6.820  -5.076  1.954   1.00 0.00 ? 26 TYR A CE2  5  
ATOM 3949  C CZ   . TYR A 1 26 ? -6.455  -6.342  2.364   1.00 0.00 ? 26 TYR A CZ   5  
ATOM 3950  O OH   . TYR A 1 26 ? -7.060  -7.472  1.866   1.00 0.00 ? 26 TYR A OH   5  
ATOM 3951  H H    . TYR A 1 26 ? -6.908  -1.307  4.509   1.00 0.00 ? 26 TYR A H    5  
ATOM 3952  H HA   . TYR A 1 26 ? -5.490  -3.300  6.200   1.00 0.00 ? 26 TYR A HA   5  
ATOM 3953  H HB2  . TYR A 1 26 ? -4.701  -2.063  3.503   1.00 0.00 ? 26 TYR A HB2  5  
ATOM 3954  H HB3  . TYR A 1 26 ? -3.667  -3.130  4.482   1.00 0.00 ? 26 TYR A HB3  5  
ATOM 3955  H HD1  . TYR A 1 26 ? -4.141  -5.516  4.665   1.00 0.00 ? 26 TYR A HD1  5  
ATOM 3956  H HD2  . TYR A 1 26 ? -6.574  -2.976  2.229   1.00 0.00 ? 26 TYR A HD2  5  
ATOM 3957  H HE1  . TYR A 1 26 ? -5.176  -7.481  3.545   1.00 0.00 ? 26 TYR A HE1  5  
ATOM 3958  H HE2  . TYR A 1 26 ? -7.514  -4.957  1.144   1.00 0.00 ? 26 TYR A HE2  5  
ATOM 3959  H HH   . TYR A 1 26 ? -6.967  -7.512  0.920   1.00 0.00 ? 26 TYR A HH   5  
ATOM 3960  N N    . ASP A 1 27 ? -4.104  -1.571  7.264   1.00 0.00 ? 27 ASP A N    5  
ATOM 3961  C CA   . ASP A 1 27 ? -3.303  -0.579  7.984   1.00 0.00 ? 27 ASP A CA   5  
ATOM 3962  C C    . ASP A 1 27 ? -1.863  -1.102  8.094   1.00 0.00 ? 27 ASP A C    5  
ATOM 3963  O O    . ASP A 1 27 ? -1.143  -0.831  9.047   1.00 0.00 ? 27 ASP A O    5  
ATOM 3964  C CB   . ASP A 1 27 ? -3.912  -0.337  9.374   1.00 0.00 ? 27 ASP A CB   5  
ATOM 3965  C CG   . ASP A 1 27 ? -5.171  0.524   9.242   1.00 0.00 ? 27 ASP A CG   5  
ATOM 3966  O OD1  . ASP A 1 27 ? -6.248  -0.032  9.028   1.00 0.00 ? 27 ASP A OD1  5  
ATOM 3967  O OD2  . ASP A 1 27 ? -5.051  1.744   9.343   1.00 0.00 ? 27 ASP A OD2  5  
ATOM 3968  H H    . ASP A 1 27 ? -4.196  -2.483  7.661   1.00 0.00 ? 27 ASP A H    5  
ATOM 3969  H HA   . ASP A 1 27 ? -3.282  0.361   7.429   1.00 0.00 ? 27 ASP A HA   5  
ATOM 3970  H HB2  . ASP A 1 27 ? -4.157  -1.275  9.873   1.00 0.00 ? 27 ASP A HB2  5  
ATOM 3971  H HB3  . ASP A 1 27 ? -3.212  0.194   10.020  1.00 0.00 ? 27 ASP A HB3  5  
ATOM 3972  N N    . SER A 1 28 ? -1.485  -1.891  7.069   1.00 0.00 ? 28 SER A N    5  
ATOM 3973  C CA   . SER A 1 28 ? -0.166  -2.493  7.088   1.00 0.00 ? 28 SER A CA   5  
ATOM 3974  C C    . SER A 1 28 ? 0.150   -3.009  5.683   1.00 0.00 ? 28 SER A C    5  
ATOM 3975  O O    . SER A 1 28 ? -0.744  -3.288  4.893   1.00 0.00 ? 28 SER A O    5  
ATOM 3976  C CB   . SER A 1 28 ? -0.202  -3.683  8.077   1.00 0.00 ? 28 SER A CB   5  
ATOM 3977  O OG   . SER A 1 28 ? -1.300  -4.535  7.788   1.00 0.00 ? 28 SER A OG   5  
ATOM 3978  H H    . SER A 1 28 ? -2.080  -2.116  6.298   1.00 0.00 ? 28 SER A H    5  
ATOM 3979  H HA   . SER A 1 28 ? 0.570   -1.724  7.344   1.00 0.00 ? 28 SER A HA   5  
ATOM 3980  H HB2  . SER A 1 28 ? 0.741   -4.267  8.029   1.00 0.00 ? 28 SER A HB2  5  
ATOM 3981  H HB3  . SER A 1 28 ? -0.388  -3.314  9.106   1.00 0.00 ? 28 SER A HB3  5  
ATOM 3982  H HG   . SER A 1 28 ? -1.289  -4.788  6.868   1.00 0.00 ? 28 SER A HG   5  
ATOM 3983  N N    . CYS A 1 29 ? 1.467   -3.151  5.464   1.00 0.00 ? 29 CYS A N    5  
ATOM 3984  C CA   . CYS A 1 29 ? 2.022   -3.684  4.222   1.00 0.00 ? 29 CYS A CA   5  
ATOM 3985  C C    . CYS A 1 29 ? 1.386   -5.040  3.835   1.00 0.00 ? 29 CYS A C    5  
ATOM 3986  O O    . CYS A 1 29 ? 1.420   -5.977  4.630   1.00 0.00 ? 29 CYS A O    5  
ATOM 3987  C CB   . CYS A 1 29 ? 3.495   -3.941  4.536   1.00 0.00 ? 29 CYS A CB   5  
ATOM 3988  S SG   . CYS A 1 29 ? 4.348   -2.438  5.054   1.00 0.00 ? 29 CYS A SG   5  
ATOM 3989  H H    . CYS A 1 29 ? 2.105   -2.856  6.180   1.00 0.00 ? 29 CYS A H    5  
ATOM 3990  H HA   . CYS A 1 29 ? 1.904   -2.938  3.435   1.00 0.00 ? 29 CYS A HA   5  
ATOM 3991  H HB2  . CYS A 1 29 ? 3.590   -4.680  5.342   1.00 0.00 ? 29 CYS A HB2  5  
ATOM 3992  H HB3  . CYS A 1 29 ? 4.002   -4.333  3.656   1.00 0.00 ? 29 CYS A HB3  5  
ATOM 3993  N N    . THR A 1 30 ? 0.818   -5.120  2.607   1.00 0.00 ? 30 THR A N    5  
ATOM 3994  C CA   . THR A 1 30 ? 0.167   -6.359  2.176   1.00 0.00 ? 30 THR A CA   5  
ATOM 3995  C C    . THR A 1 30 ? 0.887   -6.927  0.948   1.00 0.00 ? 30 THR A C    5  
ATOM 3996  O O    . THR A 1 30 ? 1.690   -6.268  0.303   1.00 0.00 ? 30 THR A O    5  
ATOM 3997  C CB   . THR A 1 30 ? -1.330  -6.120  1.890   1.00 0.00 ? 30 THR A CB   5  
ATOM 3998  O OG1  . THR A 1 30 ? -1.950  -7.392  1.747   1.00 0.00 ? 30 THR A OG1  5  
ATOM 3999  C CG2  . THR A 1 30 ? -1.582  -5.287  0.614   1.00 0.00 ? 30 THR A CG2  5  
ATOM 4000  H H    . THR A 1 30 ? 0.833   -4.367  1.939   1.00 0.00 ? 30 THR A H    5  
ATOM 4001  H HA   . THR A 1 30 ? 0.233   -7.096  2.975   1.00 0.00 ? 30 THR A HA   5  
ATOM 4002  H HB   . THR A 1 30 ? -1.734  -5.611  2.780   1.00 0.00 ? 30 THR A HB   5  
ATOM 4003  H HG1  . THR A 1 30 ? -2.900  -7.291  1.694   1.00 0.00 ? 30 THR A HG1  5  
ATOM 4004  H HG21 . THR A 1 30 ? -1.368  -5.874  -0.281  1.00 0.00 ? 30 THR A HG21 5  
ATOM 4005  H HG22 . THR A 1 30 ? -0.947  -4.401  0.564   1.00 0.00 ? 30 THR A HG22 5  
ATOM 4006  H HG23 . THR A 1 30 ? -2.618  -4.954  0.534   1.00 0.00 ? 30 THR A HG23 5  
ATOM 4007  N N    . THR A 1 31 ? 0.510   -8.185  0.674   1.00 0.00 ? 31 THR A N    5  
ATOM 4008  C CA   . THR A 1 31 ? 0.985   -8.908  -0.503  1.00 0.00 ? 31 THR A CA   5  
ATOM 4009  C C    . THR A 1 31 ? -0.199  -9.333  -1.393  1.00 0.00 ? 31 THR A C    5  
ATOM 4010  O O    . THR A 1 31 ? -0.006  -9.919  -2.451  1.00 0.00 ? 31 THR A O    5  
ATOM 4011  C CB   . THR A 1 31 ? 1.852   -10.117 -0.077  1.00 0.00 ? 31 THR A CB   5  
ATOM 4012  O OG1  . THR A 1 31 ? 1.670   -10.417 1.308   1.00 0.00 ? 31 THR A OG1  5  
ATOM 4013  C CG2  . THR A 1 31 ? 3.334   -9.819  -0.323  1.00 0.00 ? 31 THR A CG2  5  
ATOM 4014  H H    . THR A 1 31 ? -0.138  -8.575  1.329   1.00 0.00 ? 31 THR A H    5  
ATOM 4015  H HA   . THR A 1 31 ? 1.574   -8.222  -1.116  1.00 0.00 ? 31 THR A HA   5  
ATOM 4016  H HB   . THR A 1 31 ? 1.627   -11.000 -0.693  1.00 0.00 ? 31 THR A HB   5  
ATOM 4017  H HG1  . THR A 1 31 ? 0.783   -10.758 1.431   1.00 0.00 ? 31 THR A HG1  5  
ATOM 4018  H HG21 . THR A 1 31 ? 3.610   -8.871  0.126   1.00 0.00 ? 31 THR A HG21 5  
ATOM 4019  H HG22 . THR A 1 31 ? 3.546   -9.734  -1.390  1.00 0.00 ? 31 THR A HG22 5  
ATOM 4020  H HG23 . THR A 1 31 ? 3.982   -10.601 0.073   1.00 0.00 ? 31 THR A HG23 5  
ATOM 4021  N N    . GLU A 1 32 ? -1.433  -9.022  -0.937  1.00 0.00 ? 32 GLU A N    5  
ATOM 4022  C CA   . GLU A 1 32 ? -2.592  -9.413  -1.727  1.00 0.00 ? 32 GLU A CA   5  
ATOM 4023  C C    . GLU A 1 32 ? -2.530  -8.727  -3.100  1.00 0.00 ? 32 GLU A C    5  
ATOM 4024  O O    . GLU A 1 32 ? -2.421  -7.512  -3.194  1.00 0.00 ? 32 GLU A O    5  
ATOM 4025  C CB   . GLU A 1 32 ? -3.875  -9.017  -0.978  1.00 0.00 ? 32 GLU A CB   5  
ATOM 4026  C CG   . GLU A 1 32 ? -4.131  -9.854  0.284   1.00 0.00 ? 32 GLU A CG   5  
ATOM 4027  C CD   . GLU A 1 32 ? -4.450  -11.303 -0.108  1.00 0.00 ? 32 GLU A CD   5  
ATOM 4028  O OE1  . GLU A 1 32 ? -5.551  -11.547 -0.600  1.00 0.00 ? 32 GLU A OE1  5  
ATOM 4029  O OE2  . GLU A 1 32 ? -3.588  -12.162 0.066   1.00 0.00 ? 32 GLU A OE2  5  
ATOM 4030  H H    . GLU A 1 32 ? -1.622  -8.516  -0.097  1.00 0.00 ? 32 GLU A H    5  
ATOM 4031  H HA   . GLU A 1 32 ? -2.540  -10.496 -1.858  1.00 0.00 ? 32 GLU A HA   5  
ATOM 4032  H HB2  . GLU A 1 32 ? -3.835  -7.961  -0.713  1.00 0.00 ? 32 GLU A HB2  5  
ATOM 4033  H HB3  . GLU A 1 32 ? -4.736  -9.132  -1.638  1.00 0.00 ? 32 GLU A HB3  5  
ATOM 4034  H HG2  . GLU A 1 32 ? -3.277  -9.838  0.961   1.00 0.00 ? 32 GLU A HG2  5  
ATOM 4035  H HG3  . GLU A 1 32 ? -4.985  -9.455  0.834   1.00 0.00 ? 32 GLU A HG3  5  
ATOM 4036  N N    . GLY A 1 33 ? -2.586  -9.573  -4.144  1.00 0.00 ? 33 GLY A N    5  
ATOM 4037  C CA   . GLY A 1 33 ? -2.549  -9.067  -5.512  1.00 0.00 ? 33 GLY A CA   5  
ATOM 4038  C C    . GLY A 1 33 ? -1.173  -9.213  -6.179  1.00 0.00 ? 33 GLY A C    5  
ATOM 4039  O O    . GLY A 1 33 ? -1.076  -9.103  -7.394  1.00 0.00 ? 33 GLY A O    5  
ATOM 4040  H H    . GLY A 1 33 ? -2.663  -10.553 -3.960  1.00 0.00 ? 33 GLY A H    5  
ATOM 4041  H HA2  . GLY A 1 33 ? -3.274  -9.659  -6.076  1.00 0.00 ? 33 GLY A HA2  5  
ATOM 4042  H HA3  . GLY A 1 33 ? -2.852  -8.014  -5.530  1.00 0.00 ? 33 GLY A HA3  5  
ATOM 4043  N N    . ARG A 1 34 ? -0.125  -9.470  -5.365  1.00 0.00 ? 34 ARG A N    5  
ATOM 4044  C CA   . ARG A 1 34 ? 1.207   -9.636  -5.985  1.00 0.00 ? 34 ARG A CA   5  
ATOM 4045  C C    . ARG A 1 34 ? 1.722   -11.051 -5.699  1.00 0.00 ? 34 ARG A C    5  
ATOM 4046  O O    . ARG A 1 34 ? 1.770   -11.509 -4.566  1.00 0.00 ? 34 ARG A O    5  
ATOM 4047  C CB   . ARG A 1 34 ? 2.209   -8.633  -5.403  1.00 0.00 ? 34 ARG A CB   5  
ATOM 4048  C CG   . ARG A 1 34 ? 1.858   -7.178  -5.756  1.00 0.00 ? 34 ARG A CG   5  
ATOM 4049  C CD   . ARG A 1 34 ? 3.076   -6.233  -5.630  1.00 0.00 ? 34 ARG A CD   5  
ATOM 4050  N NE   . ARG A 1 34 ? 3.926   -6.342  -6.830  1.00 0.00 ? 34 ARG A NE   5  
ATOM 4051  C CZ   . ARG A 1 34 ? 4.042   -5.376  -7.774  1.00 0.00 ? 34 ARG A CZ   5  
ATOM 4052  N NH1  . ARG A 1 34 ? 3.355   -4.243  -7.682  1.00 0.00 ? 34 ARG A NH1  5  
ATOM 4053  N NH2  . ARG A 1 34 ? 4.855   -5.572  -8.804  1.00 0.00 ? 34 ARG A NH2  5  
ATOM 4054  H H    . ARG A 1 34 ? -0.265  -9.560  -4.361  1.00 0.00 ? 34 ARG A H    5  
ATOM 4055  H HA   . ARG A 1 34 ? 1.192   -9.497  -7.088  1.00 0.00 ? 34 ARG A HA   5  
ATOM 4056  H HB2  . ARG A 1 34 ? 2.231   -8.740  -4.291  1.00 0.00 ? 34 ARG A HB2  5  
ATOM 4057  H HB3  . ARG A 1 34 ? 3.178   -8.871  -5.892  1.00 0.00 ? 34 ARG A HB3  5  
ATOM 4058  H HG2  . ARG A 1 34 ? 1.479   -7.121  -6.778  1.00 0.00 ? 34 ARG A HG2  5  
ATOM 4059  H HG3  . ARG A 1 34 ? 1.019   -6.869  -5.126  1.00 0.00 ? 34 ARG A HG3  5  
ATOM 4060  H HD2  . ARG A 1 34 ? 2.760   -5.192  -5.499  1.00 0.00 ? 34 ARG A HD2  5  
ATOM 4061  H HD3  . ARG A 1 34 ? 3.709   -6.496  -4.770  1.00 0.00 ? 34 ARG A HD3  5  
ATOM 4062  H HE   . ARG A 1 34 ? 4.472   -7.183  -6.988  1.00 0.00 ? 34 ARG A HE   5  
ATOM 4063  H HH11 . ARG A 1 34 ? 2.699   -4.138  -6.937  1.00 0.00 ? 34 ARG A HH11 5  
ATOM 4064  H HH12 . ARG A 1 34 ? 3.462   -3.467  -8.324  1.00 0.00 ? 34 ARG A HH12 5  
ATOM 4065  H HH21 . ARG A 1 34 ? 5.343   -6.456  -8.863  1.00 0.00 ? 34 ARG A HH21 5  
ATOM 4066  H HH22 . ARG A 1 34 ? 4.994   -4.889  -9.518  1.00 0.00 ? 34 ARG A HH22 5  
ATOM 4067  N N    . THR A 1 35 ? 2.143   -11.690 -6.800  1.00 0.00 ? 35 THR A N    5  
ATOM 4068  C CA   . THR A 1 35 ? 2.691   -13.035 -6.761  1.00 0.00 ? 35 THR A CA   5  
ATOM 4069  C C    . THR A 1 35 ? 4.199   -13.000 -7.073  1.00 0.00 ? 35 THR A C    5  
ATOM 4070  O O    . THR A 1 35 ? 4.811   -14.024 -7.348  1.00 0.00 ? 35 THR A O    5  
ATOM 4071  C CB   . THR A 1 35 ? 1.926   -13.839 -7.822  1.00 0.00 ? 35 THR A CB   5  
ATOM 4072  O OG1  . THR A 1 35 ? 1.799   -12.993 -8.958  1.00 0.00 ? 35 THR A OG1  5  
ATOM 4073  C CG2  . THR A 1 35 ? 0.534   -14.243 -7.309  1.00 0.00 ? 35 THR A CG2  5  
ATOM 4074  H H    . THR A 1 35 ? 2.060   -11.309 -7.723  1.00 0.00 ? 35 THR A H    5  
ATOM 4075  H HA   . THR A 1 35 ? 2.558   -13.467 -5.767  1.00 0.00 ? 35 THR A HA   5  
ATOM 4076  H HB   . THR A 1 35 ? 2.497   -14.742 -8.074  1.00 0.00 ? 35 THR A HB   5  
ATOM 4077  H HG1  . THR A 1 35 ? 1.354   -13.450 -9.666  1.00 0.00 ? 35 THR A HG1  5  
ATOM 4078  H HG21 . THR A 1 35 ? 0.614   -14.812 -6.382  1.00 0.00 ? 35 THR A HG21 5  
ATOM 4079  H HG22 . THR A 1 35 ? 0.000   -14.868 -8.025  1.00 0.00 ? 35 THR A HG22 5  
ATOM 4080  H HG23 . THR A 1 35 ? -0.082  -13.366 -7.103  1.00 0.00 ? 35 THR A HG23 5  
ATOM 4081  N N    . ASP A 1 36 ? 4.762   -11.773 -6.990  1.00 0.00 ? 36 ASP A N    5  
ATOM 4082  C CA   . ASP A 1 36 ? 6.181   -11.554 -7.263  1.00 0.00 ? 36 ASP A CA   5  
ATOM 4083  C C    . ASP A 1 36 ? 6.981   -11.325 -5.962  1.00 0.00 ? 36 ASP A C    5  
ATOM 4084  O O    . ASP A 1 36 ? 8.187   -11.115 -5.997  1.00 0.00 ? 36 ASP A O    5  
ATOM 4085  C CB   . ASP A 1 36 ? 6.341   -10.378 -8.248  1.00 0.00 ? 36 ASP A CB   5  
ATOM 4086  C CG   . ASP A 1 36 ? 5.804   -9.028  -7.741  1.00 0.00 ? 36 ASP A CG   5  
ATOM 4087  O OD1  . ASP A 1 36 ? 5.443   -8.907  -6.575  1.00 0.00 ? 36 ASP A OD1  5  
ATOM 4088  O OD2  . ASP A 1 36 ? 5.748   -8.083  -8.523  1.00 0.00 ? 36 ASP A OD2  5  
ATOM 4089  H H    . ASP A 1 36 ? 4.229   -10.952 -6.783  1.00 0.00 ? 36 ASP A H    5  
ATOM 4090  H HA   . ASP A 1 36 ? 6.589   -12.452 -7.731  1.00 0.00 ? 36 ASP A HA   5  
ATOM 4091  H HB2  . ASP A 1 36 ? 7.393   -10.248 -8.503  1.00 0.00 ? 36 ASP A HB2  5  
ATOM 4092  H HB3  . ASP A 1 36 ? 5.822   -10.614 -9.178  1.00 0.00 ? 36 ASP A HB3  5  
ATOM 4093  N N    . GLY A 1 37 ? 6.262   -11.419 -4.819  1.00 0.00 ? 37 GLY A N    5  
ATOM 4094  C CA   . GLY A 1 37 ? 6.909   -11.324 -3.513  1.00 0.00 ? 37 GLY A CA   5  
ATOM 4095  C C    . GLY A 1 37 ? 6.669   -9.997  -2.789  1.00 0.00 ? 37 GLY A C    5  
ATOM 4096  O O    . GLY A 1 37 ? 6.383   -9.960  -1.598  1.00 0.00 ? 37 GLY A O    5  
ATOM 4097  H H    . GLY A 1 37 ? 5.279   -11.578 -4.856  1.00 0.00 ? 37 GLY A H    5  
ATOM 4098  H HA2  . GLY A 1 37 ? 6.522   -12.145 -2.905  1.00 0.00 ? 37 GLY A HA2  5  
ATOM 4099  H HA3  . GLY A 1 37 ? 7.993   -11.440 -3.641  1.00 0.00 ? 37 GLY A HA3  5  
ATOM 4100  N N    . TYR A 1 38 ? 6.882   -8.928  -3.571  1.00 0.00 ? 38 TYR A N    5  
ATOM 4101  C CA   . TYR A 1 38 ? 6.951   -7.585  -3.000  1.00 0.00 ? 38 TYR A CA   5  
ATOM 4102  C C    . TYR A 1 38 ? 5.706   -7.149  -2.216  1.00 0.00 ? 38 TYR A C    5  
ATOM 4103  O O    . TYR A 1 38 ? 4.567   -7.290  -2.648  1.00 0.00 ? 38 TYR A O    5  
ATOM 4104  C CB   . TYR A 1 38 ? 7.409   -6.567  -4.058  1.00 0.00 ? 38 TYR A CB   5  
ATOM 4105  C CG   . TYR A 1 38 ? 8.500   -7.195  -4.884  1.00 0.00 ? 38 TYR A CG   5  
ATOM 4106  C CD1  . TYR A 1 38 ? 9.675   -7.639  -4.298  1.00 0.00 ? 38 TYR A CD1  5  
ATOM 4107  C CD2  . TYR A 1 38 ? 8.325   -7.437  -6.234  1.00 0.00 ? 38 TYR A CD2  5  
ATOM 4108  C CE1  . TYR A 1 38 ? 10.604  -8.355  -5.017  1.00 0.00 ? 38 TYR A CE1  5  
ATOM 4109  C CE2  . TYR A 1 38 ? 9.253   -8.152  -6.956  1.00 0.00 ? 38 TYR A CE2  5  
ATOM 4110  C CZ   . TYR A 1 38 ? 10.398  -8.632  -6.353  1.00 0.00 ? 38 TYR A CZ   5  
ATOM 4111  O OH   . TYR A 1 38 ? 11.307  -9.388  -7.060  1.00 0.00 ? 38 TYR A OH   5  
ATOM 4112  H H    . TYR A 1 38 ? 7.074   -9.075  -4.543  1.00 0.00 ? 38 TYR A H    5  
ATOM 4113  H HA   . TYR A 1 38 ? 7.759   -7.672  -2.282  1.00 0.00 ? 38 TYR A HA   5  
ATOM 4114  H HB2  . TYR A 1 38 ? 6.577   -6.270  -4.699  1.00 0.00 ? 38 TYR A HB2  5  
ATOM 4115  H HB3  . TYR A 1 38 ? 7.781   -5.660  -3.579  1.00 0.00 ? 38 TYR A HB3  5  
ATOM 4116  H HD1  . TYR A 1 38 ? 9.899   -7.487  -3.265  1.00 0.00 ? 38 TYR A HD1  5  
ATOM 4117  H HD2  . TYR A 1 38 ? 7.460   -7.118  -6.769  1.00 0.00 ? 38 TYR A HD2  5  
ATOM 4118  H HE1  . TYR A 1 38 ? 11.453  -8.703  -4.477  1.00 0.00 ? 38 TYR A HE1  5  
ATOM 4119  H HE2  . TYR A 1 38 ? 9.010   -8.329  -7.977  1.00 0.00 ? 38 TYR A HE2  5  
ATOM 4120  H HH   . TYR A 1 38 ? 10.867  -10.176 -7.355  1.00 0.00 ? 38 TYR A HH   5  
ATOM 4121  N N    . ARG A 1 39 ? 6.023   -6.595  -1.031  1.00 0.00 ? 39 ARG A N    5  
ATOM 4122  C CA   . ARG A 1 39 ? 4.935   -6.086  -0.169  1.00 0.00 ? 39 ARG A CA   5  
ATOM 4123  C C    . ARG A 1 39 ? 4.655   -4.637  -0.603  1.00 0.00 ? 39 ARG A C    5  
ATOM 4124  O O    . ARG A 1 39 ? 5.574   -3.838  -0.745  1.00 0.00 ? 39 ARG A O    5  
ATOM 4125  C CB   . ARG A 1 39 ? 5.399   -6.159  1.299   1.00 0.00 ? 39 ARG A CB   5  
ATOM 4126  C CG   . ARG A 1 39 ? 5.885   -7.558  1.723   1.00 0.00 ? 39 ARG A CG   5  
ATOM 4127  C CD   . ARG A 1 39 ? 5.830   -7.781  3.253   1.00 0.00 ? 39 ARG A CD   5  
ATOM 4128  N NE   . ARG A 1 39 ? 4.466   -7.682  3.781   1.00 0.00 ? 39 ARG A NE   5  
ATOM 4129  C CZ   . ARG A 1 39 ? 3.486   -8.562  3.474   1.00 0.00 ? 39 ARG A CZ   5  
ATOM 4130  N NH1  . ARG A 1 39 ? 3.738   -9.604  2.694   1.00 0.00 ? 39 ARG A NH1  5  
ATOM 4131  N NH2  . ARG A 1 39 ? 2.258   -8.378  3.942   1.00 0.00 ? 39 ARG A NH2  5  
ATOM 4132  H H    . ARG A 1 39 ? 7.031   -6.540  -0.845  1.00 0.00 ? 39 ARG A H    5  
ATOM 4133  H HA   . ARG A 1 39 ? 3.989   -6.661  -0.297  1.00 0.00 ? 39 ARG A HA   5  
ATOM 4134  H HB2  . ARG A 1 39 ? 6.206   -5.446  1.476   1.00 0.00 ? 39 ARG A HB2  5  
ATOM 4135  H HB3  . ARG A 1 39 ? 4.578   -5.839  1.934   1.00 0.00 ? 39 ARG A HB3  5  
ATOM 4136  H HG2  . ARG A 1 39 ? 5.272   -8.314  1.229   1.00 0.00 ? 39 ARG A HG2  5  
ATOM 4137  H HG3  . ARG A 1 39 ? 6.912   -7.700  1.352   1.00 0.00 ? 39 ARG A HG3  5  
ATOM 4138  H HD2  . ARG A 1 39 ? 6.223   -8.756  3.551   1.00 0.00 ? 39 ARG A HD2  5  
ATOM 4139  H HD3  . ARG A 1 39 ? 6.409   -7.023  3.786   1.00 0.00 ? 39 ARG A HD3  5  
ATOM 4140  H HE   . ARG A 1 39 ? 4.291   -6.915  4.399   1.00 0.00 ? 39 ARG A HE   5  
ATOM 4141  H HH11 . ARG A 1 39 ? 4.684   -9.820  2.453   1.00 0.00 ? 39 ARG A HH11 5  
ATOM 4142  H HH12 . ARG A 1 39 ? 2.991   -10.164 2.301   1.00 0.00 ? 39 ARG A HH12 5  
ATOM 4143  H HH21 . ARG A 1 39 ? 2.015   -7.545  4.460   1.00 0.00 ? 39 ARG A HH21 5  
ATOM 4144  H HH22 . ARG A 1 39 ? 1.547   -9.061  3.779   1.00 0.00 ? 39 ARG A HH22 5  
ATOM 4145  N N    . TRP A 1 40 ? 3.357   -4.349  -0.832  1.00 0.00 ? 40 TRP A N    5  
ATOM 4146  C CA   . TRP A 1 40 ? 2.931   -3.034  -1.293  1.00 0.00 ? 40 TRP A CA   5  
ATOM 4147  C C    . TRP A 1 40 ? 1.942   -2.411  -0.289  1.00 0.00 ? 40 TRP A C    5  
ATOM 4148  O O    . TRP A 1 40 ? 1.376   -3.091  0.565   1.00 0.00 ? 40 TRP A O    5  
ATOM 4149  C CB   . TRP A 1 40 ? 2.317   -3.154  -2.704  1.00 0.00 ? 40 TRP A CB   5  
ATOM 4150  C CG   . TRP A 1 40 ? 1.000   -3.913  -2.700  1.00 0.00 ? 40 TRP A CG   5  
ATOM 4151  C CD1  . TRP A 1 40 ? 0.849   -5.304  -2.742  1.00 0.00 ? 40 TRP A CD1  5  
ATOM 4152  C CD2  . TRP A 1 40 ? -0.338  -3.361  -2.691  1.00 0.00 ? 40 TRP A CD2  5  
ATOM 4153  N NE1  . TRP A 1 40 ? -0.468  -5.610  -2.771  1.00 0.00 ? 40 TRP A NE1  5  
ATOM 4154  C CE2  . TRP A 1 40 ? -1.226  -4.456  -2.743  1.00 0.00 ? 40 TRP A CE2  5  
ATOM 4155  C CE3  . TRP A 1 40 ? -0.844  -2.090  -2.641  1.00 0.00 ? 40 TRP A CE3  5  
ATOM 4156  C CZ2  . TRP A 1 40 ? -2.572  -4.250  -2.751  1.00 0.00 ? 40 TRP A CZ2  5  
ATOM 4157  C CZ3  . TRP A 1 40 ? -2.227  -1.869  -2.645  1.00 0.00 ? 40 TRP A CZ3  5  
ATOM 4158  C CH2  . TRP A 1 40 ? -3.093  -2.961  -2.703  1.00 0.00 ? 40 TRP A CH2  5  
ATOM 4159  H H    . TRP A 1 40 ? 2.643   -5.035  -0.682  1.00 0.00 ? 40 TRP A H    5  
ATOM 4160  H HA   . TRP A 1 40 ? 3.819   -2.410  -1.338  1.00 0.00 ? 40 TRP A HA   5  
ATOM 4161  H HB2  . TRP A 1 40 ? 2.168   -2.172  -3.134  1.00 0.00 ? 40 TRP A HB2  5  
ATOM 4162  H HB3  . TRP A 1 40 ? 3.009   -3.625  -3.400  1.00 0.00 ? 40 TRP A HB3  5  
ATOM 4163  H HD1  . TRP A 1 40 ? 1.642   -6.035  -2.731  1.00 0.00 ? 40 TRP A HD1  5  
ATOM 4164  H HE1  . TRP A 1 40 ? -0.870  -6.507  -2.817  1.00 0.00 ? 40 TRP A HE1  5  
ATOM 4165  H HE3  . TRP A 1 40 ? -0.150  -1.268  -2.585  1.00 0.00 ? 40 TRP A HE3  5  
ATOM 4166  H HZ2  . TRP A 1 40 ? -3.219  -5.107  -2.803  1.00 0.00 ? 40 TRP A HZ2  5  
ATOM 4167  H HZ3  . TRP A 1 40 ? -2.650  -0.870  -2.602  1.00 0.00 ? 40 TRP A HZ3  5  
ATOM 4168  H HH2  . TRP A 1 40 ? -4.166  -2.827  -2.712  1.00 0.00 ? 40 TRP A HH2  5  
ATOM 4169  N N    . CYS A 1 41 ? 1.768   -1.083  -0.455  1.00 0.00 ? 41 CYS A N    5  
ATOM 4170  C CA   . CYS A 1 41 ? 0.832   -0.306  0.337   1.00 0.00 ? 41 CYS A CA   5  
ATOM 4171  C C    . CYS A 1 41 ? -0.023  0.529   -0.629  1.00 0.00 ? 41 CYS A C    5  
ATOM 4172  O O    . CYS A 1 41 ? 0.449   0.939   -1.683  1.00 0.00 ? 41 CYS A O    5  
ATOM 4173  C CB   . CYS A 1 41 ? 1.621   0.633   1.252   1.00 0.00 ? 41 CYS A CB   5  
ATOM 4174  S SG   . CYS A 1 41 ? 2.474   1.935   0.303   1.00 0.00 ? 41 CYS A SG   5  
ATOM 4175  H H    . CYS A 1 41 ? 2.249   -0.542  -1.149  1.00 0.00 ? 41 CYS A H    5  
ATOM 4176  H HA   . CYS A 1 41 ? 0.212   -0.995  0.911   1.00 0.00 ? 41 CYS A HA   5  
ATOM 4177  H HB2  . CYS A 1 41 ? 0.833   1.127   1.877   1.00 0.00 ? 41 CYS A HB2  5  
ATOM 4178  H HB3  . CYS A 1 41 ? 2.391   0.028   1.803   1.00 0.00 ? 41 CYS A HB3  5  
ATOM 4179  N N    . GLY A 1 42 ? -1.280  0.787   -0.231  1.00 0.00 ? 42 GLY A N    5  
ATOM 4180  C CA   . GLY A 1 42 ? -2.097  1.683   -1.041  1.00 0.00 ? 42 GLY A CA   5  
ATOM 4181  C C    . GLY A 1 42 ? -1.630  3.113   -0.748  1.00 0.00 ? 42 GLY A C    5  
ATOM 4182  O O    . GLY A 1 42 ? -1.066  3.371   0.308   1.00 0.00 ? 42 GLY A O    5  
ATOM 4183  H H    . GLY A 1 42 ? -1.648  0.432   0.629   1.00 0.00 ? 42 GLY A H    5  
ATOM 4184  H HA2  . GLY A 1 42 ? -2.000  1.414   -2.095  1.00 0.00 ? 42 GLY A HA2  5  
ATOM 4185  H HA3  . GLY A 1 42 ? -3.134  1.573   -0.726  1.00 0.00 ? 42 GLY A HA3  5  
ATOM 4186  N N    . THR A 1 43 ? -1.892  4.022   -1.705  1.00 0.00 ? 43 THR A N    5  
ATOM 4187  C CA   . THR A 1 43 ? -1.476  5.417   -1.504  1.00 0.00 ? 43 THR A CA   5  
ATOM 4188  C C    . THR A 1 43 ? -2.686  6.345   -1.344  1.00 0.00 ? 43 THR A C    5  
ATOM 4189  O O    . THR A 1 43 ? -2.548  7.562   -1.347  1.00 0.00 ? 43 THR A O    5  
ATOM 4190  C CB   . THR A 1 43 ? -0.555  5.880   -2.654  1.00 0.00 ? 43 THR A CB   5  
ATOM 4191  O OG1  . THR A 1 43 ? -0.509  4.919   -3.689  1.00 0.00 ? 43 THR A OG1  5  
ATOM 4192  C CG2  . THR A 1 43 ? 0.886   6.077   -2.175  1.00 0.00 ? 43 THR A CG2  5  
ATOM 4193  H H    . THR A 1 43 ? -2.334  3.735   -2.556  1.00 0.00 ? 43 THR A H    5  
ATOM 4194  H HA   . THR A 1 43 ? -0.939  5.496   -0.558  1.00 0.00 ? 43 THR A HA   5  
ATOM 4195  H HB   . THR A 1 43 ? -0.880  6.841   -3.072  1.00 0.00 ? 43 THR A HB   5  
ATOM 4196  H HG1  . THR A 1 43 ? -1.391  4.728   -4.008  1.00 0.00 ? 43 THR A HG1  5  
ATOM 4197  H HG21 . THR A 1 43 ? 1.296   5.155   -1.763  1.00 0.00 ? 43 THR A HG21 5  
ATOM 4198  H HG22 . THR A 1 43 ? 0.940   6.848   -1.405  1.00 0.00 ? 43 THR A HG22 5  
ATOM 4199  H HG23 . THR A 1 43 ? 1.531   6.390   -2.995  1.00 0.00 ? 43 THR A HG23 5  
ATOM 4200  N N    . THR A 1 44 ? -3.859  5.711   -1.184  1.00 0.00 ? 44 THR A N    5  
ATOM 4201  C CA   . THR A 1 44 ? -5.089  6.448   -0.966  1.00 0.00 ? 44 THR A CA   5  
ATOM 4202  C C    . THR A 1 44 ? -5.894  5.639   0.045   1.00 0.00 ? 44 THR A C    5  
ATOM 4203  O O    . THR A 1 44 ? -5.606  4.474   0.306   1.00 0.00 ? 44 THR A O    5  
ATOM 4204  C CB   . THR A 1 44 ? -5.869  6.625   -2.280  1.00 0.00 ? 44 THR A CB   5  
ATOM 4205  O OG1  . THR A 1 44 ? -6.291  5.345   -2.731  1.00 0.00 ? 44 THR A OG1  5  
ATOM 4206  C CG2  . THR A 1 44 ? -5.018  7.320   -3.353  1.00 0.00 ? 44 THR A CG2  5  
ATOM 4207  H H    . THR A 1 44 ? -3.963  4.717   -1.168  1.00 0.00 ? 44 THR A H    5  
ATOM 4208  H HA   . THR A 1 44 ? -4.846  7.416   -0.520  1.00 0.00 ? 44 THR A HA   5  
ATOM 4209  H HB   . THR A 1 44 ? -6.736  7.261   -2.057  1.00 0.00 ? 44 THR A HB   5  
ATOM 4210  H HG1  . THR A 1 44 ? -7.012  5.428   -3.370  1.00 0.00 ? 44 THR A HG1  5  
ATOM 4211  H HG21 . THR A 1 44 ? -5.617  7.646   -4.199  1.00 0.00 ? 44 THR A HG21 5  
ATOM 4212  H HG22 . THR A 1 44 ? -4.241  6.659   -3.736  1.00 0.00 ? 44 THR A HG22 5  
ATOM 4213  H HG23 . THR A 1 44 ? -4.534  8.209   -2.948  1.00 0.00 ? 44 THR A HG23 5  
ATOM 4214  N N    . GLU A 1 45 ? -6.914  6.326   0.580   1.00 0.00 ? 45 GLU A N    5  
ATOM 4215  C CA   . GLU A 1 45 ? -7.782  5.724   1.582   1.00 0.00 ? 45 GLU A CA   5  
ATOM 4216  C C    . GLU A 1 45 ? -8.593  4.567   0.961   1.00 0.00 ? 45 GLU A C    5  
ATOM 4217  O O    . GLU A 1 45 ? -8.939  3.607   1.636   1.00 0.00 ? 45 GLU A O    5  
ATOM 4218  C CB   . GLU A 1 45 ? -8.652  6.765   2.345   1.00 0.00 ? 45 GLU A CB   5  
ATOM 4219  C CG   . GLU A 1 45 ? -8.399  8.259   2.024   1.00 0.00 ? 45 GLU A CG   5  
ATOM 4220  C CD   . GLU A 1 45 ? -6.932  8.704   2.195   1.00 0.00 ? 45 GLU A CD   5  
ATOM 4221  O OE1  . GLU A 1 45 ? -6.440  8.725   3.320   1.00 0.00 ? 45 GLU A OE1  5  
ATOM 4222  O OE2  . GLU A 1 45 ? -6.297  9.009   1.183   1.00 0.00 ? 45 GLU A OE2  5  
ATOM 4223  H H    . GLU A 1 45 ? -7.023  7.286   0.320   1.00 0.00 ? 45 GLU A H    5  
ATOM 4224  H HA   . GLU A 1 45 ? -7.100  5.270   2.303   1.00 0.00 ? 45 GLU A HA   5  
ATOM 4225  H HB2  . GLU A 1 45 ? -9.732  6.589   2.086   1.00 0.00 ? 45 GLU A HB2  5  
ATOM 4226  H HB3  . GLU A 1 45 ? -8.387  6.643   3.433   1.00 0.00 ? 45 GLU A HB3  5  
ATOM 4227  H HG2  . GLU A 1 45 ? -8.742  8.500   1.017   1.00 0.00 ? 45 GLU A HG2  5  
ATOM 4228  H HG3  . GLU A 1 45 ? -9.006  8.873   2.694   1.00 0.00 ? 45 GLU A HG3  5  
ATOM 4229  N N    . ASP A 1 46 ? -8.854  4.702   -0.364  1.00 0.00 ? 46 ASP A N    5  
ATOM 4230  C CA   . ASP A 1 46 ? -9.545  3.649   -1.112  1.00 0.00 ? 46 ASP A CA   5  
ATOM 4231  C C    . ASP A 1 46 ? -8.697  3.294   -2.351  1.00 0.00 ? 46 ASP A C    5  
ATOM 4232  O O    . ASP A 1 46 ? -8.681  3.999   -3.354  1.00 0.00 ? 46 ASP A O    5  
ATOM 4233  C CB   . ASP A 1 46 ? -11.008 4.026   -1.448  1.00 0.00 ? 46 ASP A CB   5  
ATOM 4234  C CG   . ASP A 1 46 ? -11.804 2.805   -1.960  1.00 0.00 ? 46 ASP A CG   5  
ATOM 4235  O OD1  . ASP A 1 46 ? -11.348 2.171   -2.907  1.00 0.00 ? 46 ASP A OD1  5  
ATOM 4236  O OD2  . ASP A 1 46 ? -12.857 2.482   -1.399  1.00 0.00 ? 46 ASP A OD2  5  
ATOM 4237  H H    . ASP A 1 46 ? -8.504  5.500   -0.854  1.00 0.00 ? 46 ASP A H    5  
ATOM 4238  H HA   . ASP A 1 46 ? -9.557  2.787   -0.455  1.00 0.00 ? 46 ASP A HA   5  
ATOM 4239  H HB2  . ASP A 1 46 ? -11.498 4.400   -0.549  1.00 0.00 ? 46 ASP A HB2  5  
ATOM 4240  H HB3  . ASP A 1 46 ? -11.067 4.825   -2.188  1.00 0.00 ? 46 ASP A HB3  5  
ATOM 4241  N N    . TYR A 1 47 ? -7.970  2.168   -2.212  1.00 0.00 ? 47 TYR A N    5  
ATOM 4242  C CA   . TYR A 1 47 ? -7.098  1.738   -3.310  1.00 0.00 ? 47 TYR A CA   5  
ATOM 4243  C C    . TYR A 1 47 ? -7.919  1.168   -4.466  1.00 0.00 ? 47 TYR A C    5  
ATOM 4244  O O    . TYR A 1 47 ? -7.552  1.309   -5.626  1.00 0.00 ? 47 TYR A O    5  
ATOM 4245  C CB   . TYR A 1 47 ? -6.133  0.643   -2.825  1.00 0.00 ? 47 TYR A CB   5  
ATOM 4246  C CG   . TYR A 1 47 ? -5.293  0.101   -3.947  1.00 0.00 ? 47 TYR A CG   5  
ATOM 4247  C CD1  . TYR A 1 47 ? -4.193  0.796   -4.414  1.00 0.00 ? 47 TYR A CD1  5  
ATOM 4248  C CD2  . TYR A 1 47 ? -5.612  -1.113  -4.539  1.00 0.00 ? 47 TYR A CD2  5  
ATOM 4249  C CE1  . TYR A 1 47 ? -3.407  0.260   -5.417  1.00 0.00 ? 47 TYR A CE1  5  
ATOM 4250  C CE2  . TYR A 1 47 ? -4.808  -1.665  -5.521  1.00 0.00 ? 47 TYR A CE2  5  
ATOM 4251  C CZ   . TYR A 1 47 ? -3.690  -0.977  -5.962  1.00 0.00 ? 47 TYR A CZ   5  
ATOM 4252  O OH   . TYR A 1 47 ? -2.851  -1.491  -6.929  1.00 0.00 ? 47 TYR A OH   5  
ATOM 4253  H H    . TYR A 1 47 ? -8.073  1.625   -1.367  1.00 0.00 ? 47 TYR A H    5  
ATOM 4254  H HA   . TYR A 1 47 ? -6.536  2.600   -3.703  1.00 0.00 ? 47 TYR A HA   5  
ATOM 4255  H HB2  . TYR A 1 47 ? -5.487  1.030   -2.036  1.00 0.00 ? 47 TYR A HB2  5  
ATOM 4256  H HB3  . TYR A 1 47 ? -6.673  -0.207  -2.402  1.00 0.00 ? 47 TYR A HB3  5  
ATOM 4257  H HD1  . TYR A 1 47 ? -3.952  1.761   -4.010  1.00 0.00 ? 47 TYR A HD1  5  
ATOM 4258  H HD2  . TYR A 1 47 ? -6.514  -1.620  -4.258  1.00 0.00 ? 47 TYR A HD2  5  
ATOM 4259  H HE1  . TYR A 1 47 ? -2.568  0.812   -5.780  1.00 0.00 ? 47 TYR A HE1  5  
ATOM 4260  H HE2  . TYR A 1 47 ? -5.082  -2.627  -5.913  1.00 0.00 ? 47 TYR A HE2  5  
ATOM 4261  H HH   . TYR A 1 47 ? -2.773  -2.430  -6.835  1.00 0.00 ? 47 TYR A HH   5  
ATOM 4262  N N    . ASP A 1 48 ? -9.025  0.496   -4.097  1.00 0.00 ? 48 ASP A N    5  
ATOM 4263  C CA   . ASP A 1 48 ? -9.835  -0.143  -5.130  1.00 0.00 ? 48 ASP A CA   5  
ATOM 4264  C C    . ASP A 1 48 ? -10.286 0.883   -6.189  1.00 0.00 ? 48 ASP A C    5  
ATOM 4265  O O    . ASP A 1 48 ? -10.380 0.586   -7.373  1.00 0.00 ? 48 ASP A O    5  
ATOM 4266  C CB   . ASP A 1 48 ? -11.076 -0.849  -4.538  1.00 0.00 ? 48 ASP A CB   5  
ATOM 4267  C CG   . ASP A 1 48 ? -10.712 -2.081  -3.693  1.00 0.00 ? 48 ASP A CG   5  
ATOM 4268  O OD1  . ASP A 1 48 ? -9.975  -2.939  -4.174  1.00 0.00 ? 48 ASP A OD1  5  
ATOM 4269  O OD2  . ASP A 1 48 ? -11.172 -2.192  -2.560  1.00 0.00 ? 48 ASP A OD2  5  
ATOM 4270  H H    . ASP A 1 48 ? -9.291  0.444   -3.133  1.00 0.00 ? 48 ASP A H    5  
ATOM 4271  H HA   . ASP A 1 48 ? -9.217  -0.894  -5.631  1.00 0.00 ? 48 ASP A HA   5  
ATOM 4272  H HB2  . ASP A 1 48 ? -11.679 -0.157  -3.940  1.00 0.00 ? 48 ASP A HB2  5  
ATOM 4273  H HB3  . ASP A 1 48 ? -11.696 -1.232  -5.356  1.00 0.00 ? 48 ASP A HB3  5  
ATOM 4274  N N    . ARG A 1 49 ? -10.551 2.100   -5.682  1.00 0.00 ? 49 ARG A N    5  
ATOM 4275  C CA   . ARG A 1 49 ? -10.957 3.223   -6.516  1.00 0.00 ? 49 ARG A CA   5  
ATOM 4276  C C    . ARG A 1 49 ? -9.788  3.760   -7.389  1.00 0.00 ? 49 ARG A C    5  
ATOM 4277  O O    . ARG A 1 49 ? -9.908  3.840   -8.607  1.00 0.00 ? 49 ARG A O    5  
ATOM 4278  C CB   . ARG A 1 49 ? -11.570 4.296   -5.580  1.00 0.00 ? 49 ARG A CB   5  
ATOM 4279  C CG   . ARG A 1 49 ? -11.988 5.639   -6.209  1.00 0.00 ? 49 ARG A CG   5  
ATOM 4280  C CD   . ARG A 1 49 ? -11.999 6.802   -5.141  1.00 0.00 ? 49 ARG A CD   5  
ATOM 4281  N NE   . ARG A 1 49 ? -10.655 7.363   -5.022  1.00 0.00 ? 49 ARG A NE   5  
ATOM 4282  C CZ   . ARG A 1 49 ? -10.380 8.534   -4.407  1.00 0.00 ? 49 ARG A CZ   5  
ATOM 4283  N NH1  . ARG A 1 49 ? -11.350 9.251   -3.846  1.00 0.00 ? 49 ARG A NH1  5  
ATOM 4284  N NH2  . ARG A 1 49 ? -9.124  8.958   -4.370  1.00 0.00 ? 49 ARG A NH2  5  
ATOM 4285  H H    . ARG A 1 49 ? -10.465 2.200   -4.685  1.00 0.00 ? 49 ARG A H    5  
ATOM 4286  H HA   . ARG A 1 49 ? -11.723 2.832   -7.191  1.00 0.00 ? 49 ARG A HA   5  
ATOM 4287  H HB2  . ARG A 1 49 ? -12.438 3.812   -5.121  1.00 0.00 ? 49 ARG A HB2  5  
ATOM 4288  H HB3  . ARG A 1 49 ? -10.893 4.558   -4.769  1.00 0.00 ? 49 ARG A HB3  5  
ATOM 4289  H HG2  . ARG A 1 49 ? -11.296 5.872   -7.032  1.00 0.00 ? 49 ARG A HG2  5  
ATOM 4290  H HG3  . ARG A 1 49 ? -12.960 5.468   -6.692  1.00 0.00 ? 49 ARG A HG3  5  
ATOM 4291  H HD2  . ARG A 1 49 ? -12.667 7.647   -5.362  1.00 0.00 ? 49 ARG A HD2  5  
ATOM 4292  H HD3  . ARG A 1 49 ? -12.246 6.475   -4.119  1.00 0.00 ? 49 ARG A HD3  5  
ATOM 4293  H HE   . ARG A 1 49 ? -9.857  6.853   -5.368  1.00 0.00 ? 49 ARG A HE   5  
ATOM 4294  H HH11 . ARG A 1 49 ? -12.287 8.906   -3.880  1.00 0.00 ? 49 ARG A HH11 5  
ATOM 4295  H HH12 . ARG A 1 49 ? -11.166 10.122  -3.392  1.00 0.00 ? 49 ARG A HH12 5  
ATOM 4296  H HH21 . ARG A 1 49 ? -8.429  8.361   -4.814  1.00 0.00 ? 49 ARG A HH21 5  
ATOM 4297  H HH22 . ARG A 1 49 ? -8.829  9.809   -3.946  1.00 0.00 ? 49 ARG A HH22 5  
ATOM 4298  N N    . ASP A 1 50 ? -8.685  4.153   -6.717  1.00 0.00 ? 50 ASP A N    5  
ATOM 4299  C CA   . ASP A 1 50 ? -7.558  4.804   -7.412  1.00 0.00 ? 50 ASP A CA   5  
ATOM 4300  C C    . ASP A 1 50 ? -6.636  3.887   -8.248  1.00 0.00 ? 50 ASP A C    5  
ATOM 4301  O O    . ASP A 1 50 ? -6.205  4.254   -9.333  1.00 0.00 ? 50 ASP A O    5  
ATOM 4302  C CB   . ASP A 1 50 ? -6.678  5.536   -6.389  1.00 0.00 ? 50 ASP A CB   5  
ATOM 4303  C CG   . ASP A 1 50 ? -7.490  6.646   -5.717  1.00 0.00 ? 50 ASP A CG   5  
ATOM 4304  O OD1  . ASP A 1 50 ? -7.662  7.712   -6.297  1.00 0.00 ? 50 ASP A OD1  5  
ATOM 4305  O OD2  . ASP A 1 50 ? -7.967  6.465   -4.605  1.00 0.00 ? 50 ASP A OD2  5  
ATOM 4306  H H    . ASP A 1 50 ? -8.667  4.066   -5.716  1.00 0.00 ? 50 ASP A H    5  
ATOM 4307  H HA   . ASP A 1 50 ? -7.962  5.557   -8.093  1.00 0.00 ? 50 ASP A HA   5  
ATOM 4308  H HB2  . ASP A 1 50 ? -6.317  4.818   -5.631  1.00 0.00 ? 50 ASP A HB2  5  
ATOM 4309  H HB3  . ASP A 1 50 ? -5.840  6.036   -6.908  1.00 0.00 ? 50 ASP A HB3  5  
ATOM 4310  N N    . LYS A 1 51 ? -6.298  2.722   -7.665  1.00 0.00 ? 51 LYS A N    5  
ATOM 4311  C CA   . LYS A 1 51 ? -5.383  1.740   -8.248  1.00 0.00 ? 51 LYS A CA   5  
ATOM 4312  C C    . LYS A 1 51 ? -3.940  2.252   -8.332  1.00 0.00 ? 51 LYS A C    5  
ATOM 4313  O O    . LYS A 1 51 ? -3.202  1.913   -9.252  1.00 0.00 ? 51 LYS A O    5  
ATOM 4314  C CB   . LYS A 1 51 ? -5.807  1.216   -9.638  1.00 0.00 ? 51 LYS A CB   5  
ATOM 4315  C CG   . LYS A 1 51 ? -7.194  0.539   -9.645  1.00 0.00 ? 51 LYS A CG   5  
ATOM 4316  C CD   . LYS A 1 51 ? -8.362  1.505   -9.421  1.00 0.00 ? 51 LYS A CD   5  
ATOM 4317  C CE   . LYS A 1 51 ? -9.703  1.029   -9.986  1.00 0.00 ? 51 LYS A CE   5  
ATOM 4318  N NZ   . LYS A 1 51 ? -9.802  1.268   -11.421 1.00 0.00 ? 51 LYS A NZ   5  
ATOM 4319  H H    . LYS A 1 51 ? -6.751  2.465   -6.814  1.00 0.00 ? 51 LYS A H    5  
ATOM 4320  H HA   . LYS A 1 51 ? -5.363  0.930   -7.519  1.00 0.00 ? 51 LYS A HA   5  
ATOM 4321  H HB2  . LYS A 1 51 ? -5.846  2.090   -10.344 1.00 0.00 ? 51 LYS A HB2  5  
ATOM 4322  H HB3  . LYS A 1 51 ? -5.027  0.432   -9.878  1.00 0.00 ? 51 LYS A HB3  5  
ATOM 4323  H HG2  . LYS A 1 51 ? -7.392  0.031   -10.585 1.00 0.00 ? 51 LYS A HG2  5  
ATOM 4324  H HG3  . LYS A 1 51 ? -7.179  -0.235  -8.881  1.00 0.00 ? 51 LYS A HG3  5  
ATOM 4325  H HD2  . LYS A 1 51 ? -8.466  1.651   -8.349  1.00 0.00 ? 51 LYS A HD2  5  
ATOM 4326  H HD3  . LYS A 1 51 ? -8.139  2.479   -9.855  1.00 0.00 ? 51 LYS A HD3  5  
ATOM 4327  H HE2  . LYS A 1 51 ? -9.870  -0.030  -9.779  1.00 0.00 ? 51 LYS A HE2  5  
ATOM 4328  H HE3  . LYS A 1 51 ? -10.518 1.582   -9.516  1.00 0.00 ? 51 LYS A HE3  5  
ATOM 4329  H HZ1  . LYS A 1 51 ? -9.037  0.767   -11.916 1.00 0.00 ? 51 LYS A HZ1  5  
ATOM 4330  H HZ2  . LYS A 1 51 ? -9.708  2.292   -11.586 1.00 0.00 ? 51 LYS A HZ2  5  
ATOM 4331  H HZ3  . LYS A 1 51 ? -10.725 0.944   -11.773 1.00 0.00 ? 51 LYS A HZ3  5  
ATOM 4332  N N    . LYS A 1 52 ? -3.563  3.067   -7.329  1.00 0.00 ? 52 LYS A N    5  
ATOM 4333  C CA   . LYS A 1 52 ? -2.191  3.563   -7.297  1.00 0.00 ? 52 LYS A CA   5  
ATOM 4334  C C    . LYS A 1 52 ? -1.601  3.248   -5.911  1.00 0.00 ? 52 LYS A C    5  
ATOM 4335  O O    . LYS A 1 52 ? -2.277  3.380   -4.892  1.00 0.00 ? 52 LYS A O    5  
ATOM 4336  C CB   . LYS A 1 52 ? -2.170  5.043   -7.719  1.00 0.00 ? 52 LYS A CB   5  
ATOM 4337  C CG   . LYS A 1 52 ? -2.866  5.292   -9.082  1.00 0.00 ? 52 LYS A CG   5  
ATOM 4338  C CD   . LYS A 1 52 ? -2.255  6.470   -9.860  1.00 0.00 ? 52 LYS A CD   5  
ATOM 4339  C CE   . LYS A 1 52 ? -2.473  7.880   -9.259  1.00 0.00 ? 52 LYS A CE   5  
ATOM 4340  N NZ   . LYS A 1 52 ? -1.977  8.886   -10.188 1.00 0.00 ? 52 LYS A NZ   5  
ATOM 4341  H H    . LYS A 1 52 ? -4.202  3.305   -6.598  1.00 0.00 ? 52 LYS A H    5  
ATOM 4342  H HA   . LYS A 1 52 ? -1.629  2.938   -7.995  1.00 0.00 ? 52 LYS A HA   5  
ATOM 4343  H HB2  . LYS A 1 52 ? -2.638  5.664   -6.953  1.00 0.00 ? 52 LYS A HB2  5  
ATOM 4344  H HB3  . LYS A 1 52 ? -1.131  5.363   -7.772  1.00 0.00 ? 52 LYS A HB3  5  
ATOM 4345  H HG2  . LYS A 1 52 ? -2.753  4.412   -9.730  1.00 0.00 ? 52 LYS A HG2  5  
ATOM 4346  H HG3  . LYS A 1 52 ? -3.952  5.400   -8.972  1.00 0.00 ? 52 LYS A HG3  5  
ATOM 4347  H HD2  . LYS A 1 52 ? -1.139  6.282   -9.854  1.00 0.00 ? 52 LYS A HD2  5  
ATOM 4348  H HD3  . LYS A 1 52 ? -2.784  6.449   -10.858 1.00 0.00 ? 52 LYS A HD3  5  
ATOM 4349  H HE2  . LYS A 1 52 ? -3.520  8.126   -9.057  1.00 0.00 ? 52 LYS A HE2  5  
ATOM 4350  H HE3  . LYS A 1 52 ? -1.922  8.032   -8.324  1.00 0.00 ? 52 LYS A HE3  5  
ATOM 4351  H HZ1  . LYS A 1 52 ? -1.890  9.819   -9.719  1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 4352  H HZ2  . LYS A 1 52 ? -2.533  8.966   -11.058 1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 4353  H HZ3  . LYS A 1 52 ? -0.979  8.684   -10.425 1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 4354  N N    . TYR A 1 53 ? -0.358  2.716   -5.954  1.00 0.00 ? 53 TYR A N    5  
ATOM 4355  C CA   . TYR A 1 53 ? 0.293   2.137   -4.788  1.00 0.00 ? 53 TYR A CA   5  
ATOM 4356  C C    . TYR A 1 53 ? 1.759   2.567   -4.668  1.00 0.00 ? 53 TYR A C    5  
ATOM 4357  O O    . TYR A 1 53 ? 2.339   3.218   -5.527  1.00 0.00 ? 53 TYR A O    5  
ATOM 4358  C CB   . TYR A 1 53 ? 0.222   0.594   -4.894  1.00 0.00 ? 53 TYR A CB   5  
ATOM 4359  C CG   . TYR A 1 53 ? 1.094   0.005   -5.976  1.00 0.00 ? 53 TYR A CG   5  
ATOM 4360  C CD1  . TYR A 1 53 ? 0.750   0.087   -7.320  1.00 0.00 ? 53 TYR A CD1  5  
ATOM 4361  C CD2  . TYR A 1 53 ? 2.263   -0.656  -5.633  1.00 0.00 ? 53 TYR A CD2  5  
ATOM 4362  C CE1  . TYR A 1 53 ? 1.542   -0.502  -8.299  1.00 0.00 ? 53 TYR A CE1  5  
ATOM 4363  C CE2  . TYR A 1 53 ? 3.042   -1.262  -6.598  1.00 0.00 ? 53 TYR A CE2  5  
ATOM 4364  C CZ   . TYR A 1 53 ? 2.684   -1.203  -7.932  1.00 0.00 ? 53 TYR A CZ   5  
ATOM 4365  O OH   . TYR A 1 53 ? 3.464   -1.870  -8.860  1.00 0.00 ? 53 TYR A OH   5  
ATOM 4366  H H    . TYR A 1 53 ? 0.173   2.723   -6.805  1.00 0.00 ? 53 TYR A H    5  
ATOM 4367  H HA   . TYR A 1 53 ? -0.221  2.488   -3.897  1.00 0.00 ? 53 TYR A HA   5  
ATOM 4368  H HB2  . TYR A 1 53 ? 0.516   0.145   -3.951  1.00 0.00 ? 53 TYR A HB2  5  
ATOM 4369  H HB3  . TYR A 1 53 ? -0.790  0.231   -5.037  1.00 0.00 ? 53 TYR A HB3  5  
ATOM 4370  H HD1  . TYR A 1 53 ? -0.147  0.607   -7.602  1.00 0.00 ? 53 TYR A HD1  5  
ATOM 4371  H HD2  . TYR A 1 53 ? 2.576   -0.702  -4.605  1.00 0.00 ? 53 TYR A HD2  5  
ATOM 4372  H HE1  . TYR A 1 53 ? 1.248   -0.408  -9.333  1.00 0.00 ? 53 TYR A HE1  5  
ATOM 4373  H HE2  . TYR A 1 53 ? 3.927   -1.788  -6.295  1.00 0.00 ? 53 TYR A HE2  5  
ATOM 4374  H HH   . TYR A 1 53 ? 3.711   -1.258  -9.549  1.00 0.00 ? 53 TYR A HH   5  
ATOM 4375  N N    . GLY A 1 54 ? 2.301   2.088   -3.539  1.00 0.00 ? 54 GLY A N    5  
ATOM 4376  C CA   . GLY A 1 54 ? 3.695   2.263   -3.145  1.00 0.00 ? 54 GLY A CA   5  
ATOM 4377  C C    . GLY A 1 54 ? 4.254   0.900   -2.689  1.00 0.00 ? 54 GLY A C    5  
ATOM 4378  O O    . GLY A 1 54 ? 3.501   -0.061  -2.573  1.00 0.00 ? 54 GLY A O    5  
ATOM 4379  H H    . GLY A 1 54 ? 1.657   1.565   -2.970  1.00 0.00 ? 54 GLY A H    5  
ATOM 4380  H HA2  . GLY A 1 54 ? 4.258   2.697   -3.976  1.00 0.00 ? 54 GLY A HA2  5  
ATOM 4381  H HA3  . GLY A 1 54 ? 3.681   2.953   -2.305  1.00 0.00 ? 54 GLY A HA3  5  
ATOM 4382  N N    . PHE A 1 55 ? 5.586   0.846   -2.432  1.00 0.00 ? 55 PHE A N    5  
ATOM 4383  C CA   . PHE A 1 55 ? 6.188   -0.404  -1.951  1.00 0.00 ? 55 PHE A CA   5  
ATOM 4384  C C    . PHE A 1 55 ? 6.379   -0.217  -0.443  1.00 0.00 ? 55 PHE A C    5  
ATOM 4385  O O    . PHE A 1 55 ? 6.400   0.893   0.071   1.00 0.00 ? 55 PHE A O    5  
ATOM 4386  C CB   . PHE A 1 55 ? 7.533   -0.785  -2.618  1.00 0.00 ? 55 PHE A CB   5  
ATOM 4387  C CG   . PHE A 1 55 ? 7.362   -1.461  -3.960  1.00 0.00 ? 55 PHE A CG   5  
ATOM 4388  C CD1  . PHE A 1 55 ? 6.667   -0.847  -4.993  1.00 0.00 ? 55 PHE A CD1  5  
ATOM 4389  C CD2  . PHE A 1 55 ? 7.901   -2.726  -4.194  1.00 0.00 ? 55 PHE A CD2  5  
ATOM 4390  C CE1  . PHE A 1 55 ? 6.516   -1.466  -6.226  1.00 0.00 ? 55 PHE A CE1  5  
ATOM 4391  C CE2  . PHE A 1 55 ? 7.746   -3.353  -5.424  1.00 0.00 ? 55 PHE A CE2  5  
ATOM 4392  C CZ   . PHE A 1 55 ? 7.055   -2.722  -6.445  1.00 0.00 ? 55 PHE A CZ   5  
ATOM 4393  H H    . PHE A 1 55 ? 6.191   1.641   -2.473  1.00 0.00 ? 55 PHE A H    5  
ATOM 4394  H HA   . PHE A 1 55 ? 5.495   -1.232  -2.084  1.00 0.00 ? 55 PHE A HA   5  
ATOM 4395  H HB2  . PHE A 1 55 ? 8.209   0.070   -2.712  1.00 0.00 ? 55 PHE A HB2  5  
ATOM 4396  H HB3  . PHE A 1 55 ? 8.021   -1.539  -1.988  1.00 0.00 ? 55 PHE A HB3  5  
ATOM 4397  H HD1  . PHE A 1 55 ? 6.235   0.124   -4.842  1.00 0.00 ? 55 PHE A HD1  5  
ATOM 4398  H HD2  . PHE A 1 55 ? 8.449   -3.242  -3.421  1.00 0.00 ? 55 PHE A HD2  5  
ATOM 4399  H HE1  . PHE A 1 55 ? 5.968   -0.963  -7.012  1.00 0.00 ? 55 PHE A HE1  5  
ATOM 4400  H HE2  . PHE A 1 55 ? 8.162   -4.337  -5.581  1.00 0.00 ? 55 PHE A HE2  5  
ATOM 4401  H HZ   . PHE A 1 55 ? 6.939   -3.206  -7.404  1.00 0.00 ? 55 PHE A HZ   5  
ATOM 4402  N N    . CYS A 1 56 ? 6.451   -1.381  0.211   1.00 0.00 ? 56 CYS A N    5  
ATOM 4403  C CA   . CYS A 1 56 ? 6.540   -1.432  1.683   1.00 0.00 ? 56 CYS A CA   5  
ATOM 4404  C C    . CYS A 1 56 ? 7.850   -2.176  1.988   1.00 0.00 ? 56 CYS A C    5  
ATOM 4405  O O    . CYS A 1 56 ? 8.440   -2.776  1.097   1.00 0.00 ? 56 CYS A O    5  
ATOM 4406  C CB   . CYS A 1 56 ? 5.305   -2.212  2.214   1.00 0.00 ? 56 CYS A CB   5  
ATOM 4407  S SG   . CYS A 1 56 ? 4.236   -1.306  3.364   1.00 0.00 ? 56 CYS A SG   5  
ATOM 4408  H H    . CYS A 1 56 ? 6.495   -2.206  -0.390  1.00 0.00 ? 56 CYS A H    5  
ATOM 4409  H HA   . CYS A 1 56 ? 6.600   -0.422  2.144   1.00 0.00 ? 56 CYS A HA   5  
ATOM 4410  H HB2  . CYS A 1 56 ? 4.631   -2.517  1.398   1.00 0.00 ? 56 CYS A HB2  5  
ATOM 4411  H HB3  . CYS A 1 56 ? 5.634   -3.129  2.719   1.00 0.00 ? 56 CYS A HB3  5  
ATOM 4412  N N    . PRO A 1 57 ? 8.303   -2.143  3.271   1.00 0.00 ? 57 PRO A N    5  
ATOM 4413  C CA   . PRO A 1 57 ? 9.459   -2.938  3.666   1.00 0.00 ? 57 PRO A CA   5  
ATOM 4414  C C    . PRO A 1 57 ? 9.084   -4.430  3.601   1.00 0.00 ? 57 PRO A C    5  
ATOM 4415  O O    . PRO A 1 57 ? 8.071   -4.860  4.139   1.00 0.00 ? 57 PRO A O    5  
ATOM 4416  C CB   . PRO A 1 57 ? 9.765   -2.485  5.094   1.00 0.00 ? 57 PRO A CB   5  
ATOM 4417  C CG   . PRO A 1 57 ? 8.443   -1.925  5.621   1.00 0.00 ? 57 PRO A CG   5  
ATOM 4418  C CD   . PRO A 1 57 ? 7.701   -1.407  4.384   1.00 0.00 ? 57 PRO A CD   5  
ATOM 4419  H HA   . PRO A 1 57 ? 10.304  -2.734  3.006   1.00 0.00 ? 57 PRO A HA   5  
ATOM 4420  H HB2  . PRO A 1 57 ? 10.168  -3.282  5.716   1.00 0.00 ? 57 PRO A HB2  5  
ATOM 4421  H HB3  . PRO A 1 57 ? 10.506  -1.686  5.072   1.00 0.00 ? 57 PRO A HB3  5  
ATOM 4422  H HG2  . PRO A 1 57 ? 7.872   -2.736  6.077   1.00 0.00 ? 57 PRO A HG2  5  
ATOM 4423  H HG3  . PRO A 1 57 ? 8.586   -1.161  6.386   1.00 0.00 ? 57 PRO A HG3  5  
ATOM 4424  H HD2  . PRO A 1 57 ? 6.634   -1.651  4.484   1.00 0.00 ? 57 PRO A HD2  5  
ATOM 4425  H HD3  . PRO A 1 57 ? 7.892   -0.329  4.246   1.00 0.00 ? 57 PRO A HD3  5  
ATOM 4426  N N    . GLU A 1 58 ? 9.946   -5.176  2.885   1.00 0.00 ? 58 GLU A N    5  
ATOM 4427  C CA   . GLU A 1 58 ? 9.694   -6.598  2.661   1.00 0.00 ? 58 GLU A CA   5  
ATOM 4428  C C    . GLU A 1 58 ? 9.536   -7.378  3.984   1.00 0.00 ? 58 GLU A C    5  
ATOM 4429  O O    . GLU A 1 58 ? 8.637   -8.188  4.161   1.00 0.00 ? 58 GLU A O    5  
ATOM 4430  C CB   . GLU A 1 58 ? 10.828  -7.194  1.800   1.00 0.00 ? 58 GLU A CB   5  
ATOM 4431  C CG   . GLU A 1 58 ? 10.400  -8.457  1.032   1.00 0.00 ? 58 GLU A CG   5  
ATOM 4432  C CD   . GLU A 1 58 ? 9.592   -8.132  -0.240  1.00 0.00 ? 58 GLU A CD   5  
ATOM 4433  O OE1  . GLU A 1 58 ? 8.902   -7.111  -0.278  1.00 0.00 ? 58 GLU A OE1  5  
ATOM 4434  O OE2  . GLU A 1 58 ? 9.675   -8.904  -1.193  1.00 0.00 ? 58 GLU A OE2  5  
ATOM 4435  H H    . GLU A 1 58 ? 10.729  -4.717  2.471   1.00 0.00 ? 58 GLU A H    5  
ATOM 4436  H HA   . GLU A 1 58 ? 8.743   -6.640  2.133   1.00 0.00 ? 58 GLU A HA   5  
ATOM 4437  H HB2  . GLU A 1 58 ? 11.167  -6.458  1.060   1.00 0.00 ? 58 GLU A HB2  5  
ATOM 4438  H HB3  . GLU A 1 58 ? 11.686  -7.444  2.437   1.00 0.00 ? 58 GLU A HB3  5  
ATOM 4439  H HG2  . GLU A 1 58 ? 11.288  -9.013  0.730   1.00 0.00 ? 58 GLU A HG2  5  
ATOM 4440  H HG3  . GLU A 1 58 ? 9.811   -9.122  1.663   1.00 0.00 ? 58 GLU A HG3  5  
ATOM 4441  N N    . THR A 1 59 ? 10.478  -7.073  4.896   1.00 0.00 ? 59 THR A N    5  
ATOM 4442  C CA   . THR A 1 59 ? 10.492  -7.721  6.200   1.00 0.00 ? 59 THR A CA   5  
ATOM 4443  C C    . THR A 1 59 ? 9.519   -7.018  7.169   1.00 0.00 ? 59 THR A C    5  
ATOM 4444  O O    . THR A 1 59 ? 8.530   -7.588  7.610   1.00 0.00 ? 59 THR A O    5  
ATOM 4445  C CB   . THR A 1 59 ? 11.951  -7.722  6.701   1.00 0.00 ? 59 THR A CB   5  
ATOM 4446  O OG1  . THR A 1 59 ? 12.823  -7.927  5.605   1.00 0.00 ? 59 THR A OG1  5  
ATOM 4447  C CG2  . THR A 1 59 ? 12.202  -8.750  7.814   1.00 0.00 ? 59 THR A CG2  5  
ATOM 4448  H H    . THR A 1 59 ? 11.196  -6.417  4.670   1.00 0.00 ? 59 THR A H    5  
ATOM 4449  H HA   . THR A 1 59 ? 10.145  -8.747  6.061   1.00 0.00 ? 59 THR A HA   5  
ATOM 4450  H HB   . THR A 1 59 ? 12.215  -6.739  7.095   1.00 0.00 ? 59 THR A HB   5  
ATOM 4451  H HG1  . THR A 1 59 ? 12.641  -8.773  5.211   1.00 0.00 ? 59 THR A HG1  5  
ATOM 4452  H HG21 . THR A 1 59 ? 13.250  -8.749  8.114   1.00 0.00 ? 59 THR A HG21 5  
ATOM 4453  H HG22 . THR A 1 59 ? 11.942  -9.762  7.503   1.00 0.00 ? 59 THR A HG22 5  
ATOM 4454  H HG23 . THR A 1 59 ? 11.607  -8.517  8.697   1.00 0.00 ? 59 THR A HG23 5  
ATOM 4455  N N    . ALA A 1 60 ? 9.886   -5.759  7.469   1.00 0.00 ? 60 ALA A N    5  
ATOM 4456  C CA   . ALA A 1 60 ? 9.155   -4.891  8.376   1.00 0.00 ? 60 ALA A CA   5  
ATOM 4457  C C    . ALA A 1 60 ? 9.891   -3.541  8.399   1.00 0.00 ? 60 ALA A C    5  
ATOM 4458  O O    . ALA A 1 60 ? 11.077  -3.517  8.060   1.00 0.00 ? 60 ALA A O    5  
ATOM 4459  C CB   . ALA A 1 60 ? 9.112   -5.474  9.797   1.00 0.00 ? 60 ALA A CB   5  
ATOM 4460  O OXT  . ALA A 1 60 ? 9.275   -2.535  8.742   1.00 0.00 ? 60 ALA A OXT  5  
ATOM 4461  H H    . ALA A 1 60 ? 10.700  -5.311  7.097   1.00 0.00 ? 60 ALA A H    5  
ATOM 4462  H HA   . ALA A 1 60 ? 8.154   -4.758  7.960   1.00 0.00 ? 60 ALA A HA   5  
ATOM 4463  H HB1  . ALA A 1 60 ? 8.571   -6.420  9.825   1.00 0.00 ? 60 ALA A HB1  5  
ATOM 4464  H HB2  . ALA A 1 60 ? 8.609   -4.790  10.481  1.00 0.00 ? 60 ALA A HB2  5  
ATOM 4465  H HB3  . ALA A 1 60 ? 10.117  -5.650  10.181  1.00 0.00 ? 60 ALA A HB3  5  
ATOM 4466  N N    . THR A 1 1  ? 10.449  4.240   10.956  1.00 0.00 ? 1  THR A N    6  
ATOM 4467  C CA   . THR A 1 1  ? 10.759  5.454   10.223  1.00 0.00 ? 1  THR A CA   6  
ATOM 4468  C C    . THR A 1 1  ? 9.532   5.672   9.350   1.00 0.00 ? 1  THR A C    6  
ATOM 4469  O O    . THR A 1 1  ? 8.653   4.820   9.382   1.00 0.00 ? 1  THR A O    6  
ATOM 4470  C CB   . THR A 1 1  ? 12.043  5.198   9.401   1.00 0.00 ? 1  THR A CB   6  
ATOM 4471  O OG1  . THR A 1 1  ? 12.384  3.827   9.595   1.00 0.00 ? 1  THR A OG1  6  
ATOM 4472  C CG2  . THR A 1 1  ? 13.196  6.098   9.870   1.00 0.00 ? 1  THR A CG2  6  
ATOM 4473  H H1   . THR A 1 1  ? 9.502   3.950   10.612  1.00 0.00 ? 1  THR A H1   6  
ATOM 4474  H H2   . THR A 1 1  ? 10.478  4.366   11.984  1.00 0.00 ? 1  THR A H2   6  
ATOM 4475  H H3   . THR A 1 1  ? 11.174  3.561   10.626  1.00 0.00 ? 1  THR A H3   6  
ATOM 4476  H HA   . THR A 1 1  ? 10.854  6.278   10.932  1.00 0.00 ? 1  THR A HA   6  
ATOM 4477  H HB   . THR A 1 1  ? 11.857  5.387   8.334   1.00 0.00 ? 1  THR A HB   6  
ATOM 4478  H HG1  . THR A 1 1  ? 13.141  3.588   9.056   1.00 0.00 ? 1  THR A HG1  6  
ATOM 4479  H HG21 . THR A 1 1  ? 12.924  7.152   9.796   1.00 0.00 ? 1  THR A HG21 6  
ATOM 4480  H HG22 . THR A 1 1  ? 14.095  5.957   9.269   1.00 0.00 ? 1  THR A HG22 6  
ATOM 4481  H HG23 . THR A 1 1  ? 13.457  5.896   10.910  1.00 0.00 ? 1  THR A HG23 6  
ATOM 4482  N N    . ALA A 1 2  ? 9.510   6.794   8.608   1.00 0.00 ? 2  ALA A N    6  
ATOM 4483  C CA   . ALA A 1 2  ? 8.390   7.042   7.707   1.00 0.00 ? 2  ALA A CA   6  
ATOM 4484  C C    . ALA A 1 2  ? 8.562   6.147   6.468   1.00 0.00 ? 2  ALA A C    6  
ATOM 4485  O O    . ALA A 1 2  ? 9.672   5.764   6.119   1.00 0.00 ? 2  ALA A O    6  
ATOM 4486  C CB   . ALA A 1 2  ? 8.372   8.522   7.314   1.00 0.00 ? 2  ALA A CB   6  
ATOM 4487  H H    . ALA A 1 2  ? 10.267  7.445   8.622   1.00 0.00 ? 2  ALA A H    6  
ATOM 4488  H HA   . ALA A 1 2  ? 7.469   6.777   8.230   1.00 0.00 ? 2  ALA A HA   6  
ATOM 4489  H HB1  . ALA A 1 2  ? 8.214   9.155   8.188   1.00 0.00 ? 2  ALA A HB1  6  
ATOM 4490  H HB2  . ALA A 1 2  ? 7.575   8.738   6.602   1.00 0.00 ? 2  ALA A HB2  6  
ATOM 4491  H HB3  . ALA A 1 2  ? 9.317   8.819   6.859   1.00 0.00 ? 2  ALA A HB3  6  
ATOM 4492  N N    . LEU A 1 3  ? 7.404   5.835   5.856   1.00 0.00 ? 3  LEU A N    6  
ATOM 4493  C CA   . LEU A 1 3  ? 7.344   4.970   4.684   1.00 0.00 ? 3  LEU A CA   6  
ATOM 4494  C C    . LEU A 1 3  ? 6.853   5.817   3.488   1.00 0.00 ? 3  LEU A C    6  
ATOM 4495  O O    . LEU A 1 3  ? 5.689   6.189   3.403   1.00 0.00 ? 3  LEU A O    6  
ATOM 4496  C CB   . LEU A 1 3  ? 6.488   3.690   4.918   1.00 0.00 ? 3  LEU A CB   6  
ATOM 4497  C CG   . LEU A 1 3  ? 5.592   3.617   6.180   1.00 0.00 ? 3  LEU A CG   6  
ATOM 4498  C CD1  . LEU A 1 3  ? 6.358   3.526   7.510   1.00 0.00 ? 3  LEU A CD1  6  
ATOM 4499  C CD2  . LEU A 1 3  ? 4.476   4.664   6.228   1.00 0.00 ? 3  LEU A CD2  6  
ATOM 4500  H H    . LEU A 1 3  ? 6.548   6.203   6.214   1.00 0.00 ? 3  LEU A H    6  
ATOM 4501  H HA   . LEU A 1 3  ? 8.359   4.632   4.473   1.00 0.00 ? 3  LEU A HA   6  
ATOM 4502  H HB2  . LEU A 1 3  ? 5.785   3.563   4.048   1.00 0.00 ? 3  LEU A HB2  6  
ATOM 4503  H HB3  . LEU A 1 3  ? 7.242   2.865   5.051   1.00 0.00 ? 3  LEU A HB3  6  
ATOM 4504  H HG   . LEU A 1 3  ? 5.069   2.665   6.103   1.00 0.00 ? 3  LEU A HG   6  
ATOM 4505  H HD11 . LEU A 1 3  ? 5.707   3.140   8.295   1.00 0.00 ? 3  LEU A HD11 6  
ATOM 4506  H HD12 . LEU A 1 3  ? 6.710   4.494   7.856   1.00 0.00 ? 3  LEU A HD12 6  
ATOM 4507  H HD13 . LEU A 1 3  ? 7.214   2.856   7.436   1.00 0.00 ? 3  LEU A HD13 6  
ATOM 4508  H HD21 . LEU A 1 3  ? 4.070   4.744   7.235   1.00 0.00 ? 3  LEU A HD21 6  
ATOM 4509  H HD22 . LEU A 1 3  ? 3.650   4.372   5.588   1.00 0.00 ? 3  LEU A HD22 6  
ATOM 4510  H HD23 . LEU A 1 3  ? 4.807   5.647   5.908   1.00 0.00 ? 3  LEU A HD23 6  
ATOM 4511  N N    . PHE A 1 4  ? 7.828   6.099   2.589   1.00 0.00 ? 4  PHE A N    6  
ATOM 4512  C CA   . PHE A 1 4  ? 7.586   6.881   1.373   1.00 0.00 ? 4  PHE A CA   6  
ATOM 4513  C C    . PHE A 1 4  ? 6.925   5.901   0.353   1.00 0.00 ? 4  PHE A C    6  
ATOM 4514  O O    . PHE A 1 4  ? 5.902   5.321   0.691   1.00 0.00 ? 4  PHE A O    6  
ATOM 4515  C CB   . PHE A 1 4  ? 8.884   7.674   1.021   1.00 0.00 ? 4  PHE A CB   6  
ATOM 4516  C CG   . PHE A 1 4  ? 9.379   8.428   2.230   1.00 0.00 ? 4  PHE A CG   6  
ATOM 4517  C CD1  . PHE A 1 4  ? 8.819   9.659   2.561   1.00 0.00 ? 4  PHE A CD1  6  
ATOM 4518  C CD2  . PHE A 1 4  ? 10.393  7.913   3.033   1.00 0.00 ? 4  PHE A CD2  6  
ATOM 4519  C CE1  . PHE A 1 4  ? 9.267   10.366  3.669   1.00 0.00 ? 4  PHE A CE1  6  
ATOM 4520  C CE2  . PHE A 1 4  ? 10.841  8.615   4.144   1.00 0.00 ? 4  PHE A CE2  6  
ATOM 4521  C CZ   . PHE A 1 4  ? 10.281  9.845   4.460   1.00 0.00 ? 4  PHE A CZ   6  
ATOM 4522  H H    . PHE A 1 4  ? 8.746   5.752   2.765   1.00 0.00 ? 4  PHE A H    6  
ATOM 4523  H HA   . PHE A 1 4  ? 6.834   7.612   1.650   1.00 0.00 ? 4  PHE A HA   6  
ATOM 4524  H HB2  . PHE A 1 4  ? 9.683   7.001   0.700   1.00 0.00 ? 4  PHE A HB2  6  
ATOM 4525  H HB3  . PHE A 1 4  ? 8.759   8.453   0.249   1.00 0.00 ? 4  PHE A HB3  6  
ATOM 4526  H HD1  . PHE A 1 4  ? 8.029   10.073  1.951   1.00 0.00 ? 4  PHE A HD1  6  
ATOM 4527  H HD2  . PHE A 1 4  ? 10.841  6.958   2.803   1.00 0.00 ? 4  PHE A HD2  6  
ATOM 4528  H HE1  . PHE A 1 4  ? 8.827   11.321  3.916   1.00 0.00 ? 4  PHE A HE1  6  
ATOM 4529  H HE2  . PHE A 1 4  ? 11.625  8.202   4.762   1.00 0.00 ? 4  PHE A HE2  6  
ATOM 4530  H HZ   . PHE A 1 4  ? 10.632  10.395  5.321   1.00 0.00 ? 4  PHE A HZ   6  
ATOM 4531  N N    . THR A 1 5  ? 7.509   5.664   -0.843  1.00 0.00 ? 5  THR A N    6  
ATOM 4532  C CA   . THR A 1 5  ? 6.942   4.687   -1.775  1.00 0.00 ? 5  THR A CA   6  
ATOM 4533  C C    . THR A 1 5  ? 7.804   3.420   -1.827  1.00 0.00 ? 5  THR A C    6  
ATOM 4534  O O    . THR A 1 5  ? 7.335   2.316   -2.073  1.00 0.00 ? 5  THR A O    6  
ATOM 4535  C CB   . THR A 1 5  ? 6.944   5.301   -3.168  1.00 0.00 ? 5  THR A CB   6  
ATOM 4536  O OG1  . THR A 1 5  ? 8.207   5.948   -3.304  1.00 0.00 ? 5  THR A OG1  6  
ATOM 4537  C CG2  . THR A 1 5  ? 5.742   6.243   -3.368  1.00 0.00 ? 5  THR A CG2  6  
ATOM 4538  H H    . THR A 1 5  ? 8.297   6.102   -1.261  1.00 0.00 ? 5  THR A H    6  
ATOM 4539  H HA   . THR A 1 5  ? 5.951   4.393   -1.456  1.00 0.00 ? 5  THR A HA   6  
ATOM 4540  H HB   . THR A 1 5  ? 6.870   4.458   -3.859  1.00 0.00 ? 5  THR A HB   6  
ATOM 4541  H HG1  . THR A 1 5  ? 8.353   6.240   -4.203  1.00 0.00 ? 5  THR A HG1  6  
ATOM 4542  H HG21 . THR A 1 5  ? 4.799   5.739   -3.136  1.00 0.00 ? 5  THR A HG21 6  
ATOM 4543  H HG22 . THR A 1 5  ? 5.644   6.599   -4.393  1.00 0.00 ? 5  THR A HG22 6  
ATOM 4544  H HG23 . THR A 1 5  ? 5.802   7.106   -2.704  1.00 0.00 ? 5  THR A HG23 6  
ATOM 4545  N N    . MET A 1 6  ? 9.094   3.674   -1.583  1.00 0.00 ? 6  MET A N    6  
ATOM 4546  C CA   . MET A 1 6  ? 10.115  2.638   -1.476  1.00 0.00 ? 6  MET A CA   6  
ATOM 4547  C C    . MET A 1 6  ? 10.188  1.755   -2.737  1.00 0.00 ? 6  MET A C    6  
ATOM 4548  O O    . MET A 1 6  ? 10.407  0.554   -2.667  1.00 0.00 ? 6  MET A O    6  
ATOM 4549  C CB   . MET A 1 6  ? 9.834   1.819   -0.201  1.00 0.00 ? 6  MET A CB   6  
ATOM 4550  C CG   . MET A 1 6  ? 9.648   2.719   1.052   1.00 0.00 ? 6  MET A CG   6  
ATOM 4551  S SD   . MET A 1 6  ? 11.234  3.230   1.750   1.00 0.00 ? 6  MET A SD   6  
ATOM 4552  C CE   . MET A 1 6  ? 11.580  4.694   0.756   1.00 0.00 ? 6  MET A CE   6  
ATOM 4553  H H    . MET A 1 6  ? 9.270   4.642   -1.439  1.00 0.00 ? 6  MET A H    6  
ATOM 4554  H HA   . MET A 1 6  ? 11.064  3.162   -1.388  1.00 0.00 ? 6  MET A HA   6  
ATOM 4555  H HB2  . MET A 1 6  ? 8.963   1.177   -0.385  1.00 0.00 ? 6  MET A HB2  6  
ATOM 4556  H HB3  . MET A 1 6  ? 10.654  1.122   -0.021  1.00 0.00 ? 6  MET A HB3  6  
ATOM 4557  H HG2  . MET A 1 6  ? 9.038   3.608   0.866   1.00 0.00 ? 6  MET A HG2  6  
ATOM 4558  H HG3  . MET A 1 6  ? 9.107   2.197   1.840   1.00 0.00 ? 6  MET A HG3  6  
ATOM 4559  H HE1  . MET A 1 6  ? 11.945  5.493   1.401   1.00 0.00 ? 6  MET A HE1  6  
ATOM 4560  H HE2  . MET A 1 6  ? 10.689  5.052   0.246   1.00 0.00 ? 6  MET A HE2  6  
ATOM 4561  H HE3  . MET A 1 6  ? 12.363  4.479   0.029   1.00 0.00 ? 6  MET A HE3  6  
ATOM 4562  N N    . GLY A 1 7  ? 9.976   2.432   -3.885  1.00 0.00 ? 7  GLY A N    6  
ATOM 4563  C CA   . GLY A 1 7  ? 9.986   1.763   -5.188  1.00 0.00 ? 7  GLY A CA   6  
ATOM 4564  C C    . GLY A 1 7  ? 8.639   1.926   -5.907  1.00 0.00 ? 7  GLY A C    6  
ATOM 4565  O O    . GLY A 1 7  ? 8.564   1.914   -7.126  1.00 0.00 ? 7  GLY A O    6  
ATOM 4566  H H    . GLY A 1 7  ? 9.810   3.416   -3.833  1.00 0.00 ? 7  GLY A H    6  
ATOM 4567  H HA2  . GLY A 1 7  ? 10.771  2.235   -5.782  1.00 0.00 ? 7  GLY A HA2  6  
ATOM 4568  H HA3  . GLY A 1 7  ? 10.205  0.698   -5.067  1.00 0.00 ? 7  GLY A HA3  6  
ATOM 4569  N N    . GLY A 1 8  ? 7.606   2.086   -5.053  1.00 0.00 ? 8  GLY A N    6  
ATOM 4570  C CA   . GLY A 1 8  ? 6.203   2.292   -5.412  1.00 0.00 ? 8  GLY A CA   6  
ATOM 4571  C C    . GLY A 1 8  ? 5.939   3.167   -6.647  1.00 0.00 ? 8  GLY A C    6  
ATOM 4572  O O    . GLY A 1 8  ? 6.789   3.913   -7.112  1.00 0.00 ? 8  GLY A O    6  
ATOM 4573  H H    . GLY A 1 8  ? 7.827   1.962   -4.087  1.00 0.00 ? 8  GLY A H    6  
ATOM 4574  H HA2  . GLY A 1 8  ? 5.755   1.301   -5.508  1.00 0.00 ? 8  GLY A HA2  6  
ATOM 4575  H HA3  . GLY A 1 8  ? 5.764   2.824   -4.579  1.00 0.00 ? 8  GLY A HA3  6  
ATOM 4576  N N    . ASN A 1 9  ? 4.693   3.018   -7.147  1.00 0.00 ? 9  ASN A N    6  
ATOM 4577  C CA   . ASN A 1 9  ? 4.313   3.684   -8.397  1.00 0.00 ? 9  ASN A CA   6  
ATOM 4578  C C    . ASN A 1 9  ? 3.332   4.846   -8.172  1.00 0.00 ? 9  ASN A C    6  
ATOM 4579  O O    . ASN A 1 9  ? 2.912   5.505   -9.118  1.00 0.00 ? 9  ASN A O    6  
ATOM 4580  C CB   . ASN A 1 9  ? 3.699   2.642   -9.370  1.00 0.00 ? 9  ASN A CB   6  
ATOM 4581  C CG   . ASN A 1 9  ? 2.290   2.154   -8.965  1.00 0.00 ? 9  ASN A CG   6  
ATOM 4582  O OD1  . ASN A 1 9  ? 1.741   2.558   -7.953  1.00 0.00 ? 9  ASN A OD1  6  
ATOM 4583  N ND2  . ASN A 1 9  ? 1.667   1.366   -9.849  1.00 0.00 ? 9  ASN A ND2  6  
ATOM 4584  H H    . ASN A 1 9  ? 4.024   2.452   -6.648  1.00 0.00 ? 9  ASN A H    6  
ATOM 4585  H HA   . ASN A 1 9  ? 5.218   4.096   -8.850  1.00 0.00 ? 9  ASN A HA   6  
ATOM 4586  H HB2  . ASN A 1 9  ? 3.617   3.095   -10.359 1.00 0.00 ? 9  ASN A HB2  6  
ATOM 4587  H HB3  . ASN A 1 9  ? 4.367   1.788   -9.483  1.00 0.00 ? 9  ASN A HB3  6  
ATOM 4588  H HD21 . ASN A 1 9  ? 2.115   1.004   -10.671 1.00 0.00 ? 9  ASN A HD21 6  
ATOM 4589  H HD22 . ASN A 1 9  ? 0.702   1.169   -9.632  1.00 0.00 ? 9  ASN A HD22 6  
ATOM 4590  N N    . ALA A 1 10 ? 2.965   5.061   -6.898  1.00 0.00 ? 10 ALA A N    6  
ATOM 4591  C CA   . ALA A 1 10 ? 1.969   6.079   -6.585  1.00 0.00 ? 10 ALA A CA   6  
ATOM 4592  C C    . ALA A 1 10 ? 2.497   7.526   -6.575  1.00 0.00 ? 10 ALA A C    6  
ATOM 4593  O O    . ALA A 1 10 ? 2.342   8.226   -5.586  1.00 0.00 ? 10 ALA A O    6  
ATOM 4594  C CB   . ALA A 1 10 ? 1.367   5.754   -5.219  1.00 0.00 ? 10 ALA A CB   6  
ATOM 4595  H H    . ALA A 1 10 ? 3.313   4.463   -6.173  1.00 0.00 ? 10 ALA A H    6  
ATOM 4596  H HA   . ALA A 1 10 ? 1.191   6.023   -7.344  1.00 0.00 ? 10 ALA A HA   6  
ATOM 4597  H HB1  . ALA A 1 10 ? 2.135   5.732   -4.445  1.00 0.00 ? 10 ALA A HB1  6  
ATOM 4598  H HB2  . ALA A 1 10 ? 0.863   4.789   -5.225  1.00 0.00 ? 10 ALA A HB2  6  
ATOM 4599  H HB3  . ALA A 1 10 ? 0.644   6.520   -4.944  1.00 0.00 ? 10 ALA A HB3  6  
ATOM 4600  N N    . GLU A 1 11 ? 3.097   7.957   -7.702  1.00 0.00 ? 11 GLU A N    6  
ATOM 4601  C CA   . GLU A 1 11 ? 3.520   9.352   -7.856  1.00 0.00 ? 11 GLU A CA   6  
ATOM 4602  C C    . GLU A 1 11 ? 4.384   9.874   -6.674  1.00 0.00 ? 11 GLU A C    6  
ATOM 4603  O O    . GLU A 1 11 ? 4.303   11.034  -6.289  1.00 0.00 ? 11 GLU A O    6  
ATOM 4604  C CB   . GLU A 1 11 ? 2.271   10.244  -8.059  1.00 0.00 ? 11 GLU A CB   6  
ATOM 4605  C CG   . GLU A 1 11 ? 1.545   10.079  -9.410  1.00 0.00 ? 11 GLU A CG   6  
ATOM 4606  C CD   . GLU A 1 11 ? 0.883   8.711   -9.644  1.00 0.00 ? 11 GLU A CD   6  
ATOM 4607  O OE1  . GLU A 1 11 ? 0.326   8.120   -8.715  1.00 0.00 ? 11 GLU A OE1  6  
ATOM 4608  O OE2  . GLU A 1 11 ? 0.931   8.211   -10.768 1.00 0.00 ? 11 GLU A OE2  6  
ATOM 4609  H H    . GLU A 1 11 ? 3.159   7.337   -8.484  1.00 0.00 ? 11 GLU A H    6  
ATOM 4610  H HA   . GLU A 1 11 ? 4.139   9.378   -8.753  1.00 0.00 ? 11 GLU A HA   6  
ATOM 4611  H HB2  . GLU A 1 11 ? 1.562   10.095  -7.244  1.00 0.00 ? 11 GLU A HB2  6  
ATOM 4612  H HB3  . GLU A 1 11 ? 2.570   11.290  -7.993  1.00 0.00 ? 11 GLU A HB3  6  
ATOM 4613  H HG2  . GLU A 1 11 ? 0.760   10.832  -9.489  1.00 0.00 ? 11 GLU A HG2  6  
ATOM 4614  H HG3  . GLU A 1 11 ? 2.242   10.276  -10.225 1.00 0.00 ? 11 GLU A HG3  6  
ATOM 4615  N N    . GLY A 1 12 ? 5.206   8.964   -6.107  1.00 0.00 ? 12 GLY A N    6  
ATOM 4616  C CA   . GLY A 1 12 ? 6.081   9.358   -4.987  1.00 0.00 ? 12 GLY A CA   6  
ATOM 4617  C C    . GLY A 1 12 ? 5.308   9.611   -3.666  1.00 0.00 ? 12 GLY A C    6  
ATOM 4618  O O    . GLY A 1 12 ? 5.904   9.963   -2.657  1.00 0.00 ? 12 GLY A O    6  
ATOM 4619  H H    . GLY A 1 12 ? 5.189   8.043   -6.497  1.00 0.00 ? 12 GLY A H    6  
ATOM 4620  H HA2  . GLY A 1 12 ? 6.789   8.493   -4.804  1.00 0.00 ? 12 GLY A HA2  6  
ATOM 4621  H HA3  . GLY A 1 12 ? 6.521   10.356  -5.283  1.00 0.00 ? 12 GLY A HA3  6  
ATOM 4622  N N    . GLN A 1 13 ? 3.970   9.441   -3.712  1.00 0.00 ? 13 GLN A N    6  
ATOM 4623  C CA   . GLN A 1 13 ? 3.135   9.674   -2.540  1.00 0.00 ? 13 GLN A CA   6  
ATOM 4624  C C    . GLN A 1 13 ? 3.394   8.586   -1.470  1.00 0.00 ? 13 GLN A C    6  
ATOM 4625  O O    . GLN A 1 13 ? 3.560   7.416   -1.791  1.00 0.00 ? 13 GLN A O    6  
ATOM 4626  C CB   . GLN A 1 13 ? 1.640   9.715   -2.924  1.00 0.00 ? 13 GLN A CB   6  
ATOM 4627  C CG   . GLN A 1 13 ? 1.229   10.787  -3.958  1.00 0.00 ? 13 GLN A CG   6  
ATOM 4628  C CD   . GLN A 1 13 ? 1.823   12.179  -3.630  1.00 0.00 ? 13 GLN A CD   6  
ATOM 4629  O OE1  . GLN A 1 13 ? 1.272   12.904  -2.815  1.00 0.00 ? 13 GLN A OE1  6  
ATOM 4630  N NE2  . GLN A 1 13 ? 2.966   12.527  -4.249  1.00 0.00 ? 13 GLN A NE2  6  
ATOM 4631  H H    . GLN A 1 13 ? 3.526   9.119   -4.544  1.00 0.00 ? 13 GLN A H    6  
ATOM 4632  H HA   . GLN A 1 13 ? 3.447   10.642  -2.148  1.00 0.00 ? 13 GLN A HA   6  
ATOM 4633  H HB2  . GLN A 1 13 ? 1.323   8.737   -3.287  1.00 0.00 ? 13 GLN A HB2  6  
ATOM 4634  H HB3  . GLN A 1 13 ? 1.059   9.898   -2.019  1.00 0.00 ? 13 GLN A HB3  6  
ATOM 4635  H HG2  . GLN A 1 13 ? 1.401   10.468  -4.988  1.00 0.00 ? 13 GLN A HG2  6  
ATOM 4636  H HG3  . GLN A 1 13 ? 0.146   10.898  -3.910  1.00 0.00 ? 13 GLN A HG3  6  
ATOM 4637  H HE21 . GLN A 1 13 ? 3.459   11.972  -4.925  1.00 0.00 ? 13 GLN A HE21 6  
ATOM 4638  H HE22 . GLN A 1 13 ? 3.369   13.414  -4.014  1.00 0.00 ? 13 GLN A HE22 6  
ATOM 4639  N N    . PRO A 1 14 ? 3.421   9.015   -0.181  1.00 0.00 ? 14 PRO A N    6  
ATOM 4640  C CA   . PRO A 1 14 ? 3.764   8.129   0.931   1.00 0.00 ? 14 PRO A CA   6  
ATOM 4641  C C    . PRO A 1 14 ? 2.688   7.065   1.206   1.00 0.00 ? 14 PRO A C    6  
ATOM 4642  O O    . PRO A 1 14 ? 1.497   7.339   1.097   1.00 0.00 ? 14 PRO A O    6  
ATOM 4643  C CB   . PRO A 1 14 ? 3.862   9.087   2.133   1.00 0.00 ? 14 PRO A CB   6  
ATOM 4644  C CG   . PRO A 1 14 ? 2.952   10.265  1.774   1.00 0.00 ? 14 PRO A CG   6  
ATOM 4645  C CD   . PRO A 1 14 ? 3.096   10.375  0.257   1.00 0.00 ? 14 PRO A CD   6  
ATOM 4646  H HA   . PRO A 1 14 ? 4.716   7.636   0.740   1.00 0.00 ? 14 PRO A HA   6  
ATOM 4647  H HB2  . PRO A 1 14 ? 3.588   8.620   3.086   1.00 0.00 ? 14 PRO A HB2  6  
ATOM 4648  H HB3  . PRO A 1 14 ? 4.880   9.476   2.213   1.00 0.00 ? 14 PRO A HB3  6  
ATOM 4649  H HG2  . PRO A 1 14 ? 1.897   9.948   1.990   1.00 0.00 ? 14 PRO A HG2  6  
ATOM 4650  H HG3  . PRO A 1 14 ? 3.320   11.209  2.255   1.00 0.00 ? 14 PRO A HG3  6  
ATOM 4651  H HD2  . PRO A 1 14 ? 2.178   10.745  -0.201  1.00 0.00 ? 14 PRO A HD2  6  
ATOM 4652  H HD3  . PRO A 1 14 ? 3.916   11.045  -0.004  1.00 0.00 ? 14 PRO A HD3  6  
ATOM 4653  N N    . CYS A 1 15 ? 3.168   5.865   1.615   1.00 0.00 ? 15 CYS A N    6  
ATOM 4654  C CA   . CYS A 1 15 ? 2.271   4.792   2.050   1.00 0.00 ? 15 CYS A CA   6  
ATOM 4655  C C    . CYS A 1 15 ? 1.239   5.356   3.046   1.00 0.00 ? 15 CYS A C    6  
ATOM 4656  O O    . CYS A 1 15 ? 1.552   6.182   3.897   1.00 0.00 ? 15 CYS A O    6  
ATOM 4657  C CB   . CYS A 1 15 ? 3.042   3.737   2.858   1.00 0.00 ? 15 CYS A CB   6  
ATOM 4658  S SG   . CYS A 1 15 ? 3.956   2.509   1.896   1.00 0.00 ? 15 CYS A SG   6  
ATOM 4659  H H    . CYS A 1 15 ? 4.158   5.713   1.640   1.00 0.00 ? 15 CYS A H    6  
ATOM 4660  H HA   . CYS A 1 15 ? 1.753   4.371   1.186   1.00 0.00 ? 15 CYS A HA   6  
ATOM 4661  H HB2  . CYS A 1 15 ? 3.710   4.225   3.552   1.00 0.00 ? 15 CYS A HB2  6  
ATOM 4662  H HB3  . CYS A 1 15 ? 2.375   3.163   3.495   1.00 0.00 ? 15 CYS A HB3  6  
ATOM 4663  N N    . LYS A 1 16 ? 0.000   4.869   2.869   1.00 0.00 ? 16 LYS A N    6  
ATOM 4664  C CA   . LYS A 1 16 ? -1.116  5.341   3.664   1.00 0.00 ? 16 LYS A CA   6  
ATOM 4665  C C    . LYS A 1 16 ? -1.713  4.191   4.463   1.00 0.00 ? 16 LYS A C    6  
ATOM 4666  O O    . LYS A 1 16 ? -1.969  3.103   3.963   1.00 0.00 ? 16 LYS A O    6  
ATOM 4667  C CB   . LYS A 1 16 ? -2.206  5.879   2.726   1.00 0.00 ? 16 LYS A CB   6  
ATOM 4668  C CG   . LYS A 1 16 ? -3.328  6.694   3.432   1.00 0.00 ? 16 LYS A CG   6  
ATOM 4669  C CD   . LYS A 1 16 ? -2.756  7.984   4.038   1.00 0.00 ? 16 LYS A CD   6  
ATOM 4670  C CE   . LYS A 1 16 ? -2.531  7.932   5.557   1.00 0.00 ? 16 LYS A CE   6  
ATOM 4671  N NZ   . LYS A 1 16 ? -2.288  9.249   6.142   1.00 0.00 ? 16 LYS A NZ   6  
ATOM 4672  H H    . LYS A 1 16 ? -0.176  4.173   2.171   1.00 0.00 ? 16 LYS A H    6  
ATOM 4673  H HA   . LYS A 1 16 ? -0.728  6.117   4.328   1.00 0.00 ? 16 LYS A HA   6  
ATOM 4674  H HB2  . LYS A 1 16 ? -1.726  6.546   2.011   1.00 0.00 ? 16 LYS A HB2  6  
ATOM 4675  H HB3  . LYS A 1 16 ? -2.578  5.034   2.131   1.00 0.00 ? 16 LYS A HB3  6  
ATOM 4676  H HG2  . LYS A 1 16 ? -4.094  7.033   2.724   1.00 0.00 ? 16 LYS A HG2  6  
ATOM 4677  H HG3  . LYS A 1 16 ? -3.907  6.103   4.149   1.00 0.00 ? 16 LYS A HG3  6  
ATOM 4678  H HD2  . LYS A 1 16 ? -1.861  8.277   3.471   1.00 0.00 ? 16 LYS A HD2  6  
ATOM 4679  H HD3  . LYS A 1 16 ? -3.484  8.767   3.860   1.00 0.00 ? 16 LYS A HD3  6  
ATOM 4680  H HE2  . LYS A 1 16 ? -3.414  7.517   6.048   1.00 0.00 ? 16 LYS A HE2  6  
ATOM 4681  H HE3  . LYS A 1 16 ? -1.684  7.303   5.821   1.00 0.00 ? 16 LYS A HE3  6  
ATOM 4682  H HZ1  . LYS A 1 16 ? -3.096  9.873   5.943   1.00 0.00 ? 16 LYS A HZ1  6  
ATOM 4683  H HZ2  . LYS A 1 16 ? -1.424  9.664   5.736   1.00 0.00 ? 16 LYS A HZ2  6  
ATOM 4684  H HZ3  . LYS A 1 16 ? -2.175  9.155   7.173   1.00 0.00 ? 16 LYS A HZ3  6  
ATOM 4685  N N    . PHE A 1 17 ? -1.945  4.543   5.731   1.00 0.00 ? 17 PHE A N    6  
ATOM 4686  C CA   . PHE A 1 17 ? -2.623  3.688   6.679   1.00 0.00 ? 17 PHE A CA   6  
ATOM 4687  C C    . PHE A 1 17 ? -3.664  4.628   7.305   1.00 0.00 ? 17 PHE A C    6  
ATOM 4688  O O    . PHE A 1 17 ? -3.294  5.740   7.683   1.00 0.00 ? 17 PHE A O    6  
ATOM 4689  C CB   . PHE A 1 17 ? -1.617  3.179   7.732   1.00 0.00 ? 17 PHE A CB   6  
ATOM 4690  C CG   . PHE A 1 17 ? -0.468  2.430   7.108   1.00 0.00 ? 17 PHE A CG   6  
ATOM 4691  C CD1  . PHE A 1 17 ? -0.689  1.298   6.333   1.00 0.00 ? 17 PHE A CD1  6  
ATOM 4692  C CD2  . PHE A 1 17 ? 0.840   2.861   7.293   1.00 0.00 ? 17 PHE A CD2  6  
ATOM 4693  C CE1  . PHE A 1 17 ? 0.372   0.617   5.756   1.00 0.00 ? 17 PHE A CE1  6  
ATOM 4694  C CE2  . PHE A 1 17 ? 1.902   2.177   6.725   1.00 0.00 ? 17 PHE A CE2  6  
ATOM 4695  C CZ   . PHE A 1 17 ? 1.672   1.047   5.958   1.00 0.00 ? 17 PHE A CZ   6  
ATOM 4696  H H    . PHE A 1 17 ? -1.721  5.464   6.044   1.00 0.00 ? 17 PHE A H    6  
ATOM 4697  H HA   . PHE A 1 17 ? -3.088  2.880   6.114   1.00 0.00 ? 17 PHE A HA   6  
ATOM 4698  H HB2  . PHE A 1 17 ? -1.217  4.035   8.289   1.00 0.00 ? 17 PHE A HB2  6  
ATOM 4699  H HB3  . PHE A 1 17 ? -2.099  2.509   8.455   1.00 0.00 ? 17 PHE A HB3  6  
ATOM 4700  H HD1  . PHE A 1 17 ? -1.693  0.946   6.172   1.00 0.00 ? 17 PHE A HD1  6  
ATOM 4701  H HD2  . PHE A 1 17 ? 1.044   3.735   7.884   1.00 0.00 ? 17 PHE A HD2  6  
ATOM 4702  H HE1  . PHE A 1 17 ? 0.187   -0.245  5.142   1.00 0.00 ? 17 PHE A HE1  6  
ATOM 4703  H HE2  . PHE A 1 17 ? 2.904   2.533   6.885   1.00 0.00 ? 17 PHE A HE2  6  
ATOM 4704  H HZ   . PHE A 1 17 ? 2.498   0.501   5.528   1.00 0.00 ? 17 PHE A HZ   6  
ATOM 4705  N N    . PRO A 1 18 ? -4.955  4.215   7.377   1.00 0.00 ? 18 PRO A N    6  
ATOM 4706  C CA   . PRO A 1 18 ? -5.520  3.008   6.773   1.00 0.00 ? 18 PRO A CA   6  
ATOM 4707  C C    . PRO A 1 18 ? -5.865  3.205   5.279   1.00 0.00 ? 18 PRO A C    6  
ATOM 4708  O O    . PRO A 1 18 ? -6.379  4.242   4.882   1.00 0.00 ? 18 PRO A O    6  
ATOM 4709  C CB   . PRO A 1 18 ? -6.815  2.792   7.566   1.00 0.00 ? 18 PRO A CB   6  
ATOM 4710  C CG   . PRO A 1 18 ? -7.250  4.202   7.978   1.00 0.00 ? 18 PRO A CG   6  
ATOM 4711  C CD   . PRO A 1 18 ? -5.939  4.979   8.141   1.00 0.00 ? 18 PRO A CD   6  
ATOM 4712  H HA   . PRO A 1 18 ? -4.852  2.161   6.896   1.00 0.00 ? 18 PRO A HA   6  
ATOM 4713  H HB2  . PRO A 1 18 ? -7.586  2.248   7.018   1.00 0.00 ? 18 PRO A HB2  6  
ATOM 4714  H HB3  . PRO A 1 18 ? -6.586  2.214   8.462   1.00 0.00 ? 18 PRO A HB3  6  
ATOM 4715  H HG2  . PRO A 1 18 ? -7.838  4.648   7.175   1.00 0.00 ? 18 PRO A HG2  6  
ATOM 4716  H HG3  . PRO A 1 18 ? -7.859  4.208   8.882   1.00 0.00 ? 18 PRO A HG3  6  
ATOM 4717  H HD2  . PRO A 1 18 ? -6.022  6.001   7.762   1.00 0.00 ? 18 PRO A HD2  6  
ATOM 4718  H HD3  . PRO A 1 18 ? -5.634  5.001   9.192   1.00 0.00 ? 18 PRO A HD3  6  
ATOM 4719  N N    . PHE A 1 19 ? -5.570  2.153   4.493   1.00 0.00 ? 19 PHE A N    6  
ATOM 4720  C CA   . PHE A 1 19 ? -5.937  2.101   3.079   1.00 0.00 ? 19 PHE A CA   6  
ATOM 4721  C C    . PHE A 1 19 ? -6.943  0.948   2.968   1.00 0.00 ? 19 PHE A C    6  
ATOM 4722  O O    . PHE A 1 19 ? -6.770  -0.097  3.581   1.00 0.00 ? 19 PHE A O    6  
ATOM 4723  C CB   . PHE A 1 19 ? -4.745  1.885   2.121   1.00 0.00 ? 19 PHE A CB   6  
ATOM 4724  C CG   . PHE A 1 19 ? -3.983  0.575   2.346   1.00 0.00 ? 19 PHE A CG   6  
ATOM 4725  C CD1  . PHE A 1 19 ? -3.250  0.288   3.511   1.00 0.00 ? 19 PHE A CD1  6  
ATOM 4726  C CD2  . PHE A 1 19 ? -4.010  -0.391  1.332   1.00 0.00 ? 19 PHE A CD2  6  
ATOM 4727  C CE1  . PHE A 1 19 ? -2.540  -0.895  3.631   1.00 0.00 ? 19 PHE A CE1  6  
ATOM 4728  C CE2  . PHE A 1 19 ? -3.285  -1.597  1.462   1.00 0.00 ? 19 PHE A CE2  6  
ATOM 4729  C CZ   . PHE A 1 19 ? -2.548  -1.830  2.611   1.00 0.00 ? 19 PHE A CZ   6  
ATOM 4730  H H    . PHE A 1 19 ? -5.179  1.324   4.901   1.00 0.00 ? 19 PHE A H    6  
ATOM 4731  H HA   . PHE A 1 19 ? -6.456  3.023   2.807   1.00 0.00 ? 19 PHE A HA   6  
ATOM 4732  H HB2  . PHE A 1 19 ? -5.190  1.836   1.115   1.00 0.00 ? 19 PHE A HB2  6  
ATOM 4733  H HB3  . PHE A 1 19 ? -4.087  2.776   2.097   1.00 0.00 ? 19 PHE A HB3  6  
ATOM 4734  H HD1  . PHE A 1 19 ? -3.186  0.911   4.397   1.00 0.00 ? 19 PHE A HD1  6  
ATOM 4735  H HD2  . PHE A 1 19 ? -4.626  -0.111  0.471   1.00 0.00 ? 19 PHE A HD2  6  
ATOM 4736  H HE1  . PHE A 1 19 ? -1.985  -1.082  4.540   1.00 0.00 ? 19 PHE A HE1  6  
ATOM 4737  H HE2  . PHE A 1 19 ? -3.215  -2.425  0.746   1.00 0.00 ? 19 PHE A HE2  6  
ATOM 4738  H HZ   . PHE A 1 19 ? -1.981  -2.747  2.707   1.00 0.00 ? 19 PHE A HZ   6  
ATOM 4739  N N    . ARG A 1 20 ? -8.018  1.195   2.202   1.00 0.00 ? 20 ARG A N    6  
ATOM 4740  C CA   . ARG A 1 20 ? -9.084  0.205   2.081   1.00 0.00 ? 20 ARG A CA   6  
ATOM 4741  C C    . ARG A 1 20 ? -8.971  -0.495  0.713   1.00 0.00 ? 20 ARG A C    6  
ATOM 4742  O O    . ARG A 1 20 ? -8.964  0.160   -0.320  1.00 0.00 ? 20 ARG A O    6  
ATOM 4743  C CB   . ARG A 1 20 ? -10.412 0.963   2.283   1.00 0.00 ? 20 ARG A CB   6  
ATOM 4744  C CG   . ARG A 1 20 ? -11.599 0.081   2.693   1.00 0.00 ? 20 ARG A CG   6  
ATOM 4745  C CD   . ARG A 1 20 ? -12.394 -0.496  1.487   1.00 0.00 ? 20 ARG A CD   6  
ATOM 4746  N NE   . ARG A 1 20 ? -12.782 0.523   0.473   1.00 0.00 ? 20 ARG A NE   6  
ATOM 4747  C CZ   . ARG A 1 20 ? -13.748 1.434   0.745   1.00 0.00 ? 20 ARG A CZ   6  
ATOM 4748  N NH1  . ARG A 1 20 ? -14.369 1.428   1.922   1.00 0.00 ? 20 ARG A NH1  6  
ATOM 4749  N NH2  . ARG A 1 20 ? -14.077 2.334   -0.173  1.00 0.00 ? 20 ARG A NH2  6  
ATOM 4750  H H    . ARG A 1 20 ? -8.120  2.071   1.721   1.00 0.00 ? 20 ARG A H    6  
ATOM 4751  H HA   . ARG A 1 20 ? -8.957  -0.532  2.876   1.00 0.00 ? 20 ARG A HA   6  
ATOM 4752  H HB2  . ARG A 1 20 ? -10.260 1.674   3.097   1.00 0.00 ? 20 ARG A HB2  6  
ATOM 4753  H HB3  . ARG A 1 20 ? -10.648 1.577   1.414   1.00 0.00 ? 20 ARG A HB3  6  
ATOM 4754  H HG2  . ARG A 1 20 ? -11.218 -0.716  3.333   1.00 0.00 ? 20 ARG A HG2  6  
ATOM 4755  H HG3  . ARG A 1 20 ? -12.237 0.637   3.394   1.00 0.00 ? 20 ARG A HG3  6  
ATOM 4756  H HD2  . ARG A 1 20 ? -11.813 -1.273  0.974   1.00 0.00 ? 20 ARG A HD2  6  
ATOM 4757  H HD3  . ARG A 1 20 ? -13.307 -0.986  1.853   1.00 0.00 ? 20 ARG A HD3  6  
ATOM 4758  H HE   . ARG A 1 20 ? -12.397 0.624   -0.476  1.00 0.00 ? 20 ARG A HE   6  
ATOM 4759  H HH11 . ARG A 1 20 ? -14.105 0.742   2.599   1.00 0.00 ? 20 ARG A HH11 6  
ATOM 4760  H HH12 . ARG A 1 20 ? -15.087 2.085   2.147   1.00 0.00 ? 20 ARG A HH12 6  
ATOM 4761  H HH21 . ARG A 1 20 ? -13.580 2.306   -1.054  1.00 0.00 ? 20 ARG A HH21 6  
ATOM 4762  H HH22 . ARG A 1 20 ? -14.779 3.029   -0.038  1.00 0.00 ? 20 ARG A HH22 6  
ATOM 4763  N N    . PHE A 1 21 ? -8.866  -1.842  0.756   1.00 0.00 ? 21 PHE A N    6  
ATOM 4764  C CA   . PHE A 1 21 ? -8.748  -2.641  -0.469  1.00 0.00 ? 21 PHE A CA   6  
ATOM 4765  C C    . PHE A 1 21 ? -9.668  -3.867  -0.307  1.00 0.00 ? 21 PHE A C    6  
ATOM 4766  O O    . PHE A 1 21 ? -9.790  -4.426  0.775   1.00 0.00 ? 21 PHE A O    6  
ATOM 4767  C CB   . PHE A 1 21 ? -7.276  -3.055  -0.679  1.00 0.00 ? 21 PHE A CB   6  
ATOM 4768  C CG   . PHE A 1 21 ? -7.056  -4.061  -1.791  1.00 0.00 ? 21 PHE A CG   6  
ATOM 4769  C CD1  . PHE A 1 21 ? -7.737  -3.942  -2.989  1.00 0.00 ? 21 PHE A CD1  6  
ATOM 4770  C CD2  . PHE A 1 21 ? -6.176  -5.128  -1.652  1.00 0.00 ? 21 PHE A CD2  6  
ATOM 4771  C CE1  . PHE A 1 21 ? -7.544  -4.831  -4.037  1.00 0.00 ? 21 PHE A CE1  6  
ATOM 4772  C CE2  . PHE A 1 21 ? -5.976  -6.036  -2.687  1.00 0.00 ? 21 PHE A CE2  6  
ATOM 4773  C CZ   . PHE A 1 21 ? -6.655  -5.885  -3.887  1.00 0.00 ? 21 PHE A CZ   6  
ATOM 4774  H H    . PHE A 1 21 ? -8.889  -2.329  1.642   1.00 0.00 ? 21 PHE A H    6  
ATOM 4775  H HA   . PHE A 1 21 ? -9.095  -2.054  -1.324  1.00 0.00 ? 21 PHE A HA   6  
ATOM 4776  H HB2  . PHE A 1 21 ? -6.662  -2.172  -0.880  1.00 0.00 ? 21 PHE A HB2  6  
ATOM 4777  H HB3  . PHE A 1 21 ? -6.929  -3.497  0.247   1.00 0.00 ? 21 PHE A HB3  6  
ATOM 4778  H HD1  . PHE A 1 21 ? -8.449  -3.148  -3.070  1.00 0.00 ? 21 PHE A HD1  6  
ATOM 4779  H HD2  . PHE A 1 21 ? -5.640  -5.259  -0.728  1.00 0.00 ? 21 PHE A HD2  6  
ATOM 4780  H HE1  . PHE A 1 21 ? -8.103  -4.703  -4.954  1.00 0.00 ? 21 PHE A HE1  6  
ATOM 4781  H HE2  . PHE A 1 21 ? -5.290  -6.862  -2.557  1.00 0.00 ? 21 PHE A HE2  6  
ATOM 4782  H HZ   . PHE A 1 21 ? -6.500  -6.588  -4.693  1.00 0.00 ? 21 PHE A HZ   6  
ATOM 4783  N N    . GLN A 1 22 ? -10.328 -4.231  -1.426  1.00 0.00 ? 22 GLN A N    6  
ATOM 4784  C CA   . GLN A 1 22 ? -11.268 -5.349  -1.498  1.00 0.00 ? 22 GLN A CA   6  
ATOM 4785  C C    . GLN A 1 22 ? -12.472 -5.123  -0.556  1.00 0.00 ? 22 GLN A C    6  
ATOM 4786  O O    . GLN A 1 22 ? -13.144 -6.062  -0.151  1.00 0.00 ? 22 GLN A O    6  
ATOM 4787  C CB   . GLN A 1 22 ? -10.616 -6.733  -1.192  1.00 0.00 ? 22 GLN A CB   6  
ATOM 4788  C CG   . GLN A 1 22 ? -9.387  -7.134  -2.048  1.00 0.00 ? 22 GLN A CG   6  
ATOM 4789  C CD   . GLN A 1 22 ? -8.638  -8.368  -1.508  1.00 0.00 ? 22 GLN A CD   6  
ATOM 4790  O OE1  . GLN A 1 22 ? -8.266  -9.248  -2.273  1.00 0.00 ? 22 GLN A OE1  6  
ATOM 4791  N NE2  . GLN A 1 22 ? -8.409  -8.410  -0.192  1.00 0.00 ? 22 GLN A NE2  6  
ATOM 4792  H H    . GLN A 1 22 ? -10.196 -3.693  -2.269  1.00 0.00 ? 22 GLN A H    6  
ATOM 4793  H HA   . GLN A 1 22 ? -11.659 -5.284  -2.515  1.00 0.00 ? 22 GLN A HA   6  
ATOM 4794  H HB2  . GLN A 1 22 ? -10.341 -6.734  -0.136  1.00 0.00 ? 22 GLN A HB2  6  
ATOM 4795  H HB3  . GLN A 1 22 ? -11.368 -7.517  -1.296  1.00 0.00 ? 22 GLN A HB3  6  
ATOM 4796  H HG2  . GLN A 1 22 ? -9.657  -7.458  -3.074  1.00 0.00 ? 22 GLN A HG2  6  
ATOM 4797  H HG3  . GLN A 1 22 ? -8.692  -6.284  -2.062  1.00 0.00 ? 22 GLN A HG3  6  
ATOM 4798  H HE21 . GLN A 1 22 ? -8.677  -7.733  0.501   1.00 0.00 ? 22 GLN A HE21 6  
ATOM 4799  H HE22 . GLN A 1 22 ? -7.893  -9.182  0.194   1.00 0.00 ? 22 GLN A HE22 6  
ATOM 4800  N N    . GLY A 1 23 ? -12.703 -3.836  -0.217  1.00 0.00 ? 23 GLY A N    6  
ATOM 4801  C CA   . GLY A 1 23 ? -13.805 -3.528  0.688   1.00 0.00 ? 23 GLY A CA   6  
ATOM 4802  C C    . GLY A 1 23 ? -13.416 -3.687  2.171   1.00 0.00 ? 23 GLY A C    6  
ATOM 4803  O O    . GLY A 1 23 ? -14.252 -3.534  3.050   1.00 0.00 ? 23 GLY A O    6  
ATOM 4804  H H    . GLY A 1 23 ? -12.132 -3.100  -0.583  1.00 0.00 ? 23 GLY A H    6  
ATOM 4805  H HA2  . GLY A 1 23 ? -14.097 -2.496  0.485   1.00 0.00 ? 23 GLY A HA2  6  
ATOM 4806  H HA3  . GLY A 1 23 ? -14.648 -4.190  0.460   1.00 0.00 ? 23 GLY A HA3  6  
ATOM 4807  N N    . THR A 1 24 ? -12.124 -3.986  2.411   1.00 0.00 ? 24 THR A N    6  
ATOM 4808  C CA   . THR A 1 24 ? -11.618 -4.197  3.763   1.00 0.00 ? 24 THR A CA   6  
ATOM 4809  C C    . THR A 1 24 ? -10.533 -3.155  4.084   1.00 0.00 ? 24 THR A C    6  
ATOM 4810  O O    . THR A 1 24 ? -9.692  -2.826  3.259   1.00 0.00 ? 24 THR A O    6  
ATOM 4811  C CB   . THR A 1 24 ? -11.061 -5.631  3.820   1.00 0.00 ? 24 THR A CB   6  
ATOM 4812  O OG1  . THR A 1 24 ? -11.936 -6.539  3.180   1.00 0.00 ? 24 THR A OG1  6  
ATOM 4813  C CG2  . THR A 1 24 ? -10.780 -6.105  5.253   1.00 0.00 ? 24 THR A CG2  6  
ATOM 4814  H H    . THR A 1 24 ? -11.456 -4.116  1.675   1.00 0.00 ? 24 THR A H    6  
ATOM 4815  H HA   . THR A 1 24 ? -12.438 -4.074  4.474   1.00 0.00 ? 24 THR A HA   6  
ATOM 4816  H HB   . THR A 1 24 ? -10.132 -5.665  3.244   1.00 0.00 ? 24 THR A HB   6  
ATOM 4817  H HG1  . THR A 1 24 ? -12.822 -6.417  3.502   1.00 0.00 ? 24 THR A HG1  6  
ATOM 4818  H HG21 . THR A 1 24 ? -10.406 -7.129  5.252   1.00 0.00 ? 24 THR A HG21 6  
ATOM 4819  H HG22 . THR A 1 24 ? -11.679 -6.079  5.870   1.00 0.00 ? 24 THR A HG22 6  
ATOM 4820  H HG23 . THR A 1 24 ? -10.029 -5.480  5.737   1.00 0.00 ? 24 THR A HG23 6  
ATOM 4821  N N    . SER A 1 25 ? -10.619 -2.636  5.321   1.00 0.00 ? 25 SER A N    6  
ATOM 4822  C CA   . SER A 1 25 ? -9.687  -1.631  5.808   1.00 0.00 ? 25 SER A CA   6  
ATOM 4823  C C    . SER A 1 25 ? -8.393  -2.319  6.284   1.00 0.00 ? 25 SER A C    6  
ATOM 4824  O O    . SER A 1 25 ? -8.417  -3.232  7.101   1.00 0.00 ? 25 SER A O    6  
ATOM 4825  C CB   . SER A 1 25 ? -10.392 -0.884  6.952   1.00 0.00 ? 25 SER A CB   6  
ATOM 4826  O OG   . SER A 1 25 ? -11.390 -1.729  7.521   1.00 0.00 ? 25 SER A OG   6  
ATOM 4827  H H    . SER A 1 25 ? -11.307 -2.907  5.997   1.00 0.00 ? 25 SER A H    6  
ATOM 4828  H HA   . SER A 1 25 ? -9.457  -0.945  4.993   1.00 0.00 ? 25 SER A HA   6  
ATOM 4829  H HB2  . SER A 1 25 ? -9.668  -0.553  7.709   1.00 0.00 ? 25 SER A HB2  6  
ATOM 4830  H HB3  . SER A 1 25 ? -10.872 0.011   6.544   1.00 0.00 ? 25 SER A HB3  6  
ATOM 4831  H HG   . SER A 1 25 ? -11.794 -1.326  8.287   1.00 0.00 ? 25 SER A HG   6  
ATOM 4832  N N    . TYR A 1 26 ? -7.271  -1.830  5.724   1.00 0.00 ? 26 TYR A N    6  
ATOM 4833  C CA   . TYR A 1 26 ? -5.949  -2.354  6.038   1.00 0.00 ? 26 TYR A CA   6  
ATOM 4834  C C    . TYR A 1 26 ? -5.101  -1.218  6.624   1.00 0.00 ? 26 TYR A C    6  
ATOM 4835  O O    . TYR A 1 26 ? -5.018  -0.130  6.068   1.00 0.00 ? 26 TYR A O    6  
ATOM 4836  C CB   . TYR A 1 26 ? -5.286  -2.881  4.753   1.00 0.00 ? 26 TYR A CB   6  
ATOM 4837  C CG   . TYR A 1 26 ? -6.035  -3.997  4.066   1.00 0.00 ? 26 TYR A CG   6  
ATOM 4838  C CD1  . TYR A 1 26 ? -6.820  -4.908  4.770   1.00 0.00 ? 26 TYR A CD1  6  
ATOM 4839  C CD2  . TYR A 1 26 ? -5.932  -4.153  2.688   1.00 0.00 ? 26 TYR A CD2  6  
ATOM 4840  C CE1  . TYR A 1 26 ? -7.451  -5.951  4.115   1.00 0.00 ? 26 TYR A CE1  6  
ATOM 4841  C CE2  . TYR A 1 26 ? -6.564  -5.210  2.049   1.00 0.00 ? 26 TYR A CE2  6  
ATOM 4842  C CZ   . TYR A 1 26 ? -7.312  -6.114  2.761   1.00 0.00 ? 26 TYR A CZ   6  
ATOM 4843  O OH   . TYR A 1 26 ? -7.901  -7.188  2.138   1.00 0.00 ? 26 TYR A OH   6  
ATOM 4844  H H    . TYR A 1 26 ? -7.299  -1.085  5.055   1.00 0.00 ? 26 TYR A H    6  
ATOM 4845  H HA   . TYR A 1 26 ? -6.039  -3.140  6.789   1.00 0.00 ? 26 TYR A HA   6  
ATOM 4846  H HB2  . TYR A 1 26 ? -5.185  -2.053  4.041   1.00 0.00 ? 26 TYR A HB2  6  
ATOM 4847  H HB3  . TYR A 1 26 ? -4.285  -3.257  4.990   1.00 0.00 ? 26 TYR A HB3  6  
ATOM 4848  H HD1  . TYR A 1 26 ? -6.962  -4.827  5.830   1.00 0.00 ? 26 TYR A HD1  6  
ATOM 4849  H HD2  . TYR A 1 26 ? -5.368  -3.455  2.091   1.00 0.00 ? 26 TYR A HD2  6  
ATOM 4850  H HE1  . TYR A 1 26 ? -8.062  -6.660  4.619   1.00 0.00 ? 26 TYR A HE1  6  
ATOM 4851  H HE2  . TYR A 1 26 ? -6.492  -5.350  0.992   1.00 0.00 ? 26 TYR A HE2  6  
ATOM 4852  H HH   . TYR A 1 26 ? -7.225  -7.874  2.073   1.00 0.00 ? 26 TYR A HH   6  
ATOM 4853  N N    . ASP A 1 27 ? -4.478  -1.543  7.773   1.00 0.00 ? 27 ASP A N    6  
ATOM 4854  C CA   . ASP A 1 27 ? -3.633  -0.584  8.484   1.00 0.00 ? 27 ASP A CA   6  
ATOM 4855  C C    . ASP A 1 27 ? -2.200  -1.134  8.597   1.00 0.00 ? 27 ASP A C    6  
ATOM 4856  O O    . ASP A 1 27 ? -1.463  -0.864  9.534   1.00 0.00 ? 27 ASP A O    6  
ATOM 4857  C CB   . ASP A 1 27 ? -4.286  -0.287  9.848   1.00 0.00 ? 27 ASP A CB   6  
ATOM 4858  C CG   . ASP A 1 27 ? -3.936  1.122   10.353  1.00 0.00 ? 27 ASP A CG   6  
ATOM 4859  O OD1  . ASP A 1 27 ? -4.218  2.084   9.638   1.00 0.00 ? 27 ASP A OD1  6  
ATOM 4860  O OD2  . ASP A 1 27 ? -3.403  1.247   11.452  1.00 0.00 ? 27 ASP A OD2  6  
ATOM 4861  H H    . ASP A 1 27 ? -4.616  -2.450  8.167   1.00 0.00 ? 27 ASP A H    6  
ATOM 4862  H HA   . ASP A 1 27 ? -3.564  0.330   7.896   1.00 0.00 ? 27 ASP A HA   6  
ATOM 4863  H HB2  . ASP A 1 27 ? -5.372  -0.322  9.757   1.00 0.00 ? 27 ASP A HB2  6  
ATOM 4864  H HB3  . ASP A 1 27 ? -4.011  -1.033  10.595  1.00 0.00 ? 27 ASP A HB3  6  
ATOM 4865  N N    . SER A 1 28 ? -1.845  -1.946  7.580   1.00 0.00 ? 28 SER A N    6  
ATOM 4866  C CA   . SER A 1 28 ? -0.513  -2.526  7.553   1.00 0.00 ? 28 SER A CA   6  
ATOM 4867  C C    . SER A 1 28 ? -0.297  -3.096  6.147   1.00 0.00 ? 28 SER A C    6  
ATOM 4868  O O    . SER A 1 28 ? -1.239  -3.281  5.385   1.00 0.00 ? 28 SER A O    6  
ATOM 4869  C CB   . SER A 1 28 ? -0.393  -3.616  8.647   1.00 0.00 ? 28 SER A CB   6  
ATOM 4870  O OG   . SER A 1 28 ? -1.420  -4.582  8.511   1.00 0.00 ? 28 SER A OG   6  
ATOM 4871  H H    . SER A 1 28 ? -2.431  -2.179  6.802   1.00 0.00 ? 28 SER A H    6  
ATOM 4872  H HA   . SER A 1 28 ? 0.210   -1.714  7.683   1.00 0.00 ? 28 SER A HA   6  
ATOM 4873  H HB2  . SER A 1 28 ? 0.567   -4.153  8.529   1.00 0.00 ? 28 SER A HB2  6  
ATOM 4874  H HB3  . SER A 1 28 ? -0.478  -3.176  9.666   1.00 0.00 ? 28 SER A HB3  6  
ATOM 4875  H HG   . SER A 1 28 ? -2.267  -4.150  8.477   1.00 0.00 ? 28 SER A HG   6  
ATOM 4876  N N    . CYS A 1 29 ? 0.994   -3.339  5.868   1.00 0.00 ? 29 CYS A N    6  
ATOM 4877  C CA   . CYS A 1 29 ? 1.452   -3.876  4.590   1.00 0.00 ? 29 CYS A CA   6  
ATOM 4878  C C    . CYS A 1 29 ? 0.756   -5.215  4.245   1.00 0.00 ? 29 CYS A C    6  
ATOM 4879  O O    . CYS A 1 29 ? 0.725   -6.104  5.086   1.00 0.00 ? 29 CYS A O    6  
ATOM 4880  C CB   . CYS A 1 29 ? 2.947   -4.141  4.790   1.00 0.00 ? 29 CYS A CB   6  
ATOM 4881  S SG   . CYS A 1 29 ? 3.777   -2.731  5.547   1.00 0.00 ? 29 CYS A SG   6  
ATOM 4882  H H    . CYS A 1 29 ? 1.688   -3.115  6.555   1.00 0.00 ? 29 CYS A H    6  
ATOM 4883  H HA   . CYS A 1 29 ? 1.287   -3.096  3.845   1.00 0.00 ? 29 CYS A HA   6  
ATOM 4884  H HB2  . CYS A 1 29 ? 3.096   -5.006  5.447   1.00 0.00 ? 29 CYS A HB2  6  
ATOM 4885  H HB3  . CYS A 1 29 ? 3.421   -4.343  3.832   1.00 0.00 ? 29 CYS A HB3  6  
ATOM 4886  N N    . THR A 1 30 ? 0.223   -5.338  3.005   1.00 0.00 ? 30 THR A N    6  
ATOM 4887  C CA   . THR A 1 30 ? -0.425  -6.595  2.607   1.00 0.00 ? 30 THR A CA   6  
ATOM 4888  C C    . THR A 1 30 ? 0.270   -7.154  1.359   1.00 0.00 ? 30 THR A C    6  
ATOM 4889  O O    . THR A 1 30 ? 0.854   -6.420  0.576   1.00 0.00 ? 30 THR A O    6  
ATOM 4890  C CB   . THR A 1 30 ? -1.934  -6.391  2.348   1.00 0.00 ? 30 THR A CB   6  
ATOM 4891  O OG1  . THR A 1 30 ? -2.477  -7.672  2.064   1.00 0.00 ? 30 THR A OG1  6  
ATOM 4892  C CG2  . THR A 1 30 ? -2.227  -5.448  1.160   1.00 0.00 ? 30 THR A CG2  6  
ATOM 4893  H H    . THR A 1 30 ? 0.270   -4.607  2.314   1.00 0.00 ? 30 THR A H    6  
ATOM 4894  H HA   . THR A 1 30 ? -0.303  -7.330  3.405   1.00 0.00 ? 30 THR A HA   6  
ATOM 4895  H HB   . THR A 1 30 ? -2.378  -6.000  3.279   1.00 0.00 ? 30 THR A HB   6  
ATOM 4896  H HG1  . THR A 1 30 ? -3.441  -7.644  2.079   1.00 0.00 ? 30 THR A HG1  6  
ATOM 4897  H HG21 . THR A 1 30 ? -1.692  -4.501  1.241   1.00 0.00 ? 30 THR A HG21 6  
ATOM 4898  H HG22 . THR A 1 30 ? -3.290  -5.217  1.071   1.00 0.00 ? 30 THR A HG22 6  
ATOM 4899  H HG23 . THR A 1 30 ? -1.922  -5.901  0.215   1.00 0.00 ? 30 THR A HG23 6  
ATOM 4900  N N    . THR A 1 31 ? 0.150   -8.483  1.205   1.00 0.00 ? 31 THR A N    6  
ATOM 4901  C CA   . THR A 1 31 ? 0.665   -9.179  0.033   1.00 0.00 ? 31 THR A CA   6  
ATOM 4902  C C    . THR A 1 31 ? -0.501  -9.551  -0.899  1.00 0.00 ? 31 THR A C    6  
ATOM 4903  O O    . THR A 1 31 ? -0.302  -10.176 -1.931  1.00 0.00 ? 31 THR A O    6  
ATOM 4904  C CB   . THR A 1 31 ? 1.408   -10.441 0.493   1.00 0.00 ? 31 THR A CB   6  
ATOM 4905  O OG1  . THR A 1 31 ? 0.680   -10.963 1.596   1.00 0.00 ? 31 THR A OG1  6  
ATOM 4906  C CG2  . THR A 1 31 ? 2.852   -10.115 0.900   1.00 0.00 ? 31 THR A CG2  6  
ATOM 4907  H H    . THR A 1 31 ? -0.326  -9.049  1.881   1.00 0.00 ? 31 THR A H    6  
ATOM 4908  H HA   . THR A 1 31 ? 1.331   -8.521  -0.528  1.00 0.00 ? 31 THR A HA   6  
ATOM 4909  H HB   . THR A 1 31 ? 1.433   -11.167 -0.332  1.00 0.00 ? 31 THR A HB   6  
ATOM 4910  H HG1  . THR A 1 31 ? 1.085   -11.766 1.911   1.00 0.00 ? 31 THR A HG1  6  
ATOM 4911  H HG21 . THR A 1 31 ? 3.415   -11.006 1.182   1.00 0.00 ? 31 THR A HG21 6  
ATOM 4912  H HG22 . THR A 1 31 ? 2.860   -9.427  1.741   1.00 0.00 ? 31 THR A HG22 6  
ATOM 4913  H HG23 . THR A 1 31 ? 3.394   -9.644  0.078   1.00 0.00 ? 31 THR A HG23 6  
ATOM 4914  N N    . GLU A 1 32 ? -1.730  -9.147  -0.516  1.00 0.00 ? 32 GLU A N    6  
ATOM 4915  C CA   . GLU A 1 32 ? -2.868  -9.473  -1.373  1.00 0.00 ? 32 GLU A CA   6  
ATOM 4916  C C    . GLU A 1 32 ? -2.700  -8.812  -2.757  1.00 0.00 ? 32 GLU A C    6  
ATOM 4917  O O    . GLU A 1 32 ? -2.776  -7.598  -2.897  1.00 0.00 ? 32 GLU A O    6  
ATOM 4918  C CB   . GLU A 1 32 ? -4.156  -9.007  -0.689  1.00 0.00 ? 32 GLU A CB   6  
ATOM 4919  C CG   . GLU A 1 32 ? -4.463  -9.844  0.565   1.00 0.00 ? 32 GLU A CG   6  
ATOM 4920  C CD   . GLU A 1 32 ? -5.503  -9.143  1.439   1.00 0.00 ? 32 GLU A CD   6  
ATOM 4921  O OE1  . GLU A 1 32 ? -5.216  -8.061  1.941   1.00 0.00 ? 32 GLU A OE1  6  
ATOM 4922  O OE2  . GLU A 1 32 ? -6.602  -9.660  1.611   1.00 0.00 ? 32 GLU A OE2  6  
ATOM 4923  H H    . GLU A 1 32 ? -1.884  -8.638  0.336   1.00 0.00 ? 32 GLU A H    6  
ATOM 4924  H HA   . GLU A 1 32 ? -2.884  -10.559 -1.484  1.00 0.00 ? 32 GLU A HA   6  
ATOM 4925  H HB2  . GLU A 1 32 ? -4.061  -7.947  -0.444  1.00 0.00 ? 32 GLU A HB2  6  
ATOM 4926  H HB3  . GLU A 1 32 ? -5.004  -9.081  -1.373  1.00 0.00 ? 32 GLU A HB3  6  
ATOM 4927  H HG2  . GLU A 1 32 ? -4.830  -10.830 0.279   1.00 0.00 ? 32 GLU A HG2  6  
ATOM 4928  H HG3  . GLU A 1 32 ? -3.571  -10.014 1.168   1.00 0.00 ? 32 GLU A HG3  6  
ATOM 4929  N N    . GLY A 1 33 ? -2.456  -9.688  -3.753  1.00 0.00 ? 33 GLY A N    6  
ATOM 4930  C CA   . GLY A 1 33 ? -2.268  -9.254  -5.135  1.00 0.00 ? 33 GLY A CA   6  
ATOM 4931  C C    . GLY A 1 33 ? -0.823  -9.445  -5.623  1.00 0.00 ? 33 GLY A C    6  
ATOM 4932  O O    . GLY A 1 33 ? -0.568  -9.461  -6.819  1.00 0.00 ? 33 GLY A O    6  
ATOM 4933  H H    . GLY A 1 33 ? -2.388  -10.658 -3.521  1.00 0.00 ? 33 GLY A H    6  
ATOM 4934  H HA2  . GLY A 1 33 ? -2.933  -9.868  -5.747  1.00 0.00 ? 33 GLY A HA2  6  
ATOM 4935  H HA3  . GLY A 1 33 ? -2.549  -8.201  -5.238  1.00 0.00 ? 33 GLY A HA3  6  
ATOM 4936  N N    . ARG A 1 34 ? 0.103   -9.584  -4.654  1.00 0.00 ? 34 ARG A N    6  
ATOM 4937  C CA   . ARG A 1 34 ? 1.521   -9.761  -5.018  1.00 0.00 ? 34 ARG A CA   6  
ATOM 4938  C C    . ARG A 1 34 ? 2.071   -11.050 -4.395  1.00 0.00 ? 34 ARG A C    6  
ATOM 4939  O O    . ARG A 1 34 ? 2.152   -11.205 -3.183  1.00 0.00 ? 34 ARG A O    6  
ATOM 4940  C CB   . ARG A 1 34 ? 2.331   -8.582  -4.475  1.00 0.00 ? 34 ARG A CB   6  
ATOM 4941  C CG   . ARG A 1 34 ? 1.934   -7.260  -5.154  1.00 0.00 ? 34 ARG A CG   6  
ATOM 4942  C CD   . ARG A 1 34 ? 3.064   -6.207  -5.111  1.00 0.00 ? 34 ARG A CD   6  
ATOM 4943  N NE   . ARG A 1 34 ? 4.067   -6.509  -6.148  1.00 0.00 ? 34 ARG A NE   6  
ATOM 4944  C CZ   . ARG A 1 34 ? 4.273   -5.749  -7.248  1.00 0.00 ? 34 ARG A CZ   6  
ATOM 4945  N NH1  . ARG A 1 34 ? 3.585   -4.627  -7.426  1.00 0.00 ? 34 ARG A NH1  6  
ATOM 4946  N NH2  . ARG A 1 34 ? 5.171   -6.140  -8.141  1.00 0.00 ? 34 ARG A NH2  6  
ATOM 4947  H H    . ARG A 1 34 ? -0.197  -9.569  -3.685  1.00 0.00 ? 34 ARG A H    6  
ATOM 4948  H HA   . ARG A 1 34 ? 1.679   -9.814  -6.118  1.00 0.00 ? 34 ARG A HA   6  
ATOM 4949  H HB2  . ARG A 1 34 ? 2.164   -8.496  -3.372  1.00 0.00 ? 34 ARG A HB2  6  
ATOM 4950  H HB3  . ARG A 1 34 ? 3.381   -8.813  -4.743  1.00 0.00 ? 34 ARG A HB3  6  
ATOM 4951  H HG2  . ARG A 1 34 ? 1.670   -7.440  -6.197  1.00 0.00 ? 34 ARG A HG2  6  
ATOM 4952  H HG3  . ARG A 1 34 ? 1.006   -6.901  -4.697  1.00 0.00 ? 34 ARG A HG3  6  
ATOM 4953  H HD2  . ARG A 1 34 ? 2.661   -5.198  -5.260  1.00 0.00 ? 34 ARG A HD2  6  
ATOM 4954  H HD3  . ARG A 1 34 ? 3.601   -6.207  -4.156  1.00 0.00 ? 34 ARG A HD3  6  
ATOM 4955  H HE   . ARG A 1 34 ? 4.652   -7.335  -6.078  1.00 0.00 ? 34 ARG A HE   6  
ATOM 4956  H HH11 . ARG A 1 34 ? 2.866   -4.401  -6.774  1.00 0.00 ? 34 ARG A HH11 6  
ATOM 4957  H HH12 . ARG A 1 34 ? 3.739   -3.960  -8.172  1.00 0.00 ? 34 ARG A HH12 6  
ATOM 4958  H HH21 . ARG A 1 34 ? 5.633   -7.027  -7.983  1.00 0.00 ? 34 ARG A HH21 6  
ATOM 4959  H HH22 . ARG A 1 34 ? 5.394   -5.608  -8.956  1.00 0.00 ? 34 ARG A HH22 6  
ATOM 4960  N N    . THR A 1 35 ? 2.496   -11.941 -5.306  1.00 0.00 ? 35 THR A N    6  
ATOM 4961  C CA   . THR A 1 35 ? 3.079   -13.215 -4.914  1.00 0.00 ? 35 THR A CA   6  
ATOM 4962  C C    . THR A 1 35 ? 4.581   -13.217 -5.245  1.00 0.00 ? 35 THR A C    6  
ATOM 4963  O O    . THR A 1 35 ? 5.161   -14.253 -5.538  1.00 0.00 ? 35 THR A O    6  
ATOM 4964  C CB   . THR A 1 35 ? 2.345   -14.301 -5.717  1.00 0.00 ? 35 THR A CB   6  
ATOM 4965  O OG1  . THR A 1 35 ? 2.343   -13.953 -7.093  1.00 0.00 ? 35 THR A OG1  6  
ATOM 4966  C CG2  . THR A 1 35 ? 0.878   -14.424 -5.289  1.00 0.00 ? 35 THR A CG2  6  
ATOM 4967  H H    . THR A 1 35 ? 2.385   -11.780 -6.287  1.00 0.00 ? 35 THR A H    6  
ATOM 4968  H HA   . THR A 1 35 ? 2.955   -13.375 -3.841  1.00 0.00 ? 35 THR A HA   6  
ATOM 4969  H HB   . THR A 1 35 ? 2.818   -15.280 -5.563  1.00 0.00 ? 35 THR A HB   6  
ATOM 4970  H HG1  . THR A 1 35 ? 3.231   -13.999 -7.442  1.00 0.00 ? 35 THR A HG1  6  
ATOM 4971  H HG21 . THR A 1 35 ? 0.328   -13.500 -5.468  1.00 0.00 ? 35 THR A HG21 6  
ATOM 4972  H HG22 . THR A 1 35 ? 0.796   -14.663 -4.228  1.00 0.00 ? 35 THR A HG22 6  
ATOM 4973  H HG23 . THR A 1 35 ? 0.378   -15.215 -5.848  1.00 0.00 ? 35 THR A HG23 6  
ATOM 4974  N N    . ASP A 1 36 ? 5.161   -12.000 -5.192  1.00 0.00 ? 36 ASP A N    6  
ATOM 4975  C CA   . ASP A 1 36 ? 6.569   -11.788 -5.523  1.00 0.00 ? 36 ASP A CA   6  
ATOM 4976  C C    . ASP A 1 36 ? 7.414   -11.389 -4.290  1.00 0.00 ? 36 ASP A C    6  
ATOM 4977  O O    . ASP A 1 36 ? 8.605   -11.127 -4.408  1.00 0.00 ? 36 ASP A O    6  
ATOM 4978  C CB   . ASP A 1 36 ? 6.662   -10.729 -6.641  1.00 0.00 ? 36 ASP A CB   6  
ATOM 4979  C CG   . ASP A 1 36 ? 6.013   -9.376  -6.294  1.00 0.00 ? 36 ASP A CG   6  
ATOM 4980  O OD1  . ASP A 1 36 ? 5.670   -9.138  -5.139  1.00 0.00 ? 36 ASP A OD1  6  
ATOM 4981  O OD2  . ASP A 1 36 ? 5.847   -8.555  -7.195  1.00 0.00 ? 36 ASP A OD2  6  
ATOM 4982  H H    . ASP A 1 36 ? 4.636   -11.171 -4.982  1.00 0.00 ? 36 ASP A H    6  
ATOM 4983  H HA   . ASP A 1 36 ? 6.992   -12.724 -5.893  1.00 0.00 ? 36 ASP A HA   6  
ATOM 4984  H HB2  . ASP A 1 36 ? 7.703   -10.551 -6.912  1.00 0.00 ? 36 ASP A HB2  6  
ATOM 4985  H HB3  . ASP A 1 36 ? 6.162   -11.107 -7.532  1.00 0.00 ? 36 ASP A HB3  6  
ATOM 4986  N N    . GLY A 1 37 ? 6.759   -11.383 -3.105  1.00 0.00 ? 37 GLY A N    6  
ATOM 4987  C CA   . GLY A 1 37 ? 7.468   -11.068 -1.862  1.00 0.00 ? 37 GLY A CA   6  
ATOM 4988  C C    . GLY A 1 37 ? 7.318   -9.608  -1.424  1.00 0.00 ? 37 GLY A C    6  
ATOM 4989  O O    . GLY A 1 37 ? 7.693   -9.224  -0.319  1.00 0.00 ? 37 GLY A O    6  
ATOM 4990  H H    . GLY A 1 37 ? 5.788   -11.605 -3.067  1.00 0.00 ? 37 GLY A H    6  
ATOM 4991  H HA2  . GLY A 1 37 ? 7.079   -11.730 -1.087  1.00 0.00 ? 37 GLY A HA2  6  
ATOM 4992  H HA3  . GLY A 1 37 ? 8.537   -11.252 -2.009  1.00 0.00 ? 37 GLY A HA3  6  
ATOM 4993  N N    . TYR A 1 38 ? 6.787   -8.800  -2.356  1.00 0.00 ? 38 TYR A N    6  
ATOM 4994  C CA   . TYR A 1 38 ? 6.712   -7.372  -2.088  1.00 0.00 ? 38 TYR A CA   6  
ATOM 4995  C C    . TYR A 1 38 ? 5.355   -7.044  -1.457  1.00 0.00 ? 38 TYR A C    6  
ATOM 4996  O O    . TYR A 1 38 ? 4.321   -7.004  -2.109  1.00 0.00 ? 38 TYR A O    6  
ATOM 4997  C CB   . TYR A 1 38 ? 7.052   -6.598  -3.376  1.00 0.00 ? 38 TYR A CB   6  
ATOM 4998  C CG   . TYR A 1 38 ? 8.244   -7.198  -4.094  1.00 0.00 ? 38 TYR A CG   6  
ATOM 4999  C CD1  . TYR A 1 38 ? 9.315   -7.764  -3.413  1.00 0.00 ? 38 TYR A CD1  6  
ATOM 5000  C CD2  . TYR A 1 38 ? 8.280   -7.262  -5.476  1.00 0.00 ? 38 TYR A CD2  6  
ATOM 5001  C CE1  . TYR A 1 38 ? 10.331  -8.418  -4.068  1.00 0.00 ? 38 TYR A CE1  6  
ATOM 5002  C CE2  . TYR A 1 38 ? 9.298   -7.912  -6.138  1.00 0.00 ? 38 TYR A CE2  6  
ATOM 5003  C CZ   . TYR A 1 38 ? 10.327  -8.511  -5.443  1.00 0.00 ? 38 TYR A CZ   6  
ATOM 5004  O OH   . TYR A 1 38 ? 11.315  -9.203  -6.109  1.00 0.00 ? 38 TYR A OH   6  
ATOM 5005  H H    . TYR A 1 38 ? 6.484   -9.131  -3.255  1.00 0.00 ? 38 TYR A H    6  
ATOM 5006  H HA   . TYR A 1 38 ? 7.485   -7.113  -1.369  1.00 0.00 ? 38 TYR A HA   6  
ATOM 5007  H HB2  . TYR A 1 38 ? 6.193   -6.614  -4.049  1.00 0.00 ? 38 TYR A HB2  6  
ATOM 5008  H HB3  . TYR A 1 38 ? 7.261   -5.555  -3.146  1.00 0.00 ? 38 TYR A HB3  6  
ATOM 5009  H HD1  . TYR A 1 38 ? 9.400   -7.764  -2.353  1.00 0.00 ? 38 TYR A HD1  6  
ATOM 5010  H HD2  . TYR A 1 38 ? 7.512   -6.849  -6.088  1.00 0.00 ? 38 TYR A HD2  6  
ATOM 5011  H HE1  . TYR A 1 38 ? 11.078  -8.860  -3.448  1.00 0.00 ? 38 TYR A HE1  6  
ATOM 5012  H HE2  . TYR A 1 38 ? 9.229   -7.956  -7.197  1.00 0.00 ? 38 TYR A HE2  6  
ATOM 5013  H HH   . TYR A 1 38 ? 11.215  -10.124 -5.901  1.00 0.00 ? 38 TYR A HH   6  
ATOM 5014  N N    . ARG A 1 39 ? 5.429   -6.820  -0.132  1.00 0.00 ? 39 ARG A N    6  
ATOM 5015  C CA   . ARG A 1 39 ? 4.188   -6.432  0.577   1.00 0.00 ? 39 ARG A CA   6  
ATOM 5016  C C    . ARG A 1 39 ? 3.989   -4.950  0.212   1.00 0.00 ? 39 ARG A C    6  
ATOM 5017  O O    . ARG A 1 39 ? 4.944   -4.184  0.258   1.00 0.00 ? 39 ARG A O    6  
ATOM 5018  C CB   . ARG A 1 39 ? 4.421   -6.547  2.095   1.00 0.00 ? 39 ARG A CB   6  
ATOM 5019  C CG   . ARG A 1 39 ? 4.986   -7.880  2.626   1.00 0.00 ? 39 ARG A CG   6  
ATOM 5020  C CD   . ARG A 1 39 ? 6.137   -7.749  3.664   1.00 0.00 ? 39 ARG A CD   6  
ATOM 5021  N NE   . ARG A 1 39 ? 6.027   -6.596  4.572   1.00 0.00 ? 39 ARG A NE   6  
ATOM 5022  C CZ   . ARG A 1 39 ? 6.676   -5.422  4.355   1.00 0.00 ? 39 ARG A CZ   6  
ATOM 5023  N NH1  . ARG A 1 39 ? 7.331   -5.190  3.227   1.00 0.00 ? 39 ARG A NH1  6  
ATOM 5024  N NH2  . ARG A 1 39 ? 6.672   -4.460  5.267   1.00 0.00 ? 39 ARG A NH2  6  
ATOM 5025  H H    . ARG A 1 39 ? 6.376   -6.846  0.251   1.00 0.00 ? 39 ARG A H    6  
ATOM 5026  H HA   . ARG A 1 39 ? 3.300   -7.024  0.254   1.00 0.00 ? 39 ARG A HA   6  
ATOM 5027  H HB2  . ARG A 1 39 ? 5.074   -5.727  2.368   1.00 0.00 ? 39 ARG A HB2  6  
ATOM 5028  H HB3  . ARG A 1 39 ? 3.488   -6.344  2.612   1.00 0.00 ? 39 ARG A HB3  6  
ATOM 5029  H HG2  . ARG A 1 39 ? 4.160   -8.408  3.119   1.00 0.00 ? 39 ARG A HG2  6  
ATOM 5030  H HG3  . ARG A 1 39 ? 5.311   -8.510  1.782   1.00 0.00 ? 39 ARG A HG3  6  
ATOM 5031  H HD2  . ARG A 1 39 ? 6.156   -8.624  4.318   1.00 0.00 ? 39 ARG A HD2  6  
ATOM 5032  H HD3  . ARG A 1 39 ? 7.123   -7.722  3.201   1.00 0.00 ? 39 ARG A HD3  6  
ATOM 5033  H HE   . ARG A 1 39 ? 5.536   -6.730  5.435   1.00 0.00 ? 39 ARG A HE   6  
ATOM 5034  H HH11 . ARG A 1 39 ? 7.375   -5.874  2.483   1.00 0.00 ? 39 ARG A HH11 6  
ATOM 5035  H HH12 . ARG A 1 39 ? 7.803   -4.302  3.128   1.00 0.00 ? 39 ARG A HH12 6  
ATOM 5036  H HH21 . ARG A 1 39 ? 6.159   -4.520  6.122   1.00 0.00 ? 39 ARG A HH21 6  
ATOM 5037  H HH22 . ARG A 1 39 ? 7.227   -3.640  5.069   1.00 0.00 ? 39 ARG A HH22 6  
ATOM 5038  N N    . TRP A 1 40 ? 2.756   -4.587  -0.180  1.00 0.00 ? 40 TRP A N    6  
ATOM 5039  C CA   . TRP A 1 40 ? 2.489   -3.229  -0.626  1.00 0.00 ? 40 TRP A CA   6  
ATOM 5040  C C    . TRP A 1 40 ? 1.487   -2.533  0.319   1.00 0.00 ? 40 TRP A C    6  
ATOM 5041  O O    . TRP A 1 40 ? 0.794   -3.163  1.113   1.00 0.00 ? 40 TRP A O    6  
ATOM 5042  C CB   . TRP A 1 40 ? 2.002   -3.276  -2.090  1.00 0.00 ? 40 TRP A CB   6  
ATOM 5043  C CG   . TRP A 1 40 ? 0.668   -3.994  -2.198  1.00 0.00 ? 40 TRP A CG   6  
ATOM 5044  C CD1  . TRP A 1 40 ? 0.472   -5.373  -2.345  1.00 0.00 ? 40 TRP A CD1  6  
ATOM 5045  C CD2  . TRP A 1 40 ? -0.649  -3.402  -2.154  1.00 0.00 ? 40 TRP A CD2  6  
ATOM 5046  N NE1  . TRP A 1 40 ? -0.855  -5.633  -2.394  1.00 0.00 ? 40 TRP A NE1  6  
ATOM 5047  C CE2  . TRP A 1 40 ? -1.573  -4.459  -2.278  1.00 0.00 ? 40 TRP A CE2  6  
ATOM 5048  C CE3  . TRP A 1 40 ? -1.106  -2.119  -2.014  1.00 0.00 ? 40 TRP A CE3  6  
ATOM 5049  C CZ2  . TRP A 1 40 ? -2.909  -4.210  -2.259  1.00 0.00 ? 40 TRP A CZ2  6  
ATOM 5050  C CZ3  . TRP A 1 40 ? -2.481  -1.854  -1.988  1.00 0.00 ? 40 TRP A CZ3  6  
ATOM 5051  C CH2  . TRP A 1 40 ? -3.385  -2.910  -2.111  1.00 0.00 ? 40 TRP A CH2  6  
ATOM 5052  H H    . TRP A 1 40 ? 1.998   -5.239  -0.189  1.00 0.00 ? 40 TRP A H    6  
ATOM 5053  H HA   . TRP A 1 40 ? 3.433   -2.696  -0.584  1.00 0.00 ? 40 TRP A HA   6  
ATOM 5054  H HB2  . TRP A 1 40 ? 1.922   -2.285  -2.529  1.00 0.00 ? 40 TRP A HB2  6  
ATOM 5055  H HB3  . TRP A 1 40 ? 2.748   -3.773  -2.708  1.00 0.00 ? 40 TRP A HB3  6  
ATOM 5056  H HD1  . TRP A 1 40 ? 1.240   -6.129  -2.388  1.00 0.00 ? 40 TRP A HD1  6  
ATOM 5057  H HE1  . TRP A 1 40 ? -1.288  -6.510  -2.492  1.00 0.00 ? 40 TRP A HE1  6  
ATOM 5058  H HE3  . TRP A 1 40 ? -0.379  -1.329  -1.935  1.00 0.00 ? 40 TRP A HE3  6  
ATOM 5059  H HZ2  . TRP A 1 40 ? -3.579  -5.045  -2.363  1.00 0.00 ? 40 TRP A HZ2  6  
ATOM 5060  H HZ3  . TRP A 1 40 ? -2.864  -0.846  -1.868  1.00 0.00 ? 40 TRP A HZ3  6  
ATOM 5061  H HH2  . TRP A 1 40 ? -4.451  -2.736  -2.097  1.00 0.00 ? 40 TRP A HH2  6  
ATOM 5062  N N    . CYS A 1 41 ? 1.469   -1.193  0.166   1.00 0.00 ? 41 CYS A N    6  
ATOM 5063  C CA   . CYS A 1 41 ? 0.594   -0.288  0.885   1.00 0.00 ? 41 CYS A CA   6  
ATOM 5064  C C    . CYS A 1 41 ? -0.155  0.560   -0.158  1.00 0.00 ? 41 CYS A C    6  
ATOM 5065  O O    . CYS A 1 41 ? 0.380   0.866   -1.221  1.00 0.00 ? 41 CYS A O    6  
ATOM 5066  C CB   . CYS A 1 41 ? 1.456   0.644   1.742   1.00 0.00 ? 41 CYS A CB   6  
ATOM 5067  S SG   . CYS A 1 41 ? 2.525   1.691   0.695   1.00 0.00 ? 41 CYS A SG   6  
ATOM 5068  H H    . CYS A 1 41 ? 2.056   -0.718  -0.487  1.00 0.00 ? 41 CYS A H    6  
ATOM 5069  H HA   . CYS A 1 41 ? -0.099  -0.875  1.489   1.00 0.00 ? 41 CYS A HA   6  
ATOM 5070  H HB2  . CYS A 1 41 ? 0.718   1.311   2.259   1.00 0.00 ? 41 CYS A HB2  6  
ATOM 5071  H HB3  . CYS A 1 41 ? 2.115   0.019   2.401   1.00 0.00 ? 41 CYS A HB3  6  
ATOM 5072  N N    . GLY A 1 42 ? -1.398  0.932   0.192   1.00 0.00 ? 42 GLY A N    6  
ATOM 5073  C CA   . GLY A 1 42 ? -2.153  1.827   -0.675  1.00 0.00 ? 42 GLY A CA   6  
ATOM 5074  C C    . GLY A 1 42 ? -1.792  3.262   -0.285  1.00 0.00 ? 42 GLY A C    6  
ATOM 5075  O O    . GLY A 1 42 ? -1.145  3.486   0.731   1.00 0.00 ? 42 GLY A O    6  
ATOM 5076  H H    . GLY A 1 42 ? -1.799  0.656   1.066   1.00 0.00 ? 42 GLY A H    6  
ATOM 5077  H HA2  . GLY A 1 42 ? -1.925  1.621   -1.724  1.00 0.00 ? 42 GLY A HA2  6  
ATOM 5078  H HA3  . GLY A 1 42 ? -3.213  1.653   -0.484  1.00 0.00 ? 42 GLY A HA3  6  
ATOM 5079  N N    . THR A 1 43 ? -2.259  4.206   -1.117  1.00 0.00 ? 43 THR A N    6  
ATOM 5080  C CA   . THR A 1 43 ? -2.049  5.628   -0.864  1.00 0.00 ? 43 THR A CA   6  
ATOM 5081  C C    . THR A 1 43 ? -3.417  6.281   -0.645  1.00 0.00 ? 43 THR A C    6  
ATOM 5082  O O    . THR A 1 43 ? -3.716  6.785   0.426   1.00 0.00 ? 43 THR A O    6  
ATOM 5083  C CB   . THR A 1 43 ? -1.309  6.235   -2.054  1.00 0.00 ? 43 THR A CB   6  
ATOM 5084  O OG1  . THR A 1 43 ? -1.850  5.588   -3.197  1.00 0.00 ? 43 THR A OG1  6  
ATOM 5085  C CG2  . THR A 1 43 ? 0.207   6.026   -1.891  1.00 0.00 ? 43 THR A CG2  6  
ATOM 5086  H H    . THR A 1 43 ? -2.746  3.984   -1.962  1.00 0.00 ? 43 THR A H    6  
ATOM 5087  H HA   . THR A 1 43 ? -1.465  5.757   0.046   1.00 0.00 ? 43 THR A HA   6  
ATOM 5088  H HB   . THR A 1 43 ? -1.509  7.314   -2.091  1.00 0.00 ? 43 THR A HB   6  
ATOM 5089  H HG1  . THR A 1 43 ? -1.499  5.962   -3.996  1.00 0.00 ? 43 THR A HG1  6  
ATOM 5090  H HG21 . THR A 1 43 ? 0.477   4.971   -1.874  1.00 0.00 ? 43 THR A HG21 6  
ATOM 5091  H HG22 . THR A 1 43 ? 0.546   6.450   -0.945  1.00 0.00 ? 43 THR A HG22 6  
ATOM 5092  H HG23 . THR A 1 43 ? 0.789   6.520   -2.664  1.00 0.00 ? 43 THR A HG23 6  
ATOM 5093  N N    . THR A 1 44 ? -4.245  6.223   -1.701  1.00 0.00 ? 44 THR A N    6  
ATOM 5094  C CA   . THR A 1 44 ? -5.594  6.755   -1.564  1.00 0.00 ? 44 THR A CA   6  
ATOM 5095  C C    . THR A 1 44 ? -6.377  5.867   -0.570  1.00 0.00 ? 44 THR A C    6  
ATOM 5096  O O    . THR A 1 44 ? -6.062  4.697   -0.376  1.00 0.00 ? 44 THR A O    6  
ATOM 5097  C CB   . THR A 1 44 ? -6.248  6.826   -2.955  1.00 0.00 ? 44 THR A CB   6  
ATOM 5098  O OG1  . THR A 1 44 ? -5.214  7.047   -3.905  1.00 0.00 ? 44 THR A OG1  6  
ATOM 5099  C CG2  . THR A 1 44 ? -7.279  7.968   -3.024  1.00 0.00 ? 44 THR A CG2  6  
ATOM 5100  H H    . THR A 1 44 ? -3.954  5.844   -2.583  1.00 0.00 ? 44 THR A H    6  
ATOM 5101  H HA   . THR A 1 44 ? -5.489  7.760   -1.147  1.00 0.00 ? 44 THR A HA   6  
ATOM 5102  H HB   . THR A 1 44 ? -6.732  5.866   -3.174  1.00 0.00 ? 44 THR A HB   6  
ATOM 5103  H HG1  . THR A 1 44 ? -5.604  7.140   -4.780  1.00 0.00 ? 44 THR A HG1  6  
ATOM 5104  H HG21 . THR A 1 44 ? -7.823  7.976   -3.967  1.00 0.00 ? 44 THR A HG21 6  
ATOM 5105  H HG22 . THR A 1 44 ? -6.788  8.936   -2.922  1.00 0.00 ? 44 THR A HG22 6  
ATOM 5106  H HG23 . THR A 1 44 ? -8.023  7.884   -2.235  1.00 0.00 ? 44 THR A HG23 6  
ATOM 5107  N N    . GLU A 1 45 ? -7.398  6.484   0.054   1.00 0.00 ? 45 GLU A N    6  
ATOM 5108  C CA   . GLU A 1 45 ? -8.190  5.809   1.080   1.00 0.00 ? 45 GLU A CA   6  
ATOM 5109  C C    . GLU A 1 45 ? -8.899  4.539   0.551   1.00 0.00 ? 45 GLU A C    6  
ATOM 5110  O O    . GLU A 1 45 ? -9.236  3.647   1.320   1.00 0.00 ? 45 GLU A O    6  
ATOM 5111  C CB   . GLU A 1 45 ? -9.178  6.788   1.760   1.00 0.00 ? 45 GLU A CB   6  
ATOM 5112  C CG   . GLU A 1 45 ? -8.491  8.018   2.398   1.00 0.00 ? 45 GLU A CG   6  
ATOM 5113  C CD   . GLU A 1 45 ? -7.981  9.077   1.398   1.00 0.00 ? 45 GLU A CD   6  
ATOM 5114  O OE1  . GLU A 1 45 ? -8.493  9.145   0.279   1.00 0.00 ? 45 GLU A OE1  6  
ATOM 5115  O OE2  . GLU A 1 45 ? -7.062  9.814   1.746   1.00 0.00 ? 45 GLU A OE2  6  
ATOM 5116  H H    . GLU A 1 45 ? -7.606  7.447   -0.133  1.00 0.00 ? 45 GLU A H    6  
ATOM 5117  H HA   . GLU A 1 45 ? -7.468  5.477   1.828   1.00 0.00 ? 45 GLU A HA   6  
ATOM 5118  H HB2  . GLU A 1 45 ? -9.925  7.182   1.017   1.00 0.00 ? 45 GLU A HB2  6  
ATOM 5119  H HB3  . GLU A 1 45 ? -9.608  6.211   2.623   1.00 0.00 ? 45 GLU A HB3  6  
ATOM 5120  H HG2  . GLU A 1 45 ? -9.197  8.521   3.058   1.00 0.00 ? 45 GLU A HG2  6  
ATOM 5121  H HG3  . GLU A 1 45 ? -7.659  7.695   3.025   1.00 0.00 ? 45 GLU A HG3  6  
ATOM 5122  N N    . ASP A 1 46 ? -9.089  4.503   -0.786  1.00 0.00 ? 46 ASP A N    6  
ATOM 5123  C CA   . ASP A 1 46 ? -9.660  3.351   -1.481  1.00 0.00 ? 46 ASP A CA   6  
ATOM 5124  C C    . ASP A 1 46 ? -8.596  2.960   -2.501  1.00 0.00 ? 46 ASP A C    6  
ATOM 5125  O O    . ASP A 1 46 ? -8.026  3.816   -3.164  1.00 0.00 ? 46 ASP A O    6  
ATOM 5126  C CB   . ASP A 1 46 ? -11.013 3.651   -2.172  1.00 0.00 ? 46 ASP A CB   6  
ATOM 5127  C CG   . ASP A 1 46 ? -11.582 2.361   -2.772  1.00 0.00 ? 46 ASP A CG   6  
ATOM 5128  O OD1  . ASP A 1 46 ? -11.220 2.028   -3.892  1.00 0.00 ? 46 ASP A OD1  6  
ATOM 5129  O OD2  . ASP A 1 46 ? -12.376 1.700   -2.111  1.00 0.00 ? 46 ASP A OD2  6  
ATOM 5130  H H    . ASP A 1 46 ? -8.706  5.233   -1.349  1.00 0.00 ? 46 ASP A H    6  
ATOM 5131  H HA   . ASP A 1 46 ? -9.783  2.549   -0.749  1.00 0.00 ? 46 ASP A HA   6  
ATOM 5132  H HB2  . ASP A 1 46 ? -11.722 4.050   -1.447  1.00 0.00 ? 46 ASP A HB2  6  
ATOM 5133  H HB3  . ASP A 1 46 ? -10.956 4.380   -2.987  1.00 0.00 ? 46 ASP A HB3  6  
ATOM 5134  N N    . TYR A 1 47 ? -8.334  1.649   -2.567  1.00 0.00 ? 47 TYR A N    6  
ATOM 5135  C CA   . TYR A 1 47 ? -7.311  1.180   -3.495  1.00 0.00 ? 47 TYR A CA   6  
ATOM 5136  C C    . TYR A 1 47 ? -7.924  0.672   -4.800  1.00 0.00 ? 47 TYR A C    6  
ATOM 5137  O O    . TYR A 1 47 ? -7.351  0.844   -5.868  1.00 0.00 ? 47 TYR A O    6  
ATOM 5138  C CB   . TYR A 1 47 ? -6.512  0.043   -2.851  1.00 0.00 ? 47 TYR A CB   6  
ATOM 5139  C CG   . TYR A 1 47 ? -5.459  -0.454  -3.801  1.00 0.00 ? 47 TYR A CG   6  
ATOM 5140  C CD1  . TYR A 1 47 ? -4.300  0.277   -3.992  1.00 0.00 ? 47 TYR A CD1  6  
ATOM 5141  C CD2  . TYR A 1 47 ? -5.629  -1.631  -4.519  1.00 0.00 ? 47 TYR A CD2  6  
ATOM 5142  C CE1  . TYR A 1 47 ? -3.321  -0.179  -4.851  1.00 0.00 ? 47 TYR A CE1  6  
ATOM 5143  C CE2  . TYR A 1 47 ? -4.636  -2.101  -5.363  1.00 0.00 ? 47 TYR A CE2  6  
ATOM 5144  C CZ   . TYR A 1 47 ? -3.470  -1.372  -5.532  1.00 0.00 ? 47 TYR A CZ   6  
ATOM 5145  O OH   . TYR A 1 47 ? -2.458  -1.802  -6.365  1.00 0.00 ? 47 TYR A OH   6  
ATOM 5146  H H    . TYR A 1 47 ? -8.865  1.050   -1.955  1.00 0.00 ? 47 TYR A H    6  
ATOM 5147  H HA   . TYR A 1 47 ? -6.627  1.999   -3.754  1.00 0.00 ? 47 TYR A HA   6  
ATOM 5148  H HB2  . TYR A 1 47 ? -6.034  0.393   -1.935  1.00 0.00 ? 47 TYR A HB2  6  
ATOM 5149  H HB3  . TYR A 1 47 ? -7.162  -0.782  -2.563  1.00 0.00 ? 47 TYR A HB3  6  
ATOM 5150  H HD1  . TYR A 1 47 ? -4.154  1.213   -3.483  1.00 0.00 ? 47 TYR A HD1  6  
ATOM 5151  H HD2  . TYR A 1 47 ? -6.550  -2.181  -4.455  1.00 0.00 ? 47 TYR A HD2  6  
ATOM 5152  H HE1  . TYR A 1 47 ? -2.440  0.410   -4.977  1.00 0.00 ? 47 TYR A HE1  6  
ATOM 5153  H HE2  . TYR A 1 47 ? -4.804  -3.034  -5.868  1.00 0.00 ? 47 TYR A HE2  6  
ATOM 5154  H HH   . TYR A 1 47 ? -2.317  -2.733  -6.246  1.00 0.00 ? 47 TYR A HH   6  
ATOM 5155  N N    . ASP A 1 48 ? -9.077  -0.005  -4.662  1.00 0.00 ? 48 ASP A N    6  
ATOM 5156  C CA   . ASP A 1 48 ? -9.687  -0.664  -5.806  1.00 0.00 ? 48 ASP A CA   6  
ATOM 5157  C C    . ASP A 1 48 ? -9.917  0.317   -6.976  1.00 0.00 ? 48 ASP A C    6  
ATOM 5158  O O    . ASP A 1 48 ? -9.722  -0.006  -8.141  1.00 0.00 ? 48 ASP A O    6  
ATOM 5159  C CB   . ASP A 1 48 ? -11.007 -1.344  -5.373  1.00 0.00 ? 48 ASP A CB   6  
ATOM 5160  C CG   . ASP A 1 48 ? -10.783 -2.313  -4.195  1.00 0.00 ? 48 ASP A CG   6  
ATOM 5161  O OD1  . ASP A 1 48 ? -10.751 -1.864  -3.051  1.00 0.00 ? 48 ASP A OD1  6  
ATOM 5162  O OD2  . ASP A 1 48 ? -10.628 -3.511  -4.417  1.00 0.00 ? 48 ASP A OD2  6  
ATOM 5163  H H    . ASP A 1 48 ? -9.561  -0.110  -3.791  1.00 0.00 ? 48 ASP A H    6  
ATOM 5164  H HA   . ASP A 1 48 ? -8.993  -1.446  -6.127  1.00 0.00 ? 48 ASP A HA   6  
ATOM 5165  H HB2  . ASP A 1 48 ? -11.759 -0.608  -5.061  1.00 0.00 ? 48 ASP A HB2  6  
ATOM 5166  H HB3  . ASP A 1 48 ? -11.419 -1.914  -6.214  1.00 0.00 ? 48 ASP A HB3  6  
ATOM 5167  N N    . ARG A 1 49 ? -10.343 1.529   -6.581  1.00 0.00 ? 49 ARG A N    6  
ATOM 5168  C CA   . ARG A 1 49 ? -10.609 2.611   -7.521  1.00 0.00 ? 49 ARG A CA   6  
ATOM 5169  C C    . ARG A 1 49 ? -9.292  3.155   -8.124  1.00 0.00 ? 49 ARG A C    6  
ATOM 5170  O O    . ARG A 1 49 ? -9.121  3.243   -9.339  1.00 0.00 ? 49 ARG A O    6  
ATOM 5171  C CB   . ARG A 1 49 ? -11.421 3.715   -6.798  1.00 0.00 ? 49 ARG A CB   6  
ATOM 5172  C CG   . ARG A 1 49 ? -11.891 4.863   -7.700  1.00 0.00 ? 49 ARG A CG   6  
ATOM 5173  C CD   . ARG A 1 49 ? -10.827 5.974   -7.807  1.00 0.00 ? 49 ARG A CD   6  
ATOM 5174  N NE   . ARG A 1 49 ? -11.418 7.252   -7.417  1.00 0.00 ? 49 ARG A NE   6  
ATOM 5175  C CZ   . ARG A 1 49 ? -10.751 8.270   -6.819  1.00 0.00 ? 49 ARG A CZ   6  
ATOM 5176  N NH1  . ARG A 1 49 ? -9.506  8.128   -6.378  1.00 0.00 ? 49 ARG A NH1  6  
ATOM 5177  N NH2  . ARG A 1 49 ? -11.365 9.439   -6.666  1.00 0.00 ? 49 ARG A NH2  6  
ATOM 5178  H H    . ARG A 1 49 ? -10.446 1.658   -5.592  1.00 0.00 ? 49 ARG A H    6  
ATOM 5179  H HA   . ARG A 1 49 ? -11.209 2.193   -8.332  1.00 0.00 ? 49 ARG A HA   6  
ATOM 5180  H HB2  . ARG A 1 49 ? -12.301 3.272   -6.327  1.00 0.00 ? 49 ARG A HB2  6  
ATOM 5181  H HB3  . ARG A 1 49 ? -10.858 4.159   -5.979  1.00 0.00 ? 49 ARG A HB3  6  
ATOM 5182  H HG2  . ARG A 1 49 ? -12.180 4.489   -8.686  1.00 0.00 ? 49 ARG A HG2  6  
ATOM 5183  H HG3  . ARG A 1 49 ? -12.812 5.268   -7.272  1.00 0.00 ? 49 ARG A HG3  6  
ATOM 5184  H HD2  . ARG A 1 49 ? -9.961  5.780   -7.168  1.00 0.00 ? 49 ARG A HD2  6  
ATOM 5185  H HD3  . ARG A 1 49 ? -10.480 6.070   -8.840  1.00 0.00 ? 49 ARG A HD3  6  
ATOM 5186  H HE   . ARG A 1 49 ? -12.388 7.336   -7.641  1.00 0.00 ? 49 ARG A HE   6  
ATOM 5187  H HH11 . ARG A 1 49 ? -9.052  7.223   -6.344  1.00 0.00 ? 49 ARG A HH11 6  
ATOM 5188  H HH12 . ARG A 1 49 ? -8.948  8.882   -6.037  1.00 0.00 ? 49 ARG A HH12 6  
ATOM 5189  H HH21 . ARG A 1 49 ? -12.297 9.571   -7.000  1.00 0.00 ? 49 ARG A HH21 6  
ATOM 5190  H HH22 . ARG A 1 49 ? -10.906 10.205  -6.215  1.00 0.00 ? 49 ARG A HH22 6  
ATOM 5191  N N    . ASP A 1 50 ? -8.380  3.537   -7.212  1.00 0.00 ? 50 ASP A N    6  
ATOM 5192  C CA   . ASP A 1 50 ? -7.116  4.155   -7.611  1.00 0.00 ? 50 ASP A CA   6  
ATOM 5193  C C    . ASP A 1 50 ? -6.169  3.173   -8.338  1.00 0.00 ? 50 ASP A C    6  
ATOM 5194  O O    . ASP A 1 50 ? -5.863  3.358   -9.512  1.00 0.00 ? 50 ASP A O    6  
ATOM 5195  C CB   . ASP A 1 50 ? -6.466  4.831   -6.386  1.00 0.00 ? 50 ASP A CB   6  
ATOM 5196  C CG   . ASP A 1 50 ? -7.323  6.020   -5.947  1.00 0.00 ? 50 ASP A CG   6  
ATOM 5197  O OD1  . ASP A 1 50 ? -8.404  5.826   -5.406  1.00 0.00 ? 50 ASP A OD1  6  
ATOM 5198  O OD2  . ASP A 1 50 ? -6.917  7.160   -6.160  1.00 0.00 ? 50 ASP A OD2  6  
ATOM 5199  H H    . ASP A 1 50 ? -8.583  3.462   -6.234  1.00 0.00 ? 50 ASP A H    6  
ATOM 5200  H HA   . ASP A 1 50 ? -7.362  4.925   -8.345  1.00 0.00 ? 50 ASP A HA   6  
ATOM 5201  H HB2  . ASP A 1 50 ? -6.381  4.122   -5.543  1.00 0.00 ? 50 ASP A HB2  6  
ATOM 5202  H HB3  . ASP A 1 50 ? -5.499  5.286   -6.655  1.00 0.00 ? 50 ASP A HB3  6  
ATOM 5203  N N    . LYS A 1 51 ? -5.716  2.134   -7.617  1.00 0.00 ? 51 LYS A N    6  
ATOM 5204  C CA   . LYS A 1 51 ? -4.780  1.122   -8.132  1.00 0.00 ? 51 LYS A CA   6  
ATOM 5205  C C    . LYS A 1 51 ? -3.346  1.645   -8.241  1.00 0.00 ? 51 LYS A C    6  
ATOM 5206  O O    . LYS A 1 51 ? -2.599  1.288   -9.146  1.00 0.00 ? 51 LYS A O    6  
ATOM 5207  C CB   . LYS A 1 51 ? -5.207  0.453   -9.436  1.00 0.00 ? 51 LYS A CB   6  
ATOM 5208  C CG   . LYS A 1 51 ? -6.606  -0.173  -9.162  1.00 0.00 ? 51 LYS A CG   6  
ATOM 5209  C CD   . LYS A 1 51 ? -7.384  -0.361  -10.443 1.00 0.00 ? 51 LYS A CD   6  
ATOM 5210  C CE   . LYS A 1 51 ? -8.261  0.833   -10.837 1.00 0.00 ? 51 LYS A CE   6  
ATOM 5211  N NZ   . LYS A 1 51 ? -7.568  2.114   -10.974 1.00 0.00 ? 51 LYS A NZ   6  
ATOM 5212  H H    . LYS A 1 51 ? -6.101  1.986   -6.704  1.00 0.00 ? 51 LYS A H    6  
ATOM 5213  H HA   . LYS A 1 51 ? -4.811  0.329   -7.393  1.00 0.00 ? 51 LYS A HA   6  
ATOM 5214  H HB2  . LYS A 1 51 ? -5.217  1.238   -10.258 1.00 0.00 ? 51 LYS A HB2  6  
ATOM 5215  H HB3  . LYS A 1 51 ? -4.445  -0.365  -9.635  1.00 0.00 ? 51 LYS A HB3  6  
ATOM 5216  H HG2  . LYS A 1 51 ? -6.575  -1.158  -8.670  1.00 0.00 ? 51 LYS A HG2  6  
ATOM 5217  H HG3  . LYS A 1 51 ? -7.194  0.393   -8.429  1.00 0.00 ? 51 LYS A HG3  6  
ATOM 5218  H HD2  . LYS A 1 51 ? -6.712  -0.667  -11.244 1.00 0.00 ? 51 LYS A HD2  6  
ATOM 5219  H HD3  . LYS A 1 51 ? -8.024  -1.199  -10.207 1.00 0.00 ? 51 LYS A HD3  6  
ATOM 5220  H HE2  . LYS A 1 51 ? -8.794  0.633   -11.768 1.00 0.00 ? 51 LYS A HE2  6  
ATOM 5221  H HE3  . LYS A 1 51 ? -9.032  0.969   -10.083 1.00 0.00 ? 51 LYS A HE3  6  
ATOM 5222  H HZ1  . LYS A 1 51 ? -8.238  2.863   -10.677 1.00 0.00 ? 51 LYS A HZ1  6  
ATOM 5223  H HZ2  . LYS A 1 51 ? -7.236  2.286   -11.941 1.00 0.00 ? 51 LYS A HZ2  6  
ATOM 5224  H HZ3  . LYS A 1 51 ? -6.757  2.202   -10.322 1.00 0.00 ? 51 LYS A HZ3  6  
ATOM 5225  N N    . LYS A 1 52 ? -3.006  2.504   -7.268  1.00 0.00 ? 52 LYS A N    6  
ATOM 5226  C CA   . LYS A 1 52 ? -1.660  3.035   -7.184  1.00 0.00 ? 52 LYS A CA   6  
ATOM 5227  C C    . LYS A 1 52 ? -1.181  2.663   -5.779  1.00 0.00 ? 52 LYS A C    6  
ATOM 5228  O O    . LYS A 1 52 ? -1.954  2.731   -4.830  1.00 0.00 ? 52 LYS A O    6  
ATOM 5229  C CB   . LYS A 1 52 ? -1.636  4.554   -7.435  1.00 0.00 ? 52 LYS A CB   6  
ATOM 5230  C CG   . LYS A 1 52 ? -2.211  5.031   -8.796  1.00 0.00 ? 52 LYS A CG   6  
ATOM 5231  C CD   . LYS A 1 52 ? -1.559  4.463   -10.074 1.00 0.00 ? 52 LYS A CD   6  
ATOM 5232  C CE   . LYS A 1 52 ? -0.032  4.538   -10.047 1.00 0.00 ? 52 LYS A CE   6  
ATOM 5233  N NZ   . LYS A 1 52 ? 0.508   5.890   -9.973  1.00 0.00 ? 52 LYS A NZ   6  
ATOM 5234  H H    . LYS A 1 52 ? -3.636  2.734   -6.529  1.00 0.00 ? 52 LYS A H    6  
ATOM 5235  H HA   . LYS A 1 52 ? -1.054  2.477   -7.892  1.00 0.00 ? 52 LYS A HA   6  
ATOM 5236  H HB2  . LYS A 1 52 ? -2.183  5.045   -6.626  1.00 0.00 ? 52 LYS A HB2  6  
ATOM 5237  H HB3  . LYS A 1 52 ? -0.612  4.902   -7.338  1.00 0.00 ? 52 LYS A HB3  6  
ATOM 5238  H HG2  . LYS A 1 52 ? -3.279  4.816   -8.846  1.00 0.00 ? 52 LYS A HG2  6  
ATOM 5239  H HG3  . LYS A 1 52 ? -2.128  6.120   -8.840  1.00 0.00 ? 52 LYS A HG3  6  
ATOM 5240  H HD2  . LYS A 1 52 ? -1.834  3.371   -10.148 1.00 0.00 ? 52 LYS A HD2  6  
ATOM 5241  H HD3  . LYS A 1 52 ? -1.886  5.127   -10.927 1.00 0.00 ? 52 LYS A HD3  6  
ATOM 5242  H HE2  . LYS A 1 52 ? 0.346   3.993   -9.187  1.00 0.00 ? 52 LYS A HE2  6  
ATOM 5243  H HE3  . LYS A 1 52 ? 0.389   4.063   -10.935 1.00 0.00 ? 52 LYS A HE3  6  
ATOM 5244  H HZ1  . LYS A 1 52 ? 0.331   6.519   -10.789 1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 5245  H HZ2  . LYS A 1 52 ? 1.544   5.878   -9.865  1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 5246  H HZ3  . LYS A 1 52 ? 0.150   6.459   -9.173  1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 5247  N N    . TYR A 1 53 ? 0.080   2.200   -5.710  1.00 0.00 ? 53 TYR A N    6  
ATOM 5248  C CA   . TYR A 1 53 ? 0.605   1.664   -4.462  1.00 0.00 ? 53 TYR A CA   6  
ATOM 5249  C C    . TYR A 1 53 ? 2.079   2.050   -4.252  1.00 0.00 ? 53 TYR A C    6  
ATOM 5250  O O    . TYR A 1 53 ? 2.762   2.626   -5.096  1.00 0.00 ? 53 TYR A O    6  
ATOM 5251  C CB   . TYR A 1 53 ? 0.482   0.119   -4.505  1.00 0.00 ? 53 TYR A CB   6  
ATOM 5252  C CG   . TYR A 1 53 ? 1.292   -0.510  -5.611  1.00 0.00 ? 53 TYR A CG   6  
ATOM 5253  C CD1  . TYR A 1 53 ? 2.622   -0.866  -5.413  1.00 0.00 ? 53 TYR A CD1  6  
ATOM 5254  C CD2  . TYR A 1 53 ? 0.716   -0.750  -6.851  1.00 0.00 ? 53 TYR A CD2  6  
ATOM 5255  C CE1  . TYR A 1 53 ? 3.350   -1.452  -6.437  1.00 0.00 ? 53 TYR A CE1  6  
ATOM 5256  C CE2  . TYR A 1 53 ? 1.437   -1.349  -7.874  1.00 0.00 ? 53 TYR A CE2  6  
ATOM 5257  C CZ   . TYR A 1 53 ? 2.760   -1.708  -7.665  1.00 0.00 ? 53 TYR A CZ   6  
ATOM 5258  O OH   . TYR A 1 53 ? 3.493   -2.341  -8.654  1.00 0.00 ? 53 TYR A OH   6  
ATOM 5259  H H    . TYR A 1 53 ? 0.677   2.192   -6.515  1.00 0.00 ? 53 TYR A H    6  
ATOM 5260  H HA   . TYR A 1 53 ? 0.022   2.080   -3.640  1.00 0.00 ? 53 TYR A HA   6  
ATOM 5261  H HB2  . TYR A 1 53 ? 0.770   -0.333  -3.558  1.00 0.00 ? 53 TYR A HB2  6  
ATOM 5262  H HB3  . TYR A 1 53 ? -0.552  -0.189  -4.637  1.00 0.00 ? 53 TYR A HB3  6  
ATOM 5263  H HD1  . TYR A 1 53 ? 3.099   -0.688  -4.461  1.00 0.00 ? 53 TYR A HD1  6  
ATOM 5264  H HD2  . TYR A 1 53 ? -0.308  -0.466  -7.015  1.00 0.00 ? 53 TYR A HD2  6  
ATOM 5265  H HE1  . TYR A 1 53 ? 4.379   -1.707  -6.267  1.00 0.00 ? 53 TYR A HE1  6  
ATOM 5266  H HE2  . TYR A 1 53 ? 0.944   -1.536  -8.814  1.00 0.00 ? 53 TYR A HE2  6  
ATOM 5267  H HH   . TYR A 1 53 ? 3.469   -1.806  -9.442  1.00 0.00 ? 53 TYR A HH   6  
ATOM 5268  N N    . GLY A 1 54 ? 2.502   1.595   -3.061  1.00 0.00 ? 54 GLY A N    6  
ATOM 5269  C CA   . GLY A 1 54 ? 3.879   1.670   -2.591  1.00 0.00 ? 54 GLY A CA   6  
ATOM 5270  C C    . GLY A 1 54 ? 4.282   0.314   -1.982  1.00 0.00 ? 54 GLY A C    6  
ATOM 5271  O O    . GLY A 1 54 ? 3.430   -0.554  -1.844  1.00 0.00 ? 54 GLY A O    6  
ATOM 5272  H H    . GLY A 1 54 ? 1.779   1.177   -2.506  1.00 0.00 ? 54 GLY A H    6  
ATOM 5273  H HA2  . GLY A 1 54 ? 4.496   1.880   -3.454  1.00 0.00 ? 54 GLY A HA2  6  
ATOM 5274  H HA3  . GLY A 1 54 ? 3.931   2.479   -1.870  1.00 0.00 ? 54 GLY A HA3  6  
ATOM 5275  N N    . PHE A 1 55 ? 5.586   0.146   -1.625  1.00 0.00 ? 55 PHE A N    6  
ATOM 5276  C CA   . PHE A 1 55 ? 6.052   -1.153  -1.100  1.00 0.00 ? 55 PHE A CA   6  
ATOM 5277  C C    . PHE A 1 55 ? 6.225   -1.170  0.432   1.00 0.00 ? 55 PHE A C    6  
ATOM 5278  O O    . PHE A 1 55 ? 6.933   -2.013  0.973   1.00 0.00 ? 55 PHE A O    6  
ATOM 5279  C CB   . PHE A 1 55 ? 7.381   -1.584  -1.746  1.00 0.00 ? 55 PHE A CB   6  
ATOM 5280  C CG   . PHE A 1 55 ? 7.232   -1.840  -3.219  1.00 0.00 ? 55 PHE A CG   6  
ATOM 5281  C CD1  . PHE A 1 55 ? 6.460   -2.901  -3.677  1.00 0.00 ? 55 PHE A CD1  6  
ATOM 5282  C CD2  . PHE A 1 55 ? 7.874   -1.031  -4.143  1.00 0.00 ? 55 PHE A CD2  6  
ATOM 5283  C CE1  . PHE A 1 55 ? 6.344   -3.149  -5.036  1.00 0.00 ? 55 PHE A CE1  6  
ATOM 5284  C CE2  . PHE A 1 55 ? 7.755   -1.272  -5.503  1.00 0.00 ? 55 PHE A CE2  6  
ATOM 5285  C CZ   . PHE A 1 55 ? 6.994   -2.338  -5.954  1.00 0.00 ? 55 PHE A CZ   6  
ATOM 5286  H H    . PHE A 1 55 ? 6.267   0.877   -1.746  1.00 0.00 ? 55 PHE A H    6  
ATOM 5287  H HA   . PHE A 1 55 ? 5.315   -1.914  -1.340  1.00 0.00 ? 55 PHE A HA   6  
ATOM 5288  H HB2  . PHE A 1 55 ? 8.173   -0.846  -1.567  1.00 0.00 ? 55 PHE A HB2  6  
ATOM 5289  H HB3  . PHE A 1 55 ? 7.705   -2.537  -1.309  1.00 0.00 ? 55 PHE A HB3  6  
ATOM 5290  H HD1  . PHE A 1 55 ? 5.950   -3.538  -2.969  1.00 0.00 ? 55 PHE A HD1  6  
ATOM 5291  H HD2  . PHE A 1 55 ? 8.477   -0.210  -3.794  1.00 0.00 ? 55 PHE A HD2  6  
ATOM 5292  H HE1  . PHE A 1 55 ? 5.742   -3.971  -5.377  1.00 0.00 ? 55 PHE A HE1  6  
ATOM 5293  H HE2  . PHE A 1 55 ? 8.254   -0.624  -6.205  1.00 0.00 ? 55 PHE A HE2  6  
ATOM 5294  H HZ   . PHE A 1 55 ? 6.906   -2.528  -7.014  1.00 0.00 ? 55 PHE A HZ   6  
ATOM 5295  N N    . CYS A 1 56 ? 5.520   -0.225  1.100   1.00 0.00 ? 56 CYS A N    6  
ATOM 5296  C CA   . CYS A 1 56 ? 5.583   -0.238  2.616   1.00 0.00 ? 56 CYS A CA   6  
ATOM 5297  C C    . CYS A 1 56 ? 7.057   -0.110  3.117   1.00 0.00 ? 56 CYS A C    6  
ATOM 5298  O O    . CYS A 1 56 ? 7.969   0.105   2.327   1.00 0.00 ? 56 CYS A O    6  
ATOM 5299  C CB   . CYS A 1 56 ? 4.949   -1.585  3.058   1.00 0.00 ? 56 CYS A CB   6  
ATOM 5300  S SG   . CYS A 1 56 ? 3.483   -1.348  4.089   1.00 0.00 ? 56 CYS A SG   6  
ATOM 5301  H H    . CYS A 1 56 ? 5.014   0.272   0.370   1.00 0.00 ? 56 CYS A H    6  
ATOM 5302  H HA   . CYS A 1 56 ? 5.065   0.592   3.149   1.00 0.00 ? 56 CYS A HA   6  
ATOM 5303  H HB2  . CYS A 1 56 ? 4.634   -2.189  2.189   1.00 0.00 ? 56 CYS A HB2  6  
ATOM 5304  H HB3  . CYS A 1 56 ? 5.666   -2.191  3.625   1.00 0.00 ? 56 CYS A HB3  6  
ATOM 5305  N N    . PRO A 1 57 ? 7.296   -0.263  4.460   1.00 0.00 ? 57 PRO A N    6  
ATOM 5306  C CA   . PRO A 1 57 ? 8.641   -0.607  4.932   1.00 0.00 ? 57 PRO A CA   6  
ATOM 5307  C C    . PRO A 1 57 ? 9.134   -1.944  4.345   1.00 0.00 ? 57 PRO A C    6  
ATOM 5308  O O    . PRO A 1 57 ? 8.342   -2.816  3.985   1.00 0.00 ? 57 PRO A O    6  
ATOM 5309  C CB   . PRO A 1 57 ? 8.527   -0.679  6.462   1.00 0.00 ? 57 PRO A CB   6  
ATOM 5310  C CG   . PRO A 1 57 ? 7.028   -0.814  6.737   1.00 0.00 ? 57 PRO A CG   6  
ATOM 5311  C CD   . PRO A 1 57 ? 6.349   -0.087  5.575   1.00 0.00 ? 57 PRO A CD   6  
ATOM 5312  H HA   . PRO A 1 57 ? 9.340   0.181   4.642   1.00 0.00 ? 57 PRO A HA   6  
ATOM 5313  H HB2  . PRO A 1 57 ? 9.110   -1.485  6.912   1.00 0.00 ? 57 PRO A HB2  6  
ATOM 5314  H HB3  . PRO A 1 57 ? 8.897   0.252   6.893   1.00 0.00 ? 57 PRO A HB3  6  
ATOM 5315  H HG2  . PRO A 1 57 ? 6.749   -1.868  6.713   1.00 0.00 ? 57 PRO A HG2  6  
ATOM 5316  H HG3  . PRO A 1 57 ? 6.739   -0.419  7.711   1.00 0.00 ? 57 PRO A HG3  6  
ATOM 5317  H HD2  . PRO A 1 57 ? 5.340   -0.499  5.428   1.00 0.00 ? 57 PRO A HD2  6  
ATOM 5318  H HD3  . PRO A 1 57 ? 6.323   0.988   5.811   1.00 0.00 ? 57 PRO A HD3  6  
ATOM 5319  N N    . GLU A 1 58 ? 10.482  -1.995  4.270   1.00 0.00 ? 58 GLU A N    6  
ATOM 5320  C CA   . GLU A 1 58 ? 11.335  -3.085  3.769   1.00 0.00 ? 58 GLU A CA   6  
ATOM 5321  C C    . GLU A 1 58 ? 10.614  -4.448  3.749   1.00 0.00 ? 58 GLU A C    6  
ATOM 5322  O O    . GLU A 1 58 ? 9.962   -4.861  4.700   1.00 0.00 ? 58 GLU A O    6  
ATOM 5323  C CB   . GLU A 1 58 ? 12.606  -3.183  4.637   1.00 0.00 ? 58 GLU A CB   6  
ATOM 5324  C CG   . GLU A 1 58 ? 13.598  -2.015  4.456   1.00 0.00 ? 58 GLU A CG   6  
ATOM 5325  C CD   . GLU A 1 58 ? 13.066  -0.649  4.927   1.00 0.00 ? 58 GLU A CD   6  
ATOM 5326  O OE1  . GLU A 1 58 ? 12.366  -0.598  5.938   1.00 0.00 ? 58 GLU A OE1  6  
ATOM 5327  O OE2  . GLU A 1 58 ? 13.332  0.346   4.260   1.00 0.00 ? 58 GLU A OE2  6  
ATOM 5328  H H    . GLU A 1 58 ? 10.934  -1.186  4.665   1.00 0.00 ? 58 GLU A H    6  
ATOM 5329  H HA   . GLU A 1 58 ? 11.607  -2.836  2.737   1.00 0.00 ? 58 GLU A HA   6  
ATOM 5330  H HB2  . GLU A 1 58 ? 12.319  -3.260  5.694   1.00 0.00 ? 58 GLU A HB2  6  
ATOM 5331  H HB3  . GLU A 1 58 ? 13.147  -4.099  4.370   1.00 0.00 ? 58 GLU A HB3  6  
ATOM 5332  H HG2  . GLU A 1 58 ? 14.509  -2.218  5.018   1.00 0.00 ? 58 GLU A HG2  6  
ATOM 5333  H HG3  . GLU A 1 58 ? 13.892  -1.938  3.408   1.00 0.00 ? 58 GLU A HG3  6  
ATOM 5334  N N    . THR A 1 59 ? 10.758  -5.095  2.577   1.00 0.00 ? 59 THR A N    6  
ATOM 5335  C CA   . THR A 1 59 ? 10.071  -6.354  2.307   1.00 0.00 ? 59 THR A CA   6  
ATOM 5336  C C    . THR A 1 59 ? 11.049  -7.519  2.093   1.00 0.00 ? 59 THR A C    6  
ATOM 5337  O O    . THR A 1 59 ? 10.674  -8.547  1.543   1.00 0.00 ? 59 THR A O    6  
ATOM 5338  C CB   . THR A 1 59 ? 9.174   -6.098  1.075   1.00 0.00 ? 59 THR A CB   6  
ATOM 5339  O OG1  . THR A 1 59 ? 8.027   -6.925  1.115   1.00 0.00 ? 59 THR A OG1  6  
ATOM 5340  C CG2  . THR A 1 59 ? 9.921   -6.111  -0.269  1.00 0.00 ? 59 THR A CG2  6  
ATOM 5341  H H    . THR A 1 59 ? 11.319  -4.692  1.853   1.00 0.00 ? 59 THR A H    6  
ATOM 5342  H HA   . THR A 1 59 ? 9.465   -6.617  3.174   1.00 0.00 ? 59 THR A HA   6  
ATOM 5343  H HB   . THR A 1 59 ? 8.789   -5.080  1.151   1.00 0.00 ? 59 THR A HB   6  
ATOM 5344  H HG1  . THR A 1 59 ? 8.294   -7.828  0.884   1.00 0.00 ? 59 THR A HG1  6  
ATOM 5345  H HG21 . THR A 1 59 ? 10.758  -5.412  -0.255  1.00 0.00 ? 59 THR A HG21 6  
ATOM 5346  H HG22 . THR A 1 59 ? 9.266   -5.806  -1.084  1.00 0.00 ? 59 THR A HG22 6  
ATOM 5347  H HG23 . THR A 1 59 ? 10.335  -7.091  -0.505  1.00 0.00 ? 59 THR A HG23 6  
ATOM 5348  N N    . ALA A 1 60 ? 12.292  -7.266  2.552   1.00 0.00 ? 60 ALA A N    6  
ATOM 5349  C CA   . ALA A 1 60 ? 13.429  -8.168  2.395   1.00 0.00 ? 60 ALA A CA   6  
ATOM 5350  C C    . ALA A 1 60 ? 14.029  -7.982  0.984   1.00 0.00 ? 60 ALA A C    6  
ATOM 5351  O O    . ALA A 1 60 ? 14.827  -8.818  0.563   1.00 0.00 ? 60 ALA A O    6  
ATOM 5352  C CB   . ALA A 1 60 ? 13.099  -9.635  2.724   1.00 0.00 ? 60 ALA A CB   6  
ATOM 5353  O OXT  . ALA A 1 60 ? 13.694  -6.993  0.326   1.00 0.00 ? 60 ALA A OXT  6  
ATOM 5354  H H    . ALA A 1 60 ? 12.486  -6.385  2.972   1.00 0.00 ? 60 ALA A H    6  
ATOM 5355  H HA   . ALA A 1 60 ? 14.168  -7.806  3.109   1.00 0.00 ? 60 ALA A HA   6  
ATOM 5356  H HB1  . ALA A 1 60 ? 14.011  -10.231 2.768   1.00 0.00 ? 60 ALA A HB1  6  
ATOM 5357  H HB2  . ALA A 1 60 ? 12.459  -10.088 1.968   1.00 0.00 ? 60 ALA A HB2  6  
ATOM 5358  H HB3  . ALA A 1 60 ? 12.600  -9.720  3.689   1.00 0.00 ? 60 ALA A HB3  6  
ATOM 5359  N N    . THR A 1 1  ? 14.104  7.435   10.256  1.00 0.00 ? 1  THR A N    7  
ATOM 5360  C CA   . THR A 1 1  ? 13.416  6.892   9.103   1.00 0.00 ? 1  THR A CA   7  
ATOM 5361  C C    . THR A 1 1  ? 11.947  7.168   9.364   1.00 0.00 ? 1  THR A C    7  
ATOM 5362  O O    . THR A 1 1  ? 11.637  7.603   10.466  1.00 0.00 ? 1  THR A O    7  
ATOM 5363  C CB   . THR A 1 1  ? 13.737  5.385   9.066   1.00 0.00 ? 1  THR A CB   7  
ATOM 5364  O OG1  . THR A 1 1  ? 15.009  5.270   9.697   1.00 0.00 ? 1  THR A OG1  7  
ATOM 5365  C CG2  . THR A 1 1  ? 13.746  4.830   7.632   1.00 0.00 ? 1  THR A CG2  7  
ATOM 5366  H H1   . THR A 1 1  ? 14.523  8.363   10.062  1.00 0.00 ? 1  THR A H1   7  
ATOM 5367  H H2   . THR A 1 1  ? 14.825  6.708   10.476  1.00 0.00 ? 1  THR A H2   7  
ATOM 5368  H H3   . THR A 1 1  ? 13.365  7.504   10.995  1.00 0.00 ? 1  THR A H3   7  
ATOM 5369  H HA   . THR A 1 1  ? 13.769  7.416   8.215   1.00 0.00 ? 1  THR A HA   7  
ATOM 5370  H HB   . THR A 1 1  ? 13.001  4.830   9.664   1.00 0.00 ? 1  THR A HB   7  
ATOM 5371  H HG1  . THR A 1 1  ? 15.327  4.368   9.640   1.00 0.00 ? 1  THR A HG1  7  
ATOM 5372  H HG21 . THR A 1 1  ? 14.509  5.316   7.022   1.00 0.00 ? 1  THR A HG21 7  
ATOM 5373  H HG22 . THR A 1 1  ? 12.784  4.982   7.143   1.00 0.00 ? 1  THR A HG22 7  
ATOM 5374  H HG23 . THR A 1 1  ? 13.940  3.756   7.612   1.00 0.00 ? 1  THR A HG23 7  
ATOM 5375  N N    . ALA A 1 2  ? 11.107  6.898   8.353   1.00 0.00 ? 2  ALA A N    7  
ATOM 5376  C CA   . ALA A 1 2  ? 9.667   7.053   8.479   1.00 0.00 ? 2  ALA A CA   7  
ATOM 5377  C C    . ALA A 1 2  ? 9.066   6.087   7.456   1.00 0.00 ? 2  ALA A C    7  
ATOM 5378  O O    . ALA A 1 2  ? 9.721   5.124   7.077   1.00 0.00 ? 2  ALA A O    7  
ATOM 5379  C CB   . ALA A 1 2  ? 9.233   8.512   8.275   1.00 0.00 ? 2  ALA A CB   7  
ATOM 5380  H H    . ALA A 1 2  ? 11.422  6.519   7.482   1.00 0.00 ? 2  ALA A H    7  
ATOM 5381  H HA   . ALA A 1 2  ? 9.388   6.707   9.476   1.00 0.00 ? 2  ALA A HA   7  
ATOM 5382  H HB1  . ALA A 1 2  ? 9.365   8.828   7.244   1.00 0.00 ? 2  ALA A HB1  7  
ATOM 5383  H HB2  . ALA A 1 2  ? 9.809   9.183   8.911   1.00 0.00 ? 2  ALA A HB2  7  
ATOM 5384  H HB3  . ALA A 1 2  ? 8.182   8.651   8.529   1.00 0.00 ? 2  ALA A HB3  7  
ATOM 5385  N N    . LEU A 1 3  ? 7.821   6.374   7.033   1.00 0.00 ? 3  LEU A N    7  
ATOM 5386  C CA   . LEU A 1 3  ? 7.115   5.493   6.120   1.00 0.00 ? 3  LEU A CA   7  
ATOM 5387  C C    . LEU A 1 3  ? 6.869   6.243   4.787   1.00 0.00 ? 3  LEU A C    7  
ATOM 5388  O O    . LEU A 1 3  ? 5.786   6.763   4.546   1.00 0.00 ? 3  LEU A O    7  
ATOM 5389  C CB   . LEU A 1 3  ? 5.792   5.141   6.834   1.00 0.00 ? 3  LEU A CB   7  
ATOM 5390  C CG   . LEU A 1 3  ? 5.066   3.898   6.317   1.00 0.00 ? 3  LEU A CG   7  
ATOM 5391  C CD1  . LEU A 1 3  ? 3.581   4.132   6.601   1.00 0.00 ? 3  LEU A CD1  7  
ATOM 5392  C CD2  . LEU A 1 3  ? 5.379   3.510   4.859   1.00 0.00 ? 3  LEU A CD2  7  
ATOM 5393  H H    . LEU A 1 3  ? 7.315   7.179   7.337   1.00 0.00 ? 3  LEU A H    7  
ATOM 5394  H HA   . LEU A 1 3  ? 7.711   4.596   5.944   1.00 0.00 ? 3  LEU A HA   7  
ATOM 5395  H HB2  . LEU A 1 3  ? 5.978   4.842   7.905   1.00 0.00 ? 3  LEU A HB2  7  
ATOM 5396  H HB3  . LEU A 1 3  ? 5.119   6.035   6.701   1.00 0.00 ? 3  LEU A HB3  7  
ATOM 5397  H HG   . LEU A 1 3  ? 5.381   3.050   6.925   1.00 0.00 ? 3  LEU A HG   7  
ATOM 5398  H HD11 . LEU A 1 3  ? 3.432   4.413   7.643   1.00 0.00 ? 3  LEU A HD11 7  
ATOM 5399  H HD12 . LEU A 1 3  ? 2.990   3.244   6.391   1.00 0.00 ? 3  LEU A HD12 7  
ATOM 5400  H HD13 . LEU A 1 3  ? 3.206   4.967   6.004   1.00 0.00 ? 3  LEU A HD13 7  
ATOM 5401  H HD21 . LEU A 1 3  ? 6.438   3.310   4.704   1.00 0.00 ? 3  LEU A HD21 7  
ATOM 5402  H HD22 . LEU A 1 3  ? 5.083   4.285   4.154   1.00 0.00 ? 3  LEU A HD22 7  
ATOM 5403  H HD23 . LEU A 1 3  ? 4.863   2.590   4.582   1.00 0.00 ? 3  LEU A HD23 7  
ATOM 5404  N N    . PHE A 1 4  ? 7.929   6.276   3.944   1.00 0.00 ? 4  PHE A N    7  
ATOM 5405  C CA   . PHE A 1 4  ? 7.832   6.948   2.637   1.00 0.00 ? 4  PHE A CA   7  
ATOM 5406  C C    . PHE A 1 4  ? 7.158   5.934   1.649   1.00 0.00 ? 4  PHE A C    7  
ATOM 5407  O O    . PHE A 1 4  ? 6.206   5.278   2.052   1.00 0.00 ? 4  PHE A O    7  
ATOM 5408  C CB   . PHE A 1 4  ? 9.236   7.528   2.273   1.00 0.00 ? 4  PHE A CB   7  
ATOM 5409  C CG   . PHE A 1 4  ? 9.921   8.218   3.424   1.00 0.00 ? 4  PHE A CG   7  
ATOM 5410  C CD1  . PHE A 1 4  ? 9.424   9.421   3.915   1.00 0.00 ? 4  PHE A CD1  7  
ATOM 5411  C CD2  . PHE A 1 4  ? 11.081  7.688   3.984   1.00 0.00 ? 4  PHE A CD2  7  
ATOM 5412  C CE1  . PHE A 1 4  ? 10.086  10.097  4.932   1.00 0.00 ? 4  PHE A CE1  7  
ATOM 5413  C CE2  . PHE A 1 4  ? 11.744  8.359   5.003   1.00 0.00 ? 4  PHE A CE2  7  
ATOM 5414  C CZ   . PHE A 1 4  ? 11.250  9.568   5.474   1.00 0.00 ? 4  PHE A CZ   7  
ATOM 5415  H H    . PHE A 1 4  ? 8.776   5.827   4.223   1.00 0.00 ? 4  PHE A H    7  
ATOM 5416  H HA   . PHE A 1 4  ? 7.127   7.766   2.798   1.00 0.00 ? 4  PHE A HA   7  
ATOM 5417  H HB2  . PHE A 1 4  ? 9.881   6.714   1.927   1.00 0.00 ? 4  PHE A HB2  7  
ATOM 5418  H HB3  . PHE A 1 4  ? 9.229   8.313   1.498   1.00 0.00 ? 4  PHE A HB3  7  
ATOM 5419  H HD1  . PHE A 1 4  ? 8.521   9.842   3.497   1.00 0.00 ? 4  PHE A HD1  7  
ATOM 5420  H HD2  . PHE A 1 4  ? 11.484  6.756   3.616   1.00 0.00 ? 4  PHE A HD2  7  
ATOM 5421  H HE1  . PHE A 1 4  ? 9.696   11.035  5.299   1.00 0.00 ? 4  PHE A HE1  7  
ATOM 5422  H HE2  . PHE A 1 4  ? 12.650  7.946   5.420   1.00 0.00 ? 4  PHE A HE2  7  
ATOM 5423  H HZ   . PHE A 1 4  ? 11.767  10.099  6.260   1.00 0.00 ? 4  PHE A HZ   7  
ATOM 5424  N N    . THR A 1 5  ? 7.647   5.767   0.393   1.00 0.00 ? 5  THR A N    7  
ATOM 5425  C CA   . THR A 1 5  ? 7.039   4.821   -0.541  1.00 0.00 ? 5  THR A CA   7  
ATOM 5426  C C    . THR A 1 5  ? 7.885   3.556   -0.704  1.00 0.00 ? 5  THR A C    7  
ATOM 5427  O O    . THR A 1 5  ? 7.409   2.487   -1.058  1.00 0.00 ? 5  THR A O    7  
ATOM 5428  C CB   . THR A 1 5  ? 7.009   5.504   -1.898  1.00 0.00 ? 5  THR A CB   7  
ATOM 5429  O OG1  . THR A 1 5  ? 8.305   6.066   -2.093  1.00 0.00 ? 5  THR A OG1  7  
ATOM 5430  C CG2  . THR A 1 5  ? 5.900   6.567   -1.942  1.00 0.00 ? 5  THR A CG2  7  
ATOM 5431  H H    . THR A 1 5  ? 8.371   6.221   -0.120  1.00 0.00 ? 5  THR A H    7  
ATOM 5432  H HA   . THR A 1 5  ? 6.055   4.531   -0.194  1.00 0.00 ? 5  THR A HA   7  
ATOM 5433  H HB   . THR A 1 5  ? 6.825   4.695   -2.612  1.00 0.00 ? 5  THR A HB   7  
ATOM 5434  H HG1  . THR A 1 5  ? 8.417   6.384   -2.988  1.00 0.00 ? 5  THR A HG1  7  
ATOM 5435  H HG21 . THR A 1 5  ? 4.983   6.163   -1.517  1.00 0.00 ? 5  THR A HG21 7  
ATOM 5436  H HG22 . THR A 1 5  ? 5.662   6.896   -2.952  1.00 0.00 ? 5  THR A HG22 7  
ATOM 5437  H HG23 . THR A 1 5  ? 6.143   7.440   -1.335  1.00 0.00 ? 5  THR A HG23 7  
ATOM 5438  N N    . MET A 1 6  ? 9.167   3.766   -0.413  1.00 0.00 ? 6  MET A N    7  
ATOM 5439  C CA   . MET A 1 6  ? 10.166  2.711   -0.333  1.00 0.00 ? 6  MET A CA   7  
ATOM 5440  C C    . MET A 1 6  ? 10.264  1.807   -1.586  1.00 0.00 ? 6  MET A C    7  
ATOM 5441  O O    . MET A 1 6  ? 10.737  0.683   -1.494  1.00 0.00 ? 6  MET A O    7  
ATOM 5442  C CB   . MET A 1 6  ? 9.856   1.876   0.925   1.00 0.00 ? 6  MET A CB   7  
ATOM 5443  C CG   . MET A 1 6  ? 9.467   2.736   2.159   1.00 0.00 ? 6  MET A CG   7  
ATOM 5444  S SD   . MET A 1 6  ? 10.821  3.826   2.641   1.00 0.00 ? 6  MET A SD   7  
ATOM 5445  C CE   . MET A 1 6  ? 10.511  3.886   4.415   1.00 0.00 ? 6  MET A CE   7  
ATOM 5446  H H    . MET A 1 6  ? 9.351   4.719   -0.202  1.00 0.00 ? 6  MET A H    7  
ATOM 5447  H HA   . MET A 1 6  ? 11.119  3.226   -0.214  1.00 0.00 ? 6  MET A HA   7  
ATOM 5448  H HB2  . MET A 1 6  ? 9.067   1.162   0.670   1.00 0.00 ? 6  MET A HB2  7  
ATOM 5449  H HB3  . MET A 1 6  ? 10.724  1.263   1.172   1.00 0.00 ? 6  MET A HB3  7  
ATOM 5450  H HG2  . MET A 1 6  ? 8.574   3.351   2.003   1.00 0.00 ? 6  MET A HG2  7  
ATOM 5451  H HG3  . MET A 1 6  ? 9.233   2.090   3.007   1.00 0.00 ? 6  MET A HG3  7  
ATOM 5452  H HE1  . MET A 1 6  ? 10.910  4.806   4.838   1.00 0.00 ? 6  MET A HE1  7  
ATOM 5453  H HE2  . MET A 1 6  ? 10.970  3.032   4.913   1.00 0.00 ? 6  MET A HE2  7  
ATOM 5454  H HE3  . MET A 1 6  ? 9.440   3.868   4.614   1.00 0.00 ? 6  MET A HE3  7  
ATOM 5455  N N    . GLY A 1 7  ? 9.802   2.331   -2.744  1.00 0.00 ? 7  GLY A N    7  
ATOM 5456  C CA   . GLY A 1 7  ? 9.874   1.557   -3.989  1.00 0.00 ? 7  GLY A CA   7  
ATOM 5457  C C    . GLY A 1 7  ? 8.517   1.377   -4.684  1.00 0.00 ? 7  GLY A C    7  
ATOM 5458  O O    . GLY A 1 7  ? 8.458   1.115   -5.877  1.00 0.00 ? 7  GLY A O    7  
ATOM 5459  H H    . GLY A 1 7  ? 9.431   3.259   -2.741  1.00 0.00 ? 7  GLY A H    7  
ATOM 5460  H HA2  . GLY A 1 7  ? 10.551  2.096   -4.657  1.00 0.00 ? 7  GLY A HA2  7  
ATOM 5461  H HA3  . GLY A 1 7  ? 10.275  0.558   -3.789  1.00 0.00 ? 7  GLY A HA3  7  
ATOM 5462  N N    . GLY A 1 8  ? 7.443   1.504   -3.879  1.00 0.00 ? 8  GLY A N    7  
ATOM 5463  C CA   . GLY A 1 8  ? 6.089   1.321   -4.406  1.00 0.00 ? 8  GLY A CA   7  
ATOM 5464  C C    . GLY A 1 8  ? 5.669   2.438   -5.404  1.00 0.00 ? 8  GLY A C    7  
ATOM 5465  O O    . GLY A 1 8  ? 6.517   3.139   -5.940  1.00 0.00 ? 8  GLY A O    7  
ATOM 5466  H H    . GLY A 1 8  ? 7.599   1.656   -2.903  1.00 0.00 ? 8  GLY A H    7  
ATOM 5467  H HA2  . GLY A 1 8  ? 6.072   0.363   -4.927  1.00 0.00 ? 8  GLY A HA2  7  
ATOM 5468  H HA3  . GLY A 1 8  ? 5.447   1.222   -3.538  1.00 0.00 ? 8  GLY A HA3  7  
ATOM 5469  N N    . ASN A 1 9  ? 4.342   2.551   -5.678  1.00 0.00 ? 9  ASN A N    7  
ATOM 5470  C CA   . ASN A 1 9  ? 3.867   3.458   -6.740  1.00 0.00 ? 9  ASN A CA   7  
ATOM 5471  C C    . ASN A 1 9  ? 3.012   4.613   -6.188  1.00 0.00 ? 9  ASN A C    7  
ATOM 5472  O O    . ASN A 1 9  ? 2.284   5.271   -6.919  1.00 0.00 ? 9  ASN A O    7  
ATOM 5473  C CB   . ASN A 1 9  ? 3.053   2.647   -7.784  1.00 0.00 ? 9  ASN A CB   7  
ATOM 5474  C CG   . ASN A 1 9  ? 1.710   2.136   -7.224  1.00 0.00 ? 9  ASN A CG   7  
ATOM 5475  O OD1  . ASN A 1 9  ? 1.406   2.332   -6.062  1.00 0.00 ? 9  ASN A OD1  7  
ATOM 5476  N ND2  . ASN A 1 9  ? 0.882   1.542   -8.088  1.00 0.00 ? 9  ASN A ND2  7  
ATOM 5477  H H    . ASN A 1 9  ? 3.618   2.057   -5.178  1.00 0.00 ? 9  ASN A H    7  
ATOM 5478  H HA   . ASN A 1 9  ? 4.735   3.900   -7.234  1.00 0.00 ? 9  ASN A HA   7  
ATOM 5479  H HB2  . ASN A 1 9  ? 2.835   3.281   -8.644  1.00 0.00 ? 9  ASN A HB2  7  
ATOM 5480  H HB3  . ASN A 1 9  ? 3.638   1.807   -8.156  1.00 0.00 ? 9  ASN A HB3  7  
ATOM 5481  H HD21 . ASN A 1 9  ? 1.142   1.351   -9.034  1.00 0.00 ? 9  ASN A HD21 7  
ATOM 5482  H HD22 . ASN A 1 9  ? -0.031  1.318   -7.721  1.00 0.00 ? 9  ASN A HD22 7  
ATOM 5483  N N    . ALA A 1 10 ? 3.144   4.815   -4.871  1.00 0.00 ? 10 ALA A N    7  
ATOM 5484  C CA   . ALA A 1 10 ? 2.368   5.769   -4.085  1.00 0.00 ? 10 ALA A CA   7  
ATOM 5485  C C    . ALA A 1 10 ? 2.558   7.272   -4.415  1.00 0.00 ? 10 ALA A C    7  
ATOM 5486  O O    . ALA A 1 10 ? 2.299   8.119   -3.571  1.00 0.00 ? 10 ALA A O    7  
ATOM 5487  C CB   . ALA A 1 10 ? 2.686   5.481   -2.609  1.00 0.00 ? 10 ALA A CB   7  
ATOM 5488  H H    . ALA A 1 10 ? 3.736   4.180   -4.376  1.00 0.00 ? 10 ALA A H    7  
ATOM 5489  H HA   . ALA A 1 10 ? 1.325   5.528   -4.280  1.00 0.00 ? 10 ALA A HA   7  
ATOM 5490  H HB1  . ALA A 1 10 ? 2.866   6.382   -2.025  1.00 0.00 ? 10 ALA A HB1  7  
ATOM 5491  H HB2  . ALA A 1 10 ? 3.570   4.855   -2.499  1.00 0.00 ? 10 ALA A HB2  7  
ATOM 5492  H HB3  . ALA A 1 10 ? 1.865   4.944   -2.141  1.00 0.00 ? 10 ALA A HB3  7  
ATOM 5493  N N    . GLU A 1 11 ? 3.020   7.594   -5.640  1.00 0.00 ? 11 GLU A N    7  
ATOM 5494  C CA   . GLU A 1 11 ? 3.165   8.989   -6.066  1.00 0.00 ? 11 GLU A CA   7  
ATOM 5495  C C    . GLU A 1 11 ? 4.017   9.838   -5.086  1.00 0.00 ? 11 GLU A C    7  
ATOM 5496  O O    . GLU A 1 11 ? 3.811   11.032  -4.912  1.00 0.00 ? 11 GLU A O    7  
ATOM 5497  C CB   . GLU A 1 11 ? 1.763   9.585   -6.317  1.00 0.00 ? 11 GLU A CB   7  
ATOM 5498  C CG   . GLU A 1 11 ? 0.984   8.791   -7.389  1.00 0.00 ? 11 GLU A CG   7  
ATOM 5499  C CD   . GLU A 1 11 ? -0.507  9.150   -7.466  1.00 0.00 ? 11 GLU A CD   7  
ATOM 5500  O OE1  . GLU A 1 11 ? -1.139  9.375   -6.433  1.00 0.00 ? 11 GLU A OE1  7  
ATOM 5501  O OE2  . GLU A 1 11 ? -1.077  9.135   -8.556  1.00 0.00 ? 11 GLU A OE2  7  
ATOM 5502  H H    . GLU A 1 11 ? 3.169   6.868   -6.310  1.00 0.00 ? 11 GLU A H    7  
ATOM 5503  H HA   . GLU A 1 11 ? 3.710   8.945   -7.009  1.00 0.00 ? 11 GLU A HA   7  
ATOM 5504  H HB2  . GLU A 1 11 ? 1.206   9.598   -5.379  1.00 0.00 ? 11 GLU A HB2  7  
ATOM 5505  H HB3  . GLU A 1 11 ? 1.845   10.626  -6.632  1.00 0.00 ? 11 GLU A HB3  7  
ATOM 5506  H HG2  . GLU A 1 11 ? 1.440   8.944   -8.368  1.00 0.00 ? 11 GLU A HG2  7  
ATOM 5507  H HG3  . GLU A 1 11 ? 1.027   7.719   -7.195  1.00 0.00 ? 11 GLU A HG3  7  
ATOM 5508  N N    . GLY A 1 12 ? 4.988   9.136   -4.460  1.00 0.00 ? 12 GLY A N    7  
ATOM 5509  C CA   . GLY A 1 12 ? 5.912   9.776   -3.510  1.00 0.00 ? 12 GLY A CA   7  
ATOM 5510  C C    . GLY A 1 12 ? 5.281   10.026  -2.121  1.00 0.00 ? 12 GLY A C    7  
ATOM 5511  O O    . GLY A 1 12 ? 5.964   10.454  -1.200  1.00 0.00 ? 12 GLY A O    7  
ATOM 5512  H H    . GLY A 1 12 ? 5.030   8.166   -4.695  1.00 0.00 ? 12 GLY A H    7  
ATOM 5513  H HA2  . GLY A 1 12 ? 6.759   9.044   -3.344  1.00 0.00 ? 12 GLY A HA2  7  
ATOM 5514  H HA3  . GLY A 1 12 ? 6.152   10.793  -3.942  1.00 0.00 ? 12 GLY A HA3  7  
ATOM 5515  N N    . GLN A 1 13 ? 3.964   9.768   -2.008  1.00 0.00 ? 13 GLN A N    7  
ATOM 5516  C CA   . GLN A 1 13 ? 3.270   9.988   -0.744  1.00 0.00 ? 13 GLN A CA   7  
ATOM 5517  C C    . GLN A 1 13 ? 3.640   8.870   0.264   1.00 0.00 ? 13 GLN A C    7  
ATOM 5518  O O    . GLN A 1 13 ? 3.853   7.727   -0.119  1.00 0.00 ? 13 GLN A O    7  
ATOM 5519  C CB   . GLN A 1 13 ? 1.747   10.040  -0.986  1.00 0.00 ? 13 GLN A CB   7  
ATOM 5520  C CG   . GLN A 1 13 ? 1.265   11.236  -1.837  1.00 0.00 ? 13 GLN A CG   7  
ATOM 5521  C CD   . GLN A 1 13 ? 1.396   12.578  -1.089  1.00 0.00 ? 13 GLN A CD   7  
ATOM 5522  O OE1  . GLN A 1 13 ? 1.964   12.667  -0.011  1.00 0.00 ? 13 GLN A OE1  7  
ATOM 5523  N NE2  . GLN A 1 13 ? 0.800   13.614  -1.697  1.00 0.00 ? 13 GLN A NE2  7  
ATOM 5524  H H    . GLN A 1 13 ? 3.450   9.362   -2.764  1.00 0.00 ? 13 GLN A H    7  
ATOM 5525  H HA   . GLN A 1 13 ? 3.626   10.938  -0.344  1.00 0.00 ? 13 GLN A HA   7  
ATOM 5526  H HB2  . GLN A 1 13 ? 1.430   9.124   -1.479  1.00 0.00 ? 13 GLN A HB2  7  
ATOM 5527  H HB3  . GLN A 1 13 ? 1.223   10.076  -0.029  1.00 0.00 ? 13 GLN A HB3  7  
ATOM 5528  H HG2  . GLN A 1 13 ? 1.784   11.291  -2.796  1.00 0.00 ? 13 GLN A HG2  7  
ATOM 5529  H HG3  . GLN A 1 13 ? 0.210   11.094  -2.074  1.00 0.00 ? 13 GLN A HG3  7  
ATOM 5530  H HE21 . GLN A 1 13 ? 0.349   13.507  -2.581  1.00 0.00 ? 13 GLN A HE21 7  
ATOM 5531  H HE22 . GLN A 1 13 ? 0.811   14.506  -1.240  1.00 0.00 ? 13 GLN A HE22 7  
ATOM 5532  N N    . PRO A 1 14 ? 3.697   9.230   1.577   1.00 0.00 ? 14 PRO A N    7  
ATOM 5533  C CA   . PRO A 1 14 ? 3.947   8.258   2.642   1.00 0.00 ? 14 PRO A CA   7  
ATOM 5534  C C    . PRO A 1 14 ? 2.730   7.331   2.794   1.00 0.00 ? 14 PRO A C    7  
ATOM 5535  O O    . PRO A 1 14 ? 1.603   7.766   2.580   1.00 0.00 ? 14 PRO A O    7  
ATOM 5536  C CB   . PRO A 1 14 ? 4.136   9.127   3.894   1.00 0.00 ? 14 PRO A CB   7  
ATOM 5537  C CG   . PRO A 1 14 ? 3.363   10.419  3.605   1.00 0.00 ? 14 PRO A CG   7  
ATOM 5538  C CD   . PRO A 1 14 ? 3.450   10.579  2.086   1.00 0.00 ? 14 PRO A CD   7  
ATOM 5539  H HA   . PRO A 1 14 ? 4.831   7.661   2.420   1.00 0.00 ? 14 PRO A HA   7  
ATOM 5540  H HB2  . PRO A 1 14 ? 3.800   8.636   4.815   1.00 0.00 ? 14 PRO A HB2  7  
ATOM 5541  H HB3  . PRO A 1 14 ? 5.197   9.373   3.998   1.00 0.00 ? 14 PRO A HB3  7  
ATOM 5542  H HG2  . PRO A 1 14 ? 2.287   10.223  3.859   1.00 0.00 ? 14 PRO A HG2  7  
ATOM 5543  H HG3  . PRO A 1 14 ? 3.863   11.294  4.097   1.00 0.00 ? 14 PRO A HG3  7  
ATOM 5544  H HD2  . PRO A 1 14 ? 2.524   10.995  1.691   1.00 0.00 ? 14 PRO A HD2  7  
ATOM 5545  H HD3  . PRO A 1 14 ? 4.279   11.232  1.808   1.00 0.00 ? 14 PRO A HD3  7  
ATOM 5546  N N    . CYS A 1 15 ? 2.988   6.046   3.138   1.00 0.00 ? 15 CYS A N    7  
ATOM 5547  C CA   . CYS A 1 15 ? 1.830   5.145   3.286   1.00 0.00 ? 15 CYS A CA   7  
ATOM 5548  C C    . CYS A 1 15 ? 0.835   5.693   4.333   1.00 0.00 ? 15 CYS A C    7  
ATOM 5549  O O    . CYS A 1 15 ? 1.185   6.415   5.260   1.00 0.00 ? 15 CYS A O    7  
ATOM 5550  C CB   . CYS A 1 15 ? 2.177   3.701   3.659   1.00 0.00 ? 15 CYS A CB   7  
ATOM 5551  S SG   . CYS A 1 15 ? 2.471   2.578   2.276   1.00 0.00 ? 15 CYS A SG   7  
ATOM 5552  H H    . CYS A 1 15 ? 3.942   5.792   3.330   1.00 0.00 ? 15 CYS A H    7  
ATOM 5553  H HA   . CYS A 1 15 ? 1.279   5.129   2.351   1.00 0.00 ? 15 CYS A HA   7  
ATOM 5554  H HB2  . CYS A 1 15 ? 3.003   3.638   4.335   1.00 0.00 ? 15 CYS A HB2  7  
ATOM 5555  H HB3  . CYS A 1 15 ? 1.349   3.259   4.193   1.00 0.00 ? 15 CYS A HB3  7  
ATOM 5556  N N    . LYS A 1 16 ? -0.432  5.311   4.082   1.00 0.00 ? 16 LYS A N    7  
ATOM 5557  C CA   . LYS A 1 16 ? -1.566  5.763   4.852   1.00 0.00 ? 16 LYS A CA   7  
ATOM 5558  C C    . LYS A 1 16 ? -2.201  4.574   5.583   1.00 0.00 ? 16 LYS A C    7  
ATOM 5559  O O    . LYS A 1 16 ? -2.439  3.511   5.026   1.00 0.00 ? 16 LYS A O    7  
ATOM 5560  C CB   . LYS A 1 16 ? -2.566  6.335   3.830   1.00 0.00 ? 16 LYS A CB   7  
ATOM 5561  C CG   . LYS A 1 16 ? -3.714  7.178   4.432   1.00 0.00 ? 16 LYS A CG   7  
ATOM 5562  C CD   . LYS A 1 16 ? -3.179  8.425   5.158   1.00 0.00 ? 16 LYS A CD   7  
ATOM 5563  C CE   . LYS A 1 16 ? -3.178  8.324   6.687   1.00 0.00 ? 16 LYS A CE   7  
ATOM 5564  N NZ   . LYS A 1 16 ? -4.524  8.078   7.199   1.00 0.00 ? 16 LYS A NZ   7  
ATOM 5565  H H    . LYS A 1 16 ? -0.652  4.697   3.323   1.00 0.00 ? 16 LYS A H    7  
ATOM 5566  H HA   . LYS A 1 16 ? -1.198  6.510   5.558   1.00 0.00 ? 16 LYS A HA   7  
ATOM 5567  H HB2  . LYS A 1 16 ? -2.028  6.992   3.143   1.00 0.00 ? 16 LYS A HB2  7  
ATOM 5568  H HB3  . LYS A 1 16 ? -2.911  5.489   3.219   1.00 0.00 ? 16 LYS A HB3  7  
ATOM 5569  H HG2  . LYS A 1 16 ? -4.367  7.577   3.648   1.00 0.00 ? 16 LYS A HG2  7  
ATOM 5570  H HG3  . LYS A 1 16 ? -4.383  6.574   5.049   1.00 0.00 ? 16 LYS A HG3  7  
ATOM 5571  H HD2  . LYS A 1 16 ? -2.208  8.718   4.740   1.00 0.00 ? 16 LYS A HD2  7  
ATOM 5572  H HD3  . LYS A 1 16 ? -3.840  9.245   4.923   1.00 0.00 ? 16 LYS A HD3  7  
ATOM 5573  H HE2  . LYS A 1 16 ? -2.526  7.528   7.032   1.00 0.00 ? 16 LYS A HE2  7  
ATOM 5574  H HE3  . LYS A 1 16 ? -2.812  9.244   7.145   1.00 0.00 ? 16 LYS A HE3  7  
ATOM 5575  H HZ1  . LYS A 1 16 ? -5.034  8.966   7.376   1.00 0.00 ? 16 LYS A HZ1  7  
ATOM 5576  H HZ2  . LYS A 1 16 ? -4.514  7.464   8.044   1.00 0.00 ? 16 LYS A HZ2  7  
ATOM 5577  H HZ3  . LYS A 1 16 ? -5.111  7.625   6.459   1.00 0.00 ? 16 LYS A HZ3  7  
ATOM 5578  N N    . PHE A 1 17 ? -2.474  4.858   6.863   1.00 0.00 ? 17 PHE A N    7  
ATOM 5579  C CA   . PHE A 1 17 ? -3.166  3.939   7.754   1.00 0.00 ? 17 PHE A CA   7  
ATOM 5580  C C    . PHE A 1 17 ? -4.343  4.777   8.293   1.00 0.00 ? 17 PHE A C    7  
ATOM 5581  O O    . PHE A 1 17 ? -4.153  5.963   8.561   1.00 0.00 ? 17 PHE A O    7  
ATOM 5582  C CB   . PHE A 1 17 ? -2.246  3.511   8.926   1.00 0.00 ? 17 PHE A CB   7  
ATOM 5583  C CG   . PHE A 1 17 ? -0.990  2.771   8.515   1.00 0.00 ? 17 PHE A CG   7  
ATOM 5584  C CD1  . PHE A 1 17 ? -1.050  1.630   7.723   1.00 0.00 ? 17 PHE A CD1  7  
ATOM 5585  C CD2  . PHE A 1 17 ? 0.264   3.199   8.948   1.00 0.00 ? 17 PHE A CD2  7  
ATOM 5586  C CE1  . PHE A 1 17 ? 0.103   0.936   7.384   1.00 0.00 ? 17 PHE A CE1  7  
ATOM 5587  C CE2  . PHE A 1 17 ? 1.418   2.498   8.621   1.00 0.00 ? 17 PHE A CE2  7  
ATOM 5588  C CZ   . PHE A 1 17 ? 1.338   1.351   7.846   1.00 0.00 ? 17 PHE A CZ   7  
ATOM 5589  H H    . PHE A 1 17 ? -2.260  5.776   7.190   1.00 0.00 ? 17 PHE A H    7  
ATOM 5590  H HA   . PHE A 1 17 ? -3.522  3.093   7.164   1.00 0.00 ? 17 PHE A HA   7  
ATOM 5591  H HB2  . PHE A 1 17 ? -1.946  4.403   9.488   1.00 0.00 ? 17 PHE A HB2  7  
ATOM 5592  H HB3  . PHE A 1 17 ? -2.795  2.854   9.617   1.00 0.00 ? 17 PHE A HB3  7  
ATOM 5593  H HD1  . PHE A 1 17 ? -1.999  1.267   7.375   1.00 0.00 ? 17 PHE A HD1  7  
ATOM 5594  H HD2  . PHE A 1 17 ? 0.358   4.081   9.555   1.00 0.00 ? 17 PHE A HD2  7  
ATOM 5595  H HE1  . PHE A 1 17 ? 0.058   0.072   6.750   1.00 0.00 ? 17 PHE A HE1  7  
ATOM 5596  H HE2  . PHE A 1 17 ? 2.378   2.855   8.965   1.00 0.00 ? 17 PHE A HE2  7  
ATOM 5597  H HZ   . PHE A 1 17 ? 2.218   0.768   7.602   1.00 0.00 ? 17 PHE A HZ   7  
ATOM 5598  N N    . PRO A 1 18 ? -5.558  4.184   8.428   1.00 0.00 ? 18 PRO A N    7  
ATOM 5599  C CA   . PRO A 1 18 ? -5.957  2.884   7.888   1.00 0.00 ? 18 PRO A CA   7  
ATOM 5600  C C    . PRO A 1 18 ? -6.211  3.007   6.374   1.00 0.00 ? 18 PRO A C    7  
ATOM 5601  O O    . PRO A 1 18 ? -6.785  3.992   5.933   1.00 0.00 ? 18 PRO A O    7  
ATOM 5602  C CB   . PRO A 1 18 ? -7.310  2.609   8.564   1.00 0.00 ? 18 PRO A CB   7  
ATOM 5603  C CG   . PRO A 1 18 ? -7.886  3.997   8.859   1.00 0.00 ? 18 PRO A CG   7  
ATOM 5604  C CD   . PRO A 1 18 ? -6.656  4.876   9.105   1.00 0.00 ? 18 PRO A CD   7  
ATOM 5605  H HA   . PRO A 1 18 ? -5.219  2.116   8.121   1.00 0.00 ? 18 PRO A HA   7  
ATOM 5606  H HB2  . PRO A 1 18 ? -7.984  1.972   7.988   1.00 0.00 ? 18 PRO A HB2  7  
ATOM 5607  H HB3  . PRO A 1 18 ? -7.149  2.103   9.510   1.00 0.00 ? 18 PRO A HB3  7  
ATOM 5608  H HG2  . PRO A 1 18 ? -8.426  4.359   7.983   1.00 0.00 ? 18 PRO A HG2  7  
ATOM 5609  H HG3  . PRO A 1 18 ? -8.577  3.993   9.702   1.00 0.00 ? 18 PRO A HG3  7  
ATOM 5610  H HD2  . PRO A 1 18 ? -6.797  5.884   8.704   1.00 0.00 ? 18 PRO A HD2  7  
ATOM 5611  H HD3  . PRO A 1 18 ? -6.434  4.934   10.174  1.00 0.00 ? 18 PRO A HD3  7  
ATOM 5612  N N    . PHE A 1 19 ? -5.781  1.984   5.616   1.00 0.00 ? 19 PHE A N    7  
ATOM 5613  C CA   . PHE A 1 19 ? -6.064  1.931   4.184   1.00 0.00 ? 19 PHE A CA   7  
ATOM 5614  C C    . PHE A 1 19 ? -7.069  0.783   3.989   1.00 0.00 ? 19 PHE A C    7  
ATOM 5615  O O    . PHE A 1 19 ? -6.850  -0.332  4.440   1.00 0.00 ? 19 PHE A O    7  
ATOM 5616  C CB   . PHE A 1 19 ? -4.820  1.722   3.297   1.00 0.00 ? 19 PHE A CB   7  
ATOM 5617  C CG   . PHE A 1 19 ? -4.025  0.451   3.610   1.00 0.00 ? 19 PHE A CG   7  
ATOM 5618  C CD1  . PHE A 1 19 ? -3.269  0.264   4.782   1.00 0.00 ? 19 PHE A CD1  7  
ATOM 5619  C CD2  . PHE A 1 19 ? -4.040  -0.584  2.666   1.00 0.00 ? 19 PHE A CD2  7  
ATOM 5620  C CE1  . PHE A 1 19 ? -2.521  -0.888  4.971   1.00 0.00 ? 19 PHE A CE1  7  
ATOM 5621  C CE2  . PHE A 1 19 ? -3.283  -1.759  2.868   1.00 0.00 ? 19 PHE A CE2  7  
ATOM 5622  C CZ   . PHE A 1 19 ? -2.521  -1.890  4.017   1.00 0.00 ? 19 PHE A CZ   7  
ATOM 5623  H H    . PHE A 1 19 ? -5.336  1.199   6.049   1.00 0.00 ? 19 PHE A H    7  
ATOM 5624  H HA   . PHE A 1 19 ? -6.537  2.861   3.876   1.00 0.00 ? 19 PHE A HA   7  
ATOM 5625  H HB2  . PHE A 1 19 ? -5.209  1.624   2.271   1.00 0.00 ? 19 PHE A HB2  7  
ATOM 5626  H HB3  . PHE A 1 19 ? -4.199  2.640   3.274   1.00 0.00 ? 19 PHE A HB3  7  
ATOM 5627  H HD1  . PHE A 1 19 ? -3.220  0.943   5.626   1.00 0.00 ? 19 PHE A HD1  7  
ATOM 5628  H HD2  . PHE A 1 19 ? -4.678  -0.382  1.799   1.00 0.00 ? 19 PHE A HD2  7  
ATOM 5629  H HE1  . PHE A 1 19 ? -1.945  -1.003  5.879   1.00 0.00 ? 19 PHE A HE1  7  
ATOM 5630  H HE2  . PHE A 1 19 ? -3.208  -2.635  2.214   1.00 0.00 ? 19 PHE A HE2  7  
ATOM 5631  H HZ   . PHE A 1 19 ? -1.935  -2.790  4.161   1.00 0.00 ? 19 PHE A HZ   7  
ATOM 5632  N N    . ARG A 1 20 ? -8.194  1.105   3.329   1.00 0.00 ? 20 ARG A N    7  
ATOM 5633  C CA   . ARG A 1 20 ? -9.240  0.107   3.126   1.00 0.00 ? 20 ARG A CA   7  
ATOM 5634  C C    . ARG A 1 20 ? -8.970  -0.669  1.823   1.00 0.00 ? 20 ARG A C    7  
ATOM 5635  O O    . ARG A 1 20 ? -8.966  -0.087  0.744   1.00 0.00 ? 20 ARG A O    7  
ATOM 5636  C CB   . ARG A 1 20 ? -10.606 0.835   3.126   1.00 0.00 ? 20 ARG A CB   7  
ATOM 5637  C CG   . ARG A 1 20 ? -11.852 -0.059  3.074   1.00 0.00 ? 20 ARG A CG   7  
ATOM 5638  C CD   . ARG A 1 20 ? -12.435 -0.244  1.637   1.00 0.00 ? 20 ARG A CD   7  
ATOM 5639  N NE   . ARG A 1 20 ? -12.666 1.016   0.870   1.00 0.00 ? 20 ARG A NE   7  
ATOM 5640  C CZ   . ARG A 1 20 ? -13.690 1.837   1.210   1.00 0.00 ? 20 ARG A CZ   7  
ATOM 5641  N NH1  . ARG A 1 20 ? -14.409 1.594   2.302   1.00 0.00 ? 20 ARG A NH1  7  
ATOM 5642  N NH2  . ARG A 1 20 ? -13.993 2.886   0.453   1.00 0.00 ? 20 ARG A NH2  7  
ATOM 5643  H H    . ARG A 1 20 ? -8.336  2.037   2.991   1.00 0.00 ? 20 ARG A H    7  
ATOM 5644  H HA   . ARG A 1 20 ? -9.192  -0.581  3.967   1.00 0.00 ? 20 ARG A HA   7  
ATOM 5645  H HB2  . ARG A 1 20 ? -10.672 1.414   4.050   1.00 0.00 ? 20 ARG A HB2  7  
ATOM 5646  H HB3  . ARG A 1 20 ? -10.654 1.564   2.320   1.00 0.00 ? 20 ARG A HB3  7  
ATOM 5647  H HG2  . ARG A 1 20 ? -11.613 -1.020  3.530   1.00 0.00 ? 20 ARG A HG2  7  
ATOM 5648  H HG3  . ARG A 1 20 ? -12.594 0.328   3.784   1.00 0.00 ? 20 ARG A HG3  7  
ATOM 5649  H HD2  . ARG A 1 20 ? -11.788 -0.893  1.033   1.00 0.00 ? 20 ARG A HD2  7  
ATOM 5650  H HD3  . ARG A 1 20 ? -13.399 -0.761  1.712   1.00 0.00 ? 20 ARG A HD3  7  
ATOM 5651  H HE   . ARG A 1 20 ? -12.149 1.316   0.034   1.00 0.00 ? 20 ARG A HE   7  
ATOM 5652  H HH11 . ARG A 1 20 ? -14.171 0.801   2.863   1.00 0.00 ? 20 ARG A HH11 7  
ATOM 5653  H HH12 . ARG A 1 20 ? -15.171 2.175   2.580   1.00 0.00 ? 20 ARG A HH12 7  
ATOM 5654  H HH21 . ARG A 1 20 ? -13.476 3.066   -0.397  1.00 0.00 ? 20 ARG A HH21 7  
ATOM 5655  H HH22 . ARG A 1 20 ? -14.725 3.523   0.685   1.00 0.00 ? 20 ARG A HH22 7  
ATOM 5656  N N    . PHE A 1 21 ? -8.756  -1.995  1.986   1.00 0.00 ? 21 PHE A N    7  
ATOM 5657  C CA   . PHE A 1 21 ? -8.551  -2.900  0.854   1.00 0.00 ? 21 PHE A CA   7  
ATOM 5658  C C    . PHE A 1 21 ? -9.471  -4.100  1.099   1.00 0.00 ? 21 PHE A C    7  
ATOM 5659  O O    . PHE A 1 21 ? -9.718  -4.484  2.236   1.00 0.00 ? 21 PHE A O    7  
ATOM 5660  C CB   . PHE A 1 21 ? -7.087  -3.368  0.795   1.00 0.00 ? 21 PHE A CB   7  
ATOM 5661  C CG   . PHE A 1 21 ? -6.836  -4.401  -0.283  1.00 0.00 ? 21 PHE A CG   7  
ATOM 5662  C CD1  . PHE A 1 21 ? -7.343  -4.241  -1.564  1.00 0.00 ? 21 PHE A CD1  7  
ATOM 5663  C CD2  . PHE A 1 21 ? -6.086  -5.535  -0.018  1.00 0.00 ? 21 PHE A CD2  7  
ATOM 5664  C CE1  . PHE A 1 21 ? -7.082  -5.162  -2.569  1.00 0.00 ? 21 PHE A CE1  7  
ATOM 5665  C CE2  . PHE A 1 21 ? -5.812  -6.465  -1.012  1.00 0.00 ? 21 PHE A CE2  7  
ATOM 5666  C CZ   . PHE A 1 21 ? -6.304  -6.276  -2.295  1.00 0.00 ? 21 PHE A CZ   7  
ATOM 5667  H H    . PHE A 1 21 ? -8.761  -2.424  2.903   1.00 0.00 ? 21 PHE A H    7  
ATOM 5668  H HA   . PHE A 1 21 ? -8.852  -2.400  -0.078  1.00 0.00 ? 21 PHE A HA   7  
ATOM 5669  H HB2  . PHE A 1 21 ? -6.435  -2.509  0.608   1.00 0.00 ? 21 PHE A HB2  7  
ATOM 5670  H HB3  . PHE A 1 21 ? -6.817  -3.803  1.764   1.00 0.00 ? 21 PHE A HB3  7  
ATOM 5671  H HD1  . PHE A 1 21 ? -7.966  -3.390  -1.762  1.00 0.00 ? 21 PHE A HD1  7  
ATOM 5672  H HD2  . PHE A 1 21 ? -5.733  -5.696  0.981   1.00 0.00 ? 21 PHE A HD2  7  
ATOM 5673  H HE1  . PHE A 1 21 ? -7.498  -5.012  -3.555  1.00 0.00 ? 21 PHE A HE1  7  
ATOM 5674  H HE2  . PHE A 1 21 ? -5.227  -7.344  -0.782  1.00 0.00 ? 21 PHE A HE2  7  
ATOM 5675  H HZ   . PHE A 1 21 ? -6.092  -7.003  -3.065  1.00 0.00 ? 21 PHE A HZ   7  
ATOM 5676  N N    . GLN A 1 22 ? -9.993  -4.651  -0.012  1.00 0.00 ? 22 GLN A N    7  
ATOM 5677  C CA   . GLN A 1 22 ? -10.931 -5.764  0.053   1.00 0.00 ? 22 GLN A CA   7  
ATOM 5678  C C    . GLN A 1 22 ? -12.135 -5.347  0.945   1.00 0.00 ? 22 GLN A C    7  
ATOM 5679  O O    . GLN A 1 22 ? -12.667 -6.132  1.723   1.00 0.00 ? 22 GLN A O    7  
ATOM 5680  C CB   . GLN A 1 22 ? -10.272 -7.092  0.545   1.00 0.00 ? 22 GLN A CB   7  
ATOM 5681  C CG   . GLN A 1 22 ? -9.249  -7.734  -0.440  1.00 0.00 ? 22 GLN A CG   7  
ATOM 5682  C CD   . GLN A 1 22 ? -8.208  -8.677  0.192   1.00 0.00 ? 22 GLN A CD   7  
ATOM 5683  O OE1  . GLN A 1 22 ? -7.240  -9.056  -0.453  1.00 0.00 ? 22 GLN A OE1  7  
ATOM 5684  N NE2  . GLN A 1 22 ? -8.446  -9.056  1.448   1.00 0.00 ? 22 GLN A NE2  7  
ATOM 5685  H H    . GLN A 1 22 ? -9.775  -4.234  -0.900  1.00 0.00 ? 22 GLN A H    7  
ATOM 5686  H HA   . GLN A 1 22 ? -11.301 -5.868  -0.969  1.00 0.00 ? 22 GLN A HA   7  
ATOM 5687  H HB2  . GLN A 1 22 ? -9.811  -6.897  1.514   1.00 0.00 ? 22 GLN A HB2  7  
ATOM 5688  H HB3  . GLN A 1 22 ? -11.049 -7.841  0.706   1.00 0.00 ? 22 GLN A HB3  7  
ATOM 5689  H HG2  . GLN A 1 22 ? -9.729  -8.406  -1.180  1.00 0.00 ? 22 GLN A HG2  7  
ATOM 5690  H HG3  . GLN A 1 22 ? -8.690  -6.917  -0.921  1.00 0.00 ? 22 GLN A HG3  7  
ATOM 5691  H HE21 . GLN A 1 22 ? -9.225  -8.746  1.985   1.00 0.00 ? 22 GLN A HE21 7  
ATOM 5692  H HE22 . GLN A 1 22 ? -7.758  -9.647  1.882   1.00 0.00 ? 22 GLN A HE22 7  
ATOM 5693  N N    . GLY A 1 23 ? -12.523 -4.051  0.811   1.00 0.00 ? 23 GLY A N    7  
ATOM 5694  C CA   . GLY A 1 23 ? -13.674 -3.563  1.565   1.00 0.00 ? 23 GLY A CA   7  
ATOM 5695  C C    . GLY A 1 23 ? -13.421 -3.391  3.076   1.00 0.00 ? 23 GLY A C    7  
ATOM 5696  O O    . GLY A 1 23 ? -14.319 -3.006  3.812   1.00 0.00 ? 23 GLY A O    7  
ATOM 5697  H H    . GLY A 1 23 ? -12.068 -3.391  0.203   1.00 0.00 ? 23 GLY A H    7  
ATOM 5698  H HA2  . GLY A 1 23 ? -13.977 -2.621  1.107   1.00 0.00 ? 23 GLY A HA2  7  
ATOM 5699  H HA3  . GLY A 1 23 ? -14.481 -4.293  1.433   1.00 0.00 ? 23 GLY A HA3  7  
ATOM 5700  N N    . THR A 1 24 ? -12.190 -3.734  3.503   1.00 0.00 ? 24 THR A N    7  
ATOM 5701  C CA   . THR A 1 24 ? -11.855 -3.795  4.919   1.00 0.00 ? 24 THR A CA   7  
ATOM 5702  C C    . THR A 1 24 ? -10.680 -2.853  5.263   1.00 0.00 ? 24 THR A C    7  
ATOM 5703  O O    . THR A 1 24 ? -9.698  -2.783  4.538   1.00 0.00 ? 24 THR A O    7  
ATOM 5704  C CB   . THR A 1 24 ? -11.478 -5.271  5.126   1.00 0.00 ? 24 THR A CB   7  
ATOM 5705  O OG1  . THR A 1 24 ? -12.503 -6.121  4.628   1.00 0.00 ? 24 THR A OG1  7  
ATOM 5706  C CG2  . THR A 1 24 ? -11.218 -5.630  6.591   1.00 0.00 ? 24 THR A CG2  7  
ATOM 5707  H H    . THR A 1 24 ? -11.456 -4.022  2.884   1.00 0.00 ? 24 THR A H    7  
ATOM 5708  H HA   . THR A 1 24 ? -12.729 -3.531  5.517   1.00 0.00 ? 24 THR A HA   7  
ATOM 5709  H HB   . THR A 1 24 ? -10.564 -5.477  4.568   1.00 0.00 ? 24 THR A HB   7  
ATOM 5710  H HG1  . THR A 1 24 ? -12.624 -6.003  3.680   1.00 0.00 ? 24 THR A HG1  7  
ATOM 5711  H HG21 . THR A 1 24 ? -10.965 -6.686  6.685   1.00 0.00 ? 24 THR A HG21 7  
ATOM 5712  H HG22 . THR A 1 24 ? -12.097 -5.439  7.206   1.00 0.00 ? 24 THR A HG22 7  
ATOM 5713  H HG23 . THR A 1 24 ? -10.384 -5.058  7.000   1.00 0.00 ? 24 THR A HG23 7  
ATOM 5714  N N    . SER A 1 25 ? -10.822 -2.142  6.400   1.00 0.00 ? 25 SER A N    7  
ATOM 5715  C CA   . SER A 1 25 ? -9.789  -1.219  6.874   1.00 0.00 ? 25 SER A CA   7  
ATOM 5716  C C    . SER A 1 25 ? -8.560  -1.990  7.399   1.00 0.00 ? 25 SER A C    7  
ATOM 5717  O O    . SER A 1 25 ? -8.691  -2.869  8.241   1.00 0.00 ? 25 SER A O    7  
ATOM 5718  C CB   . SER A 1 25 ? -10.398 -0.364  7.992   1.00 0.00 ? 25 SER A CB   7  
ATOM 5719  O OG   . SER A 1 25 ? -11.783 -0.191  7.713   1.00 0.00 ? 25 SER A OG   7  
ATOM 5720  H H    . SER A 1 25 ? -11.644 -2.183  6.968   1.00 0.00 ? 25 SER A H    7  
ATOM 5721  H HA   . SER A 1 25 ? -9.513  -0.581  6.038   1.00 0.00 ? 25 SER A HA   7  
ATOM 5722  H HB2  . SER A 1 25 ? -10.269 -0.848  8.967   1.00 0.00 ? 25 SER A HB2  7  
ATOM 5723  H HB3  . SER A 1 25 ? -9.884  0.602   8.038   1.00 0.00 ? 25 SER A HB3  7  
ATOM 5724  H HG   . SER A 1 25 ? -12.196 0.371   8.367   1.00 0.00 ? 25 SER A HG   7  
ATOM 5725  N N    . TYR A 1 26 ? -7.380  -1.628  6.857   1.00 0.00 ? 26 TYR A N    7  
ATOM 5726  C CA   . TYR A 1 26 ? -6.118  -2.256  7.242   1.00 0.00 ? 26 TYR A CA   7  
ATOM 5727  C C    . TYR A 1 26 ? -5.239  -1.169  7.889   1.00 0.00 ? 26 TYR A C    7  
ATOM 5728  O O    . TYR A 1 26 ? -5.080  -0.090  7.334   1.00 0.00 ? 26 TYR A O    7  
ATOM 5729  C CB   . TYR A 1 26 ? -5.324  -2.736  6.010   1.00 0.00 ? 26 TYR A CB   7  
ATOM 5730  C CG   . TYR A 1 26 ? -5.854  -3.897  5.205   1.00 0.00 ? 26 TYR A CG   7  
ATOM 5731  C CD1  . TYR A 1 26 ? -7.170  -4.352  5.244   1.00 0.00 ? 26 TYR A CD1  7  
ATOM 5732  C CD2  . TYR A 1 26 ? -4.969  -4.544  4.353   1.00 0.00 ? 26 TYR A CD2  7  
ATOM 5733  C CE1  . TYR A 1 26 ? -7.569  -5.425  4.463   1.00 0.00 ? 26 TYR A CE1  7  
ATOM 5734  C CE2  . TYR A 1 26 ? -5.373  -5.611  3.574   1.00 0.00 ? 26 TYR A CE2  7  
ATOM 5735  C CZ   . TYR A 1 26 ? -6.672  -6.066  3.639   1.00 0.00 ? 26 TYR A CZ   7  
ATOM 5736  O OH   . TYR A 1 26 ? -7.080  -7.144  2.891   1.00 0.00 ? 26 TYR A OH   7  
ATOM 5737  H H    . TYR A 1 26 ? -7.327  -0.912  6.159   1.00 0.00 ? 26 TYR A H    7  
ATOM 5738  H HA   . TYR A 1 26 ? -6.294  -3.065  7.953   1.00 0.00 ? 26 TYR A HA   7  
ATOM 5739  H HB2  . TYR A 1 26 ? -5.193  -1.905  5.312   1.00 0.00 ? 26 TYR A HB2  7  
ATOM 5740  H HB3  . TYR A 1 26 ? -4.335  -3.054  6.363   1.00 0.00 ? 26 TYR A HB3  7  
ATOM 5741  H HD1  . TYR A 1 26 ? -7.920  -3.893  5.856   1.00 0.00 ? 26 TYR A HD1  7  
ATOM 5742  H HD2  . TYR A 1 26 ? -3.950  -4.212  4.283   1.00 0.00 ? 26 TYR A HD2  7  
ATOM 5743  H HE1  . TYR A 1 26 ? -8.581  -5.770  4.465   1.00 0.00 ? 26 TYR A HE1  7  
ATOM 5744  H HE2  . TYR A 1 26 ? -4.690  -6.086  2.895   1.00 0.00 ? 26 TYR A HE2  7  
ATOM 5745  H HH   . TYR A 1 26 ? -6.492  -7.892  3.049   1.00 0.00 ? 26 TYR A HH   7  
ATOM 5746  N N    . ASP A 1 27 ? -4.652  -1.518  9.048   1.00 0.00 ? 27 ASP A N    7  
ATOM 5747  C CA   . ASP A 1 27 ? -3.787  -0.582  9.774   1.00 0.00 ? 27 ASP A CA   7  
ATOM 5748  C C    . ASP A 1 27 ? -2.361  -1.140  9.899   1.00 0.00 ? 27 ASP A C    7  
ATOM 5749  O O    . ASP A 1 27 ? -1.655  -0.875  10.863  1.00 0.00 ? 27 ASP A O    7  
ATOM 5750  C CB   . ASP A 1 27 ? -4.376  -0.338  11.175  1.00 0.00 ? 27 ASP A CB   7  
ATOM 5751  C CG   . ASP A 1 27 ? -5.652  0.504   11.088  1.00 0.00 ? 27 ASP A CG   7  
ATOM 5752  O OD1  . ASP A 1 27 ? -6.706  -0.052  10.778  1.00 0.00 ? 27 ASP A OD1  7  
ATOM 5753  O OD2  . ASP A 1 27 ? -5.573  1.708   11.323  1.00 0.00 ? 27 ASP A OD2  7  
ATOM 5754  H H    . ASP A 1 27 ? -4.861  -2.407  9.450   1.00 0.00 ? 27 ASP A H    7  
ATOM 5755  H HA   . ASP A 1 27 ? -3.717  0.362   9.229   1.00 0.00 ? 27 ASP A HA   7  
ATOM 5756  H HB2  . ASP A 1 27 ? -4.597  -1.278  11.681  1.00 0.00 ? 27 ASP A HB2  7  
ATOM 5757  H HB3  . ASP A 1 27 ? -3.666  0.199   11.808  1.00 0.00 ? 27 ASP A HB3  7  
ATOM 5758  N N    . SER A 1 28 ? -1.960  -1.943  8.892   1.00 0.00 ? 28 SER A N    7  
ATOM 5759  C CA   . SER A 1 28 ? -0.619  -2.509  8.970   1.00 0.00 ? 28 SER A CA   7  
ATOM 5760  C C    . SER A 1 28 ? -0.231  -3.090  7.603   1.00 0.00 ? 28 SER A C    7  
ATOM 5761  O O    . SER A 1 28 ? -1.068  -3.328  6.739   1.00 0.00 ? 28 SER A O    7  
ATOM 5762  C CB   . SER A 1 28 ? -0.584  -3.601  10.071  1.00 0.00 ? 28 SER A CB   7  
ATOM 5763  O OG   . SER A 1 28 ? -1.549  -4.607  9.817   1.00 0.00 ? 28 SER A OG   7  
ATOM 5764  H H    . SER A 1 28 ? -2.531  -2.150  8.098   1.00 0.00 ? 28 SER A H    7  
ATOM 5765  H HA   . SER A 1 28 ? 0.077   -1.689  9.174   1.00 0.00 ? 28 SER A HA   7  
ATOM 5766  H HB2  . SER A 1 28 ? 0.401   -4.105  10.070  1.00 0.00 ? 28 SER A HB2  7  
ATOM 5767  H HB3  . SER A 1 28 ? -0.799  -3.170  11.075  1.00 0.00 ? 28 SER A HB3  7  
ATOM 5768  H HG   . SER A 1 28 ? -2.403  -4.209  9.685   1.00 0.00 ? 28 SER A HG   7  
ATOM 5769  N N    . CYS A 1 29 ? 1.092   -3.305  7.496   1.00 0.00 ? 29 CYS A N    7  
ATOM 5770  C CA   . CYS A 1 29 ? 1.728   -3.882  6.317   1.00 0.00 ? 29 CYS A CA   7  
ATOM 5771  C C    . CYS A 1 29 ? 1.130   -5.253  5.919   1.00 0.00 ? 29 CYS A C    7  
ATOM 5772  O O    . CYS A 1 29 ? 1.165   -6.180  6.720   1.00 0.00 ? 29 CYS A O    7  
ATOM 5773  C CB   . CYS A 1 29 ? 3.183   -4.129  6.726   1.00 0.00 ? 29 CYS A CB   7  
ATOM 5774  S SG   . CYS A 1 29 ? 3.971   -2.671  7.448   1.00 0.00 ? 29 CYS A SG   7  
ATOM 5775  H H    . CYS A 1 29 ? 1.692   -3.014  8.247   1.00 0.00 ? 29 CYS A H    7  
ATOM 5776  H HA   . CYS A 1 29 ? 1.663   -3.148  5.516   1.00 0.00 ? 29 CYS A HA   7  
ATOM 5777  H HB2  . CYS A 1 29 ? 3.244   -4.929  7.474   1.00 0.00 ? 29 CYS A HB2  7  
ATOM 5778  H HB3  . CYS A 1 29 ? 3.745   -4.441  5.842   1.00 0.00 ? 29 CYS A HB3  7  
ATOM 5779  N N    . THR A 1 30 ? 0.623   -5.378  4.672   1.00 0.00 ? 30 THR A N    7  
ATOM 5780  C CA   . THR A 1 30 ? 0.071   -6.666  4.238   1.00 0.00 ? 30 THR A CA   7  
ATOM 5781  C C    . THR A 1 30 ? 0.865   -7.163  3.029   1.00 0.00 ? 30 THR A C    7  
ATOM 5782  O O    . THR A 1 30 ? 1.641   -6.434  2.433   1.00 0.00 ? 30 THR A O    7  
ATOM 5783  C CB   . THR A 1 30 ? -1.424  -6.529  3.889   1.00 0.00 ? 30 THR A CB   7  
ATOM 5784  O OG1  . THR A 1 30 ? -1.902  -7.832  3.576   1.00 0.00 ? 30 THR A OG1  7  
ATOM 5785  C CG2  . THR A 1 30 ? -1.655  -5.589  2.685   1.00 0.00 ? 30 THR A CG2  7  
ATOM 5786  H H    . THR A 1 30 ? 0.623   -4.639  3.987   1.00 0.00 ? 30 THR A H    7  
ATOM 5787  H HA   . THR A 1 30 ? 0.183   -7.404  5.034   1.00 0.00 ? 30 THR A HA   7  
ATOM 5788  H HB   . THR A 1 30 ? -1.925  -6.147  4.793   1.00 0.00 ? 30 THR A HB   7  
ATOM 5789  H HG1  . THR A 1 30 ? -2.865  -7.875  3.621   1.00 0.00 ? 30 THR A HG1  7  
ATOM 5790  H HG21 . THR A 1 30 ? -2.707  -5.427  2.468   1.00 0.00 ? 30 THR A HG21 7  
ATOM 5791  H HG22 . THR A 1 30 ? -1.216  -6.005  1.778   1.00 0.00 ? 30 THR A HG22 7  
ATOM 5792  H HG23 . THR A 1 30 ? -1.204  -4.608  2.835   1.00 0.00 ? 30 THR A HG23 7  
ATOM 5793  N N    . THR A 1 31 ? 0.598   -8.434  2.696   1.00 0.00 ? 31 THR A N    7  
ATOM 5794  C CA   . THR A 1 31 ? 1.174   -9.069  1.514   1.00 0.00 ? 31 THR A CA   7  
ATOM 5795  C C    . THR A 1 31 ? 0.053   -9.525  0.553   1.00 0.00 ? 31 THR A C    7  
ATOM 5796  O O    . THR A 1 31 ? 0.321   -10.097 -0.495  1.00 0.00 ? 31 THR A O    7  
ATOM 5797  C CB   . THR A 1 31 ? 2.070   -10.251 1.954   1.00 0.00 ? 31 THR A CB   7  
ATOM 5798  O OG1  . THR A 1 31 ? 2.101   -10.351 3.365   1.00 0.00 ? 31 THR A OG1  7  
ATOM 5799  C CG2  . THR A 1 31 ? 3.497   -10.142 1.394   1.00 0.00 ? 31 THR A CG2  7  
ATOM 5800  H H    . THR A 1 31 ? -0.041  -8.923  3.294   1.00 0.00 ? 31 THR A H    7  
ATOM 5801  H HA   . THR A 1 31 ? 1.766   -8.328  0.973   1.00 0.00 ? 31 THR A HA   7  
ATOM 5802  H HB   . THR A 1 31 ? 1.651   -11.196 1.596   1.00 0.00 ? 31 THR A HB   7  
ATOM 5803  H HG1  . THR A 1 31 ? 2.399   -9.524  3.719   1.00 0.00 ? 31 THR A HG1  7  
ATOM 5804  H HG21 . THR A 1 31 ? 3.490   -10.177 0.304   1.00 0.00 ? 31 THR A HG21 7  
ATOM 5805  H HG22 . THR A 1 31 ? 4.123   -10.962 1.748   1.00 0.00 ? 31 THR A HG22 7  
ATOM 5806  H HG23 . THR A 1 31 ? 3.980   -9.208  1.678   1.00 0.00 ? 31 THR A HG23 7  
ATOM 5807  N N    . GLU A 1 32 ? -1.215  -9.264  0.945   1.00 0.00 ? 32 GLU A N    7  
ATOM 5808  C CA   . GLU A 1 32 ? -2.334  -9.695  0.111   1.00 0.00 ? 32 GLU A CA   7  
ATOM 5809  C C    . GLU A 1 32 ? -2.261  -9.024  -1.270  1.00 0.00 ? 32 GLU A C    7  
ATOM 5810  O O    . GLU A 1 32 ? -2.354  -7.810  -1.389  1.00 0.00 ? 32 GLU A O    7  
ATOM 5811  C CB   . GLU A 1 32 ? -3.646  -9.322  0.813   1.00 0.00 ? 32 GLU A CB   7  
ATOM 5812  C CG   . GLU A 1 32 ? -3.890  -10.151 2.087   1.00 0.00 ? 32 GLU A CG   7  
ATOM 5813  C CD   . GLU A 1 32 ? -4.943  -9.460  2.957   1.00 0.00 ? 32 GLU A CD   7  
ATOM 5814  O OE1  . GLU A 1 32 ? -4.597  -8.501  3.639   1.00 0.00 ? 32 GLU A OE1  7  
ATOM 5815  O OE2  . GLU A 1 32 ? -6.105  -9.854  2.937   1.00 0.00 ? 32 GLU A OE2  7  
ATOM 5816  H H    . GLU A 1 32 ? -1.449  -8.774  1.787   1.00 0.00 ? 32 GLU A H    7  
ATOM 5817  H HA   . GLU A 1 32 ? -2.257  -10.779 0.003   1.00 0.00 ? 32 GLU A HA   7  
ATOM 5818  H HB2  . GLU A 1 32 ? -3.627  -8.255  1.043   1.00 0.00 ? 32 GLU A HB2  7  
ATOM 5819  H HB3  . GLU A 1 32 ? -4.496  -9.466  0.143   1.00 0.00 ? 32 GLU A HB3  7  
ATOM 5820  H HG2  . GLU A 1 32 ? -4.233  -11.154 1.830   1.00 0.00 ? 32 GLU A HG2  7  
ATOM 5821  H HG3  . GLU A 1 32 ? -2.982  -10.273 2.676   1.00 0.00 ? 32 GLU A HG3  7  
ATOM 5822  N N    . GLY A 1 33 ? -2.084  -9.883  -2.291  1.00 0.00 ? 33 GLY A N    7  
ATOM 5823  C CA   . GLY A 1 33 ? -2.011  -9.405  -3.669  1.00 0.00 ? 33 GLY A CA   7  
ATOM 5824  C C    . GLY A 1 33 ? -0.597  -9.485  -4.259  1.00 0.00 ? 33 GLY A C    7  
ATOM 5825  O O    . GLY A 1 33 ? -0.427  -9.313  -5.458  1.00 0.00 ? 33 GLY A O    7  
ATOM 5826  H H    . GLY A 1 33 ? -2.002  -10.859 -2.091  1.00 0.00 ? 33 GLY A H    7  
ATOM 5827  H HA2  . GLY A 1 33 ? -2.671  -10.051 -4.254  1.00 0.00 ? 33 GLY A HA2  7  
ATOM 5828  H HA3  . GLY A 1 33 ? -2.371  -8.373  -3.730  1.00 0.00 ? 33 GLY A HA3  7  
ATOM 5829  N N    . ARG A 1 34 ? 0.400   -9.755  -3.390  1.00 0.00 ? 34 ARG A N    7  
ATOM 5830  C CA   . ARG A 1 34 ? 1.775   -9.862  -3.921  1.00 0.00 ? 34 ARG A CA   7  
ATOM 5831  C C    . ARG A 1 34 ? 2.323   -11.267 -3.649  1.00 0.00 ? 34 ARG A C    7  
ATOM 5832  O O    . ARG A 1 34 ? 2.218   -11.796 -2.551  1.00 0.00 ? 34 ARG A O    7  
ATOM 5833  C CB   . ARG A 1 34 ? 2.692   -8.856  -3.220  1.00 0.00 ? 34 ARG A CB   7  
ATOM 5834  C CG   . ARG A 1 34 ? 2.281   -7.401  -3.483  1.00 0.00 ? 34 ARG A CG   7  
ATOM 5835  C CD   . ARG A 1 34 ? 3.448   -6.429  -3.216  1.00 0.00 ? 34 ARG A CD   7  
ATOM 5836  N NE   . ARG A 1 34 ? 4.370   -6.468  -4.364  1.00 0.00 ? 34 ARG A NE   7  
ATOM 5837  C CZ   . ARG A 1 34 ? 4.315   -5.582  -5.385  1.00 0.00 ? 34 ARG A CZ   7  
ATOM 5838  N NH1  . ARG A 1 34 ? 3.400   -4.620  -5.391  1.00 0.00 ? 34 ARG A NH1  7  
ATOM 5839  N NH2  . ARG A 1 34 ? 5.185   -5.681  -6.380  1.00 0.00 ? 34 ARG A NH2  7  
ATOM 5840  H H    . ARG A 1 34 ? 0.192   -9.887  -2.402  1.00 0.00 ? 34 ARG A H    7  
ATOM 5841  H HA   . ARG A 1 34 ? 1.828   -9.674  -5.016  1.00 0.00 ? 34 ARG A HA   7  
ATOM 5842  H HB2  . ARG A 1 34 ? 2.662   -9.042  -2.118  1.00 0.00 ? 34 ARG A HB2  7  
ATOM 5843  H HB3  . ARG A 1 34 ? 3.697   -9.010  -3.669  1.00 0.00 ? 34 ARG A HB3  7  
ATOM 5844  H HG2  . ARG A 1 34 ? 1.952   -7.287  -4.517  1.00 0.00 ? 34 ARG A HG2  7  
ATOM 5845  H HG3  . ARG A 1 34 ? 1.400   -7.171  -2.879  1.00 0.00 ? 34 ARG A HG3  7  
ATOM 5846  H HD2  . ARG A 1 34 ? 3.099   -5.400  -3.070  1.00 0.00 ? 34 ARG A HD2  7  
ATOM 5847  H HD3  . ARG A 1 34 ? 4.019   -6.713  -2.320  1.00 0.00 ? 34 ARG A HD3  7  
ATOM 5848  H HE   . ARG A 1 34 ? 5.063   -7.206  -4.453  1.00 0.00 ? 34 ARG A HE   7  
ATOM 5849  H HH11 . ARG A 1 34 ? 2.701   -4.612  -4.679  1.00 0.00 ? 34 ARG A HH11 7  
ATOM 5850  H HH12 . ARG A 1 34 ? 3.378   -3.879  -6.081  1.00 0.00 ? 34 ARG A HH12 7  
ATOM 5851  H HH21 . ARG A 1 34 ? 5.843   -6.450  -6.352  1.00 0.00 ? 34 ARG A HH21 7  
ATOM 5852  H HH22 . ARG A 1 34 ? 5.207   -5.042  -7.145  1.00 0.00 ? 34 ARG A HH22 7  
ATOM 5853  N N    . THR A 1 35 ? 2.949   -11.805 -4.710  1.00 0.00 ? 35 THR A N    7  
ATOM 5854  C CA   . THR A 1 35 ? 3.561   -13.129 -4.652  1.00 0.00 ? 35 THR A CA   7  
ATOM 5855  C C    . THR A 1 35 ? 5.085   -13.015 -4.856  1.00 0.00 ? 35 THR A C    7  
ATOM 5856  O O    . THR A 1 35 ? 5.752   -13.979 -5.206  1.00 0.00 ? 35 THR A O    7  
ATOM 5857  C CB   . THR A 1 35 ? 2.910   -14.017 -5.733  1.00 0.00 ? 35 THR A CB   7  
ATOM 5858  O OG1  . THR A 1 35 ? 1.551   -13.621 -5.848  1.00 0.00 ? 35 THR A OG1  7  
ATOM 5859  C CG2  . THR A 1 35 ? 3.008   -15.512 -5.380  1.00 0.00 ? 35 THR A CG2  7  
ATOM 5860  H H    . THR A 1 35 ? 2.956   -11.310 -5.577  1.00 0.00 ? 35 THR A H    7  
ATOM 5861  H HA   . THR A 1 35 ? 3.381   -13.556 -3.664  1.00 0.00 ? 35 THR A HA   7  
ATOM 5862  H HB   . THR A 1 35 ? 3.414   -13.833 -6.690  1.00 0.00 ? 35 THR A HB   7  
ATOM 5863  H HG1  . THR A 1 35 ? 1.094   -14.154 -6.490  1.00 0.00 ? 35 THR A HG1  7  
ATOM 5864  H HG21 . THR A 1 35 ? 4.044   -15.811 -5.221  1.00 0.00 ? 35 THR A HG21 7  
ATOM 5865  H HG22 . THR A 1 35 ? 2.613   -16.148 -6.172  1.00 0.00 ? 35 THR A HG22 7  
ATOM 5866  H HG23 . THR A 1 35 ? 2.458   -15.733 -4.465  1.00 0.00 ? 35 THR A HG23 7  
ATOM 5867  N N    . ASP A 1 36 ? 5.593   -11.786 -4.617  1.00 0.00 ? 36 ASP A N    7  
ATOM 5868  C CA   . ASP A 1 36 ? 7.015   -11.493 -4.802  1.00 0.00 ? 36 ASP A CA   7  
ATOM 5869  C C    . ASP A 1 36 ? 7.777   -11.374 -3.463  1.00 0.00 ? 36 ASP A C    7  
ATOM 5870  O O    . ASP A 1 36 ? 8.997   -11.257 -3.449  1.00 0.00 ? 36 ASP A O    7  
ATOM 5871  C CB   . ASP A 1 36 ? 7.165   -10.218 -5.653  1.00 0.00 ? 36 ASP A CB   7  
ATOM 5872  C CG   . ASP A 1 36 ? 6.510   -8.961  -5.055  1.00 0.00 ? 36 ASP A CG   7  
ATOM 5873  O OD1  . ASP A 1 36 ? 6.068   -8.976  -3.907  1.00 0.00 ? 36 ASP A OD1  7  
ATOM 5874  O OD2  . ASP A 1 36 ? 6.435   -7.956  -5.755  1.00 0.00 ? 36 ASP A OD2  7  
ATOM 5875  H H    . ASP A 1 36 ? 5.010   -11.013 -4.364  1.00 0.00 ? 36 ASP A H    7  
ATOM 5876  H HA   . ASP A 1 36 ? 7.477   -12.319 -5.345  1.00 0.00 ? 36 ASP A HA   7  
ATOM 5877  H HB2  . ASP A 1 36 ? 8.219   -10.003 -5.827  1.00 0.00 ? 36 ASP A HB2  7  
ATOM 5878  H HB3  . ASP A 1 36 ? 6.713   -10.386 -6.630  1.00 0.00 ? 36 ASP A HB3  7  
ATOM 5879  N N    . GLY A 1 37 ? 7.015   -11.463 -2.347  1.00 0.00 ? 37 GLY A N    7  
ATOM 5880  C CA   . GLY A 1 37 ? 7.636   -11.471 -1.026  1.00 0.00 ? 37 GLY A CA   7  
ATOM 5881  C C    . GLY A 1 37 ? 7.653   -10.117 -0.313  1.00 0.00 ? 37 GLY A C    7  
ATOM 5882  O O    . GLY A 1 37 ? 8.156   -10.030 0.799   1.00 0.00 ? 37 GLY A O    7  
ATOM 5883  H H    . GLY A 1 37 ? 6.025   -11.550 -2.411  1.00 0.00 ? 37 GLY A H    7  
ATOM 5884  H HA2  . GLY A 1 37 ? 7.083   -12.191 -0.420  1.00 0.00 ? 37 GLY A HA2  7  
ATOM 5885  H HA3  . GLY A 1 37 ? 8.677   -11.798 -1.129  1.00 0.00 ? 37 GLY A HA3  7  
ATOM 5886  N N    . TYR A 1 38 ? 7.130   -9.070  -0.982  1.00 0.00 ? 38 TYR A N    7  
ATOM 5887  C CA   . TYR A 1 38 ? 7.227   -7.725  -0.397  1.00 0.00 ? 38 TYR A CA   7  
ATOM 5888  C C    . TYR A 1 38 ? 5.892   -7.330  0.245   1.00 0.00 ? 38 TYR A C    7  
ATOM 5889  O O    . TYR A 1 38 ? 4.825   -7.644  -0.271  1.00 0.00 ? 38 TYR A O    7  
ATOM 5890  C CB   . TYR A 1 38 ? 7.692   -6.746  -1.495  1.00 0.00 ? 38 TYR A CB   7  
ATOM 5891  C CG   . TYR A 1 38 ? 8.829   -7.338  -2.295  1.00 0.00 ? 38 TYR A CG   7  
ATOM 5892  C CD1  . TYR A 1 38 ? 9.844   -8.069  -1.691  1.00 0.00 ? 38 TYR A CD1  7  
ATOM 5893  C CD2  . TYR A 1 38 ? 8.862   -7.232  -3.674  1.00 0.00 ? 38 TYR A CD2  7  
ATOM 5894  C CE1  . TYR A 1 38 ? 10.801  -8.723  -2.429  1.00 0.00 ? 38 TYR A CE1  7  
ATOM 5895  C CE2  . TYR A 1 38 ? 9.821   -7.882  -4.418  1.00 0.00 ? 38 TYR A CE2  7  
ATOM 5896  C CZ   . TYR A 1 38 ? 10.790  -8.651  -3.806  1.00 0.00 ? 38 TYR A CZ   7  
ATOM 5897  O OH   . TYR A 1 38 ? 11.705  -9.356  -4.554  1.00 0.00 ? 38 TYR A OH   7  
ATOM 5898  H H    . TYR A 1 38 ? 6.726   -9.174  -1.896  1.00 0.00 ? 38 TYR A H    7  
ATOM 5899  H HA   . TYR A 1 38 ? 7.978   -7.740  0.394   1.00 0.00 ? 38 TYR A HA   7  
ATOM 5900  H HB2  . TYR A 1 38 ? 6.862   -6.534  -2.171  1.00 0.00 ? 38 TYR A HB2  7  
ATOM 5901  H HB3  . TYR A 1 38 ? 7.999   -5.790  -1.070  1.00 0.00 ? 38 TYR A HB3  7  
ATOM 5902  H HD1  . TYR A 1 38 ? 9.913   -8.197  -0.636  1.00 0.00 ? 38 TYR A HD1  7  
ATOM 5903  H HD2  . TYR A 1 38 ? 8.136   -6.682  -4.227  1.00 0.00 ? 38 TYR A HD2  7  
ATOM 5904  H HE1  . TYR A 1 38 ? 11.511  -9.298  -1.880  1.00 0.00 ? 38 TYR A HE1  7  
ATOM 5905  H HE2  . TYR A 1 38 ? 9.751   -7.786  -5.474  1.00 0.00 ? 38 TYR A HE2  7  
ATOM 5906  H HH   . TYR A 1 38 ? 11.402  -10.256 -4.589  1.00 0.00 ? 38 TYR A HH   7  
ATOM 5907  N N    . ARG A 1 39 ? 6.002   -6.651  1.403   1.00 0.00 ? 39 ARG A N    7  
ATOM 5908  C CA   . ARG A 1 39 ? 4.757   -6.230  2.088   1.00 0.00 ? 39 ARG A CA   7  
ATOM 5909  C C    . ARG A 1 39 ? 4.463   -4.784  1.646   1.00 0.00 ? 39 ARG A C    7  
ATOM 5910  O O    . ARG A 1 39 ? 5.349   -3.936  1.626   1.00 0.00 ? 39 ARG A O    7  
ATOM 5911  C CB   . ARG A 1 39 ? 4.957   -6.312  3.613   1.00 0.00 ? 39 ARG A CB   7  
ATOM 5912  C CG   . ARG A 1 39 ? 5.347   -7.705  4.120   1.00 0.00 ? 39 ARG A CG   7  
ATOM 5913  C CD   . ARG A 1 39 ? 5.308   -7.776  5.676   1.00 0.00 ? 39 ARG A CD   7  
ATOM 5914  N NE   . ARG A 1 39 ? 3.980   -7.588  6.318   1.00 0.00 ? 39 ARG A NE   7  
ATOM 5915  C CZ   . ARG A 1 39 ? 3.713   -8.094  7.552   1.00 0.00 ? 39 ARG A CZ   7  
ATOM 5916  N NH1  . ARG A 1 39 ? 4.653   -8.690  8.275   1.00 0.00 ? 39 ARG A NH1  7  
ATOM 5917  N NH2  . ARG A 1 39 ? 2.490   -7.977  8.060   1.00 0.00 ? 39 ARG A NH2  7  
ATOM 5918  H H    . ARG A 1 39 ? 6.959   -6.418  1.704   1.00 0.00 ? 39 ARG A H    7  
ATOM 5919  H HA   . ARG A 1 39 ? 3.883   -6.863  1.807   1.00 0.00 ? 39 ARG A HA   7  
ATOM 5920  H HB2  . ARG A 1 39 ? 5.723   -5.597  3.924   1.00 0.00 ? 39 ARG A HB2  7  
ATOM 5921  H HB3  . ARG A 1 39 ? 4.045   -6.019  4.120   1.00 0.00 ? 39 ARG A HB3  7  
ATOM 5922  H HG2  . ARG A 1 39 ? 4.700   -8.473  3.676   1.00 0.00 ? 39 ARG A HG2  7  
ATOM 5923  H HG3  . ARG A 1 39 ? 6.368   -7.915  3.735   1.00 0.00 ? 39 ARG A HG3  7  
ATOM 5924  H HD2  . ARG A 1 39 ? 5.696   -8.748  5.990   1.00 0.00 ? 39 ARG A HD2  7  
ATOM 5925  H HD3  . ARG A 1 39 ? 5.947   -7.002  6.108   1.00 0.00 ? 39 ARG A HD3  7  
ATOM 5926  H HE   . ARG A 1 39 ? 3.223   -7.024  5.971   1.00 0.00 ? 39 ARG A HE   7  
ATOM 5927  H HH11 . ARG A 1 39 ? 5.624   -8.594  7.996   1.00 0.00 ? 39 ARG A HH11 7  
ATOM 5928  H HH12 . ARG A 1 39 ? 4.473   -9.190  9.117   1.00 0.00 ? 39 ARG A HH12 7  
ATOM 5929  H HH21 . ARG A 1 39 ? 1.783   -7.459  7.558   1.00 0.00 ? 39 ARG A HH21 7  
ATOM 5930  H HH22 . ARG A 1 39 ? 2.247   -8.373  8.943   1.00 0.00 ? 39 ARG A HH22 7  
ATOM 5931  N N    . TRP A 1 40 ? 3.191   -4.542  1.272   1.00 0.00 ? 40 TRP A N    7  
ATOM 5932  C CA   . TRP A 1 40 ? 2.764   -3.236  0.800   1.00 0.00 ? 40 TRP A CA   7  
ATOM 5933  C C    . TRP A 1 40 ? 1.731   -2.648  1.773   1.00 0.00 ? 40 TRP A C    7  
ATOM 5934  O O    . TRP A 1 40 ? 1.123   -3.347  2.580   1.00 0.00 ? 40 TRP A O    7  
ATOM 5935  C CB   . TRP A 1 40 ? 2.197   -3.340  -0.629  1.00 0.00 ? 40 TRP A CB   7  
ATOM 5936  C CG   . TRP A 1 40 ? 0.890   -4.113  -0.660  1.00 0.00 ? 40 TRP A CG   7  
ATOM 5937  C CD1  . TRP A 1 40 ? 0.760   -5.503  -0.754  1.00 0.00 ? 40 TRP A CD1  7  
ATOM 5938  C CD2  . TRP A 1 40 ? -0.456  -3.585  -0.615  1.00 0.00 ? 40 TRP A CD2  7  
ATOM 5939  N NE1  . TRP A 1 40 ? -0.550  -5.831  -0.782  1.00 0.00 ? 40 TRP A NE1  7  
ATOM 5940  C CE2  . TRP A 1 40 ? -1.329  -4.692  -0.699  1.00 0.00 ? 40 TRP A CE2  7  
ATOM 5941  C CE3  . TRP A 1 40 ? -0.976  -2.322  -0.510  1.00 0.00 ? 40 TRP A CE3  7  
ATOM 5942  C CZ2  . TRP A 1 40 ? -2.680  -4.511  -0.673  1.00 0.00 ? 40 TRP A CZ2  7  
ATOM 5943  C CZ3  . TRP A 1 40 ? -2.363  -2.126  -0.481  1.00 0.00 ? 40 TRP A CZ3  7  
ATOM 5944  C CH2  . TRP A 1 40 ? -3.214  -3.230  -0.565  1.00 0.00 ? 40 TRP A CH2  7  
ATOM 5945  H H    . TRP A 1 40 ? 2.484   -5.247  1.335   1.00 0.00 ? 40 TRP A H    7  
ATOM 5946  H HA   . TRP A 1 40 ? 3.646   -2.607  0.787   1.00 0.00 ? 40 TRP A HA   7  
ATOM 5947  H HB2  . TRP A 1 40 ? 2.049   -2.348  -1.050  1.00 0.00 ? 40 TRP A HB2  7  
ATOM 5948  H HB3  . TRP A 1 40 ? 2.919   -3.810  -1.295  1.00 0.00 ? 40 TRP A HB3  7  
ATOM 5949  H HD1  . TRP A 1 40 ? 1.566   -6.217  -0.774  1.00 0.00 ? 40 TRP A HD1  7  
ATOM 5950  H HE1  . TRP A 1 40 ? -0.930  -6.735  -0.869  1.00 0.00 ? 40 TRP A HE1  7  
ATOM 5951  H HE3  . TRP A 1 40 ? -0.291  -1.492  -0.435  1.00 0.00 ? 40 TRP A HE3  7  
ATOM 5952  H HZ2  . TRP A 1 40 ? -3.324  -5.374  -0.741  1.00 0.00 ? 40 TRP A HZ2  7  
ATOM 5953  H HZ3  . TRP A 1 40 ? -2.798  -1.135  -0.394  1.00 0.00 ? 40 TRP A HZ3  7  
ATOM 5954  H HH2  . TRP A 1 40 ? -4.287  -3.111  -0.540  1.00 0.00 ? 40 TRP A HH2  7  
ATOM 5955  N N    . CYS A 1 41 ? 1.575   -1.320  1.637   1.00 0.00 ? 41 CYS A N    7  
ATOM 5956  C CA   . CYS A 1 41 ? 0.604   -0.574  2.406   1.00 0.00 ? 41 CYS A CA   7  
ATOM 5957  C C    . CYS A 1 41 ? -0.041  0.456   1.456   1.00 0.00 ? 41 CYS A C    7  
ATOM 5958  O O    . CYS A 1 41 ? 0.578   0.898   0.495   1.00 0.00 ? 41 CYS A O    7  
ATOM 5959  C CB   . CYS A 1 41 ? 1.311   -0.023  3.642   1.00 0.00 ? 41 CYS A CB   7  
ATOM 5960  S SG   . CYS A 1 41 ? 2.873   0.851   3.288   1.00 0.00 ? 41 CYS A SG   7  
ATOM 5961  H H    . CYS A 1 41 ? 2.087   -0.754  0.987   1.00 0.00 ? 41 CYS A H    7  
ATOM 5962  H HA   . CYS A 1 41 ? -0.188  -1.260  2.709   1.00 0.00 ? 41 CYS A HA   7  
ATOM 5963  H HB2  . CYS A 1 41 ? 0.579   0.628   4.184   1.00 0.00 ? 41 CYS A HB2  7  
ATOM 5964  H HB3  . CYS A 1 41 ? 1.660   -0.929  4.203   1.00 0.00 ? 41 CYS A HB3  7  
ATOM 5965  N N    . GLY A 1 42 ? -1.324  0.764   1.725   1.00 0.00 ? 42 GLY A N    7  
ATOM 5966  C CA   . GLY A 1 42 ? -2.069  1.685   0.865   1.00 0.00 ? 42 GLY A CA   7  
ATOM 5967  C C    . GLY A 1 42 ? -1.612  3.133   1.096   1.00 0.00 ? 42 GLY A C    7  
ATOM 5968  O O    . GLY A 1 42 ? -0.896  3.411   2.048   1.00 0.00 ? 42 GLY A O    7  
ATOM 5969  H H    . GLY A 1 42 ? -1.773  0.373   2.529   1.00 0.00 ? 42 GLY A H    7  
ATOM 5970  H HA2  . GLY A 1 42 ? -1.945  1.372   -0.175  1.00 0.00 ? 42 GLY A HA2  7  
ATOM 5971  H HA3  . GLY A 1 42 ? -3.120  1.595   1.145   1.00 0.00 ? 42 GLY A HA3  7  
ATOM 5972  N N    . THR A 1 43 ? -2.078  4.039   0.204   1.00 0.00 ? 43 THR A N    7  
ATOM 5973  C CA   . THR A 1 43 ? -1.720  5.458   0.358   1.00 0.00 ? 43 THR A CA   7  
ATOM 5974  C C    . THR A 1 43 ? -2.931  6.378   0.510   1.00 0.00 ? 43 THR A C    7  
ATOM 5975  O O    . THR A 1 43 ? -2.811  7.593   0.432   1.00 0.00 ? 43 THR A O    7  
ATOM 5976  C CB   . THR A 1 43 ? -0.773  5.932   -0.764  1.00 0.00 ? 43 THR A CB   7  
ATOM 5977  O OG1  . THR A 1 43 ? -0.531  4.915   -1.713  1.00 0.00 ? 43 THR A OG1  7  
ATOM 5978  C CG2  . THR A 1 43 ? 0.589   6.337   -0.199  1.00 0.00 ? 43 THR A CG2  7  
ATOM 5979  H H    . THR A 1 43 ? -2.640  3.739   -0.567  1.00 0.00 ? 43 THR A H    7  
ATOM 5980  H HA   . THR A 1 43 ? -1.239  5.583   1.320   1.00 0.00 ? 43 THR A HA   7  
ATOM 5981  H HB   . THR A 1 43 ? -1.180  6.805   -1.288  1.00 0.00 ? 43 THR A HB   7  
ATOM 5982  H HG1  . THR A 1 43 ? -1.354  4.491   -1.946  1.00 0.00 ? 43 THR A HG1  7  
ATOM 5983  H HG21 . THR A 1 43 ? 0.476   7.000   0.656   1.00 0.00 ? 43 THR A HG21 7  
ATOM 5984  H HG22 . THR A 1 43 ? 1.168   6.878   -0.939  1.00 0.00 ? 43 THR A HG22 7  
ATOM 5985  H HG23 . THR A 1 43 ? 1.169   5.467   0.114   1.00 0.00 ? 43 THR A HG23 7  
ATOM 5986  N N    . THR A 1 44 ? -4.083  5.748   0.765   1.00 0.00 ? 44 THR A N    7  
ATOM 5987  C CA   . THR A 1 44 ? -5.295  6.502   1.010   1.00 0.00 ? 44 THR A CA   7  
ATOM 5988  C C    . THR A 1 44 ? -6.143  5.617   1.913   1.00 0.00 ? 44 THR A C    7  
ATOM 5989  O O    . THR A 1 44 ? -5.899  4.420   2.041   1.00 0.00 ? 44 THR A O    7  
ATOM 5990  C CB   . THR A 1 44 ? -6.051  6.775   -0.304  1.00 0.00 ? 44 THR A CB   7  
ATOM 5991  O OG1  . THR A 1 44 ? -6.331  5.517   -0.895  1.00 0.00 ? 44 THR A OG1  7  
ATOM 5992  C CG2  . THR A 1 44 ? -5.257  7.672   -1.265  1.00 0.00 ? 44 THR A CG2  7  
ATOM 5993  H H    . THR A 1 44 ? -4.181  4.755   0.834   1.00 0.00 ? 44 THR A H    7  
ATOM 5994  H HA   . THR A 1 44 ? -5.047  7.425   1.537   1.00 0.00 ? 44 THR A HA   7  
ATOM 5995  H HB   . THR A 1 44 ? -6.986  7.292   -0.054  1.00 0.00 ? 44 THR A HB   7  
ATOM 5996  H HG1  . THR A 1 44 ? -6.961  5.601   -1.624  1.00 0.00 ? 44 THR A HG1  7  
ATOM 5997  H HG21 . THR A 1 44 ? -4.424  7.135   -1.719  1.00 0.00 ? 44 THR A HG21 7  
ATOM 5998  H HG22 . THR A 1 44 ? -4.854  8.540   -0.743  1.00 0.00 ? 44 THR A HG22 7  
ATOM 5999  H HG23 . THR A 1 44 ? -5.880  8.053   -2.070  1.00 0.00 ? 44 THR A HG23 7  
ATOM 6000  N N    . GLU A 1 45 ? -7.184  6.259   2.465   1.00 0.00 ? 45 GLU A N    7  
ATOM 6001  C CA   . GLU A 1 45 ? -8.156  5.539   3.272   1.00 0.00 ? 45 GLU A CA   7  
ATOM 6002  C C    . GLU A 1 45 ? -8.907  4.486   2.426   1.00 0.00 ? 45 GLU A C    7  
ATOM 6003  O O    . GLU A 1 45 ? -9.508  3.572   2.971   1.00 0.00 ? 45 GLU A O    7  
ATOM 6004  C CB   . GLU A 1 45 ? -9.142  6.487   3.994   1.00 0.00 ? 45 GLU A CB   7  
ATOM 6005  C CG   . GLU A 1 45 ? -8.493  7.278   5.151   1.00 0.00 ? 45 GLU A CG   7  
ATOM 6006  C CD   . GLU A 1 45 ? -7.325  8.201   4.762   1.00 0.00 ? 45 GLU A CD   7  
ATOM 6007  O OE1  . GLU A 1 45 ? -7.339  8.771   3.672   1.00 0.00 ? 45 GLU A OE1  7  
ATOM 6008  O OE2  . GLU A 1 45 ? -6.400  8.333   5.563   1.00 0.00 ? 45 GLU A OE2  7  
ATOM 6009  H H    . GLU A 1 45 ? -7.262  7.253   2.363   1.00 0.00 ? 45 GLU A H    7  
ATOM 6010  H HA   . GLU A 1 45 ? -7.583  5.002   4.021   1.00 0.00 ? 45 GLU A HA   7  
ATOM 6011  H HB2  . GLU A 1 45 ? -9.614  7.215   3.274   1.00 0.00 ? 45 GLU A HB2  7  
ATOM 6012  H HB3  . GLU A 1 45 ? -9.861  5.802   4.514   1.00 0.00 ? 45 GLU A HB3  7  
ATOM 6013  H HG2  . GLU A 1 45 ? -9.249  7.892   5.641   1.00 0.00 ? 45 GLU A HG2  7  
ATOM 6014  H HG3  . GLU A 1 45 ? -8.134  6.572   5.903   1.00 0.00 ? 45 GLU A HG3  7  
ATOM 6015  N N    . ASP A 1 46 ? -8.842  4.657   1.085   1.00 0.00 ? 46 ASP A N    7  
ATOM 6016  C CA   . ASP A 1 46 ? -9.480  3.722   0.155   1.00 0.00 ? 46 ASP A CA   7  
ATOM 6017  C C    . ASP A 1 46 ? -8.471  3.280   -0.920  1.00 0.00 ? 46 ASP A C    7  
ATOM 6018  O O    . ASP A 1 46 ? -8.245  3.953   -1.920  1.00 0.00 ? 46 ASP A O    7  
ATOM 6019  C CB   . ASP A 1 46 ? -10.748 4.335   -0.473  1.00 0.00 ? 46 ASP A CB   7  
ATOM 6020  C CG   . ASP A 1 46 ? -11.545 3.311   -1.293  1.00 0.00 ? 46 ASP A CG   7  
ATOM 6021  O OD1  . ASP A 1 46 ? -11.129 2.162   -1.415  1.00 0.00 ? 46 ASP A OD1  7  
ATOM 6022  O OD2  . ASP A 1 46 ? -12.621 3.656   -1.767  1.00 0.00 ? 46 ASP A OD2  7  
ATOM 6023  H H    . ASP A 1 46 ? -8.282  5.407   0.735   1.00 0.00 ? 46 ASP A H    7  
ATOM 6024  H HA   . ASP A 1 46 ? -9.765  2.836   0.725   1.00 0.00 ? 46 ASP A HA   7  
ATOM 6025  H HB2  . ASP A 1 46 ? -11.400 4.698   0.322   1.00 0.00 ? 46 ASP A HB2  7  
ATOM 6026  H HB3  . ASP A 1 46 ? -10.537 5.193   -1.112  1.00 0.00 ? 46 ASP A HB3  7  
ATOM 6027  N N    . TYR A 1 47 ? -7.886  2.096   -0.664  1.00 0.00 ? 47 TYR A N    7  
ATOM 6028  C CA   . TYR A 1 47 ? -6.927  1.567   -1.635  1.00 0.00 ? 47 TYR A CA   7  
ATOM 6029  C C    . TYR A 1 47 ? -7.661  1.033   -2.869  1.00 0.00 ? 47 TYR A C    7  
ATOM 6030  O O    . TYR A 1 47 ? -7.091  0.877   -3.951  1.00 0.00 ? 47 TYR A O    7  
ATOM 6031  C CB   . TYR A 1 47 ? -6.134  0.407   -1.015  1.00 0.00 ? 47 TYR A CB   7  
ATOM 6032  C CG   . TYR A 1 47 ? -5.205  -0.198  -2.032  1.00 0.00 ? 47 TYR A CG   7  
ATOM 6033  C CD1  . TYR A 1 47 ? -4.116  0.514   -2.503  1.00 0.00 ? 47 TYR A CD1  7  
ATOM 6034  C CD2  . TYR A 1 47 ? -5.438  -1.466  -2.539  1.00 0.00 ? 47 TYR A CD2  7  
ATOM 6035  C CE1  . TYR A 1 47 ? -3.258  -0.046  -3.431  1.00 0.00 ? 47 TYR A CE1  7  
ATOM 6036  C CE2  . TYR A 1 47 ? -4.564  -2.044  -3.444  1.00 0.00 ? 47 TYR A CE2  7  
ATOM 6037  C CZ   . TYR A 1 47 ? -3.468  -1.330  -3.897  1.00 0.00 ? 47 TYR A CZ   7  
ATOM 6038  O OH   . TYR A 1 47 ? -2.597  -1.881  -4.808  1.00 0.00 ? 47 TYR A OH   7  
ATOM 6039  H H    . TYR A 1 47 ? -8.183  1.580   0.151   1.00 0.00 ? 47 TYR A H    7  
ATOM 6040  H HA   . TYR A 1 47 ? -6.254  2.371   -1.972  1.00 0.00 ? 47 TYR A HA   7  
ATOM 6041  H HB2  . TYR A 1 47 ? -5.555  0.762   -0.162  1.00 0.00 ? 47 TYR A HB2  7  
ATOM 6042  H HB3  . TYR A 1 47 ? -6.802  -0.379  -0.645  1.00 0.00 ? 47 TYR A HB3  7  
ATOM 6043  H HD1  . TYR A 1 47 ? -3.951  1.519   -2.170  1.00 0.00 ? 47 TYR A HD1  7  
ATOM 6044  H HD2  . TYR A 1 47 ? -6.328  -1.989  -2.248  1.00 0.00 ? 47 TYR A HD2  7  
ATOM 6045  H HE1  . TYR A 1 47 ? -2.426  0.528   -3.787  1.00 0.00 ? 47 TYR A HE1  7  
ATOM 6046  H HE2  . TYR A 1 47 ? -4.736  -3.053  -3.770  1.00 0.00 ? 47 TYR A HE2  7  
ATOM 6047  H HH   . TYR A 1 47 ? -2.102  -2.575  -4.388  1.00 0.00 ? 47 TYR A HH   7  
ATOM 6048  N N    . ASP A 1 48 ? -8.943  0.702   -2.656  1.00 0.00 ? 48 ASP A N    7  
ATOM 6049  C CA   . ASP A 1 48 ? -9.674  0.174   -3.790  1.00 0.00 ? 48 ASP A CA   7  
ATOM 6050  C C    . ASP A 1 48 ? -9.958  1.244   -4.843  1.00 0.00 ? 48 ASP A C    7  
ATOM 6051  O O    . ASP A 1 48 ? -9.795  1.005   -6.032  1.00 0.00 ? 48 ASP A O    7  
ATOM 6052  C CB   . ASP A 1 48 ? -10.807 -0.799  -3.422  1.00 0.00 ? 48 ASP A CB   7  
ATOM 6053  C CG   . ASP A 1 48 ? -10.180 -2.131  -2.938  1.00 0.00 ? 48 ASP A CG   7  
ATOM 6054  O OD1  . ASP A 1 48 ? -9.263  -2.628  -3.610  1.00 0.00 ? 48 ASP A OD1  7  
ATOM 6055  O OD2  . ASP A 1 48 ? -10.595 -2.652  -1.904  1.00 0.00 ? 48 ASP A OD2  7  
ATOM 6056  H H    . ASP A 1 48 ? -9.397  0.850   -1.772  1.00 0.00 ? 48 ASP A H    7  
ATOM 6057  H HA   . ASP A 1 48 ? -8.983  -0.441  -4.332  1.00 0.00 ? 48 ASP A HA   7  
ATOM 6058  H HB2  . ASP A 1 48 ? -11.484 -0.384  -2.669  1.00 0.00 ? 48 ASP A HB2  7  
ATOM 6059  H HB3  . ASP A 1 48 ? -11.377 -1.059  -4.318  1.00 0.00 ? 48 ASP A HB3  7  
ATOM 6060  N N    . ARG A 1 49 ? -10.340 2.432   -4.365  1.00 0.00 ? 49 ARG A N    7  
ATOM 6061  C CA   . ARG A 1 49 ? -10.537 3.520   -5.318  1.00 0.00 ? 49 ARG A CA   7  
ATOM 6062  C C    . ARG A 1 49 ? -9.203  3.939   -6.003  1.00 0.00 ? 49 ARG A C    7  
ATOM 6063  O O    . ARG A 1 49 ? -9.132  4.069   -7.218  1.00 0.00 ? 49 ARG A O    7  
ATOM 6064  C CB   . ARG A 1 49 ? -11.222 4.687   -4.569  1.00 0.00 ? 49 ARG A CB   7  
ATOM 6065  C CG   . ARG A 1 49 ? -11.435 6.009   -5.332  1.00 0.00 ? 49 ARG A CG   7  
ATOM 6066  C CD   . ARG A 1 49 ? -11.525 7.236   -4.344  1.00 0.00 ? 49 ARG A CD   7  
ATOM 6067  N NE   . ARG A 1 49 ? -10.178 7.673   -3.980  1.00 0.00 ? 49 ARG A NE   7  
ATOM 6068  C CZ   . ARG A 1 49 ? -9.924  8.792   -3.269  1.00 0.00 ? 49 ARG A CZ   7  
ATOM 6069  N NH1  . ARG A 1 49 ? -10.920 9.569   -2.851  1.00 0.00 ? 49 ARG A NH1  7  
ATOM 6070  N NH2  . ARG A 1 49 ? -8.665  9.102   -2.994  1.00 0.00 ? 49 ARG A NH2  7  
ATOM 6071  H H    . ARG A 1 49 ? -10.475 2.537   -3.374  1.00 0.00 ? 49 ARG A H    7  
ATOM 6072  H HA   . ARG A 1 49 ? -11.206 3.141   -6.098  1.00 0.00 ? 49 ARG A HA   7  
ATOM 6073  H HB2  . ARG A 1 49 ? -12.185 4.289   -4.238  1.00 0.00 ? 49 ARG A HB2  7  
ATOM 6074  H HB3  . ARG A 1 49 ? -10.669 4.956   -3.675  1.00 0.00 ? 49 ARG A HB3  7  
ATOM 6075  H HG2  . ARG A 1 49 ? -10.609 6.143   -6.048  1.00 0.00 ? 49 ARG A HG2  7  
ATOM 6076  H HG3  . ARG A 1 49 ? -12.331 5.870   -5.953  1.00 0.00 ? 49 ARG A HG3  7  
ATOM 6077  H HD2  . ARG A 1 49 ? -12.031 8.130   -4.733  1.00 0.00 ? 49 ARG A HD2  7  
ATOM 6078  H HD3  . ARG A 1 49 ? -12.009 7.003   -3.383  1.00 0.00 ? 49 ARG A HD3  7  
ATOM 6079  H HE   . ARG A 1 49 ? -9.371  7.116   -4.212  1.00 0.00 ? 49 ARG A HE   7  
ATOM 6080  H HH11 . ARG A 1 49 ? -11.859 9.306   -3.066  1.00 0.00 ? 49 ARG A HH11 7  
ATOM 6081  H HH12 . ARG A 1 49 ? -10.753 10.404  -2.329  1.00 0.00 ? 49 ARG A HH12 7  
ATOM 6082  H HH21 . ARG A 1 49 ? -7.953  8.453   -3.321  1.00 0.00 ? 49 ARG A HH21 7  
ATOM 6083  H HH22 . ARG A 1 49 ? -8.384  9.916   -2.494  1.00 0.00 ? 49 ARG A HH22 7  
ATOM 6084  N N    . ASP A 1 50 ? -8.178  4.194   -5.166  1.00 0.00 ? 50 ASP A N    7  
ATOM 6085  C CA   . ASP A 1 50 ? -6.923  4.764   -5.680  1.00 0.00 ? 50 ASP A CA   7  
ATOM 6086  C C    . ASP A 1 50 ? -5.928  3.820   -6.403  1.00 0.00 ? 50 ASP A C    7  
ATOM 6087  O O    . ASP A 1 50 ? -5.294  4.240   -7.363  1.00 0.00 ? 50 ASP A O    7  
ATOM 6088  C CB   . ASP A 1 50 ? -6.184  5.455   -4.522  1.00 0.00 ? 50 ASP A CB   7  
ATOM 6089  C CG   . ASP A 1 50 ? -7.010  6.643   -4.024  1.00 0.00 ? 50 ASP A CG   7  
ATOM 6090  O OD1  . ASP A 1 50 ? -6.933  7.721   -4.605  1.00 0.00 ? 50 ASP A OD1  7  
ATOM 6091  O OD2  . ASP A 1 50 ? -7.746  6.514   -3.055  1.00 0.00 ? 50 ASP A OD2  7  
ATOM 6092  H H    . ASP A 1 50 ? -8.303  4.090   -4.174  1.00 0.00 ? 50 ASP A H    7  
ATOM 6093  H HA   . ASP A 1 50 ? -7.172  5.546   -6.401  1.00 0.00 ? 50 ASP A HA   7  
ATOM 6094  H HB2  . ASP A 1 50 ? -6.017  4.731   -3.704  1.00 0.00 ? 50 ASP A HB2  7  
ATOM 6095  H HB3  . ASP A 1 50 ? -5.240  5.898   -4.879  1.00 0.00 ? 50 ASP A HB3  7  
ATOM 6096  N N    . LYS A 1 51 ? -5.719  2.595   -5.869  1.00 0.00 ? 51 LYS A N    7  
ATOM 6097  C CA   . LYS A 1 51 ? -4.688  1.692   -6.405  1.00 0.00 ? 51 LYS A CA   7  
ATOM 6098  C C    . LYS A 1 51 ? -3.268  2.314   -6.412  1.00 0.00 ? 51 LYS A C    7  
ATOM 6099  O O    . LYS A 1 51 ? -2.457  2.094   -7.306  1.00 0.00 ? 51 LYS A O    7  
ATOM 6100  C CB   . LYS A 1 51 ? -5.041  1.073   -7.783  1.00 0.00 ? 51 LYS A CB   7  
ATOM 6101  C CG   . LYS A 1 51 ? -5.918  -0.206  -7.668  1.00 0.00 ? 51 LYS A CG   7  
ATOM 6102  C CD   . LYS A 1 51 ? -7.319  -0.017  -7.084  1.00 0.00 ? 51 LYS A CD   7  
ATOM 6103  C CE   . LYS A 1 51 ? -7.863  -1.317  -6.479  1.00 0.00 ? 51 LYS A CE   7  
ATOM 6104  N NZ   . LYS A 1 51 ? -7.270  -1.585  -5.167  1.00 0.00 ? 51 LYS A NZ   7  
ATOM 6105  H H    . LYS A 1 51 ? -6.290  2.240   -5.129  1.00 0.00 ? 51 LYS A H    7  
ATOM 6106  H HA   . LYS A 1 51 ? -4.557  0.921   -5.650  1.00 0.00 ? 51 LYS A HA   7  
ATOM 6107  H HB2  . LYS A 1 51 ? -5.583  1.851   -8.387  1.00 0.00 ? 51 LYS A HB2  7  
ATOM 6108  H HB3  . LYS A 1 51 ? -4.062  0.699   -8.205  1.00 0.00 ? 51 LYS A HB3  7  
ATOM 6109  H HG2  . LYS A 1 51 ? -6.108  -0.658  -8.641  1.00 0.00 ? 51 LYS A HG2  7  
ATOM 6110  H HG3  . LYS A 1 51 ? -5.367  -0.973  -7.118  1.00 0.00 ? 51 LYS A HG3  7  
ATOM 6111  H HD2  . LYS A 1 51 ? -7.350  0.770   -6.338  1.00 0.00 ? 51 LYS A HD2  7  
ATOM 6112  H HD3  . LYS A 1 51 ? -7.987  0.327   -7.876  1.00 0.00 ? 51 LYS A HD3  7  
ATOM 6113  H HE2  . LYS A 1 51 ? -8.944  -1.239  -6.346  1.00 0.00 ? 51 LYS A HE2  7  
ATOM 6114  H HE3  . LYS A 1 51 ? -7.694  -2.178  -7.128  1.00 0.00 ? 51 LYS A HE3  7  
ATOM 6115  H HZ1  . LYS A 1 51 ? -6.334  -2.024  -5.248  1.00 0.00 ? 51 LYS A HZ1  7  
ATOM 6116  H HZ2  . LYS A 1 51 ? -7.921  -2.191  -4.606  1.00 0.00 ? 51 LYS A HZ2  7  
ATOM 6117  H HZ3  . LYS A 1 51 ? -7.171  -0.672  -4.660  1.00 0.00 ? 51 LYS A HZ3  7  
ATOM 6118  N N    . LYS A 1 52 ? -3.004  3.057   -5.326  1.00 0.00 ? 52 LYS A N    7  
ATOM 6119  C CA   . LYS A 1 52 ? -1.674  3.603   -5.097  1.00 0.00 ? 52 LYS A CA   7  
ATOM 6120  C C    . LYS A 1 52 ? -1.248  3.032   -3.742  1.00 0.00 ? 52 LYS A C    7  
ATOM 6121  O O    . LYS A 1 52 ? -2.032  3.022   -2.793  1.00 0.00 ? 52 LYS A O    7  
ATOM 6122  C CB   . LYS A 1 52 ? -1.650  5.148   -5.024  1.00 0.00 ? 52 LYS A CB   7  
ATOM 6123  C CG   . LYS A 1 52 ? -1.258  5.845   -6.339  1.00 0.00 ? 52 LYS A CG   7  
ATOM 6124  C CD   . LYS A 1 52 ? -2.240  5.693   -7.512  1.00 0.00 ? 52 LYS A CD   7  
ATOM 6125  C CE   . LYS A 1 52 ? -3.464  6.618   -7.412  1.00 0.00 ? 52 LYS A CE   7  
ATOM 6126  N NZ   . LYS A 1 52 ? -3.133  8.045   -7.412  1.00 0.00 ? 52 LYS A NZ   7  
ATOM 6127  H H    . LYS A 1 52 ? -3.702  3.160   -4.619  1.00 0.00 ? 52 LYS A H    7  
ATOM 6128  H HA   . LYS A 1 52 ? -0.977  3.196   -5.835  1.00 0.00 ? 52 LYS A HA   7  
ATOM 6129  H HB2  . LYS A 1 52 ? -2.573  5.548   -4.603  1.00 0.00 ? 52 LYS A HB2  7  
ATOM 6130  H HB3  . LYS A 1 52 ? -0.833  5.455   -4.371  1.00 0.00 ? 52 LYS A HB3  7  
ATOM 6131  H HG2  . LYS A 1 52 ? -1.079  6.900   -6.132  1.00 0.00 ? 52 LYS A HG2  7  
ATOM 6132  H HG3  . LYS A 1 52 ? -0.280  5.472   -6.654  1.00 0.00 ? 52 LYS A HG3  7  
ATOM 6133  H HD2  . LYS A 1 52 ? -1.655  6.016   -8.423  1.00 0.00 ? 52 LYS A HD2  7  
ATOM 6134  H HD3  . LYS A 1 52 ? -2.634  4.637   -7.498  1.00 0.00 ? 52 LYS A HD3  7  
ATOM 6135  H HE2  . LYS A 1 52 ? -4.139  6.431   -8.251  1.00 0.00 ? 52 LYS A HE2  7  
ATOM 6136  H HE3  . LYS A 1 52 ? -4.035  6.406   -6.511  1.00 0.00 ? 52 LYS A HE3  7  
ATOM 6137  H HZ1  . LYS A 1 52 ? -2.557  8.318   -8.244  1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 6138  H HZ2  . LYS A 1 52 ? -2.494  8.310   -6.626  1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 6139  H HZ3  . LYS A 1 52 ? -3.973  8.650   -7.368  1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 6140  N N    . TYR A 1 53 ? 0.005   2.552   -3.710  1.00 0.00 ? 53 TYR A N    7  
ATOM 6141  C CA   . TYR A 1 53 ? 0.568   1.928   -2.534  1.00 0.00 ? 53 TYR A CA   7  
ATOM 6142  C C    . TYR A 1 53 ? 2.072   2.175   -2.496  1.00 0.00 ? 53 TYR A C    7  
ATOM 6143  O O    . TYR A 1 53 ? 2.710   2.537   -3.476  1.00 0.00 ? 53 TYR A O    7  
ATOM 6144  C CB   . TYR A 1 53 ? 0.337   0.402   -2.601  1.00 0.00 ? 53 TYR A CB   7  
ATOM 6145  C CG   . TYR A 1 53 ? 1.100   -0.290  -3.710  1.00 0.00 ? 53 TYR A CG   7  
ATOM 6146  C CD1  . TYR A 1 53 ? 2.382   -0.783  -3.482  1.00 0.00 ? 53 TYR A CD1  7  
ATOM 6147  C CD2  . TYR A 1 53 ? 0.546   -0.458  -4.972  1.00 0.00 ? 53 TYR A CD2  7  
ATOM 6148  C CE1  . TYR A 1 53 ? 3.079   -1.450  -4.476  1.00 0.00 ? 53 TYR A CE1  7  
ATOM 6149  C CE2  . TYR A 1 53 ? 1.233   -1.137  -5.970  1.00 0.00 ? 53 TYR A CE2  7  
ATOM 6150  C CZ   . TYR A 1 53 ? 2.501   -1.642  -5.720  1.00 0.00 ? 53 TYR A CZ   7  
ATOM 6151  O OH   . TYR A 1 53 ? 3.195   -2.349  -6.688  1.00 0.00 ? 53 TYR A OH   7  
ATOM 6152  H H    . TYR A 1 53 ? 0.627   2.600   -4.492  1.00 0.00 ? 53 TYR A H    7  
ATOM 6153  H HA   . TYR A 1 53 ? 0.120   2.408   -1.661  1.00 0.00 ? 53 TYR A HA   7  
ATOM 6154  H HB2  . TYR A 1 53 ? 0.642   -0.056  -1.667  1.00 0.00 ? 53 TYR A HB2  7  
ATOM 6155  H HB3  . TYR A 1 53 ? -0.720  0.169   -2.685  1.00 0.00 ? 53 TYR A HB3  7  
ATOM 6156  H HD1  . TYR A 1 53 ? 2.852   -0.634  -2.525  1.00 0.00 ? 53 TYR A HD1  7  
ATOM 6157  H HD2  . TYR A 1 53 ? -0.421  -0.041  -5.191  1.00 0.00 ? 53 TYR A HD2  7  
ATOM 6158  H HE1  . TYR A 1 53 ? 4.073   -1.815  -4.270  1.00 0.00 ? 53 TYR A HE1  7  
ATOM 6159  H HE2  . TYR A 1 53 ? 0.754   -1.263  -6.928  1.00 0.00 ? 53 TYR A HE2  7  
ATOM 6160  H HH   . TYR A 1 53 ? 3.193   -1.843  -7.495  1.00 0.00 ? 53 TYR A HH   7  
ATOM 6161  N N    . GLY A 1 54 ? 2.593   1.888   -1.304  1.00 0.00 ? 54 GLY A N    7  
ATOM 6162  C CA   . GLY A 1 54 ? 4.029   1.944   -1.074  1.00 0.00 ? 54 GLY A CA   7  
ATOM 6163  C C    . GLY A 1 54 ? 4.449   0.598   -0.462  1.00 0.00 ? 54 GLY A C    7  
ATOM 6164  O O    . GLY A 1 54 ? 3.595   -0.246  -0.199  1.00 0.00 ? 54 GLY A O    7  
ATOM 6165  H H    . GLY A 1 54 ? 1.942   1.586   -0.596  1.00 0.00 ? 54 GLY A H    7  
ATOM 6166  H HA2  . GLY A 1 54 ? 4.548   2.142   -2.012  1.00 0.00 ? 54 GLY A HA2  7  
ATOM 6167  H HA3  . GLY A 1 54 ? 4.198   2.778   -0.398  1.00 0.00 ? 54 GLY A HA3  7  
ATOM 6168  N N    . PHE A 1 55 ? 5.772   0.431   -0.221  1.00 0.00 ? 55 PHE A N    7  
ATOM 6169  C CA   . PHE A 1 55 ? 6.236   -0.779  0.453   1.00 0.00 ? 55 PHE A CA   7  
ATOM 6170  C C    . PHE A 1 55 ? 6.325   -0.375  1.927   1.00 0.00 ? 55 PHE A C    7  
ATOM 6171  O O    . PHE A 1 55 ? 6.589   0.774   2.262   1.00 0.00 ? 55 PHE A O    7  
ATOM 6172  C CB   . PHE A 1 55 ? 7.552   -1.356  -0.098  1.00 0.00 ? 55 PHE A CB   7  
ATOM 6173  C CG   . PHE A 1 55 ? 7.380   -1.864  -1.505  1.00 0.00 ? 55 PHE A CG   7  
ATOM 6174  C CD1  . PHE A 1 55 ? 6.464   -2.872  -1.786  1.00 0.00 ? 55 PHE A CD1  7  
ATOM 6175  C CD2  . PHE A 1 55 ? 8.125   -1.330  -2.547  1.00 0.00 ? 55 PHE A CD2  7  
ATOM 6176  C CE1  . PHE A 1 55 ? 6.277   -3.313  -3.087  1.00 0.00 ? 55 PHE A CE1  7  
ATOM 6177  C CE2  . PHE A 1 55 ? 7.941   -1.770  -3.850  1.00 0.00 ? 55 PHE A CE2  7  
ATOM 6178  C CZ   . PHE A 1 55 ? 7.013   -2.763  -4.124  1.00 0.00 ? 55 PHE A CZ   7  
ATOM 6179  H H    . PHE A 1 55 ? 6.463   1.125   -0.431  1.00 0.00 ? 55 PHE A H    7  
ATOM 6180  H HA   . PHE A 1 55 ? 5.471   -1.536  0.337   1.00 0.00 ? 55 PHE A HA   7  
ATOM 6181  H HB2  . PHE A 1 55 ? 8.355   -0.618  -0.073  1.00 0.00 ? 55 PHE A HB2  7  
ATOM 6182  H HB3  . PHE A 1 55 ? 7.850   -2.217  0.513   1.00 0.00 ? 55 PHE A HB3  7  
ATOM 6183  H HD1  . PHE A 1 55 ? 5.898   -3.322  -0.984  1.00 0.00 ? 55 PHE A HD1  7  
ATOM 6184  H HD2  . PHE A 1 55 ? 8.860   -0.566  -2.346  1.00 0.00 ? 55 PHE A HD2  7  
ATOM 6185  H HE1  . PHE A 1 55 ? 5.551   -4.081  -3.285  1.00 0.00 ? 55 PHE A HE1  7  
ATOM 6186  H HE2  . PHE A 1 55 ? 8.515   -1.323  -4.647  1.00 0.00 ? 55 PHE A HE2  7  
ATOM 6187  H HZ   . PHE A 1 55 ? 6.868   -3.101  -5.139  1.00 0.00 ? 55 PHE A HZ   7  
ATOM 6188  N N    . CYS A 1 56 ? 5.948   -1.356  2.757   1.00 0.00 ? 56 CYS A N    7  
ATOM 6189  C CA   . CYS A 1 56 ? 5.739   -1.040  4.185   1.00 0.00 ? 56 CYS A CA   7  
ATOM 6190  C C    . CYS A 1 56 ? 7.050   -1.356  4.933   1.00 0.00 ? 56 CYS A C    7  
ATOM 6191  O O    . CYS A 1 56 ? 7.822   -2.201  4.499   1.00 0.00 ? 56 CYS A O    7  
ATOM 6192  C CB   . CYS A 1 56 ? 4.562   -1.937  4.665   1.00 0.00 ? 56 CYS A CB   7  
ATOM 6193  S SG   . CYS A 1 56 ? 3.569   -1.286  6.027   1.00 0.00 ? 56 CYS A SG   7  
ATOM 6194  H H    . CYS A 1 56 ? 5.902   -2.279  2.324   1.00 0.00 ? 56 CYS A H    7  
ATOM 6195  H HA   . CYS A 1 56 ? 5.538   0.052   4.330   1.00 0.00 ? 56 CYS A HA   7  
ATOM 6196  H HB2  . CYS A 1 56 ? 3.814   -2.177  3.882   1.00 0.00 ? 56 CYS A HB2  7  
ATOM 6197  H HB3  . CYS A 1 56 ? 4.987   -2.897  4.986   1.00 0.00 ? 56 CYS A HB3  7  
ATOM 6198  N N    . PRO A 1 57 ? 7.317   -0.636  6.059   1.00 0.00 ? 57 PRO A N    7  
ATOM 6199  C CA   . PRO A 1 57 ? 8.604   -0.781  6.732   1.00 0.00 ? 57 PRO A CA   7  
ATOM 6200  C C    . PRO A 1 57 ? 8.713   -2.115  7.497   1.00 0.00 ? 57 PRO A C    7  
ATOM 6201  O O    . PRO A 1 57 ? 8.166   -2.295  8.576   1.00 0.00 ? 57 PRO A O    7  
ATOM 6202  C CB   . PRO A 1 57 ? 8.642   0.416   7.695   1.00 0.00 ? 57 PRO A CB   7  
ATOM 6203  C CG   . PRO A 1 57 ? 7.172   0.755   7.960   1.00 0.00 ? 57 PRO A CG   7  
ATOM 6204  C CD   . PRO A 1 57 ? 6.440   0.358   6.676   1.00 0.00 ? 57 PRO A CD   7  
ATOM 6205  H HA   . PRO A 1 57 ? 9.422   -0.706  6.013   1.00 0.00 ? 57 PRO A HA   7  
ATOM 6206  H HB2  . PRO A 1 57 ? 9.203   0.228   8.611   1.00 0.00 ? 57 PRO A HB2  7  
ATOM 6207  H HB3  . PRO A 1 57 ? 9.114   1.262   7.193   1.00 0.00 ? 57 PRO A HB3  7  
ATOM 6208  H HG2  . PRO A 1 57 ? 6.808   0.143   8.786   1.00 0.00 ? 57 PRO A HG2  7  
ATOM 6209  H HG3  . PRO A 1 57 ? 7.021   1.801   8.229   1.00 0.00 ? 57 PRO A HG3  7  
ATOM 6210  H HD2  . PRO A 1 57 ? 5.458   -0.079  6.920   1.00 0.00 ? 57 PRO A HD2  7  
ATOM 6211  H HD3  . PRO A 1 57 ? 6.375   1.229   6.004   1.00 0.00 ? 57 PRO A HD3  7  
ATOM 6212  N N    . GLU A 1 58 ? 9.501   -3.000  6.868   1.00 0.00 ? 58 GLU A N    7  
ATOM 6213  C CA   . GLU A 1 58 ? 9.845   -4.320  7.376   1.00 0.00 ? 58 GLU A CA   7  
ATOM 6214  C C    . GLU A 1 58 ? 11.045  -4.726  6.510   1.00 0.00 ? 58 GLU A C    7  
ATOM 6215  O O    . GLU A 1 58 ? 11.588  -3.891  5.798   1.00 0.00 ? 58 GLU A O    7  
ATOM 6216  C CB   . GLU A 1 58 ? 8.624   -5.275  7.284   1.00 0.00 ? 58 GLU A CB   7  
ATOM 6217  C CG   . GLU A 1 58 ? 8.822   -6.683  7.908   1.00 0.00 ? 58 GLU A CG   7  
ATOM 6218  C CD   . GLU A 1 58 ? 7.496   -7.392  8.221   1.00 0.00 ? 58 GLU A CD   7  
ATOM 6219  O OE1  . GLU A 1 58 ? 6.585   -6.768  8.756   1.00 0.00 ? 58 GLU A OE1  7  
ATOM 6220  O OE2  . GLU A 1 58 ? 7.362   -8.577  7.920   1.00 0.00 ? 58 GLU A OE2  7  
ATOM 6221  H H    . GLU A 1 58 ? 9.899   -2.763  5.978   1.00 0.00 ? 58 GLU A H    7  
ATOM 6222  H HA   . GLU A 1 58 ? 10.179  -4.170  8.404   1.00 0.00 ? 58 GLU A HA   7  
ATOM 6223  H HB2  . GLU A 1 58 ? 7.805   -4.779  7.818   1.00 0.00 ? 58 GLU A HB2  7  
ATOM 6224  H HB3  . GLU A 1 58 ? 8.318   -5.389  6.236   1.00 0.00 ? 58 GLU A HB3  7  
ATOM 6225  H HG2  . GLU A 1 58 ? 9.364   -7.340  7.227   1.00 0.00 ? 58 GLU A HG2  7  
ATOM 6226  H HG3  . GLU A 1 58 ? 9.385   -6.629  8.840   1.00 0.00 ? 58 GLU A HG3  7  
ATOM 6227  N N    . THR A 1 59 ? 11.425  -6.012  6.577   1.00 0.00 ? 59 THR A N    7  
ATOM 6228  C CA   . THR A 1 59 ? 12.536  -6.527  5.789   1.00 0.00 ? 59 THR A CA   7  
ATOM 6229  C C    . THR A 1 59 ? 12.381  -6.234  4.279   1.00 0.00 ? 59 THR A C    7  
ATOM 6230  O O    . THR A 1 59 ? 13.354  -5.956  3.590   1.00 0.00 ? 59 THR A O    7  
ATOM 6231  C CB   . THR A 1 59 ? 12.610  -8.037  6.067   1.00 0.00 ? 59 THR A CB   7  
ATOM 6232  O OG1  . THR A 1 59 ? 12.311  -8.270  7.431   1.00 0.00 ? 59 THR A OG1  7  
ATOM 6233  C CG2  . THR A 1 59 ? 13.954  -8.664  5.667   1.00 0.00 ? 59 THR A CG2  7  
ATOM 6234  H H    . THR A 1 59 ? 10.972  -6.663  7.186   1.00 0.00 ? 59 THR A H    7  
ATOM 6235  H HA   . THR A 1 59 ? 13.429  -6.014  6.149   1.00 0.00 ? 59 THR A HA   7  
ATOM 6236  H HB   . THR A 1 59 ? 11.820  -8.540  5.503   1.00 0.00 ? 59 THR A HB   7  
ATOM 6237  H HG1  . THR A 1 59 ? 12.997  -7.898  7.975   1.00 0.00 ? 59 THR A HG1  7  
ATOM 6238  H HG21 . THR A 1 59 ? 14.797  -8.180  6.160   1.00 0.00 ? 59 THR A HG21 7  
ATOM 6239  H HG22 . THR A 1 59 ? 14.115  -8.580  4.591   1.00 0.00 ? 59 THR A HG22 7  
ATOM 6240  H HG23 . THR A 1 59 ? 13.978  -9.724  5.921   1.00 0.00 ? 59 THR A HG23 7  
ATOM 6241  N N    . ALA A 1 60 ? 11.113  -6.315  3.828   1.00 0.00 ? 60 ALA A N    7  
ATOM 6242  C CA   . ALA A 1 60 ? 10.771  -6.039  2.443   1.00 0.00 ? 60 ALA A CA   7  
ATOM 6243  C C    . ALA A 1 60 ? 9.236   -6.019  2.313   1.00 0.00 ? 60 ALA A C    7  
ATOM 6244  O O    . ALA A 1 60 ? 8.556   -6.545  3.193   1.00 0.00 ? 60 ALA A O    7  
ATOM 6245  C CB   . ALA A 1 60 ? 11.367  -7.093  1.500   1.00 0.00 ? 60 ALA A CB   7  
ATOM 6246  O OXT  . ALA A 1 60 ? 8.732   -5.482  1.331   1.00 0.00 ? 60 ALA A OXT  7  
ATOM 6247  H H    . ALA A 1 60 ? 10.322  -6.538  4.401   1.00 0.00 ? 60 ALA A H    7  
ATOM 6248  H HA   . ALA A 1 60 ? 11.157  -5.045  2.215   1.00 0.00 ? 60 ALA A HA   7  
ATOM 6249  H HB1  . ALA A 1 60 ? 10.919  -8.075  1.662   1.00 0.00 ? 60 ALA A HB1  7  
ATOM 6250  H HB2  . ALA A 1 60 ? 12.445  -7.186  1.629   1.00 0.00 ? 60 ALA A HB2  7  
ATOM 6251  H HB3  . ALA A 1 60 ? 11.196  -6.802  0.465   1.00 0.00 ? 60 ALA A HB3  7  
ATOM 6252  N N    . THR A 1 1  ? 6.825   9.946   9.157   1.00 0.00 ? 1  THR A N    8  
ATOM 6253  C CA   . THR A 1 1  ? 6.494   8.666   8.557   1.00 0.00 ? 1  THR A CA   8  
ATOM 6254  C C    . THR A 1 1  ? 7.827   8.164   8.017   1.00 0.00 ? 1  THR A C    8  
ATOM 6255  O O    . THR A 1 1  ? 8.778   8.933   8.056   1.00 0.00 ? 1  THR A O    8  
ATOM 6256  C CB   . THR A 1 1  ? 5.444   8.919   7.449   1.00 0.00 ? 1  THR A CB   8  
ATOM 6257  O OG1  . THR A 1 1  ? 5.275   10.332  7.363   1.00 0.00 ? 1  THR A OG1  8  
ATOM 6258  C CG2  . THR A 1 1  ? 4.106   8.238   7.776   1.00 0.00 ? 1  THR A CG2  8  
ATOM 6259  H H1   . THR A 1 1  ? 6.609   9.991   10.170  1.00 0.00 ? 1  THR A H1   8  
ATOM 6260  H H2   . THR A 1 1  ? 6.261   10.634  8.606   1.00 0.00 ? 1  THR A H2   8  
ATOM 6261  H H3   . THR A 1 1  ? 7.846   10.081  8.959   1.00 0.00 ? 1  THR A H3   8  
ATOM 6262  H HA   . THR A 1 1  ? 6.140   7.994   9.341   1.00 0.00 ? 1  THR A HA   8  
ATOM 6263  H HB   . THR A 1 1  ? 5.807   8.536   6.486   1.00 0.00 ? 1  THR A HB   8  
ATOM 6264  H HG1  . THR A 1 1  ? 4.634   10.553  6.685   1.00 0.00 ? 1  THR A HG1  8  
ATOM 6265  H HG21 . THR A 1 1  ? 3.377   8.364   6.974   1.00 0.00 ? 1  THR A HG21 8  
ATOM 6266  H HG22 . THR A 1 1  ? 3.669   8.643   8.689   1.00 0.00 ? 1  THR A HG22 8  
ATOM 6267  H HG23 . THR A 1 1  ? 4.238   7.165   7.919   1.00 0.00 ? 1  THR A HG23 8  
ATOM 6268  N N    . ALA A 1 2  ? 7.855   6.903   7.540   1.00 0.00 ? 2  ALA A N    8  
ATOM 6269  C CA   . ALA A 1 2  ? 9.104   6.355   7.008   1.00 0.00 ? 2  ALA A CA   8  
ATOM 6270  C C    . ALA A 1 2  ? 8.802   5.272   5.959   1.00 0.00 ? 2  ALA A C    8  
ATOM 6271  O O    . ALA A 1 2  ? 9.502   4.277   5.834   1.00 0.00 ? 2  ALA A O    8  
ATOM 6272  C CB   . ALA A 1 2  ? 9.947   5.779   8.154   1.00 0.00 ? 2  ALA A CB   8  
ATOM 6273  H H    . ALA A 1 2  ? 7.043   6.319   7.558   1.00 0.00 ? 2  ALA A H    8  
ATOM 6274  H HA   . ALA A 1 2  ? 9.638   7.162   6.508   1.00 0.00 ? 2  ALA A HA   8  
ATOM 6275  H HB1  . ALA A 1 2  ? 10.180  6.546   8.893   1.00 0.00 ? 2  ALA A HB1  8  
ATOM 6276  H HB2  . ALA A 1 2  ? 10.895  5.385   7.784   1.00 0.00 ? 2  ALA A HB2  8  
ATOM 6277  H HB3  . ALA A 1 2  ? 9.427   4.968   8.663   1.00 0.00 ? 2  ALA A HB3  8  
ATOM 6278  N N    . LEU A 1 3  ? 7.696   5.527   5.236   1.00 0.00 ? 3  LEU A N    8  
ATOM 6279  C CA   . LEU A 1 3  ? 7.213   4.612   4.206   1.00 0.00 ? 3  LEU A CA   8  
ATOM 6280  C C    . LEU A 1 3  ? 7.311   5.356   2.864   1.00 0.00 ? 3  LEU A C    8  
ATOM 6281  O O    . LEU A 1 3  ? 6.323   5.776   2.271   1.00 0.00 ? 3  LEU A O    8  
ATOM 6282  C CB   . LEU A 1 3  ? 5.761   4.158   4.488   1.00 0.00 ? 3  LEU A CB   8  
ATOM 6283  C CG   . LEU A 1 3  ? 5.609   2.941   5.429   1.00 0.00 ? 3  LEU A CG   8  
ATOM 6284  C CD1  . LEU A 1 3  ? 5.917   1.617   4.724   1.00 0.00 ? 3  LEU A CD1  8  
ATOM 6285  C CD2  . LEU A 1 3  ? 6.397   3.054   6.739   1.00 0.00 ? 3  LEU A CD2  8  
ATOM 6286  H H    . LEU A 1 3  ? 7.228   6.395   5.375   1.00 0.00 ? 3  LEU A H    8  
ATOM 6287  H HA   . LEU A 1 3  ? 7.869   3.741   4.151   1.00 0.00 ? 3  LEU A HA   8  
ATOM 6288  H HB2  . LEU A 1 3  ? 5.163   4.989   4.956   1.00 0.00 ? 3  LEU A HB2  8  
ATOM 6289  H HB3  . LEU A 1 3  ? 5.393   3.804   3.493   1.00 0.00 ? 3  LEU A HB3  8  
ATOM 6290  H HG   . LEU A 1 3  ? 4.555   2.896   5.698   1.00 0.00 ? 3  LEU A HG   8  
ATOM 6291  H HD11 . LEU A 1 3  ? 6.939   1.598   4.353   1.00 0.00 ? 3  LEU A HD11 8  
ATOM 6292  H HD12 . LEU A 1 3  ? 5.255   1.455   3.876   1.00 0.00 ? 3  LEU A HD12 8  
ATOM 6293  H HD13 . LEU A 1 3  ? 5.770   0.774   5.398   1.00 0.00 ? 3  LEU A HD13 8  
ATOM 6294  H HD21 . LEU A 1 3  ? 6.218   4.006   7.235   1.00 0.00 ? 3  LEU A HD21 8  
ATOM 6295  H HD22 . LEU A 1 3  ? 7.467   2.944   6.565   1.00 0.00 ? 3  LEU A HD22 8  
ATOM 6296  H HD23 . LEU A 1 3  ? 6.108   2.259   7.427   1.00 0.00 ? 3  LEU A HD23 8  
ATOM 6297  N N    . PHE A 1 4  ? 8.589   5.492   2.467   1.00 0.00 ? 4  PHE A N    8  
ATOM 6298  C CA   . PHE A 1 4  ? 8.976   6.159   1.224   1.00 0.00 ? 4  PHE A CA   8  
ATOM 6299  C C    . PHE A 1 4  ? 8.707   5.190   0.055   1.00 0.00 ? 4  PHE A C    8  
ATOM 6300  O O    . PHE A 1 4  ? 8.649   3.984   0.256   1.00 0.00 ? 4  PHE A O    8  
ATOM 6301  C CB   . PHE A 1 4  ? 10.478  6.528   1.321   1.00 0.00 ? 4  PHE A CB   8  
ATOM 6302  C CG   . PHE A 1 4  ? 10.780  7.292   2.584   1.00 0.00 ? 4  PHE A CG   8  
ATOM 6303  C CD1  . PHE A 1 4  ? 10.320  8.596   2.742   1.00 0.00 ? 4  PHE A CD1  8  
ATOM 6304  C CD2  . PHE A 1 4  ? 11.520  6.708   3.609   1.00 0.00 ? 4  PHE A CD2  8  
ATOM 6305  C CE1  . PHE A 1 4  ? 10.595  9.306   3.904   1.00 0.00 ? 4  PHE A CE1  8  
ATOM 6306  C CE2  . PHE A 1 4  ? 11.799  7.417   4.770   1.00 0.00 ? 4  PHE A CE2  8  
ATOM 6307  C CZ   . PHE A 1 4  ? 11.336  8.717   4.919   1.00 0.00 ? 4  PHE A CZ   8  
ATOM 6308  H H    . PHE A 1 4  ? 9.274   5.082   3.067   1.00 0.00 ? 4  PHE A H    8  
ATOM 6309  H HA   . PHE A 1 4  ? 8.337   7.042   1.134   1.00 0.00 ? 4  PHE A HA   8  
ATOM 6310  H HB2  . PHE A 1 4  ? 11.080  5.608   1.309   1.00 0.00 ? 4  PHE A HB2  8  
ATOM 6311  H HB3  . PHE A 1 4  ? 10.824  7.143   0.479   1.00 0.00 ? 4  PHE A HB3  8  
ATOM 6312  H HD1  . PHE A 1 4  ? 9.745   9.065   1.957   1.00 0.00 ? 4  PHE A HD1  8  
ATOM 6313  H HD2  . PHE A 1 4  ? 11.885  5.696   3.510   1.00 0.00 ? 4  PHE A HD2  8  
ATOM 6314  H HE1  . PHE A 1 4  ? 10.235  10.318  4.018   1.00 0.00 ? 4  PHE A HE1  8  
ATOM 6315  H HE2  . PHE A 1 4  ? 12.375  6.955   5.559   1.00 0.00 ? 4  PHE A HE2  8  
ATOM 6316  H HZ   . PHE A 1 4  ? 11.550  9.269   5.823   1.00 0.00 ? 4  PHE A HZ   8  
ATOM 6317  N N    . THR A 1 5  ? 8.557   5.745   -1.166  1.00 0.00 ? 5  THR A N    8  
ATOM 6318  C CA   . THR A 1 5  ? 8.252   4.876   -2.294  1.00 0.00 ? 5  THR A CA   8  
ATOM 6319  C C    . THR A 1 5  ? 9.552   4.514   -3.025  1.00 0.00 ? 5  THR A C    8  
ATOM 6320  O O    . THR A 1 5  ? 10.366  5.382   -3.311  1.00 0.00 ? 5  THR A O    8  
ATOM 6321  C CB   . THR A 1 5  ? 7.363   5.634   -3.294  1.00 0.00 ? 5  THR A CB   8  
ATOM 6322  O OG1  . THR A 1 5  ? 8.049   6.650   -4.006  1.00 0.00 ? 5  THR A OG1  8  
ATOM 6323  C CG2  . THR A 1 5  ? 6.199   6.378   -2.636  1.00 0.00 ? 5  THR A CG2  8  
ATOM 6324  H H    . THR A 1 5  ? 8.585   6.724   -1.362  1.00 0.00 ? 5  THR A H    8  
ATOM 6325  H HA   . THR A 1 5  ? 7.728   3.988   -1.933  1.00 0.00 ? 5  THR A HA   8  
ATOM 6326  H HB   . THR A 1 5  ? 6.964   4.887   -3.992  1.00 0.00 ? 5  THR A HB   8  
ATOM 6327  H HG1  . THR A 1 5  ? 8.963   6.399   -4.157  1.00 0.00 ? 5  THR A HG1  8  
ATOM 6328  H HG21 . THR A 1 5  ? 5.625   5.734   -1.973  1.00 0.00 ? 5  THR A HG21 8  
ATOM 6329  H HG22 . THR A 1 5  ? 5.524   6.779   -3.393  1.00 0.00 ? 5  THR A HG22 8  
ATOM 6330  H HG23 . THR A 1 5  ? 6.549   7.232   -2.050  1.00 0.00 ? 5  THR A HG23 8  
ATOM 6331  N N    . MET A 1 6  ? 9.676   3.209   -3.323  1.00 0.00 ? 6  MET A N    8  
ATOM 6332  C CA   . MET A 1 6  ? 10.841  2.674   -4.012  1.00 0.00 ? 6  MET A CA   8  
ATOM 6333  C C    . MET A 1 6  ? 10.416  2.334   -5.453  1.00 0.00 ? 6  MET A C    8  
ATOM 6334  O O    . MET A 1 6  ? 10.687  3.078   -6.383  1.00 0.00 ? 6  MET A O    8  
ATOM 6335  C CB   . MET A 1 6  ? 11.368  1.472   -3.189  1.00 0.00 ? 6  MET A CB   8  
ATOM 6336  C CG   . MET A 1 6  ? 11.563  1.764   -1.682  1.00 0.00 ? 6  MET A CG   8  
ATOM 6337  S SD   . MET A 1 6  ? 12.146  0.299   -0.806  1.00 0.00 ? 6  MET A SD   8  
ATOM 6338  C CE   . MET A 1 6  ? 10.555  -0.397  -0.317  1.00 0.00 ? 6  MET A CE   8  
ATOM 6339  H H    . MET A 1 6  ? 8.953   2.579   -3.072  1.00 0.00 ? 6  MET A H    8  
ATOM 6340  H HA   . MET A 1 6  ? 11.598  3.460   -4.109  1.00 0.00 ? 6  MET A HA   8  
ATOM 6341  H HB2  . MET A 1 6  ? 10.683  0.628   -3.262  1.00 0.00 ? 6  MET A HB2  8  
ATOM 6342  H HB3  . MET A 1 6  ? 12.311  1.131   -3.617  1.00 0.00 ? 6  MET A HB3  8  
ATOM 6343  H HG2  . MET A 1 6  ? 12.286  2.565   -1.513  1.00 0.00 ? 6  MET A HG2  8  
ATOM 6344  H HG3  . MET A 1 6  ? 10.642  2.097   -1.194  1.00 0.00 ? 6  MET A HG3  8  
ATOM 6345  H HE1  . MET A 1 6  ? 9.956   0.351   0.203   1.00 0.00 ? 6  MET A HE1  8  
ATOM 6346  H HE2  . MET A 1 6  ? 10.697  -1.248  0.350   1.00 0.00 ? 6  MET A HE2  8  
ATOM 6347  H HE3  . MET A 1 6  ? 10.000  -0.717  -1.197  1.00 0.00 ? 6  MET A HE3  8  
ATOM 6348  N N    . GLY A 1 7  ? 9.702   1.196   -5.579  1.00 0.00 ? 7  GLY A N    8  
ATOM 6349  C CA   . GLY A 1 7  ? 9.189   0.781   -6.887  1.00 0.00 ? 7  GLY A CA   8  
ATOM 6350  C C    . GLY A 1 7  ? 7.722   1.216   -7.114  1.00 0.00 ? 7  GLY A C    8  
ATOM 6351  O O    . GLY A 1 7  ? 7.144   1.004   -8.172  1.00 0.00 ? 7  GLY A O    8  
ATOM 6352  H H    . GLY A 1 7  ? 9.533   0.619   -4.782  1.00 0.00 ? 7  GLY A H    8  
ATOM 6353  H HA2  . GLY A 1 7  ? 9.819   1.199   -7.680  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 6354  H HA3  . GLY A 1 7  ? 9.266   -0.306  -6.900  1.00 0.00 ? 7  GLY A HA3  8  
ATOM 6355  N N    . GLY A 1 8  ? 7.169   1.832   -6.046  1.00 0.00 ? 8  GLY A N    8  
ATOM 6356  C CA   . GLY A 1 8  ? 5.802   2.355   -5.989  1.00 0.00 ? 8  GLY A CA   8  
ATOM 6357  C C    . GLY A 1 8  ? 5.440   3.239   -7.189  1.00 0.00 ? 8  GLY A C    8  
ATOM 6358  O O    . GLY A 1 8  ? 6.308   3.756   -7.880  1.00 0.00 ? 8  GLY A O    8  
ATOM 6359  H H    . GLY A 1 8  ? 7.747   1.857   -5.243  1.00 0.00 ? 8  GLY A H    8  
ATOM 6360  H HA2  . GLY A 1 8  ? 5.131   1.500   -5.920  1.00 0.00 ? 8  GLY A HA2  8  
ATOM 6361  H HA3  . GLY A 1 8  ? 5.736   2.951   -5.082  1.00 0.00 ? 8  GLY A HA3  8  
ATOM 6362  N N    . ASN A 1 9  ? 4.110   3.364   -7.403  1.00 0.00 ? 9  ASN A N    8  
ATOM 6363  C CA   . ASN A 1 9  ? 3.626   4.104   -8.577  1.00 0.00 ? 9  ASN A CA   8  
ATOM 6364  C C    . ASN A 1 9  ? 2.807   5.349   -8.197  1.00 0.00 ? 9  ASN A C    8  
ATOM 6365  O O    . ASN A 1 9  ? 2.370   6.094   -9.067  1.00 0.00 ? 9  ASN A O    8  
ATOM 6366  C CB   . ASN A 1 9  ? 2.810   3.162   -9.501  1.00 0.00 ? 9  ASN A CB   8  
ATOM 6367  C CG   . ASN A 1 9  ? 1.415   2.792   -8.953  1.00 0.00 ? 9  ASN A CG   8  
ATOM 6368  O OD1  . ASN A 1 9  ? 1.029   3.205   -7.873  1.00 0.00 ? 9  ASN A OD1  8  
ATOM 6369  N ND2  . ASN A 1 9  ? 0.620   2.099   -9.779  1.00 0.00 ? 9  ASN A ND2  8  
ATOM 6370  H H    . ASN A 1 9  ? 3.456   2.952   -6.755  1.00 0.00 ? 9  ASN A H    8  
ATOM 6371  H HA   . ASN A 1 9  ? 4.496   4.461   -9.134  1.00 0.00 ? 9  ASN A HA   8  
ATOM 6372  H HB2  . ASN A 1 9  ? 2.659   3.661   -10.459 1.00 0.00 ? 9  ASN A HB2  8  
ATOM 6373  H HB3  . ASN A 1 9  ? 3.376   2.256   -9.719  1.00 0.00 ? 9  ASN A HB3  8  
ATOM 6374  H HD21 . ASN A 1 9  ? 0.936   1.732   -10.658 1.00 0.00 ? 9  ASN A HD21 8  
ATOM 6375  H HD22 . ASN A 1 9  ? -0.330  1.981   -9.461  1.00 0.00 ? 9  ASN A HD22 8  
ATOM 6376  N N    . ALA A 1 10 ? 2.590   5.543   -6.885  1.00 0.00 ? 10 ALA A N    8  
ATOM 6377  C CA   . ALA A 1 10 ? 1.733   6.633   -6.423  1.00 0.00 ? 10 ALA A CA   8  
ATOM 6378  C C    . ALA A 1 10 ? 2.397   8.023   -6.387  1.00 0.00 ? 10 ALA A C    8  
ATOM 6379  O O    . ALA A 1 10 ? 2.313   8.725   -5.389  1.00 0.00 ? 10 ALA A O    8  
ATOM 6380  C CB   . ALA A 1 10 ? 1.236   6.267   -5.029  1.00 0.00 ? 10 ALA A CB   8  
ATOM 6381  H H    . ALA A 1 10 ? 2.939   4.881   -6.218  1.00 0.00 ? 10 ALA A H    8  
ATOM 6382  H HA   . ALA A 1 10 ? 0.882   6.690   -7.100  1.00 0.00 ? 10 ALA A HA   8  
ATOM 6383  H HB1  . ALA A 1 10 ? 2.065   6.211   -4.324  1.00 0.00 ? 10 ALA A HB1  8  
ATOM 6384  H HB2  . ALA A 1 10 ? 0.753   5.294   -5.052  1.00 0.00 ? 10 ALA A HB2  8  
ATOM 6385  H HB3  . ALA A 1 10 ? 0.516   6.994   -4.650  1.00 0.00 ? 10 ALA A HB3  8  
ATOM 6386  N N    . GLU A 1 11 ? 3.044   8.397   -7.506  1.00 0.00 ? 11 GLU A N    8  
ATOM 6387  C CA   . GLU A 1 11 ? 3.622   9.734   -7.644  1.00 0.00 ? 11 GLU A CA   8  
ATOM 6388  C C    . GLU A 1 11 ? 4.533   10.159  -6.457  1.00 0.00 ? 11 GLU A C    8  
ATOM 6389  O O    . GLU A 1 11 ? 4.594   11.325  -6.088  1.00 0.00 ? 11 GLU A O    8  
ATOM 6390  C CB   . GLU A 1 11 ? 2.493   10.767  -7.874  1.00 0.00 ? 11 GLU A CB   8  
ATOM 6391  C CG   . GLU A 1 11 ? 1.752   10.647  -9.224  1.00 0.00 ? 11 GLU A CG   8  
ATOM 6392  C CD   . GLU A 1 11 ? 0.817   9.433   -9.375  1.00 0.00 ? 11 GLU A CD   8  
ATOM 6393  O OE1  . GLU A 1 11 ? 0.268   8.937   -8.388  1.00 0.00 ? 11 GLU A OE1  8  
ATOM 6394  O OE2  . GLU A 1 11 ? 0.635   8.959   -10.498 1.00 0.00 ? 11 GLU A OE2  8  
ATOM 6395  H H    . GLU A 1 11 ? 3.034   7.778   -8.292  1.00 0.00 ? 11 GLU A H    8  
ATOM 6396  H HA   . GLU A 1 11 ? 4.254   9.686   -8.530  1.00 0.00 ? 11 GLU A HA   8  
ATOM 6397  H HB2  . GLU A 1 11 ? 1.780   10.742  -7.049  1.00 0.00 ? 11 GLU A HB2  8  
ATOM 6398  H HB3  . GLU A 1 11 ? 2.929   11.766  -7.850  1.00 0.00 ? 11 GLU A HB3  8  
ATOM 6399  H HG2  . GLU A 1 11 ? 1.138   11.535  -9.372  1.00 0.00 ? 11 GLU A HG2  8  
ATOM 6400  H HG3  . GLU A 1 11 ? 2.475   10.637  -10.040 1.00 0.00 ? 11 GLU A HG3  8  
ATOM 6401  N N    . GLY A 1 12 ? 5.245   9.162   -5.889  1.00 0.00 ? 12 GLY A N    8  
ATOM 6402  C CA   . GLY A 1 12 ? 6.179   9.458   -4.789  1.00 0.00 ? 12 GLY A CA   8  
ATOM 6403  C C    . GLY A 1 12 ? 5.478   9.639   -3.423  1.00 0.00 ? 12 GLY A C    8  
ATOM 6404  O O    . GLY A 1 12 ? 6.131   9.907   -2.422  1.00 0.00 ? 12 GLY A O    8  
ATOM 6405  H H    . GLY A 1 12 ? 5.113   8.243   -6.261  1.00 0.00 ? 12 GLY A H    8  
ATOM 6406  H HA2  . GLY A 1 12 ? 6.864   8.562   -4.698  1.00 0.00 ? 12 GLY A HA2  8  
ATOM 6407  H HA3  . GLY A 1 12 ? 6.642   10.461  -5.031  1.00 0.00 ? 12 GLY A HA3  8  
ATOM 6408  N N    . GLN A 1 13 ? 4.136   9.497   -3.409  1.00 0.00 ? 13 GLN A N    8  
ATOM 6409  C CA   . GLN A 1 13 ? 3.397   9.653   -2.158  1.00 0.00 ? 13 GLN A CA   8  
ATOM 6410  C C    . GLN A 1 13 ? 3.733   8.476   -1.209  1.00 0.00 ? 13 GLN A C    8  
ATOM 6411  O O    . GLN A 1 13 ? 3.720   7.325   -1.628  1.00 0.00 ? 13 GLN A O    8  
ATOM 6412  C CB   . GLN A 1 13 ? 1.874   9.689   -2.408  1.00 0.00 ? 13 GLN A CB   8  
ATOM 6413  C CG   . GLN A 1 13 ? 1.360   10.923  -3.184  1.00 0.00 ? 13 GLN A CG   8  
ATOM 6414  C CD   . GLN A 1 13 ? 1.446   12.211  -2.340  1.00 0.00 ? 13 GLN A CD   8  
ATOM 6415  O OE1  . GLN A 1 13 ? 2.039   12.248  -1.271  1.00 0.00 ? 13 GLN A OE1  8  
ATOM 6416  N NE2  . GLN A 1 13 ? 0.785   13.257  -2.856  1.00 0.00 ? 13 GLN A NE2  8  
ATOM 6417  H H    . GLN A 1 13 ? 3.640   9.240   -4.238  1.00 0.00 ? 13 GLN A H    8  
ATOM 6418  H HA   . GLN A 1 13 ? 3.734   10.589  -1.715  1.00 0.00 ? 13 GLN A HA   8  
ATOM 6419  H HB2  . GLN A 1 13 ? 1.573   8.782   -2.934  1.00 0.00 ? 13 GLN A HB2  8  
ATOM 6420  H HB3  . GLN A 1 13 ? 1.354   9.676   -1.447  1.00 0.00 ? 13 GLN A HB3  8  
ATOM 6421  H HG2  . GLN A 1 13 ? 1.878   11.066  -4.133  1.00 0.00 ? 13 GLN A HG2  8  
ATOM 6422  H HG3  . GLN A 1 13 ? 0.311   10.764  -3.435  1.00 0.00 ? 13 GLN A HG3  8  
ATOM 6423  H HE21 . GLN A 1 13 ? 0.316   13.191  -3.735  1.00 0.00 ? 13 GLN A HE21 8  
ATOM 6424  H HE22 . GLN A 1 13 ? 0.765   14.112  -2.335  1.00 0.00 ? 13 GLN A HE22 8  
ATOM 6425  N N    . PRO A 1 14 ? 4.028   8.787   0.083   1.00 0.00 ? 14 PRO A N    8  
ATOM 6426  C CA   . PRO A 1 14 ? 4.333   7.755   1.071   1.00 0.00 ? 14 PRO A CA   8  
ATOM 6427  C C    . PRO A 1 14 ? 3.069   6.949   1.420   1.00 0.00 ? 14 PRO A C    8  
ATOM 6428  O O    . PRO A 1 14 ? 1.955   7.420   1.231   1.00 0.00 ? 14 PRO A O    8  
ATOM 6429  C CB   . PRO A 1 14 ? 4.852   8.542   2.282   1.00 0.00 ? 14 PRO A CB   8  
ATOM 6430  C CG   . PRO A 1 14 ? 4.209   9.928   2.158   1.00 0.00 ? 14 PRO A CG   8  
ATOM 6431  C CD   . PRO A 1 14 ? 4.043   10.136  0.649   1.00 0.00 ? 14 PRO A CD   8  
ATOM 6432  H HA   . PRO A 1 14 ? 5.091   7.078   0.677   1.00 0.00 ? 14 PRO A HA   8  
ATOM 6433  H HB2  . PRO A 1 14 ? 4.628   8.060   3.240   1.00 0.00 ? 14 PRO A HB2  8  
ATOM 6434  H HB3  . PRO A 1 14 ? 5.938   8.644   2.187   1.00 0.00 ? 14 PRO A HB3  8  
ATOM 6435  H HG2  . PRO A 1 14 ? 3.177   9.852   2.596   1.00 0.00 ? 14 PRO A HG2  8  
ATOM 6436  H HG3  . PRO A 1 14 ? 4.891   10.715  2.571   1.00 0.00 ? 14 PRO A HG3  8  
ATOM 6437  H HD2  . PRO A 1 14 ? 3.119   10.673  0.427   1.00 0.00 ? 14 PRO A HD2  8  
ATOM 6438  H HD3  . PRO A 1 14 ? 4.886   10.693  0.236   1.00 0.00 ? 14 PRO A HD3  8  
ATOM 6439  N N    . CYS A 1 15 ? 3.304   5.717   1.921   1.00 0.00 ? 15 CYS A N    8  
ATOM 6440  C CA   . CYS A 1 15 ? 2.189   4.824   2.269   1.00 0.00 ? 15 CYS A CA   8  
ATOM 6441  C C    . CYS A 1 15 ? 1.102   5.520   3.111   1.00 0.00 ? 15 CYS A C    8  
ATOM 6442  O O    . CYS A 1 15 ? 1.379   6.356   3.964   1.00 0.00 ? 15 CYS A O    8  
ATOM 6443  C CB   . CYS A 1 15 ? 2.683   3.671   3.145   1.00 0.00 ? 15 CYS A CB   8  
ATOM 6444  S SG   . CYS A 1 15 ? 3.674   2.451   2.253   1.00 0.00 ? 15 CYS A SG   8  
ATOM 6445  H H    . CYS A 1 15 ? 4.262   5.437   2.035   1.00 0.00 ? 15 CYS A H    8  
ATOM 6446  H HA   . CYS A 1 15 ? 1.741   4.460   1.343   1.00 0.00 ? 15 CYS A HA   8  
ATOM 6447  H HB2  . CYS A 1 15 ? 3.241   4.060   3.992   1.00 0.00 ? 15 CYS A HB2  8  
ATOM 6448  H HB3  . CYS A 1 15 ? 1.846   3.139   3.587   1.00 0.00 ? 15 CYS A HB3  8  
ATOM 6449  N N    . LYS A 1 16 ? -0.142  5.090   2.816   1.00 0.00 ? 16 LYS A N    8  
ATOM 6450  C CA   . LYS A 1 16 ? -1.318  5.609   3.488   1.00 0.00 ? 16 LYS A CA   8  
ATOM 6451  C C    . LYS A 1 16 ? -1.986  4.460   4.249   1.00 0.00 ? 16 LYS A C    8  
ATOM 6452  O O    . LYS A 1 16 ? -2.237  3.391   3.712   1.00 0.00 ? 16 LYS A O    8  
ATOM 6453  C CB   . LYS A 1 16 ? -2.276  6.154   2.418   1.00 0.00 ? 16 LYS A CB   8  
ATOM 6454  C CG   . LYS A 1 16 ? -3.461  6.990   2.968   1.00 0.00 ? 16 LYS A CG   8  
ATOM 6455  C CD   . LYS A 1 16 ? -2.988  8.241   3.729   1.00 0.00 ? 16 LYS A CD   8  
ATOM 6456  C CE   . LYS A 1 16 ? -2.954  8.125   5.259   1.00 0.00 ? 16 LYS A CE   8  
ATOM 6457  N NZ   . LYS A 1 16 ? -4.248  7.747   5.820   1.00 0.00 ? 16 LYS A NZ   8  
ATOM 6458  H H    . LYS A 1 16 ? -0.301  4.383   2.120   1.00 0.00 ? 16 LYS A H    8  
ATOM 6459  H HA   . LYS A 1 16 ? -0.982  6.388   4.174   1.00 0.00 ? 16 LYS A HA   8  
ATOM 6460  H HB2  . LYS A 1 16 ? -1.705  6.802   1.754   1.00 0.00 ? 16 LYS A HB2  8  
ATOM 6461  H HB3  . LYS A 1 16 ? -2.594  5.297   1.808   1.00 0.00 ? 16 LYS A HB3  8  
ATOM 6462  H HG2  . LYS A 1 16 ? -4.073  7.386   2.151   1.00 0.00 ? 16 LYS A HG2  8  
ATOM 6463  H HG3  . LYS A 1 16 ? -4.154  6.376   3.546   1.00 0.00 ? 16 LYS A HG3  8  
ATOM 6464  H HD2  . LYS A 1 16 ? -2.032  8.580   3.314   1.00 0.00 ? 16 LYS A HD2  8  
ATOM 6465  H HD3  . LYS A 1 16 ? -3.692  9.034   3.522   1.00 0.00 ? 16 LYS A HD3  8  
ATOM 6466  H HE2  . LYS A 1 16 ? -2.211  7.413   5.596   1.00 0.00 ? 16 LYS A HE2  8  
ATOM 6467  H HE3  . LYS A 1 16 ? -2.674  9.083   5.701   1.00 0.00 ? 16 LYS A HE3  8  
ATOM 6468  H HZ1  . LYS A 1 16 ? -4.739  7.030   5.238   1.00 0.00 ? 16 LYS A HZ1  8  
ATOM 6469  H HZ2  . LYS A 1 16 ? -4.940  8.531   5.770   1.00 0.00 ? 16 LYS A HZ2  8  
ATOM 6470  H HZ3  . LYS A 1 16 ? -4.181  7.349   6.784   1.00 0.00 ? 16 LYS A HZ3  8  
ATOM 6471  N N    . PHE A 1 17 ? -2.244  4.756   5.530   1.00 0.00 ? 17 PHE A N    8  
ATOM 6472  C CA   . PHE A 1 17 ? -2.907  3.833   6.441   1.00 0.00 ? 17 PHE A CA   8  
ATOM 6473  C C    . PHE A 1 17 ? -4.029  4.661   7.098   1.00 0.00 ? 17 PHE A C    8  
ATOM 6474  O O    . PHE A 1 17 ? -3.808  5.840   7.372   1.00 0.00 ? 17 PHE A O    8  
ATOM 6475  C CB   . PHE A 1 17 ? -1.896  3.356   7.509   1.00 0.00 ? 17 PHE A CB   8  
ATOM 6476  C CG   . PHE A 1 17 ? -0.689  2.641   6.939   1.00 0.00 ? 17 PHE A CG   8  
ATOM 6477  C CD1  . PHE A 1 17 ? -0.830  1.522   6.124   1.00 0.00 ? 17 PHE A CD1  8  
ATOM 6478  C CD2  . PHE A 1 17 ? 0.601   3.070   7.238   1.00 0.00 ? 17 PHE A CD2  8  
ATOM 6479  C CE1  . PHE A 1 17 ? 0.279   0.843   5.643   1.00 0.00 ? 17 PHE A CE1  8  
ATOM 6480  C CE2  . PHE A 1 17 ? 1.713   2.391   6.760   1.00 0.00 ? 17 PHE A CE2  8  
ATOM 6481  C CZ   . PHE A 1 17 ? 1.558   1.264   5.968   1.00 0.00 ? 17 PHE A CZ   8  
ATOM 6482  H H    . PHE A 1 17 ? -2.025  5.671   5.863   1.00 0.00 ? 17 PHE A H    8  
ATOM 6483  H HA   . PHE A 1 17 ? -3.321  3.012   5.854   1.00 0.00 ? 17 PHE A HA   8  
ATOM 6484  H HB2  . PHE A 1 17 ? -1.542  4.228   8.073   1.00 0.00 ? 17 PHE A HB2  8  
ATOM 6485  H HB3  . PHE A 1 17 ? -2.382  2.677   8.224   1.00 0.00 ? 17 PHE A HB3  8  
ATOM 6486  H HD1  . PHE A 1 17 ? -1.806  1.158   5.861   1.00 0.00 ? 17 PHE A HD1  8  
ATOM 6487  H HD2  . PHE A 1 17 ? 0.769   3.935   7.853   1.00 0.00 ? 17 PHE A HD2  8  
ATOM 6488  H HE1  . PHE A 1 17 ? 0.139   -0.018  5.017   1.00 0.00 ? 17 PHE A HE1  8  
ATOM 6489  H HE2  . PHE A 1 17 ? 2.694   2.751   7.019   1.00 0.00 ? 17 PHE A HE2  8  
ATOM 6490  H HZ   . PHE A 1 17 ? 2.418   0.708   5.617   1.00 0.00 ? 17 PHE A HZ   8  
ATOM 6491  N N    . PRO A 1 18 ? -5.231  4.067   7.333   1.00 0.00 ? 18 PRO A N    8  
ATOM 6492  C CA   . PRO A 1 18 ? -5.662  2.748   6.865   1.00 0.00 ? 18 PRO A CA   8  
ATOM 6493  C C    . PRO A 1 18 ? -6.085  2.831   5.385   1.00 0.00 ? 18 PRO A C    8  
ATOM 6494  O O    . PRO A 1 18 ? -6.874  3.694   5.029   1.00 0.00 ? 18 PRO A O    8  
ATOM 6495  C CB   . PRO A 1 18 ? -6.925  2.466   7.697   1.00 0.00 ? 18 PRO A CB   8  
ATOM 6496  C CG   . PRO A 1 18 ? -7.493  3.848   8.030   1.00 0.00 ? 18 PRO A CG   8  
ATOM 6497  C CD   . PRO A 1 18 ? -6.267  4.765   8.095   1.00 0.00 ? 18 PRO A CD   8  
ATOM 6498  H HA   . PRO A 1 18 ? -4.894  1.994   7.032   1.00 0.00 ? 18 PRO A HA   8  
ATOM 6499  H HB2  . PRO A 1 18 ? -7.648  1.805   7.213   1.00 0.00 ? 18 PRO A HB2  8  
ATOM 6500  H HB3  . PRO A 1 18 ? -6.650  1.984   8.631   1.00 0.00 ? 18 PRO A HB3  8  
ATOM 6501  H HG2  . PRO A 1 18 ? -8.150  4.177   7.224   1.00 0.00 ? 18 PRO A HG2  8  
ATOM 6502  H HG3  . PRO A 1 18 ? -8.070  3.853   8.955   1.00 0.00 ? 18 PRO A HG3  8  
ATOM 6503  H HD2  . PRO A 1 18 ? -6.479  5.747   7.663   1.00 0.00 ? 18 PRO A HD2  8  
ATOM 6504  H HD3  . PRO A 1 18 ? -5.929  4.882   9.128   1.00 0.00 ? 18 PRO A HD3  8  
ATOM 6505  N N    . PHE A 1 19 ? -5.558  1.916   4.548   1.00 0.00 ? 19 PHE A N    8  
ATOM 6506  C CA   . PHE A 1 19 ? -5.982  1.918   3.143   1.00 0.00 ? 19 PHE A CA   8  
ATOM 6507  C C    . PHE A 1 19 ? -6.951  0.736   2.971   1.00 0.00 ? 19 PHE A C    8  
ATOM 6508  O O    . PHE A 1 19 ? -6.723  -0.356  3.477   1.00 0.00 ? 19 PHE A O    8  
ATOM 6509  C CB   . PHE A 1 19 ? -4.834  1.855   2.109   1.00 0.00 ? 19 PHE A CB   8  
ATOM 6510  C CG   . PHE A 1 19 ? -4.035  0.525   2.156   1.00 0.00 ? 19 PHE A CG   8  
ATOM 6511  C CD1  . PHE A 1 19 ? -3.001  0.323   3.103   1.00 0.00 ? 19 PHE A CD1  8  
ATOM 6512  C CD2  . PHE A 1 19 ? -4.287  -0.539  1.256   1.00 0.00 ? 19 PHE A CD2  8  
ATOM 6513  C CE1  . PHE A 1 19 ? -2.208  -0.851  3.075   1.00 0.00 ? 19 PHE A CE1  8  
ATOM 6514  C CE2  . PHE A 1 19 ? -3.509  -1.686  1.250   1.00 0.00 ? 19 PHE A CE2  8  
ATOM 6515  C CZ   . PHE A 1 19 ? -2.461  -1.833  2.137   1.00 0.00 ? 19 PHE A CZ   8  
ATOM 6516  H H    . PHE A 1 19 ? -4.952  1.207   4.920   1.00 0.00 ? 19 PHE A H    8  
ATOM 6517  H HA   . PHE A 1 19 ? -6.512  2.852   2.944   1.00 0.00 ? 19 PHE A HA   8  
ATOM 6518  H HB2  . PHE A 1 19 ? -5.338  2.046   1.140   1.00 0.00 ? 19 PHE A HB2  8  
ATOM 6519  H HB3  . PHE A 1 19 ? -4.193  2.763   2.197   1.00 0.00 ? 19 PHE A HB3  8  
ATOM 6520  H HD1  . PHE A 1 19 ? -2.854  1.080   3.883   1.00 0.00 ? 19 PHE A HD1  8  
ATOM 6521  H HD2  . PHE A 1 19 ? -5.073  -0.626  0.514   1.00 0.00 ? 19 PHE A HD2  8  
ATOM 6522  H HE1  . PHE A 1 19 ? -1.371  -1.142  3.724   1.00 0.00 ? 19 PHE A HE1  8  
ATOM 6523  H HE2  . PHE A 1 19 ? -3.734  -2.474  0.543   1.00 0.00 ? 19 PHE A HE2  8  
ATOM 6524  H HZ   . PHE A 1 19 ? -1.830  -2.712  2.109   1.00 0.00 ? 19 PHE A HZ   8  
ATOM 6525  N N    . ARG A 1 20 ? -8.053  1.017   2.256   1.00 0.00 ? 20 ARG A N    8  
ATOM 6526  C CA   . ARG A 1 20 ? -9.080  0.011   2.015   1.00 0.00 ? 20 ARG A CA   8  
ATOM 6527  C C    . ARG A 1 20 ? -8.746  -0.719  0.702   1.00 0.00 ? 20 ARG A C    8  
ATOM 6528  O O    . ARG A 1 20 ? -8.518  -0.092  -0.325  1.00 0.00 ? 20 ARG A O    8  
ATOM 6529  C CB   . ARG A 1 20 ? -10.445 0.735   1.932   1.00 0.00 ? 20 ARG A CB   8  
ATOM 6530  C CG   . ARG A 1 20 ? -11.676 -0.121  1.596   1.00 0.00 ? 20 ARG A CG   8  
ATOM 6531  C CD   . ARG A 1 20 ? -12.145 -1.056  2.748   1.00 0.00 ? 20 ARG A CD   8  
ATOM 6532  N NE   . ARG A 1 20 ? -11.947 -0.449  4.088   1.00 0.00 ? 20 ARG A NE   8  
ATOM 6533  C CZ   . ARG A 1 20 ? -12.702 0.581   4.528   1.00 0.00 ? 20 ARG A CZ   8  
ATOM 6534  N NH1  . ARG A 1 20 ? -13.610 1.144   3.736   1.00 0.00 ? 20 ARG A NH1  8  
ATOM 6535  N NH2  . ARG A 1 20 ? -12.512 1.021   5.767   1.00 0.00 ? 20 ARG A NH2  8  
ATOM 6536  H H    . ARG A 1 20 ? -8.175  1.944   1.897   1.00 0.00 ? 20 ARG A H    8  
ATOM 6537  H HA   . ARG A 1 20 ? -9.037  -0.686  2.854   1.00 0.00 ? 20 ARG A HA   8  
ATOM 6538  H HB2  . ARG A 1 20 ? -10.618 1.308   2.842   1.00 0.00 ? 20 ARG A HB2  8  
ATOM 6539  H HB3  . ARG A 1 20 ? -10.412 1.480   1.145   1.00 0.00 ? 20 ARG A HB3  8  
ATOM 6540  H HG2  . ARG A 1 20 ? -12.488 0.572   1.379   1.00 0.00 ? 20 ARG A HG2  8  
ATOM 6541  H HG3  . ARG A 1 20 ? -11.506 -0.608  0.620   1.00 0.00 ? 20 ARG A HG3  8  
ATOM 6542  H HD2  . ARG A 1 20 ? -13.211 -1.339  2.651   1.00 0.00 ? 20 ARG A HD2  8  
ATOM 6543  H HD3  . ARG A 1 20 ? -11.582 -1.990  2.735   1.00 0.00 ? 20 ARG A HD3  8  
ATOM 6544  H HE   . ARG A 1 20 ? -11.243 -0.721  4.769   1.00 0.00 ? 20 ARG A HE   8  
ATOM 6545  H HH11 . ARG A 1 20 ? -13.700 0.808   2.797   1.00 0.00 ? 20 ARG A HH11 8  
ATOM 6546  H HH12 . ARG A 1 20 ? -14.196 1.893   4.040   1.00 0.00 ? 20 ARG A HH12 8  
ATOM 6547  H HH21 . ARG A 1 20 ? -11.841 0.530   6.344   1.00 0.00 ? 20 ARG A HH21 8  
ATOM 6548  H HH22 . ARG A 1 20 ? -13.003 1.803   6.147   1.00 0.00 ? 20 ARG A HH22 8  
ATOM 6549  N N    . PHE A 1 21 ? -8.729  -2.059  0.798   1.00 0.00 ? 21 PHE A N    8  
ATOM 6550  C CA   . PHE A 1 21 ? -8.471  -2.909  -0.360  1.00 0.00 ? 21 PHE A CA   8  
ATOM 6551  C C    . PHE A 1 21 ? -9.341  -4.161  -0.165  1.00 0.00 ? 21 PHE A C    8  
ATOM 6552  O O    . PHE A 1 21 ? -9.489  -4.655  0.941   1.00 0.00 ? 21 PHE A O    8  
ATOM 6553  C CB   . PHE A 1 21 ? -6.975  -3.234  -0.426  1.00 0.00 ? 21 PHE A CB   8  
ATOM 6554  C CG   . PHE A 1 21 ? -6.657  -4.345  -1.391  1.00 0.00 ? 21 PHE A CG   8  
ATOM 6555  C CD1  . PHE A 1 21 ? -7.010  -4.250  -2.726  1.00 0.00 ? 21 PHE A CD1  8  
ATOM 6556  C CD2  . PHE A 1 21 ? -5.994  -5.481  -0.956  1.00 0.00 ? 21 PHE A CD2  8  
ATOM 6557  C CE1  . PHE A 1 21 ? -6.649  -5.235  -3.636  1.00 0.00 ? 21 PHE A CE1  8  
ATOM 6558  C CE2  . PHE A 1 21 ? -5.634  -6.479  -1.852  1.00 0.00 ? 21 PHE A CE2  8  
ATOM 6559  C CZ   . PHE A 1 21 ? -5.948  -6.352  -3.198  1.00 0.00 ? 21 PHE A CZ   8  
ATOM 6560  H H    . PHE A 1 21 ? -8.903  -2.516  1.682   1.00 0.00 ? 21 PHE A H    8  
ATOM 6561  H HA   . PHE A 1 21 ? -8.773  -2.408  -1.286  1.00 0.00 ? 21 PHE A HA   8  
ATOM 6562  H HB2  . PHE A 1 21 ? -6.417  -2.340  -0.725  1.00 0.00 ? 21 PHE A HB2  8  
ATOM 6563  H HB3  . PHE A 1 21 ? -6.624  -3.544  0.556   1.00 0.00 ? 21 PHE A HB3  8  
ATOM 6564  H HD1  . PHE A 1 21 ? -7.601  -3.404  -3.025  1.00 0.00 ? 21 PHE A HD1  8  
ATOM 6565  H HD2  . PHE A 1 21 ? -5.787  -5.572  0.096   1.00 0.00 ? 21 PHE A HD2  8  
ATOM 6566  H HE1  . PHE A 1 21 ? -6.924  -5.135  -4.676  1.00 0.00 ? 21 PHE A HE1  8  
ATOM 6567  H HE2  . PHE A 1 21 ? -5.111  -7.355  -1.500  1.00 0.00 ? 21 PHE A HE2  8  
ATOM 6568  H HZ   . PHE A 1 21 ? -5.657  -7.124  -3.896  1.00 0.00 ? 21 PHE A HZ   8  
ATOM 6569  N N    . GLN A 1 22 ? -9.947  -4.634  -1.261  1.00 0.00 ? 22 GLN A N    8  
ATOM 6570  C CA   . GLN A 1 22 ? -10.859 -5.773  -1.229  1.00 0.00 ? 22 GLN A CA   8  
ATOM 6571  C C    . GLN A 1 22 ? -12.011 -5.584  -0.202  1.00 0.00 ? 22 GLN A C    8  
ATOM 6572  O O    . GLN A 1 22 ? -12.600 -6.554  0.259   1.00 0.00 ? 22 GLN A O    8  
ATOM 6573  C CB   . GLN A 1 22 ? -10.147 -7.126  -0.930  1.00 0.00 ? 22 GLN A CB   8  
ATOM 6574  C CG   . GLN A 1 22 ? -8.996  -7.529  -1.881  1.00 0.00 ? 22 GLN A CG   8  
ATOM 6575  C CD   . GLN A 1 22 ? -8.144  -8.691  -1.329  1.00 0.00 ? 22 GLN A CD   8  
ATOM 6576  O OE1  . GLN A 1 22 ? -7.905  -9.660  -2.036  1.00 0.00 ? 22 GLN A OE1  8  
ATOM 6577  N NE2  . GLN A 1 22 ? -7.713  -8.595  -0.063  1.00 0.00 ? 22 GLN A NE2  8  
ATOM 6578  H H    . GLN A 1 22 ? -9.807  -4.138  -2.123  1.00 0.00 ? 22 GLN A H    8  
ATOM 6579  H HA   . GLN A 1 22 ? -11.302 -5.729  -2.220  1.00 0.00 ? 22 GLN A HA   8  
ATOM 6580  H HB2  . GLN A 1 22 ? -9.779  -7.079  0.096   1.00 0.00 ? 22 GLN A HB2  8  
ATOM 6581  H HB3  . GLN A 1 22 ? -10.880 -7.934  -0.943  1.00 0.00 ? 22 GLN A HB3  8  
ATOM 6582  H HG2  . GLN A 1 22 ? -9.364  -7.949  -2.840  1.00 0.00 ? 22 GLN A HG2  8  
ATOM 6583  H HG3  . GLN A 1 22 ? -8.363  -6.646  -2.047  1.00 0.00 ? 22 GLN A HG3  8  
ATOM 6584  H HE21 . GLN A 1 22 ? -7.837  -7.849  0.598   1.00 0.00 ? 22 GLN A HE21 8  
ATOM 6585  H HE22 . GLN A 1 22 ? -7.186  -9.374  0.294   1.00 0.00 ? 22 GLN A HE22 8  
ATOM 6586  N N    . GLY A 1 23 ? -12.296 -4.313  0.158   1.00 0.00 ? 23 GLY A N    8  
ATOM 6587  C CA   . GLY A 1 23 ? -13.351 -4.078  1.147   1.00 0.00 ? 23 GLY A CA   8  
ATOM 6588  C C    . GLY A 1 23 ? -12.890 -4.266  2.615   1.00 0.00 ? 23 GLY A C    8  
ATOM 6589  O O    . GLY A 1 23 ? -13.685 -4.146  3.538   1.00 0.00 ? 23 GLY A O    8  
ATOM 6590  H H    . GLY A 1 23 ? -11.799 -3.551  -0.271  1.00 0.00 ? 23 GLY A H    8  
ATOM 6591  H HA2  . GLY A 1 23 ? -13.681 -3.046  1.005   1.00 0.00 ? 23 GLY A HA2  8  
ATOM 6592  H HA3  . GLY A 1 23 ? -14.187 -4.754  0.939   1.00 0.00 ? 23 GLY A HA3  8  
ATOM 6593  N N    . THR A 1 24 ? -11.580 -4.518  2.796   1.00 0.00 ? 24 THR A N    8  
ATOM 6594  C CA   . THR A 1 24 ? -10.961 -4.674  4.110   1.00 0.00 ? 24 THR A CA   8  
ATOM 6595  C C    . THR A 1 24 ? -9.977  -3.505  4.319   1.00 0.00 ? 24 THR A C    8  
ATOM 6596  O O    . THR A 1 24 ? -9.387  -3.013  3.369   1.00 0.00 ? 24 THR A O    8  
ATOM 6597  C CB   . THR A 1 24 ? -10.229 -6.031  4.117   1.00 0.00 ? 24 THR A CB   8  
ATOM 6598  O OG1  . THR A 1 24 ? -11.063 -7.053  3.611   1.00 0.00 ? 24 THR A OG1  8  
ATOM 6599  C CG2  . THR A 1 24 ? -9.690  -6.429  5.499   1.00 0.00 ? 24 THR A CG2  8  
ATOM 6600  H H    . THR A 1 24 ? -10.971 -4.611  2.009   1.00 0.00 ? 24 THR A H    8  
ATOM 6601  H HA   . THR A 1 24 ? -11.736 -4.629  4.878   1.00 0.00 ? 24 THR A HA   8  
ATOM 6602  H HB   . THR A 1 24 ? -9.384  -5.976  3.426   1.00 0.00 ? 24 THR A HB   8  
ATOM 6603  H HG1  . THR A 1 24 ? -11.893 -7.055  4.074   1.00 0.00 ? 24 THR A HG1  8  
ATOM 6604  H HG21 . THR A 1 24 ? -9.223  -7.413  5.458   1.00 0.00 ? 24 THR A HG21 8  
ATOM 6605  H HG22 . THR A 1 24 ? -10.480 -6.464  6.249   1.00 0.00 ? 24 THR A HG22 8  
ATOM 6606  H HG23 . THR A 1 24 ? -8.930  -5.727  5.845   1.00 0.00 ? 24 THR A HG23 8  
ATOM 6607  N N    . SER A 1 25 ? -9.849  -3.053  5.585   1.00 0.00 ? 25 SER A N    8  
ATOM 6608  C CA   . SER A 1 25 ? -8.946  -1.943  5.884   1.00 0.00 ? 25 SER A CA   8  
ATOM 6609  C C    . SER A 1 25 ? -7.599  -2.510  6.360   1.00 0.00 ? 25 SER A C    8  
ATOM 6610  O O    . SER A 1 25 ? -7.559  -3.448  7.144   1.00 0.00 ? 25 SER A O    8  
ATOM 6611  C CB   . SER A 1 25 ? -9.586  -1.044  6.948   1.00 0.00 ? 25 SER A CB   8  
ATOM 6612  O OG   . SER A 1 25 ? -10.975 -0.863  6.690   1.00 0.00 ? 25 SER A OG   8  
ATOM 6613  H H    . SER A 1 25 ? -10.313 -3.491  6.350   1.00 0.00 ? 25 SER A H    8  
ATOM 6614  H HA   . SER A 1 25 ? -8.795  -1.361  4.974   1.00 0.00 ? 25 SER A HA   8  
ATOM 6615  H HB2  . SER A 1 25 ? -9.411  -1.410  7.968   1.00 0.00 ? 25 SER A HB2  8  
ATOM 6616  H HB3  . SER A 1 25 ? -9.108  -0.069  6.914   1.00 0.00 ? 25 SER A HB3  8  
ATOM 6617  H HG   . SER A 1 25 ? -11.437 -1.679  6.892   1.00 0.00 ? 25 SER A HG   8  
ATOM 6618  N N    . TYR A 1 26 ? -6.527  -1.903  5.820   1.00 0.00 ? 26 TYR A N    8  
ATOM 6619  C CA   . TYR A 1 26 ? -5.161  -2.327  6.090   1.00 0.00 ? 26 TYR A CA   8  
ATOM 6620  C C    . TYR A 1 26 ? -4.351  -1.153  6.662   1.00 0.00 ? 26 TYR A C    8  
ATOM 6621  O O    . TYR A 1 26 ? -4.319  -0.074  6.085   1.00 0.00 ? 26 TYR A O    8  
ATOM 6622  C CB   . TYR A 1 26 ? -4.500  -2.699  4.758   1.00 0.00 ? 26 TYR A CB   8  
ATOM 6623  C CG   . TYR A 1 26 ? -5.108  -3.894  4.077   1.00 0.00 ? 26 TYR A CG   8  
ATOM 6624  C CD1  . TYR A 1 26 ? -6.282  -3.794  3.341   1.00 0.00 ? 26 TYR A CD1  8  
ATOM 6625  C CD2  . TYR A 1 26 ? -4.473  -5.125  4.145   1.00 0.00 ? 26 TYR A CD2  8  
ATOM 6626  C CE1  . TYR A 1 26 ? -6.790  -4.910  2.698   1.00 0.00 ? 26 TYR A CE1  8  
ATOM 6627  C CE2  . TYR A 1 26 ? -4.985  -6.235  3.490   1.00 0.00 ? 26 TYR A CE2  8  
ATOM 6628  C CZ   . TYR A 1 26 ? -6.160  -6.135  2.765   1.00 0.00 ? 26 TYR A CZ   8  
ATOM 6629  O OH   . TYR A 1 26 ? -6.720  -7.206  2.091   1.00 0.00 ? 26 TYR A OH   8  
ATOM 6630  H H    . TYR A 1 26 ? -6.640  -1.145  5.175   1.00 0.00 ? 26 TYR A H    8  
ATOM 6631  H HA   . TYR A 1 26 ? -5.153  -3.164  6.792   1.00 0.00 ? 26 TYR A HA   8  
ATOM 6632  H HB2  . TYR A 1 26 ? -4.583  -1.852  4.072   1.00 0.00 ? 26 TYR A HB2  8  
ATOM 6633  H HB3  . TYR A 1 26 ? -3.441  -2.914  4.934   1.00 0.00 ? 26 TYR A HB3  8  
ATOM 6634  H HD1  . TYR A 1 26 ? -6.812  -2.855  3.240   1.00 0.00 ? 26 TYR A HD1  8  
ATOM 6635  H HD2  . TYR A 1 26 ? -3.557  -5.224  4.698   1.00 0.00 ? 26 TYR A HD2  8  
ATOM 6636  H HE1  . TYR A 1 26 ? -7.670  -4.820  2.100   1.00 0.00 ? 26 TYR A HE1  8  
ATOM 6637  H HE2  . TYR A 1 26 ? -4.430  -7.152  3.540   1.00 0.00 ? 26 TYR A HE2  8  
ATOM 6638  H HH   . TYR A 1 26 ? -6.220  -8.013  2.244   1.00 0.00 ? 26 TYR A HH   8  
ATOM 6639  N N    . ASP A 1 27 ? -3.664  -1.444  7.782   1.00 0.00 ? 27 ASP A N    8  
ATOM 6640  C CA   . ASP A 1 27 ? -2.798  -0.460  8.433   1.00 0.00 ? 27 ASP A CA   8  
ATOM 6641  C C    . ASP A 1 27 ? -1.354  -0.985  8.451   1.00 0.00 ? 27 ASP A C    8  
ATOM 6642  O O    . ASP A 1 27 ? -0.574  -0.707  9.353   1.00 0.00 ? 27 ASP A O    8  
ATOM 6643  C CB   . ASP A 1 27 ? -3.292  -0.202  9.865   1.00 0.00 ? 27 ASP A CB   8  
ATOM 6644  C CG   . ASP A 1 27 ? -4.579  0.622   9.830   1.00 0.00 ? 27 ASP A CG   8  
ATOM 6645  O OD1  . ASP A 1 27 ? -4.483  1.849   9.794   1.00 0.00 ? 27 ASP A OD1  8  
ATOM 6646  O OD2  . ASP A 1 27 ? -5.658  0.031   9.826   1.00 0.00 ? 27 ASP A OD2  8  
ATOM 6647  H H    . ASP A 1 27 ? -3.754  -2.348  8.197   1.00 0.00 ? 27 ASP A H    8  
ATOM 6648  H HA   . ASP A 1 27 ? -2.809  0.471   7.866   1.00 0.00 ? 27 ASP A HA   8  
ATOM 6649  H HB2  . ASP A 1 27 ? -3.464  -1.136  10.401  1.00 0.00 ? 27 ASP A HB2  8  
ATOM 6650  H HB3  . ASP A 1 27 ? -2.553  0.361   10.438  1.00 0.00 ? 27 ASP A HB3  8  
ATOM 6651  N N    . SER A 1 28 ? -1.044  -1.782  7.412   1.00 0.00 ? 28 SER A N    8  
ATOM 6652  C CA   . SER A 1 28 ? 0.274   -2.384  7.351   1.00 0.00 ? 28 SER A CA   8  
ATOM 6653  C C    . SER A 1 28 ? 0.490   -2.920  5.929   1.00 0.00 ? 28 SER A C    8  
ATOM 6654  O O    . SER A 1 28 ? -0.434  -3.024  5.129   1.00 0.00 ? 28 SER A O    8  
ATOM 6655  C CB   . SER A 1 28 ? 0.319   -3.527  8.400   1.00 0.00 ? 28 SER A CB   8  
ATOM 6656  O OG   . SER A 1 28 ? -0.813  -4.364  8.183   1.00 0.00 ? 28 SER A OG   8  
ATOM 6657  H H    . SER A 1 28 ? -1.678  -2.023  6.678   1.00 0.00 ? 28 SER A H    8  
ATOM 6658  H HA   . SER A 1 28 ? 1.023   -1.603  7.519   1.00 0.00 ? 28 SER A HA   8  
ATOM 6659  H HB2  . SER A 1 28 ? 1.252   -4.116  8.289   1.00 0.00 ? 28 SER A HB2  8  
ATOM 6660  H HB3  . SER A 1 28 ? 0.224   -3.102  9.423   1.00 0.00 ? 28 SER A HB3  8  
ATOM 6661  H HG   . SER A 1 28 ? -0.796  -5.131  8.751   1.00 0.00 ? 28 SER A HG   8  
ATOM 6662  N N    . CYS A 1 29 ? 1.770   -3.266  5.697   1.00 0.00 ? 29 CYS A N    8  
ATOM 6663  C CA   . CYS A 1 29 ? 2.234   -3.875  4.455   1.00 0.00 ? 29 CYS A CA   8  
ATOM 6664  C C    . CYS A 1 29 ? 1.412   -5.138  4.105   1.00 0.00 ? 29 CYS A C    8  
ATOM 6665  O O    . CYS A 1 29 ? 1.242   -5.996  4.962   1.00 0.00 ? 29 CYS A O    8  
ATOM 6666  C CB   . CYS A 1 29 ? 3.659   -4.338  4.754   1.00 0.00 ? 29 CYS A CB   8  
ATOM 6667  S SG   . CYS A 1 29 ? 4.718   -3.010  5.375   1.00 0.00 ? 29 CYS A SG   8  
ATOM 6668  H H    . CYS A 1 29 ? 2.463   -3.080  6.396   1.00 0.00 ? 29 CYS A H    8  
ATOM 6669  H HA   . CYS A 1 29 ? 2.214   -3.118  3.670   1.00 0.00 ? 29 CYS A HA   8  
ATOM 6670  H HB2  . CYS A 1 29 ? 3.653   -5.140  5.503   1.00 0.00 ? 29 CYS A HB2  8  
ATOM 6671  H HB3  . CYS A 1 29 ? 4.104   -4.737  3.844   1.00 0.00 ? 29 CYS A HB3  8  
ATOM 6672  N N    . THR A 1 30 ? 0.925   -5.232  2.844   1.00 0.00 ? 30 THR A N    8  
ATOM 6673  C CA   . THR A 1 30 ? 0.139   -6.404  2.451   1.00 0.00 ? 30 THR A CA   8  
ATOM 6674  C C    . THR A 1 30 ? 0.710   -7.010  1.156   1.00 0.00 ? 30 THR A C    8  
ATOM 6675  O O    . THR A 1 30 ? 1.197   -6.301  0.285   1.00 0.00 ? 30 THR A O    8  
ATOM 6676  C CB   . THR A 1 30 ? -1.341  -5.984  2.339   1.00 0.00 ? 30 THR A CB   8  
ATOM 6677  O OG1  . THR A 1 30 ? -2.183  -7.087  2.605   1.00 0.00 ? 30 THR A OG1  8  
ATOM 6678  C CG2  . THR A 1 30 ? -1.706  -5.264  1.015   1.00 0.00 ? 30 THR A CG2  8  
ATOM 6679  H H    . THR A 1 30 ? 1.061   -4.531  2.135   1.00 0.00 ? 30 THR A H    8  
ATOM 6680  H HA   . THR A 1 30 ? 0.232   -7.161  3.232   1.00 0.00 ? 30 THR A HA   8  
ATOM 6681  H HB   . THR A 1 30 ? -1.521  -5.302  3.181   1.00 0.00 ? 30 THR A HB   8  
ATOM 6682  H HG1  . THR A 1 30 ? -2.330  -7.603  1.823   1.00 0.00 ? 30 THR A HG1  8  
ATOM 6683  H HG21 . THR A 1 30 ? -2.735  -4.900  1.021   1.00 0.00 ? 30 THR A HG21 8  
ATOM 6684  H HG22 . THR A 1 30 ? -1.604  -5.911  0.140   1.00 0.00 ? 30 THR A HG22 8  
ATOM 6685  H HG23 . THR A 1 30 ? -1.054  -4.409  0.828   1.00 0.00 ? 30 THR A HG23 8  
ATOM 6686  N N    . THR A 1 31 ? 0.603   -8.351  1.074   1.00 0.00 ? 31 THR A N    8  
ATOM 6687  C CA   . THR A 1 31 ? 1.071   -9.099  -0.100  1.00 0.00 ? 31 THR A CA   8  
ATOM 6688  C C    . THR A 1 31 ? -0.086  -9.428  -1.060  1.00 0.00 ? 31 THR A C    8  
ATOM 6689  O O    . THR A 1 31 ? 0.115   -9.677  -2.241  1.00 0.00 ? 31 THR A O    8  
ATOM 6690  C CB   . THR A 1 31 ? 1.799   -10.385 0.355   1.00 0.00 ? 31 THR A CB   8  
ATOM 6691  O OG1  . THR A 1 31 ? 1.875   -10.352 1.775   1.00 0.00 ? 31 THR A OG1  8  
ATOM 6692  C CG2  . THR A 1 31 ? 3.194   -10.486 -0.287  1.00 0.00 ? 31 THR A CG2  8  
ATOM 6693  H H    . THR A 1 31 ? 0.259   -8.865  1.860   1.00 0.00 ? 31 THR A H    8  
ATOM 6694  H HA   . THR A 1 31 ? 1.754   -8.463  -0.660  1.00 0.00 ? 31 THR A HA   8  
ATOM 6695  H HB   . THR A 1 31 ? 1.227   -11.273 0.050   1.00 0.00 ? 31 THR A HB   8  
ATOM 6696  H HG1  . THR A 1 31 ? 2.361   -11.103 2.103   1.00 0.00 ? 31 THR A HG1  8  
ATOM 6697  H HG21 . THR A 1 31 ? 3.824   -9.646  0.000   1.00 0.00 ? 31 THR A HG21 8  
ATOM 6698  H HG22 . THR A 1 31 ? 3.116   -10.469 -1.375  1.00 0.00 ? 31 THR A HG22 8  
ATOM 6699  H HG23 . THR A 1 31 ? 3.710   -11.407 -0.016  1.00 0.00 ? 31 THR A HG23 8  
ATOM 6700  N N    . GLU A 1 32 ? -1.309  -9.421  -0.493  1.00 0.00 ? 32 GLU A N    8  
ATOM 6701  C CA   . GLU A 1 32 ? -2.492  -9.750  -1.290  1.00 0.00 ? 32 GLU A CA   8  
ATOM 6702  C C    . GLU A 1 32 ? -2.569  -8.834  -2.526  1.00 0.00 ? 32 GLU A C    8  
ATOM 6703  O O    . GLU A 1 32 ? -2.582  -7.616  -2.412  1.00 0.00 ? 32 GLU A O    8  
ATOM 6704  C CB   . GLU A 1 32 ? -3.763  -9.563  -0.450  1.00 0.00 ? 32 GLU A CB   8  
ATOM 6705  C CG   . GLU A 1 32 ? -3.900  -10.559 0.712   1.00 0.00 ? 32 GLU A CG   8  
ATOM 6706  C CD   . GLU A 1 32 ? -5.081  -10.136 1.590   1.00 0.00 ? 32 GLU A CD   8  
ATOM 6707  O OE1  . GLU A 1 32 ? -4.891  -9.288  2.456   1.00 0.00 ? 32 GLU A OE1  8  
ATOM 6708  O OE2  . GLU A 1 32 ? -6.186  -10.629 1.388   1.00 0.00 ? 32 GLU A OE2  8  
ATOM 6709  H H    . GLU A 1 32 ? -1.378  -9.198  0.474   1.00 0.00 ? 32 GLU A H    8  
ATOM 6710  H HA   . GLU A 1 32 ? -2.386  -10.791 -1.601  1.00 0.00 ? 32 GLU A HA   8  
ATOM 6711  H HB2  . GLU A 1 32 ? -3.791  -8.540  -0.070  1.00 0.00 ? 32 GLU A HB2  8  
ATOM 6712  H HB3  . GLU A 1 32 ? -4.645  -9.667  -1.085  1.00 0.00 ? 32 GLU A HB3  8  
ATOM 6713  H HG2  . GLU A 1 32 ? -4.080  -11.570 0.340   1.00 0.00 ? 32 GLU A HG2  8  
ATOM 6714  H HG3  . GLU A 1 32 ? -3.005  -10.597 1.333   1.00 0.00 ? 32 GLU A HG3  8  
ATOM 6715  N N    . GLY A 1 33 ? -2.597  -9.496  -3.698  1.00 0.00 ? 33 GLY A N    8  
ATOM 6716  C CA   . GLY A 1 33 ? -2.651  -8.779  -4.967  1.00 0.00 ? 33 GLY A CA   8  
ATOM 6717  C C    . GLY A 1 33 ? -1.368  -8.974  -5.786  1.00 0.00 ? 33 GLY A C    8  
ATOM 6718  O O    . GLY A 1 33 ? -1.369  -8.775  -6.993  1.00 0.00 ? 33 GLY A O    8  
ATOM 6719  H H    . GLY A 1 33 ? -2.573  -10.495 -3.691  1.00 0.00 ? 33 GLY A H    8  
ATOM 6720  H HA2  . GLY A 1 33 ? -3.496  -9.191  -5.524  1.00 0.00 ? 33 GLY A HA2  8  
ATOM 6721  H HA3  . GLY A 1 33 ? -2.814  -7.710  -4.797  1.00 0.00 ? 33 GLY A HA3  8  
ATOM 6722  N N    . ARG A 1 34 ? -0.286  -9.373  -5.086  1.00 0.00 ? 34 ARG A N    8  
ATOM 6723  C CA   . ARG A 1 34 ? 0.985   -9.594  -5.803  1.00 0.00 ? 34 ARG A CA   8  
ATOM 6724  C C    . ARG A 1 34 ? 1.434   -11.044 -5.592  1.00 0.00 ? 34 ARG A C    8  
ATOM 6725  O O    . ARG A 1 34 ? 1.266   -11.621 -4.526  1.00 0.00 ? 34 ARG A O    8  
ATOM 6726  C CB   . ARG A 1 34 ? 2.068   -8.676  -5.228  1.00 0.00 ? 34 ARG A CB   8  
ATOM 6727  C CG   . ARG A 1 34 ? 1.741   -7.185  -5.396  1.00 0.00 ? 34 ARG A CG   8  
ATOM 6728  C CD   . ARG A 1 34 ? 3.002   -6.319  -5.208  1.00 0.00 ? 34 ARG A CD   8  
ATOM 6729  N NE   . ARG A 1 34 ? 3.802   -6.371  -6.443  1.00 0.00 ? 34 ARG A NE   8  
ATOM 6730  C CZ   . ARG A 1 34 ? 3.703   -5.442  -7.422  1.00 0.00 ? 34 ARG A CZ   8  
ATOM 6731  N NH1  . ARG A 1 34 ? 2.877   -4.412  -7.292  1.00 0.00 ? 34 ARG A NH1  8  
ATOM 6732  N NH2  . ARG A 1 34 ? 4.434   -5.573  -8.521  1.00 0.00 ? 34 ARG A NH2  8  
ATOM 6733  H H    . ARG A 1 34 ? -0.361  -9.521  -4.081  1.00 0.00 ? 34 ARG A H    8  
ATOM 6734  H HA   . ARG A 1 34 ? 0.899   -9.405  -6.896  1.00 0.00 ? 34 ARG A HA   8  
ATOM 6735  H HB2  . ARG A 1 34 ? 2.176   -8.887  -4.135  1.00 0.00 ? 34 ARG A HB2  8  
ATOM 6736  H HB3  . ARG A 1 34 ? 2.988   -8.889  -5.813  1.00 0.00 ? 34 ARG A HB3  8  
ATOM 6737  H HG2  . ARG A 1 34 ? 1.317   -6.997  -6.384  1.00 0.00 ? 34 ARG A HG2  8  
ATOM 6738  H HG3  . ARG A 1 34 ? 0.950   -6.920  -4.692  1.00 0.00 ? 34 ARG A HG3  8  
ATOM 6739  H HD2  . ARG A 1 34 ? 2.761   -5.273  -4.980  1.00 0.00 ? 34 ARG A HD2  8  
ATOM 6740  H HD3  . ARG A 1 34 ? 3.625   -6.699  -4.384  1.00 0.00 ? 34 ARG A HD3  8  
ATOM 6741  H HE   . ARG A 1 34 ? 4.417   -7.157  -6.637  1.00 0.00 ? 34 ARG A HE   8  
ATOM 6742  H HH11 . ARG A 1 34 ? 2.286   -4.365  -6.489  1.00 0.00 ? 34 ARG A HH11 8  
ATOM 6743  H HH12 . ARG A 1 34 ? 2.816   -3.662  -7.967  1.00 0.00 ? 34 ARG A HH12 8  
ATOM 6744  H HH21 . ARG A 1 34 ? 5.007   -6.402  -8.609  1.00 0.00 ? 34 ARG A HH21 8  
ATOM 6745  H HH22 . ARG A 1 34 ? 4.428   -4.899  -9.257  1.00 0.00 ? 34 ARG A HH22 8  
ATOM 6746  N N    . THR A 1 35 ? 2.037   -11.581 -6.667  1.00 0.00 ? 35 THR A N    8  
ATOM 6747  C CA   . THR A 1 35 ? 2.567   -12.940 -6.647  1.00 0.00 ? 35 THR A CA   8  
ATOM 6748  C C    . THR A 1 35 ? 4.056   -12.927 -7.036  1.00 0.00 ? 35 THR A C    8  
ATOM 6749  O O    . THR A 1 35 ? 4.586   -13.916 -7.523  1.00 0.00 ? 35 THR A O    8  
ATOM 6750  C CB   . THR A 1 35 ? 1.744   -13.782 -7.636  1.00 0.00 ? 35 THR A CB   8  
ATOM 6751  O OG1  . THR A 1 35 ? 1.707   -13.145 -8.904  1.00 0.00 ? 35 THR A OG1  8  
ATOM 6752  C CG2  . THR A 1 35 ? 0.291   -13.937 -7.172  1.00 0.00 ? 35 THR A CG2  8  
ATOM 6753  H H    . THR A 1 35 ? 2.112   -11.063 -7.518  1.00 0.00 ? 35 THR A H    8  
ATOM 6754  H HA   . THR A 1 35 ? 2.492   -13.352 -5.639  1.00 0.00 ? 35 THR A HA   8  
ATOM 6755  H HB   . THR A 1 35 ? 2.171   -14.790 -7.722  1.00 0.00 ? 35 THR A HB   8  
ATOM 6756  H HG1  . THR A 1 35 ? 2.578   -13.141 -9.293  1.00 0.00 ? 35 THR A HG1  8  
ATOM 6757  H HG21 . THR A 1 35 ? -0.266  -14.579 -7.854  1.00 0.00 ? 35 THR A HG21 8  
ATOM 6758  H HG22 . THR A 1 35 ? -0.223  -12.976 -7.134  1.00 0.00 ? 35 THR A HG22 8  
ATOM 6759  H HG23 . THR A 1 35 ? 0.241   -14.382 -6.178  1.00 0.00 ? 35 THR A HG23 8  
ATOM 6760  N N    . ASP A 1 36 ? 4.683   -11.752 -6.820  1.00 0.00 ? 36 ASP A N    8  
ATOM 6761  C CA   . ASP A 1 36 ? 6.078   -11.528 -7.204  1.00 0.00 ? 36 ASP A CA   8  
ATOM 6762  C C    . ASP A 1 36 ? 7.021   -11.361 -5.992  1.00 0.00 ? 36 ASP A C    8  
ATOM 6763  O O    . ASP A 1 36 ? 8.214   -11.141 -6.158  1.00 0.00 ? 36 ASP A O    8  
ATOM 6764  C CB   . ASP A 1 36 ? 6.141   -10.299 -8.130  1.00 0.00 ? 36 ASP A CB   8  
ATOM 6765  C CG   . ASP A 1 36 ? 5.617   -8.998  -7.498  1.00 0.00 ? 36 ASP A CG   8  
ATOM 6766  O OD1  . ASP A 1 36 ? 5.352   -8.953  -6.298  1.00 0.00 ? 36 ASP A OD1  8  
ATOM 6767  O OD2  . ASP A 1 36 ? 5.472   -8.015  -8.219  1.00 0.00 ? 36 ASP A OD2  8  
ATOM 6768  H H    . ASP A 1 36 ? 4.204   -10.958 -6.445  1.00 0.00 ? 36 ASP A H    8  
ATOM 6769  H HA   . ASP A 1 36 ? 6.435   -12.399 -7.756  1.00 0.00 ? 36 ASP A HA   8  
ATOM 6770  H HB2  . ASP A 1 36 ? 7.166   -10.129 -8.463  1.00 0.00 ? 36 ASP A HB2  8  
ATOM 6771  H HB3  . ASP A 1 36 ? 5.548   -10.492 -9.024  1.00 0.00 ? 36 ASP A HB3  8  
ATOM 6772  N N    . GLY A 1 37 ? 6.446   -11.505 -4.776  1.00 0.00 ? 37 GLY A N    8  
ATOM 6773  C CA   . GLY A 1 37 ? 7.256   -11.441 -3.561  1.00 0.00 ? 37 GLY A CA   8  
ATOM 6774  C C    . GLY A 1 37 ? 7.163   -10.107 -2.814  1.00 0.00 ? 37 GLY A C    8  
ATOM 6775  O O    . GLY A 1 37 ? 7.480   -10.031 -1.631  1.00 0.00 ? 37 GLY A O    8  
ATOM 6776  H H    . GLY A 1 37 ? 5.468   -11.679 -4.696  1.00 0.00 ? 37 GLY A H    8  
ATOM 6777  H HA2  . GLY A 1 37 ? 6.916   -12.247 -2.909  1.00 0.00 ? 37 GLY A HA2  8  
ATOM 6778  H HA3  . GLY A 1 37 ? 8.309   -11.598 -3.823  1.00 0.00 ? 37 GLY A HA3  8  
ATOM 6779  N N    . TYR A 1 38 ? 6.763   -9.053  -3.548  1.00 0.00 ? 38 TYR A N    8  
ATOM 6780  C CA   . TYR A 1 38 ? 6.785   -7.728  -2.927  1.00 0.00 ? 38 TYR A CA   8  
ATOM 6781  C C    . TYR A 1 38 ? 5.493   -7.456  -2.151  1.00 0.00 ? 38 TYR A C    8  
ATOM 6782  O O    . TYR A 1 38 ? 4.418   -7.965  -2.444  1.00 0.00 ? 38 TYR A O    8  
ATOM 6783  C CB   . TYR A 1 38 ? 7.140   -6.657  -3.975  1.00 0.00 ? 38 TYR A CB   8  
ATOM 6784  C CG   . TYR A 1 38 ? 8.259   -7.173  -4.843  1.00 0.00 ? 38 TYR A CG   8  
ATOM 6785  C CD1  . TYR A 1 38 ? 9.454   -7.621  -4.296  1.00 0.00 ? 38 TYR A CD1  8  
ATOM 6786  C CD2  . TYR A 1 38 ? 8.100   -7.294  -6.212  1.00 0.00 ? 38 TYR A CD2  8  
ATOM 6787  C CE1  . TYR A 1 38 ? 10.414  -8.225  -5.077  1.00 0.00 ? 38 TYR A CE1  8  
ATOM 6788  C CE2  . TYR A 1 38 ? 9.056   -7.899  -6.994  1.00 0.00 ? 38 TYR A CE2  8  
ATOM 6789  C CZ   . TYR A 1 38 ? 10.220  -8.386  -6.433  1.00 0.00 ? 38 TYR A CZ   8  
ATOM 6790  O OH   . TYR A 1 38 ? 11.162  -9.033  -7.203  1.00 0.00 ? 38 TYR A OH   8  
ATOM 6791  H H    . TYR A 1 38 ? 6.488   -9.152  -4.509  1.00 0.00 ? 38 TYR A H    8  
ATOM 6792  H HA   . TYR A 1 38 ? 7.599   -7.731  -2.198  1.00 0.00 ? 38 TYR A HA   8  
ATOM 6793  H HB2  . TYR A 1 38 ? 6.273   -6.422  -4.595  1.00 0.00 ? 38 TYR A HB2  8  
ATOM 6794  H HB3  . TYR A 1 38 ? 7.442   -5.724  -3.496  1.00 0.00 ? 38 TYR A HB3  8  
ATOM 6795  H HD1  . TYR A 1 38 ? 9.679   -7.553  -3.257  1.00 0.00 ? 38 TYR A HD1  8  
ATOM 6796  H HD2  . TYR A 1 38 ? 7.227   -6.957  -6.720  1.00 0.00 ? 38 TYR A HD2  8  
ATOM 6797  H HE1  . TYR A 1 38 ? 11.284  -8.581  -4.577  1.00 0.00 ? 38 TYR A HE1  8  
ATOM 6798  H HE2  . TYR A 1 38 ? 8.825   -7.985  -8.029  1.00 0.00 ? 38 TYR A HE2  8  
ATOM 6799  H HH   . TYR A 1 38 ? 10.757  -9.806  -7.577  1.00 0.00 ? 38 TYR A HH   8  
ATOM 6800  N N    . ARG A 1 39 ? 5.712   -6.632  -1.116  1.00 0.00 ? 39 ARG A N    8  
ATOM 6801  C CA   . ARG A 1 39 ? 4.618   -6.233  -0.213  1.00 0.00 ? 39 ARG A CA   8  
ATOM 6802  C C    . ARG A 1 39 ? 4.373   -4.753  -0.518  1.00 0.00 ? 39 ARG A C    8  
ATOM 6803  O O    . ARG A 1 39 ? 5.321   -3.987  -0.663  1.00 0.00 ? 39 ARG A O    8  
ATOM 6804  C CB   . ARG A 1 39 ? 5.127   -6.427  1.218   1.00 0.00 ? 39 ARG A CB   8  
ATOM 6805  C CG   . ARG A 1 39 ? 5.389   -7.899  1.594   1.00 0.00 ? 39 ARG A CG   8  
ATOM 6806  C CD   . ARG A 1 39 ? 6.248   -7.988  2.891   1.00 0.00 ? 39 ARG A CD   8  
ATOM 6807  N NE   . ARG A 1 39 ? 7.458   -7.159  2.822   1.00 0.00 ? 39 ARG A NE   8  
ATOM 6808  C CZ   . ARG A 1 39 ? 8.542   -7.531  2.109   1.00 0.00 ? 39 ARG A CZ   8  
ATOM 6809  N NH1  . ARG A 1 39 ? 8.674   -8.756  1.619   1.00 0.00 ? 39 ARG A NH1  8  
ATOM 6810  N NH2  . ARG A 1 39 ? 9.502   -6.647  1.923   1.00 0.00 ? 39 ARG A NH2  8  
ATOM 6811  H H    . ARG A 1 39 ? 6.663   -6.277  -1.039  1.00 0.00 ? 39 ARG A H    8  
ATOM 6812  H HA   . ARG A 1 39 ? 3.670   -6.793  -0.369  1.00 0.00 ? 39 ARG A HA   8  
ATOM 6813  H HB2  . ARG A 1 39 ? 6.024   -5.819  1.335   1.00 0.00 ? 39 ARG A HB2  8  
ATOM 6814  H HB3  . ARG A 1 39 ? 4.406   -6.043  1.932   1.00 0.00 ? 39 ARG A HB3  8  
ATOM 6815  H HG2  . ARG A 1 39 ? 4.405   -8.362  1.774   1.00 0.00 ? 39 ARG A HG2  8  
ATOM 6816  H HG3  . ARG A 1 39 ? 5.832   -8.460  0.746   1.00 0.00 ? 39 ARG A HG3  8  
ATOM 6817  H HD2  . ARG A 1 39 ? 5.699   -7.603  3.753   1.00 0.00 ? 39 ARG A HD2  8  
ATOM 6818  H HD3  . ARG A 1 39 ? 6.545   -9.011  3.139   1.00 0.00 ? 39 ARG A HD3  8  
ATOM 6819  H HE   . ARG A 1 39 ? 7.565   -6.297  3.353   1.00 0.00 ? 39 ARG A HE   8  
ATOM 6820  H HH11 . ARG A 1 39 ? 7.903   -9.384  1.542   1.00 0.00 ? 39 ARG A HH11 8  
ATOM 6821  H HH12 . ARG A 1 39 ? 9.604   -9.066  1.360   1.00 0.00 ? 39 ARG A HH12 8  
ATOM 6822  H HH21 . ARG A 1 39 ? 9.377   -5.714  2.275   1.00 0.00 ? 39 ARG A HH21 8  
ATOM 6823  H HH22 . ARG A 1 39 ? 10.369  -6.900  1.468   1.00 0.00 ? 39 ARG A HH22 8  
ATOM 6824  N N    . TRP A 1 40 ? 3.078   -4.411  -0.661  1.00 0.00 ? 40 TRP A N    8  
ATOM 6825  C CA   . TRP A 1 40 ? 2.686   -3.066  -1.053  1.00 0.00 ? 40 TRP A CA   8  
ATOM 6826  C C    . TRP A 1 40 ? 1.727   -2.466  -0.012  1.00 0.00 ? 40 TRP A C    8  
ATOM 6827  O O    . TRP A 1 40 ? 1.170   -3.167  0.827   1.00 0.00 ? 40 TRP A O    8  
ATOM 6828  C CB   . TRP A 1 40 ? 2.052   -3.122  -2.460  1.00 0.00 ? 40 TRP A CB   8  
ATOM 6829  C CG   . TRP A 1 40 ? 0.735   -3.879  -2.451  1.00 0.00 ? 40 TRP A CG   8  
ATOM 6830  C CD1  . TRP A 1 40 ? 0.583   -5.266  -2.538  1.00 0.00 ? 40 TRP A CD1  8  
ATOM 6831  C CD2  . TRP A 1 40 ? -0.601  -3.333  -2.358  1.00 0.00 ? 40 TRP A CD2  8  
ATOM 6832  N NE1  . TRP A 1 40 ? -0.732  -5.578  -2.513  1.00 0.00 ? 40 TRP A NE1  8  
ATOM 6833  C CE2  . TRP A 1 40 ? -1.490  -4.427  -2.406  1.00 0.00 ? 40 TRP A CE2  8  
ATOM 6834  C CE3  . TRP A 1 40 ? -1.099  -2.063  -2.237  1.00 0.00 ? 40 TRP A CE3  8  
ATOM 6835  C CZ2  . TRP A 1 40 ? -2.835  -4.223  -2.337  1.00 0.00 ? 40 TRP A CZ2  8  
ATOM 6836  C CZ3  . TRP A 1 40 ? -2.480  -1.844  -2.161  1.00 0.00 ? 40 TRP A CZ3  8  
ATOM 6837  C CH2  . TRP A 1 40 ? -3.348  -2.935  -2.215  1.00 0.00 ? 40 TRP A CH2  8  
ATOM 6838  H H    . TRP A 1 40 ? 2.339   -5.067  -0.492  1.00 0.00 ? 40 TRP A H    8  
ATOM 6839  H HA   . TRP A 1 40 ? 3.589   -2.467  -1.077  1.00 0.00 ? 40 TRP A HA   8  
ATOM 6840  H HB2  . TRP A 1 40 ? 1.901   -2.127  -2.866  1.00 0.00 ? 40 TRP A HB2  8  
ATOM 6841  H HB3  . TRP A 1 40 ? 2.731   -3.586  -3.173  1.00 0.00 ? 40 TRP A HB3  8  
ATOM 6842  H HD1  . TRP A 1 40 ? 1.379   -5.992  -2.594  1.00 0.00 ? 40 TRP A HD1  8  
ATOM 6843  H HE1  . TRP A 1 40 ? -1.121  -6.480  -2.547  1.00 0.00 ? 40 TRP A HE1  8  
ATOM 6844  H HE3  . TRP A 1 40 ? -0.400  -1.246  -2.190  1.00 0.00 ? 40 TRP A HE3  8  
ATOM 6845  H HZ2  . TRP A 1 40 ? -3.492  -5.074  -2.383  1.00 0.00 ? 40 TRP A HZ2  8  
ATOM 6846  H HZ3  . TRP A 1 40 ? -2.897  -0.847  -2.060  1.00 0.00 ? 40 TRP A HZ3  8  
ATOM 6847  H HH2  . TRP A 1 40 ? -4.418  -2.799  -2.160  1.00 0.00 ? 40 TRP A HH2  8  
ATOM 6848  N N    . CYS A 1 41 ? 1.562   -1.136  -0.135  1.00 0.00 ? 41 CYS A N    8  
ATOM 6849  C CA   . CYS A 1 41 ? 0.630   -0.378  0.678   1.00 0.00 ? 41 CYS A CA   8  
ATOM 6850  C C    . CYS A 1 41 ? -0.168  0.545   -0.259  1.00 0.00 ? 41 CYS A C    8  
ATOM 6851  O O    . CYS A 1 41 ? 0.350   0.996   -1.275  1.00 0.00 ? 41 CYS A O    8  
ATOM 6852  C CB   . CYS A 1 41 ? 1.417   0.458   1.684   1.00 0.00 ? 41 CYS A CB   8  
ATOM 6853  S SG   . CYS A 1 41 ? 2.410   1.723   0.836   1.00 0.00 ? 41 CYS A SG   8  
ATOM 6854  H H    . CYS A 1 41 ? 2.053   -0.589  -0.814  1.00 0.00 ? 41 CYS A H    8  
ATOM 6855  H HA   . CYS A 1 41 ? -0.033  -1.082  1.178   1.00 0.00 ? 41 CYS A HA   8  
ATOM 6856  H HB2  . CYS A 1 41 ? 0.636   0.979   2.295   1.00 0.00 ? 41 CYS A HB2  8  
ATOM 6857  H HB3  . CYS A 1 41 ? 2.117   -0.225  2.239   1.00 0.00 ? 41 CYS A HB3  8  
ATOM 6858  N N    . GLY A 1 42 ? -1.431  0.819   0.118   1.00 0.00 ? 42 GLY A N    8  
ATOM 6859  C CA   . GLY A 1 42 ? -2.211  1.775   -0.659  1.00 0.00 ? 42 GLY A CA   8  
ATOM 6860  C C    . GLY A 1 42 ? -1.712  3.186   -0.316  1.00 0.00 ? 42 GLY A C    8  
ATOM 6861  O O    . GLY A 1 42 ? -1.069  3.387   0.708   1.00 0.00 ? 42 GLY A O    8  
ATOM 6862  H H    . GLY A 1 42 ? -1.831  0.425   0.946   1.00 0.00 ? 42 GLY A H    8  
ATOM 6863  H HA2  . GLY A 1 42 ? -2.106  1.549   -1.723  1.00 0.00 ? 42 GLY A HA2  8  
ATOM 6864  H HA3  . GLY A 1 42 ? -3.255  1.670   -0.358  1.00 0.00 ? 42 GLY A HA3  8  
ATOM 6865  N N    . THR A 1 43 ? -2.039  4.143   -1.207  1.00 0.00 ? 43 THR A N    8  
ATOM 6866  C CA   . THR A 1 43 ? -1.599  5.528   -0.982  1.00 0.00 ? 43 THR A CA   8  
ATOM 6867  C C    . THR A 1 43 ? -2.777  6.501   -0.877  1.00 0.00 ? 43 THR A C    8  
ATOM 6868  O O    . THR A 1 43 ? -2.626  7.709   -1.007  1.00 0.00 ? 43 THR A O    8  
ATOM 6869  C CB   . THR A 1 43 ? -0.591  5.951   -2.067  1.00 0.00 ? 43 THR A CB   8  
ATOM 6870  O OG1  . THR A 1 43 ? -0.511  4.967   -3.077  1.00 0.00 ? 43 THR A OG1  8  
ATOM 6871  C CG2  . THR A 1 43 ? 0.808   6.118   -1.472  1.00 0.00 ? 43 THR A CG2  8  
ATOM 6872  H H    . THR A 1 43 ? -2.546  3.892   -2.033  1.00 0.00 ? 43 THR A H    8  
ATOM 6873  H HA   . THR A 1 43 ? -1.127  5.582   -0.001  1.00 0.00 ? 43 THR A HA   8  
ATOM 6874  H HB   . THR A 1 43 ? -0.857  6.912   -2.524  1.00 0.00 ? 43 THR A HB   8  
ATOM 6875  H HG1  . THR A 1 43 ? -1.382  4.787   -3.430  1.00 0.00 ? 43 THR A HG1  8  
ATOM 6876  H HG21 . THR A 1 43 ? 0.816   6.938   -0.757  1.00 0.00 ? 43 THR A HG21 8  
ATOM 6877  H HG22 . THR A 1 43 ? 1.543   6.353   -2.237  1.00 0.00 ? 43 THR A HG22 8  
ATOM 6878  H HG23 . THR A 1 43 ? 1.141   5.215   -0.959  1.00 0.00 ? 43 THR A HG23 8  
ATOM 6879  N N    . THR A 1 44 ? -3.943  5.907   -0.608  1.00 0.00 ? 44 THR A N    8  
ATOM 6880  C CA   . THR A 1 44 ? -5.152  6.670   -0.380  1.00 0.00 ? 44 THR A CA   8  
ATOM 6881  C C    . THR A 1 44 ? -5.892  5.860   0.677   1.00 0.00 ? 44 THR A C    8  
ATOM 6882  O O    . THR A 1 44 ? -5.536  4.716   0.944   1.00 0.00 ? 44 THR A O    8  
ATOM 6883  C CB   . THR A 1 44 ? -5.985  6.819   -1.667  1.00 0.00 ? 44 THR A CB   8  
ATOM 6884  O OG1  . THR A 1 44 ? -6.501  5.545   -2.017  1.00 0.00 ? 44 THR A OG1  8  
ATOM 6885  C CG2  . THR A 1 44 ? -5.155  7.408   -2.819  1.00 0.00 ? 44 THR A CG2  8  
ATOM 6886  H H    . THR A 1 44 ? -4.042  4.918   -0.488  1.00 0.00 ? 44 THR A H    8  
ATOM 6887  H HA   . THR A 1 44 ? -4.882  7.643   0.035   1.00 0.00 ? 44 THR A HA   8  
ATOM 6888  H HB   . THR A 1 44 ? -6.811  7.507   -1.446  1.00 0.00 ? 44 THR A HB   8  
ATOM 6889  H HG1  . THR A 1 44 ? -7.193  5.622   -2.692  1.00 0.00 ? 44 THR A HG1  8  
ATOM 6890  H HG21 . THR A 1 44 ? -4.627  8.306   -2.498  1.00 0.00 ? 44 THR A HG21 8  
ATOM 6891  H HG22 . THR A 1 44 ? -5.776  7.698   -3.664  1.00 0.00 ? 44 THR A HG22 8  
ATOM 6892  H HG23 . THR A 1 44 ? -4.417  6.696   -3.187  1.00 0.00 ? 44 THR A HG23 8  
ATOM 6893  N N    . GLU A 1 45 ? -6.936  6.486   1.247   1.00 0.00 ? 45 GLU A N    8  
ATOM 6894  C CA   . GLU A 1 45 ? -7.719  5.749   2.226   1.00 0.00 ? 45 GLU A CA   8  
ATOM 6895  C C    . GLU A 1 45 ? -8.488  4.587   1.546   1.00 0.00 ? 45 GLU A C    8  
ATOM 6896  O O    . GLU A 1 45 ? -8.937  3.661   2.210   1.00 0.00 ? 45 GLU A O    8  
ATOM 6897  C CB   . GLU A 1 45 ? -8.662  6.688   3.009   1.00 0.00 ? 45 GLU A CB   8  
ATOM 6898  C CG   . GLU A 1 45 ? -8.038  8.028   3.470   1.00 0.00 ? 45 GLU A CG   8  
ATOM 6899  C CD   . GLU A 1 45 ? -6.789  7.927   4.366   1.00 0.00 ? 45 GLU A CD   8  
ATOM 6900  O OE1  . GLU A 1 45 ? -6.388  6.838   4.770   1.00 0.00 ? 45 GLU A OE1  8  
ATOM 6901  O OE2  . GLU A 1 45 ? -6.193  8.959   4.670   1.00 0.00 ? 45 GLU A OE2  8  
ATOM 6902  H H    . GLU A 1 45 ? -7.189  7.421   1.014   1.00 0.00 ? 45 GLU A H    8  
ATOM 6903  H HA   . GLU A 1 45 ? -7.008  5.301   2.923   1.00 0.00 ? 45 GLU A HA   8  
ATOM 6904  H HB2  . GLU A 1 45 ? -9.514  6.977   2.336   1.00 0.00 ? 45 GLU A HB2  8  
ATOM 6905  H HB3  . GLU A 1 45 ? -8.937  6.125   3.940   1.00 0.00 ? 45 GLU A HB3  8  
ATOM 6906  H HG2  . GLU A 1 45 ? -7.791  8.658   2.617   1.00 0.00 ? 45 GLU A HG2  8  
ATOM 6907  H HG3  . GLU A 1 45 ? -8.787  8.582   4.039   1.00 0.00 ? 45 GLU A HG3  8  
ATOM 6908  N N    . ASP A 1 46 ? -8.627  4.682   0.196   1.00 0.00 ? 46 ASP A N    8  
ATOM 6909  C CA   . ASP A 1 46 ? -9.322  3.643   -0.565  1.00 0.00 ? 46 ASP A CA   8  
ATOM 6910  C C    . ASP A 1 46 ? -8.536  3.295   -1.850  1.00 0.00 ? 46 ASP A C    8  
ATOM 6911  O O    . ASP A 1 46 ? -8.533  4.028   -2.835  1.00 0.00 ? 46 ASP A O    8  
ATOM 6912  C CB   . ASP A 1 46 ? -10.784 4.050   -0.814  1.00 0.00 ? 46 ASP A CB   8  
ATOM 6913  C CG   . ASP A 1 46 ? -11.607 2.839   -1.275  1.00 0.00 ? 46 ASP A CG   8  
ATOM 6914  O OD1  . ASP A 1 46 ? -11.308 2.304   -2.338  1.00 0.00 ? 46 ASP A OD1  8  
ATOM 6915  O OD2  . ASP A 1 46 ? -12.524 2.439   -0.560  1.00 0.00 ? 46 ASP A OD2  8  
ATOM 6916  H H    . ASP A 1 46 ? -8.208  5.423   -0.331  1.00 0.00 ? 46 ASP A H    8  
ATOM 6917  H HA   . ASP A 1 46 ? -9.316  2.762   0.067   1.00 0.00 ? 46 ASP A HA   8  
ATOM 6918  H HB2  . ASP A 1 46 ? -11.218 4.420   0.116   1.00 0.00 ? 46 ASP A HB2  8  
ATOM 6919  H HB3  . ASP A 1 46 ? -10.872 4.864   -1.533  1.00 0.00 ? 46 ASP A HB3  8  
ATOM 6920  N N    . TYR A 1 47 ? -7.851  2.137   -1.771  1.00 0.00 ? 47 TYR A N    8  
ATOM 6921  C CA   . TYR A 1 47 ? -7.040  1.681   -2.898  1.00 0.00 ? 47 TYR A CA   8  
ATOM 6922  C C    . TYR A 1 47 ? -7.926  1.149   -4.027  1.00 0.00 ? 47 TYR A C    8  
ATOM 6923  O O    . TYR A 1 47 ? -7.614  1.310   -5.201  1.00 0.00 ? 47 TYR A O    8  
ATOM 6924  C CB   . TYR A 1 47 ? -6.099  0.552   -2.436  1.00 0.00 ? 47 TYR A CB   8  
ATOM 6925  C CG   . TYR A 1 47 ? -5.328  -0.012  -3.596  1.00 0.00 ? 47 TYR A CG   8  
ATOM 6926  C CD1  . TYR A 1 47 ? -4.263  0.679   -4.147  1.00 0.00 ? 47 TYR A CD1  8  
ATOM 6927  C CD2  . TYR A 1 47 ? -5.682  -1.237  -4.142  1.00 0.00 ? 47 TYR A CD2  8  
ATOM 6928  C CE1  . TYR A 1 47 ? -3.549  0.134   -5.198  1.00 0.00 ? 47 TYR A CE1  8  
ATOM 6929  C CE2  . TYR A 1 47 ? -4.947  -1.800  -5.170  1.00 0.00 ? 47 TYR A CE2  8  
ATOM 6930  C CZ   . TYR A 1 47 ? -3.869  -1.111  -5.705  1.00 0.00 ? 47 TYR A CZ   8  
ATOM 6931  O OH   . TYR A 1 47 ? -3.109  -1.631  -6.732  1.00 0.00 ? 47 TYR A OH   8  
ATOM 6932  H H    . TYR A 1 47 ? -7.954  1.567   -0.947  1.00 0.00 ? 47 TYR A H    8  
ATOM 6933  H HA   . TYR A 1 47 ? -6.463  2.524   -3.313  1.00 0.00 ? 47 TYR A HA   8  
ATOM 6934  H HB2  . TYR A 1 47 ? -5.402  0.928   -1.687  1.00 0.00 ? 47 TYR A HB2  8  
ATOM 6935  H HB3  . TYR A 1 47 ? -6.638  -0.283  -1.972  1.00 0.00 ? 47 TYR A HB3  8  
ATOM 6936  H HD1  . TYR A 1 47 ? -3.993  1.649   -3.773  1.00 0.00 ? 47 TYR A HD1  8  
ATOM 6937  H HD2  . TYR A 1 47 ? -6.557  -1.749  -3.787  1.00 0.00 ? 47 TYR A HD2  8  
ATOM 6938  H HE1  . TYR A 1 47 ? -2.737  0.688   -5.619  1.00 0.00 ? 47 TYR A HE1  8  
ATOM 6939  H HE2  . TYR A 1 47 ? -5.243  -2.772  -5.513  1.00 0.00 ? 47 TYR A HE2  8  
ATOM 6940  H HH   . TYR A 1 47 ? -2.991  -2.564  -6.615  1.00 0.00 ? 47 TYR A HH   8  
ATOM 6941  N N    . ASP A 1 48 ? -9.024  0.488   -3.614  1.00 0.00 ? 48 ASP A N    8  
ATOM 6942  C CA   . ASP A 1 48 ? -9.897  -0.131  -4.609  1.00 0.00 ? 48 ASP A CA   8  
ATOM 6943  C C    . ASP A 1 48 ? -10.371 0.910   -5.644  1.00 0.00 ? 48 ASP A C    8  
ATOM 6944  O O    . ASP A 1 48 ? -10.486 0.654   -6.839  1.00 0.00 ? 48 ASP A O    8  
ATOM 6945  C CB   . ASP A 1 48 ? -11.120 -0.805  -3.941  1.00 0.00 ? 48 ASP A CB   8  
ATOM 6946  C CG   . ASP A 1 48 ? -10.725 -2.019  -3.081  1.00 0.00 ? 48 ASP A CG   8  
ATOM 6947  O OD1  . ASP A 1 48 ? -9.925  -2.830  -3.544  1.00 0.00 ? 48 ASP A OD1  8  
ATOM 6948  O OD2  . ASP A 1 48 ? -11.218 -2.161  -1.959  1.00 0.00 ? 48 ASP A OD2  8  
ATOM 6949  H H    . ASP A 1 48 ? -9.245  0.420   -2.639  1.00 0.00 ? 48 ASP A H    8  
ATOM 6950  H HA   . ASP A 1 48 ? -9.315  -0.893  -5.135  1.00 0.00 ? 48 ASP A HA   8  
ATOM 6951  H HB2  . ASP A 1 48 ? -11.687 -0.096  -3.327  1.00 0.00 ? 48 ASP A HB2  8  
ATOM 6952  H HB3  . ASP A 1 48 ? -11.784 -1.199  -4.719  1.00 0.00 ? 48 ASP A HB3  8  
ATOM 6953  N N    . ARG A 1 49 ? -10.630 2.107   -5.104  1.00 0.00 ? 49 ARG A N    8  
ATOM 6954  C CA   . ARG A 1 49 ? -11.048 3.248   -5.895  1.00 0.00 ? 49 ARG A CA   8  
ATOM 6955  C C    . ARG A 1 49 ? -9.889  3.785   -6.777  1.00 0.00 ? 49 ARG A C    8  
ATOM 6956  O O    . ARG A 1 49 ? -10.015 3.813   -7.999  1.00 0.00 ? 49 ARG A O    8  
ATOM 6957  C CB   . ARG A 1 49 ? -11.628 4.285   -4.906  1.00 0.00 ? 49 ARG A CB   8  
ATOM 6958  C CG   . ARG A 1 49 ? -11.952 5.685   -5.460  1.00 0.00 ? 49 ARG A CG   8  
ATOM 6959  C CD   . ARG A 1 49 ? -11.983 6.772   -4.321  1.00 0.00 ? 49 ARG A CD   8  
ATOM 6960  N NE   . ARG A 1 49 ? -10.821 7.633   -4.498  1.00 0.00 ? 49 ARG A NE   8  
ATOM 6961  C CZ   . ARG A 1 49 ? -10.671 8.880   -4.017  1.00 0.00 ? 49 ARG A CZ   8  
ATOM 6962  N NH1  . ARG A 1 49 ? -11.667 9.494   -3.383  1.00 0.00 ? 49 ARG A NH1  8  
ATOM 6963  N NH2  . ARG A 1 49 ? -9.499  9.477   -4.189  1.00 0.00 ? 49 ARG A NH2  8  
ATOM 6964  H H    . ARG A 1 49 ? -10.526 2.200   -4.109  1.00 0.00 ? 49 ARG A H    8  
ATOM 6965  H HA   . ARG A 1 49 ? -11.835 2.889   -6.563  1.00 0.00 ? 49 ARG A HA   8  
ATOM 6966  H HB2  . ARG A 1 49 ? -12.523 3.821   -4.472  1.00 0.00 ? 49 ARG A HB2  8  
ATOM 6967  H HB3  . ARG A 1 49 ? -10.935 4.446   -4.083  1.00 0.00 ? 49 ARG A HB3  8  
ATOM 6968  H HG2  . ARG A 1 49 ? -11.184 5.945   -6.203  1.00 0.00 ? 49 ARG A HG2  8  
ATOM 6969  H HG3  . ARG A 1 49 ? -12.878 5.618   -6.043  1.00 0.00 ? 49 ARG A HG3  8  
ATOM 6970  H HD2  . ARG A 1 49 ? -12.891 7.396   -4.260  1.00 0.00 ? 49 ARG A HD2  8  
ATOM 6971  H HD3  . ARG A 1 49 ? -11.820 6.360   -3.313  1.00 0.00 ? 49 ARG A HD3  8  
ATOM 6972  H HE   . ARG A 1 49 ? -9.997  7.235   -4.924  1.00 0.00 ? 49 ARG A HE   8  
ATOM 6973  H HH11 . ARG A 1 49 ? -12.532 9.009   -3.263  1.00 0.00 ? 49 ARG A HH11 8  
ATOM 6974  H HH12 . ARG A 1 49 ? -11.572 10.422  -3.025  1.00 0.00 ? 49 ARG A HH12 8  
ATOM 6975  H HH21 . ARG A 1 49 ? -8.781  8.935   -4.659  1.00 0.00 ? 49 ARG A HH21 8  
ATOM 6976  H HH22 . ARG A 1 49 ? -9.292  10.404  -3.887  1.00 0.00 ? 49 ARG A HH22 8  
ATOM 6977  N N    . ASP A 1 50 ? -8.805  4.231   -6.110  1.00 0.00 ? 50 ASP A N    8  
ATOM 6978  C CA   . ASP A 1 50 ? -7.701  4.933   -6.785  1.00 0.00 ? 50 ASP A CA   8  
ATOM 6979  C C    . ASP A 1 50 ? -6.707  4.094   -7.635  1.00 0.00 ? 50 ASP A C    8  
ATOM 6980  O O    . ASP A 1 50 ? -6.259  4.549   -8.679  1.00 0.00 ? 50 ASP A O    8  
ATOM 6981  C CB   . ASP A 1 50 ? -6.913  5.724   -5.728  1.00 0.00 ? 50 ASP A CB   8  
ATOM 6982  C CG   . ASP A 1 50 ? -7.805  6.804   -5.099  1.00 0.00 ? 50 ASP A CG   8  
ATOM 6983  O OD1  . ASP A 1 50 ? -8.179  7.747   -5.790  1.00 0.00 ? 50 ASP A OD1  8  
ATOM 6984  O OD2  . ASP A 1 50 ? -8.141  6.718   -3.923  1.00 0.00 ? 50 ASP A OD2  8  
ATOM 6985  H H    . ASP A 1 50 ? -8.787  4.168   -5.107  1.00 0.00 ? 50 ASP A H    8  
ATOM 6986  H HA   . ASP A 1 50 ? -8.134  5.669   -7.467  1.00 0.00 ? 50 ASP A HA   8  
ATOM 6987  H HB2  . ASP A 1 50 ? -6.534  5.034   -4.954  1.00 0.00 ? 50 ASP A HB2  8  
ATOM 6988  H HB3  . ASP A 1 50 ? -6.100  6.284   -6.216  1.00 0.00 ? 50 ASP A HB3  8  
ATOM 6989  N N    . LYS A 1 51 ? -6.321  2.908   -7.128  1.00 0.00 ? 51 LYS A N    8  
ATOM 6990  C CA   . LYS A 1 51 ? -5.339  2.025   -7.772  1.00 0.00 ? 51 LYS A CA   8  
ATOM 6991  C C    . LYS A 1 51 ? -3.903  2.580   -7.807  1.00 0.00 ? 51 LYS A C    8  
ATOM 6992  O O    . LYS A 1 51 ? -3.115  2.216   -8.675  1.00 0.00 ? 51 LYS A O    8  
ATOM 6993  C CB   . LYS A 1 51 ? -5.712  1.563   -9.198  1.00 0.00 ? 51 LYS A CB   8  
ATOM 6994  C CG   . LYS A 1 51 ? -7.017  0.745   -9.261  1.00 0.00 ? 51 LYS A CG   8  
ATOM 6995  C CD   . LYS A 1 51 ? -8.280  1.554   -8.964  1.00 0.00 ? 51 LYS A CD   8  
ATOM 6996  C CE   . LYS A 1 51 ? -9.531  0.974   -9.630  1.00 0.00 ? 51 LYS A CE   8  
ATOM 6997  N NZ   . LYS A 1 51 ? -10.725 1.675   -9.177  1.00 0.00 ? 51 LYS A NZ   8  
ATOM 6998  H H    . LYS A 1 51 ? -6.773  2.551   -6.313  1.00 0.00 ? 51 LYS A H    8  
ATOM 6999  H HA   . LYS A 1 51 ? -5.283  1.170   -7.100  1.00 0.00 ? 51 LYS A HA   8  
ATOM 7000  H HB2  . LYS A 1 51 ? -5.837  2.479   -9.840  1.00 0.00 ? 51 LYS A HB2  8  
ATOM 7001  H HB3  . LYS A 1 51 ? -4.867  0.871   -9.493  1.00 0.00 ? 51 LYS A HB3  8  
ATOM 7002  H HG2  . LYS A 1 51 ? -7.174  0.310   -10.246 1.00 0.00 ? 51 LYS A HG2  8  
ATOM 7003  H HG3  . LYS A 1 51 ? -6.918  -0.098  -8.580  1.00 0.00 ? 51 LYS A HG3  8  
ATOM 7004  H HD2  . LYS A 1 51 ? -8.418  1.614   -7.885  1.00 0.00 ? 51 LYS A HD2  8  
ATOM 7005  H HD3  . LYS A 1 51 ? -8.150  2.573   -9.328  1.00 0.00 ? 51 LYS A HD3  8  
ATOM 7006  H HE2  . LYS A 1 51 ? -9.465  1.072   -10.715 1.00 0.00 ? 51 LYS A HE2  8  
ATOM 7007  H HE3  . LYS A 1 51 ? -9.652  -0.084  -9.391  1.00 0.00 ? 51 LYS A HE3  8  
ATOM 7008  H HZ1  . LYS A 1 51 ? -10.931 1.322   -8.216  1.00 0.00 ? 51 LYS A HZ1  8  
ATOM 7009  H HZ2  . LYS A 1 51 ? -11.541 1.511   -9.795  1.00 0.00 ? 51 LYS A HZ2  8  
ATOM 7010  H HZ3  . LYS A 1 51 ? -10.517 2.698   -9.086  1.00 0.00 ? 51 LYS A HZ3  8  
ATOM 7011  N N    . LYS A 1 52 ? -3.572  3.432   -6.821  1.00 0.00 ? 52 LYS A N    8  
ATOM 7012  C CA   . LYS A 1 52 ? -2.194  3.910   -6.744  1.00 0.00 ? 52 LYS A CA   8  
ATOM 7013  C C    . LYS A 1 52 ? -1.625  3.410   -5.407  1.00 0.00 ? 52 LYS A C    8  
ATOM 7014  O O    . LYS A 1 52 ? -2.285  3.499   -4.373  1.00 0.00 ? 52 LYS A O    8  
ATOM 7015  C CB   . LYS A 1 52 ? -2.110  5.444   -6.876  1.00 0.00 ? 52 LYS A CB   8  
ATOM 7016  C CG   . LYS A 1 52 ? -2.719  6.066   -8.162  1.00 0.00 ? 52 LYS A CG   8  
ATOM 7017  C CD   . LYS A 1 52 ? -2.249  5.507   -9.520  1.00 0.00 ? 52 LYS A CD   8  
ATOM 7018  C CE   . LYS A 1 52 ? -0.725  5.436   -9.642  1.00 0.00 ? 52 LYS A CE   8  
ATOM 7019  N NZ   . LYS A 1 52 ? -0.057  6.732   -9.640  1.00 0.00 ? 52 LYS A NZ   8  
ATOM 7020  H H    . LYS A 1 52 ? -4.245  3.690   -6.130  1.00 0.00 ? 52 LYS A H    8  
ATOM 7021  H HA   . LYS A 1 52 ? -1.626  3.413   -7.528  1.00 0.00 ? 52 LYS A HA   8  
ATOM 7022  H HB2  . LYS A 1 52 ? -2.588  5.893   -6.001  1.00 0.00 ? 52 LYS A HB2  8  
ATOM 7023  H HB3  . LYS A 1 52 ? -1.064  5.737   -6.803  1.00 0.00 ? 52 LYS A HB3  8  
ATOM 7024  H HG2  . LYS A 1 52 ? -3.806  5.979   -8.136  1.00 0.00 ? 52 LYS A HG2  8  
ATOM 7025  H HG3  . LYS A 1 52 ? -2.505  7.138   -8.156  1.00 0.00 ? 52 LYS A HG3  8  
ATOM 7026  H HD2  . LYS A 1 52 ? -2.647  4.454   -9.616  1.00 0.00 ? 52 LYS A HD2  8  
ATOM 7027  H HD3  . LYS A 1 52 ? -2.585  6.245   -10.306 1.00 0.00 ? 52 LYS A HD3  8  
ATOM 7028  H HE2  . LYS A 1 52 ? -0.313  4.865   -8.816  1.00 0.00 ? 52 LYS A HE2  8  
ATOM 7029  H HE3  . LYS A 1 52 ? -0.440  4.921   -10.561 1.00 0.00 ? 52 LYS A HE3  8  
ATOM 7030  H HZ1  . LYS A 1 52 ? -0.254  7.376   -10.439 1.00 0.00 ? 52 LYS A HZ1  8  
ATOM 7031  H HZ2  . LYS A 1 52 ? 0.979   6.626   -9.649  1.00 0.00 ? 52 LYS A HZ2  8  
ATOM 7032  H HZ3  . LYS A 1 52 ? -0.256  7.331   -8.807  1.00 0.00 ? 52 LYS A HZ3  8  
ATOM 7033  N N    . TYR A 1 53 ? -0.405  2.837   -5.501  1.00 0.00 ? 53 TYR A N    8  
ATOM 7034  C CA   . TYR A 1 53 ? 0.239   2.199   -4.363  1.00 0.00 ? 53 TYR A CA   8  
ATOM 7035  C C    . TYR A 1 53 ? 1.746   2.517   -4.297  1.00 0.00 ? 53 TYR A C    8  
ATOM 7036  O O    . TYR A 1 53 ? 2.356   3.135   -5.167  1.00 0.00 ? 53 TYR A O    8  
ATOM 7037  C CB   . TYR A 1 53 ? 0.000   0.675   -4.441  1.00 0.00 ? 53 TYR A CB   8  
ATOM 7038  C CG   . TYR A 1 53 ? 0.715   -0.015  -5.574  1.00 0.00 ? 53 TYR A CG   8  
ATOM 7039  C CD1  . TYR A 1 53 ? 0.151   -0.082  -6.840  1.00 0.00 ? 53 TYR A CD1  8  
ATOM 7040  C CD2  . TYR A 1 53 ? 1.944   -0.626  -5.361  1.00 0.00 ? 53 TYR A CD2  8  
ATOM 7041  C CE1  . TYR A 1 53 ? 0.775   -0.779  -7.866  1.00 0.00 ? 53 TYR A CE1  8  
ATOM 7042  C CE2  . TYR A 1 53 ? 2.570   -1.326  -6.377  1.00 0.00 ? 53 TYR A CE2  8  
ATOM 7043  C CZ   . TYR A 1 53 ? 1.987   -1.415  -7.630  1.00 0.00 ? 53 TYR A CZ   8  
ATOM 7044  O OH   . TYR A 1 53 ? 2.620   -2.154  -8.615  1.00 0.00 ? 53 TYR A OH   8  
ATOM 7045  H H    . TYR A 1 53 ? 0.115   2.829   -6.357  1.00 0.00 ? 53 TYR A H    8  
ATOM 7046  H HA   . TYR A 1 53 ? -0.213  2.599   -3.456  1.00 0.00 ? 53 TYR A HA   8  
ATOM 7047  H HB2  . TYR A 1 53 ? 0.303   0.188   -3.522  1.00 0.00 ? 53 TYR A HB2  8  
ATOM 7048  H HB3  . TYR A 1 53 ? -1.060  0.448   -4.503  1.00 0.00 ? 53 TYR A HB3  8  
ATOM 7049  H HD1  . TYR A 1 53 ? -0.787  0.410   -7.023  1.00 0.00 ? 53 TYR A HD1  8  
ATOM 7050  H HD2  . TYR A 1 53 ? 2.421   -0.561  -4.397  1.00 0.00 ? 53 TYR A HD2  8  
ATOM 7051  H HE1  . TYR A 1 53 ? 0.287   -0.823  -8.827  1.00 0.00 ? 53 TYR A HE1  8  
ATOM 7052  H HE2  . TYR A 1 53 ? 3.510   -1.810  -6.176  1.00 0.00 ? 53 TYR A HE2  8  
ATOM 7053  H HH   . TYR A 1 53 ? 2.629   -1.647  -9.422  1.00 0.00 ? 53 TYR A HH   8  
ATOM 7054  N N    . GLY A 1 54 ? 2.272   2.003   -3.177  1.00 0.00 ? 54 GLY A N    8  
ATOM 7055  C CA   . GLY A 1 54 ? 3.675   2.095   -2.784  1.00 0.00 ? 54 GLY A CA   8  
ATOM 7056  C C    . GLY A 1 54 ? 4.169   0.700   -2.336  1.00 0.00 ? 54 GLY A C    8  
ATOM 7057  O O    . GLY A 1 54 ? 3.388   -0.244  -2.293  1.00 0.00 ? 54 GLY A O    8  
ATOM 7058  H H    . GLY A 1 54 ? 1.597   1.525   -2.605  1.00 0.00 ? 54 GLY A H    8  
ATOM 7059  H HA2  . GLY A 1 54 ? 4.271   2.503   -3.610  1.00 0.00 ? 54 GLY A HA2  8  
ATOM 7060  H HA3  . GLY A 1 54 ? 3.679   2.795   -1.953  1.00 0.00 ? 54 GLY A HA3  8  
ATOM 7061  N N    . PHE A 1 55 ? 5.487   0.601   -2.032  1.00 0.00 ? 55 PHE A N    8  
ATOM 7062  C CA   . PHE A 1 55 ? 6.110   -0.662  -1.621  1.00 0.00 ? 55 PHE A CA   8  
ATOM 7063  C C    . PHE A 1 55 ? 6.411   -0.522  -0.131  1.00 0.00 ? 55 PHE A C    8  
ATOM 7064  O O    . PHE A 1 55 ? 6.487   0.577   0.400   1.00 0.00 ? 55 PHE A O    8  
ATOM 7065  C CB   . PHE A 1 55 ? 7.406   -1.014  -2.391  1.00 0.00 ? 55 PHE A CB   8  
ATOM 7066  C CG   . PHE A 1 55 ? 7.138   -1.569  -3.769  1.00 0.00 ? 55 PHE A CG   8  
ATOM 7067  C CD1  . PHE A 1 55 ? 6.398   -0.849  -4.694  1.00 0.00 ? 55 PHE A CD1  8  
ATOM 7068  C CD2  . PHE A 1 55 ? 7.628   -2.816  -4.149  1.00 0.00 ? 55 PHE A CD2  8  
ATOM 7069  C CE1  . PHE A 1 55 ? 6.150   -1.341  -5.964  1.00 0.00 ? 55 PHE A CE1  8  
ATOM 7070  C CE2  . PHE A 1 55 ? 7.377   -3.321  -5.419  1.00 0.00 ? 55 PHE A CE2  8  
ATOM 7071  C CZ   . PHE A 1 55 ? 6.639   -2.584  -6.332  1.00 0.00 ? 55 PHE A CZ   8  
ATOM 7072  H H    . PHE A 1 55 ? 6.091   1.390   -1.995  1.00 0.00 ? 55 PHE A H    8  
ATOM 7073  H HA   . PHE A 1 55 ? 5.405   -1.480  -1.738  1.00 0.00 ? 55 PHE A HA   8  
ATOM 7074  H HB2  . PHE A 1 55 ? 8.089   -0.161  -2.465  1.00 0.00 ? 55 PHE A HB2  8  
ATOM 7075  H HB3  . PHE A 1 55 ? 7.918   -1.819  -1.850  1.00 0.00 ? 55 PHE A HB3  8  
ATOM 7076  H HD1  . PHE A 1 55 ? 6.011   0.114   -4.432  1.00 0.00 ? 55 PHE A HD1  8  
ATOM 7077  H HD2  . PHE A 1 55 ? 8.213   -3.410  -3.464  1.00 0.00 ? 55 PHE A HD2  8  
ATOM 7078  H HE1  . PHE A 1 55 ? 5.581   -0.734  -6.655  1.00 0.00 ? 55 PHE A HE1  8  
ATOM 7079  H HE2  . PHE A 1 55 ? 7.759   -4.291  -5.691  1.00 0.00 ? 55 PHE A HE2  8  
ATOM 7080  H HZ   . PHE A 1 55 ? 6.450   -2.972  -7.323  1.00 0.00 ? 55 PHE A HZ   8  
ATOM 7081  N N    . CYS A 1 56 ? 6.522   -1.702  0.495   1.00 0.00 ? 56 CYS A N    8  
ATOM 7082  C CA   . CYS A 1 56 ? 6.703   -1.750  1.961   1.00 0.00 ? 56 CYS A CA   8  
ATOM 7083  C C    . CYS A 1 56 ? 8.038   -2.478  2.238   1.00 0.00 ? 56 CYS A C    8  
ATOM 7084  O O    . CYS A 1 56 ? 8.532   -3.215  1.390   1.00 0.00 ? 56 CYS A O    8  
ATOM 7085  C CB   . CYS A 1 56 ? 5.487   -2.514  2.547   1.00 0.00 ? 56 CYS A CB   8  
ATOM 7086  S SG   . CYS A 1 56 ? 4.605   -1.648  3.869   1.00 0.00 ? 56 CYS A SG   8  
ATOM 7087  H H    . CYS A 1 56 ? 6.487   -2.516  -0.120  1.00 0.00 ? 56 CYS A H    8  
ATOM 7088  H HA   . CYS A 1 56 ? 6.779   -0.729  2.404   1.00 0.00 ? 56 CYS A HA   8  
ATOM 7089  H HB2  . CYS A 1 56 ? 4.714   -2.713  1.784   1.00 0.00 ? 56 CYS A HB2  8  
ATOM 7090  H HB3  . CYS A 1 56 ? 5.813   -3.487  2.935   1.00 0.00 ? 56 CYS A HB3  8  
ATOM 7091  N N    . PRO A 1 57 ? 8.630   -2.237  3.443   1.00 0.00 ? 57 PRO A N    8  
ATOM 7092  C CA   . PRO A 1 57 ? 9.977   -2.731  3.739   1.00 0.00 ? 57 PRO A CA   8  
ATOM 7093  C C    . PRO A 1 57 ? 9.995   -4.253  3.965   1.00 0.00 ? 57 PRO A C    8  
ATOM 7094  O O    . PRO A 1 57 ? 8.989   -4.939  3.816   1.00 0.00 ? 57 PRO A O    8  
ATOM 7095  C CB   . PRO A 1 57 ? 10.355  -1.978  5.024   1.00 0.00 ? 57 PRO A CB   8  
ATOM 7096  C CG   . PRO A 1 57 ? 9.014   -1.707  5.707   1.00 0.00 ? 57 PRO A CG   8  
ATOM 7097  C CD   . PRO A 1 57 ? 8.037   -1.471  4.546   1.00 0.00 ? 57 PRO A CD   8  
ATOM 7098  H HA   . PRO A 1 57 ? 10.663  -2.489  2.924   1.00 0.00 ? 57 PRO A HA   8  
ATOM 7099  H HB2  . PRO A 1 57 ? 11.056  -2.500  5.673   1.00 0.00 ? 57 PRO A HB2  8  
ATOM 7100  H HB3  . PRO A 1 57 ? 10.820  -1.028  4.758   1.00 0.00 ? 57 PRO A HB3  8  
ATOM 7101  H HG2  . PRO A 1 57 ? 8.717   -2.598  6.265   1.00 0.00 ? 57 PRO A HG2  8  
ATOM 7102  H HG3  . PRO A 1 57 ? 9.063   -0.879  6.414   1.00 0.00 ? 57 PRO A HG3  8  
ATOM 7103  H HD2  . PRO A 1 57 ? 7.026   -1.841  4.797   1.00 0.00 ? 57 PRO A HD2  8  
ATOM 7104  H HD3  . PRO A 1 57 ? 8.041   -0.403  4.273   1.00 0.00 ? 57 PRO A HD3  8  
ATOM 7105  N N    . GLU A 1 58 ? 11.200  -4.738  4.334   1.00 0.00 ? 58 GLU A N    8  
ATOM 7106  C CA   . GLU A 1 58 ? 11.434  -6.159  4.613   1.00 0.00 ? 58 GLU A CA   8  
ATOM 7107  C C    . GLU A 1 58 ? 11.417  -6.365  6.140   1.00 0.00 ? 58 GLU A C    8  
ATOM 7108  O O    . GLU A 1 58 ? 12.316  -6.938  6.741   1.00 0.00 ? 58 GLU A O    8  
ATOM 7109  C CB   . GLU A 1 58 ? 12.770  -6.597  3.964   1.00 0.00 ? 58 GLU A CB   8  
ATOM 7110  C CG   . GLU A 1 58 ? 12.798  -8.074  3.512   1.00 0.00 ? 58 GLU A CG   8  
ATOM 7111  C CD   . GLU A 1 58 ? 11.949  -8.333  2.252   1.00 0.00 ? 58 GLU A CD   8  
ATOM 7112  O OE1  . GLU A 1 58 ? 11.978  -7.520  1.328   1.00 0.00 ? 58 GLU A OE1  8  
ATOM 7113  O OE2  . GLU A 1 58 ? 11.224  -9.323  2.199   1.00 0.00 ? 58 GLU A OE2  8  
ATOM 7114  H H    . GLU A 1 58 ? 11.954  -4.089  4.429   1.00 0.00 ? 58 GLU A H    8  
ATOM 7115  H HA   . GLU A 1 58 ? 10.610  -6.736  4.197   1.00 0.00 ? 58 GLU A HA   8  
ATOM 7116  H HB2  . GLU A 1 58 ? 12.965  -5.970  3.085   1.00 0.00 ? 58 GLU A HB2  8  
ATOM 7117  H HB3  . GLU A 1 58 ? 13.598  -6.442  4.668   1.00 0.00 ? 58 GLU A HB3  8  
ATOM 7118  H HG2  . GLU A 1 58 ? 13.821  -8.367  3.278   1.00 0.00 ? 58 GLU A HG2  8  
ATOM 7119  H HG3  . GLU A 1 58 ? 12.463  -8.725  4.321   1.00 0.00 ? 58 GLU A HG3  8  
ATOM 7120  N N    . THR A 1 59 ? 10.339  -5.817  6.724   1.00 0.00 ? 59 THR A N    8  
ATOM 7121  C CA   . THR A 1 59 ? 10.130  -5.845  8.163   1.00 0.00 ? 59 THR A CA   8  
ATOM 7122  C C    . THR A 1 59 ? 8.759   -5.220  8.395   1.00 0.00 ? 59 THR A C    8  
ATOM 7123  O O    . THR A 1 59 ? 8.130   -4.718  7.469   1.00 0.00 ? 59 THR A O    8  
ATOM 7124  C CB   . THR A 1 59 ? 11.238  -5.056  8.917   1.00 0.00 ? 59 THR A CB   8  
ATOM 7125  O OG1  . THR A 1 59 ? 11.001  -4.968  10.313  1.00 0.00 ? 59 THR A OG1  8  
ATOM 7126  C CG2  . THR A 1 59 ? 11.522  -3.664  8.323   1.00 0.00 ? 59 THR A CG2  8  
ATOM 7127  H H    . THR A 1 59 ? 9.620   -5.366  6.189   1.00 0.00 ? 59 THR A H    8  
ATOM 7128  H HA   . THR A 1 59 ? 10.104  -6.892  8.471   1.00 0.00 ? 59 THR A HA   8  
ATOM 7129  H HB   . THR A 1 59 ? 12.162  -5.630  8.824   1.00 0.00 ? 59 THR A HB   8  
ATOM 7130  H HG1  . THR A 1 59 ? 10.346  -4.284  10.503  1.00 0.00 ? 59 THR A HG1  8  
ATOM 7131  H HG21 . THR A 1 59 ? 12.250  -3.124  8.929   1.00 0.00 ? 59 THR A HG21 8  
ATOM 7132  H HG22 . THR A 1 59 ? 10.621  -3.052  8.257   1.00 0.00 ? 59 THR A HG22 8  
ATOM 7133  H HG23 . THR A 1 59 ? 11.943  -3.746  7.322   1.00 0.00 ? 59 THR A HG23 8  
ATOM 7134  N N    . ALA A 1 60 ? 8.389   -5.272  9.681   1.00 0.00 ? 60 ALA A N    8  
ATOM 7135  C CA   . ALA A 1 60 ? 7.206   -4.617  10.206  1.00 0.00 ? 60 ALA A CA   8  
ATOM 7136  C C    . ALA A 1 60 ? 7.696   -3.377  10.982  1.00 0.00 ? 60 ALA A C    8  
ATOM 7137  O O    . ALA A 1 60 ? 6.861   -2.591  11.424  1.00 0.00 ? 60 ALA A O    8  
ATOM 7138  C CB   . ALA A 1 60 ? 6.461   -5.581  11.136  1.00 0.00 ? 60 ALA A CB   8  
ATOM 7139  O OXT  . ALA A 1 60 ? 8.912   -3.215  11.133  1.00 0.00 ? 60 ALA A OXT  8  
ATOM 7140  H H    . ALA A 1 60 ? 9.019   -5.688  10.336  1.00 0.00 ? 60 ALA A H    8  
ATOM 7141  H HA   . ALA A 1 60 ? 6.572   -4.300  9.375   1.00 0.00 ? 60 ALA A HA   8  
ATOM 7142  H HB1  . ALA A 1 60 ? 6.138   -6.472  10.598  1.00 0.00 ? 60 ALA A HB1  8  
ATOM 7143  H HB2  . ALA A 1 60 ? 5.575   -5.105  11.557  1.00 0.00 ? 60 ALA A HB2  8  
ATOM 7144  H HB3  . ALA A 1 60 ? 7.094   -5.897  11.965  1.00 0.00 ? 60 ALA A HB3  8  
ATOM 7145  N N    . THR A 1 1  ? 6.857   12.722  7.727   1.00 0.00 ? 1  THR A N    9  
ATOM 7146  C CA   . THR A 1 1  ? 7.608   11.511  7.424   1.00 0.00 ? 1  THR A CA   9  
ATOM 7147  C C    . THR A 1 1  ? 6.536   10.428  7.435   1.00 0.00 ? 1  THR A C    9  
ATOM 7148  O O    . THR A 1 1  ? 5.372   10.800  7.514   1.00 0.00 ? 1  THR A O    9  
ATOM 7149  C CB   . THR A 1 1  ? 8.798   11.251  8.375   1.00 0.00 ? 1  THR A CB   9  
ATOM 7150  O OG1  . THR A 1 1  ? 9.486   10.106  7.899   1.00 0.00 ? 1  THR A OG1  9  
ATOM 7151  C CG2  . THR A 1 1  ? 8.365   11.065  9.841   1.00 0.00 ? 1  THR A CG2  9  
ATOM 7152  H H1   . THR A 1 1  ? 5.888   12.487  7.401   1.00 0.00 ? 1  THR A H1   9  
ATOM 7153  H H2   . THR A 1 1  ? 7.233   13.559  7.241   1.00 0.00 ? 1  THR A H2   9  
ATOM 7154  H H3   . THR A 1 1  ? 6.808   12.863  8.755   1.00 0.00 ? 1  THR A H3   9  
ATOM 7155  H HA   . THR A 1 1  ? 7.963   11.601  6.397   1.00 0.00 ? 1  THR A HA   9  
ATOM 7156  H HB   . THR A 1 1  ? 9.469   12.116  8.309   1.00 0.00 ? 1  THR A HB   9  
ATOM 7157  H HG1  . THR A 1 1  ? 10.255  9.917   8.434   1.00 0.00 ? 1  THR A HG1  9  
ATOM 7158  H HG21 . THR A 1 1  ? 7.753   10.171  9.970   1.00 0.00 ? 1  THR A HG21 9  
ATOM 7159  H HG22 . THR A 1 1  ? 7.787   11.915  10.202  1.00 0.00 ? 1  THR A HG22 9  
ATOM 7160  H HG23 . THR A 1 1  ? 9.224   10.968  10.506  1.00 0.00 ? 1  THR A HG23 9  
ATOM 7161  N N    . ALA A 1 2  ? 6.978   9.160   7.348   1.00 0.00 ? 2  ALA A N    9  
ATOM 7162  C CA   . ALA A 1 2  ? 6.161   7.948   7.344   1.00 0.00 ? 2  ALA A CA   9  
ATOM 7163  C C    . ALA A 1 2  ? 6.958   6.874   6.584   1.00 0.00 ? 2  ALA A C    9  
ATOM 7164  O O    . ALA A 1 2  ? 7.892   6.294   7.120   1.00 0.00 ? 2  ALA A O    9  
ATOM 7165  C CB   . ALA A 1 2  ? 4.737   8.143   6.785   1.00 0.00 ? 2  ALA A CB   9  
ATOM 7166  H H    . ALA A 1 2  ? 7.977   9.047   7.310   1.00 0.00 ? 2  ALA A H    9  
ATOM 7167  H HA   . ALA A 1 2  ? 6.104   7.630   8.385   1.00 0.00 ? 2  ALA A HA   9  
ATOM 7168  H HB1  . ALA A 1 2  ? 4.127   8.731   7.471   1.00 0.00 ? 2  ALA A HB1  9  
ATOM 7169  H HB2  . ALA A 1 2  ? 4.221   7.191   6.652   1.00 0.00 ? 2  ALA A HB2  9  
ATOM 7170  H HB3  . ALA A 1 2  ? 4.749   8.667   5.831   1.00 0.00 ? 2  ALA A HB3  9  
ATOM 7171  N N    . LEU A 1 3  ? 6.541   6.645   5.323   1.00 0.00 ? 3  LEU A N    9  
ATOM 7172  C CA   . LEU A 1 3  ? 7.208   5.683   4.455   1.00 0.00 ? 3  LEU A CA   9  
ATOM 7173  C C    . LEU A 1 3  ? 7.457   6.361   3.101   1.00 0.00 ? 3  LEU A C    9  
ATOM 7174  O O    . LEU A 1 3  ? 6.912   7.419   2.810   1.00 0.00 ? 3  LEU A O    9  
ATOM 7175  C CB   . LEU A 1 3  ? 6.372   4.388   4.327   1.00 0.00 ? 3  LEU A CB   9  
ATOM 7176  C CG   . LEU A 1 3  ? 7.188   3.126   4.692   1.00 0.00 ? 3  LEU A CG   9  
ATOM 7177  C CD1  . LEU A 1 3  ? 6.899   2.680   6.134   1.00 0.00 ? 3  LEU A CD1  9  
ATOM 7178  C CD2  . LEU A 1 3  ? 6.931   1.970   3.719   1.00 0.00 ? 3  LEU A CD2  9  
ATOM 7179  H H    . LEU A 1 3  ? 5.793   7.185   4.941   1.00 0.00 ? 3  LEU A H    9  
ATOM 7180  H HA   . LEU A 1 3  ? 8.191   5.480   4.888   1.00 0.00 ? 3  LEU A HA   9  
ATOM 7181  H HB2  . LEU A 1 3  ? 5.544   4.456   5.084   1.00 0.00 ? 3  LEU A HB2  9  
ATOM 7182  H HB3  . LEU A 1 3  ? 6.051   4.286   3.254   1.00 0.00 ? 3  LEU A HB3  9  
ATOM 7183  H HG   . LEU A 1 3  ? 8.252   3.352   4.611   1.00 0.00 ? 3  LEU A HG   9  
ATOM 7184  H HD11 . LEU A 1 3  ? 7.114   3.479   6.845   1.00 0.00 ? 3  LEU A HD11 9  
ATOM 7185  H HD12 . LEU A 1 3  ? 7.496   1.812   6.411   1.00 0.00 ? 3  LEU A HD12 9  
ATOM 7186  H HD13 . LEU A 1 3  ? 5.849   2.407   6.257   1.00 0.00 ? 3  LEU A HD13 9  
ATOM 7187  H HD21 . LEU A 1 3  ? 6.982   2.295   2.679   1.00 0.00 ? 3  LEU A HD21 9  
ATOM 7188  H HD22 . LEU A 1 3  ? 5.953   1.518   3.882   1.00 0.00 ? 3  LEU A HD22 9  
ATOM 7189  H HD23 . LEU A 1 3  ? 7.681   1.192   3.842   1.00 0.00 ? 3  LEU A HD23 9  
ATOM 7190  N N    . PHE A 1 4  ? 8.314   5.681   2.322   1.00 0.00 ? 4  PHE A N    9  
ATOM 7191  C CA   . PHE A 1 4  ? 8.743   6.119   0.993   1.00 0.00 ? 4  PHE A CA   9  
ATOM 7192  C C    . PHE A 1 4  ? 8.056   5.194   -0.030  1.00 0.00 ? 4  PHE A C    9  
ATOM 7193  O O    . PHE A 1 4  ? 7.612   4.117   0.336   1.00 0.00 ? 4  PHE A O    9  
ATOM 7194  C CB   . PHE A 1 4  ? 10.291  6.009   0.953   1.00 0.00 ? 4  PHE A CB   9  
ATOM 7195  C CG   . PHE A 1 4  ? 10.912  6.743   2.114   1.00 0.00 ? 4  PHE A CG   9  
ATOM 7196  C CD1  . PHE A 1 4  ? 10.980  8.133   2.110   1.00 0.00 ? 4  PHE A CD1  9  
ATOM 7197  C CD2  . PHE A 1 4  ? 11.417  6.047   3.209   1.00 0.00 ? 4  PHE A CD2  9  
ATOM 7198  C CE1  . PHE A 1 4  ? 11.538  8.817   3.182   1.00 0.00 ? 4  PHE A CE1  9  
ATOM 7199  C CE2  . PHE A 1 4  ? 11.974  6.728   4.284   1.00 0.00 ? 4  PHE A CE2  9  
ATOM 7200  C CZ   . PHE A 1 4  ? 12.034  8.114   4.271   1.00 0.00 ? 4  PHE A CZ   9  
ATOM 7201  H H    . PHE A 1 4  ? 8.640   4.808   2.680   1.00 0.00 ? 4  PHE A H    9  
ATOM 7202  H HA   . PHE A 1 4  ? 8.401   7.148   0.854   1.00 0.00 ? 4  PHE A HA   9  
ATOM 7203  H HB2  . PHE A 1 4  ? 10.587  4.954   1.012   1.00 0.00 ? 4  PHE A HB2  9  
ATOM 7204  H HB3  . PHE A 1 4  ? 10.738  6.417   0.037   1.00 0.00 ? 4  PHE A HB3  9  
ATOM 7205  H HD1  . PHE A 1 4  ? 10.593  8.691   1.270   1.00 0.00 ? 4  PHE A HD1  9  
ATOM 7206  H HD2  . PHE A 1 4  ? 11.375  4.968   3.234   1.00 0.00 ? 4  PHE A HD2  9  
ATOM 7207  H HE1  . PHE A 1 4  ? 11.584  9.896   3.170   1.00 0.00 ? 4  PHE A HE1  9  
ATOM 7208  H HE2  . PHE A 1 4  ? 12.359  6.179   5.131   1.00 0.00 ? 4  PHE A HE2  9  
ATOM 7209  H HZ   . PHE A 1 4  ? 12.466  8.645   5.107   1.00 0.00 ? 4  PHE A HZ   9  
ATOM 7210  N N    . THR A 1 5  ? 8.003   5.621   -1.315  1.00 0.00 ? 5  THR A N    9  
ATOM 7211  C CA   . THR A 1 5  ? 7.310   4.785   -2.302  1.00 0.00 ? 5  THR A CA   9  
ATOM 7212  C C    . THR A 1 5  ? 8.226   3.686   -2.874  1.00 0.00 ? 5  THR A C    9  
ATOM 7213  O O    . THR A 1 5  ? 7.814   2.553   -3.109  1.00 0.00 ? 5  THR A O    9  
ATOM 7214  C CB   . THR A 1 5  ? 6.836   5.665   -3.477  1.00 0.00 ? 5  THR A CB   9  
ATOM 7215  O OG1  . THR A 1 5  ? 7.917   6.311   -4.135  1.00 0.00 ? 5  THR A OG1  9  
ATOM 7216  C CG2  . THR A 1 5  ? 5.721   6.660   -3.104  1.00 0.00 ? 5  THR A CG2  9  
ATOM 7217  H H    . THR A 1 5  ? 8.315   6.531   -1.572  1.00 0.00 ? 5  THR A H    9  
ATOM 7218  H HA   . THR A 1 5  ? 6.469   4.302   -1.819  1.00 0.00 ? 5  THR A HA   9  
ATOM 7219  H HB   . THR A 1 5  ? 6.407   4.979   -4.210  1.00 0.00 ? 5  THR A HB   9  
ATOM 7220  H HG1  . THR A 1 5  ? 8.367   6.929   -3.570  1.00 0.00 ? 5  THR A HG1  9  
ATOM 7221  H HG21 . THR A 1 5  ? 4.856   6.141   -2.689  1.00 0.00 ? 5  THR A HG21 9  
ATOM 7222  H HG22 . THR A 1 5  ? 5.352   7.190   -3.984  1.00 0.00 ? 5  THR A HG22 9  
ATOM 7223  H HG23 . THR A 1 5  ? 6.034   7.405   -2.368  1.00 0.00 ? 5  THR A HG23 9  
ATOM 7224  N N    . MET A 1 6  ? 9.475   4.142   -3.071  1.00 0.00 ? 6  MET A N    9  
ATOM 7225  C CA   . MET A 1 6  ? 10.629  3.406   -3.595  1.00 0.00 ? 6  MET A CA   9  
ATOM 7226  C C    . MET A 1 6  ? 10.245  2.189   -4.468  1.00 0.00 ? 6  MET A C    9  
ATOM 7227  O O    . MET A 1 6  ? 10.370  1.038   -4.073  1.00 0.00 ? 6  MET A O    9  
ATOM 7228  C CB   . MET A 1 6  ? 11.595  3.035   -2.453  1.00 0.00 ? 6  MET A CB   9  
ATOM 7229  C CG   . MET A 1 6  ? 10.907  2.470   -1.202  1.00 0.00 ? 6  MET A CG   9  
ATOM 7230  S SD   . MET A 1 6  ? 12.101  1.730   -0.070  1.00 0.00 ? 6  MET A SD   9  
ATOM 7231  C CE   . MET A 1 6  ? 12.760  3.221   0.700   1.00 0.00 ? 6  MET A CE   9  
ATOM 7232  H H    . MET A 1 6  ? 9.526   5.101   -2.815  1.00 0.00 ? 6  MET A H    9  
ATOM 7233  H HA   . MET A 1 6  ? 11.133  4.116   -4.253  1.00 0.00 ? 6  MET A HA   9  
ATOM 7234  H HB2  . MET A 1 6  ? 12.336  2.320   -2.816  1.00 0.00 ? 6  MET A HB2  9  
ATOM 7235  H HB3  . MET A 1 6  ? 12.160  3.922   -2.166  1.00 0.00 ? 6  MET A HB3  9  
ATOM 7236  H HG2  . MET A 1 6  ? 10.364  3.258   -0.678  1.00 0.00 ? 6  MET A HG2  9  
ATOM 7237  H HG3  . MET A 1 6  ? 10.169  1.714   -1.468  1.00 0.00 ? 6  MET A HG3  9  
ATOM 7238  H HE1  . MET A 1 6  ? 13.838  3.119   0.823   1.00 0.00 ? 6  MET A HE1  9  
ATOM 7239  H HE2  . MET A 1 6  ? 12.319  3.364   1.686   1.00 0.00 ? 6  MET A HE2  9  
ATOM 7240  H HE3  . MET A 1 6  ? 12.584  4.101   0.083   1.00 0.00 ? 6  MET A HE3  9  
ATOM 7241  N N    . GLY A 1 7  ? 9.778   2.540   -5.683  1.00 0.00 ? 7  GLY A N    9  
ATOM 7242  C CA   . GLY A 1 7  ? 9.353   1.547   -6.670  1.00 0.00 ? 7  GLY A CA   9  
ATOM 7243  C C    . GLY A 1 7  ? 7.861   1.718   -6.972  1.00 0.00 ? 7  GLY A C    9  
ATOM 7244  O O    . GLY A 1 7  ? 7.408   1.578   -8.100  1.00 0.00 ? 7  GLY A O    9  
ATOM 7245  H H    . GLY A 1 7  ? 9.704   3.511   -5.910  1.00 0.00 ? 7  GLY A H    9  
ATOM 7246  H HA2  . GLY A 1 7  ? 9.931   1.731   -7.578  1.00 0.00 ? 7  GLY A HA2  9  
ATOM 7247  H HA3  . GLY A 1 7  ? 9.553   0.536   -6.302  1.00 0.00 ? 7  GLY A HA3  9  
ATOM 7248  N N    . GLY A 1 8  ? 7.159   2.055   -5.873  1.00 0.00 ? 8  GLY A N    9  
ATOM 7249  C CA   . GLY A 1 8  ? 5.731   2.355   -5.840  1.00 0.00 ? 8  GLY A CA   9  
ATOM 7250  C C    . GLY A 1 8  ? 5.256   3.256   -6.990  1.00 0.00 ? 8  GLY A C    9  
ATOM 7251  O O    . GLY A 1 8  ? 6.039   3.915   -7.658  1.00 0.00 ? 8  GLY A O    9  
ATOM 7252  H H    . GLY A 1 8  ? 7.675   2.025   -5.015  1.00 0.00 ? 8  GLY A H    9  
ATOM 7253  H HA2  . GLY A 1 8  ? 5.194   1.406   -5.815  1.00 0.00 ? 8  GLY A HA2  9  
ATOM 7254  H HA3  . GLY A 1 8  ? 5.572   2.906   -4.919  1.00 0.00 ? 8  GLY A HA3  9  
ATOM 7255  N N    . ASN A 1 9  ? 3.918   3.239   -7.177  1.00 0.00 ? 9  ASN A N    9  
ATOM 7256  C CA   . ASN A 1 9  ? 3.328   3.982   -8.300  1.00 0.00 ? 9  ASN A CA   9  
ATOM 7257  C C    . ASN A 1 9  ? 2.607   5.255   -7.819  1.00 0.00 ? 9  ASN A C    9  
ATOM 7258  O O    . ASN A 1 9  ? 2.109   6.045   -8.611  1.00 0.00 ? 9  ASN A O    9  
ATOM 7259  C CB   . ASN A 1 9  ? 2.379   3.052   -9.106  1.00 0.00 ? 9  ASN A CB   9  
ATOM 7260  C CG   . ASN A 1 9  ? 1.032   2.751   -8.418  1.00 0.00 ? 9  ASN A CG   9  
ATOM 7261  O OD1  . ASN A 1 9  ? 0.720   3.299   -7.375  1.00 0.00 ? 9  ASN A OD1  9  
ATOM 7262  N ND2  . ASN A 1 9  ? 0.220   1.905   -9.069  1.00 0.00 ? 9  ASN A ND2  9  
ATOM 7263  H H    . ASN A 1 9  ? 3.337   2.725   -6.536  1.00 0.00 ? 9  ASN A H    9  
ATOM 7264  H HA   . ASN A 1 9  ? 4.143   4.295   -8.959  1.00 0.00 ? 9  ASN A HA   9  
ATOM 7265  H HB2  . ASN A 1 9  ? 2.148   3.530   -10.059 1.00 0.00 ? 9  ASN A HB2  9  
ATOM 7266  H HB3  . ASN A 1 9  ? 2.879   2.113   -9.348  1.00 0.00 ? 9  ASN A HB3  9  
ATOM 7267  H HD21 . ASN A 1 9  ? 0.492   1.447   -9.920  1.00 0.00 ? 9  ASN A HD21 9  
ATOM 7268  H HD22 . ASN A 1 9  ? -0.695  1.764   -8.663  1.00 0.00 ? 9  ASN A HD22 9  
ATOM 7269  N N    . ALA A 1 10 ? 2.578   5.420   -6.485  1.00 0.00 ? 10 ALA A N    9  
ATOM 7270  C CA   . ALA A 1 10 ? 1.840   6.514   -5.867  1.00 0.00 ? 10 ALA A CA   9  
ATOM 7271  C C    . ALA A 1 10 ? 2.442   7.931   -6.006  1.00 0.00 ? 10 ALA A C    9  
ATOM 7272  O O    . ALA A 1 10 ? 2.214   8.772   -5.147  1.00 0.00 ? 10 ALA A O    9  
ATOM 7273  C CB   . ALA A 1 10 ? 1.668   6.168   -4.393  1.00 0.00 ? 10 ALA A CB   9  
ATOM 7274  H H    . ALA A 1 10 ? 2.973   4.715   -5.894  1.00 0.00 ? 10 ALA A H    9  
ATOM 7275  H HA   . ALA A 1 10 ? 0.861   6.518   -6.339  1.00 0.00 ? 10 ALA A HA   9  
ATOM 7276  H HB1  . ALA A 1 10 ? 0.960   6.845   -3.917  1.00 0.00 ? 10 ALA A HB1  9  
ATOM 7277  H HB2  . ALA A 1 10 ? 2.616   6.221   -3.857  1.00 0.00 ? 10 ALA A HB2  9  
ATOM 7278  H HB3  . ALA A 1 10 ? 1.276   5.159   -4.282  1.00 0.00 ? 10 ALA A HB3  9  
ATOM 7279  N N    . GLU A 1 11 ? 3.198   8.179   -7.092  1.00 0.00 ? 11 GLU A N    9  
ATOM 7280  C CA   . GLU A 1 11 ? 3.743   9.514   -7.377  1.00 0.00 ? 11 GLU A CA   9  
ATOM 7281  C C    . GLU A 1 11 ? 4.446   10.195  -6.171  1.00 0.00 ? 11 GLU A C    9  
ATOM 7282  O O    . GLU A 1 11 ? 4.334   11.394  -5.956  1.00 0.00 ? 11 GLU A O    9  
ATOM 7283  C CB   . GLU A 1 11 ? 2.611   10.392  -7.944  1.00 0.00 ? 11 GLU A CB   9  
ATOM 7284  C CG   . GLU A 1 11 ? 2.103   9.890   -9.315  1.00 0.00 ? 11 GLU A CG   9  
ATOM 7285  C CD   . GLU A 1 11 ? 0.611   10.158  -9.568  1.00 0.00 ? 11 GLU A CD   9  
ATOM 7286  O OE1  . GLU A 1 11 ? -0.065  10.773  -8.742  1.00 0.00 ? 11 GLU A OE1  9  
ATOM 7287  O OE2  . GLU A 1 11 ? 0.074   9.658   -10.555 1.00 0.00 ? 11 GLU A OE2  9  
ATOM 7288  H H    . GLU A 1 11 ? 3.305   7.453   -7.771  1.00 0.00 ? 11 GLU A H    9  
ATOM 7289  H HA   . GLU A 1 11 ? 4.501   9.361   -8.144  1.00 0.00 ? 11 GLU A HA   9  
ATOM 7290  H HB2  . GLU A 1 11 ? 1.808   10.419  -7.206  1.00 0.00 ? 11 GLU A HB2  9  
ATOM 7291  H HB3  . GLU A 1 11 ? 2.939   11.426  -8.055  1.00 0.00 ? 11 GLU A HB3  9  
ATOM 7292  H HG2  . GLU A 1 11 ? 2.681   10.345  -10.119 1.00 0.00 ? 11 GLU A HG2  9  
ATOM 7293  H HG3  . GLU A 1 11 ? 2.247   8.814   -9.411  1.00 0.00 ? 11 GLU A HG3  9  
ATOM 7294  N N    . GLY A 1 12 ? 5.196   9.365   -5.419  1.00 0.00 ? 12 GLY A N    9  
ATOM 7295  C CA   . GLY A 1 12 ? 5.979   9.885   -4.286  1.00 0.00 ? 12 GLY A CA   9  
ATOM 7296  C C    . GLY A 1 12 ? 5.179   9.977   -2.968  1.00 0.00 ? 12 GLY A C    9  
ATOM 7297  O O    . GLY A 1 12 ? 5.743   10.306  -1.933  1.00 0.00 ? 12 GLY A O    9  
ATOM 7298  H H    . GLY A 1 12 ? 5.201   8.403   -5.693  1.00 0.00 ? 12 GLY A H    9  
ATOM 7299  H HA2  . GLY A 1 12 ? 6.801   9.131   -4.106  1.00 0.00 ? 12 GLY A HA2  9  
ATOM 7300  H HA3  . GLY A 1 12 ? 6.271   10.946  -4.550  1.00 0.00 ? 12 GLY A HA3  9  
ATOM 7301  N N    . GLN A 1 13 ? 3.865   9.679   -3.027  1.00 0.00 ? 13 GLN A N    9  
ATOM 7302  C CA   . GLN A 1 13 ? 3.057   9.757   -1.808  1.00 0.00 ? 13 GLN A CA   9  
ATOM 7303  C C    . GLN A 1 13 ? 3.509   8.693   -0.770  1.00 0.00 ? 13 GLN A C    9  
ATOM 7304  O O    . GLN A 1 13 ? 3.733   7.540   -1.113  1.00 0.00 ? 13 GLN A O    9  
ATOM 7305  C CB   . GLN A 1 13 ? 1.563   9.549   -2.119  1.00 0.00 ? 13 GLN A CB   9  
ATOM 7306  C CG   . GLN A 1 13 ? 0.908   10.720  -2.877  1.00 0.00 ? 13 GLN A CG   9  
ATOM 7307  C CD   . GLN A 1 13 ? 0.768   11.942  -1.960  1.00 0.00 ? 13 GLN A CD   9  
ATOM 7308  O OE1  . GLN A 1 13 ? 1.672   12.750  -1.815  1.00 0.00 ? 13 GLN A OE1  9  
ATOM 7309  N NE2  . GLN A 1 13 ? -0.412  12.022  -1.334  1.00 0.00 ? 13 GLN A NE2  9  
ATOM 7310  H H    . GLN A 1 13 ? 3.445   9.394   -3.889  1.00 0.00 ? 13 GLN A H    9  
ATOM 7311  H HA   . GLN A 1 13 ? 3.219   10.752  -1.397  1.00 0.00 ? 13 GLN A HA   9  
ATOM 7312  H HB2  . GLN A 1 13 ? 1.437   8.626   -2.681  1.00 0.00 ? 13 GLN A HB2  9  
ATOM 7313  H HB3  . GLN A 1 13 ? 1.008   9.430   -1.186  1.00 0.00 ? 13 GLN A HB3  9  
ATOM 7314  H HG2  . GLN A 1 13 ? 1.470   11.018  -3.761  1.00 0.00 ? 13 GLN A HG2  9  
ATOM 7315  H HG3  . GLN A 1 13 ? -0.082  10.429  -3.229  1.00 0.00 ? 13 GLN A HG3  9  
ATOM 7316  H HE21 . GLN A 1 13 ? -1.133  11.344  -1.471  1.00 0.00 ? 13 GLN A HE21 9  
ATOM 7317  H HE22 . GLN A 1 13 ? -0.553  12.792  -0.715  1.00 0.00 ? 13 GLN A HE22 9  
ATOM 7318  N N    . PRO A 1 14 ? 3.615   9.109   0.523   1.00 0.00 ? 14 PRO A N    9  
ATOM 7319  C CA   . PRO A 1 14 ? 3.992   8.195   1.599   1.00 0.00 ? 14 PRO A CA   9  
ATOM 7320  C C    . PRO A 1 14 ? 2.840   7.239   1.967   1.00 0.00 ? 14 PRO A C    9  
ATOM 7321  O O    . PRO A 1 14 ? 1.670   7.631   1.962   1.00 0.00 ? 14 PRO A O    9  
ATOM 7322  C CB   . PRO A 1 14 ? 4.308   9.130   2.773   1.00 0.00 ? 14 PRO A CB   9  
ATOM 7323  C CG   . PRO A 1 14 ? 3.468   10.387  2.521   1.00 0.00 ? 14 PRO A CG   9  
ATOM 7324  C CD   . PRO A 1 14 ? 3.382   10.475  0.995   1.00 0.00 ? 14 PRO A CD   9  
ATOM 7325  H HA   . PRO A 1 14 ? 4.870   7.614   1.313   1.00 0.00 ? 14 PRO A HA   9  
ATOM 7326  H HB2  . PRO A 1 14 ? 4.104   8.679   3.747   1.00 0.00 ? 14 PRO A HB2  9  
ATOM 7327  H HB3  . PRO A 1 14 ? 5.369   9.401   2.724   1.00 0.00 ? 14 PRO A HB3  9  
ATOM 7328  H HG2  . PRO A 1 14 ? 2.433   10.176  2.902   1.00 0.00 ? 14 PRO A HG2  9  
ATOM 7329  H HG3  . PRO A 1 14 ? 3.994   11.292  2.924   1.00 0.00 ? 14 PRO A HG3  9  
ATOM 7330  H HD2  . PRO A 1 14 ? 2.409   10.852  0.674   1.00 0.00 ? 14 PRO A HD2  9  
ATOM 7331  H HD3  . PRO A 1 14 ? 4.162   11.131  0.604   1.00 0.00 ? 14 PRO A HD3  9  
ATOM 7332  N N    . CYS A 1 15 ? 3.246   5.983   2.305   1.00 0.00 ? 15 CYS A N    9  
ATOM 7333  C CA   . CYS A 1 15 ? 2.302   4.917   2.691   1.00 0.00 ? 15 CYS A CA   9  
ATOM 7334  C C    . CYS A 1 15 ? 1.200   5.474   3.590   1.00 0.00 ? 15 CYS A C    9  
ATOM 7335  O O    . CYS A 1 15 ? 1.405   6.395   4.377   1.00 0.00 ? 15 CYS A O    9  
ATOM 7336  C CB   . CYS A 1 15 ? 2.991   3.848   3.549   1.00 0.00 ? 15 CYS A CB   9  
ATOM 7337  S SG   . CYS A 1 15 ? 4.015   2.676   2.633   1.00 0.00 ? 15 CYS A SG   9  
ATOM 7338  H H    . CYS A 1 15 ? 4.230   5.786   2.285   1.00 0.00 ? 15 CYS A H    9  
ATOM 7339  H HA   . CYS A 1 15 ? 1.831   4.495   1.798   1.00 0.00 ? 15 CYS A HA   9  
ATOM 7340  H HB2  . CYS A 1 15 ? 3.581   4.324   4.327   1.00 0.00 ? 15 CYS A HB2  9  
ATOM 7341  H HB3  . CYS A 1 15 ? 2.257   3.245   4.080   1.00 0.00 ? 15 CYS A HB3  9  
ATOM 7342  N N    . LYS A 1 16 ? -0.001  4.918   3.386   1.00 0.00 ? 16 LYS A N    9  
ATOM 7343  C CA   . LYS A 1 16 ? -1.172  5.398   4.091   1.00 0.00 ? 16 LYS A CA   9  
ATOM 7344  C C    . LYS A 1 16 ? -1.777  4.250   4.878   1.00 0.00 ? 16 LYS A C    9  
ATOM 7345  O O    . LYS A 1 16 ? -1.908  3.130   4.406   1.00 0.00 ? 16 LYS A O    9  
ATOM 7346  C CB   . LYS A 1 16 ? -2.162  5.929   3.043   1.00 0.00 ? 16 LYS A CB   9  
ATOM 7347  C CG   . LYS A 1 16 ? -3.231  6.928   3.573   1.00 0.00 ? 16 LYS A CG   9  
ATOM 7348  C CD   . LYS A 1 16 ? -2.660  8.351   3.723   1.00 0.00 ? 16 LYS A CD   9  
ATOM 7349  C CE   . LYS A 1 16 ? -1.376  8.621   4.530   1.00 0.00 ? 16 LYS A CE   9  
ATOM 7350  N NZ   . LYS A 1 16 ? -0.103  8.371   3.832   1.00 0.00 ? 16 LYS A NZ   9  
ATOM 7351  H H    . LYS A 1 16 ? -0.119  4.152   2.748   1.00 0.00 ? 16 LYS A H    9  
ATOM 7352  H HA   . LYS A 1 16 ? -0.812  6.153   4.793   1.00 0.00 ? 16 LYS A HA   9  
ATOM 7353  H HB2  . LYS A 1 16 ? -1.591  6.473   2.292   1.00 0.00 ? 16 LYS A HB2  9  
ATOM 7354  H HB3  . LYS A 1 16 ? -2.546  5.050   2.503   1.00 0.00 ? 16 LYS A HB3  9  
ATOM 7355  H HG2  . LYS A 1 16 ? -4.038  7.087   2.847   1.00 0.00 ? 16 LYS A HG2  9  
ATOM 7356  H HG3  . LYS A 1 16 ? -3.811  6.592   4.442   1.00 0.00 ? 16 LYS A HG3  9  
ATOM 7357  H HD2  . LYS A 1 16 ? -2.493  8.726   2.719   1.00 0.00 ? 16 LYS A HD2  9  
ATOM 7358  H HD3  . LYS A 1 16 ? -3.455  8.943   4.166   1.00 0.00 ? 16 LYS A HD3  9  
ATOM 7359  H HE2  . LYS A 1 16 ? -1.374  9.684   4.779   1.00 0.00 ? 16 LYS A HE2  9  
ATOM 7360  H HE3  . LYS A 1 16 ? -1.377  8.100   5.488   1.00 0.00 ? 16 LYS A HE3  9  
ATOM 7361  H HZ1  . LYS A 1 16 ? 0.680   8.864   4.303   1.00 0.00 ? 16 LYS A HZ1  9  
ATOM 7362  H HZ2  . LYS A 1 16 ? -0.103  8.644   2.826   1.00 0.00 ? 16 LYS A HZ2  9  
ATOM 7363  H HZ3  . LYS A 1 16 ? 0.173   7.368   3.863   1.00 0.00 ? 16 LYS A HZ3  9  
ATOM 7364  N N    . PHE A 1 17 ? -2.092  4.624   6.121   1.00 0.00 ? 17 PHE A N    9  
ATOM 7365  C CA   . PHE A 1 17 ? -2.694  3.701   7.066   1.00 0.00 ? 17 PHE A CA   9  
ATOM 7366  C C    . PHE A 1 17 ? -3.795  4.519   7.765   1.00 0.00 ? 17 PHE A C    9  
ATOM 7367  O O    . PHE A 1 17 ? -3.521  5.647   8.156   1.00 0.00 ? 17 PHE A O    9  
ATOM 7368  C CB   . PHE A 1 17 ? -1.640  3.231   8.098   1.00 0.00 ? 17 PHE A CB   9  
ATOM 7369  C CG   . PHE A 1 17 ? -0.447  2.518   7.502   1.00 0.00 ? 17 PHE A CG   9  
ATOM 7370  C CD1  . PHE A 1 17 ? -0.599  1.302   6.847   1.00 0.00 ? 17 PHE A CD1  9  
ATOM 7371  C CD2  . PHE A 1 17 ? 0.839   3.038   7.628   1.00 0.00 ? 17 PHE A CD2  9  
ATOM 7372  C CE1  . PHE A 1 17 ? 0.500   0.611   6.361   1.00 0.00 ? 17 PHE A CE1  9  
ATOM 7373  C CE2  . PHE A 1 17 ? 1.941   2.346   7.146   1.00 0.00 ? 17 PHE A CE2  9  
ATOM 7374  C CZ   . PHE A 1 17 ? 1.778   1.118   6.524   1.00 0.00 ? 17 PHE A CZ   9  
ATOM 7375  H H    . PHE A 1 17 ? -1.993  5.594   6.358   1.00 0.00 ? 17 PHE A H    9  
ATOM 7376  H HA   . PHE A 1 17 ? -3.117  2.874   6.493   1.00 0.00 ? 17 PHE A HA   9  
ATOM 7377  H HB2  . PHE A 1 17 ? -1.279  4.098   8.662   1.00 0.00 ? 17 PHE A HB2  9  
ATOM 7378  H HB3  . PHE A 1 17 ? -2.092  2.538   8.821   1.00 0.00 ? 17 PHE A HB3  9  
ATOM 7379  H HD1  . PHE A 1 17 ? -1.577  0.879   6.718   1.00 0.00 ? 17 PHE A HD1  9  
ATOM 7380  H HD2  . PHE A 1 17 ? 1.008   3.981   8.114   1.00 0.00 ? 17 PHE A HD2  9  
ATOM 7381  H HE1  . PHE A 1 17 ? 0.356   -0.327  5.858   1.00 0.00 ? 17 PHE A HE1  9  
ATOM 7382  H HE2  . PHE A 1 17 ? 2.923   2.772   7.267   1.00 0.00 ? 17 PHE A HE2  9  
ATOM 7383  H HZ   . PHE A 1 17 ? 2.635   0.549   6.185   1.00 0.00 ? 17 PHE A HZ   9  
ATOM 7384  N N    . PRO A 1 18 ? -5.028  3.964   7.915   1.00 0.00 ? 18 PRO A N    9  
ATOM 7385  C CA   . PRO A 1 18 ? -5.495  2.700   7.348   1.00 0.00 ? 18 PRO A CA   9  
ATOM 7386  C C    . PRO A 1 18 ? -5.957  2.869   5.884   1.00 0.00 ? 18 PRO A C    9  
ATOM 7387  O O    . PRO A 1 18 ? -6.618  3.841   5.542   1.00 0.00 ? 18 PRO A O    9  
ATOM 7388  C CB   . PRO A 1 18 ? -6.701  2.341   8.225   1.00 0.00 ? 18 PRO A CB   9  
ATOM 7389  C CG   . PRO A 1 18 ? -7.261  3.694   8.675   1.00 0.00 ? 18 PRO A CG   9  
ATOM 7390  C CD   . PRO A 1 18 ? -6.038  4.617   8.746   1.00 0.00 ? 18 PRO A CD   9  
ATOM 7391  H HA   . PRO A 1 18 ? -4.727  1.936   7.425   1.00 0.00 ? 18 PRO A HA   9  
ATOM 7392  H HB2  . PRO A 1 18 ? -7.441  1.713   7.726   1.00 0.00 ? 18 PRO A HB2  9  
ATOM 7393  H HB3  . PRO A 1 18 ? -6.350  1.791   9.099   1.00 0.00 ? 18 PRO A HB3  9  
ATOM 7394  H HG2  . PRO A 1 18 ? -7.954  4.069   7.921   1.00 0.00 ? 18 PRO A HG2  9  
ATOM 7395  H HG3  . PRO A 1 18 ? -7.798  3.633   9.622   1.00 0.00 ? 18 PRO A HG3  9  
ATOM 7396  H HD2  . PRO A 1 18 ? -6.263  5.619   8.370   1.00 0.00 ? 18 PRO A HD2  9  
ATOM 7397  H HD3  . PRO A 1 18 ? -5.666  4.685   9.772   1.00 0.00 ? 18 PRO A HD3  9  
ATOM 7398  N N    . PHE A 1 19 ? -5.582  1.880   5.051   1.00 0.00 ? 19 PHE A N    9  
ATOM 7399  C CA   . PHE A 1 19 ? -6.005  1.852   3.651   1.00 0.00 ? 19 PHE A CA   9  
ATOM 7400  C C    . PHE A 1 19 ? -7.016  0.698   3.499   1.00 0.00 ? 19 PHE A C    9  
ATOM 7401  O O    . PHE A 1 19 ? -6.840  -0.378  4.055   1.00 0.00 ? 19 PHE A O    9  
ATOM 7402  C CB   . PHE A 1 19 ? -4.837  1.718   2.653   1.00 0.00 ? 19 PHE A CB   9  
ATOM 7403  C CG   . PHE A 1 19 ? -3.969  0.467   2.835   1.00 0.00 ? 19 PHE A CG   9  
ATOM 7404  C CD1  . PHE A 1 19 ? -3.054  0.278   3.891   1.00 0.00 ? 19 PHE A CD1  9  
ATOM 7405  C CD2  . PHE A 1 19 ? -4.075  -0.545  1.873   1.00 0.00 ? 19 PHE A CD2  9  
ATOM 7406  C CE1  . PHE A 1 19 ? -2.231  -0.839  3.925   1.00 0.00 ? 19 PHE A CE1  9  
ATOM 7407  C CE2  . PHE A 1 19 ? -3.250  -1.690  1.931   1.00 0.00 ? 19 PHE A CE2  9  
ATOM 7408  C CZ   . PHE A 1 19 ? -2.312  -1.810  2.942   1.00 0.00 ? 19 PHE A CZ   9  
ATOM 7409  H H    . PHE A 1 19 ? -5.075  1.106   5.436   1.00 0.00 ? 19 PHE A H    9  
ATOM 7410  H HA   . PHE A 1 19 ? -6.531  2.778   3.424   1.00 0.00 ? 19 PHE A HA   9  
ATOM 7411  H HB2  . PHE A 1 19 ? -5.304  1.651   1.657   1.00 0.00 ? 19 PHE A HB2  9  
ATOM 7412  H HB3  . PHE A 1 19 ? -4.251  2.659   2.622   1.00 0.00 ? 19 PHE A HB3  9  
ATOM 7413  H HD1  . PHE A 1 19 ? -2.912  0.923   4.753   1.00 0.00 ? 19 PHE A HD1  9  
ATOM 7414  H HD2  . PHE A 1 19 ? -4.836  -0.351  1.110   1.00 0.00 ? 19 PHE A HD2  9  
ATOM 7415  H HE1  . PHE A 1 19 ? -1.527  -0.952  4.737   1.00 0.00 ? 19 PHE A HE1  9  
ATOM 7416  H HE2  . PHE A 1 19 ? -3.244  -2.556  1.262   1.00 0.00 ? 19 PHE A HE2  9  
ATOM 7417  H HZ   . PHE A 1 19 ? -1.646  -2.665  2.950   1.00 0.00 ? 19 PHE A HZ   9  
ATOM 7418  N N    . ARG A 1 20 ? -8.101  0.990   2.751   1.00 0.00 ? 20 ARG A N    9  
ATOM 7419  C CA   . ARG A 1 20 ? -9.193  0.037   2.558   1.00 0.00 ? 20 ARG A CA   9  
ATOM 7420  C C    . ARG A 1 20 ? -9.064  -0.563  1.136   1.00 0.00 ? 20 ARG A C    9  
ATOM 7421  O O    . ARG A 1 20 ? -9.112  0.160   0.148   1.00 0.00 ? 20 ARG A O    9  
ATOM 7422  C CB   . ARG A 1 20 ? -10.521 0.822   2.761   1.00 0.00 ? 20 ARG A CB   9  
ATOM 7423  C CG   . ARG A 1 20 ? -11.813 -0.005  2.974   1.00 0.00 ? 20 ARG A CG   9  
ATOM 7424  C CD   . ARG A 1 20 ? -13.097 0.726   2.441   1.00 0.00 ? 20 ARG A CD   9  
ATOM 7425  N NE   . ARG A 1 20 ? -12.932 1.180   1.036   1.00 0.00 ? 20 ARG A NE   9  
ATOM 7426  C CZ   . ARG A 1 20 ? -12.799 0.297   0.027   1.00 0.00 ? 20 ARG A CZ   9  
ATOM 7427  N NH1  . ARG A 1 20 ? -12.845 -1.002  0.241   1.00 0.00 ? 20 ARG A NH1  9  
ATOM 7428  N NH2  . ARG A 1 20 ? -12.605 0.698   -1.212  1.00 0.00 ? 20 ARG A NH2  9  
ATOM 7429  H H    . ARG A 1 20 ? -8.186  1.892   2.323   1.00 0.00 ? 20 ARG A H    9  
ATOM 7430  H HA   . ARG A 1 20 ? -9.051  -0.742  3.305   1.00 0.00 ? 20 ARG A HA   9  
ATOM 7431  H HB2  . ARG A 1 20 ? -10.422 1.480   3.626   1.00 0.00 ? 20 ARG A HB2  9  
ATOM 7432  H HB3  . ARG A 1 20 ? -10.637 1.501   1.916   1.00 0.00 ? 20 ARG A HB3  9  
ATOM 7433  H HG2  . ARG A 1 20 ? -11.708 -0.968  2.482   1.00 0.00 ? 20 ARG A HG2  9  
ATOM 7434  H HG3  . ARG A 1 20 ? -11.895 -0.277  4.042   1.00 0.00 ? 20 ARG A HG3  9  
ATOM 7435  H HD2  . ARG A 1 20 ? -13.993 0.080   2.477   1.00 0.00 ? 20 ARG A HD2  9  
ATOM 7436  H HD3  . ARG A 1 20 ? -13.351 1.615   3.036   1.00 0.00 ? 20 ARG A HD3  9  
ATOM 7437  H HE   . ARG A 1 20 ? -12.854 2.141   0.702   1.00 0.00 ? 20 ARG A HE   9  
ATOM 7438  H HH11 . ARG A 1 20 ? -13.015 -1.364  1.154   1.00 0.00 ? 20 ARG A HH11 9  
ATOM 7439  H HH12 . ARG A 1 20 ? -12.692 -1.600  -0.555  1.00 0.00 ? 20 ARG A HH12 9  
ATOM 7440  H HH21 . ARG A 1 20 ? -12.569 1.683   -1.453  1.00 0.00 ? 20 ARG A HH21 9  
ATOM 7441  H HH22 . ARG A 1 20 ? -12.463 0.010   -1.934  1.00 0.00 ? 20 ARG A HH22 9  
ATOM 7442  N N    . PHE A 1 21 ? -8.865  -1.897  1.086   1.00 0.00 ? 21 PHE A N    9  
ATOM 7443  C CA   . PHE A 1 21 ? -8.658  -2.634  -0.166  1.00 0.00 ? 21 PHE A CA   9  
ATOM 7444  C C    . PHE A 1 21 ? -9.504  -3.913  -0.100  1.00 0.00 ? 21 PHE A C    9  
ATOM 7445  O O    . PHE A 1 21 ? -9.688  -4.480  0.963   1.00 0.00 ? 21 PHE A O    9  
ATOM 7446  C CB   . PHE A 1 21 ? -7.159  -2.979  -0.249  1.00 0.00 ? 21 PHE A CB   9  
ATOM 7447  C CG   . PHE A 1 21 ? -6.800  -3.973  -1.322  1.00 0.00 ? 21 PHE A CG   9  
ATOM 7448  C CD1  . PHE A 1 21 ? -7.129  -3.731  -2.645  1.00 0.00 ? 21 PHE A CD1  9  
ATOM 7449  C CD2  . PHE A 1 21 ? -6.105  -5.135  -1.005  1.00 0.00 ? 21 PHE A CD2  9  
ATOM 7450  C CE1  . PHE A 1 21 ? -6.698  -4.582  -3.655  1.00 0.00 ? 21 PHE A CE1  9  
ATOM 7451  C CE2  . PHE A 1 21 ? -5.672  -5.995  -2.007  1.00 0.00 ? 21 PHE A CE2  9  
ATOM 7452  C CZ   . PHE A 1 21 ? -5.954  -5.711  -3.336  1.00 0.00 ? 21 PHE A CZ   9  
ATOM 7453  H H    . PHE A 1 21 ? -8.859  -2.431  1.943   1.00 0.00 ? 21 PHE A H    9  
ATOM 7454  H HA   . PHE A 1 21 ? -8.985  -2.044  -1.032  1.00 0.00 ? 21 PHE A HA   9  
ATOM 7455  H HB2  . PHE A 1 21 ? -6.581  -2.063  -0.422  1.00 0.00 ? 21 PHE A HB2  9  
ATOM 7456  H HB3  . PHE A 1 21 ? -6.827  -3.414  0.695   1.00 0.00 ? 21 PHE A HB3  9  
ATOM 7457  H HD1  . PHE A 1 21 ? -7.755  -2.884  -2.862  1.00 0.00 ? 21 PHE A HD1  9  
ATOM 7458  H HD2  . PHE A 1 21 ? -5.926  -5.379  0.032   1.00 0.00 ? 21 PHE A HD2  9  
ATOM 7459  H HE1  . PHE A 1 21 ? -6.948  -4.367  -4.684  1.00 0.00 ? 21 PHE A HE1  9  
ATOM 7460  H HE2  . PHE A 1 21 ? -5.121  -6.888  -1.750  1.00 0.00 ? 21 PHE A HE2  9  
ATOM 7461  H HZ   . PHE A 1 21 ? -5.607  -6.374  -4.115  1.00 0.00 ? 21 PHE A HZ   9  
ATOM 7462  N N    . GLN A 1 22 ? -10.035 -4.342  -1.258  1.00 0.00 ? 22 GLN A N    9  
ATOM 7463  C CA   . GLN A 1 22 ? -10.879 -5.539  -1.314  1.00 0.00 ? 22 GLN A CA   9  
ATOM 7464  C C    . GLN A 1 22 ? -12.021 -5.463  -0.253  1.00 0.00 ? 22 GLN A C    9  
ATOM 7465  O O    . GLN A 1 22 ? -12.363 -6.456  0.380   1.00 0.00 ? 22 GLN A O    9  
ATOM 7466  C CB   . GLN A 1 22 ? -10.091 -6.869  -1.101  1.00 0.00 ? 22 GLN A CB   9  
ATOM 7467  C CG   . GLN A 1 22 ? -9.007  -7.212  -2.157  1.00 0.00 ? 22 GLN A CG   9  
ATOM 7468  C CD   . GLN A 1 22 ? -8.021  -8.308  -1.701  1.00 0.00 ? 22 GLN A CD   9  
ATOM 7469  O OE1  . GLN A 1 22 ? -7.681  -9.194  -2.473  1.00 0.00 ? 22 GLN A OE1  9  
ATOM 7470  N NE2  . GLN A 1 22 ? -7.579  -8.234  -0.443  1.00 0.00 ? 22 GLN A NE2  9  
ATOM 7471  H H    . GLN A 1 22 ? -9.872  -3.797  -2.086  1.00 0.00 ? 22 GLN A H    9  
ATOM 7472  H HA   . GLN A 1 22 ? -11.315 -5.494  -2.312  1.00 0.00 ? 22 GLN A HA   9  
ATOM 7473  H HB2  . GLN A 1 22 ? -9.656  -6.832  -0.102  1.00 0.00 ? 22 GLN A HB2  9  
ATOM 7474  H HB3  . GLN A 1 22 ? -10.789 -7.708  -1.097  1.00 0.00 ? 22 GLN A HB3  9  
ATOM 7475  H HG2  . GLN A 1 22 ? -9.428  -7.674  -3.074  1.00 0.00 ? 22 GLN A HG2  9  
ATOM 7476  H HG3  . GLN A 1 22 ? -8.453  -6.290  -2.382  1.00 0.00 ? 22 GLN A HG3  9  
ATOM 7477  H HE21 . GLN A 1 22 ? -7.808  -7.532  0.238   1.00 0.00 ? 22 GLN A HE21 9  
ATOM 7478  H HE22 . GLN A 1 22 ? -6.941  -8.929  -0.100  1.00 0.00 ? 22 GLN A HE22 9  
ATOM 7479  N N    . GLY A 1 23 ? -12.575 -4.241  -0.050  1.00 0.00 ? 23 GLY A N    9  
ATOM 7480  C CA   . GLY A 1 23 ? -13.670 -4.121  0.923   1.00 0.00 ? 23 GLY A CA   9  
ATOM 7481  C C    . GLY A 1 23 ? -13.251 -4.364  2.392   1.00 0.00 ? 23 GLY A C    9  
ATOM 7482  O O    . GLY A 1 23 ? -14.092 -4.471  3.271   1.00 0.00 ? 23 GLY A O    9  
ATOM 7483  H H    . GLY A 1 23 ? -12.248 -3.449  -0.569  1.00 0.00 ? 23 GLY A H    9  
ATOM 7484  H HA2  . GLY A 1 23 ? -14.116 -3.128  0.819   1.00 0.00 ? 23 GLY A HA2  9  
ATOM 7485  H HA3  . GLY A 1 23 ? -14.423 -4.871  0.654   1.00 0.00 ? 23 GLY A HA3  9  
ATOM 7486  N N    . THR A 1 24 ? -11.925 -4.462  2.599   1.00 0.00 ? 24 THR A N    9  
ATOM 7487  C CA   . THR A 1 24 ? -11.331 -4.780  3.889   1.00 0.00 ? 24 THR A CA   9  
ATOM 7488  C C    . THR A 1 24 ? -10.381 -3.638  4.306   1.00 0.00 ? 24 THR A C    9  
ATOM 7489  O O    . THR A 1 24 ? -9.806  -2.960  3.466   1.00 0.00 ? 24 THR A O    9  
ATOM 7490  C CB   . THR A 1 24 ? -10.599 -6.121  3.689   1.00 0.00 ? 24 THR A CB   9  
ATOM 7491  O OG1  . THR A 1 24 ? -11.458 -7.052  3.046   1.00 0.00 ? 24 THR A OG1  9  
ATOM 7492  C CG2  . THR A 1 24 ? -10.152 -6.747  5.014   1.00 0.00 ? 24 THR A CG2  9  
ATOM 7493  H H    . THR A 1 24 ? -11.263 -4.352  1.859   1.00 0.00 ? 24 THR A H    9  
ATOM 7494  H HA   . THR A 1 24 ? -12.128 -4.879  4.628   1.00 0.00 ? 24 THR A HA   9  
ATOM 7495  H HB   . THR A 1 24 ? -9.709  -5.982  3.067   1.00 0.00 ? 24 THR A HB   9  
ATOM 7496  H HG1  . THR A 1 24 ? -11.751 -6.723  2.190   1.00 0.00 ? 24 THR A HG1  9  
ATOM 7497  H HG21 . THR A 1 24 ? -11.001 -6.903  5.680   1.00 0.00 ? 24 THR A HG21 9  
ATOM 7498  H HG22 . THR A 1 24 ? -9.426  -6.118  5.531   1.00 0.00 ? 24 THR A HG22 9  
ATOM 7499  H HG23 . THR A 1 24 ? -9.682  -7.715  4.842   1.00 0.00 ? 24 THR A HG23 9  
ATOM 7500  N N    . SER A 1 25 ? -10.264 -3.447  5.634   1.00 0.00 ? 25 SER A N    9  
ATOM 7501  C CA   . SER A 1 25 ? -9.436  -2.393  6.214   1.00 0.00 ? 25 SER A CA   9  
ATOM 7502  C C    . SER A 1 25 ? -8.051  -2.946  6.596   1.00 0.00 ? 25 SER A C    9  
ATOM 7503  O O    . SER A 1 25 ? -7.969  -3.952  7.291   1.00 0.00 ? 25 SER A O    9  
ATOM 7504  C CB   . SER A 1 25 ? -10.148 -1.998  7.512   1.00 0.00 ? 25 SER A CB   9  
ATOM 7505  O OG   . SER A 1 25 ? -10.472 -3.171  8.243   1.00 0.00 ? 25 SER A OG   9  
ATOM 7506  H H    . SER A 1 25 ? -10.749 -4.018  6.297   1.00 0.00 ? 25 SER A H    9  
ATOM 7507  H HA   . SER A 1 25 ? -9.353  -1.557  5.517   1.00 0.00 ? 25 SER A HA   9  
ATOM 7508  H HB2  . SER A 1 25 ? -9.554  -1.311  8.126   1.00 0.00 ? 25 SER A HB2  9  
ATOM 7509  H HB3  . SER A 1 25 ? -11.084 -1.484  7.285   1.00 0.00 ? 25 SER A HB3  9  
ATOM 7510  H HG   . SER A 1 25 ? -9.676  -3.698  8.358   1.00 0.00 ? 25 SER A HG   9  
ATOM 7511  N N    . TYR A 1 26 ? -7.001  -2.236  6.137   1.00 0.00 ? 26 TYR A N    9  
ATOM 7512  C CA   . TYR A 1 26 ? -5.612  -2.606  6.397   1.00 0.00 ? 26 TYR A CA   9  
ATOM 7513  C C    . TYR A 1 26 ? -4.911  -1.438  7.102   1.00 0.00 ? 26 TYR A C    9  
ATOM 7514  O O    . TYR A 1 26 ? -5.080  -0.287  6.723   1.00 0.00 ? 26 TYR A O    9  
ATOM 7515  C CB   . TYR A 1 26 ? -4.847  -2.814  5.081   1.00 0.00 ? 26 TYR A CB   9  
ATOM 7516  C CG   . TYR A 1 26 ? -5.369  -3.923  4.217   1.00 0.00 ? 26 TYR A CG   9  
ATOM 7517  C CD1  . TYR A 1 26 ? -6.604  -3.820  3.591   1.00 0.00 ? 26 TYR A CD1  9  
ATOM 7518  C CD2  . TYR A 1 26 ? -4.607  -5.063  4.003   1.00 0.00 ? 26 TYR A CD2  9  
ATOM 7519  C CE1  . TYR A 1 26 ? -7.076  -4.852  2.808   1.00 0.00 ? 26 TYR A CE1  9  
ATOM 7520  C CE2  . TYR A 1 26 ? -5.079  -6.082  3.194   1.00 0.00 ? 26 TYR A CE2  9  
ATOM 7521  C CZ   . TYR A 1 26 ? -6.330  -5.993  2.608   1.00 0.00 ? 26 TYR A CZ   9  
ATOM 7522  O OH   . TYR A 1 26 ? -6.857  -6.991  1.817   1.00 0.00 ? 26 TYR A OH   9  
ATOM 7523  H H    . TYR A 1 26 ? -7.133  -1.416  5.574   1.00 0.00 ? 26 TYR A H    9  
ATOM 7524  H HA   . TYR A 1 26 ? -5.582  -3.500  7.022   1.00 0.00 ? 26 TYR A HA   9  
ATOM 7525  H HB2  . TYR A 1 26 ? -4.880  -1.905  4.476   1.00 0.00 ? 26 TYR A HB2  9  
ATOM 7526  H HB3  . TYR A 1 26 ? -3.805  -3.035  5.327   1.00 0.00 ? 26 TYR A HB3  9  
ATOM 7527  H HD1  . TYR A 1 26 ? -7.208  -2.932  3.686   1.00 0.00 ? 26 TYR A HD1  9  
ATOM 7528  H HD2  . TYR A 1 26 ? -3.631  -5.162  4.451   1.00 0.00 ? 26 TYR A HD2  9  
ATOM 7529  H HE1  . TYR A 1 26 ? -8.019  -4.758  2.317   1.00 0.00 ? 26 TYR A HE1  9  
ATOM 7530  H HE2  . TYR A 1 26 ? -4.444  -6.920  3.008   1.00 0.00 ? 26 TYR A HE2  9  
ATOM 7531  H HH   . TYR A 1 26 ? -6.387  -7.821  1.940   1.00 0.00 ? 26 TYR A HH   9  
ATOM 7532  N N    . ASP A 1 27 ? -4.100  -1.803  8.113   1.00 0.00 ? 27 ASP A N    9  
ATOM 7533  C CA   . ASP A 1 27 ? -3.308  -0.821  8.857   1.00 0.00 ? 27 ASP A CA   9  
ATOM 7534  C C    . ASP A 1 27 ? -1.841  -1.296  8.916   1.00 0.00 ? 27 ASP A C    9  
ATOM 7535  O O    . ASP A 1 27 ? -1.098  -1.020  9.847   1.00 0.00 ? 27 ASP A O    9  
ATOM 7536  C CB   . ASP A 1 27 ? -3.947  -0.629  10.247  1.00 0.00 ? 27 ASP A CB   9  
ATOM 7537  C CG   . ASP A 1 27 ? -3.648  0.761   10.832  1.00 0.00 ? 27 ASP A CG   9  
ATOM 7538  O OD1  . ASP A 1 27 ? -3.973  1.751   10.178  1.00 0.00 ? 27 ASP A OD1  9  
ATOM 7539  O OD2  . ASP A 1 27 ? -3.116  0.841   11.937  1.00 0.00 ? 27 ASP A OD2  9  
ATOM 7540  H H    . ASP A 1 27 ? -4.019  -2.768  8.363   1.00 0.00 ? 27 ASP A H    9  
ATOM 7541  H HA   . ASP A 1 27 ? -3.303  0.122   8.307   1.00 0.00 ? 27 ASP A HA   9  
ATOM 7542  H HB2  . ASP A 1 27 ? -5.031  -0.707  10.171  1.00 0.00 ? 27 ASP A HB2  9  
ATOM 7543  H HB3  . ASP A 1 27 ? -3.625  -1.406  10.942  1.00 0.00 ? 27 ASP A HB3  9  
ATOM 7544  N N    . SER A 1 28 ? -1.468  -2.058  7.867   1.00 0.00 ? 28 SER A N    9  
ATOM 7545  C CA   . SER A 1 28 ? -0.131  -2.626  7.824   1.00 0.00 ? 28 SER A CA   9  
ATOM 7546  C C    . SER A 1 28 ? 0.131   -3.133  6.395   1.00 0.00 ? 28 SER A C    9  
ATOM 7547  O O    . SER A 1 28 ? -0.780  -3.264  5.585   1.00 0.00 ? 28 SER A O    9  
ATOM 7548  C CB   . SER A 1 28 ? -0.068  -3.787  8.848   1.00 0.00 ? 28 SER A CB   9  
ATOM 7549  O OG   . SER A 1 28 ? -1.163  -4.659  8.590   1.00 0.00 ? 28 SER A OG   9  
ATOM 7550  H H    . SER A 1 28 ? -2.064  -2.304  7.104   1.00 0.00 ? 28 SER A H    9  
ATOM 7551  H HA   . SER A 1 28 ? 0.591   -1.828  8.023   1.00 0.00 ? 28 SER A HA   9  
ATOM 7552  H HB2  . SER A 1 28 ? 0.890   -4.335  8.733   1.00 0.00 ? 28 SER A HB2  9  
ATOM 7553  H HB3  . SER A 1 28 ? -0.194  -3.390  9.879   1.00 0.00 ? 28 SER A HB3  9  
ATOM 7554  H HG   . SER A 1 28 ? -1.130  -5.435  9.146   1.00 0.00 ? 28 SER A HG   9  
ATOM 7555  N N    . CYS A 1 29 ? 1.429   -3.406  6.157   1.00 0.00 ? 29 CYS A N    9  
ATOM 7556  C CA   . CYS A 1 29 ? 1.899   -3.947  4.884   1.00 0.00 ? 29 CYS A CA   9  
ATOM 7557  C C    . CYS A 1 29 ? 1.202   -5.286  4.525   1.00 0.00 ? 29 CYS A C    9  
ATOM 7558  O O    . CYS A 1 29 ? 1.003   -6.112  5.406   1.00 0.00 ? 29 CYS A O    9  
ATOM 7559  C CB   . CYS A 1 29 ? 3.366   -4.333  5.073   1.00 0.00 ? 29 CYS A CB   9  
ATOM 7560  S SG   . CYS A 1 29 ? 4.503   -3.071  5.679   1.00 0.00 ? 29 CYS A SG   9  
ATOM 7561  H H    . CYS A 1 29 ? 2.105   -3.218  6.869   1.00 0.00 ? 29 CYS A H    9  
ATOM 7562  H HA   . CYS A 1 29 ? 1.801   -3.173  4.121   1.00 0.00 ? 29 CYS A HA   9  
ATOM 7563  H HB2  . CYS A 1 29 ? 3.438   -5.181  5.766   1.00 0.00 ? 29 CYS A HB2  9  
ATOM 7564  H HB3  . CYS A 1 29 ? 3.734   -4.649  4.101   1.00 0.00 ? 29 CYS A HB3  9  
ATOM 7565  N N    . THR A 1 30 ? 0.902   -5.497  3.222   1.00 0.00 ? 30 THR A N    9  
ATOM 7566  C CA   . THR A 1 30 ? 0.398   -6.811  2.798   1.00 0.00 ? 30 THR A CA   9  
ATOM 7567  C C    . THR A 1 30 ? 1.101   -7.205  1.492   1.00 0.00 ? 30 THR A C    9  
ATOM 7568  O O    . THR A 1 30 ? 1.780   -6.401  0.871   1.00 0.00 ? 30 THR A O    9  
ATOM 7569  C CB   . THR A 1 30 ? -1.139  -6.853  2.675   1.00 0.00 ? 30 THR A CB   9  
ATOM 7570  O OG1  . THR A 1 30 ? -1.503  -8.182  2.311   1.00 0.00 ? 30 THR A OG1  9  
ATOM 7571  C CG2  . THR A 1 30 ? -1.673  -5.870  1.613   1.00 0.00 ? 30 THR A CG2  9  
ATOM 7572  H H    . THR A 1 30 ? 1.080   -4.811  2.507   1.00 0.00 ? 30 THR A H    9  
ATOM 7573  H HA   . THR A 1 30 ? 0.710   -7.549  3.540   1.00 0.00 ? 30 THR A HA   9  
ATOM 7574  H HB   . THR A 1 30 ? -1.535  -6.613  3.675   1.00 0.00 ? 30 THR A HB   9  
ATOM 7575  H HG1  . THR A 1 30 ? -2.433  -8.363  2.495   1.00 0.00 ? 30 THR A HG1  9  
ATOM 7576  H HG21 . THR A 1 30 ? -1.372  -4.842  1.821   1.00 0.00 ? 30 THR A HG21 9  
ATOM 7577  H HG22 . THR A 1 30 ? -2.761  -5.884  1.545   1.00 0.00 ? 30 THR A HG22 9  
ATOM 7578  H HG23 . THR A 1 30 ? -1.294  -6.121  0.621   1.00 0.00 ? 30 THR A HG23 9  
ATOM 7579  N N    . THR A 1 31 ? 0.867   -8.471  1.108   1.00 0.00 ? 31 THR A N    9  
ATOM 7580  C CA   . THR A 1 31 ? 1.355   -9.026  -0.150  1.00 0.00 ? 31 THR A CA   9  
ATOM 7581  C C    . THR A 1 31 ? 0.166   -9.389  -1.058  1.00 0.00 ? 31 THR A C    9  
ATOM 7582  O O    . THR A 1 31 ? 0.344   -9.895  -2.155  1.00 0.00 ? 31 THR A O    9  
ATOM 7583  C CB   . THR A 1 31 ? 2.187   -10.287 0.141   1.00 0.00 ? 31 THR A CB   9  
ATOM 7584  O OG1  . THR A 1 31 ? 1.525   -11.102 1.097   1.00 0.00 ? 31 THR A OG1  9  
ATOM 7585  C CG2  . THR A 1 31 ? 3.554   -9.938  0.731   1.00 0.00 ? 31 THR A CG2  9  
ATOM 7586  H H    . THR A 1 31 ? 0.303   -9.023  1.726   1.00 0.00 ? 31 THR A H    9  
ATOM 7587  H HA   . THR A 1 31 ? 1.957   -8.279  -0.672  1.00 0.00 ? 31 THR A HA   9  
ATOM 7588  H HB   . THR A 1 31 ? 2.370   -10.848 -0.787  1.00 0.00 ? 31 THR A HB   9  
ATOM 7589  H HG1  . THR A 1 31 ? 0.705   -11.431 0.742   1.00 0.00 ? 31 THR A HG1  9  
ATOM 7590  H HG21 . THR A 1 31 ? 4.133   -9.314  0.048   1.00 0.00 ? 31 THR A HG21 9  
ATOM 7591  H HG22 . THR A 1 31 ? 4.135   -10.840 0.924   1.00 0.00 ? 31 THR A HG22 9  
ATOM 7592  H HG23 . THR A 1 31 ? 3.441   -9.406  1.673   1.00 0.00 ? 31 THR A HG23 9  
ATOM 7593  N N    . GLU A 1 32 ? -1.065  -9.138  -0.567  1.00 0.00 ? 32 GLU A N    9  
ATOM 7594  C CA   . GLU A 1 32 ? -2.230  -9.506  -1.370  1.00 0.00 ? 32 GLU A CA   9  
ATOM 7595  C C    . GLU A 1 32 ? -2.213  -8.776  -2.727  1.00 0.00 ? 32 GLU A C    9  
ATOM 7596  O O    . GLU A 1 32 ? -2.156  -7.556  -2.791  1.00 0.00 ? 32 GLU A O    9  
ATOM 7597  C CB   . GLU A 1 32 ? -3.491  -9.179  -0.566  1.00 0.00 ? 32 GLU A CB   9  
ATOM 7598  C CG   . GLU A 1 32 ? -3.676  -10.175 0.589   1.00 0.00 ? 32 GLU A CG   9  
ATOM 7599  C CD   . GLU A 1 32 ? -4.589  -9.583  1.661   1.00 0.00 ? 32 GLU A CD   9  
ATOM 7600  O OE1  . GLU A 1 32 ? -5.791  -9.496  1.433   1.00 0.00 ? 32 GLU A OE1  9  
ATOM 7601  O OE2  . GLU A 1 32 ? -4.081  -9.191  2.707   1.00 0.00 ? 32 GLU A OE2  9  
ATOM 7602  H H    . GLU A 1 32 ? -1.216  -8.715  0.330   1.00 0.00 ? 32 GLU A H    9  
ATOM 7603  H HA   . GLU A 1 32 ? -2.169  -10.583 -1.539  1.00 0.00 ? 32 GLU A HA   9  
ATOM 7604  H HB2  . GLU A 1 32 ? -3.417  -8.155  -0.194  1.00 0.00 ? 32 GLU A HB2  9  
ATOM 7605  H HB3  . GLU A 1 32 ? -4.379  -9.209  -1.199  1.00 0.00 ? 32 GLU A HB3  9  
ATOM 7606  H HG2  . GLU A 1 32 ? -4.113  -11.105 0.224   1.00 0.00 ? 32 GLU A HG2  9  
ATOM 7607  H HG3  . GLU A 1 32 ? -2.723  -10.446 1.045   1.00 0.00 ? 32 GLU A HG3  9  
ATOM 7608  N N    . GLY A 1 33 ? -2.239  -9.602  -3.792  1.00 0.00 ? 33 GLY A N    9  
ATOM 7609  C CA   . GLY A 1 33 ? -2.208  -9.088  -5.159  1.00 0.00 ? 33 GLY A CA   9  
ATOM 7610  C C    . GLY A 1 33 ? -0.813  -9.205  -5.799  1.00 0.00 ? 33 GLY A C    9  
ATOM 7611  O O    . GLY A 1 33 ? -0.672  -9.127  -7.012  1.00 0.00 ? 33 GLY A O    9  
ATOM 7612  H H    . GLY A 1 33 ? -2.273  -10.589 -3.635  1.00 0.00 ? 33 GLY A H    9  
ATOM 7613  H HA2  . GLY A 1 33 ? -2.914  -9.691  -5.734  1.00 0.00 ? 33 GLY A HA2  9  
ATOM 7614  H HA3  . GLY A 1 33 ? -2.530  -8.042  -5.169  1.00 0.00 ? 33 GLY A HA3  9  
ATOM 7615  N N    . ARG A 1 34 ? 0.200   -9.389  -4.932  1.00 0.00 ? 34 ARG A N    9  
ATOM 7616  C CA   . ARG A 1 34 ? 1.581   -9.518  -5.418  1.00 0.00 ? 34 ARG A CA   9  
ATOM 7617  C C    . ARG A 1 34 ? 2.186   -10.812 -4.861  1.00 0.00 ? 34 ARG A C    9  
ATOM 7618  O O    . ARG A 1 34 ? 2.514   -10.931 -3.688  1.00 0.00 ? 34 ARG A O    9  
ATOM 7619  C CB   . ARG A 1 34 ? 2.405   -8.328  -4.923  1.00 0.00 ? 34 ARG A CB   9  
ATOM 7620  C CG   . ARG A 1 34 ? 1.908   -7.000  -5.532  1.00 0.00 ? 34 ARG A CG   9  
ATOM 7621  C CD   . ARG A 1 34 ? 3.036   -5.959  -5.698  1.00 0.00 ? 34 ARG A CD   9  
ATOM 7622  N NE   . ARG A 1 34 ? 3.897   -6.355  -6.828  1.00 0.00 ? 34 ARG A NE   9  
ATOM 7623  C CZ   . ARG A 1 34 ? 3.681   -5.967  -8.110  1.00 0.00 ? 34 ARG A CZ   9  
ATOM 7624  N NH1  . ARG A 1 34 ? 2.871   -4.959  -8.423  1.00 0.00 ? 34 ARG A NH1  9  
ATOM 7625  N NH2  . ARG A 1 34 ? 4.302   -6.617  -9.086  1.00 0.00 ? 34 ARG A NH2  9  
ATOM 7626  H H    . ARG A 1 34 ? 0.006   -9.457  -3.941  1.00 0.00 ? 34 ARG A H    9  
ATOM 7627  H HA   . ARG A 1 34 ? 1.645   -9.551  -6.530  1.00 0.00 ? 34 ARG A HA   9  
ATOM 7628  H HB2  . ARG A 1 34 ? 2.342   -8.274  -3.807  1.00 0.00 ? 34 ARG A HB2  9  
ATOM 7629  H HB3  . ARG A 1 34 ? 3.428   -8.534  -5.295  1.00 0.00 ? 34 ARG A HB3  9  
ATOM 7630  H HG2  . ARG A 1 34 ? 1.470   -7.193  -6.514  1.00 0.00 ? 34 ARG A HG2  9  
ATOM 7631  H HG3  . ARG A 1 34 ? 1.081   -6.612  -4.929  1.00 0.00 ? 34 ARG A HG3  9  
ATOM 7632  H HD2  . ARG A 1 34 ? 2.626   -4.963  -5.897  1.00 0.00 ? 34 ARG A HD2  9  
ATOM 7633  H HD3  . ARG A 1 34 ? 3.653   -5.898  -4.791  1.00 0.00 ? 34 ARG A HD3  9  
ATOM 7634  H HE   . ARG A 1 34 ? 4.608   -7.071  -6.723  1.00 0.00 ? 34 ARG A HE   9  
ATOM 7635  H HH11 . ARG A 1 34 ? 2.534   -4.305  -7.731  1.00 0.00 ? 34 ARG A HH11 9  
ATOM 7636  H HH12 . ARG A 1 34 ? 2.592   -4.791  -9.366  1.00 0.00 ? 34 ARG A HH12 9  
ATOM 7637  H HH21 . ARG A 1 34 ? 4.915   -7.378  -8.831  1.00 0.00 ? 34 ARG A HH21 9  
ATOM 7638  H HH22 . ARG A 1 34 ? 4.194   -6.390  -10.051 1.00 0.00 ? 34 ARG A HH22 9  
ATOM 7639  N N    . THR A 1 35 ? 2.357   -11.756 -5.797  1.00 0.00 ? 35 THR A N    9  
ATOM 7640  C CA   . THR A 1 35 ? 2.912   -13.061 -5.453  1.00 0.00 ? 35 THR A CA   9  
ATOM 7641  C C    . THR A 1 35 ? 4.378   -13.131 -5.917  1.00 0.00 ? 35 THR A C    9  
ATOM 7642  O O    . THR A 1 35 ? 4.906   -14.192 -6.223  1.00 0.00 ? 35 THR A O    9  
ATOM 7643  C CB   . THR A 1 35 ? 2.045   -14.143 -6.127  1.00 0.00 ? 35 THR A CB   9  
ATOM 7644  O OG1  . THR A 1 35 ? 0.705   -13.671 -6.117  1.00 0.00 ? 35 THR A OG1  9  
ATOM 7645  C CG2  . THR A 1 35 ? 2.151   -15.496 -5.402  1.00 0.00 ? 35 THR A CG2  9  
ATOM 7646  H H    . THR A 1 35 ? 2.040   -11.578 -6.725  1.00 0.00 ? 35 THR A H    9  
ATOM 7647  H HA   . THR A 1 35 ? 2.876   -13.188 -4.368  1.00 0.00 ? 35 THR A HA   9  
ATOM 7648  H HB   . THR A 1 35 ? 2.372   -14.257 -7.168  1.00 0.00 ? 35 THR A HB   9  
ATOM 7649  H HG1  . THR A 1 35 ? 0.117   -14.316 -6.498  1.00 0.00 ? 35 THR A HG1  9  
ATOM 7650  H HG21 . THR A 1 35 ? 1.769   -15.425 -4.384  1.00 0.00 ? 35 THR A HG21 9  
ATOM 7651  H HG22 . THR A 1 35 ? 3.188   -15.828 -5.341  1.00 0.00 ? 35 THR A HG22 9  
ATOM 7652  H HG23 . THR A 1 35 ? 1.596   -16.282 -5.916  1.00 0.00 ? 35 THR A HG23 9  
ATOM 7653  N N    . ASP A 1 36 ? 4.997   -11.932 -5.935  1.00 0.00 ? 36 ASP A N    9  
ATOM 7654  C CA   . ASP A 1 36 ? 6.385   -11.767 -6.350  1.00 0.00 ? 36 ASP A CA   9  
ATOM 7655  C C    . ASP A 1 36 ? 7.303   -11.439 -5.151  1.00 0.00 ? 36 ASP A C    9  
ATOM 7656  O O    . ASP A 1 36 ? 8.498   -11.228 -5.317  1.00 0.00 ? 36 ASP A O    9  
ATOM 7657  C CB   . ASP A 1 36 ? 6.455   -10.660 -7.421  1.00 0.00 ? 36 ASP A CB   9  
ATOM 7658  C CG   . ASP A 1 36 ? 5.939   -9.288  -6.950  1.00 0.00 ? 36 ASP A CG   9  
ATOM 7659  O OD1  . ASP A 1 36 ? 5.693   -9.094  -5.763  1.00 0.00 ? 36 ASP A OD1  9  
ATOM 7660  O OD2  . ASP A 1 36 ? 5.783   -8.405  -7.787  1.00 0.00 ? 36 ASP A OD2  9  
ATOM 7661  H H    . ASP A 1 36 ? 4.521   -11.079 -5.707  1.00 0.00 ? 36 ASP A H    9  
ATOM 7662  H HA   . ASP A 1 36 ? 6.741   -12.704 -6.781  1.00 0.00 ? 36 ASP A HA   9  
ATOM 7663  H HB2  . ASP A 1 36 ? 7.481   -10.537 -7.769  1.00 0.00 ? 36 ASP A HB2  9  
ATOM 7664  H HB3  . ASP A 1 36 ? 5.861   -10.958 -8.285  1.00 0.00 ? 36 ASP A HB3  9  
ATOM 7665  N N    . GLY A 1 37 ? 6.697   -11.436 -3.940  1.00 0.00 ? 37 GLY A N    9  
ATOM 7666  C CA   . GLY A 1 37 ? 7.465   -11.209 -2.720  1.00 0.00 ? 37 GLY A CA   9  
ATOM 7667  C C    . GLY A 1 37 ? 7.221   -9.840  -2.084  1.00 0.00 ? 37 GLY A C    9  
ATOM 7668  O O    . GLY A 1 37 ? 7.103   -9.714  -0.874  1.00 0.00 ? 37 GLY A O    9  
ATOM 7669  H H    . GLY A 1 37 ? 5.718   -11.604 -3.854  1.00 0.00 ? 37 GLY A H    9  
ATOM 7670  H HA2  . GLY A 1 37 ? 7.186   -11.994 -2.015  1.00 0.00 ? 37 GLY A HA2  9  
ATOM 7671  H HA3  . GLY A 1 37 ? 8.535   -11.278 -2.947  1.00 0.00 ? 37 GLY A HA3  9  
ATOM 7672  N N    . TYR A 1 38 ? 7.231   -8.823  -2.958  1.00 0.00 ? 38 TYR A N    9  
ATOM 7673  C CA   . TYR A 1 38 ? 7.236   -7.440  -2.481  1.00 0.00 ? 38 TYR A CA   9  
ATOM 7674  C C    . TYR A 1 38 ? 5.948   -7.050  -1.737  1.00 0.00 ? 38 TYR A C    9  
ATOM 7675  O O    . TYR A 1 38 ? 4.846   -7.060  -2.275  1.00 0.00 ? 38 TYR A O    9  
ATOM 7676  C CB   . TYR A 1 38 ? 7.573   -6.502  -3.654  1.00 0.00 ? 38 TYR A CB   9  
ATOM 7677  C CG   . TYR A 1 38 ? 8.691   -7.111  -4.459  1.00 0.00 ? 38 TYR A CG   9  
ATOM 7678  C CD1  . TYR A 1 38 ? 9.917   -7.406  -3.882  1.00 0.00 ? 38 TYR A CD1  9  
ATOM 7679  C CD2  . TYR A 1 38 ? 8.499   -7.478  -5.779  1.00 0.00 ? 38 TYR A CD2  9  
ATOM 7680  C CE1  . TYR A 1 38 ? 10.884  -8.095  -4.579  1.00 0.00 ? 38 TYR A CE1  9  
ATOM 7681  C CE2  . TYR A 1 38 ? 9.462   -8.169  -6.477  1.00 0.00 ? 38 TYR A CE2  9  
ATOM 7682  C CZ   . TYR A 1 38 ? 10.665  -8.497  -5.882  1.00 0.00 ? 38 TYR A CZ   9  
ATOM 7683  O OH   . TYR A 1 38 ? 11.625  -9.218  -6.558  1.00 0.00 ? 38 TYR A OH   9  
ATOM 7684  H H    . TYR A 1 38 ? 7.284   -9.022  -3.940  1.00 0.00 ? 38 TYR A H    9  
ATOM 7685  H HA   . TYR A 1 38 ? 8.062   -7.393  -1.768  1.00 0.00 ? 38 TYR A HA   9  
ATOM 7686  H HB2  . TYR A 1 38 ? 6.697   -6.366  -4.291  1.00 0.00 ? 38 TYR A HB2  9  
ATOM 7687  H HB3  . TYR A 1 38 ? 7.866   -5.515  -3.295  1.00 0.00 ? 38 TYR A HB3  9  
ATOM 7688  H HD1  . TYR A 1 38 ? 10.158  -7.148  -2.875  1.00 0.00 ? 38 TYR A HD1  9  
ATOM 7689  H HD2  . TYR A 1 38 ? 7.596   -7.272  -6.306  1.00 0.00 ? 38 TYR A HD2  9  
ATOM 7690  H HE1  . TYR A 1 38 ? 11.782  -8.321  -4.055  1.00 0.00 ? 38 TYR A HE1  9  
ATOM 7691  H HE2  . TYR A 1 38 ? 9.198   -8.443  -7.471  1.00 0.00 ? 38 TYR A HE2  9  
ATOM 7692  H HH   . TYR A 1 38 ? 11.219  -9.990  -6.933  1.00 0.00 ? 38 TYR A HH   9  
ATOM 7693  N N    . ARG A 1 39 ? 6.180   -6.697  -0.460  1.00 0.00 ? 39 ARG A N    9  
ATOM 7694  C CA   . ARG A 1 39 ? 5.043   -6.271  0.388   1.00 0.00 ? 39 ARG A CA   9  
ATOM 7695  C C    . ARG A 1 39 ? 4.762   -4.792  0.042   1.00 0.00 ? 39 ARG A C    9  
ATOM 7696  O O    . ARG A 1 39 ? 5.689   -4.003  -0.099  1.00 0.00 ? 39 ARG A O    9  
ATOM 7697  C CB   . ARG A 1 39 ? 5.510   -6.410  1.850   1.00 0.00 ? 39 ARG A CB   9  
ATOM 7698  C CG   . ARG A 1 39 ? 5.900   -7.843  2.278   1.00 0.00 ? 39 ARG A CG   9  
ATOM 7699  C CD   . ARG A 1 39 ? 7.102   -7.867  3.262   1.00 0.00 ? 39 ARG A CD   9  
ATOM 7700  N NE   . ARG A 1 39 ? 6.783   -7.728  4.696   1.00 0.00 ? 39 ARG A NE   9  
ATOM 7701  C CZ   . ARG A 1 39 ? 6.396   -6.594  5.324   1.00 0.00 ? 39 ARG A CZ   9  
ATOM 7702  N NH1  . ARG A 1 39 ? 6.327   -5.437  4.688   1.00 0.00 ? 39 ARG A NH1  9  
ATOM 7703  N NH2  . ARG A 1 39 ? 6.117   -6.632  6.620   1.00 0.00 ? 39 ARG A NH2  9  
ATOM 7704  H H    . ARG A 1 39 ? 7.167   -6.711  -0.175  1.00 0.00 ? 39 ARG A H    9  
ATOM 7705  H HA   . ARG A 1 39 ? 4.107   -6.849  0.201   1.00 0.00 ? 39 ARG A HA   9  
ATOM 7706  H HB2  . ARG A 1 39 ? 6.365   -5.742  1.972   1.00 0.00 ? 39 ARG A HB2  9  
ATOM 7707  H HB3  . ARG A 1 39 ? 4.741   -6.058  2.524   1.00 0.00 ? 39 ARG A HB3  9  
ATOM 7708  H HG2  . ARG A 1 39 ? 5.042   -8.349  2.733   1.00 0.00 ? 39 ARG A HG2  9  
ATOM 7709  H HG3  . ARG A 1 39 ? 6.155   -8.406  1.361   1.00 0.00 ? 39 ARG A HG3  9  
ATOM 7710  H HD2  . ARG A 1 39 ? 7.639   -8.817  3.200   1.00 0.00 ? 39 ARG A HD2  9  
ATOM 7711  H HD3  . ARG A 1 39 ? 7.811   -7.091  2.992   1.00 0.00 ? 39 ARG A HD3  9  
ATOM 7712  H HE   . ARG A 1 39 ? 6.936   -8.529  5.284   1.00 0.00 ? 39 ARG A HE   9  
ATOM 7713  H HH11 . ARG A 1 39 ? 6.807   -5.366  3.801   1.00 0.00 ? 39 ARG A HH11 9  
ATOM 7714  H HH12 . ARG A 1 39 ? 5.878   -4.624  5.065   1.00 0.00 ? 39 ARG A HH12 9  
ATOM 7715  H HH21 . ARG A 1 39 ? 6.408   -7.444  7.148   1.00 0.00 ? 39 ARG A HH21 9  
ATOM 7716  H HH22 . ARG A 1 39 ? 5.671   -5.877  7.099   1.00 0.00 ? 39 ARG A HH22 9  
ATOM 7717  N N    . TRP A 1 40 ? 3.465   -4.454  -0.111  1.00 0.00 ? 40 TRP A N    9  
ATOM 7718  C CA   . TRP A 1 40 ? 3.055   -3.103  -0.477  1.00 0.00 ? 40 TRP A CA   9  
ATOM 7719  C C    . TRP A 1 40 ? 2.090   -2.509  0.576   1.00 0.00 ? 40 TRP A C    9  
ATOM 7720  O O    . TRP A 1 40 ? 1.532   -3.222  1.406   1.00 0.00 ? 40 TRP A O    9  
ATOM 7721  C CB   . TRP A 1 40 ? 2.440   -3.142  -1.892  1.00 0.00 ? 40 TRP A CB   9  
ATOM 7722  C CG   . TRP A 1 40 ? 1.162   -3.960  -1.921  1.00 0.00 ? 40 TRP A CG   9  
ATOM 7723  C CD1  . TRP A 1 40 ? 1.062   -5.333  -2.176  1.00 0.00 ? 40 TRP A CD1  9  
ATOM 7724  C CD2  . TRP A 1 40 ? -0.186  -3.492  -1.698  1.00 0.00 ? 40 TRP A CD2  9  
ATOM 7725  N NE1  . TRP A 1 40 ? -0.242  -5.696  -2.121  1.00 0.00 ? 40 TRP A NE1  9  
ATOM 7726  C CE2  . TRP A 1 40 ? -1.038  -4.604  -1.831  1.00 0.00 ? 40 TRP A CE2  9  
ATOM 7727  C CE3  . TRP A 1 40 ? -0.717  -2.268  -1.397  1.00 0.00 ? 40 TRP A CE3  9  
ATOM 7728  C CZ2  . TRP A 1 40 ? -2.387  -4.471  -1.672  1.00 0.00 ? 40 TRP A CZ2  9  
ATOM 7729  C CZ3  . TRP A 1 40 ? -2.096  -2.121  -1.222  1.00 0.00 ? 40 TRP A CZ3  9  
ATOM 7730  C CH2  . TRP A 1 40 ? -2.934  -3.228  -1.366  1.00 0.00 ? 40 TRP A CH2  9  
ATOM 7731  H H    . TRP A 1 40 ? 2.732   -5.125  0.010   1.00 0.00 ? 40 TRP A H    9  
ATOM 7732  H HA   . TRP A 1 40 ? 3.948   -2.490  -0.475  1.00 0.00 ? 40 TRP A HA   9  
ATOM 7733  H HB2  . TRP A 1 40 ? 2.240   -2.141  -2.258  1.00 0.00 ? 40 TRP A HB2  9  
ATOM 7734  H HB3  . TRP A 1 40 ? 3.144   -3.556  -2.612  1.00 0.00 ? 40 TRP A HB3  9  
ATOM 7735  H HD1  . TRP A 1 40 ? 1.892   -5.997  -2.377  1.00 0.00 ? 40 TRP A HD1  9  
ATOM 7736  H HE1  . TRP A 1 40 ? -0.628  -6.584  -2.260  1.00 0.00 ? 40 TRP A HE1  9  
ATOM 7737  H HE3  . TRP A 1 40 ? -0.039  -1.436  -1.316  1.00 0.00 ? 40 TRP A HE3  9  
ATOM 7738  H HZ2  . TRP A 1 40 ? -3.021  -5.336  -1.792  1.00 0.00 ? 40 TRP A HZ2  9  
ATOM 7739  H HZ3  . TRP A 1 40 ? -2.534  -1.163  -0.964  1.00 0.00 ? 40 TRP A HZ3  9  
ATOM 7740  H HH2  . TRP A 1 40 ? -4.005  -3.137  -1.248  1.00 0.00 ? 40 TRP A HH2  9  
ATOM 7741  N N    . CYS A 1 41 ? 1.931   -1.166  0.477   1.00 0.00 ? 41 CYS A N    9  
ATOM 7742  C CA   . CYS A 1 41 ? 1.016   -0.397  1.309   1.00 0.00 ? 41 CYS A CA   9  
ATOM 7743  C C    . CYS A 1 41 ? 0.158   0.479   0.381   1.00 0.00 ? 41 CYS A C    9  
ATOM 7744  O O    . CYS A 1 41 ? 0.636   0.940   -0.650  1.00 0.00 ? 41 CYS A O    9  
ATOM 7745  C CB   . CYS A 1 41 ? 1.812   0.522   2.240   1.00 0.00 ? 41 CYS A CB   9  
ATOM 7746  S SG   . CYS A 1 41 ? 2.724   1.802   1.316   1.00 0.00 ? 41 CYS A SG   9  
ATOM 7747  H H    . CYS A 1 41 ? 2.405   -0.600  -0.204  1.00 0.00 ? 41 CYS A H    9  
ATOM 7748  H HA   . CYS A 1 41 ? 0.391   -1.094  1.871   1.00 0.00 ? 41 CYS A HA   9  
ATOM 7749  H HB2  . CYS A 1 41 ? 1.024   1.045   2.842   1.00 0.00 ? 41 CYS A HB2  9  
ATOM 7750  H HB3  . CYS A 1 41 ? 2.553   -0.102  2.807   1.00 0.00 ? 41 CYS A HB3  9  
ATOM 7751  N N    . GLY A 1 42 ? -1.112  0.701   0.770   1.00 0.00 ? 42 GLY A N    9  
ATOM 7752  C CA   . GLY A 1 42 ? -1.931  1.607   -0.033  1.00 0.00 ? 42 GLY A CA   9  
ATOM 7753  C C    . GLY A 1 42 ? -1.477  3.042   0.267   1.00 0.00 ? 42 GLY A C    9  
ATOM 7754  O O    . GLY A 1 42 ? -0.870  3.285   1.302   1.00 0.00 ? 42 GLY A O    9  
ATOM 7755  H H    . GLY A 1 42 ? -1.483  0.316   1.617   1.00 0.00 ? 42 GLY A H    9  
ATOM 7756  H HA2  . GLY A 1 42 ? -1.822  1.355   -1.091  1.00 0.00 ? 42 GLY A HA2  9  
ATOM 7757  H HA3  . GLY A 1 42 ? -2.968  1.480   0.278   1.00 0.00 ? 42 GLY A HA3  9  
ATOM 7758  N N    . THR A 1 43 ? -1.794  3.971   -0.659  1.00 0.00 ? 43 THR A N    9  
ATOM 7759  C CA   . THR A 1 43 ? -1.386  5.366   -0.438  1.00 0.00 ? 43 THR A CA   9  
ATOM 7760  C C    . THR A 1 43 ? -2.579  6.310   -0.270  1.00 0.00 ? 43 THR A C    9  
ATOM 7761  O O    . THR A 1 43 ? -2.410  7.520   -0.180  1.00 0.00 ? 43 THR A O    9  
ATOM 7762  C CB   . THR A 1 43 ? -0.448  5.850   -1.560  1.00 0.00 ? 43 THR A CB   9  
ATOM 7763  O OG1  . THR A 1 43 ? -0.472  4.974   -2.667  1.00 0.00 ? 43 THR A OG1  9  
ATOM 7764  C CG2  . THR A 1 43 ? 0.997   5.919   -1.062  1.00 0.00 ? 43 THR A CG2  9  
ATOM 7765  H H    . THR A 1 43 ? -2.266  3.698   -1.499  1.00 0.00 ? 43 THR A H    9  
ATOM 7766  H HA   . THR A 1 43 ? -0.869  5.433   0.519   1.00 0.00 ? 43 THR A HA   9  
ATOM 7767  H HB   . THR A 1 43 ? -0.713  6.858   -1.901  1.00 0.00 ? 43 THR A HB   9  
ATOM 7768  H HG1  . THR A 1 43 ? -1.371  4.814   -2.954  1.00 0.00 ? 43 THR A HG1  9  
ATOM 7769  H HG21 . THR A 1 43 ? 1.351   4.940   -0.740  1.00 0.00 ? 43 THR A HG21 9  
ATOM 7770  H HG22 . THR A 1 43 ? 1.079   6.611   -0.224  1.00 0.00 ? 43 THR A HG22 9  
ATOM 7771  H HG23 . THR A 1 43 ? 1.671   6.281   -1.833  1.00 0.00 ? 43 THR A HG23 9  
ATOM 7772  N N    . THR A 1 44 ? -3.769  5.700   -0.202  1.00 0.00 ? 44 THR A N    9  
ATOM 7773  C CA   . THR A 1 44 ? -4.977  6.461   0.042   1.00 0.00 ? 44 THR A CA   9  
ATOM 7774  C C    . THR A 1 44 ? -5.801  5.602   0.990   1.00 0.00 ? 44 THR A C    9  
ATOM 7775  O O    . THR A 1 44 ? -5.558  4.410   1.155   1.00 0.00 ? 44 THR A O    9  
ATOM 7776  C CB   . THR A 1 44 ? -5.745  6.748   -1.262  1.00 0.00 ? 44 THR A CB   9  
ATOM 7777  O OG1  . THR A 1 44 ? -6.237  5.522   -1.779  1.00 0.00 ? 44 THR A OG1  9  
ATOM 7778  C CG2  . THR A 1 44 ? -4.861  7.449   -2.304  1.00 0.00 ? 44 THR A CG2  9  
ATOM 7779  H H    . THR A 1 44 ? -3.900  4.711   -0.261  1.00 0.00 ? 44 THR A H    9  
ATOM 7780  H HA   . THR A 1 44 ? -4.716  7.389   0.556   1.00 0.00 ? 44 THR A HA   9  
ATOM 7781  H HB   . THR A 1 44 ? -6.579  7.416   -1.006  1.00 0.00 ? 44 THR A HB   9  
ATOM 7782  H HG1  . THR A 1 44 ? -6.933  5.674   -2.435  1.00 0.00 ? 44 THR A HG1  9  
ATOM 7783  H HG21 . THR A 1 44 ? -5.445  7.813   -3.147  1.00 0.00 ? 44 THR A HG21 9  
ATOM 7784  H HG22 . THR A 1 44 ? -4.100  6.776   -2.698  1.00 0.00 ? 44 THR A HG22 9  
ATOM 7785  H HG23 . THR A 1 44 ? -4.355  8.311   -1.868  1.00 0.00 ? 44 THR A HG23 9  
ATOM 7786  N N    . GLU A 1 45 ? -6.794  6.277   1.580   1.00 0.00 ? 45 GLU A N    9  
ATOM 7787  C CA   . GLU A 1 45 ? -7.690  5.619   2.517   1.00 0.00 ? 45 GLU A CA   9  
ATOM 7788  C C    . GLU A 1 45 ? -8.539  4.551   1.785   1.00 0.00 ? 45 GLU A C    9  
ATOM 7789  O O    . GLU A 1 45 ? -9.026  3.602   2.388   1.00 0.00 ? 45 GLU A O    9  
ATOM 7790  C CB   . GLU A 1 45 ? -8.556  6.628   3.324   1.00 0.00 ? 45 GLU A CB   9  
ATOM 7791  C CG   . GLU A 1 45 ? -8.233  8.133   3.155   1.00 0.00 ? 45 GLU A CG   9  
ATOM 7792  C CD   . GLU A 1 45 ? -6.757  8.503   3.408   1.00 0.00 ? 45 GLU A CD   9  
ATOM 7793  O OE1  . GLU A 1 45 ? -6.308  8.423   4.549   1.00 0.00 ? 45 GLU A OE1  9  
ATOM 7794  O OE2  . GLU A 1 45 ? -6.073  8.857   2.446   1.00 0.00 ? 45 GLU A OE2  9  
ATOM 7795  H H    . GLU A 1 45 ? -6.860  7.260   1.402   1.00 0.00 ? 45 GLU A H    9  
ATOM 7796  H HA   . GLU A 1 45 ? -7.037  5.101   3.221   1.00 0.00 ? 45 GLU A HA   9  
ATOM 7797  H HB2  . GLU A 1 45 ? -9.624  6.525   2.985   1.00 0.00 ? 45 GLU A HB2  9  
ATOM 7798  H HB3  . GLU A 1 45 ? -8.363  6.393   4.408   1.00 0.00 ? 45 GLU A HB3  9  
ATOM 7799  H HG2  . GLU A 1 45 ? -8.534  8.483   2.166   1.00 0.00 ? 45 GLU A HG2  9  
ATOM 7800  H HG3  . GLU A 1 45 ? -8.840  8.706   3.861   1.00 0.00 ? 45 GLU A HG3  9  
ATOM 7801  N N    . ASP A 1 46 ? -8.694  4.775   0.459   1.00 0.00 ? 46 ASP A N    9  
ATOM 7802  C CA   . ASP A 1 46 ? -9.485  3.887   -0.398  1.00 0.00 ? 46 ASP A CA   9  
ATOM 7803  C C    . ASP A 1 46 ? -8.648  3.444   -1.620  1.00 0.00 ? 46 ASP A C    9  
ATOM 7804  O O    . ASP A 1 46 ? -8.447  4.185   -2.576  1.00 0.00 ? 46 ASP A O    9  
ATOM 7805  C CB   . ASP A 1 46 ? -10.797 4.588   -0.808  1.00 0.00 ? 46 ASP A CB   9  
ATOM 7806  C CG   . ASP A 1 46 ? -11.783 3.569   -1.375  1.00 0.00 ? 46 ASP A CG   9  
ATOM 7807  O OD1  . ASP A 1 46 ? -11.466 2.889   -2.346  1.00 0.00 ? 46 ASP A OD1  9  
ATOM 7808  O OD2  . ASP A 1 46 ? -12.861 3.397   -0.815  1.00 0.00 ? 46 ASP A OD2  9  
ATOM 7809  H H    . ASP A 1 46 ? -8.208  5.554   0.063   1.00 0.00 ? 46 ASP A H    9  
ATOM 7810  H HA   . ASP A 1 46 ? -9.732  3.007   0.201   1.00 0.00 ? 46 ASP A HA   9  
ATOM 7811  H HB2  . ASP A 1 46 ? -11.248 5.043   0.075   1.00 0.00 ? 46 ASP A HB2  9  
ATOM 7812  H HB3  . ASP A 1 46 ? -10.660 5.398   -1.525  1.00 0.00 ? 46 ASP A HB3  9  
ATOM 7813  N N    . TYR A 1 47 ? -8.167  2.188   -1.527  1.00 0.00 ? 47 TYR A N    9  
ATOM 7814  C CA   . TYR A 1 47 ? -7.342  1.649   -2.615  1.00 0.00 ? 47 TYR A CA   9  
ATOM 7815  C C    . TYR A 1 47 ? -8.205  1.311   -3.833  1.00 0.00 ? 47 TYR A C    9  
ATOM 7816  O O    . TYR A 1 47 ? -7.794  1.507   -4.970  1.00 0.00 ? 47 TYR A O    9  
ATOM 7817  C CB   . TYR A 1 47 ? -6.620  0.370   -2.133  1.00 0.00 ? 47 TYR A CB   9  
ATOM 7818  C CG   . TYR A 1 47 ? -5.686  -0.239  -3.156  1.00 0.00 ? 47 TYR A CG   9  
ATOM 7819  C CD1  . TYR A 1 47 ? -6.143  -0.886  -4.306  1.00 0.00 ? 47 TYR A CD1  9  
ATOM 7820  C CD2  . TYR A 1 47 ? -4.319  -0.182  -2.948  1.00 0.00 ? 47 TYR A CD2  9  
ATOM 7821  C CE1  . TYR A 1 47 ? -5.253  -1.441  -5.212  1.00 0.00 ? 47 TYR A CE1  9  
ATOM 7822  C CE2  . TYR A 1 47 ? -3.437  -0.780  -3.831  1.00 0.00 ? 47 TYR A CE2  9  
ATOM 7823  C CZ   . TYR A 1 47 ? -3.895  -1.402  -4.975  1.00 0.00 ? 47 TYR A CZ   9  
ATOM 7824  O OH   . TYR A 1 47 ? -3.021  -1.976  -5.875  1.00 0.00 ? 47 TYR A OH   9  
ATOM 7825  H H    . TYR A 1 47 ? -8.425  1.649   -0.714  1.00 0.00 ? 47 TYR A H    9  
ATOM 7826  H HA   . TYR A 1 47 ? -6.606  2.405   -2.929  1.00 0.00 ? 47 TYR A HA   9  
ATOM 7827  H HB2  . TYR A 1 47 ? -6.050  0.613   -1.235  1.00 0.00 ? 47 TYR A HB2  9  
ATOM 7828  H HB3  . TYR A 1 47 ? -7.315  -0.406  -1.817  1.00 0.00 ? 47 TYR A HB3  9  
ATOM 7829  H HD1  . TYR A 1 47 ? -7.194  -0.974  -4.528  1.00 0.00 ? 47 TYR A HD1  9  
ATOM 7830  H HD2  . TYR A 1 47 ? -3.929  0.332   -2.091  1.00 0.00 ? 47 TYR A HD2  9  
ATOM 7831  H HE1  . TYR A 1 47 ? -5.606  -1.901  -6.112  1.00 0.00 ? 47 TYR A HE1  9  
ATOM 7832  H HE2  . TYR A 1 47 ? -2.396  -0.772  -3.592  1.00 0.00 ? 47 TYR A HE2  9  
ATOM 7833  H HH   . TYR A 1 47 ? -2.383  -2.509  -5.416  1.00 0.00 ? 47 TYR A HH   9  
ATOM 7834  N N    . ASP A 1 48 ? -9.390  0.736   -3.552  1.00 0.00 ? 48 ASP A N    9  
ATOM 7835  C CA   . ASP A 1 48 ? -10.208 0.229   -4.651  1.00 0.00 ? 48 ASP A CA   9  
ATOM 7836  C C    . ASP A 1 48 ? -10.529 1.337   -5.672  1.00 0.00 ? 48 ASP A C    9  
ATOM 7837  O O    . ASP A 1 48 ? -10.609 1.123   -6.876  1.00 0.00 ? 48 ASP A O    9  
ATOM 7838  C CB   . ASP A 1 48 ? -11.495 -0.431  -4.112  1.00 0.00 ? 48 ASP A CB   9  
ATOM 7839  C CG   . ASP A 1 48 ? -11.213 -1.577  -3.110  1.00 0.00 ? 48 ASP A CG   9  
ATOM 7840  O OD1  . ASP A 1 48 ? -10.202 -2.259  -3.245  1.00 0.00 ? 48 ASP A OD1  9  
ATOM 7841  O OD2  . ASP A 1 48 ? -12.009 -1.774  -2.187  1.00 0.00 ? 48 ASP A OD2  9  
ATOM 7842  H H    . ASP A 1 48 ? -9.721  0.631   -2.615  1.00 0.00 ? 48 ASP A H    9  
ATOM 7843  H HA   . ASP A 1 48 ? -9.635  -0.553  -5.157  1.00 0.00 ? 48 ASP A HA   9  
ATOM 7844  H HB2  . ASP A 1 48 ? -12.124 0.334   -3.649  1.00 0.00 ? 48 ASP A HB2  9  
ATOM 7845  H HB3  . ASP A 1 48 ? -12.051 -0.867  -4.950  1.00 0.00 ? 48 ASP A HB3  9  
ATOM 7846  N N    . ARG A 1 49 ? -10.697 2.543   -5.108  1.00 0.00 ? 49 ARG A N    9  
ATOM 7847  C CA   . ARG A 1 49 ? -10.937 3.738   -5.897  1.00 0.00 ? 49 ARG A CA   9  
ATOM 7848  C C    . ARG A 1 49 ? -9.673  4.145   -6.706  1.00 0.00 ? 49 ARG A C    9  
ATOM 7849  O O    . ARG A 1 49 ? -9.717  4.179   -7.934  1.00 0.00 ? 49 ARG A O    9  
ATOM 7850  C CB   . ARG A 1 49 ? -11.443 4.826   -4.922  1.00 0.00 ? 49 ARG A CB   9  
ATOM 7851  C CG   . ARG A 1 49 ? -11.527 6.266   -5.464  1.00 0.00 ? 49 ARG A CG   9  
ATOM 7852  C CD   . ARG A 1 49 ? -11.505 7.333   -4.309  1.00 0.00 ? 49 ARG A CD   9  
ATOM 7853  N NE   . ARG A 1 49 ? -10.275 8.106   -4.454  1.00 0.00 ? 49 ARG A NE   9  
ATOM 7854  C CZ   . ARG A 1 49 ? -10.073 9.381   -4.075  1.00 0.00 ? 49 ARG A CZ   9  
ATOM 7855  N NH1  . ARG A 1 49 ? -11.061 10.109  -3.565  1.00 0.00 ? 49 ARG A NH1  9  
ATOM 7856  N NH2  . ARG A 1 49 ? -8.854  9.886   -4.224  1.00 0.00 ? 49 ARG A NH2  9  
ATOM 7857  H H    . ARG A 1 49 ? -10.637 2.612   -4.108  1.00 0.00 ? 49 ARG A H    9  
ATOM 7858  H HA   . ARG A 1 49 ? -11.722 3.485   -6.614  1.00 0.00 ? 49 ARG A HA   9  
ATOM 7859  H HB2  . ARG A 1 49 ? -12.421 4.489   -4.560  1.00 0.00 ? 49 ARG A HB2  9  
ATOM 7860  H HB3  . ARG A 1 49 ? -10.796 4.872   -4.050  1.00 0.00 ? 49 ARG A HB3  9  
ATOM 7861  H HG2  . ARG A 1 49 ? -10.667 6.428   -6.129  1.00 0.00 ? 49 ARG A HG2  9  
ATOM 7862  H HG3  . ARG A 1 49 ? -12.393 6.339   -6.131  1.00 0.00 ? 49 ARG A HG3  9  
ATOM 7863  H HD2  . ARG A 1 49 ? -12.372 8.016   -4.259  1.00 0.00 ? 49 ARG A HD2  9  
ATOM 7864  H HD3  . ARG A 1 49 ? -11.404 6.889   -3.305  1.00 0.00 ? 49 ARG A HD3  9  
ATOM 7865  H HE   . ARG A 1 49 ? -9.450  7.628   -4.789  1.00 0.00 ? 49 ARG A HE   9  
ATOM 7866  H HH11 . ARG A 1 49 ? -11.962 9.691   -3.459  1.00 0.00 ? 49 ARG A HH11 9  
ATOM 7867  H HH12 . ARG A 1 49 ? -10.928 11.059  -3.287  1.00 0.00 ? 49 ARG A HH12 9  
ATOM 7868  H HH21 . ARG A 1 49 ? -8.147  9.270   -4.608  1.00 0.00 ? 49 ARG A HH21 9  
ATOM 7869  H HH22 . ARG A 1 49 ? -8.607  10.821  -3.980  1.00 0.00 ? 49 ARG A HH22 9  
ATOM 7870  N N    . ASP A 1 50 ? -8.592  4.478   -5.971  1.00 0.00 ? 50 ASP A N    9  
ATOM 7871  C CA   . ASP A 1 50 ? -7.373  5.051   -6.567  1.00 0.00 ? 50 ASP A CA   9  
ATOM 7872  C C    . ASP A 1 50 ? -6.434  4.093   -7.345  1.00 0.00 ? 50 ASP A C    9  
ATOM 7873  O O    . ASP A 1 50 ? -5.874  4.470   -8.366  1.00 0.00 ? 50 ASP A O    9  
ATOM 7874  C CB   . ASP A 1 50 ? -6.561  5.732   -5.449  1.00 0.00 ? 50 ASP A CB   9  
ATOM 7875  C CG   . ASP A 1 50 ? -7.350  6.899   -4.841  1.00 0.00 ? 50 ASP A CG   9  
ATOM 7876  O OD1  . ASP A 1 50 ? -7.531  7.913   -5.511  1.00 0.00 ? 50 ASP A OD1  9  
ATOM 7877  O OD2  . ASP A 1 50 ? -7.799  6.808   -3.704  1.00 0.00 ? 50 ASP A OD2  9  
ATOM 7878  H H    . ASP A 1 50 ? -8.637  4.418   -4.969  1.00 0.00 ? 50 ASP A H    9  
ATOM 7879  H HA   . ASP A 1 50 ? -7.672  5.834   -7.267  1.00 0.00 ? 50 ASP A HA   9  
ATOM 7880  H HB2  . ASP A 1 50 ? -6.314  4.987   -4.672  1.00 0.00 ? 50 ASP A HB2  9  
ATOM 7881  H HB3  . ASP A 1 50 ? -5.658  6.201   -5.870  1.00 0.00 ? 50 ASP A HB3  9  
ATOM 7882  N N    . LYS A 1 51 ? -6.219  2.886   -6.787  1.00 0.00 ? 51 LYS A N    9  
ATOM 7883  C CA   . LYS A 1 51 ? -5.287  1.882   -7.319  1.00 0.00 ? 51 LYS A CA   9  
ATOM 7884  C C    . LYS A 1 51 ? -3.837  2.373   -7.323  1.00 0.00 ? 51 LYS A C    9  
ATOM 7885  O O    . LYS A 1 51 ? -3.049  2.042   -8.204  1.00 0.00 ? 51 LYS A O    9  
ATOM 7886  C CB   . LYS A 1 51 ? -5.618  1.377   -8.739  1.00 0.00 ? 51 LYS A CB   9  
ATOM 7887  C CG   . LYS A 1 51 ? -7.006  0.719   -8.847  1.00 0.00 ? 51 LYS A CG   9  
ATOM 7888  C CD   . LYS A 1 51 ? -8.167  1.710   -8.739  1.00 0.00 ? 51 LYS A CD   9  
ATOM 7889  C CE   . LYS A 1 51 ? -9.405  1.281   -9.530  1.00 0.00 ? 51 LYS A CE   9  
ATOM 7890  N NZ   . LYS A 1 51 ? -10.533 2.147   -9.213  1.00 0.00 ? 51 LYS A NZ   9  
ATOM 7891  H H    . LYS A 1 51 ? -6.763  2.623   -5.993  1.00 0.00 ? 51 LYS A H    9  
ATOM 7892  H HA   . LYS A 1 51 ? -5.319  1.071   -6.592  1.00 0.00 ? 51 LYS A HA   9  
ATOM 7893  H HB2  . LYS A 1 51 ? -5.603  2.259   -9.437  1.00 0.00 ? 51 LYS A HB2  9  
ATOM 7894  H HB3  . LYS A 1 51 ? -4.831  0.587   -8.933  1.00 0.00 ? 51 LYS A HB3  9  
ATOM 7895  H HG2  . LYS A 1 51 ? -7.138  0.204   -9.797  1.00 0.00 ? 51 LYS A HG2  9  
ATOM 7896  H HG3  . LYS A 1 51 ? -7.067  -0.045  -8.077  1.00 0.00 ? 51 LYS A HG3  9  
ATOM 7897  H HD2  . LYS A 1 51 ? -8.412  1.841   -7.686  1.00 0.00 ? 51 LYS A HD2  9  
ATOM 7898  H HD3  . LYS A 1 51 ? -7.860  2.684   -9.119  1.00 0.00 ? 51 LYS A HD3  9  
ATOM 7899  H HE2  . LYS A 1 51 ? -9.212  1.341   -10.602 1.00 0.00 ? 51 LYS A HE2  9  
ATOM 7900  H HE3  . LYS A 1 51 ? -9.693  0.255   -9.291  1.00 0.00 ? 51 LYS A HE3  9  
ATOM 7901  H HZ1  . LYS A 1 51 ? -10.879 1.845   -8.276  1.00 0.00 ? 51 LYS A HZ1  9  
ATOM 7902  H HZ2  . LYS A 1 51 ? -11.298 2.080   -9.910  1.00 0.00 ? 51 LYS A HZ2  9  
ATOM 7903  H HZ3  . LYS A 1 51 ? -10.203 3.136   -9.104  1.00 0.00 ? 51 LYS A HZ3  9  
ATOM 7904  N N    . LYS A 1 52 ? -3.527  3.176   -6.292  1.00 0.00 ? 52 LYS A N    9  
ATOM 7905  C CA   . LYS A 1 52 ? -2.172  3.694   -6.195  1.00 0.00 ? 52 LYS A CA   9  
ATOM 7906  C C    . LYS A 1 52 ? -1.595  3.274   -4.833  1.00 0.00 ? 52 LYS A C    9  
ATOM 7907  O O    . LYS A 1 52 ? -2.246  3.405   -3.797  1.00 0.00 ? 52 LYS A O    9  
ATOM 7908  C CB   . LYS A 1 52 ? -2.152  5.216   -6.424  1.00 0.00 ? 52 LYS A CB   9  
ATOM 7909  C CG   . LYS A 1 52 ? -2.489  5.621   -7.885  1.00 0.00 ? 52 LYS A CG   9  
ATOM 7910  C CD   . LYS A 1 52 ? -1.264  6.140   -8.665  1.00 0.00 ? 52 LYS A CD   9  
ATOM 7911  C CE   . LYS A 1 52 ? -0.809  7.540   -8.212  1.00 0.00 ? 52 LYS A CE   9  
ATOM 7912  N NZ   . LYS A 1 52 ? -1.552  8.628   -8.842  1.00 0.00 ? 52 LYS A NZ   9  
ATOM 7913  H H    . LYS A 1 52 ? -4.208  3.376   -5.589  1.00 0.00 ? 52 LYS A H    9  
ATOM 7914  H HA   . LYS A 1 52 ? -1.584  3.182   -6.953  1.00 0.00 ? 52 LYS A HA   9  
ATOM 7915  H HB2  . LYS A 1 52 ? -2.837  5.703   -5.729  1.00 0.00 ? 52 LYS A HB2  9  
ATOM 7916  H HB3  . LYS A 1 52 ? -1.153  5.582   -6.187  1.00 0.00 ? 52 LYS A HB3  9  
ATOM 7917  H HG2  . LYS A 1 52 ? -2.901  4.769   -8.435  1.00 0.00 ? 52 LYS A HG2  9  
ATOM 7918  H HG3  . LYS A 1 52 ? -3.282  6.371   -7.908  1.00 0.00 ? 52 LYS A HG3  9  
ATOM 7919  H HD2  . LYS A 1 52 ? -0.415  5.434   -8.425  1.00 0.00 ? 52 LYS A HD2  9  
ATOM 7920  H HD3  . LYS A 1 52 ? -1.576  6.230   -9.748  1.00 0.00 ? 52 LYS A HD3  9  
ATOM 7921  H HE2  . LYS A 1 52 ? -0.872  7.672   -7.131  1.00 0.00 ? 52 LYS A HE2  9  
ATOM 7922  H HE3  . LYS A 1 52 ? 0.244   7.689   -8.474  1.00 0.00 ? 52 LYS A HE3  9  
ATOM 7923  H HZ1  . LYS A 1 52 ? -1.234  9.543   -8.442  1.00 0.00 ? 52 LYS A HZ1  9  
ATOM 7924  H HZ2  . LYS A 1 52 ? -2.582  8.534   -8.782  1.00 0.00 ? 52 LYS A HZ2  9  
ATOM 7925  H HZ3  . LYS A 1 52 ? -1.230  8.724   -9.836  1.00 0.00 ? 52 LYS A HZ3  9  
ATOM 7926  N N    . TYR A 1 53 ? -0.367  2.718   -4.913  1.00 0.00 ? 53 TYR A N    9  
ATOM 7927  C CA   . TYR A 1 53 ? 0.308   2.143   -3.766  1.00 0.00 ? 53 TYR A CA   9  
ATOM 7928  C C    . TYR A 1 53 ? 1.810   2.412   -3.828  1.00 0.00 ? 53 TYR A C    9  
ATOM 7929  O O    . TYR A 1 53 ? 2.363   2.940   -4.792  1.00 0.00 ? 53 TYR A O    9  
ATOM 7930  C CB   . TYR A 1 53 ? 0.014   0.637   -3.758  1.00 0.00 ? 53 TYR A CB   9  
ATOM 7931  C CG   . TYR A 1 53 ? 0.704   -0.152  -4.843  1.00 0.00 ? 53 TYR A CG   9  
ATOM 7932  C CD1  . TYR A 1 53 ? 1.965   -0.695  -4.629  1.00 0.00 ? 53 TYR A CD1  9  
ATOM 7933  C CD2  . TYR A 1 53 ? 0.086   -0.372  -6.067  1.00 0.00 ? 53 TYR A CD2  9  
ATOM 7934  C CE1  . TYR A 1 53 ? 2.584   -1.466  -5.598  1.00 0.00 ? 53 TYR A CE1  9  
ATOM 7935  C CE2  . TYR A 1 53 ? 0.699   -1.146  -7.042  1.00 0.00 ? 53 TYR A CE2  9  
ATOM 7936  C CZ   . TYR A 1 53 ? 1.946   -1.704  -6.802  1.00 0.00 ? 53 TYR A CZ   9  
ATOM 7937  O OH   . TYR A 1 53 ? 2.555   -2.496  -7.753  1.00 0.00 ? 53 TYR A OH   9  
ATOM 7938  H H    . TYR A 1 53 ? 0.145   2.670   -5.773  1.00 0.00 ? 53 TYR A H    9  
ATOM 7939  H HA   . TYR A 1 53 ? -0.086  2.600   -2.861  1.00 0.00 ? 53 TYR A HA   9  
ATOM 7940  H HB2  . TYR A 1 53 ? 0.234   0.171   -2.800  1.00 0.00 ? 53 TYR A HB2  9  
ATOM 7941  H HB3  . TYR A 1 53 ? -1.054  0.548   -3.882  1.00 0.00 ? 53 TYR A HB3  9  
ATOM 7942  H HD1  . TYR A 1 53 ? 2.482   -0.521  -3.700  1.00 0.00 ? 53 TYR A HD1  9  
ATOM 7943  H HD2  . TYR A 1 53 ? -0.880  0.062   -6.258  1.00 0.00 ? 53 TYR A HD2  9  
ATOM 7944  H HE1  . TYR A 1 53 ? 3.562   -1.873  -5.403  1.00 0.00 ? 53 TYR A HE1  9  
ATOM 7945  H HE2  . TYR A 1 53 ? 0.200   -1.307  -7.984  1.00 0.00 ? 53 TYR A HE2  9  
ATOM 7946  H HH   . TYR A 1 53 ? 3.193   -1.954  -8.207  1.00 0.00 ? 53 TYR A HH   9  
ATOM 7947  N N    . GLY A 1 54 ? 2.415   1.963   -2.722  1.00 0.00 ? 54 GLY A N    9  
ATOM 7948  C CA   . GLY A 1 54 ? 3.857   2.056   -2.555  1.00 0.00 ? 54 GLY A CA   9  
ATOM 7949  C C    . GLY A 1 54 ? 4.395   0.747   -1.992  1.00 0.00 ? 54 GLY A C    9  
ATOM 7950  O O    . GLY A 1 54 ? 3.610   -0.127  -1.633  1.00 0.00 ? 54 GLY A O    9  
ATOM 7951  H H    . GLY A 1 54 ? 1.816   1.537   -2.031  1.00 0.00 ? 54 GLY A H    9  
ATOM 7952  H HA2  . GLY A 1 54 ? 4.303   2.266   -3.521  1.00 0.00 ? 54 GLY A HA2  9  
ATOM 7953  H HA3  . GLY A 1 54 ? 4.037   2.862   -1.854  1.00 0.00 ? 54 GLY A HA3  9  
ATOM 7954  N N    . PHE A 1 55 ? 5.747   0.636   -1.913  1.00 0.00 ? 55 PHE A N    9  
ATOM 7955  C CA   . PHE A 1 55 ? 6.276   -0.602  -1.346  1.00 0.00 ? 55 PHE A CA   9  
ATOM 7956  C C    . PHE A 1 55 ? 6.512   -0.363  0.146   1.00 0.00 ? 55 PHE A C    9  
ATOM 7957  O O    . PHE A 1 55 ? 6.642   0.756   0.619   1.00 0.00 ? 55 PHE A O    9  
ATOM 7958  C CB   . PHE A 1 55 ? 7.532   -1.134  -2.053  1.00 0.00 ? 55 PHE A CB   9  
ATOM 7959  C CG   . PHE A 1 55 ? 7.184   -1.620  -3.433  1.00 0.00 ? 55 PHE A CG   9  
ATOM 7960  C CD1  . PHE A 1 55 ? 6.402   -2.759  -3.604  1.00 0.00 ? 55 PHE A CD1  9  
ATOM 7961  C CD2  . PHE A 1 55 ? 7.627   -0.934  -4.554  1.00 0.00 ? 55 PHE A CD2  9  
ATOM 7962  C CE1  . PHE A 1 55 ? 6.059   -3.192  -4.877  1.00 0.00 ? 55 PHE A CE1  9  
ATOM 7963  C CE2  . PHE A 1 55 ? 7.285   -1.369  -5.827  1.00 0.00 ? 55 PHE A CE2  9  
ATOM 7964  C CZ   . PHE A 1 55 ? 6.499   -2.497  -5.992  1.00 0.00 ? 55 PHE A CZ   9  
ATOM 7965  H H    . PHE A 1 55 ? 6.411   1.341   -2.188  1.00 0.00 ? 55 PHE A H    9  
ATOM 7966  H HA   . PHE A 1 55 ? 5.524   -1.376  -1.448  1.00 0.00 ? 55 PHE A HA   9  
ATOM 7967  H HB2  . PHE A 1 55 ? 8.326   -0.384  -2.103  1.00 0.00 ? 55 PHE A HB2  9  
ATOM 7968  H HB3  . PHE A 1 55 ? 7.915   -2.006  -1.510  1.00 0.00 ? 55 PHE A HB3  9  
ATOM 7969  H HD1  . PHE A 1 55 ? 6.058   -3.314  -2.742  1.00 0.00 ? 55 PHE A HD1  9  
ATOM 7970  H HD2  . PHE A 1 55 ? 8.244   -0.059  -4.426  1.00 0.00 ? 55 PHE A HD2  9  
ATOM 7971  H HE1  . PHE A 1 55 ? 5.443   -4.064  -5.000  1.00 0.00 ? 55 PHE A HE1  9  
ATOM 7972  H HE2  . PHE A 1 55 ? 7.631   -0.822  -6.688  1.00 0.00 ? 55 PHE A HE2  9  
ATOM 7973  H HZ   . PHE A 1 55 ? 6.233   -2.834  -6.984  1.00 0.00 ? 55 PHE A HZ   9  
ATOM 7974  N N    . CYS A 1 56 ? 6.461   -1.504  0.840   1.00 0.00 ? 56 CYS A N    9  
ATOM 7975  C CA   . CYS A 1 56 ? 6.568   -1.524  2.307   1.00 0.00 ? 56 CYS A CA   9  
ATOM 7976  C C    . CYS A 1 56 ? 7.966   -2.121  2.549   1.00 0.00 ? 56 CYS A C    9  
ATOM 7977  O O    . CYS A 1 56 ? 8.634   -2.498  1.593   1.00 0.00 ? 56 CYS A O    9  
ATOM 7978  C CB   . CYS A 1 56 ? 5.402   -2.403  2.854   1.00 0.00 ? 56 CYS A CB   9  
ATOM 7979  S SG   . CYS A 1 56 ? 4.445   -1.660  4.207   1.00 0.00 ? 56 CYS A SG   9  
ATOM 7980  H H    . CYS A 1 56 ? 6.464   -2.343  0.260   1.00 0.00 ? 56 CYS A H    9  
ATOM 7981  H HA   . CYS A 1 56 ? 6.551   -0.504  2.752   1.00 0.00 ? 56 CYS A HA   9  
ATOM 7982  H HB2  . CYS A 1 56 ? 4.641   -2.635  2.087   1.00 0.00 ? 56 CYS A HB2  9  
ATOM 7983  H HB3  . CYS A 1 56 ? 5.802   -3.361  3.201   1.00 0.00 ? 56 CYS A HB3  9  
ATOM 7984  N N    . PRO A 1 57 ? 8.423   -2.209  3.828   1.00 0.00 ? 57 PRO A N    9  
ATOM 7985  C CA   . PRO A 1 57 ? 9.699   -2.874  4.088   1.00 0.00 ? 57 PRO A CA   9  
ATOM 7986  C C    . PRO A 1 57 ? 9.498   -4.393  3.932   1.00 0.00 ? 57 PRO A C    9  
ATOM 7987  O O    . PRO A 1 57 ? 8.458   -4.840  3.458   1.00 0.00 ? 57 PRO A O    9  
ATOM 7988  C CB   . PRO A 1 57 ? 10.009  -2.469  5.537   1.00 0.00 ? 57 PRO A CB   9  
ATOM 7989  C CG   . PRO A 1 57 ? 8.637   -2.227  6.173   1.00 0.00 ? 57 PRO A CG   9  
ATOM 7990  C CD   . PRO A 1 57 ? 7.761   -1.703  5.032   1.00 0.00 ? 57 PRO A CD   9  
ATOM 7991  H HA   . PRO A 1 57 ? 10.475  -2.539  3.397   1.00 0.00 ? 57 PRO A HA   9  
ATOM 7992  H HB2  . PRO A 1 57 ? 10.617  -3.184  6.091   1.00 0.00 ? 57 PRO A HB2  9  
ATOM 7993  H HB3  . PRO A 1 57 ? 10.560  -1.528  5.527   1.00 0.00 ? 57 PRO A HB3  9  
ATOM 7994  H HG2  . PRO A 1 57 ? 8.233   -3.175  6.531   1.00 0.00 ? 57 PRO A HG2  9  
ATOM 7995  H HG3  . PRO A 1 57 ? 8.678   -1.541  7.020   1.00 0.00 ? 57 PRO A HG3  9  
ATOM 7996  H HD2  . PRO A 1 57 ? 6.740   -2.104  5.134   1.00 0.00 ? 57 PRO A HD2  9  
ATOM 7997  H HD3  . PRO A 1 57 ? 7.790   -0.602  5.021   1.00 0.00 ? 57 PRO A HD3  9  
ATOM 7998  N N    . GLU A 1 58 ? 10.514  -5.144  4.399   1.00 0.00 ? 58 GLU A N    9  
ATOM 7999  C CA   . GLU A 1 58 ? 10.471  -6.606  4.352   1.00 0.00 ? 58 GLU A CA   9  
ATOM 8000  C C    . GLU A 1 58 ? 10.573  -7.188  5.770   1.00 0.00 ? 58 GLU A C    9  
ATOM 8001  O O    . GLU A 1 58 ? 11.134  -8.248  6.013   1.00 0.00 ? 58 GLU A O    9  
ATOM 8002  C CB   . GLU A 1 58 ? 11.534  -7.128  3.370   1.00 0.00 ? 58 GLU A CB   9  
ATOM 8003  C CG   . GLU A 1 58 ? 11.232  -6.725  1.898   1.00 0.00 ? 58 GLU A CG   9  
ATOM 8004  C CD   . GLU A 1 58 ? 9.953   -7.394  1.340   1.00 0.00 ? 58 GLU A CD   9  
ATOM 8005  O OE1  . GLU A 1 58 ? 9.730   -8.565  1.638   1.00 0.00 ? 58 GLU A OE1  9  
ATOM 8006  O OE2  . GLU A 1 58 ? 9.192   -6.744  0.617   1.00 0.00 ? 58 GLU A OE2  9  
ATOM 8007  H H    . GLU A 1 58 ? 11.326  -4.696  4.769   1.00 0.00 ? 58 GLU A H    9  
ATOM 8008  H HA   . GLU A 1 58 ? 9.499   -6.919  4.002   1.00 0.00 ? 58 GLU A HA   9  
ATOM 8009  H HB2  . GLU A 1 58 ? 12.516  -6.753  3.691   1.00 0.00 ? 58 GLU A HB2  9  
ATOM 8010  H HB3  . GLU A 1 58 ? 11.564  -8.224  3.427   1.00 0.00 ? 58 GLU A HB3  9  
ATOM 8011  H HG2  . GLU A 1 58 ? 11.132  -5.643  1.791   1.00 0.00 ? 58 GLU A HG2  9  
ATOM 8012  H HG3  . GLU A 1 58 ? 12.053  -7.025  1.245   1.00 0.00 ? 58 GLU A HG3  9  
ATOM 8013  N N    . THR A 1 59 ? 9.964   -6.418  6.690   1.00 0.00 ? 59 THR A N    9  
ATOM 8014  C CA   . THR A 1 59 ? 9.924   -6.789  8.095   1.00 0.00 ? 59 THR A CA   9  
ATOM 8015  C C    . THR A 1 59 ? 8.968   -7.980  8.320   1.00 0.00 ? 59 THR A C    9  
ATOM 8016  O O    . THR A 1 59 ? 7.945   -8.127  7.651   1.00 0.00 ? 59 THR A O    9  
ATOM 8017  C CB   . THR A 1 59 ? 9.463   -5.555  8.892   1.00 0.00 ? 59 THR A CB   9  
ATOM 8018  O OG1  . THR A 1 59 ? 9.935   -4.410  8.195   1.00 0.00 ? 59 THR A OG1  9  
ATOM 8019  C CG2  . THR A 1 59 ? 9.968   -5.595  10.346  1.00 0.00 ? 59 THR A CG2  9  
ATOM 8020  H H    . THR A 1 59 ? 9.549   -5.540  6.458   1.00 0.00 ? 59 THR A H    9  
ATOM 8021  H HA   . THR A 1 59 ? 10.944  -7.068  8.370   1.00 0.00 ? 59 THR A HA   9  
ATOM 8022  H HB   . THR A 1 59 ? 8.367   -5.521  8.892   1.00 0.00 ? 59 THR A HB   9  
ATOM 8023  H HG1  . THR A 1 59 ? 9.802   -3.624  8.718   1.00 0.00 ? 59 THR A HG1  9  
ATOM 8024  H HG21 . THR A 1 59 ? 11.058  -5.566  10.385  1.00 0.00 ? 59 THR A HG21 9  
ATOM 8025  H HG22 . THR A 1 59 ? 9.647   -6.508  10.849  1.00 0.00 ? 59 THR A HG22 9  
ATOM 8026  H HG23 . THR A 1 59 ? 9.589   -4.762  10.939  1.00 0.00 ? 59 THR A HG23 9  
ATOM 8027  N N    . ALA A 1 60 ? 9.365   -8.789  9.312   1.00 0.00 ? 60 ALA A N    9  
ATOM 8028  C CA   . ALA A 1 60 ? 8.614   -9.952  9.744   1.00 0.00 ? 60 ALA A CA   9  
ATOM 8029  C C    . ALA A 1 60 ? 9.016   -10.240 11.200  1.00 0.00 ? 60 ALA A C    9  
ATOM 8030  O O    . ALA A 1 60 ? 10.044  -9.719  11.639  1.00 0.00 ? 60 ALA A O    9  
ATOM 8031  C CB   . ALA A 1 60 ? 8.938   -11.150 8.844   1.00 0.00 ? 60 ALA A CB   9  
ATOM 8032  O OXT  . ALA A 1 60 ? 8.298   -10.973 11.876  1.00 0.00 ? 60 ALA A OXT  9  
ATOM 8033  H H    . ALA A 1 60 ? 10.193  -8.642  9.857   1.00 0.00 ? 60 ALA A H    9  
ATOM 8034  H HA   . ALA A 1 60 ? 7.552   -9.701  9.710   1.00 0.00 ? 60 ALA A HA   9  
ATOM 8035  H HB1  . ALA A 1 60 ? 10.002  -11.387 8.873   1.00 0.00 ? 60 ALA A HB1  9  
ATOM 8036  H HB2  . ALA A 1 60 ? 8.667   -10.946 7.809   1.00 0.00 ? 60 ALA A HB2  9  
ATOM 8037  H HB3  . ALA A 1 60 ? 8.390   -12.036 9.166   1.00 0.00 ? 60 ALA A HB3  9  
ATOM 8038  N N    . THR A 1 1  ? 5.203   7.773   11.060  1.00 0.00 ? 1  THR A N    10 
ATOM 8039  C CA   . THR A 1 1  ? 5.326   6.941   9.881   1.00 0.00 ? 1  THR A CA   10 
ATOM 8040  C C    . THR A 1 1  ? 6.819   6.753   9.689   1.00 0.00 ? 1  THR A C    10 
ATOM 8041  O O    . THR A 1 1  ? 7.557   7.600   10.172  1.00 0.00 ? 1  THR A O    10 
ATOM 8042  C CB   . THR A 1 1  ? 4.673   7.744   8.743   1.00 0.00 ? 1  THR A CB   10 
ATOM 8043  O OG1  . THR A 1 1  ? 3.600   8.432   9.379   1.00 0.00 ? 1  THR A OG1  10 
ATOM 8044  C CG2  . THR A 1 1  ? 4.208   6.845   7.586   1.00 0.00 ? 1  THR A CG2  10 
ATOM 8045  H H1   . THR A 1 1  ? 5.089   7.219   11.929  1.00 0.00 ? 1  THR A H1   10 
ATOM 8046  H H2   . THR A 1 1  ? 4.367   8.369   10.848  1.00 0.00 ? 1  THR A H2   10 
ATOM 8047  H H3   . THR A 1 1  ? 6.088   8.331   11.082  1.00 0.00 ? 1  THR A H3   10 
ATOM 8048  H HA   . THR A 1 1  ? 4.816   5.996   10.070  1.00 0.00 ? 1  THR A HA   10 
ATOM 8049  H HB   . THR A 1 1  ? 5.382   8.490   8.360   1.00 0.00 ? 1  THR A HB   10 
ATOM 8050  H HG1  . THR A 1 1  ? 3.056   8.873   8.725   1.00 0.00 ? 1  THR A HG1  10 
ATOM 8051  H HG21 . THR A 1 1  ? 5.055   6.335   7.130   1.00 0.00 ? 1  THR A HG21 10 
ATOM 8052  H HG22 . THR A 1 1  ? 3.726   7.414   6.789   1.00 0.00 ? 1  THR A HG22 10 
ATOM 8053  H HG23 . THR A 1 1  ? 3.502   6.087   7.926   1.00 0.00 ? 1  THR A HG23 10 
ATOM 8054  N N    . ALA A 1 2  ? 7.210   5.654   9.016   1.00 0.00 ? 2  ALA A N    10 
ATOM 8055  C CA   . ALA A 1 2  ? 8.636   5.389   8.809   1.00 0.00 ? 2  ALA A CA   10 
ATOM 8056  C C    . ALA A 1 2  ? 8.872   4.470   7.594   1.00 0.00 ? 2  ALA A C    10 
ATOM 8057  O O    . ALA A 1 2  ? 9.948   3.914   7.419   1.00 0.00 ? 2  ALA A O    10 
ATOM 8058  C CB   . ALA A 1 2  ? 9.225   4.745   10.072  1.00 0.00 ? 2  ALA A CB   10 
ATOM 8059  H H    . ALA A 1 2  ? 6.528   5.004   8.682   1.00 0.00 ? 2  ALA A H    10 
ATOM 8060  H HA   . ALA A 1 2  ? 9.129   6.341   8.600   1.00 0.00 ? 2  ALA A HA   10 
ATOM 8061  H HB1  . ALA A 1 2  ? 10.293  4.557   9.957   1.00 0.00 ? 2  ALA A HB1  10 
ATOM 8062  H HB2  . ALA A 1 2  ? 8.743   3.792   10.295  1.00 0.00 ? 2  ALA A HB2  10 
ATOM 8063  H HB3  . ALA A 1 2  ? 9.101   5.394   10.939  1.00 0.00 ? 2  ALA A HB3  10 
ATOM 8064  N N    . LEU A 1 3  ? 7.806   4.323   6.783   1.00 0.00 ? 3  LEU A N    10 
ATOM 8065  C CA   . LEU A 1 3  ? 7.839   3.512   5.584   1.00 0.00 ? 3  LEU A CA   10 
ATOM 8066  C C    . LEU A 1 3  ? 7.408   4.511   4.510   1.00 0.00 ? 3  LEU A C    10 
ATOM 8067  O O    . LEU A 1 3  ? 6.277   4.977   4.501   1.00 0.00 ? 3  LEU A O    10 
ATOM 8068  C CB   . LEU A 1 3  ? 6.964   2.232   5.681   1.00 0.00 ? 3  LEU A CB   10 
ATOM 8069  C CG   . LEU A 1 3  ? 5.901   2.149   6.805   1.00 0.00 ? 3  LEU A CG   10 
ATOM 8070  C CD1  . LEU A 1 3  ? 6.473   2.040   8.230   1.00 0.00 ? 3  LEU A CD1  10 
ATOM 8071  C CD2  . LEU A 1 3  ? 4.807   3.214   6.694   1.00 0.00 ? 3  LEU A CD2  10 
ATOM 8072  H H    . LEU A 1 3  ? 6.936   4.806   6.869   1.00 0.00 ? 3  LEU A H    10 
ATOM 8073  H HA   . LEU A 1 3  ? 8.870   3.207   5.400   1.00 0.00 ? 3  LEU A HA   10 
ATOM 8074  H HB2  . LEU A 1 3  ? 6.404   2.130   4.709   1.00 0.00 ? 3  LEU A HB2  10 
ATOM 8075  H HB3  . LEU A 1 3  ? 7.685   1.403   5.917   1.00 0.00 ? 3  LEU A HB3  10 
ATOM 8076  H HG   . LEU A 1 3  ? 5.397   1.194   6.640   1.00 0.00 ? 3  LEU A HG   10 
ATOM 8077  H HD11 . LEU A 1 3  ? 6.812   2.987   8.635   1.00 0.00 ? 3  LEU A HD11 10 
ATOM 8078  H HD12 . LEU A 1 3  ? 7.308   1.341   8.268   1.00 0.00 ? 3  LEU A HD12 10 
ATOM 8079  H HD13 . LEU A 1 3  ? 5.710   1.674   8.917   1.00 0.00 ? 3  LEU A HD13 10 
ATOM 8080  H HD21 . LEU A 1 3  ? 4.165   3.219   7.572   1.00 0.00 ? 3  LEU A HD21 10 
ATOM 8081  H HD22 . LEU A 1 3  ? 4.182   3.005   5.829   1.00 0.00 ? 3  LEU A HD22 10 
ATOM 8082  H HD23 . LEU A 1 3  ? 5.205   4.216   6.578   1.00 0.00 ? 3  LEU A HD23 10 
ATOM 8083  N N    . PHE A 1 4  ? 8.410   4.877   3.686   1.00 0.00 ? 4  PHE A N    10 
ATOM 8084  C CA   . PHE A 1 4  ? 8.207   5.926   2.694   1.00 0.00 ? 4  PHE A CA   10 
ATOM 8085  C C    . PHE A 1 4  ? 7.562   5.325   1.432   1.00 0.00 ? 4  PHE A C    10 
ATOM 8086  O O    . PHE A 1 4  ? 6.344   5.195   1.409   1.00 0.00 ? 4  PHE A O    10 
ATOM 8087  C CB   . PHE A 1 4  ? 9.473   6.833   2.603   1.00 0.00 ? 4  PHE A CB   10 
ATOM 8088  C CG   . PHE A 1 4  ? 9.708   7.470   3.951   1.00 0.00 ? 4  PHE A CG   10 
ATOM 8089  C CD1  . PHE A 1 4  ? 9.053   8.649   4.297   1.00 0.00 ? 4  PHE A CD1  10 
ATOM 8090  C CD2  . PHE A 1 4  ? 10.564  6.880   4.880   1.00 0.00 ? 4  PHE A CD2  10 
ATOM 8091  C CE1  . PHE A 1 4  ? 9.241   9.222   5.548   1.00 0.00 ? 4  PHE A CE1  10 
ATOM 8092  C CE2  . PHE A 1 4  ? 10.751  7.449   6.132   1.00 0.00 ? 4  PHE A CE2  10 
ATOM 8093  C CZ   . PHE A 1 4  ? 10.088  8.621   6.469   1.00 0.00 ? 4  PHE A CZ   10 
ATOM 8094  H H    . PHE A 1 4  ? 9.298   4.432   3.772   1.00 0.00 ? 4  PHE A H    10 
ATOM 8095  H HA   . PHE A 1 4  ? 7.406   6.568   3.066   1.00 0.00 ? 4  PHE A HA   10 
ATOM 8096  H HB2  . PHE A 1 4  ? 10.393  6.289   2.365   1.00 0.00 ? 4  PHE A HB2  10 
ATOM 8097  H HB3  . PHE A 1 4  ? 9.363   7.654   1.876   1.00 0.00 ? 4  PHE A HB3  10 
ATOM 8098  H HD1  . PHE A 1 4  ? 8.388   9.124   3.591   1.00 0.00 ? 4  PHE A HD1  10 
ATOM 8099  H HD2  . PHE A 1 4  ? 11.088  5.968   4.636   1.00 0.00 ? 4  PHE A HD2  10 
ATOM 8100  H HE1  . PHE A 1 4  ? 8.727   10.137  5.806   1.00 0.00 ? 4  PHE A HE1  10 
ATOM 8101  H HE2  . PHE A 1 4  ? 11.412  6.977   6.845   1.00 0.00 ? 4  PHE A HE2  10 
ATOM 8102  H HZ   . PHE A 1 4  ? 10.232  9.064   7.444   1.00 0.00 ? 4  PHE A HZ   10 
ATOM 8103  N N    . THR A 1 5  ? 8.367   5.005   0.392   1.00 0.00 ? 5  THR A N    10 
ATOM 8104  C CA   . THR A 1 5  ? 7.784   4.501   -0.854  1.00 0.00 ? 5  THR A CA   10 
ATOM 8105  C C    . THR A 1 5  ? 8.589   3.357   -1.458  1.00 0.00 ? 5  THR A C    10 
ATOM 8106  O O    . THR A 1 5  ? 8.094   2.300   -1.808  1.00 0.00 ? 5  THR A O    10 
ATOM 8107  C CB   . THR A 1 5  ? 7.649   5.658   -1.848  1.00 0.00 ? 5  THR A CB   10 
ATOM 8108  O OG1  . THR A 1 5  ? 8.953   6.079   -2.241  1.00 0.00 ? 5  THR A OG1  10 
ATOM 8109  C CG2  . THR A 1 5  ? 6.875   6.804   -1.182  1.00 0.00 ? 5  THR A CG2  10 
ATOM 8110  H H    . THR A 1 5  ? 9.352   5.093   0.421   1.00 0.00 ? 5  THR A H    10 
ATOM 8111  H HA   . THR A 1 5  ? 6.814   4.076   -0.633  1.00 0.00 ? 5  THR A HA   10 
ATOM 8112  H HB   . THR A 1 5  ? 7.078   5.245   -2.693  1.00 0.00 ? 5  THR A HB   10 
ATOM 8113  H HG1  . THR A 1 5  ? 8.912   6.712   -2.953  1.00 0.00 ? 5  THR A HG1  10 
ATOM 8114  H HG21 . THR A 1 5  ? 6.365   7.474   -1.860  1.00 0.00 ? 5  THR A HG21 10 
ATOM 8115  H HG22 . THR A 1 5  ? 7.437   7.411   -0.488  1.00 0.00 ? 5  THR A HG22 10 
ATOM 8116  H HG23 . THR A 1 5  ? 6.104   6.356   -0.577  1.00 0.00 ? 5  THR A HG23 10 
ATOM 8117  N N    . MET A 1 6  ? 9.882   3.667   -1.580  1.00 0.00 ? 6  MET A N    10 
ATOM 8118  C CA   . MET A 1 6  ? 10.844  2.726   -2.153  1.00 0.00 ? 6  MET A CA   10 
ATOM 8119  C C    . MET A 1 6  ? 10.442  2.363   -3.603  1.00 0.00 ? 6  MET A C    10 
ATOM 8120  O O    . MET A 1 6  ? 10.684  1.267   -4.091  1.00 0.00 ? 6  MET A O    10 
ATOM 8121  C CB   . MET A 1 6  ? 10.967  1.463   -1.267  1.00 0.00 ? 6  MET A CB   10 
ATOM 8122  C CG   . MET A 1 6  ? 10.915  1.746   0.245   1.00 0.00 ? 6  MET A CG   10 
ATOM 8123  S SD   . MET A 1 6  ? 11.255  0.266   1.214   1.00 0.00 ? 6  MET A SD   10 
ATOM 8124  C CE   . MET A 1 6  ? 10.901  0.941   2.847   1.00 0.00 ? 6  MET A CE   10 
ATOM 8125  H H    . MET A 1 6  ? 10.032  4.621   -1.321  1.00 0.00 ? 6  MET A H    10 
ATOM 8126  H HA   . MET A 1 6  ? 11.792  3.265   -2.194  1.00 0.00 ? 6  MET A HA   10 
ATOM 8127  H HB2  . MET A 1 6  ? 10.164  0.763   -1.500  1.00 0.00 ? 6  MET A HB2  10 
ATOM 8128  H HB3  . MET A 1 6  ? 11.893  0.945   -1.517  1.00 0.00 ? 6  MET A HB3  10 
ATOM 8129  H HG2  . MET A 1 6  ? 11.619  2.527   0.532   1.00 0.00 ? 6  MET A HG2  10 
ATOM 8130  H HG3  . MET A 1 6  ? 9.924   2.102   0.534   1.00 0.00 ? 6  MET A HG3  10 
ATOM 8131  H HE1  . MET A 1 6  ? 9.914   1.404   2.854   1.00 0.00 ? 6  MET A HE1  10 
ATOM 8132  H HE2  . MET A 1 6  ? 11.631  1.708   3.105   1.00 0.00 ? 6  MET A HE2  10 
ATOM 8133  H HE3  . MET A 1 6  ? 10.920  0.152   3.599   1.00 0.00 ? 6  MET A HE3  10 
ATOM 8134  N N    . GLY A 1 7  ? 9.784   3.356   -4.236  1.00 0.00 ? 7  GLY A N    10 
ATOM 8135  C CA   . GLY A 1 7  ? 9.249   3.207   -5.580  1.00 0.00 ? 7  GLY A CA   10 
ATOM 8136  C C    . GLY A 1 7  ? 7.813   3.731   -5.558  1.00 0.00 ? 7  GLY A C    10 
ATOM 8137  O O    . GLY A 1 7  ? 7.528   4.769   -4.966  1.00 0.00 ? 7  GLY A O    10 
ATOM 8138  H H    . GLY A 1 7  ? 9.615   4.219   -3.758  1.00 0.00 ? 7  GLY A H    10 
ATOM 8139  H HA2  . GLY A 1 7  ? 9.865   3.805   -6.253  1.00 0.00 ? 7  GLY A HA2  10 
ATOM 8140  H HA3  . GLY A 1 7  ? 9.272   2.153   -5.875  1.00 0.00 ? 7  GLY A HA3  10 
ATOM 8141  N N    . GLY A 1 8  ? 6.926   2.940   -6.194  1.00 0.00 ? 8  GLY A N    10 
ATOM 8142  C CA   . GLY A 1 8  ? 5.507   3.308   -6.229  1.00 0.00 ? 8  GLY A CA   10 
ATOM 8143  C C    . GLY A 1 8  ? 5.131   3.793   -7.632  1.00 0.00 ? 8  GLY A C    10 
ATOM 8144  O O    . GLY A 1 8  ? 6.007   3.960   -8.471  1.00 0.00 ? 8  GLY A O    10 
ATOM 8145  H H    . GLY A 1 8  ? 7.294   2.143   -6.675  1.00 0.00 ? 8  GLY A H    10 
ATOM 8146  H HA2  . GLY A 1 8  ? 4.887   2.455   -5.935  1.00 0.00 ? 8  GLY A HA2  10 
ATOM 8147  H HA3  . GLY A 1 8  ? 5.361   4.113   -5.510  1.00 0.00 ? 8  GLY A HA3  10 
ATOM 8148  N N    . ASN A 1 9  ? 3.808   4.026   -7.842  1.00 0.00 ? 9  ASN A N    10 
ATOM 8149  C CA   . ASN A 1 9  ? 3.352   4.487   -9.182  1.00 0.00 ? 9  ASN A CA   10 
ATOM 8150  C C    . ASN A 1 9  ? 2.944   5.990   -9.215  1.00 0.00 ? 9  ASN A C    10 
ATOM 8151  O O    . ASN A 1 9  ? 3.101   6.667   -10.221 1.00 0.00 ? 9  ASN A O    10 
ATOM 8152  C CB   . ASN A 1 9  ? 2.377   3.486   -9.848  1.00 0.00 ? 9  ASN A CB   10 
ATOM 8153  C CG   . ASN A 1 9  ? 0.891   3.564   -9.425  1.00 0.00 ? 9  ASN A CG   10 
ATOM 8154  O OD1  . ASN A 1 9  ? 0.323   4.643   -9.338  1.00 0.00 ? 9  ASN A OD1  10 
ATOM 8155  N ND2  . ASN A 1 9  ? 0.245   2.389   -9.263  1.00 0.00 ? 9  ASN A ND2  10 
ATOM 8156  H H    . ASN A 1 9  ? 3.201   3.819   -7.056  1.00 0.00 ? 9  ASN A H    10 
ATOM 8157  H HA   . ASN A 1 9  ? 4.236   4.462   -9.825  1.00 0.00 ? 9  ASN A HA   10 
ATOM 8158  H HB2  . ASN A 1 9  ? 2.380   3.684   -10.920 1.00 0.00 ? 9  ASN A HB2  10 
ATOM 8159  H HB3  . ASN A 1 9  ? 2.791   2.482   -9.742  1.00 0.00 ? 9  ASN A HB3  10 
ATOM 8160  H HD21 . ASN A 1 9  ? 0.627   1.458   -9.318  1.00 0.00 ? 9  ASN A HD21 10 
ATOM 8161  H HD22 . ASN A 1 9  ? -0.737  2.516   -9.086  1.00 0.00 ? 9  ASN A HD22 10 
ATOM 8162  N N    . ALA A 1 10 ? 2.551   6.489   -8.030  1.00 0.00 ? 10 ALA A N    10 
ATOM 8163  C CA   . ALA A 1 10 ? 2.279   7.898   -7.684  1.00 0.00 ? 10 ALA A CA   10 
ATOM 8164  C C    . ALA A 1 10 ? 3.616   8.673   -7.555  1.00 0.00 ? 10 ALA A C    10 
ATOM 8165  O O    . ALA A 1 10 ? 3.832   9.378   -6.580  1.00 0.00 ? 10 ALA A O    10 
ATOM 8166  C CB   . ALA A 1 10 ? 1.520   8.031   -6.319  1.00 0.00 ? 10 ALA A CB   10 
ATOM 8167  H H    . ALA A 1 10 ? 2.428   5.748   -7.383  1.00 0.00 ? 10 ALA A H    10 
ATOM 8168  H HA   . ALA A 1 10 ? 1.693   8.322   -8.500  1.00 0.00 ? 10 ALA A HA   10 
ATOM 8169  H HB1  . ALA A 1 10 ? 2.086   7.704   -5.443  1.00 0.00 ? 10 ALA A HB1  10 
ATOM 8170  H HB2  . ALA A 1 10 ? 0.576   7.491   -6.296  1.00 0.00 ? 10 ALA A HB2  10 
ATOM 8171  H HB3  . ALA A 1 10 ? 1.277   9.059   -6.062  1.00 0.00 ? 10 ALA A HB3  10 
ATOM 8172  N N    . GLU A 1 11 ? 4.500   8.472   -8.559  1.00 0.00 ? 11 GLU A N    10 
ATOM 8173  C CA   . GLU A 1 11 ? 5.828   9.085   -8.660  1.00 0.00 ? 11 GLU A CA   10 
ATOM 8174  C C    . GLU A 1 11 ? 6.549   9.254   -7.297  1.00 0.00 ? 11 GLU A C    10 
ATOM 8175  O O    . GLU A 1 11 ? 7.068   10.319  -6.984  1.00 0.00 ? 11 GLU A O    10 
ATOM 8176  C CB   . GLU A 1 11 ? 5.703   10.427  -9.401  1.00 0.00 ? 11 GLU A CB   10 
ATOM 8177  C CG   . GLU A 1 11 ? 5.062   10.274  -10.791 1.00 0.00 ? 11 GLU A CG   10 
ATOM 8178  C CD   . GLU A 1 11 ? 5.047   11.621  -11.528 1.00 0.00 ? 11 GLU A CD   10 
ATOM 8179  O OE1  . GLU A 1 11 ? 6.024   11.930  -12.209 1.00 0.00 ? 11 GLU A OE1  10 
ATOM 8180  O OE2  . GLU A 1 11 ? 4.059   12.345  -11.413 1.00 0.00 ? 11 GLU A OE2  10 
ATOM 8181  H H    . GLU A 1 11 ? 4.205   7.907   -9.330  1.00 0.00 ? 11 GLU A H    10 
ATOM 8182  H HA   . GLU A 1 11 ? 6.419   8.403   -9.273  1.00 0.00 ? 11 GLU A HA   10 
ATOM 8183  H HB2  . GLU A 1 11 ? 5.119   11.128  -8.803  1.00 0.00 ? 11 GLU A HB2  10 
ATOM 8184  H HB3  . GLU A 1 11 ? 6.694   10.872  -9.512  1.00 0.00 ? 11 GLU A HB3  10 
ATOM 8185  H HG2  . GLU A 1 11 ? 5.615   9.552   -11.392 1.00 0.00 ? 11 GLU A HG2  10 
ATOM 8186  H HG3  . GLU A 1 11 ? 4.038   9.907   -10.716 1.00 0.00 ? 11 GLU A HG3  10 
ATOM 8187  N N    . GLY A 1 12 ? 6.540   8.149   -6.514  1.00 0.00 ? 12 GLY A N    10 
ATOM 8188  C CA   . GLY A 1 12 ? 7.098   8.168   -5.160  1.00 0.00 ? 12 GLY A CA   10 
ATOM 8189  C C    . GLY A 1 12 ? 5.869   8.053   -4.199  1.00 0.00 ? 12 GLY A C    10 
ATOM 8190  O O    . GLY A 1 12 ? 5.524   9.067   -3.615  1.00 0.00 ? 12 GLY A O    10 
ATOM 8191  H H    . GLY A 1 12 ? 6.087   7.324   -6.844  1.00 0.00 ? 12 GLY A H    10 
ATOM 8192  H HA2  . GLY A 1 12 ? 7.907   7.369   -5.130  1.00 0.00 ? 12 GLY A HA2  10 
ATOM 8193  H HA3  . GLY A 1 12 ? 7.448   9.229   -4.969  1.00 0.00 ? 12 GLY A HA3  10 
ATOM 8194  N N    . GLN A 1 13 ? 5.149   6.889   -4.071  1.00 0.00 ? 13 GLN A N    10 
ATOM 8195  C CA   . GLN A 1 13 ? 3.886   6.902   -3.302  1.00 0.00 ? 13 GLN A CA   10 
ATOM 8196  C C    . GLN A 1 13 ? 3.998   6.696   -1.753  1.00 0.00 ? 13 GLN A C    10 
ATOM 8197  O O    . GLN A 1 13 ? 4.230   5.574   -1.324  1.00 0.00 ? 13 GLN A O    10 
ATOM 8198  C CB   . GLN A 1 13 ? 2.971   5.755   -3.751  1.00 0.00 ? 13 GLN A CB   10 
ATOM 8199  C CG   . GLN A 1 13 ? 2.837   5.319   -5.202  1.00 0.00 ? 13 GLN A CG   10 
ATOM 8200  C CD   . GLN A 1 13 ? 1.379   5.033   -5.644  1.00 0.00 ? 13 GLN A CD   10 
ATOM 8201  O OE1  . GLN A 1 13 ? 1.185   4.444   -6.693  1.00 0.00 ? 13 GLN A OE1  10 
ATOM 8202  N NE2  . GLN A 1 13 ? 0.373   5.465   -4.876  1.00 0.00 ? 13 GLN A NE2  10 
ATOM 8203  H H    . GLN A 1 13 ? 5.359   5.978   -4.423  1.00 0.00 ? 13 GLN A H    10 
ATOM 8204  H HA   . GLN A 1 13 ? 3.430   7.867   -3.543  1.00 0.00 ? 13 GLN A HA   10 
ATOM 8205  H HB2  . GLN A 1 13 ? 3.162   4.879   -3.187  1.00 0.00 ? 13 GLN A HB2  10 
ATOM 8206  H HB3  . GLN A 1 13 ? 2.033   5.989   -3.350  1.00 0.00 ? 13 GLN A HB3  10 
ATOM 8207  H HG2  . GLN A 1 13 ? 3.284   6.058   -5.850  1.00 0.00 ? 13 GLN A HG2  10 
ATOM 8208  H HG3  . GLN A 1 13 ? 3.375   4.380   -5.368  1.00 0.00 ? 13 GLN A HG3  10 
ATOM 8209  H HE21 . GLN A 1 13 ? 0.493   5.911   -3.992  1.00 0.00 ? 13 GLN A HE21 10 
ATOM 8210  H HE22 . GLN A 1 13 ? -0.558  5.310   -5.190  1.00 0.00 ? 13 GLN A HE22 10 
ATOM 8211  N N    . PRO A 1 14 ? 3.791   7.747   -0.914  1.00 0.00 ? 14 PRO A N    10 
ATOM 8212  C CA   . PRO A 1 14 ? 3.996   7.653   0.547   1.00 0.00 ? 14 PRO A CA   10 
ATOM 8213  C C    . PRO A 1 14 ? 2.936   6.786   1.248   1.00 0.00 ? 14 PRO A C    10 
ATOM 8214  O O    . PRO A 1 14 ? 1.749   7.058   1.133   1.00 0.00 ? 14 PRO A O    10 
ATOM 8215  C CB   . PRO A 1 14 ? 3.911   9.108   1.012   1.00 0.00 ? 14 PRO A CB   10 
ATOM 8216  C CG   . PRO A 1 14 ? 3.076   9.835   -0.059  1.00 0.00 ? 14 PRO A CG   10 
ATOM 8217  C CD   . PRO A 1 14 ? 3.270   9.029   -1.347  1.00 0.00 ? 14 PRO A CD   10 
ATOM 8218  H HA   . PRO A 1 14 ? 4.975   7.260   0.803   1.00 0.00 ? 14 PRO A HA   10 
ATOM 8219  H HB2  . PRO A 1 14 ? 3.476   9.218   2.012   1.00 0.00 ? 14 PRO A HB2  10 
ATOM 8220  H HB3  . PRO A 1 14 ? 4.937   9.492   1.037   1.00 0.00 ? 14 PRO A HB3  10 
ATOM 8221  H HG2  . PRO A 1 14 ? 1.998   9.727   0.236   1.00 0.00 ? 14 PRO A HG2  10 
ATOM 8222  H HG3  . PRO A 1 14 ? 3.470   10.871  -0.221  1.00 0.00 ? 14 PRO A HG3  10 
ATOM 8223  H HD2  . PRO A 1 14 ? 2.342   8.886   -1.901  1.00 0.00 ? 14 PRO A HD2  10 
ATOM 8224  H HD3  . PRO A 1 14 ? 3.973   9.501   -2.021  1.00 0.00 ? 14 PRO A HD3  10 
ATOM 8225  N N    . CYS A 1 15 ? 3.388   5.734   1.969   1.00 0.00 ? 15 CYS A N    10 
ATOM 8226  C CA   . CYS A 1 15 ? 2.385   4.837   2.556   1.00 0.00 ? 15 CYS A CA   10 
ATOM 8227  C C    . CYS A 1 15 ? 1.305   5.579   3.380   1.00 0.00 ? 15 CYS A C    10 
ATOM 8228  O O    . CYS A 1 15 ? 1.587   6.482   4.159   1.00 0.00 ? 15 CYS A O    10 
ATOM 8229  C CB   . CYS A 1 15 ? 3.039   3.834   3.510   1.00 0.00 ? 15 CYS A CB   10 
ATOM 8230  S SG   . CYS A 1 15 ? 4.091   2.598   2.707   1.00 0.00 ? 15 CYS A SG   10 
ATOM 8231  H H    . CYS A 1 15 ? 4.372   5.534   2.070   1.00 0.00 ? 15 CYS A H    10 
ATOM 8232  H HA   . CYS A 1 15 ? 1.898   4.340   1.710   1.00 0.00 ? 15 CYS A HA   10 
ATOM 8233  H HB2  . CYS A 1 15 ? 3.605   4.367   4.266   1.00 0.00 ? 15 CYS A HB2  10 
ATOM 8234  H HB3  . CYS A 1 15 ? 2.280   3.285   4.065   1.00 0.00 ? 15 CYS A HB3  10 
ATOM 8235  N N    . LYS A 1 16 ? 0.060   5.119   3.144   1.00 0.00 ? 16 LYS A N    10 
ATOM 8236  C CA   . LYS A 1 16 ? -1.122  5.662   3.784   1.00 0.00 ? 16 LYS A CA   10 
ATOM 8237  C C    . LYS A 1 16 ? -1.712  4.553   4.641   1.00 0.00 ? 16 LYS A C    10 
ATOM 8238  O O    . LYS A 1 16 ? -2.155  3.523   4.155   1.00 0.00 ? 16 LYS A O    10 
ATOM 8239  C CB   . LYS A 1 16 ? -2.118  6.086   2.694   1.00 0.00 ? 16 LYS A CB   10 
ATOM 8240  C CG   . LYS A 1 16 ? -3.479  6.622   3.202   1.00 0.00 ? 16 LYS A CG   10 
ATOM 8241  C CD   . LYS A 1 16 ? -3.378  7.819   4.158   1.00 0.00 ? 16 LYS A CD   10 
ATOM 8242  C CE   . LYS A 1 16 ? -3.817  7.532   5.603   1.00 0.00 ? 16 LYS A CE   10 
ATOM 8243  N NZ   . LYS A 1 16 ? -5.140  6.903   5.686   1.00 0.00 ? 16 LYS A NZ   10 
ATOM 8244  H H    . LYS A 1 16 ? -0.105  4.357   2.514   1.00 0.00 ? 16 LYS A H    10 
ATOM 8245  H HA   . LYS A 1 16 ? -0.821  6.487   4.427   1.00 0.00 ? 16 LYS A HA   10 
ATOM 8246  H HB2  . LYS A 1 16 ? -1.650  6.847   2.069   1.00 0.00 ? 16 LYS A HB2  10 
ATOM 8247  H HB3  . LYS A 1 16 ? -2.269  5.199   2.067   1.00 0.00 ? 16 LYS A HB3  10 
ATOM 8248  H HG2  . LYS A 1 16 ? -4.092  6.988   2.372   1.00 0.00 ? 16 LYS A HG2  10 
ATOM 8249  H HG3  . LYS A 1 16 ? -4.053  5.804   3.636   1.00 0.00 ? 16 LYS A HG3  10 
ATOM 8250  H HD2  . LYS A 1 16 ? -2.433  8.354   4.038   1.00 0.00 ? 16 LYS A HD2  10 
ATOM 8251  H HD3  . LYS A 1 16 ? -4.074  8.557   3.818   1.00 0.00 ? 16 LYS A HD3  10 
ATOM 8252  H HE2  . LYS A 1 16 ? -3.100  6.896   6.104   1.00 0.00 ? 16 LYS A HE2  10 
ATOM 8253  H HE3  . LYS A 1 16 ? -3.863  8.463   6.172   1.00 0.00 ? 16 LYS A HE3  10 
ATOM 8254  H HZ1  . LYS A 1 16 ? -5.489  6.721   6.647   1.00 0.00 ? 16 LYS A HZ1  10 
ATOM 8255  H HZ2  . LYS A 1 16 ? -5.217  5.985   5.193   1.00 0.00 ? 16 LYS A HZ2  10 
ATOM 8256  H HZ3  . LYS A 1 16 ? -5.883  7.511   5.272   1.00 0.00 ? 16 LYS A HZ3  10 
ATOM 8257  N N    . PHE A 1 17 ? -1.657  4.833   5.948   1.00 0.00 ? 17 PHE A N    10 
ATOM 8258  C CA   . PHE A 1 17 ? -2.169  3.920   6.964   1.00 0.00 ? 17 PHE A CA   10 
ATOM 8259  C C    . PHE A 1 17 ? -3.192  4.757   7.748   1.00 0.00 ? 17 PHE A C    10 
ATOM 8260  O O    . PHE A 1 17 ? -2.853  5.840   8.209   1.00 0.00 ? 17 PHE A O    10 
ATOM 8261  C CB   . PHE A 1 17 ? -1.070  3.448   7.951   1.00 0.00 ? 17 PHE A CB   10 
ATOM 8262  C CG   . PHE A 1 17 ? -0.004  2.528   7.394   1.00 0.00 ? 17 PHE A CG   10 
ATOM 8263  C CD1  . PHE A 1 17 ? -0.070  1.941   6.135   1.00 0.00 ? 17 PHE A CD1  10 
ATOM 8264  C CD2  . PHE A 1 17 ? 1.101   2.239   8.184   1.00 0.00 ? 17 PHE A CD2  10 
ATOM 8265  C CE1  . PHE A 1 17 ? 0.949   1.124   5.670   1.00 0.00 ? 17 PHE A CE1  10 
ATOM 8266  C CE2  . PHE A 1 17 ? 2.117   1.413   7.728   1.00 0.00 ? 17 PHE A CE2  10 
ATOM 8267  C CZ   . PHE A 1 17 ? 2.051   0.857   6.462   1.00 0.00 ? 17 PHE A CZ   10 
ATOM 8268  H H    . PHE A 1 17 ? -1.344  5.755   6.183   1.00 0.00 ? 17 PHE A H    10 
ATOM 8269  H HA   . PHE A 1 17 ? -2.643  3.074   6.469   1.00 0.00 ? 17 PHE A HA   10 
ATOM 8270  H HB2  . PHE A 1 17 ? -0.567  4.327   8.373   1.00 0.00 ? 17 PHE A HB2  10 
ATOM 8271  H HB3  . PHE A 1 17 ? -1.533  2.894   8.780   1.00 0.00 ? 17 PHE A HB3  10 
ATOM 8272  H HD1  . PHE A 1 17 ? -0.916  2.093   5.496   1.00 0.00 ? 17 PHE A HD1  10 
ATOM 8273  H HD2  . PHE A 1 17 ? 1.162   2.648   9.175   1.00 0.00 ? 17 PHE A HD2  10 
ATOM 8274  H HE1  . PHE A 1 17 ? 0.876   0.699   4.686   1.00 0.00 ? 17 PHE A HE1  10 
ATOM 8275  H HE2  . PHE A 1 17 ? 2.959   1.206   8.365   1.00 0.00 ? 17 PHE A HE2  10 
ATOM 8276  H HZ   . PHE A 1 17 ? 2.848   0.217   6.105   1.00 0.00 ? 17 PHE A HZ   10 
ATOM 8277  N N    . PRO A 1 18 ? -4.454  4.280   7.859   1.00 0.00 ? 18 PRO A N    10 
ATOM 8278  C CA   . PRO A 1 18 ? -4.982  3.086   7.202   1.00 0.00 ? 18 PRO A CA   10 
ATOM 8279  C C    . PRO A 1 18 ? -5.241  3.301   5.695   1.00 0.00 ? 18 PRO A C    10 
ATOM 8280  O O    . PRO A 1 18 ? -5.553  4.405   5.259   1.00 0.00 ? 18 PRO A O    10 
ATOM 8281  C CB   . PRO A 1 18 ? -6.325  2.837   7.909   1.00 0.00 ? 18 PRO A CB   10 
ATOM 8282  C CG   . PRO A 1 18 ? -6.739  4.196   8.479   1.00 0.00 ? 18 PRO A CG   10 
ATOM 8283  C CD   . PRO A 1 18 ? -5.422  4.929   8.740   1.00 0.00 ? 18 PRO A CD   10 
ATOM 8284  H HA   . PRO A 1 18 ? -4.307  2.249   7.371   1.00 0.00 ? 18 PRO A HA   10 
ATOM 8285  H HB2  . PRO A 1 18 ? -7.092  2.397   7.270   1.00 0.00 ? 18 PRO A HB2  10 
ATOM 8286  H HB3  . PRO A 1 18 ? -6.171  2.144   8.733   1.00 0.00 ? 18 PRO A HB3  10 
ATOM 8287  H HG2  . PRO A 1 18 ? -7.320  4.740   7.735   1.00 0.00 ? 18 PRO A HG2  10 
ATOM 8288  H HG3  . PRO A 1 18 ? -7.351  4.105   9.376   1.00 0.00 ? 18 PRO A HG3  10 
ATOM 8289  H HD2  . PRO A 1 18 ? -5.503  5.999   8.534   1.00 0.00 ? 18 PRO A HD2  10 
ATOM 8290  H HD3  . PRO A 1 18 ? -5.104  4.781   9.777   1.00 0.00 ? 18 PRO A HD3  10 
ATOM 8291  N N    . PHE A 1 19 ? -5.133  2.181   4.957   1.00 0.00 ? 19 PHE A N    10 
ATOM 8292  C CA   . PHE A 1 19 ? -5.567  2.103   3.564   1.00 0.00 ? 19 PHE A CA   10 
ATOM 8293  C C    . PHE A 1 19 ? -6.582  0.947   3.550   1.00 0.00 ? 19 PHE A C    10 
ATOM 8294  O O    . PHE A 1 19 ? -6.329  -0.107  4.122   1.00 0.00 ? 19 PHE A O    10 
ATOM 8295  C CB   . PHE A 1 19 ? -4.458  1.882   2.513   1.00 0.00 ? 19 PHE A CB   10 
ATOM 8296  C CG   . PHE A 1 19 ? -3.615  0.618   2.710   1.00 0.00 ? 19 PHE A CG   10 
ATOM 8297  C CD1  . PHE A 1 19 ? -2.714  0.436   3.774   1.00 0.00 ? 19 PHE A CD1  10 
ATOM 8298  C CD2  . PHE A 1 19 ? -3.725  -0.408  1.762   1.00 0.00 ? 19 PHE A CD2  10 
ATOM 8299  C CE1  . PHE A 1 19 ? -1.894  -0.681  3.833   1.00 0.00 ? 19 PHE A CE1  10 
ATOM 8300  C CE2  . PHE A 1 19 ? -2.905  -1.557  1.841   1.00 0.00 ? 19 PHE A CE2  10 
ATOM 8301  C CZ   . PHE A 1 19 ? -1.977  -1.666  2.864   1.00 0.00 ? 19 PHE A CZ   10 
ATOM 8302  H H    . PHE A 1 19 ? -4.841  1.328   5.397   1.00 0.00 ? 19 PHE A H    10 
ATOM 8303  H HA   . PHE A 1 19 ? -6.107  3.020   3.316   1.00 0.00 ? 19 PHE A HA   10 
ATOM 8304  H HB2  . PHE A 1 19 ? -4.988  1.772   1.554   1.00 0.00 ? 19 PHE A HB2  10 
ATOM 8305  H HB3  . PHE A 1 19 ? -3.847  2.799   2.391   1.00 0.00 ? 19 PHE A HB3  10 
ATOM 8306  H HD1  . PHE A 1 19 ? -2.605  1.092   4.630   1.00 0.00 ? 19 PHE A HD1  10 
ATOM 8307  H HD2  . PHE A 1 19 ? -4.479  -0.219  0.992   1.00 0.00 ? 19 PHE A HD2  10 
ATOM 8308  H HE1  . PHE A 1 19 ? -1.195  -0.780  4.653   1.00 0.00 ? 19 PHE A HE1  10 
ATOM 8309  H HE2  . PHE A 1 19 ? -2.892  -2.427  1.175   1.00 0.00 ? 19 PHE A HE2  10 
ATOM 8310  H HZ   . PHE A 1 19 ? -1.320  -2.527  2.897   1.00 0.00 ? 19 PHE A HZ   10 
ATOM 8311  N N    . ARG A 1 20 ? -7.748  1.194   2.919   1.00 0.00 ? 20 ARG A N    10 
ATOM 8312  C CA   . ARG A 1 20 ? -8.811  0.186   2.901   1.00 0.00 ? 20 ARG A CA   10 
ATOM 8313  C C    . ARG A 1 20 ? -8.759  -0.569  1.549   1.00 0.00 ? 20 ARG A C    10 
ATOM 8314  O O    . ARG A 1 20 ? -8.905  0.033   0.491   1.00 0.00 ? 20 ARG A O    10 
ATOM 8315  C CB   . ARG A 1 20 ? -10.159 0.932   3.119   1.00 0.00 ? 20 ARG A CB   10 
ATOM 8316  C CG   . ARG A 1 20 ? -11.389 0.077   3.523   1.00 0.00 ? 20 ARG A CG   10 
ATOM 8317  C CD   . ARG A 1 20 ? -12.747 0.657   2.991   1.00 0.00 ? 20 ARG A CD   10 
ATOM 8318  N NE   . ARG A 1 20 ? -12.687 0.952   1.537   1.00 0.00 ? 20 ARG A NE   10 
ATOM 8319  C CZ   . ARG A 1 20 ? -12.531 -0.027  0.622   1.00 0.00 ? 20 ARG A CZ   10 
ATOM 8320  N NH1  . ARG A 1 20 ? -12.498 -1.299  0.970   1.00 0.00 ? 20 ARG A NH1  10 
ATOM 8321  N NH2  . ARG A 1 20 ? -12.391 0.255   -0.656  1.00 0.00 ? 20 ARG A NH2  10 
ATOM 8322  H H    . ARG A 1 20 ? -7.896  2.084   2.479   1.00 0.00 ? 20 ARG A H    10 
ATOM 8323  H HA   . ARG A 1 20 ? -8.586  -0.511  3.710   1.00 0.00 ? 20 ARG A HA   10 
ATOM 8324  H HB2  . ARG A 1 20 ? -10.030 1.685   3.898   1.00 0.00 ? 20 ARG A HB2  10 
ATOM 8325  H HB3  . ARG A 1 20 ? -10.369 1.508   2.218   1.00 0.00 ? 20 ARG A HB3  10 
ATOM 8326  H HG2  . ARG A 1 20 ? -11.267 -0.937  3.151   1.00 0.00 ? 20 ARG A HG2  10 
ATOM 8327  H HG3  . ARG A 1 20 ? -11.386 -0.058  4.620   1.00 0.00 ? 20 ARG A HG3  10 
ATOM 8328  H HD2  . ARG A 1 20 ? -13.592 -0.037  3.154   1.00 0.00 ? 20 ARG A HD2  10 
ATOM 8329  H HD3  . ARG A 1 20 ? -13.030 1.592   3.496   1.00 0.00 ? 20 ARG A HD3  10 
ATOM 8330  H HE   . ARG A 1 20 ? -12.693 1.871   1.094   1.00 0.00 ? 20 ARG A HE   10 
ATOM 8331  H HH11 . ARG A 1 20 ? -12.631 -1.572  1.919   1.00 0.00 ? 20 ARG A HH11 10 
ATOM 8332  H HH12 . ARG A 1 20 ? -12.324 -1.970  0.236   1.00 0.00 ? 20 ARG A HH12 10 
ATOM 8333  H HH21 . ARG A 1 20 ? -12.440 1.209   -1.001  1.00 0.00 ? 20 ARG A HH21 10 
ATOM 8334  H HH22 . ARG A 1 20 ? -12.205 -0.492  -1.305  1.00 0.00 ? 20 ARG A HH22 10 
ATOM 8335  N N    . PHE A 1 21 ? -8.524  -1.897  1.646   1.00 0.00 ? 21 PHE A N    10 
ATOM 8336  C CA   . PHE A 1 21 ? -8.402  -2.783  0.484   1.00 0.00 ? 21 PHE A CA   10 
ATOM 8337  C C    . PHE A 1 21 ? -9.215  -4.058  0.786   1.00 0.00 ? 21 PHE A C    10 
ATOM 8338  O O    . PHE A 1 21 ? -9.285  -4.506  1.919   1.00 0.00 ? 21 PHE A O    10 
ATOM 8339  C CB   . PHE A 1 21 ? -6.904  -3.085  0.284   1.00 0.00 ? 21 PHE A CB   10 
ATOM 8340  C CG   . PHE A 1 21 ? -6.610  -4.238  -0.640  1.00 0.00 ? 21 PHE A CG   10 
ATOM 8341  C CD1  . PHE A 1 21 ? -7.063  -4.228  -1.947  1.00 0.00 ? 21 PHE A CD1  10 
ATOM 8342  C CD2  . PHE A 1 21 ? -5.851  -5.316  -0.209  1.00 0.00 ? 21 PHE A CD2  10 
ATOM 8343  C CE1  . PHE A 1 21 ? -6.697  -5.220  -2.847  1.00 0.00 ? 21 PHE A CE1  10 
ATOM 8344  C CE2  . PHE A 1 21 ? -5.487  -6.322  -1.094  1.00 0.00 ? 21 PHE A CE2  10 
ATOM 8345  C CZ   . PHE A 1 21 ? -5.892  -6.268  -2.421  1.00 0.00 ? 21 PHE A CZ   10 
ATOM 8346  H H    . PHE A 1 21 ? -8.419  -2.337  2.551   1.00 0.00 ? 21 PHE A H    10 
ATOM 8347  H HA   . PHE A 1 21 ? -8.825  -2.317  -0.415  1.00 0.00 ? 21 PHE A HA   10 
ATOM 8348  H HB2  . PHE A 1 21 ? -6.399  -2.198  -0.108  1.00 0.00 ? 21 PHE A HB2  10 
ATOM 8349  H HB3  . PHE A 1 21 ? -6.433  -3.331  1.234   1.00 0.00 ? 21 PHE A HB3  10 
ATOM 8350  H HD1  . PHE A 1 21 ? -7.734  -3.440  -2.225  1.00 0.00 ? 21 PHE A HD1  10 
ATOM 8351  H HD2  . PHE A 1 21 ? -5.565  -5.372  0.829   1.00 0.00 ? 21 PHE A HD2  10 
ATOM 8352  H HE1  . PHE A 1 21 ? -7.047  -5.179  -3.868  1.00 0.00 ? 21 PHE A HE1  10 
ATOM 8353  H HE2  . PHE A 1 21 ? -4.892  -7.149  -0.747  1.00 0.00 ? 21 PHE A HE2  10 
ATOM 8354  H HZ   . PHE A 1 21 ? -5.594  -7.045  -3.109  1.00 0.00 ? 21 PHE A HZ   10 
ATOM 8355  N N    . GLN A 1 22 ? -9.856  -4.604  -0.259  1.00 0.00 ? 22 GLN A N    10 
ATOM 8356  C CA   . GLN A 1 22 ? -10.700 -5.800  -0.169  1.00 0.00 ? 22 GLN A CA   10 
ATOM 8357  C C    . GLN A 1 22 ? -11.832 -5.690  0.891   1.00 0.00 ? 22 GLN A C    10 
ATOM 8358  O O    . GLN A 1 22 ? -12.408 -6.692  1.289   1.00 0.00 ? 22 GLN A O    10 
ATOM 8359  C CB   . GLN A 1 22 ? -9.898  -7.110  0.113   1.00 0.00 ? 22 GLN A CB   10 
ATOM 8360  C CG   . GLN A 1 22 ? -8.834  -7.523  -0.932  1.00 0.00 ? 22 GLN A CG   10 
ATOM 8361  C CD   . GLN A 1 22 ? -7.860  -8.609  -0.431  1.00 0.00 ? 22 GLN A CD   10 
ATOM 8362  O OE1  . GLN A 1 22 ? -7.563  -9.552  -1.153  1.00 0.00 ? 22 GLN A OE1  10 
ATOM 8363  N NE2  . GLN A 1 22 ? -7.375  -8.465  0.807   1.00 0.00 ? 22 GLN A NE2  10 
ATOM 8364  H H    . GLN A 1 22 ? -9.762  -4.152  -1.151  1.00 0.00 ? 22 GLN A H    10 
ATOM 8365  H HA   . GLN A 1 22 ? -11.200 -5.796  -1.134  1.00 0.00 ? 22 GLN A HA   10 
ATOM 8366  H HB2  . GLN A 1 22 ? -9.436  -7.000  1.095   1.00 0.00 ? 22 GLN A HB2  10 
ATOM 8367  H HB3  . GLN A 1 22 ? -10.590 -7.950  0.196   1.00 0.00 ? 22 GLN A HB3  10 
ATOM 8368  H HG2  . GLN A 1 22 ? -9.280  -8.013  -1.821  1.00 0.00 ? 22 GLN A HG2  10 
ATOM 8369  H HG3  . GLN A 1 22 ? -8.259  -6.629  -1.203  1.00 0.00 ? 22 GLN A HG3  10 
ATOM 8370  H HE21 . GLN A 1 22 ? -7.551  -7.726  1.464   1.00 0.00 ? 22 GLN A HE21 10 
ATOM 8371  H HE22 . GLN A 1 22 ? -6.742  -9.164  1.153   1.00 0.00 ? 22 GLN A HE22 10 
ATOM 8372  N N    . GLY A 1 23 ? -12.124 -4.448  1.332   1.00 0.00 ? 23 GLY A N    10 
ATOM 8373  C CA   . GLY A 1 23 ? -13.164 -4.256  2.349   1.00 0.00 ? 23 GLY A CA   10 
ATOM 8374  C C    . GLY A 1 23 ? -12.598 -4.220  3.783   1.00 0.00 ? 23 GLY A C    10 
ATOM 8375  O O    . GLY A 1 23 ? -13.328 -4.016  4.743   1.00 0.00 ? 23 GLY A O    10 
ATOM 8376  H H    . GLY A 1 23 ? -11.583 -3.703  0.949   1.00 0.00 ? 23 GLY A H    10 
ATOM 8377  H HA2  . GLY A 1 23 ? -13.662 -3.308  2.134   1.00 0.00 ? 23 GLY A HA2  10 
ATOM 8378  H HA3  . GLY A 1 23 ? -13.898 -5.066  2.275   1.00 0.00 ? 23 GLY A HA3  10 
ATOM 8379  N N    . THR A 1 24 ? -11.271 -4.408  3.863   1.00 0.00 ? 24 THR A N    10 
ATOM 8380  C CA   . THR A 1 24 ? -10.535 -4.461  5.118   1.00 0.00 ? 24 THR A CA   10 
ATOM 8381  C C    . THR A 1 24 ? -9.612  -3.238  5.227   1.00 0.00 ? 24 THR A C    10 
ATOM 8382  O O    . THR A 1 24 ? -9.008  -2.802  4.255   1.00 0.00 ? 24 THR A O    10 
ATOM 8383  C CB   . THR A 1 24 ? -9.690  -5.749  5.073   1.00 0.00 ? 24 THR A CB   10 
ATOM 8384  O OG1  . THR A 1 24 ? -10.576 -6.815  4.767   1.00 0.00 ? 24 THR A OG1  10 
ATOM 8385  C CG2  . THR A 1 24 ? -8.951  -6.030  6.393   1.00 0.00 ? 24 THR A CG2  10 
ATOM 8386  H H    . THR A 1 24 ? -10.727 -4.576  3.044   1.00 0.00 ? 24 THR A H    10 
ATOM 8387  H HA   . THR A 1 24 ? -11.244 -4.483  5.948   1.00 0.00 ? 24 THR A HA   10 
ATOM 8388  H HB   . THR A 1 24 ? -8.958  -5.642  4.262   1.00 0.00 ? 24 THR A HB   10 
ATOM 8389  H HG1  . THR A 1 24 ? -10.095 -7.623  4.620   1.00 0.00 ? 24 THR A HG1  10 
ATOM 8390  H HG21 . THR A 1 24 ? -8.264  -5.221  6.646   1.00 0.00 ? 24 THR A HG21 10 
ATOM 8391  H HG22 . THR A 1 24 ? -8.351  -6.939  6.337   1.00 0.00 ? 24 THR A HG22 10 
ATOM 8392  H HG23 . THR A 1 24 ? -9.652  -6.141  7.220   1.00 0.00 ? 24 THR A HG23 10 
ATOM 8393  N N    . SER A 1 25 ? -9.522  -2.723  6.464   1.00 0.00 ? 25 SER A N    10 
ATOM 8394  C CA   . SER A 1 25 ? -8.633  -1.617  6.775   1.00 0.00 ? 25 SER A CA   10 
ATOM 8395  C C    . SER A 1 25 ? -7.259  -2.212  7.140   1.00 0.00 ? 25 SER A C    10 
ATOM 8396  O O    . SER A 1 25 ? -7.157  -3.120  7.954   1.00 0.00 ? 25 SER A O    10 
ATOM 8397  C CB   . SER A 1 25 ? -9.251  -0.849  7.953   1.00 0.00 ? 25 SER A CB   10 
ATOM 8398  O OG   . SER A 1 25 ? -10.070 -1.737  8.712   1.00 0.00 ? 25 SER A OG   10 
ATOM 8399  H H    . SER A 1 25 ? -10.019 -3.073  7.261   1.00 0.00 ? 25 SER A H    10 
ATOM 8400  H HA   . SER A 1 25 ? -8.538  -0.973  5.900   1.00 0.00 ? 25 SER A HA   10 
ATOM 8401  H HB2  . SER A 1 25 ? -8.470  -0.391  8.574   1.00 0.00 ? 25 SER A HB2  10 
ATOM 8402  H HB3  . SER A 1 25 ? -9.874  -0.041  7.557   1.00 0.00 ? 25 SER A HB3  10 
ATOM 8403  H HG   . SER A 1 25 ? -10.400 -1.315  9.502   1.00 0.00 ? 25 SER A HG   10 
ATOM 8404  N N    . TYR A 1 26 ? -6.223  -1.660  6.484   1.00 0.00 ? 26 TYR A N    10 
ATOM 8405  C CA   . TYR A 1 26 ? -4.855  -2.106  6.704   1.00 0.00 ? 26 TYR A CA   10 
ATOM 8406  C C    . TYR A 1 26 ? -4.006  -0.920  7.160   1.00 0.00 ? 26 TYR A C    10 
ATOM 8407  O O    . TYR A 1 26 ? -4.034  0.140   6.551   1.00 0.00 ? 26 TYR A O    10 
ATOM 8408  C CB   . TYR A 1 26 ? -4.242  -2.575  5.385   1.00 0.00 ? 26 TYR A CB   10 
ATOM 8409  C CG   . TYR A 1 26 ? -4.895  -3.796  4.817   1.00 0.00 ? 26 TYR A CG   10 
ATOM 8410  C CD1  . TYR A 1 26 ? -4.458  -5.058  5.191   1.00 0.00 ? 26 TYR A CD1  10 
ATOM 8411  C CD2  . TYR A 1 26 ? -5.911  -3.688  3.879   1.00 0.00 ? 26 TYR A CD2  10 
ATOM 8412  C CE1  . TYR A 1 26 ? -5.007  -6.190  4.616   1.00 0.00 ? 26 TYR A CE1  10 
ATOM 8413  C CE2  . TYR A 1 26 ? -6.444  -4.828  3.302   1.00 0.00 ? 26 TYR A CE2  10 
ATOM 8414  C CZ   . TYR A 1 26 ? -6.002  -6.082  3.663   1.00 0.00 ? 26 TYR A CZ   10 
ATOM 8415  O OH   . TYR A 1 26 ? -6.551  -7.194  3.055   1.00 0.00 ? 26 TYR A OH   10 
ATOM 8416  H H    . TYR A 1 26 ? -6.361  -0.925  5.816   1.00 0.00 ? 26 TYR A H    10 
ATOM 8417  H HA   . TYR A 1 26 ? -4.828  -2.895  7.459   1.00 0.00 ? 26 TYR A HA   10 
ATOM 8418  H HB2  . TYR A 1 26 ? -4.313  -1.776  4.640   1.00 0.00 ? 26 TYR A HB2  10 
ATOM 8419  H HB3  . TYR A 1 26 ? -3.187  -2.815  5.546   1.00 0.00 ? 26 TYR A HB3  10 
ATOM 8420  H HD1  . TYR A 1 26 ? -3.676  -5.165  5.923   1.00 0.00 ? 26 TYR A HD1  10 
ATOM 8421  H HD2  . TYR A 1 26 ? -6.285  -2.717  3.584   1.00 0.00 ? 26 TYR A HD2  10 
ATOM 8422  H HE1  . TYR A 1 26 ? -4.635  -7.154  4.893   1.00 0.00 ? 26 TYR A HE1  10 
ATOM 8423  H HE2  . TYR A 1 26 ? -7.181  -4.749  2.528   1.00 0.00 ? 26 TYR A HE2  10 
ATOM 8424  H HH   . TYR A 1 26 ? -5.880  -7.884  2.969   1.00 0.00 ? 26 TYR A HH   10 
ATOM 8425  N N    . ASP A 1 27 ? -3.221  -1.185  8.215   1.00 0.00 ? 27 ASP A N    10 
ATOM 8426  C CA   . ASP A 1 27 ? -2.293  -0.193  8.751   1.00 0.00 ? 27 ASP A CA   10 
ATOM 8427  C C    . ASP A 1 27 ? -0.879  -0.793  8.744   1.00 0.00 ? 27 ASP A C    10 
ATOM 8428  O O    . ASP A 1 27 ? -0.083  -0.548  9.642   1.00 0.00 ? 27 ASP A O    10 
ATOM 8429  C CB   . ASP A 1 27 ? -2.717  0.184   10.180  1.00 0.00 ? 27 ASP A CB   10 
ATOM 8430  C CG   . ASP A 1 27 ? -4.011  1.002   10.156  1.00 0.00 ? 27 ASP A CG   10 
ATOM 8431  O OD1  . ASP A 1 27 ? -5.088  0.408   10.191  1.00 0.00 ? 27 ASP A OD1  10 
ATOM 8432  O OD2  . ASP A 1 27 ? -3.924  2.228   10.093  1.00 0.00 ? 27 ASP A OD2  10 
ATOM 8433  H H    . ASP A 1 27 ? -3.276  -2.076  8.661   1.00 0.00 ? 27 ASP A H    10 
ATOM 8434  H HA   . ASP A 1 27 ? -2.291  0.699   8.119   1.00 0.00 ? 27 ASP A HA   10 
ATOM 8435  H HB2  . ASP A 1 27 ? -2.858  -0.705  10.796  1.00 0.00 ? 27 ASP A HB2  10 
ATOM 8436  H HB3  . ASP A 1 27 ? -1.947  0.785   10.667  1.00 0.00 ? 27 ASP A HB3  10 
ATOM 8437  N N    . SER A 1 28 ? -0.611  -1.614  7.703   1.00 0.00 ? 28 SER A N    10 
ATOM 8438  C CA   . SER A 1 28 ? 0.691   -2.259  7.644   1.00 0.00 ? 28 SER A CA   10 
ATOM 8439  C C    . SER A 1 28 ? 0.962   -2.747  6.217   1.00 0.00 ? 28 SER A C    10 
ATOM 8440  O O    . SER A 1 28 ? 0.048   -2.846  5.403   1.00 0.00 ? 28 SER A O    10 
ATOM 8441  C CB   . SER A 1 28 ? 0.695   -3.449  8.634   1.00 0.00 ? 28 SER A CB   10 
ATOM 8442  O OG   . SER A 1 28 ? -0.423  -4.294  8.393   1.00 0.00 ? 28 SER A OG   10 
ATOM 8443  H H    . SER A 1 28 ? -1.251  -1.827  6.966   1.00 0.00 ? 28 SER A H    10 
ATOM 8444  H HA   . SER A 1 28 ? 1.433   -1.490  7.860   1.00 0.00 ? 28 SER A HA   10 
ATOM 8445  H HB2  . SER A 1 28 ? 1.638   -4.033  8.551   1.00 0.00 ? 28 SER A HB2  10 
ATOM 8446  H HB3  . SER A 1 28 ? 0.561   -3.073  9.668   1.00 0.00 ? 28 SER A HB3  10 
ATOM 8447  H HG   . SER A 1 28 ? -0.386  -4.631  7.502   1.00 0.00 ? 28 SER A HG   10 
ATOM 8448  N N    . CYS A 1 29 ? 2.250   -3.055  5.968   1.00 0.00 ? 29 CYS A N    10 
ATOM 8449  C CA   . CYS A 1 29 ? 2.678   -3.563  4.664   1.00 0.00 ? 29 CYS A CA   10 
ATOM 8450  C C    . CYS A 1 29 ? 1.997   -4.909  4.342   1.00 0.00 ? 29 CYS A C    10 
ATOM 8451  O O    . CYS A 1 29 ? 2.016   -5.801  5.184   1.00 0.00 ? 29 CYS A O    10 
ATOM 8452  C CB   . CYS A 1 29 ? 4.184   -3.837  4.727   1.00 0.00 ? 29 CYS A CB   10 
ATOM 8453  S SG   . CYS A 1 29 ? 5.174   -2.387  5.137   1.00 0.00 ? 29 CYS A SG   10 
ATOM 8454  H H    . CYS A 1 29 ? 2.928   -2.952  6.712   1.00 0.00 ? 29 CYS A H    10 
ATOM 8455  H HA   . CYS A 1 29 ? 2.448   -2.806  3.913   1.00 0.00 ? 29 CYS A HA   10 
ATOM 8456  H HB2  . CYS A 1 29 ? 4.406   -4.617  5.464   1.00 0.00 ? 29 CYS A HB2  10 
ATOM 8457  H HB3  . CYS A 1 29 ? 4.520   -4.196  3.750   1.00 0.00 ? 29 CYS A HB3  10 
ATOM 8458  N N    . THR A 1 30 ? 1.433   -5.055  3.116   1.00 0.00 ? 30 THR A N    10 
ATOM 8459  C CA   . THR A 1 30 ? 0.821   -6.342  2.749   1.00 0.00 ? 30 THR A CA   10 
ATOM 8460  C C    . THR A 1 30 ? 1.419   -6.870  1.435   1.00 0.00 ? 30 THR A C    10 
ATOM 8461  O O    . THR A 1 30 ? 1.972   -6.131  0.630   1.00 0.00 ? 30 THR A O    10 
ATOM 8462  C CB   . THR A 1 30 ? -0.717  -6.259  2.687   1.00 0.00 ? 30 THR A CB   10 
ATOM 8463  O OG1  . THR A 1 30 ? -1.186  -7.591  2.521   1.00 0.00 ? 30 THR A OG1  10 
ATOM 8464  C CG2  . THR A 1 30 ? -1.233  -5.374  1.531   1.00 0.00 ? 30 THR A CG2  10 
ATOM 8465  H H    . THR A 1 30 ? 1.438   -4.324  2.423   1.00 0.00 ? 30 THR A H    10 
ATOM 8466  H HA   . THR A 1 30 ? 1.070   -7.077  3.514   1.00 0.00 ? 30 THR A HA   10 
ATOM 8467  H HB   . THR A 1 30 ? -1.053  -5.868  3.661   1.00 0.00 ? 30 THR A HB   10 
ATOM 8468  H HG1  . THR A 1 30 ? -2.142  -7.636  2.646   1.00 0.00 ? 30 THR A HG1  10 
ATOM 8469  H HG21 . THR A 1 30 ? -1.009  -5.825  0.563   1.00 0.00 ? 30 THR A HG21 10 
ATOM 8470  H HG22 . THR A 1 30 ? -0.772  -4.385  1.534   1.00 0.00 ? 30 THR A HG22 10 
ATOM 8471  H HG23 . THR A 1 30 ? -2.314  -5.233  1.572   1.00 0.00 ? 30 THR A HG23 10 
ATOM 8472  N N    . THR A 1 31 ? 1.246   -8.198  1.284   1.00 0.00 ? 31 THR A N    10 
ATOM 8473  C CA   . THR A 1 31 ? 1.647   -8.934  0.090   1.00 0.00 ? 31 THR A CA   10 
ATOM 8474  C C    . THR A 1 31 ? 0.407   -9.241  -0.784  1.00 0.00 ? 31 THR A C    10 
ATOM 8475  O O    . THR A 1 31 ? 0.528   -9.661  -1.928  1.00 0.00 ? 31 THR A O    10 
ATOM 8476  C CB   . THR A 1 31 ? 2.315   -10.276 0.499   1.00 0.00 ? 31 THR A CB   10 
ATOM 8477  O OG1  . THR A 1 31 ? 2.332   -10.414 1.927   1.00 0.00 ? 31 THR A OG1  10 
ATOM 8478  C CG2  . THR A 1 31 ? 3.745   -10.379 -0.049  1.00 0.00 ? 31 THR A CG2  10 
ATOM 8479  H H    . THR A 1 31 ? 0.790   -8.698  2.022   1.00 0.00 ? 31 THR A H    10 
ATOM 8480  H HA   . THR A 1 31 ? 2.330   -8.310  -0.491  1.00 0.00 ? 31 THR A HA   10 
ATOM 8481  H HB   . THR A 1 31 ? 1.755   -11.105 0.036   1.00 0.00 ? 31 THR A HB   10 
ATOM 8482  H HG1  . THR A 1 31 ? 2.337   -11.343 2.171   1.00 0.00 ? 31 THR A HG1  10 
ATOM 8483  H HG21 . THR A 1 31 ? 4.240   -11.300 0.257   1.00 0.00 ? 31 THR A HG21 10 
ATOM 8484  H HG22 . THR A 1 31 ? 4.357   -9.545  0.275   1.00 0.00 ? 31 THR A HG22 10 
ATOM 8485  H HG23 . THR A 1 31 ? 3.744   -10.352 -1.140  1.00 0.00 ? 31 THR A HG23 10 
ATOM 8486  N N    . GLU A 1 32 ? -0.787  -9.070  -0.178  1.00 0.00 ? 32 GLU A N    10 
ATOM 8487  C CA   . GLU A 1 32 ? -2.015  -9.455  -0.871  1.00 0.00 ? 32 GLU A CA   10 
ATOM 8488  C C    . GLU A 1 32 ? -2.163  -8.712  -2.209  1.00 0.00 ? 32 GLU A C    10 
ATOM 8489  O O    . GLU A 1 32 ? -2.202  -7.492  -2.256  1.00 0.00 ? 32 GLU A O    10 
ATOM 8490  C CB   . GLU A 1 32 ? -3.217  -9.121  0.016   1.00 0.00 ? 32 GLU A CB   10 
ATOM 8491  C CG   . GLU A 1 32 ? -3.313  -9.974  1.290   1.00 0.00 ? 32 GLU A CG   10 
ATOM 8492  C CD   . GLU A 1 32 ? -4.257  -9.271  2.268   1.00 0.00 ? 32 GLU A CD   10 
ATOM 8493  O OE1  . GLU A 1 32 ? -3.869  -8.245  2.813   1.00 0.00 ? 32 GLU A OE1  10 
ATOM 8494  O OE2  . GLU A 1 32 ? -5.382  -9.718  2.464   1.00 0.00 ? 32 GLU A OE2  10 
ATOM 8495  H H    . GLU A 1 32 ? -0.861  -8.687  0.746   1.00 0.00 ? 32 GLU A H    10 
ATOM 8496  H HA   . GLU A 1 32 ? -1.959  -10.530 -1.045  1.00 0.00 ? 32 GLU A HA   10 
ATOM 8497  H HB2  . GLU A 1 32 ? -3.156  -8.061  0.269   1.00 0.00 ? 32 GLU A HB2  10 
ATOM 8498  H HB3  . GLU A 1 32 ? -4.146  -9.252  -0.542  1.00 0.00 ? 32 GLU A HB3  10 
ATOM 8499  H HG2  . GLU A 1 32 ? -3.693  -10.971 1.063   1.00 0.00 ? 32 GLU A HG2  10 
ATOM 8500  H HG3  . GLU A 1 32 ? -2.346  -10.104 1.776   1.00 0.00 ? 32 GLU A HG3  10 
ATOM 8501  N N    . GLY A 1 33 ? -2.248  -9.522  -3.280  1.00 0.00 ? 33 GLY A N    10 
ATOM 8502  C CA   . GLY A 1 33 ? -2.414  -8.965  -4.618  1.00 0.00 ? 33 GLY A CA   10 
ATOM 8503  C C    . GLY A 1 33 ? -1.135  -9.056  -5.457  1.00 0.00 ? 33 GLY A C    10 
ATOM 8504  O O    . GLY A 1 33 ? -1.175  -8.836  -6.660  1.00 0.00 ? 33 GLY A O    10 
ATOM 8505  H H    . GLY A 1 33 ? -2.196  -10.511 -3.147  1.00 0.00 ? 33 GLY A H    10 
ATOM 8506  H HA2  . GLY A 1 33 ? -3.195  -9.557  -5.103  1.00 0.00 ? 33 GLY A HA2  10 
ATOM 8507  H HA3  . GLY A 1 33 ? -2.737  -7.921  -4.559  1.00 0.00 ? 33 GLY A HA3  10 
ATOM 8508  N N    . ARG A 1 34 ? -0.011  -9.396  -4.790  1.00 0.00 ? 34 ARG A N    10 
ATOM 8509  C CA   . ARG A 1 34 ? 1.243   -9.528  -5.559  1.00 0.00 ? 34 ARG A CA   10 
ATOM 8510  C C    . ARG A 1 34 ? 1.750   -10.968 -5.437  1.00 0.00 ? 34 ARG A C    10 
ATOM 8511  O O    . ARG A 1 34 ? 1.575   -11.630 -4.423  1.00 0.00 ? 34 ARG A O    10 
ATOM 8512  C CB   . ARG A 1 34 ? 2.312   -8.588  -4.991  1.00 0.00 ? 34 ARG A CB   10 
ATOM 8513  C CG   . ARG A 1 34 ? 1.905   -7.110  -5.069  1.00 0.00 ? 34 ARG A CG   10 
ATOM 8514  C CD   . ARG A 1 34 ? 3.133   -6.181  -4.981  1.00 0.00 ? 34 ARG A CD   10 
ATOM 8515  N NE   . ARG A 1 34 ? 3.801   -6.158  -6.293  1.00 0.00 ? 34 ARG A NE   10 
ATOM 8516  C CZ   . ARG A 1 34 ? 3.531   -5.228  -7.238  1.00 0.00 ? 34 ARG A CZ   10 
ATOM 8517  N NH1  . ARG A 1 34 ? 2.649   -4.264  -7.003  1.00 0.00 ? 34 ARG A NH1  10 
ATOM 8518  N NH2  . ARG A 1 34 ? 4.150   -5.287  -8.409  1.00 0.00 ? 34 ARG A NH2  10 
ATOM 8519  H H    . ARG A 1 34 ? -0.045  -9.562  -3.785  1.00 0.00 ? 34 ARG A H    10 
ATOM 8520  H HA   . ARG A 1 34 ? 1.107   -9.296  -6.639  1.00 0.00 ? 34 ARG A HA   10 
ATOM 8521  H HB2  . ARG A 1 34 ? 2.490   -8.849  -3.917  1.00 0.00 ? 34 ARG A HB2  10 
ATOM 8522  H HB3  . ARG A 1 34 ? 3.207   -8.729  -5.634  1.00 0.00 ? 34 ARG A HB3  10 
ATOM 8523  H HG2  . ARG A 1 34 ? 1.381   -6.918  -6.006  1.00 0.00 ? 34 ARG A HG2  10 
ATOM 8524  H HG3  . ARG A 1 34 ? 1.171   -6.904  -4.287  1.00 0.00 ? 34 ARG A HG3  10 
ATOM 8525  H HD2  . ARG A 1 34 ? 2.859   -5.156  -4.703  1.00 0.00 ? 34 ARG A HD2  10 
ATOM 8526  H HD3  . ARG A 1 34 ? 3.859   -6.541  -4.235  1.00 0.00 ? 34 ARG A HD3  10 
ATOM 8527  H HE   . ARG A 1 34 ? 4.442   -6.897  -6.567  1.00 0.00 ? 34 ARG A HE   10 
ATOM 8528  H HH11 . ARG A 1 34 ? 2.143   -4.265  -6.142  1.00 0.00 ? 34 ARG A HH11 10 
ATOM 8529  H HH12 . ARG A 1 34 ? 2.466   -3.517  -7.659  1.00 0.00 ? 34 ARG A HH12 10 
ATOM 8530  H HH21 . ARG A 1 34 ? 4.778   -6.064  -8.571  1.00 0.00 ? 34 ARG A HH21 10 
ATOM 8531  H HH22 . ARG A 1 34 ? 4.011   -4.610  -9.128  1.00 0.00 ? 34 ARG A HH22 10 
ATOM 8532  N N    . THR A 1 35 ? 2.400   -11.399 -6.531  1.00 0.00 ? 35 THR A N    10 
ATOM 8533  C CA   . THR A 1 35 ? 2.993   -12.729 -6.595  1.00 0.00 ? 35 THR A CA   10 
ATOM 8534  C C    . THR A 1 35 ? 4.450   -12.633 -7.092  1.00 0.00 ? 35 THR A C    10 
ATOM 8535  O O    . THR A 1 35 ? 5.016   -13.591 -7.597  1.00 0.00 ? 35 THR A O    10 
ATOM 8536  C CB   . THR A 1 35 ? 2.103   -13.594 -7.506  1.00 0.00 ? 35 THR A CB   10 
ATOM 8537  O OG1  . THR A 1 35 ? 0.743   -13.241 -7.338  1.00 0.00 ? 35 THR A OG1  10 
ATOM 8538  C CG2  . THR A 1 35 ? 2.281   -15.097 -7.266  1.00 0.00 ? 35 THR A CG2  10 
ATOM 8539  H H    . THR A 1 35 ? 2.469   -10.814 -7.336  1.00 0.00 ? 35 THR A H    10 
ATOM 8540  H HA   . THR A 1 35 ? 3.027   -13.144 -5.585  1.00 0.00 ? 35 THR A HA   10 
ATOM 8541  H HB   . THR A 1 35 ? 2.343   -13.381 -8.550  1.00 0.00 ? 35 THR A HB   10 
ATOM 8542  H HG1  . THR A 1 35 ? 0.516   -13.299 -6.415  1.00 0.00 ? 35 THR A HG1  10 
ATOM 8543  H HG21 . THR A 1 35 ? 2.087   -15.365 -6.228  1.00 0.00 ? 35 THR A HG21 10 
ATOM 8544  H HG22 . THR A 1 35 ? 3.297   -15.411 -7.504  1.00 0.00 ? 35 THR A HG22 10 
ATOM 8545  H HG23 . THR A 1 35 ? 1.600   -15.669 -7.897  1.00 0.00 ? 35 THR A HG23 10 
ATOM 8546  N N    . ASP A 1 36 ? 5.009   -11.416 -6.926  1.00 0.00 ? 36 ASP A N    10 
ATOM 8547  C CA   . ASP A 1 36 ? 6.360   -11.102 -7.390  1.00 0.00 ? 36 ASP A CA   10 
ATOM 8548  C C    . ASP A 1 36 ? 7.363   -10.910 -6.231  1.00 0.00 ? 36 ASP A C    10 
ATOM 8549  O O    . ASP A 1 36 ? 8.538   -10.649 -6.461  1.00 0.00 ? 36 ASP A O    10 
ATOM 8550  C CB   . ASP A 1 36 ? 6.290   -9.844  -8.275  1.00 0.00 ? 36 ASP A CB   10 
ATOM 8551  C CG   . ASP A 1 36 ? 5.706   -8.606  -7.573  1.00 0.00 ? 36 ASP A CG   10 
ATOM 8552  O OD1  . ASP A 1 36 ? 5.509   -8.615  -6.358  1.00 0.00 ? 36 ASP A OD1  10 
ATOM 8553  O OD2  . ASP A 1 36 ? 5.439   -7.619  -8.252  1.00 0.00 ? 36 ASP A OD2  10 
ATOM 8554  H H    . ASP A 1 36 ? 4.508   -10.645 -6.531  1.00 0.00 ? 36 ASP A H    10 
ATOM 8555  H HA   . ASP A 1 36 ? 6.731   -11.935 -7.990  1.00 0.00 ? 36 ASP A HA   10 
ATOM 8556  H HB2  . ASP A 1 36 ? 7.281   -9.590  -8.653  1.00 0.00 ? 36 ASP A HB2  10 
ATOM 8557  H HB3  . ASP A 1 36 ? 5.665   -10.051 -9.144  1.00 0.00 ? 36 ASP A HB3  10 
ATOM 8558  N N    . GLY A 1 37 ? 6.859   -11.083 -4.987  1.00 0.00 ? 37 GLY A N    10 
ATOM 8559  C CA   . GLY A 1 37 ? 7.729   -11.005 -3.817  1.00 0.00 ? 37 GLY A CA   10 
ATOM 8560  C C    . GLY A 1 37 ? 7.663   -9.674  -3.063  1.00 0.00 ? 37 GLY A C    10 
ATOM 8561  O O    . GLY A 1 37 ? 8.132   -9.584  -1.935  1.00 0.00 ? 37 GLY A O    10 
ATOM 8562  H H    . GLY A 1 37 ? 5.894   -11.289 -4.852  1.00 0.00 ? 37 GLY A H    10 
ATOM 8563  H HA2  . GLY A 1 37 ? 7.432   -11.815 -3.147  1.00 0.00 ? 37 GLY A HA2  10 
ATOM 8564  H HA3  . GLY A 1 37 ? 8.768   -11.153 -4.133  1.00 0.00 ? 37 GLY A HA3  10 
ATOM 8565  N N    . TYR A 1 38 ? 7.108   -8.638  -3.722  1.00 0.00 ? 38 TYR A N    10 
ATOM 8566  C CA   . TYR A 1 38 ? 7.140   -7.316  -3.090  1.00 0.00 ? 38 TYR A CA   10 
ATOM 8567  C C    . TYR A 1 38 ? 5.912   -7.090  -2.203  1.00 0.00 ? 38 TYR A C    10 
ATOM 8568  O O    . TYR A 1 38 ? 4.866   -7.710  -2.346  1.00 0.00 ? 38 TYR A O    10 
ATOM 8569  C CB   . TYR A 1 38 ? 7.365   -6.229  -4.159  1.00 0.00 ? 38 TYR A CB   10 
ATOM 8570  C CG   . TYR A 1 38 ? 8.437   -6.698  -5.111  1.00 0.00 ? 38 TYR A CG   10 
ATOM 8571  C CD1  . TYR A 1 38 ? 9.676   -7.126  -4.654  1.00 0.00 ? 38 TYR A CD1  10 
ATOM 8572  C CD2  . TYR A 1 38 ? 8.190   -6.799  -6.468  1.00 0.00 ? 38 TYR A CD2  10 
ATOM 8573  C CE1  . TYR A 1 38 ? 10.593  -7.698  -5.505  1.00 0.00 ? 38 TYR A CE1  10 
ATOM 8574  C CE2  . TYR A 1 38 ? 9.104   -7.372  -7.322  1.00 0.00 ? 38 TYR A CE2  10 
ATOM 8575  C CZ   . TYR A 1 38 ? 10.311  -7.845  -6.848  1.00 0.00 ? 38 TYR A CZ   10 
ATOM 8576  O OH   . TYR A 1 38 ? 11.205  -8.469  -7.688  1.00 0.00 ? 38 TYR A OH   10 
ATOM 8577  H H    . TYR A 1 38 ? 6.716   -8.748  -4.640  1.00 0.00 ? 38 TYR A H    10 
ATOM 8578  H HA   . TYR A 1 38 ? 8.009   -7.290  -2.428  1.00 0.00 ? 38 TYR A HA   10 
ATOM 8579  H HB2  . TYR A 1 38 ? 6.443   -6.040  -4.711  1.00 0.00 ? 38 TYR A HB2  10 
ATOM 8580  H HB3  . TYR A 1 38 ? 7.658   -5.278  -3.709  1.00 0.00 ? 38 TYR A HB3  10 
ATOM 8581  H HD1  . TYR A 1 38 ? 9.970   -7.068  -3.631  1.00 0.00 ? 38 TYR A HD1  10 
ATOM 8582  H HD2  . TYR A 1 38 ? 7.278   -6.473  -6.912  1.00 0.00 ? 38 TYR A HD2  10 
ATOM 8583  H HE1  . TYR A 1 38 ? 11.503  -8.042  -5.071  1.00 0.00 ? 38 TYR A HE1  10 
ATOM 8584  H HE2  . TYR A 1 38 ? 8.810   -7.448  -8.342  1.00 0.00 ? 38 TYR A HE2  10 
ATOM 8585  H HH   . TYR A 1 38 ? 10.824  -9.297  -7.953  1.00 0.00 ? 38 TYR A HH   10 
ATOM 8586  N N    . ARG A 1 39 ? 6.151   -6.165  -1.260  1.00 0.00 ? 39 ARG A N    10 
ATOM 8587  C CA   . ARG A 1 39 ? 5.116   -5.792  -0.279  1.00 0.00 ? 39 ARG A CA   10 
ATOM 8588  C C    . ARG A 1 39 ? 4.757   -4.347  -0.620  1.00 0.00 ? 39 ARG A C    10 
ATOM 8589  O O    . ARG A 1 39 ? 5.633   -3.554  -0.946  1.00 0.00 ? 39 ARG A O    10 
ATOM 8590  C CB   . ARG A 1 39 ? 5.753   -5.921  1.121   1.00 0.00 ? 39 ARG A CB   10 
ATOM 8591  C CG   . ARG A 1 39 ? 6.248   -7.355  1.397   1.00 0.00 ? 39 ARG A CG   10 
ATOM 8592  C CD   . ARG A 1 39 ? 6.626   -7.599  2.874   1.00 0.00 ? 39 ARG A CD   10 
ATOM 8593  N NE   . ARG A 1 39 ? 5.491   -7.340  3.767   1.00 0.00 ? 39 ARG A NE   10 
ATOM 8594  C CZ   . ARG A 1 39 ? 4.412   -8.160  3.798   1.00 0.00 ? 39 ARG A CZ   10 
ATOM 8595  N NH1  . ARG A 1 39 ? 4.386   -9.231  3.018   1.00 0.00 ? 39 ARG A NH1  10 
ATOM 8596  N NH2  . ARG A 1 39 ? 3.367   -7.908  4.578   1.00 0.00 ? 39 ARG A NH2  10 
ATOM 8597  H H    . ARG A 1 39 ? 7.069   -5.725  -1.292  1.00 0.00 ? 39 ARG A H    10 
ATOM 8598  H HA   . ARG A 1 39 ? 4.183   -6.401  -0.361  1.00 0.00 ? 39 ARG A HA   10 
ATOM 8599  H HB2  . ARG A 1 39 ? 6.606   -5.249  1.202   1.00 0.00 ? 39 ARG A HB2  10 
ATOM 8600  H HB3  . ARG A 1 39 ? 5.059   -5.591  1.896   1.00 0.00 ? 39 ARG A HB3  10 
ATOM 8601  H HG2  . ARG A 1 39 ? 5.448   -8.045  1.136   1.00 0.00 ? 39 ARG A HG2  10 
ATOM 8602  H HG3  . ARG A 1 39 ? 7.097   -7.584  0.730   1.00 0.00 ? 39 ARG A HG3  10 
ATOM 8603  H HD2  . ARG A 1 39 ? 6.971   -8.619  3.060   1.00 0.00 ? 39 ARG A HD2  10 
ATOM 8604  H HD3  . ARG A 1 39 ? 7.435   -6.942  3.192   1.00 0.00 ? 39 ARG A HD3  10 
ATOM 8605  H HE   . ARG A 1 39 ? 5.567   -6.502  4.320   1.00 0.00 ? 39 ARG A HE   10 
ATOM 8606  H HH11 . ARG A 1 39 ? 5.219   -9.501  2.539   1.00 0.00 ? 39 ARG A HH11 10 
ATOM 8607  H HH12 . ARG A 1 39 ? 3.545   -9.763  2.854   1.00 0.00 ? 39 ARG A HH12 10 
ATOM 8608  H HH21 . ARG A 1 39 ? 3.260   -7.046  5.095   1.00 0.00 ? 39 ARG A HH21 10 
ATOM 8609  H HH22 . ARG A 1 39 ? 2.625   -8.570  4.663   1.00 0.00 ? 39 ARG A HH22 10 
ATOM 8610  N N    . TRP A 1 40 ? 3.443   -4.055  -0.590  1.00 0.00 ? 40 TRP A N    10 
ATOM 8611  C CA   . TRP A 1 40 ? 2.969   -2.734  -0.965  1.00 0.00 ? 40 TRP A CA   10 
ATOM 8612  C C    . TRP A 1 40 ? 2.092   -2.145  0.144   1.00 0.00 ? 40 TRP A C    10 
ATOM 8613  O O    . TRP A 1 40 ? 1.621   -2.850  1.034   1.00 0.00 ? 40 TRP A O    10 
ATOM 8614  C CB   . TRP A 1 40 ? 2.212   -2.846  -2.296  1.00 0.00 ? 40 TRP A CB   10 
ATOM 8615  C CG   . TRP A 1 40 ? 0.954   -3.682  -2.150  1.00 0.00 ? 40 TRP A CG   10 
ATOM 8616  C CD1  . TRP A 1 40 ? 0.888   -5.075  -2.234  1.00 0.00 ? 40 TRP A CD1  10 
ATOM 8617  C CD2  . TRP A 1 40 ? -0.399  -3.227  -1.931  1.00 0.00 ? 40 TRP A CD2  10 
ATOM 8618  N NE1  . TRP A 1 40 ? -0.395  -5.473  -2.097  1.00 0.00 ? 40 TRP A NE1  10 
ATOM 8619  C CE2  . TRP A 1 40 ? -1.217  -4.376  -1.909  1.00 0.00 ? 40 TRP A CE2  10 
ATOM 8620  C CE3  . TRP A 1 40 ? -0.964  -1.993  -1.747  1.00 0.00 ? 40 TRP A CE3  10 
ATOM 8621  C CZ2  . TRP A 1 40 ? -2.563  -4.262  -1.723  1.00 0.00 ? 40 TRP A CZ2  10 
ATOM 8622  C CZ3  . TRP A 1 40 ? -2.344  -1.866  -1.551  1.00 0.00 ? 40 TRP A CZ3  10 
ATOM 8623  C CH2  . TRP A 1 40 ? -3.144  -3.010  -1.542  1.00 0.00 ? 40 TRP A CH2  10 
ATOM 8624  H H    . TRP A 1 40 ? 2.744   -4.722  -0.318  1.00 0.00 ? 40 TRP A H    10 
ATOM 8625  H HA   . TRP A 1 40 ? 3.837   -2.095  -1.088  1.00 0.00 ? 40 TRP A HA   10 
ATOM 8626  H HB2  . TRP A 1 40 ? 1.966   -1.861  -2.686  1.00 0.00 ? 40 TRP A HB2  10 
ATOM 8627  H HB3  . TRP A 1 40 ? 2.858   -3.302  -3.046  1.00 0.00 ? 40 TRP A HB3  10 
ATOM 8628  H HD1  . TRP A 1 40 ? 1.726   -5.740  -2.360  1.00 0.00 ? 40 TRP A HD1  10 
ATOM 8629  H HE1  . TRP A 1 40 ? -0.728  -6.397  -2.122  1.00 0.00 ? 40 TRP A HE1  10 
ATOM 8630  H HE3  . TRP A 1 40 ? -0.312  -1.137  -1.740  1.00 0.00 ? 40 TRP A HE3  10 
ATOM 8631  H HZ2  . TRP A 1 40 ? -3.167  -5.155  -1.718  1.00 0.00 ? 40 TRP A HZ2  10 
ATOM 8632  H HZ3  . TRP A 1 40 ? -2.812  -0.899  -1.399  1.00 0.00 ? 40 TRP A HZ3  10 
ATOM 8633  H HH2  . TRP A 1 40 ? -4.213  -2.942  -1.397  1.00 0.00 ? 40 TRP A HH2  10 
ATOM 8634  N N    . CYS A 1 41 ? 1.900   -0.814  0.020   1.00 0.00 ? 41 CYS A N    10 
ATOM 8635  C CA   . CYS A 1 41 ? 1.018   -0.096  0.915   1.00 0.00 ? 41 CYS A CA   10 
ATOM 8636  C C    . CYS A 1 41 ? 0.169   0.838   0.053   1.00 0.00 ? 41 CYS A C    10 
ATOM 8637  O O    . CYS A 1 41 ? 0.668   1.493   -0.857  1.00 0.00 ? 41 CYS A O    10 
ATOM 8638  C CB   . CYS A 1 41 ? 1.818   0.703   1.940   1.00 0.00 ? 41 CYS A CB   10 
ATOM 8639  S SG   . CYS A 1 41 ? 2.936   1.907   1.170   1.00 0.00 ? 41 CYS A SG   10 
ATOM 8640  H H    . CYS A 1 41 ? 2.294   -0.235  -0.704  1.00 0.00 ? 41 CYS A H    10 
ATOM 8641  H HA   . CYS A 1 41 ? 0.365   -0.813  1.416   1.00 0.00 ? 41 CYS A HA   10 
ATOM 8642  H HB2  . CYS A 1 41 ? 1.047   1.277   2.517   1.00 0.00 ? 41 CYS A HB2  10 
ATOM 8643  H HB3  . CYS A 1 41 ? 2.450   -0.022  2.517   1.00 0.00 ? 41 CYS A HB3  10 
ATOM 8644  N N    . GLY A 1 42 ? -1.136  0.873   0.377   1.00 0.00 ? 42 GLY A N    10 
ATOM 8645  C CA   . GLY A 1 42 ? -2.002  1.794   -0.344  1.00 0.00 ? 42 GLY A CA   10 
ATOM 8646  C C    . GLY A 1 42 ? -1.562  3.212   0.018   1.00 0.00 ? 42 GLY A C    10 
ATOM 8647  O O    . GLY A 1 42 ? -0.969  3.431   1.069   1.00 0.00 ? 42 GLY A O    10 
ATOM 8648  H H    . GLY A 1 42 ? -1.490  0.331   1.139   1.00 0.00 ? 42 GLY A H    10 
ATOM 8649  H HA2  . GLY A 1 42 ? -1.911  1.600   -1.416  1.00 0.00 ? 42 GLY A HA2  10 
ATOM 8650  H HA3  . GLY A 1 42 ? -3.028  1.625   -0.017  1.00 0.00 ? 42 GLY A HA3  10 
ATOM 8651  N N    . THR A 1 43 ? -1.849  4.147   -0.900  1.00 0.00 ? 43 THR A N    10 
ATOM 8652  C CA   . THR A 1 43 ? -1.430  5.522   -0.669  1.00 0.00 ? 43 THR A CA   10 
ATOM 8653  C C    . THR A 1 43 ? -2.632  6.475   -0.647  1.00 0.00 ? 43 THR A C    10 
ATOM 8654  O O    . THR A 1 43 ? -2.496  7.679   -0.820  1.00 0.00 ? 43 THR A O    10 
ATOM 8655  C CB   . THR A 1 43 ? -0.422  5.888   -1.758  1.00 0.00 ? 43 THR A CB   10 
ATOM 8656  O OG1  . THR A 1 43 ? 0.414   4.796   -2.077  1.00 0.00 ? 43 THR A OG1  10 
ATOM 8657  C CG2  . THR A 1 43 ? 0.474   7.048   -1.358  1.00 0.00 ? 43 THR A CG2  10 
ATOM 8658  H H    . THR A 1 43 ? -2.307  3.921   -1.761  1.00 0.00 ? 43 THR A H    10 
ATOM 8659  H HA   . THR A 1 43 ? -0.938  5.604   0.301   1.00 0.00 ? 43 THR A HA   10 
ATOM 8660  H HB   . THR A 1 43 ? -0.969  6.148   -2.664  1.00 0.00 ? 43 THR A HB   10 
ATOM 8661  H HG1  . THR A 1 43 ? 0.726   4.389   -1.267  1.00 0.00 ? 43 THR A HG1  10 
ATOM 8662  H HG21 . THR A 1 43 ? 0.613   7.730   -2.188  1.00 0.00 ? 43 THR A HG21 10 
ATOM 8663  H HG22 . THR A 1 43 ? 1.448   6.680   -1.050  1.00 0.00 ? 43 THR A HG22 10 
ATOM 8664  H HG23 . THR A 1 43 ? 0.071   7.602   -0.513  1.00 0.00 ? 43 THR A HG23 10 
ATOM 8665  N N    . THR A 1 44 ? -3.808  5.870   -0.422  1.00 0.00 ? 44 THR A N    10 
ATOM 8666  C CA   . THR A 1 44 ? -5.036  6.635   -0.318  1.00 0.00 ? 44 THR A CA   10 
ATOM 8667  C C    . THR A 1 44 ? -5.851  5.942   0.772   1.00 0.00 ? 44 THR A C    10 
ATOM 8668  O O    . THR A 1 44 ? -5.502  4.862   1.237   1.00 0.00 ? 44 THR A O    10 
ATOM 8669  C CB   . THR A 1 44 ? -5.795  6.710   -1.657  1.00 0.00 ? 44 THR A CB   10 
ATOM 8670  O OG1  . THR A 1 44 ? -6.364  5.440   -1.929  1.00 0.00 ? 44 THR A OG1  10 
ATOM 8671  C CG2  . THR A 1 44 ? -4.884  7.151   -2.814  1.00 0.00 ? 44 THR A CG2  10 
ATOM 8672  H H    . THR A 1 44 ? -3.899  4.887   -0.265  1.00 0.00 ? 44 THR A H    10 
ATOM 8673  H HA   . THR A 1 44 ? -4.784  7.637   0.035   1.00 0.00 ? 44 THR A HA   10 
ATOM 8674  H HB   . THR A 1 44 ? -6.583  7.465   -1.537  1.00 0.00 ? 44 THR A HB   10 
ATOM 8675  H HG1  . THR A 1 44 ? -7.095  5.515   -2.559  1.00 0.00 ? 44 THR A HG1  10 
ATOM 8676  H HG21 . THR A 1 44 ? -4.324  8.048   -2.549  1.00 0.00 ? 44 THR A HG21 10 
ATOM 8677  H HG22 . THR A 1 44 ? -5.452  7.393   -3.708  1.00 0.00 ? 44 THR A HG22 10 
ATOM 8678  H HG23 . THR A 1 44 ? -4.170  6.371   -3.080  1.00 0.00 ? 44 THR A HG23 10 
ATOM 8679  N N    . GLU A 1 45 ? -6.929  6.639   1.168   1.00 0.00 ? 45 GLU A N    10 
ATOM 8680  C CA   . GLU A 1 45 ? -7.785  6.105   2.218   1.00 0.00 ? 45 GLU A CA   10 
ATOM 8681  C C    . GLU A 1 45 ? -8.500  4.827   1.711   1.00 0.00 ? 45 GLU A C    10 
ATOM 8682  O O    . GLU A 1 45 ? -8.684  3.847   2.425   1.00 0.00 ? 45 GLU A O    10 
ATOM 8683  C CB   . GLU A 1 45 ? -8.788  7.188   2.701   1.00 0.00 ? 45 GLU A CB   10 
ATOM 8684  C CG   . GLU A 1 45 ? -9.153  6.973   4.170   1.00 0.00 ? 45 GLU A CG   10 
ATOM 8685  C CD   . GLU A 1 45 ? -7.972  7.301   5.112   1.00 0.00 ? 45 GLU A CD   10 
ATOM 8686  O OE1  . GLU A 1 45 ? -7.305  8.317   4.921   1.00 0.00 ? 45 GLU A OE1  10 
ATOM 8687  O OE2  . GLU A 1 45 ? -7.668  6.528   6.015   1.00 0.00 ? 45 GLU A OE2  10 
ATOM 8688  H H    . GLU A 1 45 ? -7.128  7.495   0.702   1.00 0.00 ? 45 GLU A H    10 
ATOM 8689  H HA   . GLU A 1 45 ? -7.117  5.815   3.032   1.00 0.00 ? 45 GLU A HA   10 
ATOM 8690  H HB2  . GLU A 1 45 ? -8.338  8.220   2.719   1.00 0.00 ? 45 GLU A HB2  10 
ATOM 8691  H HB3  . GLU A 1 45 ? -9.730  7.080   2.095   1.00 0.00 ? 45 GLU A HB3  10 
ATOM 8692  H HG2  . GLU A 1 45 ? -9.985  7.626   4.413   1.00 0.00 ? 45 GLU A HG2  10 
ATOM 8693  H HG3  . GLU A 1 45 ? -9.471  5.943   4.304   1.00 0.00 ? 45 GLU A HG3  10 
ATOM 8694  N N    . ASP A 1 46 ? -8.887  4.930   0.421   1.00 0.00 ? 46 ASP A N    10 
ATOM 8695  C CA   . ASP A 1 46 ? -9.608  3.860   -0.276  1.00 0.00 ? 46 ASP A CA   10 
ATOM 8696  C C    . ASP A 1 46 ? -8.750  3.358   -1.450  1.00 0.00 ? 46 ASP A C    10 
ATOM 8697  O O    . ASP A 1 46 ? -8.598  4.016   -2.474  1.00 0.00 ? 46 ASP A O    10 
ATOM 8698  C CB   . ASP A 1 46 ? -10.991 4.354   -0.757  1.00 0.00 ? 46 ASP A CB   10 
ATOM 8699  C CG   . ASP A 1 46 ? -11.858 3.162   -1.156  1.00 0.00 ? 46 ASP A CG   10 
ATOM 8700  O OD1  . ASP A 1 46 ? -11.483 2.408   -2.050  1.00 0.00 ? 46 ASP A OD1  10 
ATOM 8701  O OD2  . ASP A 1 46 ? -12.894 2.940   -0.539  1.00 0.00 ? 46 ASP A OD2  10 
ATOM 8702  H H    . ASP A 1 46 ? -8.614  5.771   -0.044  1.00 0.00 ? 46 ASP A H    10 
ATOM 8703  H HA   . ASP A 1 46 ? -9.754  3.053   0.445   1.00 0.00 ? 46 ASP A HA   10 
ATOM 8704  H HB2  . ASP A 1 46 ? -11.487 4.883   0.058   1.00 0.00 ? 46 ASP A HB2  10 
ATOM 8705  H HB3  . ASP A 1 46 ? -10.957 5.052   -1.597  1.00 0.00 ? 46 ASP A HB3  10 
ATOM 8706  N N    . TYR A 1 47 ? -8.180  2.159   -1.223  1.00 0.00 ? 47 TYR A N    10 
ATOM 8707  C CA   . TYR A 1 47 ? -7.302  1.602   -2.252  1.00 0.00 ? 47 TYR A CA   10 
ATOM 8708  C C    . TYR A 1 47 ? -8.102  0.971   -3.395  1.00 0.00 ? 47 TYR A C    10 
ATOM 8709  O O    . TYR A 1 47 ? -7.703  1.050   -4.551  1.00 0.00 ? 47 TYR A O    10 
ATOM 8710  C CB   . TYR A 1 47 ? -6.374  0.534   -1.651  1.00 0.00 ? 47 TYR A CB   10 
ATOM 8711  C CG   . TYR A 1 47 ? -5.493  -0.049  -2.722  1.00 0.00 ? 47 TYR A CG   10 
ATOM 8712  C CD1  . TYR A 1 47 ? -4.393  0.650   -3.188  1.00 0.00 ? 47 TYR A CD1  10 
ATOM 8713  C CD2  . TYR A 1 47 ? -5.781  -1.284  -3.285  1.00 0.00 ? 47 TYR A CD2  10 
ATOM 8714  C CE1  . TYR A 1 47 ? -3.592  0.109   -4.176  1.00 0.00 ? 47 TYR A CE1  10 
ATOM 8715  C CE2  . TYR A 1 47 ? -4.961  -1.837  -4.254  1.00 0.00 ? 47 TYR A CE2  10 
ATOM 8716  C CZ   . TYR A 1 47 ? -3.858  -1.136  -4.707  1.00 0.00 ? 47 TYR A CZ   10 
ATOM 8717  O OH   . TYR A 1 47 ? -3.023  -1.649  -5.677  1.00 0.00 ? 47 TYR A OH   10 
ATOM 8718  H H    . TYR A 1 47 ? -8.399  1.671   -0.366  1.00 0.00 ? 47 TYR A H    10 
ATOM 8719  H HA   . TYR A 1 47 ? -6.696  2.409   -2.694  1.00 0.00 ? 47 TYR A HA   10 
ATOM 8720  H HB2  . TYR A 1 47 ? -5.751  0.976   -0.872  1.00 0.00 ? 47 TYR A HB2  10 
ATOM 8721  H HB3  . TYR A 1 47 ? -6.934  -0.280  -1.182  1.00 0.00 ? 47 TYR A HB3  10 
ATOM 8722  H HD1  . TYR A 1 47 ? -4.163  1.625   -2.801  1.00 0.00 ? 47 TYR A HD1  10 
ATOM 8723  H HD2  . TYR A 1 47 ? -6.674  -1.805  -2.999  1.00 0.00 ? 47 TYR A HD2  10 
ATOM 8724  H HE1  . TYR A 1 47 ? -2.754  0.663   -4.534  1.00 0.00 ? 47 TYR A HE1  10 
ATOM 8725  H HE2  . TYR A 1 47 ? -5.198  -2.810  -4.637  1.00 0.00 ? 47 TYR A HE2  10 
ATOM 8726  H HH   . TYR A 1 47 ? -2.776  -2.536  -5.449  1.00 0.00 ? 47 TYR A HH   10 
ATOM 8727  N N    . ASP A 1 48 ? -9.217  0.311   -3.022  1.00 0.00 ? 48 ASP A N    10 
ATOM 8728  C CA   . ASP A 1 48 ? -9.974  -0.415  -4.043  1.00 0.00 ? 48 ASP A CA   10 
ATOM 8729  C C    . ASP A 1 48 ? -10.379 0.510   -5.206  1.00 0.00 ? 48 ASP A C    10 
ATOM 8730  O O    . ASP A 1 48 ? -10.372 0.132   -6.369  1.00 0.00 ? 48 ASP A O    10 
ATOM 8731  C CB   . ASP A 1 48 ? -11.240 -1.088  -3.467  1.00 0.00 ? 48 ASP A CB   10 
ATOM 8732  C CG   . ASP A 1 48 ? -10.924 -2.167  -2.415  1.00 0.00 ? 48 ASP A CG   10 
ATOM 8733  O OD1  . ASP A 1 48 ? -10.018 -2.960  -2.638  1.00 0.00 ? 48 ASP A OD1  10 
ATOM 8734  O OD2  . ASP A 1 48 ? -11.588 -2.214  -1.378  1.00 0.00 ? 48 ASP A OD2  10 
ATOM 8735  H H    . ASP A 1 48 ? -9.505  0.310   -2.064  1.00 0.00 ? 48 ASP A H    10 
ATOM 8736  H HA   . ASP A 1 48 ? -9.321  -1.199  -4.438  1.00 0.00 ? 48 ASP A HA   10 
ATOM 8737  H HB2  . ASP A 1 48 ? -11.919 -0.335  -3.058  1.00 0.00 ? 48 ASP A HB2  10 
ATOM 8738  H HB3  . ASP A 1 48 ? -11.761 -1.610  -4.279  1.00 0.00 ? 48 ASP A HB3  10 
ATOM 8739  N N    . ARG A 1 49 ? -10.726 1.742   -4.800  1.00 0.00 ? 49 ARG A N    10 
ATOM 8740  C CA   . ARG A 1 49 ? -11.094 2.795   -5.729  1.00 0.00 ? 49 ARG A CA   10 
ATOM 8741  C C    . ARG A 1 49 ? -9.878  3.290   -6.548  1.00 0.00 ? 49 ARG A C    10 
ATOM 8742  O O    . ARG A 1 49 ? -9.923  3.350   -7.772  1.00 0.00 ? 49 ARG A O    10 
ATOM 8743  C CB   . ARG A 1 49 ? -11.737 3.920   -4.896  1.00 0.00 ? 49 ARG A CB   10 
ATOM 8744  C CG   . ARG A 1 49 ? -11.997 5.236   -5.643  1.00 0.00 ? 49 ARG A CG   10 
ATOM 8745  C CD   . ARG A 1 49 ? -10.888 6.292   -5.398  1.00 0.00 ? 49 ARG A CD   10 
ATOM 8746  N NE   . ARG A 1 49 ? -11.495 7.593   -5.128  1.00 0.00 ? 49 ARG A NE   10 
ATOM 8747  C CZ   . ARG A 1 49 ? -10.776 8.709   -4.861  1.00 0.00 ? 49 ARG A CZ   10 
ATOM 8748  N NH1  . ARG A 1 49 ? -9.450  8.677   -4.784  1.00 0.00 ? 49 ARG A NH1  10 
ATOM 8749  N NH2  . ARG A 1 49 ? -11.417 9.859   -4.669  1.00 0.00 ? 49 ARG A NH2  10 
ATOM 8750  H H    . ARG A 1 49 ? -10.715 1.944   -3.816  1.00 0.00 ? 49 ARG A H    10 
ATOM 8751  H HA   . ARG A 1 49 ? -11.832 2.395   -6.426  1.00 0.00 ? 49 ARG A HA   10 
ATOM 8752  H HB2  . ARG A 1 49 ? -12.683 3.542   -4.503  1.00 0.00 ? 49 ARG A HB2  10 
ATOM 8753  H HB3  . ARG A 1 49 ? -11.144 4.131   -4.009  1.00 0.00 ? 49 ARG A HB3  10 
ATOM 8754  H HG2  . ARG A 1 49 ? -12.140 5.044   -6.711  1.00 0.00 ? 49 ARG A HG2  10 
ATOM 8755  H HG3  . ARG A 1 49 ? -12.962 5.609   -5.293  1.00 0.00 ? 49 ARG A HG3  10 
ATOM 8756  H HD2  . ARG A 1 49 ? -10.261 6.061   -4.526  1.00 0.00 ? 49 ARG A HD2  10 
ATOM 8757  H HD3  . ARG A 1 49 ? -10.248 6.397   -6.280  1.00 0.00 ? 49 ARG A HD3  10 
ATOM 8758  H HE   . ARG A 1 49 ? -12.493 7.616   -5.119  1.00 0.00 ? 49 ARG A HE   10 
ATOM 8759  H HH11 . ARG A 1 49 ? -8.936  7.806   -4.885  1.00 0.00 ? 49 ARG A HH11 10 
ATOM 8760  H HH12 . ARG A 1 49 ? -8.898  9.489   -4.620  1.00 0.00 ? 49 ARG A HH12 10 
ATOM 8761  H HH21 . ARG A 1 49 ? -12.414 9.900   -4.725  1.00 0.00 ? 49 ARG A HH21 10 
ATOM 8762  H HH22 . ARG A 1 49 ? -10.917 10.701  -4.466  1.00 0.00 ? 49 ARG A HH22 10 
ATOM 8763  N N    . ASP A 1 50 ? -8.817  3.679   -5.815  1.00 0.00 ? 50 ASP A N    10 
ATOM 8764  C CA   . ASP A 1 50 ? -7.663  4.302   -6.469  1.00 0.00 ? 50 ASP A CA   10 
ATOM 8765  C C    . ASP A 1 50 ? -6.738  3.411   -7.302  1.00 0.00 ? 50 ASP A C    10 
ATOM 8766  O O    . ASP A 1 50 ? -6.288  3.876   -8.344  1.00 0.00 ? 50 ASP A O    10 
ATOM 8767  C CB   . ASP A 1 50 ? -6.765  5.025   -5.454  1.00 0.00 ? 50 ASP A CB   10 
ATOM 8768  C CG   . ASP A 1 50 ? -7.413  6.362   -5.112  1.00 0.00 ? 50 ASP A CG   10 
ATOM 8769  O OD1  . ASP A 1 50 ? -7.448  7.220   -5.996  1.00 0.00 ? 50 ASP A OD1  10 
ATOM 8770  O OD2  . ASP A 1 50 ? -7.882  6.560   -3.999  1.00 0.00 ? 50 ASP A OD2  10 
ATOM 8771  H H    . ASP A 1 50 ? -8.859  3.603   -4.815  1.00 0.00 ? 50 ASP A H    10 
ATOM 8772  H HA   . ASP A 1 50 ? -8.034  5.036   -7.188  1.00 0.00 ? 50 ASP A HA   10 
ATOM 8773  H HB2  . ASP A 1 50 ? -6.613  4.387   -4.566  1.00 0.00 ? 50 ASP A HB2  10 
ATOM 8774  H HB3  . ASP A 1 50 ? -5.808  5.330   -5.909  1.00 0.00 ? 50 ASP A HB3  10 
ATOM 8775  N N    . LYS A 1 51 ? -6.389  2.221   -6.770  1.00 0.00 ? 51 LYS A N    10 
ATOM 8776  C CA   . LYS A 1 51 ? -5.417  1.302   -7.373  1.00 0.00 ? 51 LYS A CA   10 
ATOM 8777  C C    . LYS A 1 51 ? -4.028  1.941   -7.461  1.00 0.00 ? 51 LYS A C    10 
ATOM 8778  O O    . LYS A 1 51 ? -3.330  1.852   -8.465  1.00 0.00 ? 51 LYS A O    10 
ATOM 8779  C CB   . LYS A 1 51 ? -5.825  0.791   -8.770  1.00 0.00 ? 51 LYS A CB   10 
ATOM 8780  C CG   . LYS A 1 51 ? -7.170  0.035   -8.771  1.00 0.00 ? 51 LYS A CG   10 
ATOM 8781  C CD   . LYS A 1 51 ? -8.390  0.936   -8.531  1.00 0.00 ? 51 LYS A CD   10 
ATOM 8782  C CE   . LYS A 1 51 ? -9.716  0.358   -9.029  1.00 0.00 ? 51 LYS A CE   10 
ATOM 8783  N NZ   . LYS A 1 51 ? -9.836  0.420   -10.482 1.00 0.00 ? 51 LYS A NZ   10 
ATOM 8784  H H    . LYS A 1 51 ? -6.859  1.913   -5.944  1.00 0.00 ? 51 LYS A H    10 
ATOM 8785  H HA   . LYS A 1 51 ? -5.326  0.484   -6.658  1.00 0.00 ? 51 LYS A HA   10 
ATOM 8786  H HB2  . LYS A 1 51 ? -5.935  1.680   -9.449  1.00 0.00 ? 51 LYS A HB2  10 
ATOM 8787  H HB3  . LYS A 1 51 ? -4.997  0.069   -9.042  1.00 0.00 ? 51 LYS A HB3  10 
ATOM 8788  H HG2  . LYS A 1 51 ? -7.345  -0.478  -9.714  1.00 0.00 ? 51 LYS A HG2  10 
ATOM 8789  H HG3  . LYS A 1 51 ? -7.102  -0.739  -8.011  1.00 0.00 ? 51 LYS A HG3  10 
ATOM 8790  H HD2  . LYS A 1 51 ? -8.481  1.108   -7.461  1.00 0.00 ? 51 LYS A HD2  10 
ATOM 8791  H HD3  . LYS A 1 51 ? -8.238  1.910   -8.996  1.00 0.00 ? 51 LYS A HD3  10 
ATOM 8792  H HE2  . LYS A 1 51 ? -9.844  -0.675  -8.700  1.00 0.00 ? 51 LYS A HE2  10 
ATOM 8793  H HE3  . LYS A 1 51 ? -10.544 0.935   -8.613  1.00 0.00 ? 51 LYS A HE3  10 
ATOM 8794  H HZ1  . LYS A 1 51 ? -9.063  -0.117  -10.923 1.00 0.00 ? 51 LYS A HZ1  10 
ATOM 8795  H HZ2  . LYS A 1 51 ? -9.776  1.417   -10.776 1.00 0.00 ? 51 LYS A HZ2  10 
ATOM 8796  H HZ3  . LYS A 1 51 ? -10.752 0.027   -10.779 1.00 0.00 ? 51 LYS A HZ3  10 
ATOM 8797  N N    . LYS A 1 52 ? -3.688  2.627   -6.359  1.00 0.00 ? 52 LYS A N    10 
ATOM 8798  C CA   . LYS A 1 52 ? -2.413  3.317   -6.318  1.00 0.00 ? 52 LYS A CA   10 
ATOM 8799  C C    . LYS A 1 52 ? -1.739  3.048   -4.974  1.00 0.00 ? 52 LYS A C    10 
ATOM 8800  O O    . LYS A 1 52 ? -2.382  3.056   -3.928  1.00 0.00 ? 52 LYS A O    10 
ATOM 8801  C CB   . LYS A 1 52 ? -2.609  4.785   -6.690  1.00 0.00 ? 52 LYS A CB   10 
ATOM 8802  C CG   . LYS A 1 52 ? -3.189  5.003   -8.113  1.00 0.00 ? 52 LYS A CG   10 
ATOM 8803  C CD   . LYS A 1 52 ? -3.323  6.481   -8.411  1.00 0.00 ? 52 LYS A CD   10 
ATOM 8804  C CE   . LYS A 1 52 ? -4.541  7.118   -7.705  1.00 0.00 ? 52 LYS A CE   10 
ATOM 8805  N NZ   . LYS A 1 52 ? -5.831  6.531   -8.093  1.00 0.00 ? 52 LYS A NZ   10 
ATOM 8806  H H    . LYS A 1 52 ? -4.281  2.616   -5.555  1.00 0.00 ? 52 LYS A H    10 
ATOM 8807  H HA   . LYS A 1 52 ? -1.770  2.839   -7.036  1.00 0.00 ? 52 LYS A HA   10 
ATOM 8808  H HB2  . LYS A 1 52 ? -3.240  5.262   -5.939  1.00 0.00 ? 52 LYS A HB2  10 
ATOM 8809  H HB3  . LYS A 1 52 ? -1.640  5.279   -6.654  1.00 0.00 ? 52 LYS A HB3  10 
ATOM 8810  H HG2  . LYS A 1 52 ? -2.527  4.596   -8.886  1.00 0.00 ? 52 LYS A HG2  10 
ATOM 8811  H HG3  . LYS A 1 52 ? -4.154  4.532   -8.277  1.00 0.00 ? 52 LYS A HG3  10 
ATOM 8812  H HD2  . LYS A 1 52 ? -2.364  6.868   -7.962  1.00 0.00 ? 52 LYS A HD2  10 
ATOM 8813  H HD3  . LYS A 1 52 ? -3.474  6.566   -9.527  1.00 0.00 ? 52 LYS A HD3  10 
ATOM 8814  H HE2  . LYS A 1 52 ? -4.453  7.035   -6.619  1.00 0.00 ? 52 LYS A HE2  10 
ATOM 8815  H HE3  . LYS A 1 52 ? -4.590  8.191   -7.912  1.00 0.00 ? 52 LYS A HE3  10 
ATOM 8816  H HZ1  . LYS A 1 52 ? -5.797  5.483   -8.111  1.00 0.00 ? 52 LYS A HZ1  10 
ATOM 8817  H HZ2  . LYS A 1 52 ? -6.117  6.854   -9.037  1.00 0.00 ? 52 LYS A HZ2  10 
ATOM 8818  H HZ3  . LYS A 1 52 ? -6.558  6.825   -7.396  1.00 0.00 ? 52 LYS A HZ3  10 
ATOM 8819  N N    . TYR A 1 53 ? -0.431  2.727   -5.081  1.00 0.00 ? 53 TYR A N    10 
ATOM 8820  C CA   . TYR A 1 53 ? 0.290   2.282   -3.905  1.00 0.00 ? 53 TYR A CA   10 
ATOM 8821  C C    . TYR A 1 53 ? 1.807   2.459   -4.047  1.00 0.00 ? 53 TYR A C    10 
ATOM 8822  O O    . TYR A 1 53 ? 2.358   2.450   -5.142  1.00 0.00 ? 53 TYR A O    10 
ATOM 8823  C CB   . TYR A 1 53 ? 0.077   0.759   -3.825  1.00 0.00 ? 53 TYR A CB   10 
ATOM 8824  C CG   . TYR A 1 53 ? 0.611   0.039   -5.050  1.00 0.00 ? 53 TYR A CG   10 
ATOM 8825  C CD1  . TYR A 1 53 ? -0.163  -0.135  -6.192  1.00 0.00 ? 53 TYR A CD1  10 
ATOM 8826  C CD2  . TYR A 1 53 ? 1.916   -0.443  -5.066  1.00 0.00 ? 53 TYR A CD2  10 
ATOM 8827  C CE1  . TYR A 1 53 ? 0.331   -0.816  -7.297  1.00 0.00 ? 53 TYR A CE1  10 
ATOM 8828  C CE2  . TYR A 1 53 ? 2.420   -1.118  -6.165  1.00 0.00 ? 53 TYR A CE2  10 
ATOM 8829  C CZ   . TYR A 1 53 ? 1.623   -1.326  -7.278  1.00 0.00 ? 53 TYR A CZ   10 
ATOM 8830  O OH   . TYR A 1 53 ? 2.130   -2.054  -8.341  1.00 0.00 ? 53 TYR A OH   10 
ATOM 8831  H H    . TYR A 1 53 ? 0.103   2.782   -5.932  1.00 0.00 ? 53 TYR A H    10 
ATOM 8832  H HA   . TYR A 1 53 ? -0.087  2.889   -3.070  1.00 0.00 ? 53 TYR A HA   10 
ATOM 8833  H HB2  . TYR A 1 53 ? 0.579   0.365   -2.950  1.00 0.00 ? 53 TYR A HB2  10 
ATOM 8834  H HB3  . TYR A 1 53 ? -0.970  0.522   -3.675  1.00 0.00 ? 53 TYR A HB3  10 
ATOM 8835  H HD1  . TYR A 1 53 ? -1.149  0.292   -6.233  1.00 0.00 ? 53 TYR A HD1  10 
ATOM 8836  H HD2  . TYR A 1 53 ? 2.560   -0.242  -4.227  1.00 0.00 ? 53 TYR A HD2  10 
ATOM 8837  H HE1  . TYR A 1 53 ? -0.312  -0.938  -8.153  1.00 0.00 ? 53 TYR A HE1  10 
ATOM 8838  H HE2  . TYR A 1 53 ? 3.441   -1.464  -6.150  1.00 0.00 ? 53 TYR A HE2  10 
ATOM 8839  H HH   . TYR A 1 53 ? 1.929   -1.600  -9.154  1.00 0.00 ? 53 TYR A HH   10 
ATOM 8840  N N    . GLY A 1 54 ? 2.443   2.570   -2.876  1.00 0.00 ? 54 GLY A N    10 
ATOM 8841  C CA   . GLY A 1 54 ? 3.912   2.646   -2.843  1.00 0.00 ? 54 GLY A CA   10 
ATOM 8842  C C    . GLY A 1 54 ? 4.411   1.237   -2.446  1.00 0.00 ? 54 GLY A C    10 
ATOM 8843  O O    . GLY A 1 54 ? 3.593   0.350   -2.207  1.00 0.00 ? 54 GLY A O    10 
ATOM 8844  H H    . GLY A 1 54 ? 1.853   2.504   -2.058  1.00 0.00 ? 54 GLY A H    10 
ATOM 8845  H HA2  . GLY A 1 54 ? 4.328   3.119   -3.758  1.00 0.00 ? 54 GLY A HA2  10 
ATOM 8846  H HA3  . GLY A 1 54 ? 4.167   3.344   -2.056  1.00 0.00 ? 54 GLY A HA3  10 
ATOM 8847  N N    . PHE A 1 55 ? 5.746   1.061   -2.324  1.00 0.00 ? 55 PHE A N    10 
ATOM 8848  C CA   . PHE A 1 55 ? 6.263   -0.216  -1.829  1.00 0.00 ? 55 PHE A CA   10 
ATOM 8849  C C    . PHE A 1 55 ? 6.526   -0.021  -0.327  1.00 0.00 ? 55 PHE A C    10 
ATOM 8850  O O    . PHE A 1 55 ? 6.703   1.081   0.175   1.00 0.00 ? 55 PHE A O    10 
ATOM 8851  C CB   . PHE A 1 55 ? 7.504   -0.733  -2.584  1.00 0.00 ? 55 PHE A CB   10 
ATOM 8852  C CG   . PHE A 1 55 ? 7.140   -1.163  -3.981  1.00 0.00 ? 55 PHE A CG   10 
ATOM 8853  C CD1  . PHE A 1 55 ? 6.480   -2.371  -4.194  1.00 0.00 ? 55 PHE A CD1  10 
ATOM 8854  C CD2  . PHE A 1 55 ? 7.452   -0.366  -5.076  1.00 0.00 ? 55 PHE A CD2  10 
ATOM 8855  C CE1  . PHE A 1 55 ? 6.123   -2.769  -5.475  1.00 0.00 ? 55 PHE A CE1  10 
ATOM 8856  C CE2  . PHE A 1 55 ? 7.096   -0.759  -6.361  1.00 0.00 ? 55 PHE A CE2  10 
ATOM 8857  C CZ   . PHE A 1 55 ? 6.429   -1.961  -6.561  1.00 0.00 ? 55 PHE A CZ   10 
ATOM 8858  H H    . PHE A 1 55 ? 6.444   1.761   -2.486  1.00 0.00 ? 55 PHE A H    10 
ATOM 8859  H HA   . PHE A 1 55 ? 5.492   -0.973  -1.932  1.00 0.00 ? 55 PHE A HA   10 
ATOM 8860  H HB2  . PHE A 1 55 ? 8.315   0.003   -2.615  1.00 0.00 ? 55 PHE A HB2  10 
ATOM 8861  H HB3  . PHE A 1 55 ? 7.879   -1.629  -2.075  1.00 0.00 ? 55 PHE A HB3  10 
ATOM 8862  H HD1  . PHE A 1 55 ? 6.245   -3.010  -3.355  1.00 0.00 ? 55 PHE A HD1  10 
ATOM 8863  H HD2  . PHE A 1 55 ? 7.984   0.559   -4.917  1.00 0.00 ? 55 PHE A HD2  10 
ATOM 8864  H HE1  . PHE A 1 55 ? 5.610   -3.708  -5.624  1.00 0.00 ? 55 PHE A HE1  10 
ATOM 8865  H HE2  . PHE A 1 55 ? 7.338   -0.136  -7.209  1.00 0.00 ? 55 PHE A HE2  10 
ATOM 8866  H HZ   . PHE A 1 55 ? 6.155   -2.266  -7.560  1.00 0.00 ? 55 PHE A HZ   10 
ATOM 8867  N N    . CYS A 1 56 ? 6.441   -1.166  0.358   1.00 0.00 ? 56 CYS A N    10 
ATOM 8868  C CA   . CYS A 1 56 ? 6.493   -1.164  1.829   1.00 0.00 ? 56 CYS A CA   10 
ATOM 8869  C C    . CYS A 1 56 ? 7.495   -2.258  2.219   1.00 0.00 ? 56 CYS A C    10 
ATOM 8870  O O    . CYS A 1 56 ? 7.730   -3.165  1.429   1.00 0.00 ? 56 CYS A O    10 
ATOM 8871  C CB   . CYS A 1 56 ? 5.061   -1.590  2.258   1.00 0.00 ? 56 CYS A CB   10 
ATOM 8872  S SG   . CYS A 1 56 ? 4.474   -0.977  3.855   1.00 0.00 ? 56 CYS A SG   10 
ATOM 8873  H H    . CYS A 1 56 ? 6.324   -2.018  -0.187  1.00 0.00 ? 56 CYS A H    10 
ATOM 8874  H HA   . CYS A 1 56 ? 6.835   -0.181  2.242   1.00 0.00 ? 56 CYS A HA   10 
ATOM 8875  H HB2  . CYS A 1 56 ? 4.302   -1.287  1.512   1.00 0.00 ? 56 CYS A HB2  10 
ATOM 8876  H HB3  . CYS A 1 56 ? 5.009   -2.688  2.292   1.00 0.00 ? 56 CYS A HB3  10 
ATOM 8877  N N    . PRO A 1 57 ? 8.096   -2.170  3.438   1.00 0.00 ? 57 PRO A N    10 
ATOM 8878  C CA   . PRO A 1 57 ? 8.970   -3.250  3.889   1.00 0.00 ? 57 PRO A CA   10 
ATOM 8879  C C    . PRO A 1 57 ? 8.135   -4.449  4.420   1.00 0.00 ? 57 PRO A C    10 
ATOM 8880  O O    . PRO A 1 57 ? 7.040   -4.743  3.949   1.00 0.00 ? 57 PRO A O    10 
ATOM 8881  C CB   . PRO A 1 57 ? 9.839   -2.540  4.946   1.00 0.00 ? 57 PRO A CB   10 
ATOM 8882  C CG   . PRO A 1 57 ? 8.936   -1.449  5.525   1.00 0.00 ? 57 PRO A CG   10 
ATOM 8883  C CD   . PRO A 1 57 ? 8.031   -1.030  4.360   1.00 0.00 ? 57 PRO A CD   10 
ATOM 8884  H HA   . PRO A 1 57 ? 9.598   -3.616  3.074   1.00 0.00 ? 57 PRO A HA   10 
ATOM 8885  H HB2  . PRO A 1 57 ? 10.290  -3.169  5.712   1.00 0.00 ? 57 PRO A HB2  10 
ATOM 8886  H HB3  . PRO A 1 57 ? 10.672  -2.061  4.433   1.00 0.00 ? 57 PRO A HB3  10 
ATOM 8887  H HG2  . PRO A 1 57 ? 8.338   -1.883  6.325   1.00 0.00 ? 57 PRO A HG2  10 
ATOM 8888  H HG3  . PRO A 1 57 ? 9.496   -0.614  5.946   1.00 0.00 ? 57 PRO A HG3  10 
ATOM 8889  H HD2  . PRO A 1 57 ? 7.004   -0.852  4.722   1.00 0.00 ? 57 PRO A HD2  10 
ATOM 8890  H HD3  . PRO A 1 57 ? 8.462   -0.147  3.859   1.00 0.00 ? 57 PRO A HD3  10 
ATOM 8891  N N    . GLU A 1 58 ? 8.721   -5.117  5.426   1.00 0.00 ? 58 GLU A N    10 
ATOM 8892  C CA   . GLU A 1 58 ? 8.169   -6.321  6.045   1.00 0.00 ? 58 GLU A CA   10 
ATOM 8893  C C    . GLU A 1 58 ? 7.814   -6.022  7.502   1.00 0.00 ? 58 GLU A C    10 
ATOM 8894  O O    . GLU A 1 58 ? 6.755   -6.372  8.004   1.00 0.00 ? 58 GLU A O    10 
ATOM 8895  C CB   . GLU A 1 58 ? 9.164   -7.515  5.968   1.00 0.00 ? 58 GLU A CB   10 
ATOM 8896  C CG   . GLU A 1 58 ? 10.444  -7.301  5.126   1.00 0.00 ? 58 GLU A CG   10 
ATOM 8897  C CD   . GLU A 1 58 ? 11.351  -6.173  5.662   1.00 0.00 ? 58 GLU A CD   10 
ATOM 8898  O OE1  . GLU A 1 58 ? 11.293  -5.869  6.854   1.00 0.00 ? 58 GLU A OE1  10 
ATOM 8899  O OE2  . GLU A 1 58 ? 12.061  -5.563  4.870   1.00 0.00 ? 58 GLU A OE2  10 
ATOM 8900  H H    . GLU A 1 58 ? 9.614   -4.793  5.736   1.00 0.00 ? 58 GLU A H    10 
ATOM 8901  H HA   . GLU A 1 58 ? 7.243   -6.574  5.535   1.00 0.00 ? 58 GLU A HA   10 
ATOM 8902  H HB2  . GLU A 1 58 ? 9.492   -7.814  6.974   1.00 0.00 ? 58 GLU A HB2  10 
ATOM 8903  H HB3  . GLU A 1 58 ? 8.623   -8.368  5.539   1.00 0.00 ? 58 GLU A HB3  10 
ATOM 8904  H HG2  . GLU A 1 58 ? 11.032  -8.222  5.118   1.00 0.00 ? 58 GLU A HG2  10 
ATOM 8905  H HG3  . GLU A 1 58 ? 10.186  -7.101  4.084   1.00 0.00 ? 58 GLU A HG3  10 
ATOM 8906  N N    . THR A 1 59 ? 8.781   -5.349  8.137   1.00 0.00 ? 59 THR A N    10 
ATOM 8907  C CA   . THR A 1 59 ? 8.702   -4.962  9.534   1.00 0.00 ? 59 THR A CA   10 
ATOM 8908  C C    . THR A 1 59 ? 7.884   -3.662  9.702   1.00 0.00 ? 59 THR A C    10 
ATOM 8909  O O    . THR A 1 59 ? 8.313   -2.711  10.344  1.00 0.00 ? 59 THR A O    10 
ATOM 8910  C CB   . THR A 1 59 ? 10.154  -4.829  10.042  1.00 0.00 ? 59 THR A CB   10 
ATOM 8911  O OG1  . THR A 1 59 ? 10.983  -4.200  9.078   1.00 0.00 ? 59 THR A OG1  10 
ATOM 8912  C CG2  . THR A 1 59 ? 10.742  -6.189  10.459  1.00 0.00 ? 59 THR A CG2  10 
ATOM 8913  H H    . THR A 1 59 ? 9.614   -5.130  7.630   1.00 0.00 ? 59 THR A H    10 
ATOM 8914  H HA   . THR A 1 59 ? 8.181   -5.754  10.075  1.00 0.00 ? 59 THR A HA   10 
ATOM 8915  H HB   . THR A 1 59 ? 10.168  -4.191  10.928  1.00 0.00 ? 59 THR A HB   10 
ATOM 8916  H HG1  . THR A 1 59 ? 11.232  -4.818  8.386   1.00 0.00 ? 59 THR A HG1  10 
ATOM 8917  H HG21 . THR A 1 59 ? 10.709  -6.918  9.648   1.00 0.00 ? 59 THR A HG21 10 
ATOM 8918  H HG22 . THR A 1 59 ? 10.183  -6.610  11.295  1.00 0.00 ? 59 THR A HG22 10 
ATOM 8919  H HG23 . THR A 1 59 ? 11.779  -6.085  10.778  1.00 0.00 ? 59 THR A HG23 10 
ATOM 8920  N N    . ALA A 1 60 ? 6.684   -3.689  9.092   1.00 0.00 ? 60 ALA A N    10 
ATOM 8921  C CA   . ALA A 1 60 ? 5.767   -2.565  9.145   1.00 0.00 ? 60 ALA A CA   10 
ATOM 8922  C C    . ALA A 1 60 ? 4.415   -2.999  8.558   1.00 0.00 ? 60 ALA A C    10 
ATOM 8923  O O    . ALA A 1 60 ? 4.318   -4.078  7.975   1.00 0.00 ? 60 ALA A O    10 
ATOM 8924  C CB   . ALA A 1 60 ? 6.303   -1.368  8.349   1.00 0.00 ? 60 ALA A CB   10 
ATOM 8925  O OXT  . ALA A 1 60 ? 3.464   -2.240  8.680   1.00 0.00 ? 60 ALA A OXT  10 
ATOM 8926  H H    . ALA A 1 60 ? 6.337   -4.488  8.591   1.00 0.00 ? 60 ALA A H    10 
ATOM 8927  H HA   . ALA A 1 60 ? 5.630   -2.308  10.197  1.00 0.00 ? 60 ALA A HA   10 
ATOM 8928  H HB1  . ALA A 1 60 ? 7.262   -1.024  8.735   1.00 0.00 ? 60 ALA A HB1  10 
ATOM 8929  H HB2  . ALA A 1 60 ? 5.600   -0.538  8.399   1.00 0.00 ? 60 ALA A HB2  10 
ATOM 8930  H HB3  . ALA A 1 60 ? 6.429   -1.622  7.299   1.00 0.00 ? 60 ALA A HB3  10 
ATOM 8931  N N    . THR A 1 1  ? 10.360  4.357   10.284  1.00 0.00 ? 1  THR A N    11 
ATOM 8932  C CA   . THR A 1 1  ? 10.987  5.383   9.477   1.00 0.00 ? 1  THR A CA   11 
ATOM 8933  C C    . THR A 1 1  ? 9.862   5.937   8.624   1.00 0.00 ? 1  THR A C    11 
ATOM 8934  O O    . THR A 1 1  ? 8.798   5.330   8.627   1.00 0.00 ? 1  THR A O    11 
ATOM 8935  C CB   . THR A 1 1  ? 12.075  4.684   8.640   1.00 0.00 ? 1  THR A CB   11 
ATOM 8936  O OG1  . THR A 1 1  ? 12.454  3.546   9.408   1.00 0.00 ? 1  THR A OG1  11 
ATOM 8937  C CG2  . THR A 1 1  ? 13.268  5.613   8.360   1.00 0.00 ? 1  THR A CG2  11 
ATOM 8938  H H1   . THR A 1 1  ? 11.057  3.575   10.273  1.00 0.00 ? 1  THR A H1   11 
ATOM 8939  H H2   . THR A 1 1  ? 9.483   4.115   9.765   1.00 0.00 ? 1  THR A H2   11 
ATOM 8940  H H3   . THR A 1 1  ? 10.147  4.686   11.244  1.00 0.00 ? 1  THR A H3   11 
ATOM 8941  H HA   . THR A 1 1  ? 11.394  6.143   10.145  1.00 0.00 ? 1  THR A HA   11 
ATOM 8942  H HB   . THR A 1 1  ? 11.652  4.339   7.686   1.00 0.00 ? 1  THR A HB   11 
ATOM 8943  H HG1  . THR A 1 1  ? 13.192  3.097   8.994   1.00 0.00 ? 1  THR A HG1  11 
ATOM 8944  H HG21 . THR A 1 1  ? 12.949  6.514   7.836   1.00 0.00 ? 1  THR A HG21 11 
ATOM 8945  H HG22 . THR A 1 1  ? 14.021  5.134   7.733   1.00 0.00 ? 1  THR A HG22 11 
ATOM 8946  H HG23 . THR A 1 1  ? 13.754  5.924   9.286   1.00 0.00 ? 1  THR A HG23 11 
ATOM 8947  N N    . ALA A 1 2  ? 10.126  7.056   7.925   1.00 0.00 ? 2  ALA A N    11 
ATOM 8948  C CA   . ALA A 1 2  ? 9.099   7.610   7.051   1.00 0.00 ? 2  ALA A CA   11 
ATOM 8949  C C    . ALA A 1 2  ? 8.886   6.648   5.869   1.00 0.00 ? 2  ALA A C    11 
ATOM 8950  O O    . ALA A 1 2  ? 9.823   6.021   5.389   1.00 0.00 ? 2  ALA A O    11 
ATOM 8951  C CB   . ALA A 1 2  ? 9.539   8.990   6.558   1.00 0.00 ? 2  ALA A CB   11 
ATOM 8952  H H    . ALA A 1 2  ? 11.022  7.495   7.961   1.00 0.00 ? 2  ALA A H    11 
ATOM 8953  H HA   . ALA A 1 2  ? 8.179   7.689   7.635   1.00 0.00 ? 2  ALA A HA   11 
ATOM 8954  H HB1  . ALA A 1 2  ? 9.693   9.674   7.393   1.00 0.00 ? 2  ALA A HB1  11 
ATOM 8955  H HB2  . ALA A 1 2  ? 8.783   9.432   5.907   1.00 0.00 ? 2  ALA A HB2  11 
ATOM 8956  H HB3  . ALA A 1 2  ? 10.473  8.930   5.999   1.00 0.00 ? 2  ALA A HB3  11 
ATOM 8957  N N    . LEU A 1 3  ? 7.608   6.557   5.465   1.00 0.00 ? 3  LEU A N    11 
ATOM 8958  C CA   . LEU A 1 3  ? 7.205   5.656   4.398   1.00 0.00 ? 3  LEU A CA   11 
ATOM 8959  C C    . LEU A 1 3  ? 6.678   6.490   3.229   1.00 0.00 ? 3  LEU A C    11 
ATOM 8960  O O    . LEU A 1 3  ? 5.512   6.859   3.210   1.00 0.00 ? 3  LEU A O    11 
ATOM 8961  C CB   . LEU A 1 3  ? 6.100   4.702   4.907   1.00 0.00 ? 3  LEU A CB   11 
ATOM 8962  C CG   . LEU A 1 3  ? 6.594   3.780   6.038   1.00 0.00 ? 3  LEU A CG   11 
ATOM 8963  C CD1  . LEU A 1 3  ? 5.423   3.252   6.866   1.00 0.00 ? 3  LEU A CD1  11 
ATOM 8964  C CD2  . LEU A 1 3  ? 7.402   2.602   5.489   1.00 0.00 ? 3  LEU A CD2  11 
ATOM 8965  H H    . LEU A 1 3  ? 6.901   7.108   5.898   1.00 0.00 ? 3  LEU A H    11 
ATOM 8966  H HA   . LEU A 1 3  ? 8.064   5.072   4.065   1.00 0.00 ? 3  LEU A HA   11 
ATOM 8967  H HB2  . LEU A 1 3  ? 5.226   5.288   5.315   1.00 0.00 ? 3  LEU A HB2  11 
ATOM 8968  H HB3  . LEU A 1 3  ? 5.861   4.049   4.032   1.00 0.00 ? 3  LEU A HB3  11 
ATOM 8969  H HG   . LEU A 1 3  ? 7.231   4.346   6.718   1.00 0.00 ? 3  LEU A HG   11 
ATOM 8970  H HD11 . LEU A 1 3  ? 5.776   2.627   7.686   1.00 0.00 ? 3  LEU A HD11 11 
ATOM 8971  H HD12 . LEU A 1 3  ? 4.758   2.653   6.245   1.00 0.00 ? 3  LEU A HD12 11 
ATOM 8972  H HD13 . LEU A 1 3  ? 4.851   4.073   7.297   1.00 0.00 ? 3  LEU A HD13 11 
ATOM 8973  H HD21 . LEU A 1 3  ? 7.792   1.999   6.308   1.00 0.00 ? 3  LEU A HD21 11 
ATOM 8974  H HD22 . LEU A 1 3  ? 8.245   2.935   4.886   1.00 0.00 ? 3  LEU A HD22 11 
ATOM 8975  H HD23 . LEU A 1 3  ? 6.775   1.960   4.868   1.00 0.00 ? 3  LEU A HD23 11 
ATOM 8976  N N    . PHE A 1 4  ? 7.599   6.739   2.266   1.00 0.00 ? 4  PHE A N    11 
ATOM 8977  C CA   . PHE A 1 4  ? 7.260   7.440   1.020   1.00 0.00 ? 4  PHE A CA   11 
ATOM 8978  C C    . PHE A 1 4  ? 6.661   6.327   0.107   1.00 0.00 ? 4  PHE A C    11 
ATOM 8979  O O    . PHE A 1 4  ? 5.783   5.614   0.574   1.00 0.00 ? 4  PHE A O    11 
ATOM 8980  C CB   . PHE A 1 4  ? 8.490   8.272   0.544   1.00 0.00 ? 4  PHE A CB   11 
ATOM 8981  C CG   . PHE A 1 4  ? 9.049   9.126   1.653   1.00 0.00 ? 4  PHE A CG   11 
ATOM 8982  C CD1  . PHE A 1 4  ? 8.293   10.170  2.180   1.00 0.00 ? 4  PHE A CD1  11 
ATOM 8983  C CD2  . PHE A 1 4  ? 10.329  8.901   2.155   1.00 0.00 ? 4  PHE A CD2  11 
ATOM 8984  C CE1  . PHE A 1 4  ? 8.805   10.975  3.189   1.00 0.00 ? 4  PHE A CE1  11 
ATOM 8985  C CE2  . PHE A 1 4  ? 10.843  9.705   3.163   1.00 0.00 ? 4  PHE A CE2  11 
ATOM 8986  C CZ   . PHE A 1 4  ? 10.082  10.745  3.680   1.00 0.00 ? 4  PHE A CZ   11 
ATOM 8987  H H    . PHE A 1 4  ? 8.521   6.387   2.413   1.00 0.00 ? 4  PHE A H    11 
ATOM 8988  H HA   . PHE A 1 4  ? 6.457   8.124   1.275   1.00 0.00 ? 4  PHE A HA   11 
ATOM 8989  H HB2  . PHE A 1 4  ? 9.285   7.607   0.194   1.00 0.00 ? 4  PHE A HB2  11 
ATOM 8990  H HB3  . PHE A 1 4  ? 8.271   9.000   -0.256  1.00 0.00 ? 4  PHE A HB3  11 
ATOM 8991  H HD1  . PHE A 1 4  ? 7.301   10.363  1.797   1.00 0.00 ? 4  PHE A HD1  11 
ATOM 8992  H HD2  . PHE A 1 4  ? 10.940  8.104   1.758   1.00 0.00 ? 4  PHE A HD2  11 
ATOM 8993  H HE1  . PHE A 1 4  ? 8.210   11.784  3.589   1.00 0.00 ? 4  PHE A HE1  11 
ATOM 8994  H HE2  . PHE A 1 4  ? 11.837  9.522   3.545   1.00 0.00 ? 4  PHE A HE2  11 
ATOM 8995  H HZ   . PHE A 1 4  ? 10.483  11.372  4.463   1.00 0.00 ? 4  PHE A HZ   11 
ATOM 8996  N N    . THR A 1 5  ? 7.158   6.105   -1.132  1.00 0.00 ? 5  THR A N    11 
ATOM 8997  C CA   . THR A 1 5  ? 6.633   4.993   -1.921  1.00 0.00 ? 5  THR A CA   11 
ATOM 8998  C C    . THR A 1 5  ? 7.533   3.763   -1.806  1.00 0.00 ? 5  THR A C    11 
ATOM 8999  O O    . THR A 1 5  ? 7.133   2.646   -2.100  1.00 0.00 ? 5  THR A O    11 
ATOM 9000  C CB   . THR A 1 5  ? 6.646   5.387   -3.390  1.00 0.00 ? 5  THR A CB   11 
ATOM 9001  O OG1  . THR A 1 5  ? 7.837   6.139   -3.605  1.00 0.00 ? 5  THR A OG1  11 
ATOM 9002  C CG2  . THR A 1 5  ? 5.368   6.155   -3.759  1.00 0.00 ? 5  THR A CG2  11 
ATOM 9003  H H    . THR A 1 5  ? 7.830   6.601   -1.675  1.00 0.00 ? 5  THR A H    11 
ATOM 9004  H HA   . THR A 1 5  ? 5.641   4.717   -1.578  1.00 0.00 ? 5  THR A HA   11 
ATOM 9005  H HB   . THR A 1 5  ? 6.688   4.440   -3.939  1.00 0.00 ? 5  THR A HB   11 
ATOM 9006  H HG1  . THR A 1 5  ? 8.015   6.247   -4.539  1.00 0.00 ? 5  THR A HG1  11 
ATOM 9007  H HG21 . THR A 1 5  ? 5.293   6.357   -4.826  1.00 0.00 ? 5  THR A HG21 11 
ATOM 9008  H HG22 . THR A 1 5  ? 5.277   7.096   -3.215  1.00 0.00 ? 5  THR A HG22 11 
ATOM 9009  H HG23 . THR A 1 5  ? 4.493   5.568   -3.487  1.00 0.00 ? 5  THR A HG23 11 
ATOM 9010  N N    . MET A 1 6  ? 8.765   4.039   -1.376  1.00 0.00 ? 6  MET A N    11 
ATOM 9011  C CA   . MET A 1 6  ? 9.752   3.003   -1.086  1.00 0.00 ? 6  MET A CA   11 
ATOM 9012  C C    . MET A 1 6  ? 10.051  2.079   -2.291  1.00 0.00 ? 6  MET A C    11 
ATOM 9013  O O    . MET A 1 6  ? 10.501  0.955   -2.116  1.00 0.00 ? 6  MET A O    11 
ATOM 9014  C CB   . MET A 1 6  ? 9.245   2.174   0.113   1.00 0.00 ? 6  MET A CB   11 
ATOM 9015  C CG   . MET A 1 6  ? 8.836   3.042   1.332   1.00 0.00 ? 6  MET A CG   11 
ATOM 9016  S SD   . MET A 1 6  ? 10.284  3.535   2.290   1.00 0.00 ? 6  MET A SD   11 
ATOM 9017  C CE   . MET A 1 6  ? 10.547  5.200   1.655   1.00 0.00 ? 6  MET A CE   11 
ATOM 9018  H H    . MET A 1 6  ? 8.901   5.013   -1.248  1.00 0.00 ? 6  MET A H    11 
ATOM 9019  H HA   . MET A 1 6  ? 10.669  3.529   -0.822  1.00 0.00 ? 6  MET A HA   11 
ATOM 9020  H HB2  . MET A 1 6  ? 8.418   1.546   -0.235  1.00 0.00 ? 6  MET A HB2  11 
ATOM 9021  H HB3  . MET A 1 6  ? 10.014  1.466   0.424   1.00 0.00 ? 6  MET A HB3  11 
ATOM 9022  H HG2  . MET A 1 6  ? 8.237   3.922   1.076   1.00 0.00 ? 6  MET A HG2  11 
ATOM 9023  H HG3  . MET A 1 6  ? 8.193   2.479   2.011   1.00 0.00 ? 6  MET A HG3  11 
ATOM 9024  H HE1  . MET A 1 6  ? 11.553  5.281   1.245   1.00 0.00 ? 6  MET A HE1  11 
ATOM 9025  H HE2  . MET A 1 6  ? 10.474  5.913   2.476   1.00 0.00 ? 6  MET A HE2  11 
ATOM 9026  H HE3  . MET A 1 6  ? 9.830   5.458   0.878   1.00 0.00 ? 6  MET A HE3  11 
ATOM 9027  N N    . GLY A 1 7  ? 9.766   2.597   -3.507  1.00 0.00 ? 7  GLY A N    11 
ATOM 9028  C CA   . GLY A 1 7  ? 9.988   1.820   -4.730  1.00 0.00 ? 7  GLY A CA   11 
ATOM 9029  C C    . GLY A 1 7  ? 8.696   1.596   -5.530  1.00 0.00 ? 7  GLY A C    11 
ATOM 9030  O O    . GLY A 1 7  ? 8.735   1.353   -6.728  1.00 0.00 ? 7  GLY A O    11 
ATOM 9031  H H    . GLY A 1 7  ? 9.407   3.527   -3.565  1.00 0.00 ? 7  GLY A H    11 
ATOM 9032  H HA2  . GLY A 1 7  ? 10.696  2.386   -5.340  1.00 0.00 ? 7  GLY A HA2  11 
ATOM 9033  H HA3  . GLY A 1 7  ? 10.415  0.842   -4.485  1.00 0.00 ? 7  GLY A HA3  11 
ATOM 9034  N N    . GLY A 1 8  ? 7.562   1.682   -4.801  1.00 0.00 ? 8  GLY A N    11 
ATOM 9035  C CA   . GLY A 1 8  ? 6.242   1.488   -5.403  1.00 0.00 ? 8  GLY A CA   11 
ATOM 9036  C C    . GLY A 1 8  ? 5.861   2.617   -6.404  1.00 0.00 ? 8  GLY A C    11 
ATOM 9037  O O    . GLY A 1 8  ? 6.741   3.264   -6.955  1.00 0.00 ? 8  GLY A O    11 
ATOM 9038  H H    . GLY A 1 8  ? 7.650   1.809   -3.814  1.00 0.00 ? 8  GLY A H    11 
ATOM 9039  H HA2  . GLY A 1 8  ? 6.278   0.544   -5.949  1.00 0.00 ? 8  GLY A HA2  11 
ATOM 9040  H HA3  . GLY A 1 8  ? 5.552   1.347   -4.580  1.00 0.00 ? 8  GLY A HA3  11 
ATOM 9041  N N    . ASN A 1 9  ? 4.539   2.793   -6.681  1.00 0.00 ? 9  ASN A N    11 
ATOM 9042  C CA   . ASN A 1 9  ? 4.150   3.666   -7.805  1.00 0.00 ? 9  ASN A CA   11 
ATOM 9043  C C    . ASN A 1 9  ? 3.293   4.883   -7.432  1.00 0.00 ? 9  ASN A C    11 
ATOM 9044  O O    . ASN A 1 9  ? 2.844   5.609   -8.311  1.00 0.00 ? 9  ASN A O    11 
ATOM 9045  C CB   . ASN A 1 9  ? 3.409   2.811   -8.862  1.00 0.00 ? 9  ASN A CB   11 
ATOM 9046  C CG   . ASN A 1 9  ? 2.020   2.305   -8.407  1.00 0.00 ? 9  ASN A CG   11 
ATOM 9047  O OD1  . ASN A 1 9  ? 1.464   2.744   -7.412  1.00 0.00 ? 9  ASN A OD1  11 
ATOM 9048  N ND2  . ASN A 1 9  ? 1.459   1.377   -9.192  1.00 0.00 ? 9  ASN A ND2  11 
ATOM 9049  H H    . ASN A 1 9  ? 3.787   2.348   -6.180  1.00 0.00 ? 9  ASN A H    11 
ATOM 9050  H HA   . ASN A 1 9  ? 5.054   4.071   -8.266  1.00 0.00 ? 9  ASN A HA   11 
ATOM 9051  H HB2  . ASN A 1 9  ? 3.261   3.399   -9.768  1.00 0.00 ? 9  ASN A HB2  11 
ATOM 9052  H HB3  . ASN A 1 9  ? 4.032   1.962   -9.146  1.00 0.00 ? 9  ASN A HB3  11 
ATOM 9053  H HD21 . ASN A 1 9  ? 1.904   0.996   -10.008 1.00 0.00 ? 9  ASN A HD21 11 
ATOM 9054  H HD22 . ASN A 1 9  ? 0.544   1.091   -8.891  1.00 0.00 ? 9  ASN A HD22 11 
ATOM 9055  N N    . ALA A 1 10 ? 3.070   5.090   -6.126  1.00 0.00 ? 10 ALA A N    11 
ATOM 9056  C CA   . ALA A 1 10 ? 2.197   6.191   -5.732  1.00 0.00 ? 10 ALA A CA   11 
ATOM 9057  C C    . ALA A 1 10 ? 2.891   7.568   -5.752  1.00 0.00 ? 10 ALA A C    11 
ATOM 9058  O O    . ALA A 1 10 ? 2.937   8.227   -4.730  1.00 0.00 ? 10 ALA A O    11 
ATOM 9059  C CB   . ALA A 1 10 ? 1.652   5.917   -4.327  1.00 0.00 ? 10 ALA A CB   11 
ATOM 9060  H H    . ALA A 1 10 ? 3.448   4.457   -5.446  1.00 0.00 ? 10 ALA A H    11 
ATOM 9061  H HA   . ALA A 1 10 ? 1.356   6.225   -6.428  1.00 0.00 ? 10 ALA A HA   11 
ATOM 9062  H HB1  . ALA A 1 10 ? 0.995   5.049   -4.315  1.00 0.00 ? 10 ALA A HB1  11 
ATOM 9063  H HB2  . ALA A 1 10 ? 1.102   6.783   -3.968  1.00 0.00 ? 10 ALA A HB2  11 
ATOM 9064  H HB3  . ALA A 1 10 ? 2.441   5.740   -3.602  1.00 0.00 ? 10 ALA A HB3  11 
ATOM 9065  N N    . GLU A 1 11 ? 3.399   7.984   -6.931  1.00 0.00 ? 11 GLU A N    11 
ATOM 9066  C CA   . GLU A 1 11 ? 4.004   9.308   -7.161  1.00 0.00 ? 11 GLU A CA   11 
ATOM 9067  C C    . GLU A 1 11 ? 4.836   9.918   -5.985  1.00 0.00 ? 11 GLU A C    11 
ATOM 9068  O O    . GLU A 1 11 ? 4.809   11.117  -5.747  1.00 0.00 ? 11 GLU A O    11 
ATOM 9069  C CB   . GLU A 1 11 ? 2.914   10.291  -7.649  1.00 0.00 ? 11 GLU A CB   11 
ATOM 9070  C CG   . GLU A 1 11 ? 1.651   10.314  -6.765  1.00 0.00 ? 11 GLU A CG   11 
ATOM 9071  C CD   . GLU A 1 11 ? 0.799   11.576  -6.992  1.00 0.00 ? 11 GLU A CD   11 
ATOM 9072  O OE1  . GLU A 1 11 ? 0.350   11.784  -8.117  1.00 0.00 ? 11 GLU A OE1  11 
ATOM 9073  O OE2  . GLU A 1 11 ? 0.589   12.332  -6.041  1.00 0.00 ? 11 GLU A OE2  11 
ATOM 9074  H H    . GLU A 1 11 ? 3.293   7.365   -7.712  1.00 0.00 ? 11 GLU A H    11 
ATOM 9075  H HA   . GLU A 1 11 ? 4.710   9.149   -7.976  1.00 0.00 ? 11 GLU A HA   11 
ATOM 9076  H HB2  . GLU A 1 11 ? 3.335   11.296  -7.726  1.00 0.00 ? 11 GLU A HB2  11 
ATOM 9077  H HB3  . GLU A 1 11 ? 2.614   10.029  -8.664  1.00 0.00 ? 11 GLU A HB3  11 
ATOM 9078  H HG2  . GLU A 1 11 ? 1.029   9.440   -6.958  1.00 0.00 ? 11 GLU A HG2  11 
ATOM 9079  H HG3  . GLU A 1 11 ? 1.935   10.269  -5.719  1.00 0.00 ? 11 GLU A HG3  11 
ATOM 9080  N N    . GLY A 1 12 ? 5.592   9.051   -5.277  1.00 0.00 ? 12 GLY A N    11 
ATOM 9081  C CA   . GLY A 1 12 ? 6.444   9.529   -4.169  1.00 0.00 ? 12 GLY A CA   11 
ATOM 9082  C C    . GLY A 1 12 ? 5.644   9.858   -2.880  1.00 0.00 ? 12 GLY A C    11 
ATOM 9083  O O    . GLY A 1 12 ? 6.224   10.183  -1.850  1.00 0.00 ? 12 GLY A O    11 
ATOM 9084  H H    . GLY A 1 12 ? 5.524   8.092   -5.545  1.00 0.00 ? 12 GLY A H    11 
ATOM 9085  H HA2  . GLY A 1 12 ? 7.137   8.673   -3.906  1.00 0.00 ? 12 GLY A HA2  11 
ATOM 9086  H HA3  . GLY A 1 12 ? 6.904   10.501  -4.521  1.00 0.00 ? 12 GLY A HA3  11 
ATOM 9087  N N    . GLN A 1 13 ? 4.304   9.771   -2.983  1.00 0.00 ? 13 GLN A N    11 
ATOM 9088  C CA   . GLN A 1 13 ? 3.407   10.026  -1.864  1.00 0.00 ? 13 GLN A CA   11 
ATOM 9089  C C    . GLN A 1 13 ? 3.591   8.898   -0.828  1.00 0.00 ? 13 GLN A C    11 
ATOM 9090  O O    . GLN A 1 13 ? 3.940   7.775   -1.176  1.00 0.00 ? 13 GLN A O    11 
ATOM 9091  C CB   . GLN A 1 13 ? 1.942   10.058  -2.344  1.00 0.00 ? 13 GLN A CB   11 
ATOM 9092  C CG   . GLN A 1 13 ? 1.598   11.231  -3.287  1.00 0.00 ? 13 GLN A CG   11 
ATOM 9093  C CD   . GLN A 1 13 ? 1.286   12.533  -2.539  1.00 0.00 ? 13 GLN A CD   11 
ATOM 9094  O OE1  . GLN A 1 13 ? 1.562   12.685  -1.356  1.00 0.00 ? 13 GLN A OE1  11 
ATOM 9095  N NE2  . GLN A 1 13 ? 0.650   13.441  -3.293  1.00 0.00 ? 13 GLN A NE2  11 
ATOM 9096  H H    . GLN A 1 13 ? 3.896   9.440   -3.830  1.00 0.00 ? 13 GLN A H    11 
ATOM 9097  H HA   . GLN A 1 13 ? 3.697   10.981  -1.424  1.00 0.00 ? 13 GLN A HA   11 
ATOM 9098  H HB2  . GLN A 1 13 ? 1.712   9.117   -2.844  1.00 0.00 ? 13 GLN A HB2  11 
ATOM 9099  H HB3  . GLN A 1 13 ? 1.266   10.109  -1.489  1.00 0.00 ? 13 GLN A HB3  11 
ATOM 9100  H HG2  . GLN A 1 13 ? 2.383   11.445  -4.013  1.00 0.00 ? 13 GLN A HG2  11 
ATOM 9101  H HG3  . GLN A 1 13 ? 0.707   10.965  -3.857  1.00 0.00 ? 13 GLN A HG3  11 
ATOM 9102  H HE21 . GLN A 1 13 ? 0.486   13.215  -4.262  1.00 0.00 ? 13 GLN A HE21 11 
ATOM 9103  H HE22 . GLN A 1 13 ? 0.343   14.315  -2.912  1.00 0.00 ? 13 GLN A HE22 11 
ATOM 9104  N N    . PRO A 1 14 ? 3.356   9.237   0.464   1.00 0.00 ? 14 PRO A N    11 
ATOM 9105  C CA   . PRO A 1 14 ? 3.561   8.290   1.549   1.00 0.00 ? 14 PRO A CA   11 
ATOM 9106  C C    . PRO A 1 14 ? 2.464   7.233   1.698   1.00 0.00 ? 14 PRO A C    11 
ATOM 9107  O O    . PRO A 1 14 ? 1.309   7.457   1.349   1.00 0.00 ? 14 PRO A O    11 
ATOM 9108  C CB   . PRO A 1 14 ? 3.621   9.180   2.798   1.00 0.00 ? 14 PRO A CB   11 
ATOM 9109  C CG   . PRO A 1 14 ? 2.768   10.403  2.445   1.00 0.00 ? 14 PRO A CG   11 
ATOM 9110  C CD   . PRO A 1 14 ? 2.962   10.566  0.935   1.00 0.00 ? 14 PRO A CD   11 
ATOM 9111  H HA   . PRO A 1 14 ? 4.484   7.754   1.379   1.00 0.00 ? 14 PRO A HA   11 
ATOM 9112  H HB2  . PRO A 1 14 ? 3.276   8.679   3.710   1.00 0.00 ? 14 PRO A HB2  11 
ATOM 9113  H HB3  . PRO A 1 14 ? 4.657   9.499   2.948   1.00 0.00 ? 14 PRO A HB3  11 
ATOM 9114  H HG2  . PRO A 1 14 ? 1.696   10.118  2.615   1.00 0.00 ? 14 PRO A HG2  11 
ATOM 9115  H HG3  . PRO A 1 14 ? 3.153   11.314  2.973   1.00 0.00 ? 14 PRO A HG3  11 
ATOM 9116  H HD2  . PRO A 1 14 ? 2.050   10.916  0.451   1.00 0.00 ? 14 PRO A HD2  11 
ATOM 9117  H HD3  . PRO A 1 14 ? 3.763   11.279  0.735   1.00 0.00 ? 14 PRO A HD3  11 
ATOM 9118  N N    . CYS A 1 15 ? 2.899   6.088   2.278   1.00 0.00 ? 15 CYS A N    11 
ATOM 9119  C CA   . CYS A 1 15 ? 1.976   5.002   2.617   1.00 0.00 ? 15 CYS A CA   11 
ATOM 9120  C C    . CYS A 1 15 ? 0.795   5.591   3.400   1.00 0.00 ? 15 CYS A C    11 
ATOM 9121  O O    . CYS A 1 15 ? 0.968   6.462   4.246   1.00 0.00 ? 15 CYS A O    11 
ATOM 9122  C CB   . CYS A 1 15 ? 2.619   4.007   3.596   1.00 0.00 ? 15 CYS A CB   11 
ATOM 9123  S SG   . CYS A 1 15 ? 3.727   2.771   2.874   1.00 0.00 ? 15 CYS A SG   11 
ATOM 9124  H H    . CYS A 1 15 ? 3.876   6.035   2.507   1.00 0.00 ? 15 CYS A H    11 
ATOM 9125  H HA   . CYS A 1 15 ? 1.608   4.528   1.706   1.00 0.00 ? 15 CYS A HA   11 
ATOM 9126  H HB2  . CYS A 1 15 ? 3.134   4.552   4.380   1.00 0.00 ? 15 CYS A HB2  11 
ATOM 9127  H HB3  . CYS A 1 15 ? 1.852   3.432   4.109   1.00 0.00 ? 15 CYS A HB3  11 
ATOM 9128  N N    . LYS A 1 16 ? -0.401  5.077   3.063   1.00 0.00 ? 16 LYS A N    11 
ATOM 9129  C CA   . LYS A 1 16 ? -1.608  5.593   3.683   1.00 0.00 ? 16 LYS A CA   11 
ATOM 9130  C C    . LYS A 1 16 ? -2.239  4.504   4.548   1.00 0.00 ? 16 LYS A C    11 
ATOM 9131  O O    . LYS A 1 16 ? -2.681  3.467   4.084   1.00 0.00 ? 16 LYS A O    11 
ATOM 9132  C CB   . LYS A 1 16 ? -2.556  6.101   2.581   1.00 0.00 ? 16 LYS A CB   11 
ATOM 9133  C CG   . LYS A 1 16 ? -3.753  6.980   3.028   1.00 0.00 ? 16 LYS A CG   11 
ATOM 9134  C CD   . LYS A 1 16 ? -3.392  8.115   4.000   1.00 0.00 ? 16 LYS A CD   11 
ATOM 9135  C CE   . LYS A 1 16 ? -3.326  7.629   5.454   1.00 0.00 ? 16 LYS A CE   11 
ATOM 9136  N NZ   . LYS A 1 16 ? -4.028  8.356   6.505   1.00 0.00 ? 16 LYS A NZ   11 
ATOM 9137  H H    . LYS A 1 16 ? -0.467  4.344   2.381   1.00 0.00 ? 16 LYS A H    11 
ATOM 9138  H HA   . LYS A 1 16 ? -1.307  6.420   4.318   1.00 0.00 ? 16 LYS A HA   11 
ATOM 9139  H HB2  . LYS A 1 16 ? -1.959  6.705   1.897   1.00 0.00 ? 16 LYS A HB2  11 
ATOM 9140  H HB3  . LYS A 1 16 ? -2.893  5.222   2.018   1.00 0.00 ? 16 LYS A HB3  11 
ATOM 9141  H HG2  . LYS A 1 16 ? -4.199  7.479   2.163   1.00 0.00 ? 16 LYS A HG2  11 
ATOM 9142  H HG3  . LYS A 1 16 ? -4.546  6.349   3.434   1.00 0.00 ? 16 LYS A HG3  11 
ATOM 9143  H HD2  . LYS A 1 16 ? -2.471  8.590   3.638   1.00 0.00 ? 16 LYS A HD2  11 
ATOM 9144  H HD3  . LYS A 1 16 ? -4.170  8.865   3.958   1.00 0.00 ? 16 LYS A HD3  11 
ATOM 9145  H HE2  . LYS A 1 16 ? -3.798  6.652   5.468   1.00 0.00 ? 16 LYS A HE2  11 
ATOM 9146  H HE3  . LYS A 1 16 ? -2.293  7.535   5.786   1.00 0.00 ? 16 LYS A HE3  11 
ATOM 9147  H HZ1  . LYS A 1 16 ? -3.982  7.727   7.347   1.00 0.00 ? 16 LYS A HZ1  11 
ATOM 9148  H HZ2  . LYS A 1 16 ? -5.026  8.495   6.250   1.00 0.00 ? 16 LYS A HZ2  11 
ATOM 9149  H HZ3  . LYS A 1 16 ? -3.574  9.267   6.713   1.00 0.00 ? 16 LYS A HZ3  11 
ATOM 9150  N N    . PHE A 1 17 ? -2.257  4.844   5.845   1.00 0.00 ? 17 PHE A N    11 
ATOM 9151  C CA   . PHE A 1 17 ? -2.880  4.026   6.869   1.00 0.00 ? 17 PHE A CA   11 
ATOM 9152  C C    . PHE A 1 17 ? -3.978  4.922   7.502   1.00 0.00 ? 17 PHE A C    11 
ATOM 9153  O O    . PHE A 1 17 ? -3.718  6.096   7.785   1.00 0.00 ? 17 PHE A O    11 
ATOM 9154  C CB   . PHE A 1 17 ? -1.825  3.642   7.928   1.00 0.00 ? 17 PHE A CB   11 
ATOM 9155  C CG   . PHE A 1 17 ? -0.653  2.875   7.362   1.00 0.00 ? 17 PHE A CG   11 
ATOM 9156  C CD1  . PHE A 1 17 ? -0.824  1.631   6.764   1.00 0.00 ? 17 PHE A CD1  11 
ATOM 9157  C CD2  . PHE A 1 17 ? 0.635   3.389   7.457   1.00 0.00 ? 17 PHE A CD2  11 
ATOM 9158  C CE1  . PHE A 1 17 ? 0.272   0.909   6.306   1.00 0.00 ? 17 PHE A CE1  11 
ATOM 9159  C CE2  . PHE A 1 17 ? 1.730   2.669   7.003   1.00 0.00 ? 17 PHE A CE2  11 
ATOM 9160  C CZ   . PHE A 1 17 ? 1.556   1.414   6.440   1.00 0.00 ? 17 PHE A CZ   11 
ATOM 9161  H H    . PHE A 1 17 ? -1.880  5.732   6.100   1.00 0.00 ? 17 PHE A H    11 
ATOM 9162  H HA   . PHE A 1 17 ? -3.299  3.148   6.375   1.00 0.00 ? 17 PHE A HA   11 
ATOM 9163  H HB2  . PHE A 1 17 ? -1.447  4.556   8.402   1.00 0.00 ? 17 PHE A HB2  11 
ATOM 9164  H HB3  . PHE A 1 17 ? -2.267  3.020   8.717   1.00 0.00 ? 17 PHE A HB3  11 
ATOM 9165  H HD1  . PHE A 1 17 ? -1.811  1.211   6.656   1.00 0.00 ? 17 PHE A HD1  11 
ATOM 9166  H HD2  . PHE A 1 17 ? 0.803   4.355   7.898   1.00 0.00 ? 17 PHE A HD2  11 
ATOM 9167  H HE1  . PHE A 1 17 ? 0.128   -0.048  5.844   1.00 0.00 ? 17 PHE A HE1  11 
ATOM 9168  H HE2  . PHE A 1 17 ? 2.711   3.102   7.094   1.00 0.00 ? 17 PHE A HE2  11 
ATOM 9169  H HZ   . PHE A 1 17 ? 2.410   0.823   6.125   1.00 0.00 ? 17 PHE A HZ   11 
ATOM 9170  N N    . PRO A 1 18 ? -5.216  4.388   7.679   1.00 0.00 ? 18 PRO A N    11 
ATOM 9171  C CA   . PRO A 1 18 ? -5.712  3.136   7.108   1.00 0.00 ? 18 PRO A CA   11 
ATOM 9172  C C    . PRO A 1 18 ? -6.127  3.325   5.631   1.00 0.00 ? 18 PRO A C    11 
ATOM 9173  O O    . PRO A 1 18 ? -6.756  4.318   5.286   1.00 0.00 ? 18 PRO A O    11 
ATOM 9174  C CB   . PRO A 1 18 ? -6.944  2.811   7.963   1.00 0.00 ? 18 PRO A CB   11 
ATOM 9175  C CG   . PRO A 1 18 ? -7.467  4.181   8.406   1.00 0.00 ? 18 PRO A CG   11 
ATOM 9176  C CD   . PRO A 1 18 ? -6.216  5.062   8.505   1.00 0.00 ? 18 PRO A CD   11 
ATOM 9177  H HA   . PRO A 1 18 ? -4.974  2.352   7.205   1.00 0.00 ? 18 PRO A HA   11 
ATOM 9178  H HB2  . PRO A 1 18 ? -7.697  2.196   7.462   1.00 0.00 ? 18 PRO A HB2  11 
ATOM 9179  H HB3  . PRO A 1 18 ? -6.619  2.257   8.845   1.00 0.00 ? 18 PRO A HB3  11 
ATOM 9180  H HG2  . PRO A 1 18 ? -8.133  4.580   7.639   1.00 0.00 ? 18 PRO A HG2  11 
ATOM 9181  H HG3  . PRO A 1 18 ? -8.025  4.135   9.342   1.00 0.00 ? 18 PRO A HG3  11 
ATOM 9182  H HD2  . PRO A 1 18 ? -6.406  6.077   8.146   1.00 0.00 ? 18 PRO A HD2  11 
ATOM 9183  H HD3  . PRO A 1 18 ? -5.854  5.099   9.537   1.00 0.00 ? 18 PRO A HD3  11 
ATOM 9184  N N    . PHE A 1 19 ? -5.756  2.331   4.798   1.00 0.00 ? 19 PHE A N    11 
ATOM 9185  C CA   . PHE A 1 19 ? -6.158  2.322   3.389   1.00 0.00 ? 19 PHE A CA   11 
ATOM 9186  C C    . PHE A 1 19 ? -7.175  1.179   3.211   1.00 0.00 ? 19 PHE A C    11 
ATOM 9187  O O    . PHE A 1 19 ? -7.045  0.113   3.797   1.00 0.00 ? 19 PHE A O    11 
ATOM 9188  C CB   . PHE A 1 19 ? -4.989  2.143   2.392   1.00 0.00 ? 19 PHE A CB   11 
ATOM 9189  C CG   . PHE A 1 19 ? -4.227  0.816   2.527   1.00 0.00 ? 19 PHE A CG   11 
ATOM 9190  C CD1  . PHE A 1 19 ? -3.313  0.516   3.559   1.00 0.00 ? 19 PHE A CD1  11 
ATOM 9191  C CD2  . PHE A 1 19 ? -4.448  -0.161  1.547   1.00 0.00 ? 19 PHE A CD2  11 
ATOM 9192  C CE1  . PHE A 1 19 ? -2.607  -0.680  3.560   1.00 0.00 ? 19 PHE A CE1  11 
ATOM 9193  C CE2  . PHE A 1 19 ? -3.739  -1.383  1.563   1.00 0.00 ? 19 PHE A CE2  11 
ATOM 9194  C CZ   . PHE A 1 19 ? -2.811  -1.620  2.564   1.00 0.00 ? 19 PHE A CZ   11 
ATOM 9195  H H    . PHE A 1 19 ? -5.252  1.553   5.176   1.00 0.00 ? 19 PHE A H    11 
ATOM 9196  H HA   . PHE A 1 19 ? -6.660  3.264   3.160   1.00 0.00 ? 19 PHE A HA   11 
ATOM 9197  H HB2  . PHE A 1 19 ? -5.459  2.139   1.394   1.00 0.00 ? 19 PHE A HB2  11 
ATOM 9198  H HB3  . PHE A 1 19 ? -4.343  3.044   2.381   1.00 0.00 ? 19 PHE A HB3  11 
ATOM 9199  H HD1  . PHE A 1 19 ? -3.096  1.127   4.430   1.00 0.00 ? 19 PHE A HD1  11 
ATOM 9200  H HD2  . PHE A 1 19 ? -5.201  0.124   0.805   1.00 0.00 ? 19 PHE A HD2  11 
ATOM 9201  H HE1  . PHE A 1 19 ? -1.903  -0.878  4.359   1.00 0.00 ? 19 PHE A HE1  11 
ATOM 9202  H HE2  . PHE A 1 19 ? -3.824  -2.221  0.861   1.00 0.00 ? 19 PHE A HE2  11 
ATOM 9203  H HZ   . PHE A 1 19 ? -2.254  -2.548  2.558   1.00 0.00 ? 19 PHE A HZ   11 
ATOM 9204  N N    . ARG A 1 20 ? -8.199  1.459   2.389   1.00 0.00 ? 20 ARG A N    11 
ATOM 9205  C CA   . ARG A 1 20 ? -9.255  0.483   2.126   1.00 0.00 ? 20 ARG A CA   11 
ATOM 9206  C C    . ARG A 1 20 ? -8.886  -0.305  0.858   1.00 0.00 ? 20 ARG A C    11 
ATOM 9207  O O    . ARG A 1 20 ? -8.566  0.283   -0.167  1.00 0.00 ? 20 ARG A O    11 
ATOM 9208  C CB   . ARG A 1 20 ? -10.575 1.268   1.949   1.00 0.00 ? 20 ARG A CB   11 
ATOM 9209  C CG   . ARG A 1 20 ? -11.812 0.481   1.490   1.00 0.00 ? 20 ARG A CG   11 
ATOM 9210  C CD   . ARG A 1 20 ? -12.422 -0.441  2.584   1.00 0.00 ? 20 ARG A CD   11 
ATOM 9211  N NE   . ARG A 1 20 ? -12.351 0.172   3.934   1.00 0.00 ? 20 ARG A NE   11 
ATOM 9212  C CZ   . ARG A 1 20 ? -13.121 1.226   4.281   1.00 0.00 ? 20 ARG A CZ   11 
ATOM 9213  N NH1  . ARG A 1 20 ? -13.953 1.777   3.402   1.00 0.00 ? 20 ARG A NH1  11 
ATOM 9214  N NH2  . ARG A 1 20 ? -13.024 1.704   5.517   1.00 0.00 ? 20 ARG A NH2  11 
ATOM 9215  H H    . ARG A 1 20 ? -8.237  2.361   1.953   1.00 0.00 ? 20 ARG A H    11 
ATOM 9216  H HA   . ARG A 1 20 ? -9.296  -0.195  2.982   1.00 0.00 ? 20 ARG A HA   11 
ATOM 9217  H HB2  . ARG A 1 20 ? -10.793 1.832   2.856   1.00 0.00 ? 20 ARG A HB2  11 
ATOM 9218  H HB3  . ARG A 1 20 ? -10.433 2.029   1.191   1.00 0.00 ? 20 ARG A HB3  11 
ATOM 9219  H HG2  . ARG A 1 20 ? -12.566 1.217   1.213   1.00 0.00 ? 20 ARG A HG2  11 
ATOM 9220  H HG3  . ARG A 1 20 ? -11.582 -0.004  0.525   1.00 0.00 ? 20 ARG A HG3  11 
ATOM 9221  H HD2  . ARG A 1 20 ? -13.478 -0.699  2.377   1.00 0.00 ? 20 ARG A HD2  11 
ATOM 9222  H HD3  . ARG A 1 20 ? -11.884 -1.390  2.629   1.00 0.00 ? 20 ARG A HD3  11 
ATOM 9223  H HE   . ARG A 1 20 ? -11.720 -0.103  4.682   1.00 0.00 ? 20 ARG A HE   11 
ATOM 9224  H HH11 . ARG A 1 20 ? -13.978 1.410   2.471   1.00 0.00 ? 20 ARG A HH11 11 
ATOM 9225  H HH12 . ARG A 1 20 ? -14.545 2.547   3.634   1.00 0.00 ? 20 ARG A HH12 11 
ATOM 9226  H HH21 . ARG A 1 20 ? -12.404 1.229   6.160   1.00 0.00 ? 20 ARG A HH21 11 
ATOM 9227  H HH22 . ARG A 1 20 ? -13.536 2.501   5.832   1.00 0.00 ? 20 ARG A HH22 11 
ATOM 9228  N N    . PHE A 1 21 ? -8.942  -1.645  0.989   1.00 0.00 ? 21 PHE A N    11 
ATOM 9229  C CA   . PHE A 1 21 ? -8.641  -2.549  -0.120  1.00 0.00 ? 21 PHE A CA   11 
ATOM 9230  C C    . PHE A 1 21 ? -9.562  -3.768  0.053   1.00 0.00 ? 21 PHE A C    11 
ATOM 9231  O O    . PHE A 1 21 ? -9.818  -4.212  1.161   1.00 0.00 ? 21 PHE A O    11 
ATOM 9232  C CB   . PHE A 1 21 ? -7.162  -2.950  -0.056  1.00 0.00 ? 21 PHE A CB   11 
ATOM 9233  C CG   . PHE A 1 21 ? -6.794  -4.058  -1.011  1.00 0.00 ? 21 PHE A CG   11 
ATOM 9234  C CD1  . PHE A 1 21 ? -7.114  -3.981  -2.358  1.00 0.00 ? 21 PHE A CD1  11 
ATOM 9235  C CD2  . PHE A 1 21 ? -6.111  -5.175  -0.555  1.00 0.00 ? 21 PHE A CD2  11 
ATOM 9236  C CE1  . PHE A 1 21 ? -6.701  -4.962  -3.250  1.00 0.00 ? 21 PHE A CE1  11 
ATOM 9237  C CE2  . PHE A 1 21 ? -5.700  -6.169  -1.433  1.00 0.00 ? 21 PHE A CE2  11 
ATOM 9238  C CZ   . PHE A 1 21 ? -5.982  -6.057  -2.788  1.00 0.00 ? 21 PHE A CZ   11 
ATOM 9239  H H    . PHE A 1 21 ? -9.204  -2.066  1.869   1.00 0.00 ? 21 PHE A H    11 
ATOM 9240  H HA   . PHE A 1 21 ? -8.857  -2.060  -1.080  1.00 0.00 ? 21 PHE A HA   11 
ATOM 9241  H HB2  . PHE A 1 21 ? -6.535  -2.079  -0.280  1.00 0.00 ? 21 PHE A HB2  11 
ATOM 9242  H HB3  . PHE A 1 21 ? -6.930  -3.292  0.953   1.00 0.00 ? 21 PHE A HB3  11 
ATOM 9243  H HD1  . PHE A 1 21 ? -7.724  -3.160  -2.693  1.00 0.00 ? 21 PHE A HD1  11 
ATOM 9244  H HD2  . PHE A 1 21 ? -5.924  -5.266  0.500   1.00 0.00 ? 21 PHE A HD2  11 
ATOM 9245  H HE1  . PHE A 1 21 ? -6.951  -4.876  -4.298  1.00 0.00 ? 21 PHE A HE1  11 
ATOM 9246  H HE2  . PHE A 1 21 ? -5.168  -7.033  -1.059  1.00 0.00 ? 21 PHE A HE2  11 
ATOM 9247  H HZ   . PHE A 1 21 ? -5.656  -6.826  -3.474  1.00 0.00 ? 21 PHE A HZ   11 
ATOM 9248  N N    . GLN A 1 22 ? -10.078 -4.273  -1.073  1.00 0.00 ? 22 GLN A N    11 
ATOM 9249  C CA   . GLN A 1 22 ? -11.018 -5.386  -1.100  1.00 0.00 ? 22 GLN A CA   11 
ATOM 9250  C C    . GLN A 1 22 ? -12.236 -5.140  -0.162  1.00 0.00 ? 22 GLN A C    11 
ATOM 9251  O O    . GLN A 1 22 ? -12.869 -6.082  0.296   1.00 0.00 ? 22 GLN A O    11 
ATOM 9252  C CB   . GLN A 1 22 ? -10.358 -6.756  -0.758  1.00 0.00 ? 22 GLN A CB   11 
ATOM 9253  C CG   . GLN A 1 22 ? -9.226  -7.232  -1.704  1.00 0.00 ? 22 GLN A CG   11 
ATOM 9254  C CD   . GLN A 1 22 ? -8.367  -8.364  -1.106  1.00 0.00 ? 22 GLN A CD   11 
ATOM 9255  O OE1  . GLN A 1 22 ? -8.122  -9.364  -1.767  1.00 0.00 ? 22 GLN A OE1  11 
ATOM 9256  N NE2  . GLN A 1 22 ? -7.910  -8.190  0.140   1.00 0.00 ? 22 GLN A NE2  11 
ATOM 9257  H H    . GLN A 1 22 ? -9.856  -3.803  -1.931  1.00 0.00 ? 22 GLN A H    11 
ATOM 9258  H HA   . GLN A 1 22 ? -11.395 -5.344  -2.119  1.00 0.00 ? 22 GLN A HA   11 
ATOM 9259  H HB2  . GLN A 1 22 ? -9.997  -6.697  0.270   1.00 0.00 ? 22 GLN A HB2  11 
ATOM 9260  H HB3  . GLN A 1 22 ? -11.120 -7.537  -0.766  1.00 0.00 ? 22 GLN A HB3  11 
ATOM 9261  H HG2  . GLN A 1 22 ? -9.621  -7.716  -2.622  1.00 0.00 ? 22 GLN A HG2  11 
ATOM 9262  H HG3  . GLN A 1 22 ? -8.580  -6.376  -1.949  1.00 0.00 ? 22 GLN A HG3  11 
ATOM 9263  H HE21 . GLN A 1 22 ? -8.048  -7.413  0.762   1.00 0.00 ? 22 GLN A HE21 11 
ATOM 9264  H HE22 . GLN A 1 22 ? -7.332  -8.911  0.535   1.00 0.00 ? 22 GLN A HE22 11 
ATOM 9265  N N    . GLY A 1 23 ? -12.527 -3.847  0.115   1.00 0.00 ? 23 GLY A N    11 
ATOM 9266  C CA   . GLY A 1 23 ? -13.655 -3.530  0.995   1.00 0.00 ? 23 GLY A CA   11 
ATOM 9267  C C    . GLY A 1 23 ? -13.332 -3.599  2.507   1.00 0.00 ? 23 GLY A C    11 
ATOM 9268  O O    . GLY A 1 23 ? -14.185 -3.306  3.335   1.00 0.00 ? 23 GLY A O    11 
ATOM 9269  H H    . GLY A 1 23 ? -11.984 -3.109  -0.303  1.00 0.00 ? 23 GLY A H    11 
ATOM 9270  H HA2  . GLY A 1 23 ? -13.953 -2.508  0.747   1.00 0.00 ? 23 GLY A HA2  11 
ATOM 9271  H HA3  . GLY A 1 23 ? -14.481 -4.212  0.767   1.00 0.00 ? 23 GLY A HA3  11 
ATOM 9272  N N    . THR A 1 24 ? -12.073 -3.948  2.826   1.00 0.00 ? 24 THR A N    11 
ATOM 9273  C CA   . THR A 1 24 ? -11.596 -4.041  4.207   1.00 0.00 ? 24 THR A CA   11 
ATOM 9274  C C    . THR A 1 24 ? -10.570 -2.916  4.436   1.00 0.00 ? 24 THR A C    11 
ATOM 9275  O O    . THR A 1 24 ? -9.885  -2.502  3.513   1.00 0.00 ? 24 THR A O    11 
ATOM 9276  C CB   . THR A 1 24 ? -10.958 -5.430  4.381   1.00 0.00 ? 24 THR A CB   11 
ATOM 9277  O OG1  . THR A 1 24 ? -11.965 -6.375  4.057   1.00 0.00 ? 24 THR A OG1  11 
ATOM 9278  C CG2  . THR A 1 24 ? -10.433 -5.683  5.806   1.00 0.00 ? 24 THR A CG2  11 
ATOM 9279  H H    . THR A 1 24 ? -11.418 -4.167  2.102   1.00 0.00 ? 24 THR A H    11 
ATOM 9280  H HA   . THR A 1 24 ? -12.440 -3.915  4.887   1.00 0.00 ? 24 THR A HA   11 
ATOM 9281  H HB   . THR A 1 24 ? -10.131 -5.516  3.666   1.00 0.00 ? 24 THR A HB   11 
ATOM 9282  H HG1  . THR A 1 24 ? -11.613 -7.259  4.034   1.00 0.00 ? 24 THR A HG1  11 
ATOM 9283  H HG21 . THR A 1 24 ? -11.234 -5.591  6.540   1.00 0.00 ? 24 THR A HG21 11 
ATOM 9284  H HG22 . THR A 1 24 ? -9.647  -4.977  6.075   1.00 0.00 ? 24 THR A HG22 11 
ATOM 9285  H HG23 . THR A 1 24 ? -10.001 -6.679  5.908   1.00 0.00 ? 24 THR A HG23 11 
ATOM 9286  N N    . SER A 1 25 ? -10.507 -2.415  5.689   1.00 0.00 ? 25 SER A N    11 
ATOM 9287  C CA   . SER A 1 25 ? -9.558  -1.352  6.007   1.00 0.00 ? 25 SER A CA   11 
ATOM 9288  C C    . SER A 1 25 ? -8.280  -1.985  6.586   1.00 0.00 ? 25 SER A C    11 
ATOM 9289  O O    . SER A 1 25 ? -8.338  -2.871  7.427   1.00 0.00 ? 25 SER A O    11 
ATOM 9290  C CB   . SER A 1 25 ? -10.207 -0.358  6.976   1.00 0.00 ? 25 SER A CB   11 
ATOM 9291  O OG   . SER A 1 25 ? -11.574 -0.143  6.640   1.00 0.00 ? 25 SER A OG   11 
ATOM 9292  H H    . SER A 1 25 ? -11.053 -2.792  6.432   1.00 0.00 ? 25 SER A H    11 
ATOM 9293  H HA   . SER A 1 25 ? -9.311  -0.822  5.085   1.00 0.00 ? 25 SER A HA   11 
ATOM 9294  H HB2  . SER A 1 25 ? -10.090 -0.653  8.026   1.00 0.00 ? 25 SER A HB2  11 
ATOM 9295  H HB3  . SER A 1 25 ? -9.689  0.594   6.893   1.00 0.00 ? 25 SER A HB3  11 
ATOM 9296  H HG   . SER A 1 25 ? -12.075 -0.927  6.867   1.00 0.00 ? 25 SER A HG   11 
ATOM 9297  N N    . TYR A 1 26 ? -7.148  -1.495  6.057   1.00 0.00 ? 26 TYR A N    11 
ATOM 9298  C CA   . TYR A 1 26 ? -5.819  -1.987  6.379   1.00 0.00 ? 26 TYR A CA   11 
ATOM 9299  C C    . TYR A 1 26 ? -5.018  -0.853  7.017   1.00 0.00 ? 26 TYR A C    11 
ATOM 9300  O O    . TYR A 1 26 ? -4.845  0.203   6.424   1.00 0.00 ? 26 TYR A O    11 
ATOM 9301  C CB   . TYR A 1 26 ? -5.074  -2.341  5.081   1.00 0.00 ? 26 TYR A CB   11 
ATOM 9302  C CG   . TYR A 1 26 ? -5.620  -3.540  4.364   1.00 0.00 ? 26 TYR A CG   11 
ATOM 9303  C CD1  . TYR A 1 26 ? -6.878  -3.523  3.778   1.00 0.00 ? 26 TYR A CD1  11 
ATOM 9304  C CD2  . TYR A 1 26 ? -4.850  -4.688  4.255   1.00 0.00 ? 26 TYR A CD2  11 
ATOM 9305  C CE1  . TYR A 1 26 ? -7.359  -4.649  3.136   1.00 0.00 ? 26 TYR A CE1  11 
ATOM 9306  C CE2  . TYR A 1 26 ? -5.329  -5.801  3.586   1.00 0.00 ? 26 TYR A CE2  11 
ATOM 9307  C CZ   . TYR A 1 26 ? -6.600  -5.797  3.038   1.00 0.00 ? 26 TYR A CZ   11 
ATOM 9308  O OH   . TYR A 1 26 ? -7.133  -6.891  2.383   1.00 0.00 ? 26 TYR A OH   11 
ATOM 9309  H H    . TYR A 1 26 ? -7.192  -0.765  5.374   1.00 0.00 ? 26 TYR A H    11 
ATOM 9310  H HA   . TYR A 1 26 ? -5.880  -2.839  7.059   1.00 0.00 ? 26 TYR A HA   11 
ATOM 9311  H HB2  . TYR A 1 26 ? -5.120  -1.506  4.380   1.00 0.00 ? 26 TYR A HB2  11 
ATOM 9312  H HB3  . TYR A 1 26 ? -4.025  -2.549  5.318   1.00 0.00 ? 26 TYR A HB3  11 
ATOM 9313  H HD1  . TYR A 1 26 ? -7.488  -2.632  3.790   1.00 0.00 ? 26 TYR A HD1  11 
ATOM 9314  H HD2  . TYR A 1 26 ? -3.862  -4.713  4.683   1.00 0.00 ? 26 TYR A HD2  11 
ATOM 9315  H HE1  . TYR A 1 26 ? -8.324  -4.621  2.680   1.00 0.00 ? 26 TYR A HE1  11 
ATOM 9316  H HE2  . TYR A 1 26 ? -4.679  -6.642  3.483   1.00 0.00 ? 26 TYR A HE2  11 
ATOM 9317  H HH   . TYR A 1 26 ? -6.571  -7.669  2.459   1.00 0.00 ? 26 TYR A HH   11 
ATOM 9318  N N    . ASP A 1 27 ? -4.511  -1.153  8.225   1.00 0.00 ? 27 ASP A N    11 
ATOM 9319  C CA   . ASP A 1 27 ? -3.683  -0.199  8.961   1.00 0.00 ? 27 ASP A CA   11 
ATOM 9320  C C    . ASP A 1 27 ? -2.270  -0.785  9.136   1.00 0.00 ? 27 ASP A C    11 
ATOM 9321  O O    . ASP A 1 27 ? -1.569  -0.532  10.106  1.00 0.00 ? 27 ASP A O    11 
ATOM 9322  C CB   . ASP A 1 27 ? -4.386  0.125   10.294  1.00 0.00 ? 27 ASP A CB   11 
ATOM 9323  C CG   . ASP A 1 27 ? -4.032  1.534   10.797  1.00 0.00 ? 27 ASP A CG   11 
ATOM 9324  O OD1  . ASP A 1 27 ? -4.272  2.493   10.062  1.00 0.00 ? 27 ASP A OD1  11 
ATOM 9325  O OD2  . ASP A 1 27 ? -3.538  1.662   11.915  1.00 0.00 ? 27 ASP A OD2  11 
ATOM 9326  H H    . ASP A 1 27 ? -4.719  -2.038  8.638   1.00 0.00 ? 27 ASP A H    11 
ATOM 9327  H HA   . ASP A 1 27 ? -3.570  0.709   8.370   1.00 0.00 ? 27 ASP A HA   11 
ATOM 9328  H HB2  . ASP A 1 27 ? -5.468  0.107   10.160  1.00 0.00 ? 27 ASP A HB2  11 
ATOM 9329  H HB3  . ASP A 1 27 ? -4.153  -0.617  11.059  1.00 0.00 ? 27 ASP A HB3  11 
ATOM 9330  N N    . SER A 1 28 ? -1.887  -1.610  8.135   1.00 0.00 ? 28 SER A N    11 
ATOM 9331  C CA   . SER A 1 28 ? -0.571  -2.223  8.181   1.00 0.00 ? 28 SER A CA   11 
ATOM 9332  C C    . SER A 1 28 ? -0.270  -2.839  6.804   1.00 0.00 ? 28 SER A C    11 
ATOM 9333  O O    . SER A 1 28 ? -1.156  -3.074  5.990   1.00 0.00 ? 28 SER A O    11 
ATOM 9334  C CB   . SER A 1 28 ? -0.531  -3.296  9.298   1.00 0.00 ? 28 SER A CB   11 
ATOM 9335  O OG   . SER A 1 28 ? -1.547  -4.263  9.102   1.00 0.00 ? 28 SER A OG   11 
ATOM 9336  H H    . SER A 1 28 ? -2.444  -1.828  7.332   1.00 0.00 ? 28 SER A H    11 
ATOM 9337  H HA   . SER A 1 28 ? 0.160   -1.424  8.343   1.00 0.00 ? 28 SER A HA   11 
ATOM 9338  H HB2  . SER A 1 28 ? 0.433   -3.838  9.256   1.00 0.00 ? 28 SER A HB2  11 
ATOM 9339  H HB3  . SER A 1 28 ? -0.683  -2.841  10.303  1.00 0.00 ? 28 SER A HB3  11 
ATOM 9340  H HG   . SER A 1 28 ? -2.392  -3.832  9.017   1.00 0.00 ? 28 SER A HG   11 
ATOM 9341  N N    . CYS A 1 29 ? 1.041   -3.072  6.635   1.00 0.00 ? 29 CYS A N    11 
ATOM 9342  C CA   . CYS A 1 29 ? 1.645   -3.674  5.451   1.00 0.00 ? 29 CYS A CA   11 
ATOM 9343  C C    . CYS A 1 29 ? 1.079   -5.073  5.103   1.00 0.00 ? 29 CYS A C    11 
ATOM 9344  O O    . CYS A 1 29 ? 1.137   -5.974  5.938   1.00 0.00 ? 29 CYS A O    11 
ATOM 9345  C CB   . CYS A 1 29 ? 3.101   -3.893  5.857   1.00 0.00 ? 29 CYS A CB   11 
ATOM 9346  S SG   . CYS A 1 29 ? 3.897   -2.384  6.445   1.00 0.00 ? 29 CYS A SG   11 
ATOM 9347  H H    . CYS A 1 29 ? 1.665   -2.777  7.364   1.00 0.00 ? 29 CYS A H    11 
ATOM 9348  H HA   . CYS A 1 29 ? 1.558   -2.970  4.622   1.00 0.00 ? 29 CYS A HA   11 
ATOM 9349  H HB2  . CYS A 1 29 ? 3.158   -4.624  6.674   1.00 0.00 ? 29 CYS A HB2  11 
ATOM 9350  H HB3  . CYS A 1 29 ? 3.667   -4.287  5.012   1.00 0.00 ? 29 CYS A HB3  11 
ATOM 9351  N N    . THR A 1 30 ? 0.585   -5.252  3.852   1.00 0.00 ? 30 THR A N    11 
ATOM 9352  C CA   . THR A 1 30 ? 0.104   -6.577  3.439   1.00 0.00 ? 30 THR A CA   11 
ATOM 9353  C C    . THR A 1 30 ? 0.900   -7.042  2.218   1.00 0.00 ? 30 THR A C    11 
ATOM 9354  O O    . THR A 1 30 ? 1.645   -6.291  1.612   1.00 0.00 ? 30 THR A O    11 
ATOM 9355  C CB   . THR A 1 30 ? -1.413  -6.611  3.177   1.00 0.00 ? 30 THR A CB   11 
ATOM 9356  O OG1  . THR A 1 30 ? -1.737  -7.976  2.942   1.00 0.00 ? 30 THR A OG1  11 
ATOM 9357  C CG2  . THR A 1 30 ? -1.844  -5.756  1.965   1.00 0.00 ? 30 THR A CG2  11 
ATOM 9358  H H    . THR A 1 30 ? 0.579   -4.527  3.151   1.00 0.00 ? 30 THR A H    11 
ATOM 9359  H HA   . THR A 1 30 ? 0.311   -7.292  4.234   1.00 0.00 ? 30 THR A HA   11 
ATOM 9360  H HB   . THR A 1 30 ? -1.899  -6.264  4.102   1.00 0.00 ? 30 THR A HB   11 
ATOM 9361  H HG1  . THR A 1 30 ? -2.685  -8.132  3.015   1.00 0.00 ? 30 THR A HG1  11 
ATOM 9362  H HG21 . THR A 1 30 ? -1.428  -6.144  1.033   1.00 0.00 ? 30 THR A HG21 11 
ATOM 9363  H HG22 . THR A 1 30 ? -1.506  -4.723  2.056   1.00 0.00 ? 30 THR A HG22 11 
ATOM 9364  H HG23 . THR A 1 30 ? -2.927  -5.737  1.839   1.00 0.00 ? 30 THR A HG23 11 
ATOM 9365  N N    . THR A 1 31 ? 0.689   -8.330  1.909   1.00 0.00 ? 31 THR A N    11 
ATOM 9366  C CA   . THR A 1 31 ? 1.301   -8.989  0.759   1.00 0.00 ? 31 THR A CA   11 
ATOM 9367  C C    . THR A 1 31 ? 0.217   -9.463  -0.234  1.00 0.00 ? 31 THR A C    11 
ATOM 9368  O O    . THR A 1 31 ? 0.520   -10.018 -1.281  1.00 0.00 ? 31 THR A O    11 
ATOM 9369  C CB   . THR A 1 31 ? 2.167   -10.162 1.280   1.00 0.00 ? 31 THR A CB   11 
ATOM 9370  O OG1  . THR A 1 31 ? 2.237   -10.125 2.695   1.00 0.00 ? 31 THR A OG1  11 
ATOM 9371  C CG2  . THR A 1 31 ? 3.586   -10.145 0.691   1.00 0.00 ? 31 THR A CG2  11 
ATOM 9372  H H    . THR A 1 31 ? 0.058   -8.819  2.518   1.00 0.00 ? 31 THR A H    11 
ATOM 9373  H HA   . THR A 1 31 ? 1.922   -8.259  0.234   1.00 0.00 ? 31 THR A HA   11 
ATOM 9374  H HB   . THR A 1 31 ? 1.705   -11.118 1.021   1.00 0.00 ? 31 THR A HB   11 
ATOM 9375  H HG1  . THR A 1 31 ? 2.452   -9.232  2.934   1.00 0.00 ? 31 THR A HG1  11 
ATOM 9376  H HG21 . THR A 1 31 ? 4.186   -10.966 1.083   1.00 0.00 ? 31 THR A HG21 11 
ATOM 9377  H HG22 . THR A 1 31 ? 4.112   -9.217  0.916   1.00 0.00 ? 31 THR A HG22 11 
ATOM 9378  H HG23 . THR A 1 31 ? 3.558   -10.242 -0.395  1.00 0.00 ? 31 THR A HG23 11 
ATOM 9379  N N    . GLU A 1 32 ? -1.062  -9.228  0.134   1.00 0.00 ? 32 GLU A N    11 
ATOM 9380  C CA   . GLU A 1 32 ? -2.164  -9.657  -0.718  1.00 0.00 ? 32 GLU A CA   11 
ATOM 9381  C C    . GLU A 1 32 ? -2.059  -8.993  -2.101  1.00 0.00 ? 32 GLU A C    11 
ATOM 9382  O O    . GLU A 1 32 ? -2.125  -7.778  -2.224  1.00 0.00 ? 32 GLU A O    11 
ATOM 9383  C CB   . GLU A 1 32 ? -3.477  -9.262  -0.028  1.00 0.00 ? 32 GLU A CB   11 
ATOM 9384  C CG   . GLU A 1 32 ? -3.761  -10.121 1.215   1.00 0.00 ? 32 GLU A CG   11 
ATOM 9385  C CD   . GLU A 1 32 ? -4.743  -9.410  2.153   1.00 0.00 ? 32 GLU A CD   11 
ATOM 9386  O OE1  . GLU A 1 32 ? -5.921  -9.316  1.826   1.00 0.00 ? 32 GLU A OE1  11 
ATOM 9387  O OE2  . GLU A 1 32 ? -4.318  -8.934  3.200   1.00 0.00 ? 32 GLU A OE2  11 
ATOM 9388  H H    . GLU A 1 32 ? -1.321  -8.757  0.979   1.00 0.00 ? 32 GLU A H    11 
ATOM 9389  H HA   . GLU A 1 32 ? -2.093  -10.742 -0.819  1.00 0.00 ? 32 GLU A HA   11 
ATOM 9390  H HB2  . GLU A 1 32 ? -3.426  -8.204  0.239   1.00 0.00 ? 32 GLU A HB2  11 
ATOM 9391  H HB3  . GLU A 1 32 ? -4.321  -9.357  -0.715  1.00 0.00 ? 32 GLU A HB3  11 
ATOM 9392  H HG2  . GLU A 1 32 ? -4.184  -11.083 0.923   1.00 0.00 ? 32 GLU A HG2  11 
ATOM 9393  H HG3  . GLU A 1 32 ? -2.845  -10.347 1.763   1.00 0.00 ? 32 GLU A HG3  11 
ATOM 9394  N N    . GLY A 1 33 ? -1.883  -9.858  -3.118  1.00 0.00 ? 33 GLY A N    11 
ATOM 9395  C CA   . GLY A 1 33 ? -1.778  -9.385  -4.495  1.00 0.00 ? 33 GLY A CA   11 
ATOM 9396  C C    . GLY A 1 33 ? -0.359  -9.513  -5.064  1.00 0.00 ? 33 GLY A C    11 
ATOM 9397  O O    . GLY A 1 33 ? -0.172  -9.401  -6.268  1.00 0.00 ? 33 GLY A O    11 
ATOM 9398  H H    . GLY A 1 33 ? -1.825  -10.835 -2.915  1.00 0.00 ? 33 GLY A H    11 
ATOM 9399  H HA2  . GLY A 1 33 ? -2.451  -10.009 -5.087  1.00 0.00 ? 33 GLY A HA2  11 
ATOM 9400  H HA3  . GLY A 1 33 ? -2.101  -8.341  -4.562  1.00 0.00 ? 33 GLY A HA3  11 
ATOM 9401  N N    . ARG A 1 34 ? 0.623   -9.758  -4.171  1.00 0.00 ? 34 ARG A N    11 
ATOM 9402  C CA   . ARG A 1 34 ? 2.005   -9.904  -4.676  1.00 0.00 ? 34 ARG A CA   11 
ATOM 9403  C C    . ARG A 1 34 ? 2.516   -11.314 -4.362  1.00 0.00 ? 34 ARG A C    11 
ATOM 9404  O O    . ARG A 1 34 ? 2.365   -11.832 -3.265  1.00 0.00 ? 34 ARG A O    11 
ATOM 9405  C CB   . ARG A 1 34 ? 2.926   -8.888  -3.994  1.00 0.00 ? 34 ARG A CB   11 
ATOM 9406  C CG   . ARG A 1 34 ? 2.536   -7.439  -4.322  1.00 0.00 ? 34 ARG A CG   11 
ATOM 9407  C CD   . ARG A 1 34 ? 3.710   -6.466  -4.092  1.00 0.00 ? 34 ARG A CD   11 
ATOM 9408  N NE   . ARG A 1 34 ? 4.655   -6.570  -5.219  1.00 0.00 ? 34 ARG A NE   11 
ATOM 9409  C CZ   . ARG A 1 34 ? 4.650   -5.714  -6.268  1.00 0.00 ? 34 ARG A CZ   11 
ATOM 9410  N NH1  . ARG A 1 34 ? 3.767   -4.724  -6.328  1.00 0.00 ? 34 ARG A NH1  11 
ATOM 9411  N NH2  . ARG A 1 34 ? 5.538   -5.870  -7.240  1.00 0.00 ? 34 ARG A NH2  11 
ATOM 9412  H H    . ARG A 1 34 ? 0.399   -9.842  -3.182  1.00 0.00 ? 34 ARG A H    11 
ATOM 9413  H HA   . ARG A 1 34 ? 2.078   -9.749  -5.775  1.00 0.00 ? 34 ARG A HA   11 
ATOM 9414  H HB2  . ARG A 1 34 ? 2.873   -9.033  -2.886  1.00 0.00 ? 34 ARG A HB2  11 
ATOM 9415  H HB3  . ARG A 1 34 ? 3.936   -9.073  -4.418  1.00 0.00 ? 34 ARG A HB3  11 
ATOM 9416  H HG2  . ARG A 1 34 ? 2.219   -7.366  -5.363  1.00 0.00 ? 34 ARG A HG2  11 
ATOM 9417  H HG3  . ARG A 1 34 ? 1.655   -7.170  -3.734  1.00 0.00 ? 34 ARG A HG3  11 
ATOM 9418  H HD2  . ARG A 1 34 ? 3.369   -5.427  -4.001  1.00 0.00 ? 34 ARG A HD2  11 
ATOM 9419  H HD3  . ARG A 1 34 ? 4.258   -6.712  -3.172  1.00 0.00 ? 34 ARG A HD3  11 
ATOM 9420  H HE   . ARG A 1 34 ? 5.329   -7.328  -5.269  1.00 0.00 ? 34 ARG A HE   11 
ATOM 9421  H HH11 . ARG A 1 34 ? 3.054   -4.668  -5.632  1.00 0.00 ? 34 ARG A HH11 11 
ATOM 9422  H HH12 . ARG A 1 34 ? 3.784   -4.009  -7.044  1.00 0.00 ? 34 ARG A HH12 11 
ATOM 9423  H HH21 . ARG A 1 34 ? 6.171   -6.658  -7.178  1.00 0.00 ? 34 ARG A HH21 11 
ATOM 9424  H HH22 . ARG A 1 34 ? 5.597   -5.255  -8.024  1.00 0.00 ? 34 ARG A HH22 11 
ATOM 9425  N N    . THR A 1 35 ? 3.157   -11.881 -5.396  1.00 0.00 ? 35 THR A N    11 
ATOM 9426  C CA   . THR A 1 35 ? 3.735   -13.213 -5.334  1.00 0.00 ? 35 THR A CA   11 
ATOM 9427  C C    . THR A 1 35 ? 5.269   -13.138 -5.456  1.00 0.00 ? 35 THR A C    11 
ATOM 9428  O O    . THR A 1 35 ? 5.931   -14.139 -5.698  1.00 0.00 ? 35 THR A O    11 
ATOM 9429  C CB   . THR A 1 35 ? 3.135   -13.986 -6.518  1.00 0.00 ? 35 THR A CB   11 
ATOM 9430  O OG1  . THR A 1 35 ? 3.156   -13.101 -7.631  1.00 0.00 ? 35 THR A OG1  11 
ATOM 9431  C CG2  . THR A 1 35 ? 1.691   -14.420 -6.221  1.00 0.00 ? 35 THR A CG2  11 
ATOM 9432  H H    . THR A 1 35 ? 3.228   -11.446 -6.296  1.00 0.00 ? 35 THR A H    11 
ATOM 9433  H HA   . THR A 1 35 ? 3.488   -13.687 -4.382  1.00 0.00 ? 35 THR A HA   11 
ATOM 9434  H HB   . THR A 1 35 ? 3.748   -14.874 -6.720  1.00 0.00 ? 35 THR A HB   11 
ATOM 9435  H HG1  . THR A 1 35 ? 2.823   -13.536 -8.411  1.00 0.00 ? 35 THR A HG1  11 
ATOM 9436  H HG21 . THR A 1 35 ? 1.039   -13.558 -6.078  1.00 0.00 ? 35 THR A HG21 11 
ATOM 9437  H HG22 . THR A 1 35 ? 1.647   -15.020 -5.312  1.00 0.00 ? 35 THR A HG22 11 
ATOM 9438  H HG23 . THR A 1 35 ? 1.274   -15.026 -7.026  1.00 0.00 ? 35 THR A HG23 11 
ATOM 9439  N N    . ASP A 1 36 ? 5.792   -11.907 -5.268  1.00 0.00 ? 36 ASP A N    11 
ATOM 9440  C CA   . ASP A 1 36 ? 7.226   -11.651 -5.399  1.00 0.00 ? 36 ASP A CA   11 
ATOM 9441  C C    . ASP A 1 36 ? 7.917   -11.457 -4.033  1.00 0.00 ? 36 ASP A C    11 
ATOM 9442  O O    . ASP A 1 36 ? 9.126   -11.275 -3.966  1.00 0.00 ? 36 ASP A O    11 
ATOM 9443  C CB   . ASP A 1 36 ? 7.435   -10.427 -6.311  1.00 0.00 ? 36 ASP A CB   11 
ATOM 9444  C CG   . ASP A 1 36 ? 6.778   -9.129  -5.811  1.00 0.00 ? 36 ASP A CG   11 
ATOM 9445  O OD1  . ASP A 1 36 ? 6.325   -9.062  -4.670  1.00 0.00 ? 36 ASP A OD1  11 
ATOM 9446  O OD2  . ASP A 1 36 ? 6.721   -8.170  -6.573  1.00 0.00 ? 36 ASP A OD2  11 
ATOM 9447  H H    . ASP A 1 36 ? 5.219   -11.106 -5.090  1.00 0.00 ? 36 ASP A H    11 
ATOM 9448  H HA   . ASP A 1 36 ? 7.698   -12.516 -5.868  1.00 0.00 ? 36 ASP A HA   11 
ATOM 9449  H HB2  . ASP A 1 36 ? 8.501   -10.238 -6.448  1.00 0.00 ? 36 ASP A HB2  11 
ATOM 9450  H HB3  . ASP A 1 36 ? 7.025   -10.643 -7.298  1.00 0.00 ? 36 ASP A HB3  11 
ATOM 9451  N N    . GLY A 1 37 ? 7.106   -11.545 -2.953  1.00 0.00 ? 37 GLY A N    11 
ATOM 9452  C CA   . GLY A 1 37 ? 7.656   -11.463 -1.601  1.00 0.00 ? 37 GLY A CA   11 
ATOM 9453  C C    . GLY A 1 37 ? 7.424   -10.117 -0.913  1.00 0.00 ? 37 GLY A C    11 
ATOM 9454  O O    . GLY A 1 37 ? 7.424   -10.025 0.308   1.00 0.00 ? 37 GLY A O    11 
ATOM 9455  H H    . GLY A 1 37 ? 6.127   -11.682 -3.076  1.00 0.00 ? 37 GLY A H    11 
ATOM 9456  H HA2  . GLY A 1 37 ? 7.195   -12.260 -1.016  1.00 0.00 ? 37 GLY A HA2  11 
ATOM 9457  H HA3  . GLY A 1 37 ? 8.742   -11.614 -1.646  1.00 0.00 ? 37 GLY A HA3  11 
ATOM 9458  N N    . TYR A 1 38 ? 7.285   -9.074  -1.746  1.00 0.00 ? 38 TYR A N    11 
ATOM 9459  C CA   . TYR A 1 38 ? 7.254   -7.724  -1.189  1.00 0.00 ? 38 TYR A CA   11 
ATOM 9460  C C    . TYR A 1 38 ? 5.897   -7.362  -0.574  1.00 0.00 ? 38 TYR A C    11 
ATOM 9461  O O    . TYR A 1 38 ? 4.830   -7.671  -1.090  1.00 0.00 ? 38 TYR A O    11 
ATOM 9462  C CB   . TYR A 1 38 ? 7.753   -6.748  -2.272  1.00 0.00 ? 38 TYR A CB   11 
ATOM 9463  C CG   . TYR A 1 38 ? 9.067   -7.266  -2.798  1.00 0.00 ? 38 TYR A CG   11 
ATOM 9464  C CD1  . TYR A 1 38 ? 10.130  -7.524  -1.945  1.00 0.00 ? 38 TYR A CD1  11 
ATOM 9465  C CD2  . TYR A 1 38 ? 9.232   -7.587  -4.133  1.00 0.00 ? 38 TYR A CD2  11 
ATOM 9466  C CE1  . TYR A 1 38 ? 11.273  -8.144  -2.392  1.00 0.00 ? 38 TYR A CE1  11 
ATOM 9467  C CE2  . TYR A 1 38 ? 10.374  -8.208  -4.585  1.00 0.00 ? 38 TYR A CE2  11 
ATOM 9468  C CZ   . TYR A 1 38 ? 11.407  -8.506  -3.717  1.00 0.00 ? 38 TYR A CZ   11 
ATOM 9469  O OH   . TYR A 1 38 ? 12.541  -9.159  -4.151  1.00 0.00 ? 38 TYR A OH   11 
ATOM 9470  H H    . TYR A 1 38 ? 7.259   -9.202  -2.742  1.00 0.00 ? 38 TYR A H    11 
ATOM 9471  H HA   . TYR A 1 38 ? 7.976   -7.726  -0.371  1.00 0.00 ? 38 TYR A HA   11 
ATOM 9472  H HB2  . TYR A 1 38 ? 7.027   -6.683  -3.084  1.00 0.00 ? 38 TYR A HB2  11 
ATOM 9473  H HB3  . TYR A 1 38 ? 7.878   -5.736  -1.892  1.00 0.00 ? 38 TYR A HB3  11 
ATOM 9474  H HD1  . TYR A 1 38 ? 10.107  -7.286  -0.905  1.00 0.00 ? 38 TYR A HD1  11 
ATOM 9475  H HD2  . TYR A 1 38 ? 8.483   -7.392  -4.863  1.00 0.00 ? 38 TYR A HD2  11 
ATOM 9476  H HE1  . TYR A 1 38 ? 12.015  -8.353  -1.657  1.00 0.00 ? 38 TYR A HE1  11 
ATOM 9477  H HE2  . TYR A 1 38 ? 10.383  -8.456  -5.620  1.00 0.00 ? 38 TYR A HE2  11 
ATOM 9478  H HH   . TYR A 1 38 ? 12.281  -9.941  -4.620  1.00 0.00 ? 38 TYR A HH   11 
ATOM 9479  N N    . ARG A 1 39 ? 6.031   -6.684  0.581   1.00 0.00 ? 39 ARG A N    11 
ATOM 9480  C CA   . ARG A 1 39 ? 4.827   -6.211  1.294   1.00 0.00 ? 39 ARG A CA   11 
ATOM 9481  C C    . ARG A 1 39 ? 4.598   -4.769  0.815   1.00 0.00 ? 39 ARG A C    11 
ATOM 9482  O O    . ARG A 1 39 ? 5.544   -3.990  0.722   1.00 0.00 ? 39 ARG A O    11 
ATOM 9483  C CB   . ARG A 1 39 ? 5.098   -6.234  2.812   1.00 0.00 ? 39 ARG A CB   11 
ATOM 9484  C CG   . ARG A 1 39 ? 5.467   -7.622  3.357   1.00 0.00 ? 39 ARG A CG   11 
ATOM 9485  C CD   . ARG A 1 39 ? 5.443   -7.653  4.903   1.00 0.00 ? 39 ARG A CD   11 
ATOM 9486  N NE   . ARG A 1 39 ? 4.077   -7.565  5.425   1.00 0.00 ? 39 ARG A NE   11 
ATOM 9487  C CZ   . ARG A 1 39 ? 3.238   -8.623  5.429   1.00 0.00 ? 39 ARG A CZ   11 
ATOM 9488  N NH1  . ARG A 1 39 ? 3.658   -9.800  4.975   1.00 0.00 ? 39 ARG A NH1  11 
ATOM 9489  N NH2  . ARG A 1 39 ? 1.991   -8.474  5.868   1.00 0.00 ? 39 ARG A NH2  11 
ATOM 9490  H H    . ARG A 1 39 ? 7.000   -6.486  0.836   1.00 0.00 ? 39 ARG A H    11 
ATOM 9491  H HA   . ARG A 1 39 ? 3.921   -6.816  1.058   1.00 0.00 ? 39 ARG A HA   11 
ATOM 9492  H HB2  . ARG A 1 39 ? 5.902   -5.538  3.059   1.00 0.00 ? 39 ARG A HB2  11 
ATOM 9493  H HB3  . ARG A 1 39 ? 4.220   -5.872  3.342   1.00 0.00 ? 39 ARG A HB3  11 
ATOM 9494  H HG2  . ARG A 1 39 ? 4.766   -8.363  2.965   1.00 0.00 ? 39 ARG A HG2  11 
ATOM 9495  H HG3  . ARG A 1 39 ? 6.465   -7.890  2.979   1.00 0.00 ? 39 ARG A HG3  11 
ATOM 9496  H HD2  . ARG A 1 39 ? 5.906   -8.550  5.322   1.00 0.00 ? 39 ARG A HD2  11 
ATOM 9497  H HD3  . ARG A 1 39 ? 5.979   -6.800  5.321   1.00 0.00 ? 39 ARG A HD3  11 
ATOM 9498  H HE   . ARG A 1 39 ? 3.778   -6.684  5.796   1.00 0.00 ? 39 ARG A HE   11 
ATOM 9499  H HH11 . ARG A 1 39 ? 4.622   -9.906  4.730   1.00 0.00 ? 39 ARG A HH11 11 
ATOM 9500  H HH12 . ARG A 1 39 ? 3.042   -10.580 4.846   1.00 0.00 ? 39 ARG A HH12 11 
ATOM 9501  H HH21 . ARG A 1 39 ? 1.654   -7.558  6.135   1.00 0.00 ? 39 ARG A HH21 11 
ATOM 9502  H HH22 . ARG A 1 39 ? 1.361   -9.247  5.941   1.00 0.00 ? 39 ARG A HH22 11 
ATOM 9503  N N    . TRP A 1 40 ? 3.324   -4.462  0.494   1.00 0.00 ? 40 TRP A N    11 
ATOM 9504  C CA   . TRP A 1 40 ? 2.941   -3.152  0.003   1.00 0.00 ? 40 TRP A CA   11 
ATOM 9505  C C    . TRP A 1 40 ? 1.900   -2.509  0.944   1.00 0.00 ? 40 TRP A C    11 
ATOM 9506  O O    . TRP A 1 40 ? 1.238   -3.177  1.735   1.00 0.00 ? 40 TRP A O    11 
ATOM 9507  C CB   . TRP A 1 40 ? 2.406   -3.269  -1.442  1.00 0.00 ? 40 TRP A CB   11 
ATOM 9508  C CG   . TRP A 1 40 ? 1.117   -4.074  -1.515  1.00 0.00 ? 40 TRP A CG   11 
ATOM 9509  C CD1  . TRP A 1 40 ? 1.023   -5.470  -1.568  1.00 0.00 ? 40 TRP A CD1  11 
ATOM 9510  C CD2  . TRP A 1 40 ? -0.245  -3.579  -1.567  1.00 0.00 ? 40 TRP A CD2  11 
ATOM 9511  N NE1  . TRP A 1 40 ? -0.278  -5.832  -1.655  1.00 0.00 ? 40 TRP A NE1  11 
ATOM 9512  C CE2  . TRP A 1 40 ? -1.085  -4.709  -1.659  1.00 0.00 ? 40 TRP A CE2  11 
ATOM 9513  C CE3  . TRP A 1 40 ? -0.800  -2.327  -1.550  1.00 0.00 ? 40 TRP A CE3  11 
ATOM 9514  C CZ2  . TRP A 1 40 ? -2.442  -4.559  -1.730  1.00 0.00 ? 40 TRP A CZ2  11 
ATOM 9515  C CZ3  . TRP A 1 40 ? -2.190  -2.163  -1.620  1.00 0.00 ? 40 TRP A CZ3  11 
ATOM 9516  C CH2  . TRP A 1 40 ? -3.011  -3.289  -1.714  1.00 0.00 ? 40 TRP A CH2  11 
ATOM 9517  H H    . TRP A 1 40 ? 2.571   -5.114  0.591   1.00 0.00 ? 40 TRP A H    11 
ATOM 9518  H HA   . TRP A 1 40 ? 3.844   -2.554  0.010   1.00 0.00 ? 40 TRP A HA   11 
ATOM 9519  H HB2  . TRP A 1 40 ? 2.259   -2.282  -1.877  1.00 0.00 ? 40 TRP A HB2  11 
ATOM 9520  H HB3  . TRP A 1 40 ? 3.150   -3.738  -2.085  1.00 0.00 ? 40 TRP A HB3  11 
ATOM 9521  H HD1  . TRP A 1 40 ? 1.847   -6.166  -1.541  1.00 0.00 ? 40 TRP A HD1  11 
ATOM 9522  H HE1  . TRP A 1 40 ? -0.635  -6.746  -1.726  1.00 0.00 ? 40 TRP A HE1  11 
ATOM 9523  H HE3  . TRP A 1 40 ? -0.140  -1.477  -1.476  1.00 0.00 ? 40 TRP A HE3  11 
ATOM 9524  H HZ2  . TRP A 1 40 ? -3.065  -5.438  -1.805  1.00 0.00 ? 40 TRP A HZ2  11 
ATOM 9525  H HZ3  . TRP A 1 40 ? -2.652  -1.182  -1.604  1.00 0.00 ? 40 TRP A HZ3  11 
ATOM 9526  H HH2  . TRP A 1 40 ? -4.087  -3.194  -1.777  1.00 0.00 ? 40 TRP A HH2  11 
ATOM 9527  N N    . CYS A 1 41 ? 1.794   -1.176  0.778   1.00 0.00 ? 41 CYS A N    11 
ATOM 9528  C CA   . CYS A 1 41 ? 0.815   -0.347  1.452   1.00 0.00 ? 41 CYS A CA   11 
ATOM 9529  C C    . CYS A 1 41 ? 0.081   0.424   0.349   1.00 0.00 ? 41 CYS A C    11 
ATOM 9530  O O    . CYS A 1 41 ? 0.676   0.791   -0.660  1.00 0.00 ? 41 CYS A O    11 
ATOM 9531  C CB   . CYS A 1 41 ? 1.510   0.648   2.385   1.00 0.00 ? 41 CYS A CB   11 
ATOM 9532  S SG   . CYS A 1 41 ? 2.563   1.829   1.481   1.00 0.00 ? 41 CYS A SG   11 
ATOM 9533  H H    . CYS A 1 41 ? 2.357   -0.656  0.136   1.00 0.00 ? 41 CYS A H    11 
ATOM 9534  H HA   . CYS A 1 41 ? 0.125   -0.995  1.997   1.00 0.00 ? 41 CYS A HA   11 
ATOM 9535  H HB2  . CYS A 1 41 ? 0.662   1.231   2.833   1.00 0.00 ? 41 CYS A HB2  11 
ATOM 9536  H HB3  . CYS A 1 41 ? 2.160   0.070   3.095   1.00 0.00 ? 41 CYS A HB3  11 
ATOM 9537  N N    . GLY A 1 42 ? -1.222  0.647   0.571   1.00 0.00 ? 42 GLY A N    11 
ATOM 9538  C CA   . GLY A 1 42 ? -1.972  1.426   -0.402  1.00 0.00 ? 42 GLY A CA   11 
ATOM 9539  C C    . GLY A 1 42 ? -1.769  2.914   -0.094  1.00 0.00 ? 42 GLY A C    11 
ATOM 9540  O O    . GLY A 1 42 ? -1.416  3.274   1.025   1.00 0.00 ? 42 GLY A O    11 
ATOM 9541  H H    . GLY A 1 42 ? -1.683  0.341   1.404   1.00 0.00 ? 42 GLY A H    11 
ATOM 9542  H HA2  . GLY A 1 42 ? -1.691  1.138   -1.416  1.00 0.00 ? 42 GLY A HA2  11 
ATOM 9543  H HA3  . GLY A 1 42 ? -3.027  1.192   -0.248  1.00 0.00 ? 42 GLY A HA3  11 
ATOM 9544  N N    . THR A 1 43 ? -2.071  3.751   -1.103  1.00 0.00 ? 43 THR A N    11 
ATOM 9545  C CA   . THR A 1 43 ? -2.154  5.183   -0.848  1.00 0.00 ? 43 THR A CA   11 
ATOM 9546  C C    . THR A 1 43 ? -3.638  5.512   -1.022  1.00 0.00 ? 43 THR A C    11 
ATOM 9547  O O    . THR A 1 43 ? -4.395  4.718   -1.566  1.00 0.00 ? 43 THR A O    11 
ATOM 9548  C CB   . THR A 1 43 ? -1.246  6.059   -1.720  1.00 0.00 ? 43 THR A CB   11 
ATOM 9549  O OG1  . THR A 1 43 ? -1.452  5.740   -3.086  1.00 0.00 ? 43 THR A OG1  11 
ATOM 9550  C CG2  . THR A 1 43 ? 0.226   5.923   -1.308  1.00 0.00 ? 43 THR A CG2  11 
ATOM 9551  H H    . THR A 1 43 ? -2.336  3.443   -2.021  1.00 0.00 ? 43 THR A H    11 
ATOM 9552  H HA   . THR A 1 43 ? -1.889  5.376   0.186   1.00 0.00 ? 43 THR A HA   11 
ATOM 9553  H HB   . THR A 1 43 ? -1.532  7.100   -1.513  1.00 0.00 ? 43 THR A HB   11 
ATOM 9554  H HG1  . THR A 1 43 ? -1.215  6.472   -3.644  1.00 0.00 ? 43 THR A HG1  11 
ATOM 9555  H HG21 . THR A 1 43 ? 0.652   4.969   -1.609  1.00 0.00 ? 43 THR A HG21 11 
ATOM 9556  H HG22 . THR A 1 43 ? 0.322   5.992   -0.224  1.00 0.00 ? 43 THR A HG22 11 
ATOM 9557  H HG23 . THR A 1 43 ? 0.844   6.722   -1.716  1.00 0.00 ? 43 THR A HG23 11 
ATOM 9558  N N    . THR A 1 44 ? -3.974  6.704   -0.492  1.00 0.00 ? 44 THR A N    11 
ATOM 9559  C CA   . THR A 1 44 ? -5.339  7.214   -0.438  1.00 0.00 ? 44 THR A CA   11 
ATOM 9560  C C    . THR A 1 44 ? -6.114  6.417   0.621   1.00 0.00 ? 44 THR A C    11 
ATOM 9561  O O    . THR A 1 44 ? -5.667  5.396   1.133   1.00 0.00 ? 44 THR A O    11 
ATOM 9562  C CB   . THR A 1 44 ? -6.081  7.274   -1.800  1.00 0.00 ? 44 THR A CB   11 
ATOM 9563  O OG1  . THR A 1 44 ? -6.784  6.064   -2.030  1.00 0.00 ? 44 THR A OG1  11 
ATOM 9564  C CG2  . THR A 1 44 ? -5.136  7.641   -2.960  1.00 0.00 ? 44 THR A CG2  11 
ATOM 9565  H H    . THR A 1 44 ? -3.254  7.243   -0.062  1.00 0.00 ? 44 THR A H    11 
ATOM 9566  H HA   . THR A 1 44 ? -5.220  8.230   -0.063  1.00 0.00 ? 44 THR A HA   11 
ATOM 9567  H HB   . THR A 1 44 ? -6.829  8.070   -1.709  1.00 0.00 ? 44 THR A HB   11 
ATOM 9568  H HG1  . THR A 1 44 ? -7.198  6.062   -2.899  1.00 0.00 ? 44 THR A HG1  11 
ATOM 9569  H HG21 . THR A 1 44 ? -4.516  6.796   -3.261  1.00 0.00 ? 44 THR A HG21 11 
ATOM 9570  H HG22 . THR A 1 44 ? -4.477  8.463   -2.684  1.00 0.00 ? 44 THR A HG22 11 
ATOM 9571  H HG23 . THR A 1 44 ? -5.690  7.966   -3.840  1.00 0.00 ? 44 THR A HG23 11 
ATOM 9572  N N    . GLU A 1 45 ? -7.298  6.962   0.928   1.00 0.00 ? 45 GLU A N    11 
ATOM 9573  C CA   . GLU A 1 45 ? -8.184  6.280   1.848   1.00 0.00 ? 45 GLU A CA   11 
ATOM 9574  C C    . GLU A 1 45 ? -8.766  5.011   1.189   1.00 0.00 ? 45 GLU A C    11 
ATOM 9575  O O    . GLU A 1 45 ? -9.124  4.060   1.874   1.00 0.00 ? 45 GLU A O    11 
ATOM 9576  C CB   . GLU A 1 45 ? -9.269  7.251   2.372   1.00 0.00 ? 45 GLU A CB   11 
ATOM 9577  C CG   . GLU A 1 45 ? -10.509 7.487   1.475   1.00 0.00 ? 45 GLU A CG   11 
ATOM 9578  C CD   . GLU A 1 45 ? -10.274 8.234   0.146   1.00 0.00 ? 45 GLU A CD   11 
ATOM 9579  O OE1  . GLU A 1 45 ? -9.328  7.941   -0.580  1.00 0.00 ? 45 GLU A OE1  11 
ATOM 9580  O OE2  . GLU A 1 45 ? -11.077 9.096   -0.194  1.00 0.00 ? 45 GLU A OE2  11 
ATOM 9581  H H    . GLU A 1 45 ? -7.639  7.787   0.472   1.00 0.00 ? 45 GLU A H    11 
ATOM 9582  H HA   . GLU A 1 45 ? -7.570  5.963   2.695   1.00 0.00 ? 45 GLU A HA   11 
ATOM 9583  H HB2  . GLU A 1 45 ? -9.680  6.752   3.292   1.00 0.00 ? 45 GLU A HB2  11 
ATOM 9584  H HB3  . GLU A 1 45 ? -8.777  8.249   2.531   1.00 0.00 ? 45 GLU A HB3  11 
ATOM 9585  H HG2  . GLU A 1 45 ? -11.018 6.548   1.258   1.00 0.00 ? 45 GLU A HG2  11 
ATOM 9586  H HG3  . GLU A 1 45 ? -11.227 8.071   2.056   1.00 0.00 ? 45 GLU A HG3  11 
ATOM 9587  N N    . ASP A 1 46 ? -8.870  5.068   -0.164  1.00 0.00 ? 46 ASP A N    11 
ATOM 9588  C CA   . ASP A 1 46 ? -9.488  3.986   -0.930  1.00 0.00 ? 46 ASP A CA   11 
ATOM 9589  C C    . ASP A 1 46 ? -8.584  3.517   -2.088  1.00 0.00 ? 46 ASP A C    11 
ATOM 9590  O O    . ASP A 1 46 ? -8.525  4.106   -3.165  1.00 0.00 ? 46 ASP A O    11 
ATOM 9591  C CB   . ASP A 1 46 ? -10.897 4.413   -1.383  1.00 0.00 ? 46 ASP A CB   11 
ATOM 9592  C CG   . ASP A 1 46 ? -11.730 3.185   -1.752  1.00 0.00 ? 46 ASP A CG   11 
ATOM 9593  O OD1  . ASP A 1 46 ? -11.457 2.595   -2.791  1.00 0.00 ? 46 ASP A OD1  11 
ATOM 9594  O OD2  . ASP A 1 46 ? -12.630 2.827   -0.993  1.00 0.00 ? 46 ASP A OD2  11 
ATOM 9595  H H    . ASP A 1 46 ? -8.500  5.866   -0.649  1.00 0.00 ? 46 ASP A H    11 
ATOM 9596  H HA   . ASP A 1 46 ? -9.602  3.158   -0.239  1.00 0.00 ? 46 ASP A HA   11 
ATOM 9597  H HB2  . ASP A 1 46 ? -11.398 4.929   -0.563  1.00 0.00 ? 46 ASP A HB2  11 
ATOM 9598  H HB3  . ASP A 1 46 ? -10.884 5.117   -2.215  1.00 0.00 ? 46 ASP A HB3  11 
ATOM 9599  N N    . TYR A 1 47 ? -7.889  2.398   -1.795  1.00 0.00 ? 47 TYR A N    11 
ATOM 9600  C CA   . TYR A 1 47 ? -6.994  1.807   -2.792  1.00 0.00 ? 47 TYR A CA   11 
ATOM 9601  C C    . TYR A 1 47 ? -7.804  1.192   -3.933  1.00 0.00 ? 47 TYR A C    11 
ATOM 9602  O O    . TYR A 1 47 ? -7.384  1.193   -5.083  1.00 0.00 ? 47 TYR A O    11 
ATOM 9603  C CB   . TYR A 1 47 ? -6.157  0.694   -2.136  1.00 0.00 ? 47 TYR A CB   11 
ATOM 9604  C CG   . TYR A 1 47 ? -5.242  0.032   -3.127  1.00 0.00 ? 47 TYR A CG   11 
ATOM 9605  C CD1  . TYR A 1 47 ? -4.030  0.612   -3.444  1.00 0.00 ? 47 TYR A CD1  11 
ATOM 9606  C CD2  . TYR A 1 47 ? -5.590  -1.164  -3.743  1.00 0.00 ? 47 TYR A CD2  11 
ATOM 9607  C CE1  . TYR A 1 47 ? -3.167  -0.006  -4.328  1.00 0.00 ? 47 TYR A CE1  11 
ATOM 9608  C CE2  . TYR A 1 47 ? -4.712  -1.797  -4.609  1.00 0.00 ? 47 TYR A CE2  11 
ATOM 9609  C CZ   . TYR A 1 47 ? -3.490  -1.217  -4.904  1.00 0.00 ? 47 TYR A CZ   11 
ATOM 9610  O OH   . TYR A 1 47 ? -2.591  -1.816  -5.761  1.00 0.00 ? 47 TYR A OH   11 
ATOM 9611  H H    . TYR A 1 47 ? -8.042  1.950   -0.903  1.00 0.00 ? 47 TYR A H    11 
ATOM 9612  H HA   . TYR A 1 47 ? -6.347  2.588   -3.226  1.00 0.00 ? 47 TYR A HA   11 
ATOM 9613  H HB2  . TYR A 1 47 ? -5.560  1.116   -1.327  1.00 0.00 ? 47 TYR A HB2  11 
ATOM 9614  H HB3  . TYR A 1 47 ? -6.776  -0.089  -1.690  1.00 0.00 ? 47 TYR A HB3  11 
ATOM 9615  H HD1  . TYR A 1 47 ? -3.763  1.558   -3.012  1.00 0.00 ? 47 TYR A HD1  11 
ATOM 9616  H HD2  . TYR A 1 47 ? -6.564  -1.591  -3.581  1.00 0.00 ? 47 TYR A HD2  11 
ATOM 9617  H HE1  . TYR A 1 47 ? -2.239  0.463   -4.569  1.00 0.00 ? 47 TYR A HE1  11 
ATOM 9618  H HE2  . TYR A 1 47 ? -4.996  -2.738  -5.037  1.00 0.00 ? 47 TYR A HE2  11 
ATOM 9619  H HH   . TYR A 1 47 ? -2.471  -2.725  -5.516  1.00 0.00 ? 47 TYR A HH   11 
ATOM 9620  N N    . ASP A 1 48 ? -8.976  0.650   -3.558  1.00 0.00 ? 48 ASP A N    11 
ATOM 9621  C CA   . ASP A 1 48 ? -9.788  -0.013  -4.571  1.00 0.00 ? 48 ASP A CA   11 
ATOM 9622  C C    . ASP A 1 48 ? -10.139 0.944   -5.727  1.00 0.00 ? 48 ASP A C    11 
ATOM 9623  O O    . ASP A 1 48 ? -10.212 0.563   -6.891  1.00 0.00 ? 48 ASP A O    11 
ATOM 9624  C CB   . ASP A 1 48 ? -11.081 -0.603  -3.965  1.00 0.00 ? 48 ASP A CB   11 
ATOM 9625  C CG   . ASP A 1 48 ? -10.774 -1.779  -3.026  1.00 0.00 ? 48 ASP A CG   11 
ATOM 9626  O OD1  . ASP A 1 48 ? -10.023 -2.663  -3.435  1.00 0.00 ? 48 ASP A OD1  11 
ATOM 9627  O OD2  . ASP A 1 48 ? -11.279 -1.819  -1.902  1.00 0.00 ? 48 ASP A OD2  11 
ATOM 9628  H H    . ASP A 1 48 ? -9.283  0.696   -2.606  1.00 0.00 ? 48 ASP A H    11 
ATOM 9629  H HA   . ASP A 1 48 ? -9.191  -0.832  -4.987  1.00 0.00 ? 48 ASP A HA   11 
ATOM 9630  H HB2  . ASP A 1 48 ? -11.668 0.155   -3.434  1.00 0.00 ? 48 ASP A HB2  11 
ATOM 9631  H HB3  . ASP A 1 48 ? -11.699 -1.024  -4.766  1.00 0.00 ? 48 ASP A HB3  11 
ATOM 9632  N N    . ARG A 1 49 ? -10.353 2.213   -5.347  1.00 0.00 ? 49 ARG A N    11 
ATOM 9633  C CA   . ARG A 1 49 ? -10.671 3.250   -6.315  1.00 0.00 ? 49 ARG A CA   11 
ATOM 9634  C C    . ARG A 1 49 ? -9.425  3.662   -7.149  1.00 0.00 ? 49 ARG A C    11 
ATOM 9635  O O    . ARG A 1 49 ? -9.440  3.538   -8.372  1.00 0.00 ? 49 ARG A O    11 
ATOM 9636  C CB   . ARG A 1 49 ? -11.323 4.434   -5.562  1.00 0.00 ? 49 ARG A CB   11 
ATOM 9637  C CG   . ARG A 1 49 ? -11.731 5.655   -6.415  1.00 0.00 ? 49 ARG A CG   11 
ATOM 9638  C CD   . ARG A 1 49 ? -11.178 6.959   -5.784  1.00 0.00 ? 49 ARG A CD   11 
ATOM 9639  N NE   . ARG A 1 49 ? -11.961 7.316   -4.592  1.00 0.00 ? 49 ARG A NE   11 
ATOM 9640  C CZ   . ARG A 1 49 ? -11.423 7.673   -3.398  1.00 0.00 ? 49 ARG A CZ   11 
ATOM 9641  N NH1  . ARG A 1 49 ? -10.114 7.678   -3.178  1.00 0.00 ? 49 ARG A NH1  11 
ATOM 9642  N NH2  . ARG A 1 49 ? -12.233 8.031   -2.409  1.00 0.00 ? 49 ARG A NH2  11 
ATOM 9643  H H    . ARG A 1 49 ? -10.303 2.420   -4.365  1.00 0.00 ? 49 ARG A H    11 
ATOM 9644  H HA   . ARG A 1 49 ? -11.399 2.804   -6.998  1.00 0.00 ? 49 ARG A HA   11 
ATOM 9645  H HB2  . ARG A 1 49 ? -12.199 4.058   -5.032  1.00 0.00 ? 49 ARG A HB2  11 
ATOM 9646  H HB3  . ARG A 1 49 ? -10.656 4.787   -4.778  1.00 0.00 ? 49 ARG A HB3  11 
ATOM 9647  H HG2  . ARG A 1 49 ? -11.372 5.548   -7.444  1.00 0.00 ? 49 ARG A HG2  11 
ATOM 9648  H HG3  . ARG A 1 49 ? -12.826 5.695   -6.507  1.00 0.00 ? 49 ARG A HG3  11 
ATOM 9649  H HD2  . ARG A 1 49 ? -10.125 6.843   -5.493  1.00 0.00 ? 49 ARG A HD2  11 
ATOM 9650  H HD3  . ARG A 1 49 ? -11.235 7.806   -6.477  1.00 0.00 ? 49 ARG A HD3  11 
ATOM 9651  H HE   . ARG A 1 49 ? -12.961 7.311   -4.664  1.00 0.00 ? 49 ARG A HE   11 
ATOM 9652  H HH11 . ARG A 1 49 ? -9.442  7.420   -3.889  1.00 0.00 ? 49 ARG A HH11 11 
ATOM 9653  H HH12 . ARG A 1 49 ? -9.751  7.923   -2.267  1.00 0.00 ? 49 ARG A HH12 11 
ATOM 9654  H HH21 . ARG A 1 49 ? -13.225 8.003   -2.493  1.00 0.00 ? 49 ARG A HH21 11 
ATOM 9655  H HH22 . ARG A 1 49 ? -11.833 8.350   -1.537  1.00 0.00 ? 49 ARG A HH22 11 
ATOM 9656  N N    . ASP A 1 50 ? -8.389  4.170   -6.446  1.00 0.00 ? 50 ASP A N    11 
ATOM 9657  C CA   . ASP A 1 50 ? -7.198  4.764   -7.079  1.00 0.00 ? 50 ASP A CA   11 
ATOM 9658  C C    . ASP A 1 50 ? -6.124  3.782   -7.620  1.00 0.00 ? 50 ASP A C    11 
ATOM 9659  O O    . ASP A 1 50 ? -5.448  4.039   -8.615  1.00 0.00 ? 50 ASP A O    11 
ATOM 9660  C CB   . ASP A 1 50 ? -6.534  5.686   -6.038  1.00 0.00 ? 50 ASP A CB   11 
ATOM 9661  C CG   . ASP A 1 50 ? -7.498  6.794   -5.592  1.00 0.00 ? 50 ASP A CG   11 
ATOM 9662  O OD1  . ASP A 1 50 ? -7.844  7.648   -6.402  1.00 0.00 ? 50 ASP A OD1  11 
ATOM 9663  O OD2  . ASP A 1 50 ? -7.909  6.796   -4.435  1.00 0.00 ? 50 ASP A OD2  11 
ATOM 9664  H H    . ASP A 1 50 ? -8.448  4.228   -5.445  1.00 0.00 ? 50 ASP A H    11 
ATOM 9665  H HA   . ASP A 1 50 ? -7.520  5.400   -7.907  1.00 0.00 ? 50 ASP A HA   11 
ATOM 9666  H HB2  . ASP A 1 50 ? -6.231  5.094   -5.154  1.00 0.00 ? 50 ASP A HB2  11 
ATOM 9667  H HB3  . ASP A 1 50 ? -5.676  6.204   -6.497  1.00 0.00 ? 50 ASP A HB3  11 
ATOM 9668  N N    . LYS A 1 51 ? -5.942  2.681   -6.873  1.00 0.00 ? 51 LYS A N    11 
ATOM 9669  C CA   . LYS A 1 51 ? -4.935  1.662   -7.163  1.00 0.00 ? 51 LYS A CA   11 
ATOM 9670  C C    . LYS A 1 51 ? -3.531  2.252   -7.276  1.00 0.00 ? 51 LYS A C    11 
ATOM 9671  O O    . LYS A 1 51 ? -2.894  2.148   -8.318  1.00 0.00 ? 51 LYS A O    11 
ATOM 9672  C CB   . LYS A 1 51 ? -5.181  0.856   -8.457  1.00 0.00 ? 51 LYS A CB   11 
ATOM 9673  C CG   . LYS A 1 51 ? -6.529  0.116   -8.486  1.00 0.00 ? 51 LYS A CG   11 
ATOM 9674  C CD   . LYS A 1 51 ? -7.723  1.056   -8.669  1.00 0.00 ? 51 LYS A CD   11 
ATOM 9675  C CE   . LYS A 1 51 ? -8.889  0.429   -9.437  1.00 0.00 ? 51 LYS A CE   11 
ATOM 9676  N NZ   . LYS A 1 51 ? -10.075 1.270   -9.331  1.00 0.00 ? 51 LYS A NZ   11 
ATOM 9677  H H    . LYS A 1 51 ? -6.551  2.504   -6.100  1.00 0.00 ? 51 LYS A H    11 
ATOM 9678  H HA   . LYS A 1 51 ? -4.943  1.012   -6.290  1.00 0.00 ? 51 LYS A HA   11 
ATOM 9679  H HB2  . LYS A 1 51 ? -5.184  1.575   -9.321  1.00 0.00 ? 51 LYS A HB2  11 
ATOM 9680  H HB3  . LYS A 1 51 ? -4.343  0.094   -8.458  1.00 0.00 ? 51 LYS A HB3  11 
ATOM 9681  H HG2  . LYS A 1 51 ? -6.582  -0.609  -9.299  1.00 0.00 ? 51 LYS A HG2  11 
ATOM 9682  H HG3  . LYS A 1 51 ? -6.609  -0.455  -7.564  1.00 0.00 ? 51 LYS A HG3  11 
ATOM 9683  H HD2  . LYS A 1 51 ? -8.046  1.382   -7.682  1.00 0.00 ? 51 LYS A HD2  11 
ATOM 9684  H HD3  . LYS A 1 51 ? -7.420  1.950   -9.216  1.00 0.00 ? 51 LYS A HD3  11 
ATOM 9685  H HE2  . LYS A 1 51 ? -8.635  0.317   -10.492 1.00 0.00 ? 51 LYS A HE2  11 
ATOM 9686  H HE3  . LYS A 1 51 ? -9.141  -0.556  -9.040  1.00 0.00 ? 51 LYS A HE3  11 
ATOM 9687  H HZ1  . LYS A 1 51 ? -10.793 1.038   -10.043 1.00 0.00 ? 51 LYS A HZ1  11 
ATOM 9688  H HZ2  . LYS A 1 51 ? -9.807  2.282   -9.372  1.00 0.00 ? 51 LYS A HZ2  11 
ATOM 9689  H HZ3  . LYS A 1 51 ? -10.461 1.103   -8.375  1.00 0.00 ? 51 LYS A HZ3  11 
ATOM 9690  N N    . LYS A 1 52 ? -3.070  2.862   -6.182  1.00 0.00 ? 52 LYS A N    11 
ATOM 9691  C CA   . LYS A 1 52 ? -1.701  3.351   -6.151  1.00 0.00 ? 52 LYS A CA   11 
ATOM 9692  C C    . LYS A 1 52 ? -1.116  2.834   -4.840  1.00 0.00 ? 52 LYS A C    11 
ATOM 9693  O O    . LYS A 1 52 ? -1.806  2.791   -3.826  1.00 0.00 ? 52 LYS A O    11 
ATOM 9694  C CB   . LYS A 1 52 ? -1.642  4.878   -6.234  1.00 0.00 ? 52 LYS A CB   11 
ATOM 9695  C CG   . LYS A 1 52 ? -1.914  5.422   -7.645  1.00 0.00 ? 52 LYS A CG   11 
ATOM 9696  C CD   . LYS A 1 52 ? -0.810  5.089   -8.675  1.00 0.00 ? 52 LYS A CD   11 
ATOM 9697  C CE   . LYS A 1 52 ? -1.119  3.929   -9.636  1.00 0.00 ? 52 LYS A CE   11 
ATOM 9698  N NZ   . LYS A 1 52 ? -2.514  3.864   -10.083 1.00 0.00 ? 52 LYS A NZ   11 
ATOM 9699  H H    . LYS A 1 52 ? -3.614  2.924   -5.343  1.00 0.00 ? 52 LYS A H    11 
ATOM 9700  H HA   . LYS A 1 52 ? -1.137  2.878   -6.957  1.00 0.00 ? 52 LYS A HA   11 
ATOM 9701  H HB2  . LYS A 1 52 ? -2.350  5.298   -5.518  1.00 0.00 ? 52 LYS A HB2  11 
ATOM 9702  H HB3  . LYS A 1 52 ? -0.648  5.226   -5.959  1.00 0.00 ? 52 LYS A HB3  11 
ATOM 9703  H HG2  . LYS A 1 52 ? -2.904  5.130   -7.995  1.00 0.00 ? 52 LYS A HG2  11 
ATOM 9704  H HG3  . LYS A 1 52 ? -1.945  6.511   -7.561  1.00 0.00 ? 52 LYS A HG3  11 
ATOM 9705  H HD2  . LYS A 1 52 ? -0.771  5.985   -9.350  1.00 0.00 ? 52 LYS A HD2  11 
ATOM 9706  H HD3  . LYS A 1 52 ? 0.134   4.818   -8.112  1.00 0.00 ? 52 LYS A HD3  11 
ATOM 9707  H HE2  . LYS A 1 52 ? -0.484  4.013   -10.521 1.00 0.00 ? 52 LYS A HE2  11 
ATOM 9708  H HE3  . LYS A 1 52 ? -0.867  2.971   -9.181  1.00 0.00 ? 52 LYS A HE3  11 
ATOM 9709  H HZ1  . LYS A 1 52 ? -2.612  3.209   -10.882 1.00 0.00 ? 52 LYS A HZ1  11 
ATOM 9710  H HZ2  . LYS A 1 52 ? -2.892  4.799   -10.331 1.00 0.00 ? 52 LYS A HZ2  11 
ATOM 9711  H HZ3  . LYS A 1 52 ? -3.078  3.463   -9.296  1.00 0.00 ? 52 LYS A HZ3  11 
ATOM 9712  N N    . TYR A 1 53 ? 0.151   2.390   -4.926  1.00 0.00 ? 53 TYR A N    11 
ATOM 9713  C CA   . TYR A 1 53 ? 0.777   1.795   -3.760  1.00 0.00 ? 53 TYR A CA   11 
ATOM 9714  C C    . TYR A 1 53 ? 2.252   2.178   -3.643  1.00 0.00 ? 53 TYR A C    11 
ATOM 9715  O O    . TYR A 1 53 ? 2.865   2.797   -4.505  1.00 0.00 ? 53 TYR A O    11 
ATOM 9716  C CB   . TYR A 1 53 ? 0.608   0.259   -3.806  1.00 0.00 ? 53 TYR A CB   11 
ATOM 9717  C CG   . TYR A 1 53 ? 1.431   -0.416  -4.871  1.00 0.00 ? 53 TYR A CG   11 
ATOM 9718  C CD1  . TYR A 1 53 ? 0.925   -0.602  -6.150  1.00 0.00 ? 53 TYR A CD1  11 
ATOM 9719  C CD2  . TYR A 1 53 ? 2.705   -0.886  -4.580  1.00 0.00 ? 53 TYR A CD2  11 
ATOM 9720  C CE1  . TYR A 1 53 ? 1.661   -1.282  -7.112  1.00 0.00 ? 53 TYR A CE1  11 
ATOM 9721  C CE2  . TYR A 1 53 ? 3.450   -1.554  -5.538  1.00 0.00 ? 53 TYR A CE2  11 
ATOM 9722  C CZ   . TYR A 1 53 ? 2.924   -1.770  -6.801  1.00 0.00 ? 53 TYR A CZ   11 
ATOM 9723  O OH   . TYR A 1 53 ? 3.661   -2.495  -7.722  1.00 0.00 ? 53 TYR A OH   11 
ATOM 9724  H H    . TYR A 1 53 ? 0.668   2.444   -5.781  1.00 0.00 ? 53 TYR A H    11 
ATOM 9725  H HA   . TYR A 1 53 ? 0.299   2.228   -2.886  1.00 0.00 ? 53 TYR A HA   11 
ATOM 9726  H HB2  . TYR A 1 53 ? 0.866   -0.185  -2.852  1.00 0.00 ? 53 TYR A HB2  11 
ATOM 9727  H HB3  . TYR A 1 53 ? -0.430  -0.024  -3.946  1.00 0.00 ? 53 TYR A HB3  11 
ATOM 9728  H HD1  . TYR A 1 53 ? -0.052  -0.213  -6.386  1.00 0.00 ? 53 TYR A HD1  11 
ATOM 9729  H HD2  . TYR A 1 53 ? 3.119   -0.731  -3.598  1.00 0.00 ? 53 TYR A HD2  11 
ATOM 9730  H HE1  . TYR A 1 53 ? 1.224   -1.431  -8.086  1.00 0.00 ? 53 TYR A HE1  11 
ATOM 9731  H HE2  . TYR A 1 53 ? 4.437   -1.904  -5.286  1.00 0.00 ? 53 TYR A HE2  11 
ATOM 9732  H HH   . TYR A 1 53 ? 3.712   -1.998  -8.534  1.00 0.00 ? 53 TYR A HH   11 
ATOM 9733  N N    . GLY A 1 54 ? 2.751   1.718   -2.491  1.00 0.00 ? 54 GLY A N    11 
ATOM 9734  C CA   . GLY A 1 54 ? 4.137   1.868   -2.082  1.00 0.00 ? 54 GLY A CA   11 
ATOM 9735  C C    . GLY A 1 54 ? 4.585   0.542   -1.438  1.00 0.00 ? 54 GLY A C    11 
ATOM 9736  O O    . GLY A 1 54 ? 3.755   -0.339  -1.231  1.00 0.00 ? 54 GLY A O    11 
ATOM 9737  H H    . GLY A 1 54 ? 2.092   1.220   -1.917  1.00 0.00 ? 54 GLY A H    11 
ATOM 9738  H HA2  . GLY A 1 54 ? 4.732   2.147   -2.950  1.00 0.00 ? 54 GLY A HA2  11 
ATOM 9739  H HA3  . GLY A 1 54 ? 4.153   2.675   -1.354  1.00 0.00 ? 54 GLY A HA3  11 
ATOM 9740  N N    . PHE A 1 55 ? 5.896   0.433   -1.115  1.00 0.00 ? 55 PHE A N    11 
ATOM 9741  C CA   . PHE A 1 55 ? 6.401   -0.767  -0.449  1.00 0.00 ? 55 PHE A CA   11 
ATOM 9742  C C    . PHE A 1 55 ? 6.493   -0.440  1.040   1.00 0.00 ? 55 PHE A C    11 
ATOM 9743  O O    . PHE A 1 55 ? 6.533   0.712   1.451   1.00 0.00 ? 55 PHE A O    11 
ATOM 9744  C CB   . PHE A 1 55 ? 7.742   -1.275  -1.008  1.00 0.00 ? 55 PHE A CB   11 
ATOM 9745  C CG   . PHE A 1 55 ? 7.581   -1.788  -2.413  1.00 0.00 ? 55 PHE A CG   11 
ATOM 9746  C CD1  . PHE A 1 55 ? 6.772   -2.888  -2.680  1.00 0.00 ? 55 PHE A CD1  11 
ATOM 9747  C CD2  . PHE A 1 55 ? 8.230   -1.166  -3.468  1.00 0.00 ? 55 PHE A CD2  11 
ATOM 9748  C CE1  . PHE A 1 55 ? 6.600   -3.335  -3.982  1.00 0.00 ? 55 PHE A CE1  11 
ATOM 9749  C CE2  . PHE A 1 55 ? 8.058   -1.607  -4.771  1.00 0.00 ? 55 PHE A CE2  11 
ATOM 9750  C CZ   . PHE A 1 55 ? 7.240   -2.695  -5.033  1.00 0.00 ? 55 PHE A CZ   11 
ATOM 9751  H H    . PHE A 1 55 ? 6.551   1.172   -1.284  1.00 0.00 ? 55 PHE A H    11 
ATOM 9752  H HA   . PHE A 1 55 ? 5.672   -1.559  -0.569  1.00 0.00 ? 55 PHE A HA   11 
ATOM 9753  H HB2  . PHE A 1 55 ? 8.510   -0.496  -0.978  1.00 0.00 ? 55 PHE A HB2  11 
ATOM 9754  H HB3  . PHE A 1 55 ? 8.089   -2.122  -0.406  1.00 0.00 ? 55 PHE A HB3  11 
ATOM 9755  H HD1  . PHE A 1 55 ? 6.275   -3.405  -1.871  1.00 0.00 ? 55 PHE A HD1  11 
ATOM 9756  H HD2  . PHE A 1 55 ? 8.881   -0.332  -3.272  1.00 0.00 ? 55 PHE A HD2  11 
ATOM 9757  H HE1  . PHE A 1 55 ? 5.960   -4.176  -4.174  1.00 0.00 ? 55 PHE A HE1  11 
ATOM 9758  H HE2  . PHE A 1 55 ? 8.556   -1.087  -5.575  1.00 0.00 ? 55 PHE A HE2  11 
ATOM 9759  H HZ   . PHE A 1 55 ? 7.105   -3.037  -6.048  1.00 0.00 ? 55 PHE A HZ   11 
ATOM 9760  N N    . CYS A 1 56 ? 6.434   -1.538  1.801   1.00 0.00 ? 56 CYS A N    11 
ATOM 9761  C CA   . CYS A 1 56 ? 6.350   -1.439  3.272   1.00 0.00 ? 56 CYS A CA   11 
ATOM 9762  C C    . CYS A 1 56 ? 7.596   -2.163  3.823   1.00 0.00 ? 56 CYS A C    11 
ATOM 9763  O O    . CYS A 1 56 ? 8.306   -2.816  3.069   1.00 0.00 ? 56 CYS A O    11 
ATOM 9764  C CB   . CYS A 1 56 ? 5.034   -2.157  3.690   1.00 0.00 ? 56 CYS A CB   11 
ATOM 9765  S SG   . CYS A 1 56 ? 3.907   -1.231  4.768   1.00 0.00 ? 56 CYS A SG   11 
ATOM 9766  H H    . CYS A 1 56 ? 6.489   -2.414  1.279   1.00 0.00 ? 56 CYS A H    11 
ATOM 9767  H HA   . CYS A 1 56 ? 6.373   -0.383  3.628   1.00 0.00 ? 56 CYS A HA   11 
ATOM 9768  H HB2  . CYS A 1 56 ? 4.403   -2.418  2.823   1.00 0.00 ? 56 CYS A HB2  11 
ATOM 9769  H HB3  . CYS A 1 56 ? 5.285   -3.099  4.194   1.00 0.00 ? 56 CYS A HB3  11 
ATOM 9770  N N    . PRO A 1 57 ? 7.854   -2.043  5.156   1.00 0.00 ? 57 PRO A N    11 
ATOM 9771  C CA   . PRO A 1 57 ? 8.910   -2.825  5.799   1.00 0.00 ? 57 PRO A CA   11 
ATOM 9772  C C    . PRO A 1 57 ? 8.538   -4.321  5.856   1.00 0.00 ? 57 PRO A C    11 
ATOM 9773  O O    . PRO A 1 57 ? 7.457   -4.729  5.448   1.00 0.00 ? 57 PRO A O    11 
ATOM 9774  C CB   . PRO A 1 57 ? 9.027   -2.211  7.203   1.00 0.00 ? 57 PRO A CB   11 
ATOM 9775  C CG   . PRO A 1 57 ? 7.664   -1.564  7.461   1.00 0.00 ? 57 PRO A CG   11 
ATOM 9776  C CD   . PRO A 1 57 ? 7.151   -1.154  6.079   1.00 0.00 ? 57 PRO A CD   11 
ATOM 9777  H HA   . PRO A 1 57 ? 9.847   -2.721  5.248   1.00 0.00 ? 57 PRO A HA   11 
ATOM 9778  H HB2  . PRO A 1 57 ? 9.307   -2.919  7.984   1.00 0.00 ? 57 PRO A HB2  11 
ATOM 9779  H HB3  . PRO A 1 57 ? 9.789   -1.431  7.186   1.00 0.00 ? 57 PRO A HB3  11 
ATOM 9780  H HG2  . PRO A 1 57 ? 6.989   -2.306  7.890   1.00 0.00 ? 57 PRO A HG2  11 
ATOM 9781  H HG3  . PRO A 1 57 ? 7.718   -0.725  8.155   1.00 0.00 ? 57 PRO A HG3  11 
ATOM 9782  H HD2  . PRO A 1 57 ? 6.064   -1.303  6.032   1.00 0.00 ? 57 PRO A HD2  11 
ATOM 9783  H HD3  . PRO A 1 57 ? 7.454   -0.120  5.856   1.00 0.00 ? 57 PRO A HD3  11 
ATOM 9784  N N    . GLU A 1 58 ? 9.524   -5.101  6.363   1.00 0.00 ? 58 GLU A N    11 
ATOM 9785  C CA   . GLU A 1 58 ? 9.345   -6.576  6.489   1.00 0.00 ? 58 GLU A CA   11 
ATOM 9786  C C    . GLU A 1 58 ? 9.030   -7.206  5.109   1.00 0.00 ? 58 GLU A C    11 
ATOM 9787  O O    . GLU A 1 58 ? 8.288   -8.167  4.960   1.00 0.00 ? 58 GLU A O    11 
ATOM 9788  C CB   . GLU A 1 58 ? 8.251   -6.847  7.543   1.00 0.00 ? 58 GLU A CB   11 
ATOM 9789  C CG   . GLU A 1 58 ? 8.308   -8.255  8.157   1.00 0.00 ? 58 GLU A CG   11 
ATOM 9790  C CD   . GLU A 1 58 ? 9.581   -8.503  8.989   1.00 0.00 ? 58 GLU A CD   11 
ATOM 9791  O OE1  . GLU A 1 58 ? 10.119  -7.551  9.556   1.00 0.00 ? 58 GLU A OE1  11 
ATOM 9792  O OE2  . GLU A 1 58 ? 10.021  -9.648  9.058   1.00 0.00 ? 58 GLU A OE2  11 
ATOM 9793  H H    . GLU A 1 58 ? 10.308  -4.548  6.662   1.00 0.00 ? 58 GLU A H    11 
ATOM 9794  H HA   . GLU A 1 58 ? 10.275  -7.060  6.822   1.00 0.00 ? 58 GLU A HA   11 
ATOM 9795  H HB2  . GLU A 1 58 ? 8.362   -6.121  8.359   1.00 0.00 ? 58 GLU A HB2  11 
ATOM 9796  H HB3  . GLU A 1 58 ? 7.262   -6.695  7.098   1.00 0.00 ? 58 GLU A HB3  11 
ATOM 9797  H HG2  . GLU A 1 58 ? 7.451   -8.401  8.812   1.00 0.00 ? 58 GLU A HG2  11 
ATOM 9798  H HG3  . GLU A 1 58 ? 8.244   -9.007  7.370   1.00 0.00 ? 58 GLU A HG3  11 
ATOM 9799  N N    . THR A 1 59 ? 9.646   -6.548  4.113   1.00 0.00 ? 59 THR A N    11 
ATOM 9800  C CA   . THR A 1 59 ? 9.483   -6.869  2.699   1.00 0.00 ? 59 THR A CA   11 
ATOM 9801  C C    . THR A 1 59 ? 10.727  -7.621  2.180   1.00 0.00 ? 59 THR A C    11 
ATOM 9802  O O    . THR A 1 59 ? 10.697  -8.331  1.183   1.00 0.00 ? 59 THR A O    11 
ATOM 9803  C CB   . THR A 1 59 ? 9.220   -5.517  2.002   1.00 0.00 ? 59 THR A CB   11 
ATOM 9804  O OG1  . THR A 1 59 ? 8.702   -5.691  0.695   1.00 0.00 ? 59 THR A OG1  11 
ATOM 9805  C CG2  . THR A 1 59 ? 10.462  -4.600  1.986   1.00 0.00 ? 59 THR A CG2  11 
ATOM 9806  H H    . THR A 1 59 ? 10.228  -5.782  4.374   1.00 0.00 ? 59 THR A H    11 
ATOM 9807  H HA   . THR A 1 59 ? 8.619   -7.524  2.587   1.00 0.00 ? 59 THR A HA   11 
ATOM 9808  H HB   . THR A 1 59 ? 8.435   -5.050  2.608   1.00 0.00 ? 59 THR A HB   11 
ATOM 9809  H HG1  . THR A 1 59 ? 8.528   -4.834  0.309   1.00 0.00 ? 59 THR A HG1  11 
ATOM 9810  H HG21 . THR A 1 59 ? 11.246  -5.003  1.345   1.00 0.00 ? 59 THR A HG21 11 
ATOM 9811  H HG22 . THR A 1 59 ? 10.883  -4.476  2.984   1.00 0.00 ? 59 THR A HG22 11 
ATOM 9812  H HG23 . THR A 1 59 ? 10.230  -3.597  1.626   1.00 0.00 ? 59 THR A HG23 11 
ATOM 9813  N N    . ALA A 1 60 ? 11.815  -7.410  2.939   1.00 0.00 ? 60 ALA A N    11 
ATOM 9814  C CA   . ALA A 1 60 ? 13.115  -7.996  2.686   1.00 0.00 ? 60 ALA A CA   11 
ATOM 9815  C C    . ALA A 1 60 ? 13.979  -7.709  3.926   1.00 0.00 ? 60 ALA A C    11 
ATOM 9816  O O    . ALA A 1 60 ? 13.622  -6.810  4.694   1.00 0.00 ? 60 ALA A O    11 
ATOM 9817  C CB   . ALA A 1 60 ? 13.753  -7.373  1.438   1.00 0.00 ? 60 ALA A CB   11 
ATOM 9818  O OXT  . ALA A 1 60 ? 14.989  -8.384  4.110   1.00 0.00 ? 60 ALA A OXT  11 
ATOM 9819  H H    . ALA A 1 60 ? 11.824  -6.838  3.758   1.00 0.00 ? 60 ALA A H    11 
ATOM 9820  H HA   . ALA A 1 60 ? 12.975  -9.073  2.577   1.00 0.00 ? 60 ALA A HA   11 
ATOM 9821  H HB1  . ALA A 1 60 ? 13.859  -6.294  1.549   1.00 0.00 ? 60 ALA A HB1  11 
ATOM 9822  H HB2  . ALA A 1 60 ? 13.147  -7.564  0.551   1.00 0.00 ? 60 ALA A HB2  11 
ATOM 9823  H HB3  . ALA A 1 60 ? 14.744  -7.792  1.260   1.00 0.00 ? 60 ALA A HB3  11 
ATOM 9824  N N    . THR A 1 1  ? 5.788   9.288   10.972  1.00 0.00 ? 1  THR A N    12 
ATOM 9825  C CA   . THR A 1 1  ? 6.016   10.444  10.117  1.00 0.00 ? 1  THR A CA   12 
ATOM 9826  C C    . THR A 1 1  ? 5.736   9.888   8.726   1.00 0.00 ? 1  THR A C    12 
ATOM 9827  O O    . THR A 1 1  ? 5.125   8.828   8.657   1.00 0.00 ? 1  THR A O    12 
ATOM 9828  C CB   . THR A 1 1  ? 7.413   11.090  10.285  1.00 0.00 ? 1  THR A CB   12 
ATOM 9829  O OG1  . THR A 1 1  ? 7.545   12.232  9.451   1.00 0.00 ? 1  THR A OG1  12 
ATOM 9830  C CG2  . THR A 1 1  ? 8.561   10.133  9.930   1.00 0.00 ? 1  THR A CG2  12 
ATOM 9831  H H1   . THR A 1 1  ? 6.653   8.715   11.027  1.00 0.00 ? 1  THR A H1   12 
ATOM 9832  H H2   . THR A 1 1  ? 5.079   8.731   10.435  1.00 0.00 ? 1  THR A H2   12 
ATOM 9833  H H3   . THR A 1 1  ? 5.437   9.545   11.915  1.00 0.00 ? 1  THR A H3   12 
ATOM 9834  H HA   . THR A 1 1  ? 5.229   11.164  10.339  1.00 0.00 ? 1  THR A HA   12 
ATOM 9835  H HB   . THR A 1 1  ? 7.559   11.377  11.335  1.00 0.00 ? 1  THR A HB   12 
ATOM 9836  H HG1  . THR A 1 1  ? 7.060   12.983  9.790   1.00 0.00 ? 1  THR A HG1  12 
ATOM 9837  H HG21 . THR A 1 1  ? 9.524   10.622  10.086  1.00 0.00 ? 1  THR A HG21 12 
ATOM 9838  H HG22 . THR A 1 1  ? 8.529   9.822   8.885   1.00 0.00 ? 1  THR A HG22 12 
ATOM 9839  H HG23 . THR A 1 1  ? 8.553   9.236   10.549  1.00 0.00 ? 1  THR A HG23 12 
ATOM 9840  N N    . ALA A 1 2  ? 6.186   10.600  7.680   1.00 0.00 ? 2  ALA A N    12 
ATOM 9841  C CA   . ALA A 1 2  ? 5.987   10.116  6.321   1.00 0.00 ? 2  ALA A CA   12 
ATOM 9842  C C    . ALA A 1 2  ? 6.878   8.886   6.089   1.00 0.00 ? 2  ALA A C    12 
ATOM 9843  O O    . ALA A 1 2  ? 8.043   8.873   6.466   1.00 0.00 ? 2  ALA A O    12 
ATOM 9844  C CB   . ALA A 1 2  ? 6.370   11.224  5.333   1.00 0.00 ? 2  ALA A CB   12 
ATOM 9845  H H    . ALA A 1 2  ? 6.711   11.435  7.868   1.00 0.00 ? 2  ALA A H    12 
ATOM 9846  H HA   . ALA A 1 2  ? 4.934   9.848   6.213   1.00 0.00 ? 2  ALA A HA   12 
ATOM 9847  H HB1  . ALA A 1 2  ? 5.740   12.103  5.465   1.00 0.00 ? 2  ALA A HB1  12 
ATOM 9848  H HB2  . ALA A 1 2  ? 6.262   10.890  4.301   1.00 0.00 ? 2  ALA A HB2  12 
ATOM 9849  H HB3  . ALA A 1 2  ? 7.408   11.534  5.469   1.00 0.00 ? 2  ALA A HB3  12 
ATOM 9850  N N    . LEU A 1 3  ? 6.271   7.873   5.443   1.00 0.00 ? 3  LEU A N    12 
ATOM 9851  C CA   . LEU A 1 3  ? 6.996   6.650   5.125   1.00 0.00 ? 3  LEU A CA   12 
ATOM 9852  C C    . LEU A 1 3  ? 7.222   6.625   3.602   1.00 0.00 ? 3  LEU A C    12 
ATOM 9853  O O    . LEU A 1 3  ? 6.389   6.166   2.829   1.00 0.00 ? 3  LEU A O    12 
ATOM 9854  C CB   . LEU A 1 3  ? 6.219   5.413   5.620   1.00 0.00 ? 3  LEU A CB   12 
ATOM 9855  C CG   . LEU A 1 3  ? 7.192   4.247   5.883   1.00 0.00 ? 3  LEU A CG   12 
ATOM 9856  C CD1  . LEU A 1 3  ? 6.663   3.364   7.018   1.00 0.00 ? 3  LEU A CD1  12 
ATOM 9857  C CD2  . LEU A 1 3  ? 7.478   3.450   4.597   1.00 0.00 ? 3  LEU A CD2  12 
ATOM 9858  H H    . LEU A 1 3  ? 5.312   7.961   5.180   1.00 0.00 ? 3  LEU A H    12 
ATOM 9859  H HA   . LEU A 1 3  ? 7.964   6.687   5.629   1.00 0.00 ? 3  LEU A HA   12 
ATOM 9860  H HB2  . LEU A 1 3  ? 5.741   5.653   6.613   1.00 0.00 ? 3  LEU A HB2  12 
ATOM 9861  H HB3  . LEU A 1 3  ? 5.496   5.096   4.819   1.00 0.00 ? 3  LEU A HB3  12 
ATOM 9862  H HG   . LEU A 1 3  ? 8.145   4.636   6.243   1.00 0.00 ? 3  LEU A HG   12 
ATOM 9863  H HD11 . LEU A 1 3  ? 6.596   3.892   7.964   1.00 0.00 ? 3  LEU A HD11 12 
ATOM 9864  H HD12 . LEU A 1 3  ? 7.311   2.506   7.190   1.00 0.00 ? 3  LEU A HD12 12 
ATOM 9865  H HD13 . LEU A 1 3  ? 5.659   3.019   6.783   1.00 0.00 ? 3  LEU A HD13 12 
ATOM 9866  H HD21 . LEU A 1 3  ? 8.013   4.034   3.858   1.00 0.00 ? 3  LEU A HD21 12 
ATOM 9867  H HD22 . LEU A 1 3  ? 6.561   3.102   4.117   1.00 0.00 ? 3  LEU A HD22 12 
ATOM 9868  H HD23 . LEU A 1 3  ? 8.094   2.573   4.796   1.00 0.00 ? 3  LEU A HD23 12 
ATOM 9869  N N    . PHE A 1 4  ? 8.399   7.181   3.253   1.00 0.00 ? 4  PHE A N    12 
ATOM 9870  C CA   . PHE A 1 4  ? 8.882   7.330   1.878   1.00 0.00 ? 4  PHE A CA   12 
ATOM 9871  C C    . PHE A 1 4  ? 8.839   5.980   1.130   1.00 0.00 ? 4  PHE A C    12 
ATOM 9872  O O    . PHE A 1 4  ? 8.922   4.921   1.737   1.00 0.00 ? 4  PHE A O    12 
ATOM 9873  C CB   . PHE A 1 4  ? 10.320  7.891   1.951   1.00 0.00 ? 4  PHE A CB   12 
ATOM 9874  C CG   . PHE A 1 4  ? 10.377  9.126   2.815   1.00 0.00 ? 4  PHE A CG   12 
ATOM 9875  C CD1  . PHE A 1 4  ? 9.853   10.330  2.354   1.00 0.00 ? 4  PHE A CD1  12 
ATOM 9876  C CD2  . PHE A 1 4  ? 10.937  9.076   4.089   1.00 0.00 ? 4  PHE A CD2  12 
ATOM 9877  C CE1  . PHE A 1 4  ? 9.880   11.464  3.156   1.00 0.00 ? 4  PHE A CE1  12 
ATOM 9878  C CE2  . PHE A 1 4  ? 10.962  10.208  4.893   1.00 0.00 ? 4  PHE A CE2  12 
ATOM 9879  C CZ   . PHE A 1 4  ? 10.433  11.403  4.427   1.00 0.00 ? 4  PHE A CZ   12 
ATOM 9880  H H    . PHE A 1 4  ? 8.973   7.523   3.995   1.00 0.00 ? 4  PHE A H    12 
ATOM 9881  H HA   . PHE A 1 4  ? 8.192   8.031   1.402   1.00 0.00 ? 4  PHE A HA   12 
ATOM 9882  H HB2  . PHE A 1 4  ? 10.971  7.120   2.382   1.00 0.00 ? 4  PHE A HB2  12 
ATOM 9883  H HB3  . PHE A 1 4  ? 10.733  8.155   0.969   1.00 0.00 ? 4  PHE A HB3  12 
ATOM 9884  H HD1  . PHE A 1 4  ? 9.418   10.387  1.367   1.00 0.00 ? 4  PHE A HD1  12 
ATOM 9885  H HD2  . PHE A 1 4  ? 11.354  8.154   4.465   1.00 0.00 ? 4  PHE A HD2  12 
ATOM 9886  H HE1  . PHE A 1 4  ? 9.469   12.394  2.790   1.00 0.00 ? 4  PHE A HE1  12 
ATOM 9887  H HE2  . PHE A 1 4  ? 11.390  10.157  5.884   1.00 0.00 ? 4  PHE A HE2  12 
ATOM 9888  H HZ   . PHE A 1 4  ? 10.451  12.282  5.055   1.00 0.00 ? 4  PHE A HZ   12 
ATOM 9889  N N    . THR A 1 5  ? 8.698   6.077   -0.208  1.00 0.00 ? 5  THR A N    12 
ATOM 9890  C CA   . THR A 1 5  ? 8.553   4.877   -1.024  1.00 0.00 ? 5  THR A CA   12 
ATOM 9891  C C    . THR A 1 5  ? 9.907   4.527   -1.664  1.00 0.00 ? 5  THR A C    12 
ATOM 9892  O O    . THR A 1 5  ? 10.918  5.176   -1.434  1.00 0.00 ? 5  THR A O    12 
ATOM 9893  C CB   . THR A 1 5  ? 7.475   5.147   -2.106  1.00 0.00 ? 5  THR A CB   12 
ATOM 9894  O OG1  . THR A 1 5  ? 7.946   5.923   -3.195  1.00 0.00 ? 5  THR A OG1  12 
ATOM 9895  C CG2  . THR A 1 5  ? 6.284   5.949   -1.572  1.00 0.00 ? 5  THR A CG2  12 
ATOM 9896  H H    . THR A 1 5  ? 8.634   6.953   -0.681  1.00 0.00 ? 5  THR A H    12 
ATOM 9897  H HA   . THR A 1 5  ? 8.233   4.052   -0.384  1.00 0.00 ? 5  THR A HA   12 
ATOM 9898  H HB   . THR A 1 5  ? 7.090   4.188   -2.478  1.00 0.00 ? 5  THR A HB   12 
ATOM 9899  H HG1  . THR A 1 5  ? 8.688   5.504   -3.622  1.00 0.00 ? 5  THR A HG1  12 
ATOM 9900  H HG21 . THR A 1 5  ? 5.517   6.041   -2.342  1.00 0.00 ? 5  THR A HG21 12 
ATOM 9901  H HG22 . THR A 1 5  ? 6.567   6.968   -1.301  1.00 0.00 ? 5  THR A HG22 12 
ATOM 9902  H HG23 . THR A 1 5  ? 5.837   5.487   -0.692  1.00 0.00 ? 5  THR A HG23 12 
ATOM 9903  N N    . MET A 1 6  ? 9.842   3.471   -2.501  1.00 0.00 ? 6  MET A N    12 
ATOM 9904  C CA   . MET A 1 6  ? 11.016  3.006   -3.234  1.00 0.00 ? 6  MET A CA   12 
ATOM 9905  C C    . MET A 1 6  ? 10.557  2.422   -4.582  1.00 0.00 ? 6  MET A C    12 
ATOM 9906  O O    . MET A 1 6  ? 10.549  3.109   -5.591  1.00 0.00 ? 6  MET A O    12 
ATOM 9907  C CB   . MET A 1 6  ? 11.911  2.091   -2.362  1.00 0.00 ? 6  MET A CB   12 
ATOM 9908  C CG   . MET A 1 6  ? 11.207  1.054   -1.459  1.00 0.00 ? 6  MET A CG   12 
ATOM 9909  S SD   . MET A 1 6  ? 11.116  -0.596  -2.182  1.00 0.00 ? 6  MET A SD   12 
ATOM 9910  C CE   . MET A 1 6  ? 10.745  -1.529  -0.686  1.00 0.00 ? 6  MET A CE   12 
ATOM 9911  H H    . MET A 1 6  ? 8.971   3.003   -2.624  1.00 0.00 ? 6  MET A H    12 
ATOM 9912  H HA   . MET A 1 6  ? 11.589  3.898   -3.499  1.00 0.00 ? 6  MET A HA   12 
ATOM 9913  H HB2  . MET A 1 6  ? 12.679  1.607   -2.967  1.00 0.00 ? 6  MET A HB2  12 
ATOM 9914  H HB3  . MET A 1 6  ? 12.461  2.759   -1.697  1.00 0.00 ? 6  MET A HB3  12 
ATOM 9915  H HG2  . MET A 1 6  ? 11.796  0.957   -0.546  1.00 0.00 ? 6  MET A HG2  12 
ATOM 9916  H HG3  . MET A 1 6  ? 10.221  1.370   -1.123  1.00 0.00 ? 6  MET A HG3  12 
ATOM 9917  H HE1  . MET A 1 6  ? 10.368  -2.520  -0.941  1.00 0.00 ? 6  MET A HE1  12 
ATOM 9918  H HE2  . MET A 1 6  ? 9.978   -1.017  -0.104  1.00 0.00 ? 6  MET A HE2  12 
ATOM 9919  H HE3  . MET A 1 6  ? 11.636  -1.622  -0.065  1.00 0.00 ? 6  MET A HE3  12 
ATOM 9920  N N    . GLY A 1 7  ? 10.145  1.142   -4.544  1.00 0.00 ? 7  GLY A N    12 
ATOM 9921  C CA   . GLY A 1 7  ? 9.660   0.484   -5.761  1.00 0.00 ? 7  GLY A CA   12 
ATOM 9922  C C    . GLY A 1 7  ? 8.252   0.965   -6.168  1.00 0.00 ? 7  GLY A C    12 
ATOM 9923  O O    . GLY A 1 7  ? 7.852   0.901   -7.322  1.00 0.00 ? 7  GLY A O    12 
ATOM 9924  H H    . GLY A 1 7  ? 10.200  0.647   -3.681  1.00 0.00 ? 7  GLY A H    12 
ATOM 9925  H HA2  . GLY A 1 7  ? 10.370  0.678   -6.570  1.00 0.00 ? 7  GLY A HA2  12 
ATOM 9926  H HA3  . GLY A 1 7  ? 9.632   -0.585  -5.540  1.00 0.00 ? 7  GLY A HA3  12 
ATOM 9927  N N    . GLY A 1 8  ? 7.548   1.436   -5.118  1.00 0.00 ? 8  GLY A N    12 
ATOM 9928  C CA   . GLY A 1 8  ? 6.188   1.973   -5.150  1.00 0.00 ? 8  GLY A CA   12 
ATOM 9929  C C    . GLY A 1 8  ? 5.888   2.869   -6.364  1.00 0.00 ? 8  GLY A C    12 
ATOM 9930  O O    . GLY A 1 8  ? 6.781   3.447   -6.966  1.00 0.00 ? 8  GLY A O    12 
ATOM 9931  H H    . GLY A 1 8  ? 8.018   1.313   -4.254  1.00 0.00 ? 8  GLY A H    12 
ATOM 9932  H HA2  . GLY A 1 8  ? 5.517   1.115   -5.101  1.00 0.00 ? 8  GLY A HA2  12 
ATOM 9933  H HA3  . GLY A 1 8  ? 6.080   2.576   -4.251  1.00 0.00 ? 8  GLY A HA3  12 
ATOM 9934  N N    . ASN A 1 9  ? 4.576   2.947   -6.687  1.00 0.00 ? 9  ASN A N    12 
ATOM 9935  C CA   . ASN A 1 9  ? 4.153   3.706   -7.873  1.00 0.00 ? 9  ASN A CA   12 
ATOM 9936  C C    . ASN A 1 9  ? 3.351   4.959   -7.494  1.00 0.00 ? 9  ASN A C    12 
ATOM 9937  O O    . ASN A 1 9  ? 2.785   5.629   -8.345  1.00 0.00 ? 9  ASN A O    12 
ATOM 9938  C CB   . ASN A 1 9  ? 3.367   2.801   -8.854  1.00 0.00 ? 9  ASN A CB   12 
ATOM 9939  C CG   . ASN A 1 9  ? 1.978   2.363   -8.347  1.00 0.00 ? 9  ASN A CG   12 
ATOM 9940  O OD1  . ASN A 1 9  ? 1.488   2.834   -7.333  1.00 0.00 ? 9  ASN A OD1  12 
ATOM 9941  N ND2  . ASN A 1 9  ? 1.360   1.441   -9.102  1.00 0.00 ? 9  ASN A ND2  12 
ATOM 9942  H H    . ASN A 1 9  ? 3.890   2.503   -6.094  1.00 0.00 ? 9  ASN A H    12 
ATOM 9943  H HA   . ASN A 1 9  ? 5.051   4.066   -8.384  1.00 0.00 ? 9  ASN A HA   12 
ATOM 9944  H HB2  . ASN A 1 9  ? 3.214   3.337   -9.792  1.00 0.00 ? 9  ASN A HB2  12 
ATOM 9945  H HB3  . ASN A 1 9  ? 3.958   1.918   -9.097  1.00 0.00 ? 9  ASN A HB3  12 
ATOM 9946  H HD21 . ASN A 1 9  ? 1.769   1.063   -9.938  1.00 0.00 ? 9  ASN A HD21 12 
ATOM 9947  H HD22 . ASN A 1 9  ? 0.451   1.154   -8.778  1.00 0.00 ? 9  ASN A HD22 12 
ATOM 9948  N N    . ALA A 1 10 ? 3.355   5.256   -6.182  1.00 0.00 ? 10 ALA A N    12 
ATOM 9949  C CA   . ALA A 1 10 ? 2.622   6.399   -5.647  1.00 0.00 ? 10 ALA A CA   12 
ATOM 9950  C C    . ALA A 1 10 ? 3.336   7.759   -5.835  1.00 0.00 ? 10 ALA A C    12 
ATOM 9951  O O    . ALA A 1 10 ? 3.109   8.682   -5.066  1.00 0.00 ? 10 ALA A O    12 
ATOM 9952  C CB   . ALA A 1 10 ? 2.422   6.134   -4.154  1.00 0.00 ? 10 ALA A CB   12 
ATOM 9953  H H    . ALA A 1 10 ? 3.825   4.641   -5.551  1.00 0.00 ? 10 ALA A H    12 
ATOM 9954  H HA   . ALA A 1 10 ? 1.654   6.439   -6.145  1.00 0.00 ? 10 ALA A HA   12 
ATOM 9955  H HB1  . ALA A 1 10 ? 1.763   6.880   -3.713  1.00 0.00 ? 10 ALA A HB1  12 
ATOM 9956  H HB2  . ALA A 1 10 ? 3.367   6.170   -3.608  1.00 0.00 ? 10 ALA A HB2  12 
ATOM 9957  H HB3  . ALA A 1 10 ? 1.987   5.149   -3.988  1.00 0.00 ? 10 ALA A HB3  12 
ATOM 9958  N N    . GLU A 1 11 ? 4.234   7.836   -6.837  1.00 0.00 ? 11 GLU A N    12 
ATOM 9959  C CA   . GLU A 1 11 ? 4.994   9.059   -7.111  1.00 0.00 ? 11 GLU A CA   12 
ATOM 9960  C C    . GLU A 1 11 ? 5.713   9.639   -5.865  1.00 0.00 ? 11 GLU A C    12 
ATOM 9961  O O    . GLU A 1 11 ? 5.841   10.846  -5.707  1.00 0.00 ? 11 GLU A O    12 
ATOM 9962  C CB   . GLU A 1 11 ? 4.120   10.136  -7.783  1.00 0.00 ? 11 GLU A CB   12 
ATOM 9963  C CG   . GLU A 1 11 ? 3.508   9.701   -9.130  1.00 0.00 ? 11 GLU A CG   12 
ATOM 9964  C CD   . GLU A 1 11 ? 2.054   9.212   -9.047  1.00 0.00 ? 11 GLU A CD   12 
ATOM 9965  O OE1  . GLU A 1 11 ? 1.545   8.908   -7.969  1.00 0.00 ? 11 GLU A OE1  12 
ATOM 9966  O OE2  . GLU A 1 11 ? 1.389   9.127   -10.078 1.00 0.00 ? 11 GLU A OE2  12 
ATOM 9967  H H    . GLU A 1 11 ? 4.322   7.056   -7.453  1.00 0.00 ? 11 GLU A H    12 
ATOM 9968  H HA   . GLU A 1 11 ? 5.773   8.752   -7.808  1.00 0.00 ? 11 GLU A HA   12 
ATOM 9969  H HB2  . GLU A 1 11 ? 3.351   10.495  -7.096  1.00 0.00 ? 11 GLU A HB2  12 
ATOM 9970  H HB3  . GLU A 1 11 ? 4.751   11.004  -7.980  1.00 0.00 ? 11 GLU A HB3  12 
ATOM 9971  H HG2  . GLU A 1 11 ? 3.516   10.551  -9.813  1.00 0.00 ? 11 GLU A HG2  12 
ATOM 9972  H HG3  . GLU A 1 11 ? 4.112   8.927   -9.603  1.00 0.00 ? 11 GLU A HG3  12 
ATOM 9973  N N    . GLY A 1 12 ? 6.184   8.718   -4.999  1.00 0.00 ? 12 GLY A N    12 
ATOM 9974  C CA   . GLY A 1 12 ? 6.915   9.145   -3.795  1.00 0.00 ? 12 GLY A CA   12 
ATOM 9975  C C    . GLY A 1 12 ? 5.976   9.429   -2.607  1.00 0.00 ? 12 GLY A C    12 
ATOM 9976  O O    . GLY A 1 12 ? 6.438   9.638   -1.492  1.00 0.00 ? 12 GLY A O    12 
ATOM 9977  H H    . GLY A 1 12 ? 6.017   7.756   -5.217  1.00 0.00 ? 12 GLY A H    12 
ATOM 9978  H HA2  . GLY A 1 12 ? 7.544   8.261   -3.483  1.00 0.00 ? 12 GLY A HA2  12 
ATOM 9979  H HA3  . GLY A 1 12 ? 7.440   10.118  -4.042  1.00 0.00 ? 12 GLY A HA3  12 
ATOM 9980  N N    . GLN A 1 13 ? 4.650   9.423   -2.872  1.00 0.00 ? 13 GLN A N    12 
ATOM 9981  C CA   . GLN A 1 13 ? 3.695   9.650   -1.791  1.00 0.00 ? 13 GLN A CA   12 
ATOM 9982  C C    . GLN A 1 13 ? 3.805   8.475   -0.794  1.00 0.00 ? 13 GLN A C    12 
ATOM 9983  O O    . GLN A 1 13 ? 3.771   7.317   -1.193  1.00 0.00 ? 13 GLN A O    12 
ATOM 9984  C CB   . GLN A 1 13 ? 2.245   9.751   -2.305  1.00 0.00 ? 13 GLN A CB   12 
ATOM 9985  C CG   . GLN A 1 13 ? 1.949   11.013  -3.137  1.00 0.00 ? 13 GLN A CG   12 
ATOM 9986  C CD   . GLN A 1 13 ? 1.936   12.258  -2.241  1.00 0.00 ? 13 GLN A CD   12 
ATOM 9987  O OE1  . GLN A 1 13 ? 2.951   12.890  -1.994  1.00 0.00 ? 13 GLN A OE1  12 
ATOM 9988  N NE2  . GLN A 1 13 ? 0.728   12.563  -1.753  1.00 0.00 ? 13 GLN A NE2  12 
ATOM 9989  H H    . GLN A 1 13 ? 4.311   9.218   -3.790  1.00 0.00 ? 13 GLN A H    12 
ATOM 9990  H HA   . GLN A 1 13 ? 3.989   10.582  -1.311  1.00 0.00 ? 13 GLN A HA   12 
ATOM 9991  H HB2  . GLN A 1 13 ? 1.999   8.863   -2.882  1.00 0.00 ? 13 GLN A HB2  12 
ATOM 9992  H HB3  . GLN A 1 13 ? 1.562   9.760   -1.453  1.00 0.00 ? 13 GLN A HB3  12 
ATOM 9993  H HG2  . GLN A 1 13 ? 2.671   11.175  -3.936  1.00 0.00 ? 13 GLN A HG2  12 
ATOM 9994  H HG3  . GLN A 1 13 ? 0.977   10.917  -3.621  1.00 0.00 ? 13 GLN A HG3  12 
ATOM 9995  H HE21 . GLN A 1 13 ? -0.082  12.022  -1.974  1.00 0.00 ? 13 GLN A HE21 12 
ATOM 9996  H HE22 . GLN A 1 13 ? 0.659   13.356  -1.151  1.00 0.00 ? 13 GLN A HE22 12 
ATOM 9997  N N    . PRO A 1 14 ? 3.962   8.808   0.512   1.00 0.00 ? 14 PRO A N    12 
ATOM 9998  C CA   . PRO A 1 14 ? 4.298   7.812   1.522   1.00 0.00 ? 14 PRO A CA   12 
ATOM 9999  C C    . PRO A 1 14 ? 3.176   6.792   1.764   1.00 0.00 ? 14 PRO A C    12 
ATOM 10000 O O    . PRO A 1 14 ? 2.004   7.100   1.578   1.00 0.00 ? 14 PRO A O    12 
ATOM 10001 C CB   . PRO A 1 14 ? 4.546   8.645   2.788   1.00 0.00 ? 14 PRO A CB   12 
ATOM 10002 C CG   . PRO A 1 14 ? 3.771   9.949   2.574   1.00 0.00 ? 14 PRO A CG   12 
ATOM 10003 C CD   . PRO A 1 14 ? 3.829   10.158  1.062   1.00 0.00 ? 14 PRO A CD   12 
ATOM 10004 H HA   . PRO A 1 14 ? 5.195   7.283   1.203   1.00 0.00 ? 14 PRO A HA   12 
ATOM 10005 H HB2  . PRO A 1 14 ? 4.228   8.134   3.701   1.00 0.00 ? 14 PRO A HB2  12 
ATOM 10006 H HB3  . PRO A 1 14 ? 5.613   8.875   2.855   1.00 0.00 ? 14 PRO A HB3  12 
ATOM 10007 H HG2  . PRO A 1 14 ? 2.700   9.742   2.840   1.00 0.00 ? 14 PRO A HG2  12 
ATOM 10008 H HG3  . PRO A 1 14 ? 4.278   10.802  3.097   1.00 0.00 ? 14 PRO A HG3  12 
ATOM 10009 H HD2  . PRO A 1 14 ? 2.932   10.658  0.694   1.00 0.00 ? 14 PRO A HD2  12 
ATOM 10010 H HD3  . PRO A 1 14 ? 4.705   10.748  0.788   1.00 0.00 ? 14 PRO A HD3  12 
ATOM 10011 N N    . CYS A 1 15 ? 3.595   5.580   2.207   1.00 0.00 ? 15 CYS A N    12 
ATOM 10012 C CA   . CYS A 1 15 ? 2.614   4.540   2.553   1.00 0.00 ? 15 CYS A CA   12 
ATOM 10013 C C    . CYS A 1 15 ? 1.568   5.128   3.515   1.00 0.00 ? 15 CYS A C    12 
ATOM 10014 O O    . CYS A 1 15 ? 1.884   5.934   4.384   1.00 0.00 ? 15 CYS A O    12 
ATOM 10015 C CB   . CYS A 1 15 ? 3.249   3.372   3.323   1.00 0.00 ? 15 CYS A CB   12 
ATOM 10016 S SG   . CYS A 1 15 ? 4.106   2.121   2.338   1.00 0.00 ? 15 CYS A SG   12 
ATOM 10017 H H    . CYS A 1 15 ? 4.582   5.441   2.333   1.00 0.00 ? 15 CYS A H    12 
ATOM 10018 H HA   . CYS A 1 15 ? 2.107   4.203   1.648   1.00 0.00 ? 15 CYS A HA   12 
ATOM 10019 H HB2  . CYS A 1 15 ? 3.914   3.750   4.094   1.00 0.00 ? 15 CYS A HB2  12 
ATOM 10020 H HB3  . CYS A 1 15 ? 2.477   2.821   3.852   1.00 0.00 ? 15 CYS A HB3  12 
ATOM 10021 N N    . LYS A 1 16 ? 0.317   4.688   3.286   1.00 0.00 ? 16 LYS A N    12 
ATOM 10022 C CA   . LYS A 1 16 ? -0.807  5.190   4.055   1.00 0.00 ? 16 LYS A CA   12 
ATOM 10023 C C    . LYS A 1 16 ? -1.439  4.044   4.833   1.00 0.00 ? 16 LYS A C    12 
ATOM 10024 O O    . LYS A 1 16 ? -1.710  2.965   4.322   1.00 0.00 ? 16 LYS A O    12 
ATOM 10025 C CB   . LYS A 1 16 ? -1.838  5.783   3.087   1.00 0.00 ? 16 LYS A CB   12 
ATOM 10026 C CG   . LYS A 1 16 ? -2.927  6.677   3.732   1.00 0.00 ? 16 LYS A CG   12 
ATOM 10027 C CD   . LYS A 1 16 ? -2.301  7.921   4.386   1.00 0.00 ? 16 LYS A CD   12 
ATOM 10028 C CE   . LYS A 1 16 ? -2.158  7.853   5.913   1.00 0.00 ? 16 LYS A CE   12 
ATOM 10029 N NZ   . LYS A 1 16 ? -3.446  7.614   6.563   1.00 0.00 ? 16 LYS A NZ   12 
ATOM 10030 H H    . LYS A 1 16 ? 0.135   3.999   2.580   1.00 0.00 ? 16 LYS A H    12 
ATOM 10031 H HA   . LYS A 1 16 ? -0.407  5.939   4.742   1.00 0.00 ? 16 LYS A HA   12 
ATOM 10032 H HB2  . LYS A 1 16 ? -1.295  6.423   2.393   1.00 0.00 ? 16 LYS A HB2  12 
ATOM 10033 H HB3  . LYS A 1 16 ? -2.238  4.948   2.496   1.00 0.00 ? 16 LYS A HB3  12 
ATOM 10034 H HG2  . LYS A 1 16 ? -3.611  7.080   2.975   1.00 0.00 ? 16 LYS A HG2  12 
ATOM 10035 H HG3  . LYS A 1 16 ? -3.588  6.116   4.399   1.00 0.00 ? 16 LYS A HG3  12 
ATOM 10036 H HD2  . LYS A 1 16 ? -1.360  8.160   3.873   1.00 0.00 ? 16 LYS A HD2  12 
ATOM 10037 H HD3  . LYS A 1 16 ? -2.955  8.760   4.190   1.00 0.00 ? 16 LYS A HD3  12 
ATOM 10038 H HE2  . LYS A 1 16 ? -1.468  7.074   6.221   1.00 0.00 ? 16 LYS A HE2  12 
ATOM 10039 H HE3  . LYS A 1 16 ? -1.753  8.788   6.304   1.00 0.00 ? 16 LYS A HE3  12 
ATOM 10040 H HZ1  . LYS A 1 16 ? -3.370  7.012   7.415   1.00 0.00 ? 16 LYS A HZ1  12 
ATOM 10041 H HZ2  . LYS A 1 16 ? -4.104  7.161   5.886   1.00 0.00 ? 16 LYS A HZ2  12 
ATOM 10042 H HZ3  . LYS A 1 16 ? -3.946  8.503   6.766   1.00 0.00 ? 16 LYS A HZ3  12 
ATOM 10043 N N    . PHE A 1 17 ? -1.645  4.374   6.111   1.00 0.00 ? 17 PHE A N    12 
ATOM 10044 C CA   . PHE A 1 17 ? -2.262  3.468   7.058   1.00 0.00 ? 17 PHE A CA   12 
ATOM 10045 C C    . PHE A 1 17 ? -3.341  4.307   7.762   1.00 0.00 ? 17 PHE A C    12 
ATOM 10046 O O    . PHE A 1 17 ? -3.123  5.501   7.977   1.00 0.00 ? 17 PHE A O    12 
ATOM 10047 C CB   . PHE A 1 17 ? -1.182  2.987   8.048   1.00 0.00 ? 17 PHE A CB   12 
ATOM 10048 C CG   . PHE A 1 17 ? -0.006  2.348   7.351   1.00 0.00 ? 17 PHE A CG   12 
ATOM 10049 C CD1  . PHE A 1 17 ? -0.136  1.103   6.750   1.00 0.00 ? 17 PHE A CD1  12 
ATOM 10050 C CD2  . PHE A 1 17 ? 1.233   2.980   7.301   1.00 0.00 ? 17 PHE A CD2  12 
ATOM 10051 C CE1  . PHE A 1 17 ? 0.951   0.492   6.147   1.00 0.00 ? 17 PHE A CE1  12 
ATOM 10052 C CE2  . PHE A 1 17 ? 2.323   2.371   6.696   1.00 0.00 ? 17 PHE A CE2  12 
ATOM 10053 C CZ   . PHE A 1 17 ? 2.188   1.106   6.133   1.00 0.00 ? 17 PHE A CZ   12 
ATOM 10054 H H    . PHE A 1 17 ? -1.412  5.294   6.417   1.00 0.00 ? 17 PHE A H    12 
ATOM 10055 H HA   . PHE A 1 17 ? -2.704  2.649   6.487   1.00 0.00 ? 17 PHE A HA   12 
ATOM 10056 H HB2  . PHE A 1 17 ? -0.816  3.840   8.631   1.00 0.00 ? 17 PHE A HB2  12 
ATOM 10057 H HB3  . PHE A 1 17 ? -1.589  2.256   8.760   1.00 0.00 ? 17 PHE A HB3  12 
ATOM 10058 H HD1  . PHE A 1 17 ? -1.084  0.597   6.747   1.00 0.00 ? 17 PHE A HD1  12 
ATOM 10059 H HD2  . PHE A 1 17 ? 1.371   3.954   7.738   1.00 0.00 ? 17 PHE A HD2  12 
ATOM 10060 H HE1  . PHE A 1 17 ? 0.835   -0.467  5.686   1.00 0.00 ? 17 PHE A HE1  12 
ATOM 10061 H HE2  . PHE A 1 17 ? 3.262   2.907   6.679   1.00 0.00 ? 17 PHE A HE2  12 
ATOM 10062 H HZ   . PHE A 1 17 ? 3.024   0.562   5.704   1.00 0.00 ? 17 PHE A HZ   12 
ATOM 10063 N N    . PRO A 1 18 ? -4.506  3.695   8.093   1.00 0.00 ? 18 PRO A N    12 
ATOM 10064 C CA   . PRO A 1 18 ? -4.970  2.400   7.593   1.00 0.00 ? 18 PRO A CA   12 
ATOM 10065 C C    . PRO A 1 18 ? -5.488  2.571   6.148   1.00 0.00 ? 18 PRO A C    12 
ATOM 10066 O O    . PRO A 1 18 ? -6.166  3.545   5.849   1.00 0.00 ? 18 PRO A O    12 
ATOM 10067 C CB   . PRO A 1 18 ? -6.138  2.051   8.524   1.00 0.00 ? 18 PRO A CB   12 
ATOM 10068 C CG   . PRO A 1 18 ? -6.688  3.406   8.979   1.00 0.00 ? 18 PRO A CG   12 
ATOM 10069 C CD   . PRO A 1 18 ? -5.473  4.341   8.979   1.00 0.00 ? 18 PRO A CD   12 
ATOM 10070 H HA   . PRO A 1 18 ? -4.190  1.643   7.649   1.00 0.00 ? 18 PRO A HA   12 
ATOM 10071 H HB2  . PRO A 1 18 ? -6.894  1.414   8.062   1.00 0.00 ? 18 PRO A HB2  12 
ATOM 10072 H HB3  . PRO A 1 18 ? -5.750  1.513   9.390   1.00 0.00 ? 18 PRO A HB3  12 
ATOM 10073 H HG2  . PRO A 1 18 ? -7.419  3.763   8.252   1.00 0.00 ? 18 PRO A HG2  12 
ATOM 10074 H HG3  . PRO A 1 18 ? -7.181  3.356   9.951   1.00 0.00 ? 18 PRO A HG3  12 
ATOM 10075 H HD2  . PRO A 1 18 ? -5.735  5.339   8.618   1.00 0.00 ? 18 PRO A HD2  12 
ATOM 10076 H HD3  . PRO A 1 18 ? -5.042  4.414   9.982   1.00 0.00 ? 18 PRO A HD3  12 
ATOM 10077 N N    . PHE A 1 19 ? -5.136  1.604   5.280   1.00 0.00 ? 19 PHE A N    12 
ATOM 10078 C CA   . PHE A 1 19 ? -5.620  1.627   3.901   1.00 0.00 ? 19 PHE A CA   12 
ATOM 10079 C C    . PHE A 1 19 ? -6.650  0.497   3.773   1.00 0.00 ? 19 PHE A C    12 
ATOM 10080 O O    . PHE A 1 19 ? -6.427  -0.616  4.234   1.00 0.00 ? 19 PHE A O    12 
ATOM 10081 C CB   . PHE A 1 19 ? -4.508  1.495   2.839   1.00 0.00 ? 19 PHE A CB   12 
ATOM 10082 C CG   . PHE A 1 19 ? -3.704  0.193   2.914   1.00 0.00 ? 19 PHE A CG   12 
ATOM 10083 C CD1  . PHE A 1 19 ? -2.748  -0.097  3.909   1.00 0.00 ? 19 PHE A CD1  12 
ATOM 10084 C CD2  . PHE A 1 19 ? -3.924  -0.766  1.915   1.00 0.00 ? 19 PHE A CD2  12 
ATOM 10085 C CE1  . PHE A 1 19 ? -2.006  -1.268  3.857   1.00 0.00 ? 19 PHE A CE1  12 
ATOM 10086 C CE2  . PHE A 1 19 ? -3.174  -1.962  1.879   1.00 0.00 ? 19 PHE A CE2  12 
ATOM 10087 C CZ   . PHE A 1 19 ? -2.207  -2.190  2.842   1.00 0.00 ? 19 PHE A CZ   12 
ATOM 10088 H H    . PHE A 1 19 ? -4.610  0.813   5.602   1.00 0.00 ? 19 PHE A H    12 
ATOM 10089 H HA   . PHE A 1 19 ? -6.135  2.566   3.715   1.00 0.00 ? 19 PHE A HA   12 
ATOM 10090 H HB2  . PHE A 1 19 ? -5.032  1.496   1.870   1.00 0.00 ? 19 PHE A HB2  12 
ATOM 10091 H HB3  . PHE A 1 19 ? -3.883  2.411   2.815   1.00 0.00 ? 19 PHE A HB3  12 
ATOM 10092 H HD1  . PHE A 1 19 ? -2.515  0.507   4.782   1.00 0.00 ? 19 PHE A HD1  12 
ATOM 10093 H HD2  . PHE A 1 19 ? -4.708  -0.490  1.202   1.00 0.00 ? 19 PHE A HD2  12 
ATOM 10094 H HE1  . PHE A 1 19 ? -1.270  -1.461  4.625   1.00 0.00 ? 19 PHE A HE1  12 
ATOM 10095 H HE2  . PHE A 1 19 ? -3.248  -2.787  1.160   1.00 0.00 ? 19 PHE A HE2  12 
ATOM 10096 H HZ   . PHE A 1 19 ? -1.606  -3.090  2.785   1.00 0.00 ? 19 PHE A HZ   12 
ATOM 10097 N N    . ARG A 1 20 ? -7.797  0.840   3.155   1.00 0.00 ? 20 ARG A N    12 
ATOM 10098 C CA   . ARG A 1 20 ? -8.858  -0.146  2.981   1.00 0.00 ? 20 ARG A CA   12 
ATOM 10099 C C    . ARG A 1 20 ? -8.737  -0.705  1.548   1.00 0.00 ? 20 ARG A C    12 
ATOM 10100 O O    . ARG A 1 20 ? -8.644  0.043   0.584   1.00 0.00 ? 20 ARG A O    12 
ATOM 10101 C CB   . ARG A 1 20 ? -10.249 0.489   3.242   1.00 0.00 ? 20 ARG A CB   12 
ATOM 10102 C CG   . ARG A 1 20 ? -10.586 0.766   4.734   1.00 0.00 ? 20 ARG A CG   12 
ATOM 10103 C CD   . ARG A 1 20 ? -12.001 1.411   4.963   1.00 0.00 ? 20 ARG A CD   12 
ATOM 10104 N NE   . ARG A 1 20 ? -13.065 0.780   4.138   1.00 0.00 ? 20 ARG A NE   12 
ATOM 10105 C CZ   . ARG A 1 20 ? -13.509 -0.472  4.388   1.00 0.00 ? 20 ARG A CZ   12 
ATOM 10106 N NH1  . ARG A 1 20 ? -12.968 -1.218  5.343   1.00 0.00 ? 20 ARG A NH1  12 
ATOM 10107 N NH2  . ARG A 1 20 ? -14.492 -0.993  3.663   1.00 0.00 ? 20 ARG A NH2  12 
ATOM 10108 H H    . ARG A 1 20 ? -7.928  1.759   2.772   1.00 0.00 ? 20 ARG A H    12 
ATOM 10109 H HA   . ARG A 1 20 ? -8.677  -0.959  3.683   1.00 0.00 ? 20 ARG A HA   12 
ATOM 10110 H HB2  . ARG A 1 20 ? -10.345 1.404   2.658   1.00 0.00 ? 20 ARG A HB2  12 
ATOM 10111 H HB3  . ARG A 1 20 ? -11.000 -0.194  2.843   1.00 0.00 ? 20 ARG A HB3  12 
ATOM 10112 H HG2  . ARG A 1 20 ? -10.551 -0.192  5.249   1.00 0.00 ? 20 ARG A HG2  12 
ATOM 10113 H HG3  . ARG A 1 20 ? -9.785  1.349   5.224   1.00 0.00 ? 20 ARG A HG3  12 
ATOM 10114 H HD2  . ARG A 1 20 ? -12.319 1.346   6.021   1.00 0.00 ? 20 ARG A HD2  12 
ATOM 10115 H HD3  . ARG A 1 20 ? -12.009 2.486   4.728   1.00 0.00 ? 20 ARG A HD3  12 
ATOM 10116 H HE   . ARG A 1 20 ? -13.503 1.221   3.336   1.00 0.00 ? 20 ARG A HE   12 
ATOM 10117 H HH11 . ARG A 1 20 ? -12.287 -0.834  5.963   1.00 0.00 ? 20 ARG A HH11 12 
ATOM 10118 H HH12 . ARG A 1 20 ? -13.246 -2.185  5.423   1.00 0.00 ? 20 ARG A HH12 12 
ATOM 10119 H HH21 . ARG A 1 20 ? -14.988 -0.466  2.973   1.00 0.00 ? 20 ARG A HH21 12 
ATOM 10120 H HH22 . ARG A 1 20 ? -14.735 -1.958  3.821   1.00 0.00 ? 20 ARG A HH22 12 
ATOM 10121 N N    . PHE A 1 21 ? -8.720  -2.048  1.477   1.00 0.00 ? 21 PHE A N    12 
ATOM 10122 C CA   . PHE A 1 21 ? -8.598  -2.787  0.223   1.00 0.00 ? 21 PHE A CA   12 
ATOM 10123 C C    . PHE A 1 21 ? -9.482  -4.023  0.415   1.00 0.00 ? 21 PHE A C    12 
ATOM 10124 O O    . PHE A 1 21 ? -9.586  -4.546  1.513   1.00 0.00 ? 21 PHE A O    12 
ATOM 10125 C CB   . PHE A 1 21 ? -7.125  -3.171  0.023   1.00 0.00 ? 21 PHE A CB   12 
ATOM 10126 C CG   . PHE A 1 21 ? -6.930  -4.264  -0.992  1.00 0.00 ? 21 PHE A CG   12 
ATOM 10127 C CD1  . PHE A 1 21 ? -7.419  -4.123  -2.280  1.00 0.00 ? 21 PHE A CD1  12 
ATOM 10128 C CD2  . PHE A 1 21 ? -6.247  -5.422  -0.656  1.00 0.00 ? 21 PHE A CD2  12 
ATOM 10129 C CE1  . PHE A 1 21 ? -7.164  -5.083  -3.251  1.00 0.00 ? 21 PHE A CE1  12 
ATOM 10130 C CE2  . PHE A 1 21 ? -5.991  -6.392  -1.616  1.00 0.00 ? 21 PHE A CE2  12 
ATOM 10131 C CZ   . PHE A 1 21 ? -6.434  -6.217  -2.920  1.00 0.00 ? 21 PHE A CZ   12 
ATOM 10132 H H    . PHE A 1 21 ? -8.801  -2.616  2.309   1.00 0.00 ? 21 PHE A H    12 
ATOM 10133 H HA   . PHE A 1 21 ? -8.980  -2.209  -0.631  1.00 0.00 ? 21 PHE A HA   12 
ATOM 10134 H HB2  . PHE A 1 21 ? -6.544  -2.297  -0.284  1.00 0.00 ? 21 PHE A HB2  12 
ATOM 10135 H HB3  . PHE A 1 21 ? -6.707  -3.530  0.962   1.00 0.00 ? 21 PHE A HB3  12 
ATOM 10136 H HD1  . PHE A 1 21 ? -8.032  -3.264  -2.487  1.00 0.00 ? 21 PHE A HD1  12 
ATOM 10137 H HD2  . PHE A 1 21 ? -5.942  -5.560  0.370   1.00 0.00 ? 21 PHE A HD2  12 
ATOM 10138 H HE1  . PHE A 1 21 ? -7.544  -4.948  -4.253  1.00 0.00 ? 21 PHE A HE1  12 
ATOM 10139 H HE2  . PHE A 1 21 ? -5.449  -7.284  -1.346  1.00 0.00 ? 21 PHE A HE2  12 
ATOM 10140 H HZ   . PHE A 1 21 ? -6.224  -6.969  -3.667  1.00 0.00 ? 21 PHE A HZ   12 
ATOM 10141 N N    . GLN A 1 22 ? -10.162 -4.438  -0.664  1.00 0.00 ? 22 GLN A N    12 
ATOM 10142 C CA   . GLN A 1 22 ? -11.128 -5.528  -0.585  1.00 0.00 ? 22 GLN A CA   12 
ATOM 10143 C C    . GLN A 1 22 ? -12.157 -5.226  0.545   1.00 0.00 ? 22 GLN A C    12 
ATOM 10144 O O    . GLN A 1 22 ? -12.617 -6.119  1.249   1.00 0.00 ? 22 GLN A O    12 
ATOM 10145 C CB   . GLN A 1 22 ? -10.476 -6.926  -0.361  1.00 0.00 ? 22 GLN A CB   12 
ATOM 10146 C CG   . GLN A 1 22 ? -9.450  -7.379  -1.432  1.00 0.00 ? 22 GLN A CG   12 
ATOM 10147 C CD   . GLN A 1 22 ? -8.612  -8.600  -1.005  1.00 0.00 ? 22 GLN A CD   12 
ATOM 10148 O OE1  . GLN A 1 22 ? -8.451  -9.534  -1.778  1.00 0.00 ? 22 GLN A OE1  12 
ATOM 10149 N NE2  . GLN A 1 22 ? -8.100  -8.586  0.230   1.00 0.00 ? 22 GLN A NE2  12 
ATOM 10150 H H    . GLN A 1 22 ? -10.051 -3.937  -1.527  1.00 0.00 ? 22 GLN A H    12 
ATOM 10151 H HA   . GLN A 1 22 ? -11.641 -5.466  -1.544  1.00 0.00 ? 22 GLN A HA   12 
ATOM 10152 H HB2  . GLN A 1 22 ? -10.006 -6.915  0.623   1.00 0.00 ? 22 GLN A HB2  12 
ATOM 10153 H HB3  . GLN A 1 22 ? -11.257 -7.685  -0.310  1.00 0.00 ? 22 GLN A HB3  12 
ATOM 10154 H HG2  . GLN A 1 22 ? -9.924  -7.760  -2.360  1.00 0.00 ? 22 GLN A HG2  12 
ATOM 10155 H HG3  . GLN A 1 22 ? -8.781  -6.532  -1.636  1.00 0.00 ? 22 GLN A HG3  12 
ATOM 10156 H HE21 . GLN A 1 22 ? -8.163  -7.872  0.933   1.00 0.00 ? 22 GLN A HE21 12 
ATOM 10157 H HE22 . GLN A 1 22 ? -7.571  -9.391  0.518   1.00 0.00 ? 22 GLN A HE22 12 
ATOM 10158 N N    . GLY A 1 23 ? -12.452 -3.912  0.724   1.00 0.00 ? 23 GLY A N    12 
ATOM 10159 C CA   . GLY A 1 23 ? -13.397 -3.496  1.758   1.00 0.00 ? 23 GLY A CA   12 
ATOM 10160 C C    . GLY A 1 23 ? -12.916 -3.739  3.207   1.00 0.00 ? 23 GLY A C    12 
ATOM 10161 O O    . GLY A 1 23 ? -13.652 -3.488  4.159   1.00 0.00 ? 23 GLY A O    12 
ATOM 10162 H H    . GLY A 1 23 ? -12.044 -3.190  0.158   1.00 0.00 ? 23 GLY A H    12 
ATOM 10163 H HA2  . GLY A 1 23 ? -13.571 -2.429  1.599   1.00 0.00 ? 23 GLY A HA2  12 
ATOM 10164 H HA3  . GLY A 1 23 ? -14.328 -4.046  1.591   1.00 0.00 ? 23 GLY A HA3  12 
ATOM 10165 N N    . THR A 1 24 ? -11.667 -4.218  3.322   1.00 0.00 ? 24 THR A N    12 
ATOM 10166 C CA   . THR A 1 24 ? -11.039 -4.600  4.574   1.00 0.00 ? 24 THR A CA   12 
ATOM 10167 C C    . THR A 1 24 ? -9.920  -3.597  4.901   1.00 0.00 ? 24 THR A C    12 
ATOM 10168 O O    . THR A 1 24 ? -9.186  -3.164  4.027   1.00 0.00 ? 24 THR A O    12 
ATOM 10169 C CB   . THR A 1 24 ? -10.475 -6.012  4.326   1.00 0.00 ? 24 THR A CB   12 
ATOM 10170 O OG1  . THR A 1 24 ? -11.494 -6.845  3.792   1.00 0.00 ? 24 THR A OG1  12 
ATOM 10171 C CG2  . THR A 1 24 ? -9.961  -6.670  5.610   1.00 0.00 ? 24 THR A CG2  12 
ATOM 10172 H H    . THR A 1 24 ? -11.093 -4.377  2.520   1.00 0.00 ? 24 THR A H    12 
ATOM 10173 H HA   . THR A 1 24 ? -11.794 -4.609  5.363   1.00 0.00 ? 24 THR A HA   12 
ATOM 10174 H HB   . THR A 1 24 ? -9.639  -5.968  3.615   1.00 0.00 ? 24 THR A HB   12 
ATOM 10175 H HG1  . THR A 1 24 ? -11.838 -6.495  2.965   1.00 0.00 ? 24 THR A HG1  12 
ATOM 10176 H HG21 . THR A 1 24 ? -9.594  -7.676  5.404   1.00 0.00 ? 24 THR A HG21 12 
ATOM 10177 H HG22 . THR A 1 24 ? -10.753 -6.751  6.355   1.00 0.00 ? 24 THR A HG22 12 
ATOM 10178 H HG23 . THR A 1 24 ? -9.138  -6.104  6.049   1.00 0.00 ? 24 THR A HG23 12 
ATOM 10179 N N    . SER A 1 25 ? -9.855  -3.224  6.190   1.00 0.00 ? 25 SER A N    12 
ATOM 10180 C CA   . SER A 1 25 ? -8.874  -2.255  6.661   1.00 0.00 ? 25 SER A CA   12 
ATOM 10181 C C    . SER A 1 25 ? -7.550  -2.952  7.004   1.00 0.00 ? 25 SER A C    12 
ATOM 10182 O O    . SER A 1 25 ? -7.531  -3.880  7.806   1.00 0.00 ? 25 SER A O    12 
ATOM 10183 C CB   . SER A 1 25 ? -9.456  -1.683  7.957   1.00 0.00 ? 25 SER A CB   12 
ATOM 10184 O OG   . SER A 1 25 ? -9.966  -2.750  8.740   1.00 0.00 ? 25 SER A OG   12 
ATOM 10185 H H    . SER A 1 25 ? -10.455 -3.601  6.898   1.00 0.00 ? 25 SER A H    12 
ATOM 10186 H HA   . SER A 1 25 ? -8.723  -1.483  5.904   1.00 0.00 ? 25 SER A HA   12 
ATOM 10187 H HB2  . SER A 1 25 ? -8.728  -1.093  8.526   1.00 0.00 ? 25 SER A HB2  12 
ATOM 10188 H HB3  . SER A 1 25 ? -10.288 -1.013  7.736   1.00 0.00 ? 25 SER A HB3  12 
ATOM 10189 H HG   . SER A 1 25 ? -9.259  -3.383  8.898   1.00 0.00 ? 25 SER A HG   12 
ATOM 10190 N N    . TYR A 1 26 ? -6.473  -2.428  6.393   1.00 0.00 ? 26 TYR A N    12 
ATOM 10191 C CA   . TYR A 1 26 ? -5.116  -2.908  6.611   1.00 0.00 ? 26 TYR A CA   12 
ATOM 10192 C C    . TYR A 1 26 ? -4.299  -1.759  7.215   1.00 0.00 ? 26 TYR A C    12 
ATOM 10193 O O    . TYR A 1 26 ? -4.444  -0.612  6.812   1.00 0.00 ? 26 TYR A O    12 
ATOM 10194 C CB   . TYR A 1 26 ? -4.469  -3.249  5.265   1.00 0.00 ? 26 TYR A CB   12 
ATOM 10195 C CG   . TYR A 1 26 ? -5.153  -4.367  4.534   1.00 0.00 ? 26 TYR A CG   12 
ATOM 10196 C CD1  . TYR A 1 26 ? -6.183  -4.111  3.638   1.00 0.00 ? 26 TYR A CD1  12 
ATOM 10197 C CD2  . TYR A 1 26 ? -4.744  -5.679  4.723   1.00 0.00 ? 26 TYR A CD2  12 
ATOM 10198 C CE1  . TYR A 1 26 ? -6.776  -5.153  2.943   1.00 0.00 ? 26 TYR A CE1  12 
ATOM 10199 C CE2  . TYR A 1 26 ? -5.348  -6.713  4.026   1.00 0.00 ? 26 TYR A CE2  12 
ATOM 10200 C CZ   . TYR A 1 26 ? -6.372  -6.457  3.132   1.00 0.00 ? 26 TYR A CZ   12 
ATOM 10201 O OH   . TYR A 1 26 ? -7.001  -7.458  2.416   1.00 0.00 ? 26 TYR A OH   12 
ATOM 10202 H H    . TYR A 1 26 ? -6.571  -1.666  5.750   1.00 0.00 ? 26 TYR A H    12 
ATOM 10203 H HA   . TYR A 1 26 ? -5.128  -3.765  7.287   1.00 0.00 ? 26 TYR A HA   12 
ATOM 10204 H HB2  . TYR A 1 26 ? -4.485  -2.365  4.621   1.00 0.00 ? 26 TYR A HB2  12 
ATOM 10205 H HB3  . TYR A 1 26 ? -3.429  -3.545  5.435   1.00 0.00 ? 26 TYR A HB3  12 
ATOM 10206 H HD1  . TYR A 1 26 ? -6.529  -3.103  3.464   1.00 0.00 ? 26 TYR A HD1  12 
ATOM 10207 H HD2  . TYR A 1 26 ? -3.944  -5.904  5.407   1.00 0.00 ? 26 TYR A HD2  12 
ATOM 10208 H HE1  . TYR A 1 26 ? -7.538  -4.955  2.215   1.00 0.00 ? 26 TYR A HE1  12 
ATOM 10209 H HE2  . TYR A 1 26 ? -4.997  -7.710  4.181   1.00 0.00 ? 26 TYR A HE2  12 
ATOM 10210 H HH   . TYR A 1 26 ? -6.456  -8.252  2.378   1.00 0.00 ? 26 TYR A HH   12 
ATOM 10211 N N    . ASP A 1 27 ? -3.433  -2.130  8.178   1.00 0.00 ? 27 ASP A N    12 
ATOM 10212 C CA   . ASP A 1 27 ? -2.564  -1.151  8.838   1.00 0.00 ? 27 ASP A CA   12 
ATOM 10213 C C    . ASP A 1 27 ? -1.087  -1.590  8.713   1.00 0.00 ? 27 ASP A C    12 
ATOM 10214 O O    . ASP A 1 27 ? -0.222  -1.223  9.495   1.00 0.00 ? 27 ASP A O    12 
ATOM 10215 C CB   . ASP A 1 27 ? -3.033  -0.995  10.298  1.00 0.00 ? 27 ASP A CB   12 
ATOM 10216 C CG   . ASP A 1 27 ? -2.763  0.419   10.840  1.00 0.00 ? 27 ASP A CG   12 
ATOM 10217 O OD1  . ASP A 1 27 ? -3.299  1.372   10.272  1.00 0.00 ? 27 ASP A OD1  12 
ATOM 10218 O OD2  . ASP A 1 27 ? -2.042  0.555   11.825  1.00 0.00 ? 27 ASP A OD2  12 
ATOM 10219 H H    . ASP A 1 27 ? -3.376  -3.088  8.457   1.00 0.00 ? 27 ASP A H    12 
ATOM 10220 H HA   . ASP A 1 27 ? -2.650  -0.199  8.310   1.00 0.00 ? 27 ASP A HA   12 
ATOM 10221 H HB2  . ASP A 1 27 ? -4.110  -1.149  10.363  1.00 0.00 ? 27 ASP A HB2  12 
ATOM 10222 H HB3  . ASP A 1 27 ? -2.572  -1.740  10.949  1.00 0.00 ? 27 ASP A HB3  12 
ATOM 10223 N N    . SER A 1 28 ? -0.851  -2.412  7.672   1.00 0.00 ? 28 SER A N    12 
ATOM 10224 C CA   . SER A 1 28 ? 0.480   -2.939  7.415   1.00 0.00 ? 28 SER A CA   12 
ATOM 10225 C C    . SER A 1 28 ? 0.452   -3.562  6.010   1.00 0.00 ? 28 SER A C    12 
ATOM 10226 O O    . SER A 1 28 ? -0.614  -3.829  5.466   1.00 0.00 ? 28 SER A O    12 
ATOM 10227 C CB   . SER A 1 28 ? 0.832   -3.987  8.498   1.00 0.00 ? 28 SER A CB   12 
ATOM 10228 O OG   . SER A 1 28 ? -0.197  -4.968  8.527   1.00 0.00 ? 28 SER A OG   12 
ATOM 10229 H H    . SER A 1 28 ? -1.567  -2.714  7.042   1.00 0.00 ? 28 SER A H    12 
ATOM 10230 H HA   . SER A 1 28 ? 1.179   -2.098  7.390   1.00 0.00 ? 28 SER A HA   12 
ATOM 10231 H HB2  . SER A 1 28 ? 1.797   -4.464  8.235   1.00 0.00 ? 28 SER A HB2  12 
ATOM 10232 H HB3  . SER A 1 28 ? 0.873   -3.498  9.497   1.00 0.00 ? 28 SER A HB3  12 
ATOM 10233 H HG   . SER A 1 28 ? -0.023  -5.638  9.185   1.00 0.00 ? 28 SER A HG   12 
ATOM 10234 N N    . CYS A 1 29 ? 1.667   -3.765  5.455   1.00 0.00 ? 29 CYS A N    12 
ATOM 10235 C CA   . CYS A 1 29 ? 1.760   -4.338  4.106   1.00 0.00 ? 29 CYS A CA   12 
ATOM 10236 C C    . CYS A 1 29 ? 1.048   -5.717  3.957   1.00 0.00 ? 29 CYS A C    12 
ATOM 10237 O O    . CYS A 1 29 ? 1.205   -6.584  4.818   1.00 0.00 ? 29 CYS A O    12 
ATOM 10238 C CB   . CYS A 1 29 ? 3.233   -4.611  3.764   1.00 0.00 ? 29 CYS A CB   12 
ATOM 10239 S SG   . CYS A 1 29 ? 4.483   -3.948  4.852   1.00 0.00 ? 29 CYS A SG   12 
ATOM 10240 H H    . CYS A 1 29 ? 2.488   -3.435  5.932   1.00 0.00 ? 29 CYS A H    12 
ATOM 10241 H HA   . CYS A 1 29 ? 1.378   -3.524  3.496   1.00 0.00 ? 29 CYS A HA   12 
ATOM 10242 H HB2  . CYS A 1 29 ? 3.402   -5.679  3.913   1.00 0.00 ? 29 CYS A HB2  12 
ATOM 10243 H HB3  . CYS A 1 29 ? 3.451   -4.424  2.701   1.00 0.00 ? 29 CYS A HB3  12 
ATOM 10244 N N    . THR A 1 30 ? 0.373   -5.914  2.805   1.00 0.00 ? 30 THR A N    12 
ATOM 10245 C CA   . THR A 1 30 ? -0.185  -7.228  2.471   1.00 0.00 ? 30 THR A CA   12 
ATOM 10246 C C    . THR A 1 30 ? 0.412   -7.658  1.124   1.00 0.00 ? 30 THR A C    12 
ATOM 10247 O O    . THR A 1 30 ? 0.946   -6.844  0.387   1.00 0.00 ? 30 THR A O    12 
ATOM 10248 C CB   . THR A 1 30 ? -1.725  -7.215  2.431   1.00 0.00 ? 30 THR A CB   12 
ATOM 10249 O OG1  . THR A 1 30 ? -2.130  -8.548  2.153   1.00 0.00 ? 30 THR A OG1  12 
ATOM 10250 C CG2  . THR A 1 30 ? -2.305  -6.257  1.365   1.00 0.00 ? 30 THR A CG2  12 
ATOM 10251 H H    . THR A 1 30 ? 0.296   -5.185  2.116   1.00 0.00 ? 30 THR A H    12 
ATOM 10252 H HA   . THR A 1 30 ? 0.144   -7.952  3.218   1.00 0.00 ? 30 THR A HA   12 
ATOM 10253 H HB   . THR A 1 30 ? -2.062  -6.932  3.440   1.00 0.00 ? 30 THR A HB   12 
ATOM 10254 H HG1  . THR A 1 30 ? -3.082  -8.646  2.260   1.00 0.00 ? 30 THR A HG1  12 
ATOM 10255 H HG21 . THR A 1 30 ? -3.395  -6.213  1.403   1.00 0.00 ? 30 THR A HG21 12 
ATOM 10256 H HG22 . THR A 1 30 ? -2.037  -6.573  0.354   1.00 0.00 ? 30 THR A HG22 12 
ATOM 10257 H HG23 . THR A 1 30 ? -1.938  -5.237  1.489   1.00 0.00 ? 30 THR A HG23 12 
ATOM 10258 N N    . THR A 1 31 ? 0.283   -8.966  0.848   1.00 0.00 ? 31 THR A N    12 
ATOM 10259 C CA   . THR A 1 31 ? 0.716   -9.553  -0.415  1.00 0.00 ? 31 THR A CA   12 
ATOM 10260 C C    . THR A 1 31 ? -0.498  -9.752  -1.347  1.00 0.00 ? 31 THR A C    12 
ATOM 10261 O O    . THR A 1 31 ? -0.352  -10.014 -2.536  1.00 0.00 ? 31 THR A O    12 
ATOM 10262 C CB   . THR A 1 31 ? 1.356   -10.916 -0.107  1.00 0.00 ? 31 THR A CB   12 
ATOM 10263 O OG1  . THR A 1 31 ? 0.572   -11.514 0.916   1.00 0.00 ? 31 THR A OG1  12 
ATOM 10264 C CG2  . THR A 1 31 ? 2.810   -10.773 0.363   1.00 0.00 ? 31 THR A CG2  12 
ATOM 10265 H H    . THR A 1 31 ? -0.154  -9.586  1.505   1.00 0.00 ? 31 THR A H    12 
ATOM 10266 H HA   . THR A 1 31 ? 1.421   -8.886  -0.914  1.00 0.00 ? 31 THR A HA   12 
ATOM 10267 H HB   . THR A 1 31 ? 1.340   -11.530 -1.018  1.00 0.00 ? 31 THR A HB   12 
ATOM 10268 H HG1  . THR A 1 31 ? 0.893   -12.389 1.115   1.00 0.00 ? 31 THR A HG1  12 
ATOM 10269 H HG21 . THR A 1 31 ? 3.398   -10.196 -0.350  1.00 0.00 ? 31 THR A HG21 12 
ATOM 10270 H HG22 . THR A 1 31 ? 3.300   -11.742 0.466   1.00 0.00 ? 31 THR A HG22 12 
ATOM 10271 H HG23 . THR A 1 31 ? 2.856   -10.270 1.326   1.00 0.00 ? 31 THR A HG23 12 
ATOM 10272 N N    . GLU A 1 32 ? -1.707  -9.632  -0.754  1.00 0.00 ? 32 GLU A N    12 
ATOM 10273 C CA   . GLU A 1 32 ? -2.926  -9.856  -1.525  1.00 0.00 ? 32 GLU A CA   12 
ATOM 10274 C C    . GLU A 1 32 ? -2.968  -8.917  -2.743  1.00 0.00 ? 32 GLU A C    12 
ATOM 10275 O O    . GLU A 1 32 ? -2.806  -7.712  -2.619  1.00 0.00 ? 32 GLU A O    12 
ATOM 10276 C CB   . GLU A 1 32 ? -4.140  -9.589  -0.628  1.00 0.00 ? 32 GLU A CB   12 
ATOM 10277 C CG   . GLU A 1 32 ? -4.317  -10.630 0.489   1.00 0.00 ? 32 GLU A CG   12 
ATOM 10278 C CD   . GLU A 1 32 ? -5.251  -10.062 1.560   1.00 0.00 ? 32 GLU A CD   12 
ATOM 10279 O OE1  . GLU A 1 32 ? -4.818  -9.192  2.307   1.00 0.00 ? 32 GLU A OE1  12 
ATOM 10280 O OE2  . GLU A 1 32 ? -6.408  -10.457 1.634   1.00 0.00 ? 32 GLU A OE2  12 
ATOM 10281 H H    . GLU A 1 32 ? -1.787  -9.394  0.216   1.00 0.00 ? 32 GLU A H    12 
ATOM 10282 H HA   . GLU A 1 32 ? -2.909  -10.896 -1.854  1.00 0.00 ? 32 GLU A HA   12 
ATOM 10283 H HB2  . GLU A 1 32 ? -4.030  -8.589  -0.203  1.00 0.00 ? 32 GLU A HB2  12 
ATOM 10284 H HB3  . GLU A 1 32 ? -5.056  -9.570  -1.221  1.00 0.00 ? 32 GLU A HB3  12 
ATOM 10285 H HG2  . GLU A 1 32 ? -4.736  -11.556 0.090   1.00 0.00 ? 32 GLU A HG2  12 
ATOM 10286 H HG3  . GLU A 1 32 ? -3.370  -10.892 0.959   1.00 0.00 ? 32 GLU A HG3  12 
ATOM 10287 N N    . GLY A 1 33 ? -3.177  -9.545  -3.913  1.00 0.00 ? 33 GLY A N    12 
ATOM 10288 C CA   . GLY A 1 33 ? -3.233  -8.790  -5.161  1.00 0.00 ? 33 GLY A CA   12 
ATOM 10289 C C    . GLY A 1 33 ? -1.965  -8.969  -6.005  1.00 0.00 ? 33 GLY A C    12 
ATOM 10290 O O    . GLY A 1 33 ? -1.966  -8.667  -7.191  1.00 0.00 ? 33 GLY A O    12 
ATOM 10291 H H    . GLY A 1 33 ? -3.288  -10.538 -3.920  1.00 0.00 ? 33 GLY A H    12 
ATOM 10292 H HA2  . GLY A 1 33 ? -4.088  -9.179  -5.720  1.00 0.00 ? 33 GLY A HA2  12 
ATOM 10293 H HA3  . GLY A 1 33 ? -3.390  -7.726  -4.956  1.00 0.00 ? 33 GLY A HA3  12 
ATOM 10294 N N    . ARG A 1 34 ? -0.897  -9.484  -5.362  1.00 0.00 ? 34 ARG A N    12 
ATOM 10295 C CA   . ARG A 1 34 ? 0.343   -9.703  -6.133  1.00 0.00 ? 34 ARG A CA   12 
ATOM 10296 C C    . ARG A 1 34 ? 0.604   -11.213 -6.209  1.00 0.00 ? 34 ARG A C    12 
ATOM 10297 O O    . ARG A 1 34 ? 0.300   -11.962 -5.291  1.00 0.00 ? 34 ARG A O    12 
ATOM 10298 C CB   . ARG A 1 34 ? 1.528   -9.035  -5.426  1.00 0.00 ? 34 ARG A CB   12 
ATOM 10299 C CG   . ARG A 1 34 ? 1.394   -7.509  -5.326  1.00 0.00 ? 34 ARG A CG   12 
ATOM 10300 C CD   . ARG A 1 34 ? 2.764   -6.846  -5.075  1.00 0.00 ? 34 ARG A CD   12 
ATOM 10301 N NE   . ARG A 1 34 ? 3.538   -6.831  -6.329  1.00 0.00 ? 34 ARG A NE   12 
ATOM 10302 C CZ   . ARG A 1 34 ? 3.508   -5.799  -7.198  1.00 0.00 ? 34 ARG A CZ   12 
ATOM 10303 N NH1  . ARG A 1 34 ? 2.790   -4.717  -6.930  1.00 0.00 ? 34 ARG A NH1  12 
ATOM 10304 N NH2  . ARG A 1 34 ? 4.197   -5.878  -8.329  1.00 0.00 ? 34 ARG A NH2  12 
ATOM 10305 H H    . ARG A 1 34 ? -0.965  -9.720  -4.373  1.00 0.00 ? 34 ARG A H    12 
ATOM 10306 H HA   . ARG A 1 34 ? 0.281   -9.305  -7.169  1.00 0.00 ? 34 ARG A HA   12 
ATOM 10307 H HB2  . ARG A 1 34 ? 1.618   -9.451  -4.391  1.00 0.00 ? 34 ARG A HB2  12 
ATOM 10308 H HB3  . ARG A 1 34 ? 2.409   -9.245  -6.066  1.00 0.00 ? 34 ARG A HB3  12 
ATOM 10309 H HG2  . ARG A 1 34 ? 0.961   -7.104  -6.243  1.00 0.00 ? 34 ARG A HG2  12 
ATOM 10310 H HG3  . ARG A 1 34 ? 0.675   -7.270  -4.539  1.00 0.00 ? 34 ARG A HG3  12 
ATOM 10311 H HD2  . ARG A 1 34 ? 2.668   -5.818  -4.703  1.00 0.00 ? 34 ARG A HD2  12 
ATOM 10312 H HD3  . ARG A 1 34 ? 3.342   -7.414  -4.333  1.00 0.00 ? 34 ARG A HD3  12 
ATOM 10313 H HE   . ARG A 1 34 ? 4.085   -7.630  -6.630  1.00 0.00 ? 34 ARG A HE   12 
ATOM 10314 H HH11 . ARG A 1 34 ? 2.246   -4.687  -6.094  1.00 0.00 ? 34 ARG A HH11 12 
ATOM 10315 H HH12 . ARG A 1 34 ? 2.773   -3.913  -7.542  1.00 0.00 ? 34 ARG A HH12 12 
ATOM 10316 H HH21 . ARG A 1 34 ? 4.689   -6.741  -8.523  1.00 0.00 ? 34 ARG A HH21 12 
ATOM 10317 H HH22 . ARG A 1 34 ? 4.235   -5.131  -8.989  1.00 0.00 ? 34 ARG A HH22 12 
ATOM 10318 N N    . THR A 1 35 ? 1.184   -11.601 -7.364  1.00 0.00 ? 35 THR A N    12 
ATOM 10319 C CA   . THR A 1 35 ? 1.514   -13.003 -7.625  1.00 0.00 ? 35 THR A CA   12 
ATOM 10320 C C    . THR A 1 35 ? 3.035   -13.170 -7.848  1.00 0.00 ? 35 THR A C    12 
ATOM 10321 O O    . THR A 1 35 ? 3.503   -14.199 -8.314  1.00 0.00 ? 35 THR A O    12 
ATOM 10322 C CB   . THR A 1 35 ? 0.696   -13.457 -8.853  1.00 0.00 ? 35 THR A CB   12 
ATOM 10323 O OG1  . THR A 1 35 ? -0.642  -13.000 -8.753  1.00 0.00 ? 35 THR A OG1  12 
ATOM 10324 C CG2  . THR A 1 35 ? 0.611   -14.980 -8.987  1.00 0.00 ? 35 THR A CG2  12 
ATOM 10325 H H    . THR A 1 35 ? 1.397   -10.915 -8.059  1.00 0.00 ? 35 THR A H    12 
ATOM 10326 H HA   . THR A 1 35 ? 1.236   -13.600 -6.755  1.00 0.00 ? 35 THR A HA   12 
ATOM 10327 H HB   . THR A 1 35 ? 1.136   -13.057 -9.774  1.00 0.00 ? 35 THR A HB   12 
ATOM 10328 H HG1  . THR A 1 35 ? -0.661  -12.069 -8.558  1.00 0.00 ? 35 THR A HG1  12 
ATOM 10329 H HG21 . THR A 1 35 ? 0.180   -15.425 -8.090  1.00 0.00 ? 35 THR A HG21 12 
ATOM 10330 H HG22 . THR A 1 35 ? 1.591   -15.428 -9.148  1.00 0.00 ? 35 THR A HG22 12 
ATOM 10331 H HG23 . THR A 1 35 ? -0.020  -15.256 -9.831  1.00 0.00 ? 35 THR A HG23 12 
ATOM 10332 N N    . ASP A 1 36 ? 3.772   -12.101 -7.487  1.00 0.00 ? 36 ASP A N    12 
ATOM 10333 C CA   . ASP A 1 36 ? 5.222   -12.047 -7.666  1.00 0.00 ? 36 ASP A CA   12 
ATOM 10334 C C    . ASP A 1 36 ? 5.994   -12.155 -6.329  1.00 0.00 ? 36 ASP A C    12 
ATOM 10335 O O    . ASP A 1 36 ? 7.220   -12.196 -6.321  1.00 0.00 ? 36 ASP A O    12 
ATOM 10336 C CB   . ASP A 1 36 ? 5.568   -10.743 -8.408  1.00 0.00 ? 36 ASP A CB   12 
ATOM 10337 C CG   . ASP A 1 36 ? 5.084   -9.468  -7.694  1.00 0.00 ? 36 ASP A CG   12 
ATOM 10338 O OD1  . ASP A 1 36 ? 4.721   -9.520  -6.521  1.00 0.00 ? 36 ASP A OD1  12 
ATOM 10339 O OD2  . ASP A 1 36 ? 5.062   -8.412  -8.319  1.00 0.00 ? 36 ASP A OD2  12 
ATOM 10340 H H    . ASP A 1 36 ? 3.361   -11.261 -7.136  1.00 0.00 ? 36 ASP A H    12 
ATOM 10341 H HA   . ASP A 1 36 ? 5.537   -12.895 -8.277  1.00 0.00 ? 36 ASP A HA   12 
ATOM 10342 H HB2  . ASP A 1 36 ? 6.644   -10.667 -8.566  1.00 0.00 ? 36 ASP A HB2  12 
ATOM 10343 H HB3  . ASP A 1 36 ? 5.103   -10.759 -9.395  1.00 0.00 ? 36 ASP A HB3  12 
ATOM 10344 N N    . GLY A 1 37 ? 5.231   -12.239 -5.213  1.00 0.00 ? 37 GLY A N    12 
ATOM 10345 C CA   . GLY A 1 37 ? 5.843   -12.431 -3.901  1.00 0.00 ? 37 GLY A CA   12 
ATOM 10346 C C    . GLY A 1 37 ? 6.003   -11.155 -3.070  1.00 0.00 ? 37 GLY A C    12 
ATOM 10347 O O    . GLY A 1 37 ? 6.387   -11.228 -1.909  1.00 0.00 ? 37 GLY A O    12 
ATOM 10348 H H    . GLY A 1 37 ? 4.237   -12.197 -5.269  1.00 0.00 ? 37 GLY A H    12 
ATOM 10349 H HA2  . GLY A 1 37 ? 5.217   -13.140 -3.355  1.00 0.00 ? 37 GLY A HA2  12 
ATOM 10350 H HA3  . GLY A 1 37 ? 6.845   -12.853 -4.039  1.00 0.00 ? 37 GLY A HA3  12 
ATOM 10351 N N    . TYR A 1 38 ? 5.743   -9.989  -3.692  1.00 0.00 ? 38 TYR A N    12 
ATOM 10352 C CA   . TYR A 1 38 ? 6.028   -8.743  -2.972  1.00 0.00 ? 38 TYR A CA   12 
ATOM 10353 C C    . TYR A 1 38 ? 4.838   -8.276  -2.116  1.00 0.00 ? 38 TYR A C    12 
ATOM 10354 O O    . TYR A 1 38 ? 3.681   -8.618  -2.323  1.00 0.00 ? 38 TYR A O    12 
ATOM 10355 C CB   . TYR A 1 38 ? 6.615   -7.699  -3.949  1.00 0.00 ? 38 TYR A CB   12 
ATOM 10356 C CG   . TYR A 1 38 ? 7.663   -8.364  -4.810  1.00 0.00 ? 38 TYR A CG   12 
ATOM 10357 C CD1  . TYR A 1 38 ? 8.642   -9.185  -4.262  1.00 0.00 ? 38 TYR A CD1  12 
ATOM 10358 C CD2  . TYR A 1 38 ? 7.633   -8.247  -6.187  1.00 0.00 ? 38 TYR A CD2  12 
ATOM 10359 C CE1  . TYR A 1 38 ? 9.487   -9.923  -5.058  1.00 0.00 ? 38 TYR A CE1  12 
ATOM 10360 C CE2  . TYR A 1 38 ? 8.482   -8.979  -6.986  1.00 0.00 ? 38 TYR A CE2  12 
ATOM 10361 C CZ   . TYR A 1 38 ? 9.403   -9.843  -6.432  1.00 0.00 ? 38 TYR A CZ   12 
ATOM 10362 O OH   . TYR A 1 38 ? 10.198  -10.632 -7.231  1.00 0.00 ? 38 TYR A OH   12 
ATOM 10363 H H    . TYR A 1 38 ? 5.424   -9.964  -4.644  1.00 0.00 ? 38 TYR A H    12 
ATOM 10364 H HA   . TYR A 1 38 ? 6.822   -8.961  -2.255  1.00 0.00 ? 38 TYR A HA   12 
ATOM 10365 H HB2  . TYR A 1 38 ? 5.833   -7.284  -4.588  1.00 0.00 ? 38 TYR A HB2  12 
ATOM 10366 H HB3  . TYR A 1 38 ? 7.063   -6.856  -3.422  1.00 0.00 ? 38 TYR A HB3  12 
ATOM 10367 H HD1  . TYR A 1 38 ? 8.774   -9.322  -3.214  1.00 0.00 ? 38 TYR A HD1  12 
ATOM 10368 H HD2  . TYR A 1 38 ? 6.935   -7.625  -6.699  1.00 0.00 ? 38 TYR A HD2  12 
ATOM 10369 H HE1  . TYR A 1 38 ? 10.170  -10.570 -4.558  1.00 0.00 ? 38 TYR A HE1  12 
ATOM 10370 H HE2  . TYR A 1 38 ? 8.360   -8.868  -8.036  1.00 0.00 ? 38 TYR A HE2  12 
ATOM 10371 H HH   . TYR A 1 38 ? 9.721   -11.439 -7.390  1.00 0.00 ? 38 TYR A HH   12 
ATOM 10372 N N    . ARG A 1 39 ? 5.261   -7.499  -1.110  1.00 0.00 ? 39 ARG A N    12 
ATOM 10373 C CA   . ARG A 1 39 ? 4.355   -6.911  -0.101  1.00 0.00 ? 39 ARG A CA   12 
ATOM 10374 C C    . ARG A 1 39 ? 4.097   -5.466  -0.548  1.00 0.00 ? 39 ARG A C    12 
ATOM 10375 O O    . ARG A 1 39 ? 4.957   -4.864  -1.177  1.00 0.00 ? 39 ARG A O    12 
ATOM 10376 C CB   . ARG A 1 39 ? 5.115   -6.994  1.254   1.00 0.00 ? 39 ARG A CB   12 
ATOM 10377 C CG   . ARG A 1 39 ? 4.961   -8.401  1.860   1.00 0.00 ? 39 ARG A CG   12 
ATOM 10378 C CD   . ARG A 1 39 ? 5.855   -8.695  3.088   1.00 0.00 ? 39 ARG A CD   12 
ATOM 10379 N NE   . ARG A 1 39 ? 5.669   -7.819  4.241   1.00 0.00 ? 39 ARG A NE   12 
ATOM 10380 C CZ   . ARG A 1 39 ? 4.551   -7.651  4.978   1.00 0.00 ? 39 ARG A CZ   12 
ATOM 10381 N NH1  . ARG A 1 39 ? 3.381   -8.146  4.585   1.00 0.00 ? 39 ARG A NH1  12 
ATOM 10382 N NH2  . ARG A 1 39 ? 4.630   -6.960  6.108   1.00 0.00 ? 39 ARG A NH2  12 
ATOM 10383 H H    . ARG A 1 39 ? 6.259   -7.310  -1.151  1.00 0.00 ? 39 ARG A H    12 
ATOM 10384 H HA   . ARG A 1 39 ? 3.342   -7.374  -0.054  1.00 0.00 ? 39 ARG A HA   12 
ATOM 10385 H HB2  . ARG A 1 39 ? 6.170   -6.744  1.137   1.00 0.00 ? 39 ARG A HB2  12 
ATOM 10386 H HB3  . ARG A 1 39 ? 4.773   -6.278  1.989   1.00 0.00 ? 39 ARG A HB3  12 
ATOM 10387 H HG2  . ARG A 1 39 ? 3.916   -8.547  2.149   1.00 0.00 ? 39 ARG A HG2  12 
ATOM 10388 H HG3  . ARG A 1 39 ? 5.183   -9.127  1.062   1.00 0.00 ? 39 ARG A HG3  12 
ATOM 10389 H HD2  . ARG A 1 39 ? 5.713   -9.709  3.465   1.00 0.00 ? 39 ARG A HD2  12 
ATOM 10390 H HD3  . ARG A 1 39 ? 6.910   -8.578  2.835   1.00 0.00 ? 39 ARG A HD3  12 
ATOM 10391 H HE   . ARG A 1 39 ? 6.484   -7.337  4.586   1.00 0.00 ? 39 ARG A HE   12 
ATOM 10392 H HH11 . ARG A 1 39 ? 3.359   -8.795  3.828   1.00 0.00 ? 39 ARG A HH11 12 
ATOM 10393 H HH12 . ARG A 1 39 ? 2.513   -7.858  5.014   1.00 0.00 ? 39 ARG A HH12 12 
ATOM 10394 H HH21 . ARG A 1 39 ? 5.550   -6.680  6.452   1.00 0.00 ? 39 ARG A HH21 12 
ATOM 10395 H HH22 . ARG A 1 39 ? 3.838   -6.715  6.658   1.00 0.00 ? 39 ARG A HH22 12 
ATOM 10396 N N    . TRP A 1 40 ? 2.877   -4.952  -0.237  1.00 0.00 ? 40 TRP A N    12 
ATOM 10397 C CA   . TRP A 1 40 ? 2.561   -3.572  -0.568  1.00 0.00 ? 40 TRP A CA   12 
ATOM 10398 C C    . TRP A 1 40 ? 1.619   -2.926  0.465   1.00 0.00 ? 40 TRP A C    12 
ATOM 10399 O O    . TRP A 1 40 ? 0.937   -3.610  1.221   1.00 0.00 ? 40 TRP A O    12 
ATOM 10400 C CB   . TRP A 1 40 ? 2.029   -3.485  -2.007  1.00 0.00 ? 40 TRP A CB   12 
ATOM 10401 C CG   . TRP A 1 40 ? 0.709   -4.227  -2.106  1.00 0.00 ? 40 TRP A CG   12 
ATOM 10402 C CD1  . TRP A 1 40 ? 0.546   -5.595  -2.336  1.00 0.00 ? 40 TRP A CD1  12 
ATOM 10403 C CD2  . TRP A 1 40 ? -0.620  -3.684  -1.940  1.00 0.00 ? 40 TRP A CD2  12 
ATOM 10404 N NE1  . TRP A 1 40 ? -0.772  -5.901  -2.322  1.00 0.00 ? 40 TRP A NE1  12 
ATOM 10405 C CE2  . TRP A 1 40 ? -1.519  -4.763  -2.079  1.00 0.00 ? 40 TRP A CE2  12 
ATOM 10406 C CE3  . TRP A 1 40 ? -1.101  -2.429  -1.678  1.00 0.00 ? 40 TRP A CE3  12 
ATOM 10407 C CZ2  . TRP A 1 40 ? -2.862  -4.560  -1.952  1.00 0.00 ? 40 TRP A CZ2  12 
ATOM 10408 C CZ3  . TRP A 1 40 ? -2.477  -2.213  -1.543  1.00 0.00 ? 40 TRP A CZ3  12 
ATOM 10409 C CH2  . TRP A 1 40 ? -3.357  -3.289  -1.681  1.00 0.00 ? 40 TRP A CH2  12 
ATOM 10410 H H    . TRP A 1 40 ? 2.137   -5.457  0.215   1.00 0.00 ? 40 TRP A H    12 
ATOM 10411 H HA   . TRP A 1 40 ? 3.501   -3.058  -0.439  1.00 0.00 ? 40 TRP A HA   12 
ATOM 10412 H HB2  . TRP A 1 40 ? 1.897   -2.464  -2.353  1.00 0.00 ? 40 TRP A HB2  12 
ATOM 10413 H HB3  . TRP A 1 40 ? 2.783   -3.904  -2.669  1.00 0.00 ? 40 TRP A HB3  12 
ATOM 10414 H HD1  . TRP A 1 40 ? 1.345   -6.307  -2.461  1.00 0.00 ? 40 TRP A HD1  12 
ATOM 10415 H HE1  . TRP A 1 40 ? -1.172  -6.792  -2.448  1.00 0.00 ? 40 TRP A HE1  12 
ATOM 10416 H HE3  . TRP A 1 40 ? -0.394  -1.620  -1.582  1.00 0.00 ? 40 TRP A HE3  12 
ATOM 10417 H HZ2  . TRP A 1 40 ? -3.533  -5.398  -2.064  1.00 0.00 ? 40 TRP A HZ2  12 
ATOM 10418 H HZ3  . TRP A 1 40 ? -2.882  -1.230  -1.327  1.00 0.00 ? 40 TRP A HZ3  12 
ATOM 10419 H HH2  . TRP A 1 40 ? -4.423  -3.154  -1.578  1.00 0.00 ? 40 TRP A HH2  12 
ATOM 10420 N N    . CYS A 1 41 ? 1.619   -1.574  0.423   1.00 0.00 ? 41 CYS A N    12 
ATOM 10421 C CA   . CYS A 1 41 ? 0.775   -0.710  1.227   1.00 0.00 ? 41 CYS A CA   12 
ATOM 10422 C C    . CYS A 1 41 ? -0.002  0.212   0.272   1.00 0.00 ? 41 CYS A C    12 
ATOM 10423 O O    . CYS A 1 41 ? 0.528   0.636   -0.747  1.00 0.00 ? 41 CYS A O    12 
ATOM 10424 C CB   . CYS A 1 41 ? 1.646   0.189   2.112   1.00 0.00 ? 41 CYS A CB   12 
ATOM 10425 S SG   . CYS A 1 41 ? 2.672   1.329   1.119   1.00 0.00 ? 41 CYS A SG   12 
ATOM 10426 H H    . CYS A 1 41 ? 2.191   -1.056  -0.210  1.00 0.00 ? 41 CYS A H    12 
ATOM 10427 H HA   . CYS A 1 41 ? 0.104   -1.333  1.815   1.00 0.00 ? 41 CYS A HA   12 
ATOM 10428 H HB2  . CYS A 1 41 ? 0.899   0.814   2.668   1.00 0.00 ? 41 CYS A HB2  12 
ATOM 10429 H HB3  . CYS A 1 41 ? 2.328   -0.460  2.724   1.00 0.00 ? 41 CYS A HB3  12 
ATOM 10430 N N    . GLY A 1 42 ? -1.253  0.525   0.643   1.00 0.00 ? 42 GLY A N    12 
ATOM 10431 C CA   . GLY A 1 42 ? -1.994  1.497   -0.156  1.00 0.00 ? 42 GLY A CA   12 
ATOM 10432 C C    . GLY A 1 42 ? -1.525  2.893   0.275   1.00 0.00 ? 42 GLY A C    12 
ATOM 10433 O O    . GLY A 1 42 ? -0.946  3.041   1.345   1.00 0.00 ? 42 GLY A O    12 
ATOM 10434 H H    . GLY A 1 42 ? -1.650  0.161   1.486   1.00 0.00 ? 42 GLY A H    12 
ATOM 10435 H HA2  . GLY A 1 42 ? -1.816  1.319   -1.219  1.00 0.00 ? 42 GLY A HA2  12 
ATOM 10436 H HA3  . GLY A 1 42 ? -3.053  1.373   0.075   1.00 0.00 ? 42 GLY A HA3  12 
ATOM 10437 N N    . THR A 1 43 ? -1.800  3.902   -0.574  1.00 0.00 ? 43 THR A N    12 
ATOM 10438 C CA   . THR A 1 43 ? -1.392  5.267   -0.235  1.00 0.00 ? 43 THR A CA   12 
ATOM 10439 C C    . THR A 1 43 ? -2.596  6.190   -0.003  1.00 0.00 ? 43 THR A C    12 
ATOM 10440 O O    . THR A 1 43 ? -2.472  7.408   -0.003  1.00 0.00 ? 43 THR A O    12 
ATOM 10441 C CB   . THR A 1 43 ? -0.462  5.799   -1.325  1.00 0.00 ? 43 THR A CB   12 
ATOM 10442 O OG1  . THR A 1 43 ? -0.958  5.310   -2.561  1.00 0.00 ? 43 THR A OG1  12 
ATOM 10443 C CG2  . THR A 1 43 ? 0.968   5.326   -1.043  1.00 0.00 ? 43 THR A CG2  12 
ATOM 10444 H H    . THR A 1 43 ? -2.222  3.777   -1.475  1.00 0.00 ? 43 THR A H    12 
ATOM 10445 H HA   . THR A 1 43 ? -0.848  5.256   0.707   1.00 0.00 ? 43 THR A HA   12 
ATOM 10446 H HB   . THR A 1 43 ? -0.472  6.897   -1.314  1.00 0.00 ? 43 THR A HB   12 
ATOM 10447 H HG1  . THR A 1 43 ? -0.430  5.627   -3.283  1.00 0.00 ? 43 THR A HG1  12 
ATOM 10448 H HG21 . THR A 1 43 ? 1.068   4.248   -1.154  1.00 0.00 ? 43 THR A HG21 12 
ATOM 10449 H HG22 . THR A 1 43 ? 1.240   5.569   -0.017  1.00 0.00 ? 43 THR A HG22 12 
ATOM 10450 H HG23 . THR A 1 43 ? 1.700   5.826   -1.670  1.00 0.00 ? 43 THR A HG23 12 
ATOM 10451 N N    . THR A 1 44 ? -3.749  5.547   0.237   1.00 0.00 ? 44 THR A N    12 
ATOM 10452 C CA   . THR A 1 44 ? -4.963  6.280   0.542   1.00 0.00 ? 44 THR A CA   12 
ATOM 10453 C C    . THR A 1 44 ? -5.778  5.395   1.485   1.00 0.00 ? 44 THR A C    12 
ATOM 10454 O O    . THR A 1 44 ? -5.599  4.182   1.535   1.00 0.00 ? 44 THR A O    12 
ATOM 10455 C CB   . THR A 1 44 ? -5.751  6.565   -0.750  1.00 0.00 ? 44 THR A CB   12 
ATOM 10456 O OG1  . THR A 1 44 ? -6.007  5.323   -1.384  1.00 0.00 ? 44 THR A OG1  12 
ATOM 10457 C CG2  . THR A 1 44 ? -4.983  7.502   -1.696  1.00 0.00 ? 44 THR A CG2  12 
ATOM 10458 H H    . THR A 1 44 ? -3.839  4.552   0.233   1.00 0.00 ? 44 THR A H    12 
ATOM 10459 H HA   . THR A 1 44 ? -4.704  7.206   1.059   1.00 0.00 ? 44 THR A HA   12 
ATOM 10460 H HB   . THR A 1 44 ? -6.693  7.054   -0.468  1.00 0.00 ? 44 THR A HB   12 
ATOM 10461 H HG1  . THR A 1 44 ? -6.681  5.415   -2.074  1.00 0.00 ? 44 THR A HG1  12 
ATOM 10462 H HG21 . THR A 1 44 ? -4.594  8.366   -1.158  1.00 0.00 ? 44 THR A HG21 12 
ATOM 10463 H HG22 . THR A 1 44 ? -5.616  7.884   -2.493  1.00 0.00 ? 44 THR A HG22 12 
ATOM 10464 H HG23 . THR A 1 44 ? -4.142  6.992   -2.165  1.00 0.00 ? 44 THR A HG23 12 
ATOM 10465 N N    . GLU A 1 45 ? -6.710  6.063   2.190   1.00 0.00 ? 45 GLU A N    12 
ATOM 10466 C CA   . GLU A 1 45 ? -7.620  5.356   3.084   1.00 0.00 ? 45 GLU A CA   12 
ATOM 10467 C C    . GLU A 1 45 ? -8.508  4.362   2.291   1.00 0.00 ? 45 GLU A C    12 
ATOM 10468 O O    . GLU A 1 45 ? -9.007  3.392   2.844   1.00 0.00 ? 45 GLU A O    12 
ATOM 10469 C CB   . GLU A 1 45 ? -8.458  6.316   3.964   1.00 0.00 ? 45 GLU A CB   12 
ATOM 10470 C CG   . GLU A 1 45 ? -7.618  7.027   5.047   1.00 0.00 ? 45 GLU A CG   12 
ATOM 10471 C CD   . GLU A 1 45 ? -6.495  7.935   4.518   1.00 0.00 ? 45 GLU A CD   12 
ATOM 10472 O OE1  . GLU A 1 45 ? -6.659  8.558   3.469   1.00 0.00 ? 45 GLU A OE1  12 
ATOM 10473 O OE2  . GLU A 1 45 ? -5.451  8.000   5.165   1.00 0.00 ? 45 GLU A OE2  12 
ATOM 10474 H H    . GLU A 1 45 ? -6.748  7.064   2.149   1.00 0.00 ? 45 GLU A H    12 
ATOM 10475 H HA   . GLU A 1 45 ? -6.988  4.773   3.750   1.00 0.00 ? 45 GLU A HA   12 
ATOM 10476 H HB2  . GLU A 1 45 ? -8.980  7.111   3.359   1.00 0.00 ? 45 GLU A HB2  12 
ATOM 10477 H HB3  . GLU A 1 45 ? -9.136  5.640   4.547   1.00 0.00 ? 45 GLU A HB3  12 
ATOM 10478 H HG2  . GLU A 1 45 ? -8.270  7.638   5.672   1.00 0.00 ? 45 GLU A HG2  12 
ATOM 10479 H HG3  . GLU A 1 45 ? -7.175  6.277   5.705   1.00 0.00 ? 45 GLU A HG3  12 
ATOM 10480 N N    . ASP A 1 46 ? -8.657  4.652   0.977   1.00 0.00 ? 46 ASP A N    12 
ATOM 10481 C CA   . ASP A 1 46 ? -9.410  3.795   0.056   1.00 0.00 ? 46 ASP A CA   12 
ATOM 10482 C C    . ASP A 1 46 ? -8.460  3.420   -1.085  1.00 0.00 ? 46 ASP A C    12 
ATOM 10483 O O    . ASP A 1 46 ? -8.287  4.150   -2.054  1.00 0.00 ? 46 ASP A O    12 
ATOM 10484 C CB   . ASP A 1 46 ? -10.694 4.473   -0.489  1.00 0.00 ? 46 ASP A CB   12 
ATOM 10485 C CG   . ASP A 1 46 ? -11.539 3.530   -1.372  1.00 0.00 ? 46 ASP A CG   12 
ATOM 10486 O OD1  . ASP A 1 46 ? -11.060 2.462   -1.755  1.00 0.00 ? 46 ASP A OD1  12 
ATOM 10487 O OD2  . ASP A 1 46 ? -12.674 3.885   -1.678  1.00 0.00 ? 46 ASP A OD2  12 
ATOM 10488 H H    . ASP A 1 46 ? -8.146  5.430   0.614   1.00 0.00 ? 46 ASP A H    12 
ATOM 10489 H HA   . ASP A 1 46 ? -9.690  2.886   0.594   1.00 0.00 ? 46 ASP A HA   12 
ATOM 10490 H HB2  . ASP A 1 46 ? -11.315 4.792   0.348   1.00 0.00 ? 46 ASP A HB2  12 
ATOM 10491 H HB3  . ASP A 1 46 ? -10.498 5.362   -1.091  1.00 0.00 ? 46 ASP A HB3  12 
ATOM 10492 N N    . TYR A 1 47 ? -7.843  2.241   -0.909  1.00 0.00 ? 47 TYR A N    12 
ATOM 10493 C CA   . TYR A 1 47 ? -6.921  1.785   -1.947  1.00 0.00 ? 47 TYR A CA   12 
ATOM 10494 C C    . TYR A 1 47 ? -7.705  1.389   -3.198  1.00 0.00 ? 47 TYR A C    12 
ATOM 10495 O O    . TYR A 1 47 ? -7.244  1.567   -4.317  1.00 0.00 ? 47 TYR A O    12 
ATOM 10496 C CB   . TYR A 1 47 ? -6.122  0.561   -1.465  1.00 0.00 ? 47 TYR A CB   12 
ATOM 10497 C CG   . TYR A 1 47 ? -5.289  -0.001  -2.586  1.00 0.00 ? 47 TYR A CG   12 
ATOM 10498 C CD1  . TYR A 1 47 ? -4.165  0.666   -3.042  1.00 0.00 ? 47 TYR A CD1  12 
ATOM 10499 C CD2  . TYR A 1 47 ? -5.651  -1.190  -3.206  1.00 0.00 ? 47 TYR A CD2  12 
ATOM 10500 C CE1  . TYR A 1 47 ? -3.411  0.138   -4.073  1.00 0.00 ? 47 TYR A CE1  12 
ATOM 10501 C CE2  . TYR A 1 47 ? -4.884  -1.729  -4.225  1.00 0.00 ? 47 TYR A CE2  12 
ATOM 10502 C CZ   . TYR A 1 47 ? -3.753  -1.063  -4.663  1.00 0.00 ? 47 TYR A CZ   12 
ATOM 10503 O OH   . TYR A 1 47 ? -2.965  -1.565  -5.677  1.00 0.00 ? 47 TYR A OH   12 
ATOM 10504 H H    . TYR A 1 47 ? -8.096  1.693   -0.102  1.00 0.00 ? 47 TYR A H    12 
ATOM 10505 H HA   . TYR A 1 47 ? -6.242  2.601   -2.237  1.00 0.00 ? 47 TYR A HA   12 
ATOM 10506 H HB2  . TYR A 1 47 ? -5.476  0.839   -0.633  1.00 0.00 ? 47 TYR A HB2  12 
ATOM 10507 H HB3  . TYR A 1 47 ? -6.782  -0.236  -1.108  1.00 0.00 ? 47 TYR A HB3  12 
ATOM 10508 H HD1  . TYR A 1 47 ? -3.872  1.610   -2.617  1.00 0.00 ? 47 TYR A HD1  12 
ATOM 10509 H HD2  . TYR A 1 47 ? -6.552  -1.694  -2.913  1.00 0.00 ? 47 TYR A HD2  12 
ATOM 10510 H HE1  . TYR A 1 47 ? -2.555  0.672   -4.424  1.00 0.00 ? 47 TYR A HE1  12 
ATOM 10511 H HE2  . TYR A 1 47 ? -5.185  -2.666  -4.653  1.00 0.00 ? 47 TYR A HE2  12 
ATOM 10512 H HH   . TYR A 1 47 ? -2.776  -2.480  -5.511  1.00 0.00 ? 47 TYR A HH   12 
ATOM 10513 N N    . ASP A 1 48 ? -8.892  0.804   -2.959  1.00 0.00 ? 48 ASP A N    12 
ATOM 10514 C CA   . ASP A 1 48 ? -9.633  0.318   -4.113  1.00 0.00 ? 48 ASP A CA   12 
ATOM 10515 C C    . ASP A 1 48 ? -9.977  1.409   -5.123  1.00 0.00 ? 48 ASP A C    12 
ATOM 10516 O O    . ASP A 1 48 ? -9.996  1.142   -6.320  1.00 0.00 ? 48 ASP A O    12 
ATOM 10517 C CB   . ASP A 1 48 ? -10.911 -0.473  -3.770  1.00 0.00 ? 48 ASP A CB   12 
ATOM 10518 C CG   . ASP A 1 48 ? -10.535 -1.906  -3.395  1.00 0.00 ? 48 ASP A CG   12 
ATOM 10519 O OD1  . ASP A 1 48 ? -9.920  -2.570  -4.235  1.00 0.00 ? 48 ASP A OD1  12 
ATOM 10520 O OD2  . ASP A 1 48 ? -10.853 -2.341  -2.295  1.00 0.00 ? 48 ASP A OD2  12 
ATOM 10521 H H    . ASP A 1 48 ? -9.235  0.721   -2.021  1.00 0.00 ? 48 ASP A H    12 
ATOM 10522 H HA   . ASP A 1 48 ? -8.961  -0.346  -4.655  1.00 0.00 ? 48 ASP A HA   12 
ATOM 10523 H HB2  . ASP A 1 48 ? -11.508 0.003   -2.984  1.00 0.00 ? 48 ASP A HB2  12 
ATOM 10524 H HB3  . ASP A 1 48 ? -11.537 -0.596  -4.660  1.00 0.00 ? 48 ASP A HB3  12 
ATOM 10525 N N    . ARG A 1 49 ? -10.260 2.606   -4.602  1.00 0.00 ? 49 ARG A N    12 
ATOM 10526 C CA   . ARG A 1 49 ? -10.555 3.715   -5.496  1.00 0.00 ? 49 ARG A CA   12 
ATOM 10527 C C    . ARG A 1 49 ? -9.310  4.101   -6.342  1.00 0.00 ? 49 ARG A C    12 
ATOM 10528 O O    . ARG A 1 49 ? -9.402  4.312   -7.544  1.00 0.00 ? 49 ARG A O    12 
ATOM 10529 C CB   . ARG A 1 49 ? -11.091 4.875   -4.620  1.00 0.00 ? 49 ARG A CB   12 
ATOM 10530 C CG   . ARG A 1 49 ? -11.346 6.231   -5.306  1.00 0.00 ? 49 ARG A CG   12 
ATOM 10531 C CD   . ARG A 1 49 ? -11.258 7.421   -4.274  1.00 0.00 ? 49 ARG A CD   12 
ATOM 10532 N NE   . ARG A 1 49 ? -9.857  7.780   -4.068  1.00 0.00 ? 49 ARG A NE   12 
ATOM 10533 C CZ   . ARG A 1 49 ? -9.459  8.844   -3.339  1.00 0.00 ? 49 ARG A CZ   12 
ATOM 10534 N NH1  . ARG A 1 49 ? -10.353 9.642   -2.761  1.00 0.00 ? 49 ARG A NH1  12 
ATOM 10535 N NH2  . ARG A 1 49 ? -8.161  9.076   -3.208  1.00 0.00 ? 49 ARG A NH2  12 
ATOM 10536 H H    . ARG A 1 49 ? -10.252 2.706   -3.601  1.00 0.00 ? 49 ARG A H    12 
ATOM 10537 H HA   . ARG A 1 49 ? -11.338 3.382   -6.184  1.00 0.00 ? 49 ARG A HA   12 
ATOM 10538 H HB2  . ARG A 1 49 ? -12.024 4.503   -4.186  1.00 0.00 ? 49 ARG A HB2  12 
ATOM 10539 H HB3  . ARG A 1 49 ? -10.428 5.085   -3.783  1.00 0.00 ? 49 ARG A HB3  12 
ATOM 10540 H HG2  . ARG A 1 49 ? -10.614 6.360   -6.117  1.00 0.00 ? 49 ARG A HG2  12 
ATOM 10541 H HG3  . ARG A 1 49 ? -12.319 6.147   -5.809  1.00 0.00 ? 49 ARG A HG3  12 
ATOM 10542 H HD2  . ARG A 1 49 ? -11.760 8.352   -4.570  1.00 0.00 ? 49 ARG A HD2  12 
ATOM 10543 H HD3  . ARG A 1 49 ? -11.635 7.174   -3.270  1.00 0.00 ? 49 ARG A HD3  12 
ATOM 10544 H HE   . ARG A 1 49 ? -9.113  7.203   -4.429  1.00 0.00 ? 49 ARG A HE   12 
ATOM 10545 H HH11 . ARG A 1 49 ? -11.324 9.433   -2.870  1.00 0.00 ? 49 ARG A HH11 12 
ATOM 10546 H HH12 . ARG A 1 49 ? -10.080 10.438  -2.223  1.00 0.00 ? 49 ARG A HH12 12 
ATOM 10547 H HH21 . ARG A 1 49 ? -7.536  8.410   -3.656  1.00 0.00 ? 49 ARG A HH21 12 
ATOM 10548 H HH22 . ARG A 1 49 ? -7.774  9.845   -2.708  1.00 0.00 ? 49 ARG A HH22 12 
ATOM 10549 N N    . ASP A 1 50 ? -8.171  4.228   -5.637  1.00 0.00 ? 50 ASP A N    12 
ATOM 10550 C CA   . ASP A 1 50 ? -6.941  4.740   -6.255  1.00 0.00 ? 50 ASP A CA   12 
ATOM 10551 C C    . ASP A 1 50 ? -6.081  3.746   -7.083  1.00 0.00 ? 50 ASP A C    12 
ATOM 10552 O O    . ASP A 1 50 ? -5.590  4.105   -8.145  1.00 0.00 ? 50 ASP A O    12 
ATOM 10553 C CB   . ASP A 1 50 ? -6.077  5.365   -5.145  1.00 0.00 ? 50 ASP A CB   12 
ATOM 10554 C CG   . ASP A 1 50 ? -6.818  6.555   -4.528  1.00 0.00 ? 50 ASP A CG   12 
ATOM 10555 O OD1  . ASP A 1 50 ? -6.799  7.646   -5.087  1.00 0.00 ? 50 ASP A OD1  12 
ATOM 10556 O OD2  . ASP A 1 50 ? -7.436  6.412   -3.482  1.00 0.00 ? 50 ASP A OD2  12 
ATOM 10557 H H    . ASP A 1 50 ? -8.185  4.046   -4.651  1.00 0.00 ? 50 ASP A H    12 
ATOM 10558 H HA   . ASP A 1 50 ? -7.216  5.546   -6.939  1.00 0.00 ? 50 ASP A HA   12 
ATOM 10559 H HB2  . ASP A 1 50 ? -5.867  4.612   -4.364  1.00 0.00 ? 50 ASP A HB2  12 
ATOM 10560 H HB3  . ASP A 1 50 ? -5.154  5.784   -5.574  1.00 0.00 ? 50 ASP A HB3  12 
ATOM 10561 N N    . LYS A 1 51 ? -5.827  2.537   -6.536  1.00 0.00 ? 51 LYS A N    12 
ATOM 10562 C CA   . LYS A 1 51 ? -4.908  1.578   -7.161  1.00 0.00 ? 51 LYS A CA   12 
ATOM 10563 C C    . LYS A 1 51 ? -3.485  2.159   -7.382  1.00 0.00 ? 51 LYS A C    12 
ATOM 10564 O O    . LYS A 1 51 ? -2.833  1.933   -8.395  1.00 0.00 ? 51 LYS A O    12 
ATOM 10565 C CB   . LYS A 1 51 ? -5.474  0.913   -8.437  1.00 0.00 ? 51 LYS A CB   12 
ATOM 10566 C CG   . LYS A 1 51 ? -6.350  -0.351  -8.160  1.00 0.00 ? 51 LYS A CG   12 
ATOM 10567 C CD   . LYS A 1 51 ? -7.652  -0.171  -7.368  1.00 0.00 ? 51 LYS A CD   12 
ATOM 10568 C CE   . LYS A 1 51 ? -8.495  -1.465  -7.409  1.00 0.00 ? 51 LYS A CE   12 
ATOM 10569 N NZ   . LYS A 1 51 ? -9.750  -1.415  -6.660  1.00 0.00 ? 51 LYS A NZ   12 
ATOM 10570 H H    . LYS A 1 51 ? -6.287  2.249   -5.700  1.00 0.00 ? 51 LYS A H    12 
ATOM 10571 H HA   . LYS A 1 51 ? -4.690  0.825   -6.410  1.00 0.00 ? 51 LYS A HA   12 
ATOM 10572 H HB2  . LYS A 1 51 ? -6.074  1.690   -8.987  1.00 0.00 ? 51 LYS A HB2  12 
ATOM 10573 H HB3  . LYS A 1 51 ? -4.567  0.504   -8.973  1.00 0.00 ? 51 LYS A HB3  12 
ATOM 10574 H HG2  . LYS A 1 51 ? -6.685  -0.794  -9.097  1.00 0.00 ? 51 LYS A HG2  12 
ATOM 10575 H HG3  . LYS A 1 51 ? -5.741  -1.125  -7.686  1.00 0.00 ? 51 LYS A HG3  12 
ATOM 10576 H HD2  . LYS A 1 51 ? -7.452  0.111   -6.336  1.00 0.00 ? 51 LYS A HD2  12 
ATOM 10577 H HD3  . LYS A 1 51 ? -8.215  0.647   -7.818  1.00 0.00 ? 51 LYS A HD3  12 
ATOM 10578 H HE2  . LYS A 1 51 ? -8.751  -1.685  -8.447  1.00 0.00 ? 51 LYS A HE2  12 
ATOM 10579 H HE3  . LYS A 1 51 ? -7.922  -2.315  -7.035  1.00 0.00 ? 51 LYS A HE3  12 
ATOM 10580 H HZ1  . LYS A 1 51 ? -10.134 -0.443  -6.710  1.00 0.00 ? 51 LYS A HZ1  12 
ATOM 10581 H HZ2  . LYS A 1 51 ? -9.603  -1.668  -5.653  1.00 0.00 ? 51 LYS A HZ2  12 
ATOM 10582 H HZ3  . LYS A 1 51 ? -10.444 -2.091  -7.031  1.00 0.00 ? 51 LYS A HZ3  12 
ATOM 10583 N N    . LYS A 1 52 ? -3.025  2.870   -6.337  1.00 0.00 ? 52 LYS A N    12 
ATOM 10584 C CA   . LYS A 1 52 ? -1.651  3.360   -6.293  1.00 0.00 ? 52 LYS A CA   12 
ATOM 10585 C C    . LYS A 1 52 ? -1.132  2.912   -4.922  1.00 0.00 ? 52 LYS A C    12 
ATOM 10586 O O    . LYS A 1 52 ? -1.885  2.898   -3.954  1.00 0.00 ? 52 LYS A O    12 
ATOM 10587 C CB   . LYS A 1 52 ? -1.581  4.883   -6.531  1.00 0.00 ? 52 LYS A CB   12 
ATOM 10588 C CG   . LYS A 1 52 ? -2.071  5.317   -7.935  1.00 0.00 ? 52 LYS A CG   12 
ATOM 10589 C CD   . LYS A 1 52 ? -1.004  5.290   -9.051  1.00 0.00 ? 52 LYS A CD   12 
ATOM 10590 C CE   . LYS A 1 52 ? 0.011   6.433   -8.943  1.00 0.00 ? 52 LYS A CE   12 
ATOM 10591 N NZ   . LYS A 1 52 ? -0.569  7.760   -9.098  1.00 0.00 ? 52 LYS A NZ   12 
ATOM 10592 H H    . LYS A 1 52 ? -3.597  3.006   -5.528  1.00 0.00 ? 52 LYS A H    12 
ATOM 10593 H HA   . LYS A 1 52 ? -1.074  2.799   -7.029  1.00 0.00 ? 52 LYS A HA   12 
ATOM 10594 H HB2  . LYS A 1 52 ? -2.189  5.377   -5.771  1.00 0.00 ? 52 LYS A HB2  12 
ATOM 10595 H HB3  . LYS A 1 52 ? -0.560  5.234   -6.383  1.00 0.00 ? 52 LYS A HB3  12 
ATOM 10596 H HG2  . LYS A 1 52 ? -2.906  4.687   -8.247  1.00 0.00 ? 52 LYS A HG2  12 
ATOM 10597 H HG3  . LYS A 1 52 ? -2.490  6.322   -7.876  1.00 0.00 ? 52 LYS A HG3  12 
ATOM 10598 H HD2  . LYS A 1 52 ? -0.391  4.355   -8.936  1.00 0.00 ? 52 LYS A HD2  12 
ATOM 10599 H HD3  . LYS A 1 52 ? -1.556  5.428   -10.027 1.00 0.00 ? 52 LYS A HD3  12 
ATOM 10600 H HE2  . LYS A 1 52 ? 0.529   6.413   -7.986  1.00 0.00 ? 52 LYS A HE2  12 
ATOM 10601 H HE3  . LYS A 1 52 ? 0.792   6.334   -9.703  1.00 0.00 ? 52 LYS A HE3  12 
ATOM 10602 H HZ1  . LYS A 1 52 ? -0.922  7.913   -10.060 1.00 0.00 ? 52 LYS A HZ1  12 
ATOM 10603 H HZ2  . LYS A 1 52 ? 0.223   8.437   -8.972  1.00 0.00 ? 52 LYS A HZ2  12 
ATOM 10604 H HZ3  . LYS A 1 52 ? -1.286  7.963   -8.379  1.00 0.00 ? 52 LYS A HZ3  12 
ATOM 10605 N N    . TYR A 1 53 ? 0.139   2.464   -4.907  1.00 0.00 ? 53 TYR A N    12 
ATOM 10606 C CA   . TYR A 1 53 ? 0.685   1.841   -3.712  1.00 0.00 ? 53 TYR A CA   12 
ATOM 10607 C C    . TYR A 1 53 ? 2.208   2.044   -3.608  1.00 0.00 ? 53 TYR A C    12 
ATOM 10608 O O    . TYR A 1 53 ? 2.885   2.580   -4.480  1.00 0.00 ? 53 TYR A O    12 
ATOM 10609 C CB   . TYR A 1 53 ? 0.365   0.324   -3.793  1.00 0.00 ? 53 TYR A CB   12 
ATOM 10610 C CG   . TYR A 1 53 ? 0.992   -0.368  -4.976  1.00 0.00 ? 53 TYR A CG   12 
ATOM 10611 C CD1  . TYR A 1 53 ? 2.288   -0.870  -4.908  1.00 0.00 ? 53 TYR A CD1  12 
ATOM 10612 C CD2  . TYR A 1 53 ? 0.274   -0.534  -6.151  1.00 0.00 ? 53 TYR A CD2  12 
ATOM 10613 C CE1  . TYR A 1 53 ? 2.843   -1.536  -5.988  1.00 0.00 ? 53 TYR A CE1  12 
ATOM 10614 C CE2  . TYR A 1 53 ? 0.822   -1.205  -7.234  1.00 0.00 ? 53 TYR A CE2  12 
ATOM 10615 C CZ   . TYR A 1 53 ? 2.110   -1.712  -7.151  1.00 0.00 ? 53 TYR A CZ   12 
ATOM 10616 O OH   . TYR A 1 53 ? 2.669   -2.416  -8.203  1.00 0.00 ? 53 TYR A OH   12 
ATOM 10617 H H    . TYR A 1 53 ? 0.723   2.501   -5.718  1.00 0.00 ? 53 TYR A H    12 
ATOM 10618 H HA   . TYR A 1 53 ? 0.214   2.312   -2.846  1.00 0.00 ? 53 TYR A HA   12 
ATOM 10619 H HB2  . TYR A 1 53 ? 0.671   -0.216  -2.904  1.00 0.00 ? 53 TYR A HB2  12 
ATOM 10620 H HB3  . TYR A 1 53 ? -0.708  0.160   -3.834  1.00 0.00 ? 53 TYR A HB3  12 
ATOM 10621 H HD1  . TYR A 1 53 ? 2.875   -0.748  -4.010  1.00 0.00 ? 53 TYR A HD1  12 
ATOM 10622 H HD2  . TYR A 1 53 ? -0.725  -0.138  -6.213  1.00 0.00 ? 53 TYR A HD2  12 
ATOM 10623 H HE1  . TYR A 1 53 ? 3.847   -1.919  -5.912  1.00 0.00 ? 53 TYR A HE1  12 
ATOM 10624 H HE2  . TYR A 1 53 ? 0.223   -1.330  -8.122  1.00 0.00 ? 53 TYR A HE2  12 
ATOM 10625 H HH   . TYR A 1 53 ? 2.602   -1.889  -8.993  1.00 0.00 ? 53 TYR A HH   12 
ATOM 10626 N N    . GLY A 1 54 ? 2.669   1.496   -2.474  1.00 0.00 ? 54 GLY A N    12 
ATOM 10627 C CA   . GLY A 1 54 ? 4.074   1.391   -2.081  1.00 0.00 ? 54 GLY A CA   12 
ATOM 10628 C C    . GLY A 1 54 ? 4.352   -0.066  -1.658  1.00 0.00 ? 54 GLY A C    12 
ATOM 10629 O O    . GLY A 1 54 ? 3.430   -0.868  -1.677  1.00 0.00 ? 54 GLY A O    12 
ATOM 10630 H H    . GLY A 1 54 ? 1.926   1.131   -1.906  1.00 0.00 ? 54 GLY A H    12 
ATOM 10631 H HA2  . GLY A 1 54 ? 4.702   1.666   -2.928  1.00 0.00 ? 54 GLY A HA2  12 
ATOM 10632 H HA3  . GLY A 1 54 ? 4.214   2.090   -1.268  1.00 0.00 ? 54 GLY A HA3  12 
ATOM 10633 N N    . PHE A 1 55 ? 5.622   -0.410  -1.302  1.00 0.00 ? 55 PHE A N    12 
ATOM 10634 C CA   . PHE A 1 55 ? 5.919   -1.844  -1.057  1.00 0.00 ? 55 PHE A CA   12 
ATOM 10635 C C    . PHE A 1 55 ? 5.877   -2.275  0.438   1.00 0.00 ? 55 PHE A C    12 
ATOM 10636 O O    . PHE A 1 55 ? 6.000   -3.450  0.746   1.00 0.00 ? 55 PHE A O    12 
ATOM 10637 C CB   . PHE A 1 55 ? 7.251   -2.301  -1.695  1.00 0.00 ? 55 PHE A CB   12 
ATOM 10638 C CG   . PHE A 1 55 ? 7.088   -2.540  -3.179  1.00 0.00 ? 55 PHE A CG   12 
ATOM 10639 C CD1  . PHE A 1 55 ? 6.785   -1.495  -4.038  1.00 0.00 ? 55 PHE A CD1  12 
ATOM 10640 C CD2  . PHE A 1 55 ? 7.211   -3.820  -3.715  1.00 0.00 ? 55 PHE A CD2  12 
ATOM 10641 C CE1  . PHE A 1 55 ? 6.595   -1.712  -5.395  1.00 0.00 ? 55 PHE A CE1  12 
ATOM 10642 C CE2  . PHE A 1 55 ? 7.032   -4.041  -5.074  1.00 0.00 ? 55 PHE A CE2  12 
ATOM 10643 C CZ   . PHE A 1 55 ? 6.722   -2.987  -5.919  1.00 0.00 ? 55 PHE A CZ   12 
ATOM 10644 H H    . PHE A 1 55 ? 6.357   0.271   -1.282  1.00 0.00 ? 55 PHE A H    12 
ATOM 10645 H HA   . PHE A 1 55 ? 5.184   -2.446  -1.578  1.00 0.00 ? 55 PHE A HA   12 
ATOM 10646 H HB2  . PHE A 1 55 ? 8.081   -1.615  -1.504  1.00 0.00 ? 55 PHE A HB2  12 
ATOM 10647 H HB3  . PHE A 1 55 ? 7.512   -3.286  -1.288  1.00 0.00 ? 55 PHE A HB3  12 
ATOM 10648 H HD1  . PHE A 1 55 ? 6.688   -0.501  -3.645  1.00 0.00 ? 55 PHE A HD1  12 
ATOM 10649 H HD2  . PHE A 1 55 ? 7.439   -4.659  -3.075  1.00 0.00 ? 55 PHE A HD2  12 
ATOM 10650 H HE1  . PHE A 1 55 ? 6.344   -0.881  -6.038  1.00 0.00 ? 55 PHE A HE1  12 
ATOM 10651 H HE2  . PHE A 1 55 ? 7.133   -5.035  -5.476  1.00 0.00 ? 55 PHE A HE2  12 
ATOM 10652 H HZ   . PHE A 1 55 ? 6.582   -3.156  -6.976  1.00 0.00 ? 55 PHE A HZ   12 
ATOM 10653 N N    . CYS A 1 56 ? 5.697   -1.304  1.345   1.00 0.00 ? 56 CYS A N    12 
ATOM 10654 C CA   . CYS A 1 56 ? 5.673   -1.625  2.819   1.00 0.00 ? 56 CYS A CA   12 
ATOM 10655 C C    . CYS A 1 56 ? 5.966   -0.312  3.583   1.00 0.00 ? 56 CYS A C    12 
ATOM 10656 O O    . CYS A 1 56 ? 6.458   0.639   2.990   1.00 0.00 ? 56 CYS A O    12 
ATOM 10657 C CB   . CYS A 1 56 ? 6.782   -2.649  3.236   1.00 0.00 ? 56 CYS A CB   12 
ATOM 10658 S SG   . CYS A 1 56 ? 6.182   -4.282  3.773   1.00 0.00 ? 56 CYS A SG   12 
ATOM 10659 H H    . CYS A 1 56 ? 5.643   -0.409  0.870   1.00 0.00 ? 56 CYS A H    12 
ATOM 10660 H HA   . CYS A 1 56 ? 4.699   -2.046  3.148   1.00 0.00 ? 56 CYS A HA   12 
ATOM 10661 H HB2  . CYS A 1 56 ? 7.491   -2.825  2.416   1.00 0.00 ? 56 CYS A HB2  12 
ATOM 10662 H HB3  . CYS A 1 56 ? 7.377   -2.270  4.081   1.00 0.00 ? 56 CYS A HB3  12 
ATOM 10663 N N    . PRO A 1 57 ? 5.720   -0.319  4.936   1.00 0.00 ? 57 PRO A N    12 
ATOM 10664 C CA   . PRO A 1 57 ? 6.374   0.583   5.842   1.00 0.00 ? 57 PRO A CA   12 
ATOM 10665 C C    . PRO A 1 57 ? 7.851   0.127   5.966   1.00 0.00 ? 57 PRO A C    12 
ATOM 10666 O O    . PRO A 1 57 ? 8.570   0.020   4.982   1.00 0.00 ? 57 PRO A O    12 
ATOM 10667 C CB   . PRO A 1 57 ? 5.534   0.493   7.137   1.00 0.00 ? 57 PRO A CB   12 
ATOM 10668 C CG   . PRO A 1 57 ? 4.910   -0.891  7.131   1.00 0.00 ? 57 PRO A CG   12 
ATOM 10669 C CD   . PRO A 1 57 ? 5.021   -1.338  5.674   1.00 0.00 ? 57 PRO A CD   12 
ATOM 10670 H HA   . PRO A 1 57 ? 6.322   1.561   5.429   1.00 0.00 ? 57 PRO A HA   12 
ATOM 10671 H HB2  . PRO A 1 57 ? 6.031   0.751   8.071   1.00 0.00 ? 57 PRO A HB2  12 
ATOM 10672 H HB3  . PRO A 1 57 ? 4.717   1.200   7.065   1.00 0.00 ? 57 PRO A HB3  12 
ATOM 10673 H HG2  . PRO A 1 57 ? 5.472   -1.565  7.780   1.00 0.00 ? 57 PRO A HG2  12 
ATOM 10674 H HG3  . PRO A 1 57 ? 3.880   -0.878  7.487   1.00 0.00 ? 57 PRO A HG3  12 
ATOM 10675 H HD2  . PRO A 1 57 ? 5.764   -2.119  5.695   1.00 0.00 ? 57 PRO A HD2  12 
ATOM 10676 H HD3  . PRO A 1 57 ? 4.048   -1.574  5.225   1.00 0.00 ? 57 PRO A HD3  12 
ATOM 10677 N N    . GLU A 1 58 ? 8.245   -0.172  7.215   1.00 0.00 ? 58 GLU A N    12 
ATOM 10678 C CA   . GLU A 1 58 ? 9.590   -0.702  7.456   1.00 0.00 ? 58 GLU A CA   12 
ATOM 10679 C C    . GLU A 1 58 ? 9.694   -2.082  6.781   1.00 0.00 ? 58 GLU A C    12 
ATOM 10680 O O    . GLU A 1 58 ? 8.685   -2.690  6.442   1.00 0.00 ? 58 GLU A O    12 
ATOM 10681 C CB   . GLU A 1 58 ? 9.884   -0.795  8.976   1.00 0.00 ? 58 GLU A CB   12 
ATOM 10682 C CG   . GLU A 1 58 ? 11.357  -1.063  9.339   1.00 0.00 ? 58 GLU A CG   12 
ATOM 10683 C CD   . GLU A 1 58 ? 12.304  -0.073  8.649   1.00 0.00 ? 58 GLU A CD   12 
ATOM 10684 O OE1  . GLU A 1 58 ? 12.731  -0.363  7.533   1.00 0.00 ? 58 GLU A OE1  12 
ATOM 10685 O OE2  . GLU A 1 58 ? 12.590  0.973   9.227   1.00 0.00 ? 58 GLU A OE2  12 
ATOM 10686 H H    . GLU A 1 58 ? 7.547   -0.023  7.905   1.00 0.00 ? 58 GLU A H    12 
ATOM 10687 H HA   . GLU A 1 58 ? 10.273  -0.008  6.962   1.00 0.00 ? 58 GLU A HA   12 
ATOM 10688 H HB2  . GLU A 1 58 ? 9.593   0.154   9.438   1.00 0.00 ? 58 GLU A HB2  12 
ATOM 10689 H HB3  . GLU A 1 58 ? 9.302   -1.600  9.444   1.00 0.00 ? 58 GLU A HB3  12 
ATOM 10690 H HG2  . GLU A 1 58 ? 11.493  -0.982  10.418  1.00 0.00 ? 58 GLU A HG2  12 
ATOM 10691 H HG3  . GLU A 1 58 ? 11.650  -2.079  9.076   1.00 0.00 ? 58 GLU A HG3  12 
ATOM 10692 N N    . THR A 1 59 ? 10.944  -2.545  6.605   1.00 0.00 ? 59 THR A N    12 
ATOM 10693 C CA   . THR A 1 59 ? 11.157  -3.849  5.992   1.00 0.00 ? 59 THR A CA   12 
ATOM 10694 C C    . THR A 1 59 ? 10.785  -4.960  6.994   1.00 0.00 ? 59 THR A C    12 
ATOM 10695 O O    . THR A 1 59 ? 11.645  -5.513  7.673   1.00 0.00 ? 59 THR A O    12 
ATOM 10696 C CB   . THR A 1 59 ? 12.637  -3.971  5.583   1.00 0.00 ? 59 THR A CB   12 
ATOM 10697 O OG1  . THR A 1 59 ? 13.489  -3.853  6.707   1.00 0.00 ? 59 THR A OG1  12 
ATOM 10698 C CG2  . THR A 1 59 ? 13.051  -2.888  4.581   1.00 0.00 ? 59 THR A CG2  12 
ATOM 10699 H H    . THR A 1 59 ? 11.729  -1.993  6.911   1.00 0.00 ? 59 THR A H    12 
ATOM 10700 H HA   . THR A 1 59 ? 10.514  -3.917  5.111   1.00 0.00 ? 59 THR A HA   12 
ATOM 10701 H HB   . THR A 1 59 ? 12.805  -4.945  5.109   1.00 0.00 ? 59 THR A HB   12 
ATOM 10702 H HG1  . THR A 1 59 ? 13.179  -4.452  7.391   1.00 0.00 ? 59 THR A HG1  12 
ATOM 10703 H HG21 . THR A 1 59 ? 12.983  -1.891  5.021   1.00 0.00 ? 59 THR A HG21 12 
ATOM 10704 H HG22 . THR A 1 59 ? 12.419  -2.908  3.693   1.00 0.00 ? 59 THR A HG22 12 
ATOM 10705 H HG23 . THR A 1 59 ? 14.083  -3.032  4.263   1.00 0.00 ? 59 THR A HG23 12 
ATOM 10706 N N    . ALA A 1 60 ? 9.472   -5.229  7.032   1.00 0.00 ? 60 ALA A N    12 
ATOM 10707 C CA   . ALA A 1 60 ? 8.875   -6.230  7.897   1.00 0.00 ? 60 ALA A CA   12 
ATOM 10708 C C    . ALA A 1 60 ? 7.488   -6.554  7.307   1.00 0.00 ? 60 ALA A C    12 
ATOM 10709 O O    . ALA A 1 60 ? 7.349   -6.519  6.089   1.00 0.00 ? 60 ALA A O    12 
ATOM 10710 C CB   . ALA A 1 60 ? 8.788   -5.685  9.331   1.00 0.00 ? 60 ALA A CB   12 
ATOM 10711 O OXT  . ALA A 1 60 ? 6.542   -6.820  8.043   1.00 0.00 ? 60 ALA A OXT  12 
ATOM 10712 H H    . ALA A 1 60 ? 8.832   -4.721  6.449   1.00 0.00 ? 60 ALA A H    12 
ATOM 10713 H HA   . ALA A 1 60 ? 9.497   -7.125  7.848   1.00 0.00 ? 60 ALA A HA   12 
ATOM 10714 H HB1  . ALA A 1 60 ? 8.185   -4.778  9.369   1.00 0.00 ? 60 ALA A HB1  12 
ATOM 10715 H HB2  . ALA A 1 60 ? 9.778   -5.449  9.721   1.00 0.00 ? 60 ALA A HB2  12 
ATOM 10716 H HB3  . ALA A 1 60 ? 8.334   -6.417  10.000  1.00 0.00 ? 60 ALA A HB3  12 
ATOM 10717 N N    . THR A 1 1  ? 2.354   7.764   10.139  1.00 0.00 ? 1  THR A N    13 
ATOM 10718 C CA   . THR A 1 1  ? 2.340   7.019   8.881   1.00 0.00 ? 1  THR A CA   13 
ATOM 10719 C C    . THR A 1 1  ? 3.006   7.863   7.776   1.00 0.00 ? 1  THR A C    13 
ATOM 10720 O O    . THR A 1 1  ? 2.334   8.480   6.956   1.00 0.00 ? 1  THR A O    13 
ATOM 10721 C CB   . THR A 1 1  ? 0.901   6.595   8.476   1.00 0.00 ? 1  THR A CB   13 
ATOM 10722 O OG1  . THR A 1 1  ? 0.809   6.211   7.108   1.00 0.00 ? 1  THR A OG1  13 
ATOM 10723 C CG2  . THR A 1 1  ? -0.121  7.718   8.717   1.00 0.00 ? 1  THR A CG2  13 
ATOM 10724 H H1   . THR A 1 1  ? 1.789   8.629   10.012  1.00 0.00 ? 1  THR A H1   13 
ATOM 10725 H H2   . THR A 1 1  ? 3.327   8.035   10.389  1.00 0.00 ? 1  THR A H2   13 
ATOM 10726 H H3   . THR A 1 1  ? 1.943   7.194   10.906  1.00 0.00 ? 1  THR A H3   13 
ATOM 10727 H HA   . THR A 1 1  ? 2.948   6.125   9.027   1.00 0.00 ? 1  THR A HA   13 
ATOM 10728 H HB   . THR A 1 1  ? 0.574   5.758   9.105   1.00 0.00 ? 1  THR A HB   13 
ATOM 10729 H HG1  . THR A 1 1  ? 1.380   5.460   6.929   1.00 0.00 ? 1  THR A HG1  13 
ATOM 10730 H HG21 . THR A 1 1  ? -1.118  7.408   8.405   1.00 0.00 ? 1  THR A HG21 13 
ATOM 10731 H HG22 . THR A 1 1  ? 0.131   8.629   8.176   1.00 0.00 ? 1  THR A HG22 13 
ATOM 10732 H HG23 . THR A 1 1  ? -0.202  7.969   9.774   1.00 0.00 ? 1  THR A HG23 13 
ATOM 10733 N N    . ALA A 1 2  ? 4.351   7.844   7.820   1.00 0.00 ? 2  ALA A N    13 
ATOM 10734 C CA   . ALA A 1 2  ? 5.161   8.569   6.849   1.00 0.00 ? 2  ALA A CA   13 
ATOM 10735 C C    . ALA A 1 2  ? 6.395   7.707   6.548   1.00 0.00 ? 2  ALA A C    13 
ATOM 10736 O O    . ALA A 1 2  ? 7.414   7.788   7.218   1.00 0.00 ? 2  ALA A O    13 
ATOM 10737 C CB   . ALA A 1 2  ? 5.568   9.929   7.430   1.00 0.00 ? 2  ALA A CB   13 
ATOM 10738 H H    . ALA A 1 2  ? 4.869   7.316   8.494   1.00 0.00 ? 2  ALA A H    13 
ATOM 10739 H HA   . ALA A 1 2  ? 4.582   8.704   5.933   1.00 0.00 ? 2  ALA A HA   13 
ATOM 10740 H HB1  . ALA A 1 2  ? 4.692   10.539  7.650   1.00 0.00 ? 2  ALA A HB1  13 
ATOM 10741 H HB2  . ALA A 1 2  ? 6.188   10.486  6.726   1.00 0.00 ? 2  ALA A HB2  13 
ATOM 10742 H HB3  . ALA A 1 2  ? 6.138   9.816   8.354   1.00 0.00 ? 2  ALA A HB3  13 
ATOM 10743 N N    . LEU A 1 3  ? 6.209   6.861   5.522   1.00 0.00 ? 3  LEU A N    13 
ATOM 10744 C CA   . LEU A 1 3  ? 7.235   5.934   5.076   1.00 0.00 ? 3  LEU A CA   13 
ATOM 10745 C C    . LEU A 1 3  ? 7.603   6.306   3.633   1.00 0.00 ? 3  LEU A C    13 
ATOM 10746 O O    . LEU A 1 3  ? 6.729   6.532   2.806   1.00 0.00 ? 3  LEU A O    13 
ATOM 10747 C CB   . LEU A 1 3  ? 6.712   4.490   4.999   1.00 0.00 ? 3  LEU A CB   13 
ATOM 10748 C CG   . LEU A 1 3  ? 6.262   3.770   6.286   1.00 0.00 ? 3  LEU A CG   13 
ATOM 10749 C CD1  . LEU A 1 3  ? 7.414   3.467   7.243   1.00 0.00 ? 3  LEU A CD1  13 
ATOM 10750 C CD2  . LEU A 1 3  ? 5.088   4.440   6.992   1.00 0.00 ? 3  LEU A CD2  13 
ATOM 10751 H H    . LEU A 1 3  ? 5.348   6.866   5.026   1.00 0.00 ? 3  LEU A H    13 
ATOM 10752 H HA   . LEU A 1 3  ? 8.109   6.008   5.726   1.00 0.00 ? 3  LEU A HA   13 
ATOM 10753 H HB2  . LEU A 1 3  ? 5.833   4.459   4.300   1.00 0.00 ? 3  LEU A HB2  13 
ATOM 10754 H HB3  . LEU A 1 3  ? 7.620   3.940   4.661   1.00 0.00 ? 3  LEU A HB3  13 
ATOM 10755 H HG   . LEU A 1 3  ? 5.887   2.795   5.971   1.00 0.00 ? 3  LEU A HG   13 
ATOM 10756 H HD11 . LEU A 1 3  ? 8.175   2.860   6.750   1.00 0.00 ? 3  LEU A HD11 13 
ATOM 10757 H HD12 . LEU A 1 3  ? 7.057   2.897   8.102   1.00 0.00 ? 3  LEU A HD12 13 
ATOM 10758 H HD13 . LEU A 1 3  ? 7.879   4.379   7.610   1.00 0.00 ? 3  LEU A HD13 13 
ATOM 10759 H HD21 . LEU A 1 3  ? 5.399   5.363   7.467   1.00 0.00 ? 3  LEU A HD21 13 
ATOM 10760 H HD22 . LEU A 1 3  ? 4.703   3.792   7.775   1.00 0.00 ? 3  LEU A HD22 13 
ATOM 10761 H HD23 . LEU A 1 3  ? 4.281   4.644   6.289   1.00 0.00 ? 3  LEU A HD23 13 
ATOM 10762 N N    . PHE A 1 4  ? 8.923   6.326   3.385   1.00 0.00 ? 4  PHE A N    13 
ATOM 10763 C CA   . PHE A 1 4  ? 9.457   6.616   2.051   1.00 0.00 ? 4  PHE A CA   13 
ATOM 10764 C C    . PHE A 1 4  ? 9.054   5.479   1.083   1.00 0.00 ? 4  PHE A C    13 
ATOM 10765 O O    . PHE A 1 4  ? 8.821   4.358   1.519   1.00 0.00 ? 4  PHE A O    13 
ATOM 10766 C CB   . PHE A 1 4  ? 10.997  6.705   2.164   1.00 0.00 ? 4  PHE A CB   13 
ATOM 10767 C CG   . PHE A 1 4  ? 11.423  7.658   3.250   1.00 0.00 ? 4  PHE A CG   13 
ATOM 10768 C CD1  . PHE A 1 4  ? 11.258  9.030   3.083   1.00 0.00 ? 4  PHE A CD1  13 
ATOM 10769 C CD2  . PHE A 1 4  ? 11.980  7.184   4.435   1.00 0.00 ? 4  PHE A CD2  13 
ATOM 10770 C CE1  . PHE A 1 4  ? 11.639  9.914   4.085   1.00 0.00 ? 4  PHE A CE1  13 
ATOM 10771 C CE2  . PHE A 1 4  ? 12.360  8.065   5.438   1.00 0.00 ? 4  PHE A CE2  13 
ATOM 10772 C CZ   . PHE A 1 4  ? 12.190  9.431   5.264   1.00 0.00 ? 4  PHE A CZ   13 
ATOM 10773 H H    . PHE A 1 4  ? 9.528   6.119   4.151   1.00 0.00 ? 4  PHE A H    13 
ATOM 10774 H HA   . PHE A 1 4  ? 9.005   7.560   1.736   1.00 0.00 ? 4  PHE A HA   13 
ATOM 10775 H HB2  . PHE A 1 4  ? 11.390  5.706   2.396   1.00 0.00 ? 4  PHE A HB2  13 
ATOM 10776 H HB3  . PHE A 1 4  ? 11.475  7.029   1.229   1.00 0.00 ? 4  PHE A HB3  13 
ATOM 10777 H HD1  . PHE A 1 4  ? 10.830  9.415   2.169   1.00 0.00 ? 4  PHE A HD1  13 
ATOM 10778 H HD2  . PHE A 1 4  ? 12.122  6.123   4.583   1.00 0.00 ? 4  PHE A HD2  13 
ATOM 10779 H HE1  . PHE A 1 4  ? 11.507  10.977  3.947   1.00 0.00 ? 4  PHE A HE1  13 
ATOM 10780 H HE2  . PHE A 1 4  ? 12.790  7.687   6.355   1.00 0.00 ? 4  PHE A HE2  13 
ATOM 10781 H HZ   . PHE A 1 4  ? 12.485  10.117  6.045   1.00 0.00 ? 4  PHE A HZ   13 
ATOM 10782 N N    . THR A 1 5  ? 8.995   5.805   -0.228  1.00 0.00 ? 5  THR A N    13 
ATOM 10783 C CA   . THR A 1 5  ? 8.631   4.797   -1.221  1.00 0.00 ? 5  THR A CA   13 
ATOM 10784 C C    . THR A 1 5  ? 9.900   4.357   -1.969  1.00 0.00 ? 5  THR A C    13 
ATOM 10785 O O    . THR A 1 5  ? 10.975  4.921   -1.821  1.00 0.00 ? 5  THR A O    13 
ATOM 10786 C CB   . THR A 1 5  ? 7.607   5.377   -2.227  1.00 0.00 ? 5  THR A CB   13 
ATOM 10787 O OG1  . THR A 1 5  ? 8.177   6.358   -3.076  1.00 0.00 ? 5  THR A OG1  13 
ATOM 10788 C CG2  . THR A 1 5  ? 6.447   6.100   -1.550  1.00 0.00 ? 5  THR A CG2  13 
ATOM 10789 H H    . THR A 1 5  ? 9.176   6.724   -0.575  1.00 0.00 ? 5  THR A H    13 
ATOM 10790 H HA   . THR A 1 5  ? 8.196   3.932   -0.715  1.00 0.00 ? 5  THR A HA   13 
ATOM 10791 H HB   . THR A 1 5  ? 7.167   4.564   -2.831  1.00 0.00 ? 5  THR A HB   13 
ATOM 10792 H HG1  . THR A 1 5  ? 8.960   6.025   -3.504  1.00 0.00 ? 5  THR A HG1  13 
ATOM 10793 H HG21 . THR A 1 5  ? 5.737   6.423   -2.312  1.00 0.00 ? 5  THR A HG21 13 
ATOM 10794 H HG22 . THR A 1 5  ? 6.774   6.998   -1.023  1.00 0.00 ? 5  THR A HG22 13 
ATOM 10795 H HG23 . THR A 1 5  ? 5.921   5.461   -0.842  1.00 0.00 ? 5  THR A HG23 13 
ATOM 10796 N N    . MET A 1 6  ? 9.667   3.325   -2.793  1.00 0.00 ? 6  MET A N    13 
ATOM 10797 C CA   . MET A 1 6  ? 10.653  2.680   -3.645  1.00 0.00 ? 6  MET A CA   13 
ATOM 10798 C C    . MET A 1 6  ? 9.870   1.594   -4.401  1.00 0.00 ? 6  MET A C    13 
ATOM 10799 O O    . MET A 1 6  ? 9.008   0.948   -3.815  1.00 0.00 ? 6  MET A O    13 
ATOM 10800 C CB   . MET A 1 6  ? 11.818  2.084   -2.823  1.00 0.00 ? 6  MET A CB   13 
ATOM 10801 C CG   . MET A 1 6  ? 11.381  1.280   -1.586  1.00 0.00 ? 6  MET A CG   13 
ATOM 10802 S SD   . MET A 1 6  ? 12.779  0.506   -0.755  1.00 0.00 ? 6  MET A SD   13 
ATOM 10803 C CE   . MET A 1 6  ? 11.886  -0.186  0.650   1.00 0.00 ? 6  MET A CE   13 
ATOM 10804 H H    . MET A 1 6  ? 8.746   2.951   -2.835  1.00 0.00 ? 6  MET A H    13 
ATOM 10805 H HA   . MET A 1 6  ? 11.006  3.434   -4.350  1.00 0.00 ? 6  MET A HA   13 
ATOM 10806 H HB2  . MET A 1 6  ? 12.437  1.456   -3.466  1.00 0.00 ? 6  MET A HB2  13 
ATOM 10807 H HB3  . MET A 1 6  ? 12.468  2.895   -2.492  1.00 0.00 ? 6  MET A HB3  13 
ATOM 10808 H HG2  . MET A 1 6  ? 10.884  1.926   -0.862  1.00 0.00 ? 6  MET A HG2  13 
ATOM 10809 H HG3  . MET A 1 6  ? 10.669  0.500   -1.850  1.00 0.00 ? 6  MET A HG3  13 
ATOM 10810 H HE1  . MET A 1 6  ? 11.094  -0.852  0.305   1.00 0.00 ? 6  MET A HE1  13 
ATOM 10811 H HE2  . MET A 1 6  ? 11.415  0.610   1.227   1.00 0.00 ? 6  MET A HE2  13 
ATOM 10812 H HE3  . MET A 1 6  ? 12.562  -0.746  1.297   1.00 0.00 ? 6  MET A HE3  13 
ATOM 10813 N N    . GLY A 1 7  ? 10.159  1.457   -5.713  1.00 0.00 ? 7  GLY A N    13 
ATOM 10814 C CA   . GLY A 1 7  ? 9.470   0.469   -6.557  1.00 0.00 ? 7  GLY A CA   13 
ATOM 10815 C C    . GLY A 1 7  ? 8.074   0.935   -7.031  1.00 0.00 ? 7  GLY A C    13 
ATOM 10816 O O    . GLY A 1 7  ? 7.759   0.935   -8.212  1.00 0.00 ? 7  GLY A O    13 
ATOM 10817 H H    . GLY A 1 7  ? 10.869  2.031   -6.120  1.00 0.00 ? 7  GLY A H    13 
ATOM 10818 H HA2  . GLY A 1 7  ? 10.106  0.309   -7.432  1.00 0.00 ? 7  GLY A HA2  13 
ATOM 10819 H HA3  . GLY A 1 7  ? 9.385   -0.464  -5.993  1.00 0.00 ? 7  GLY A HA3  13 
ATOM 10820 N N    . GLY A 1 8  ? 7.296   1.322   -6.004  1.00 0.00 ? 8  GLY A N    13 
ATOM 10821 C CA   . GLY A 1 8  ? 5.924   1.824   -6.012  1.00 0.00 ? 8  GLY A CA   13 
ATOM 10822 C C    . GLY A 1 8  ? 5.539   2.743   -7.179  1.00 0.00 ? 8  GLY A C    13 
ATOM 10823 O O    . GLY A 1 8  ? 6.373   3.260   -7.909  1.00 0.00 ? 8  GLY A O    13 
ATOM 10824 H H    . GLY A 1 8  ? 7.730   1.138   -5.127  1.00 0.00 ? 8  GLY A H    13 
ATOM 10825 H HA2  . GLY A 1 8  ? 5.271   0.953   -5.953  1.00 0.00 ? 8  GLY A HA2  13 
ATOM 10826 H HA3  . GLY A 1 8  ? 5.834   2.417   -5.106  1.00 0.00 ? 8  GLY A HA3  13 
ATOM 10827 N N    . ASN A 1 9  ? 4.202   2.913   -7.293  1.00 0.00 ? 9  ASN A N    13 
ATOM 10828 C CA   . ASN A 1 9  ? 3.646   3.724   -8.386  1.00 0.00 ? 9  ASN A CA   13 
ATOM 10829 C C    . ASN A 1 9  ? 2.948   4.988   -7.860  1.00 0.00 ? 9  ASN A C    13 
ATOM 10830 O O    . ASN A 1 9  ? 2.467   5.808   -8.631  1.00 0.00 ? 9  ASN A O    13 
ATOM 10831 C CB   . ASN A 1 9  ? 2.686   2.883   -9.267  1.00 0.00 ? 9  ASN A CB   13 
ATOM 10832 C CG   . ASN A 1 9  ? 1.338   2.544   -8.597  1.00 0.00 ? 9  ASN A CG   13 
ATOM 10833 O OD1  . ASN A 1 9  ? 1.026   3.021   -7.519  1.00 0.00 ? 9  ASN A OD1  13 
ATOM 10834 N ND2  . ASN A 1 9  ? 0.530   1.733   -9.294  1.00 0.00 ? 9  ASN A ND2  13 
ATOM 10835 H H    . ASN A 1 9  ? 3.596   2.500   -6.598  1.00 0.00 ? 9  ASN A H    13 
ATOM 10836 H HA   . ASN A 1 9  ? 4.478   4.063   -9.009  1.00 0.00 ? 9  ASN A HA   13 
ATOM 10837 H HB2  . ASN A 1 9  ? 2.457   3.447   -10.172 1.00 0.00 ? 9  ASN A HB2  13 
ATOM 10838 H HB3  . ASN A 1 9  ? 3.178   1.968   -9.596  1.00 0.00 ? 9  ASN A HB3  13 
ATOM 10839 H HD21 . ASN A 1 9  ? 0.791   1.336   -10.178 1.00 0.00 ? 9  ASN A HD21 13 
ATOM 10840 H HD22 . ASN A 1 9  ? -0.369  1.559   -8.871  1.00 0.00 ? 9  ASN A HD22 13 
ATOM 10841 N N    . ALA A 1 10 ? 2.916   5.123   -6.521  1.00 0.00 ? 10 ALA A N    13 
ATOM 10842 C CA   . ALA A 1 10 ? 2.201   6.235   -5.904  1.00 0.00 ? 10 ALA A CA   13 
ATOM 10843 C C    . ALA A 1 10 ? 2.870   7.624   -6.022  1.00 0.00 ? 10 ALA A C    13 
ATOM 10844 O O    . ALA A 1 10 ? 2.647   8.481   -5.179  1.00 0.00 ? 10 ALA A O    13 
ATOM 10845 C CB   . ALA A 1 10 ? 1.955   5.892   -4.436  1.00 0.00 ? 10 ALA A CB   13 
ATOM 10846 H H    . ALA A 1 10 ? 3.294   4.403   -5.936  1.00 0.00 ? 10 ALA A H    13 
ATOM 10847 H HA   . ALA A 1 10 ? 1.241   6.289   -6.409  1.00 0.00 ? 10 ALA A HA   13 
ATOM 10848 H HB1  . ALA A 1 10 ? 2.883   5.896   -3.862  1.00 0.00 ? 10 ALA A HB1  13 
ATOM 10849 H HB2  . ALA A 1 10 ? 1.506   4.905   -4.340  1.00 0.00 ? 10 ALA A HB2  13 
ATOM 10850 H HB3  . ALA A 1 10 ? 1.268   6.605   -3.981  1.00 0.00 ? 10 ALA A HB3  13 
ATOM 10851 N N    . GLU A 1 11 ? 3.685   7.825   -7.077  1.00 0.00 ? 11 GLU A N    13 
ATOM 10852 C CA   . GLU A 1 11 ? 4.316   9.122   -7.343  1.00 0.00 ? 11 GLU A CA   13 
ATOM 10853 C C    . GLU A 1 11 ? 5.077   9.715   -6.130  1.00 0.00 ? 11 GLU A C    13 
ATOM 10854 O O    . GLU A 1 11 ? 5.131   10.921  -5.936  1.00 0.00 ? 11 GLU A O    13 
ATOM 10855 C CB   . GLU A 1 11 ? 3.247   10.091  -7.885  1.00 0.00 ? 11 GLU A CB   13 
ATOM 10856 C CG   . GLU A 1 11 ? 2.684   9.642   -9.254  1.00 0.00 ? 11 GLU A CG   13 
ATOM 10857 C CD   . GLU A 1 11 ? 1.200   9.978   -9.472  1.00 0.00 ? 11 GLU A CD   13 
ATOM 10858 O OE1  . GLU A 1 11 ? 0.558   10.575  -8.608  1.00 0.00 ? 11 GLU A OE1  13 
ATOM 10859 O OE2  . GLU A 1 11 ? 0.634   9.554   -10.480 1.00 0.00 ? 11 GLU A OE2  13 
ATOM 10860 H H    . GLU A 1 11 ? 3.785   7.096   -7.752  1.00 0.00 ? 11 GLU A H    13 
ATOM 10861 H HA   . GLU A 1 11 ? 5.055   8.931   -8.120  1.00 0.00 ? 11 GLU A HA   13 
ATOM 10862 H HB2  . GLU A 1 11 ? 2.459   10.177  -7.136  1.00 0.00 ? 11 GLU A HB2  13 
ATOM 10863 H HB3  . GLU A 1 11 ? 3.656   11.096  -7.992  1.00 0.00 ? 11 GLU A HB3  13 
ATOM 10864 H HG2  . GLU A 1 11 ? 3.265   10.086  -10.062 1.00 0.00 ? 11 GLU A HG2  13 
ATOM 10865 H HG3  . GLU A 1 11 ? 2.777   8.562   -9.375  1.00 0.00 ? 11 GLU A HG3  13 
ATOM 10866 N N    . GLY A 1 12 ? 5.680   8.798   -5.342  1.00 0.00 ? 12 GLY A N    13 
ATOM 10867 C CA   . GLY A 1 12 ? 6.486   9.228   -4.189  1.00 0.00 ? 12 GLY A CA   13 
ATOM 10868 C C    . GLY A 1 12 ? 5.644   9.452   -2.918  1.00 0.00 ? 12 GLY A C    13 
ATOM 10869 O O    . GLY A 1 12 ? 6.188   9.751   -1.862  1.00 0.00 ? 12 GLY A O    13 
ATOM 10870 H H    . GLY A 1 12 ? 5.559   7.837   -5.591  1.00 0.00 ? 12 GLY A H    13 
ATOM 10871 H HA2  . GLY A 1 12 ? 7.190   8.373   -3.960  1.00 0.00 ? 12 GLY A HA2  13 
ATOM 10872 H HA3  . GLY A 1 12 ? 6.928   10.234  -4.454  1.00 0.00 ? 12 GLY A HA3  13 
ATOM 10873 N N    . GLN A 1 13 ? 4.308   9.300   -3.043  1.00 0.00 ? 13 GLN A N    13 
ATOM 10874 C CA   . GLN A 1 13 ? 3.459   9.478   -1.867  1.00 0.00 ? 13 GLN A CA   13 
ATOM 10875 C C    . GLN A 1 13 ? 3.801   8.382   -0.829  1.00 0.00 ? 13 GLN A C    13 
ATOM 10876 O O    . GLN A 1 13 ? 3.844   7.207   -1.163  1.00 0.00 ? 13 GLN A O    13 
ATOM 10877 C CB   . GLN A 1 13 ? 1.964   9.382   -2.229  1.00 0.00 ? 13 GLN A CB   13 
ATOM 10878 C CG   . GLN A 1 13 ? 1.434   10.577  -3.046  1.00 0.00 ? 13 GLN A CG   13 
ATOM 10879 C CD   . GLN A 1 13 ? 1.380   11.839  -2.177  1.00 0.00 ? 13 GLN A CD   13 
ATOM 10880 O OE1  . GLN A 1 13 ? 2.317   12.619  -2.108  1.00 0.00 ? 13 GLN A OE1  13 
ATOM 10881 N NE2  . GLN A 1 13 ? 0.234   11.985  -1.502  1.00 0.00 ? 13 GLN A NE2  13 
ATOM 10882 H H    . GLN A 1 13 ? 3.899   9.036   -3.917  1.00 0.00 ? 13 GLN A H    13 
ATOM 10883 H HA   . GLN A 1 13 ? 3.688   10.461  -1.458  1.00 0.00 ? 13 GLN A HA   13 
ATOM 10884 H HB2  . GLN A 1 13 ? 1.776   8.452   -2.764  1.00 0.00 ? 13 GLN A HB2  13 
ATOM 10885 H HB3  . GLN A 1 13 ? 1.372   9.340   -1.312  1.00 0.00 ? 13 GLN A HB3  13 
ATOM 10886 H HG2  . GLN A 1 13 ? 2.040   10.793  -3.925  1.00 0.00 ? 13 GLN A HG2  13 
ATOM 10887 H HG3  . GLN A 1 13 ? 0.431   10.360  -3.414  1.00 0.00 ? 13 GLN A HG3  13 
ATOM 10888 H HE21 . GLN A 1 13 ? -0.512  11.325  -1.579  1.00 0.00 ? 13 GLN A HE21 13 
ATOM 10889 H HE22 . GLN A 1 13 ? 0.145   12.782  -0.908  1.00 0.00 ? 13 GLN A HE22 13 
ATOM 10890 N N    . PRO A 1 14 ? 4.050   8.792   0.442   1.00 0.00 ? 14 PRO A N    13 
ATOM 10891 C CA   . PRO A 1 14 ? 4.460   7.849   1.476   1.00 0.00 ? 14 PRO A CA   13 
ATOM 10892 C C    . PRO A 1 14 ? 3.318   6.890   1.849   1.00 0.00 ? 14 PRO A C    13 
ATOM 10893 O O    . PRO A 1 14 ? 2.160   7.294   1.861   1.00 0.00 ? 14 PRO A O    13 
ATOM 10894 C CB   . PRO A 1 14 ? 4.838   8.749   2.663   1.00 0.00 ? 14 PRO A CB   13 
ATOM 10895 C CG   . PRO A 1 14 ? 4.054   10.048  2.450   1.00 0.00 ? 14 PRO A CG   13 
ATOM 10896 C CD   . PRO A 1 14 ? 3.938   10.166  0.930   1.00 0.00 ? 14 PRO A CD   13 
ATOM 10897 H HA   . PRO A 1 14 ? 5.311   7.270   1.117   1.00 0.00 ? 14 PRO A HA   13 
ATOM 10898 H HB2  . PRO A 1 14 ? 4.628   8.292   3.634   1.00 0.00 ? 14 PRO A HB2  13 
ATOM 10899 H HB3  . PRO A 1 14 ? 5.909   8.972   2.603   1.00 0.00 ? 14 PRO A HB3  13 
ATOM 10900 H HG2  . PRO A 1 14 ? 3.018   9.878   2.850   1.00 0.00 ? 14 PRO A HG2  13 
ATOM 10901 H HG3  . PRO A 1 14 ? 4.628   10.923  2.854   1.00 0.00 ? 14 PRO A HG3  13 
ATOM 10902 H HD2  . PRO A 1 14 ? 2.990   10.622  0.640   1.00 0.00 ? 14 PRO A HD2  13 
ATOM 10903 H HD3  . PRO A 1 14 ? 4.758   10.761  0.522   1.00 0.00 ? 14 PRO A HD3  13 
ATOM 10904 N N    . CYS A 1 15 ? 3.693   5.619   2.159   1.00 0.00 ? 15 CYS A N    13 
ATOM 10905 C CA   . CYS A 1 15 ? 2.685   4.608   2.532   1.00 0.00 ? 15 CYS A CA   13 
ATOM 10906 C C    . CYS A 1 15 ? 1.645   5.185   3.501   1.00 0.00 ? 15 CYS A C    13 
ATOM 10907 O O    . CYS A 1 15 ? 1.930   6.032   4.350   1.00 0.00 ? 15 CYS A O    13 
ATOM 10908 C CB   . CYS A 1 15 ? 3.297   3.429   3.306   1.00 0.00 ? 15 CYS A CB   13 
ATOM 10909 S SG   . CYS A 1 15 ? 4.246   2.244   2.328   1.00 0.00 ? 15 CYS A SG   13 
ATOM 10910 H H    . CYS A 1 15 ? 4.669   5.388   2.109   1.00 0.00 ? 15 CYS A H    13 
ATOM 10911 H HA   . CYS A 1 15 ? 2.165   4.274   1.631   1.00 0.00 ? 15 CYS A HA   13 
ATOM 10912 H HB2  . CYS A 1 15 ? 3.907   3.790   4.128   1.00 0.00 ? 15 CYS A HB2  13 
ATOM 10913 H HB3  . CYS A 1 15 ? 2.514   2.851   3.790   1.00 0.00 ? 15 CYS A HB3  13 
ATOM 10914 N N    . LYS A 1 16 ? 0.413   4.679   3.314   1.00 0.00 ? 16 LYS A N    13 
ATOM 10915 C CA   . LYS A 1 16 ? -0.687  5.149   4.130   1.00 0.00 ? 16 LYS A CA   13 
ATOM 10916 C C    . LYS A 1 16 ? -1.217  3.997   4.963   1.00 0.00 ? 16 LYS A C    13 
ATOM 10917 O O    . LYS A 1 16 ? -1.610  2.955   4.464   1.00 0.00 ? 16 LYS A O    13 
ATOM 10918 C CB   . LYS A 1 16 ? -1.739  5.800   3.220   1.00 0.00 ? 16 LYS A CB   13 
ATOM 10919 C CG   . LYS A 1 16 ? -2.662  6.847   3.908   1.00 0.00 ? 16 LYS A CG   13 
ATOM 10920 C CD   . LYS A 1 16 ? -1.895  8.111   4.363   1.00 0.00 ? 16 LYS A CD   13 
ATOM 10921 C CE   . LYS A 1 16 ? -0.958  8.018   5.578   1.00 0.00 ? 16 LYS A CE   13 
ATOM 10922 N NZ   . LYS A 1 16 ? 0.490   7.981   5.308   1.00 0.00 ? 16 LYS A NZ   13 
ATOM 10923 H H    . LYS A 1 16 ? 0.223   3.979   2.619   1.00 0.00 ? 16 LYS A H    13 
ATOM 10924 H HA   . LYS A 1 16 ? -0.243  5.849   4.814   1.00 0.00 ? 16 LYS A HA   13 
ATOM 10925 H HB2  . LYS A 1 16 ? -1.205  6.345   2.441   1.00 0.00 ? 16 LYS A HB2  13 
ATOM 10926 H HB3  . LYS A 1 16 ? -2.253  4.988   2.687   1.00 0.00 ? 16 LYS A HB3  13 
ATOM 10927 H HG2  . LYS A 1 16 ? -3.399  7.238   3.195   1.00 0.00 ? 16 LYS A HG2  13 
ATOM 10928 H HG3  . LYS A 1 16 ? -3.298  6.426   4.697   1.00 0.00 ? 16 LYS A HG3  13 
ATOM 10929 H HD2  . LYS A 1 16 ? -1.386  8.569   3.510   1.00 0.00 ? 16 LYS A HD2  13 
ATOM 10930 H HD3  . LYS A 1 16 ? -2.672  8.795   4.681   1.00 0.00 ? 16 LYS A HD3  13 
ATOM 10931 H HE2  . LYS A 1 16 ? -1.119  8.886   6.219   1.00 0.00 ? 16 LYS A HE2  13 
ATOM 10932 H HE3  . LYS A 1 16 ? -1.231  7.157   6.187   1.00 0.00 ? 16 LYS A HE3  13 
ATOM 10933 H HZ1  . LYS A 1 16 ? 0.985   7.715   6.196   1.00 0.00 ? 16 LYS A HZ1  13 
ATOM 10934 H HZ2  . LYS A 1 16 ? 0.870   8.900   5.012   1.00 0.00 ? 16 LYS A HZ2  13 
ATOM 10935 H HZ3  . LYS A 1 16 ? 0.792   7.253   4.620   1.00 0.00 ? 16 LYS A HZ3  13 
ATOM 10936 N N    . PHE A 1 17 ? -1.144  4.261   6.276   1.00 0.00 ? 17 PHE A N    13 
ATOM 10937 C CA   . PHE A 1 17 ? -1.584  3.303   7.273   1.00 0.00 ? 17 PHE A CA   13 
ATOM 10938 C C    . PHE A 1 17 ? -2.541  4.095   8.178   1.00 0.00 ? 17 PHE A C    13 
ATOM 10939 O O    . PHE A 1 17 ? -2.147  5.150   8.666   1.00 0.00 ? 17 PHE A O    13 
ATOM 10940 C CB   . PHE A 1 17 ? -0.391  2.789   8.118   1.00 0.00 ? 17 PHE A CB   13 
ATOM 10941 C CG   . PHE A 1 17 ? 0.686   2.058   7.350   1.00 0.00 ? 17 PHE A CG   13 
ATOM 10942 C CD1  . PHE A 1 17 ? 0.390   1.151   6.338   1.00 0.00 ? 17 PHE A CD1  13 
ATOM 10943 C CD2  . PHE A 1 17 ? 2.022   2.261   7.675   1.00 0.00 ? 17 PHE A CD2  13 
ATOM 10944 C CE1  . PHE A 1 17 ? 1.401   0.469   5.674   1.00 0.00 ? 17 PHE A CE1  13 
ATOM 10945 C CE2  . PHE A 1 17 ? 3.033   1.578   7.017   1.00 0.00 ? 17 PHE A CE2  13 
ATOM 10946 C CZ   . PHE A 1 17 ? 2.730   0.676   6.015   1.00 0.00 ? 17 PHE A CZ   13 
ATOM 10947 H H    . PHE A 1 17 ? -0.853  5.178   6.570   1.00 0.00 ? 17 PHE A H    13 
ATOM 10948 H HA   . PHE A 1 17 ? -2.097  2.495   6.755   1.00 0.00 ? 17 PHE A HA   13 
ATOM 10949 H HB2  . PHE A 1 17 ? 0.071   3.643   8.625   1.00 0.00 ? 17 PHE A HB2  13 
ATOM 10950 H HB3  . PHE A 1 17 ? -0.739  2.094   8.894   1.00 0.00 ? 17 PHE A HB3  13 
ATOM 10951 H HD1  . PHE A 1 17 ? -0.632  0.958   6.064   1.00 0.00 ? 17 PHE A HD1  13 
ATOM 10952 H HD2  . PHE A 1 17 ? 2.291   2.942   8.462   1.00 0.00 ? 17 PHE A HD2  13 
ATOM 10953 H HE1  . PHE A 1 17 ? 1.144   -0.222  4.893   1.00 0.00 ? 17 PHE A HE1  13 
ATOM 10954 H HE2  . PHE A 1 17 ? 4.059   1.746   7.293   1.00 0.00 ? 17 PHE A HE2  13 
ATOM 10955 H HZ   . PHE A 1 17 ? 3.535   0.142   5.526   1.00 0.00 ? 17 PHE A HZ   13 
ATOM 10956 N N    . PRO A 1 18 ? -3.790  3.600   8.382   1.00 0.00 ? 18 PRO A N    13 
ATOM 10957 C CA   . PRO A 1 18 ? -4.371  2.412   7.754   1.00 0.00 ? 18 PRO A CA   13 
ATOM 10958 C C    . PRO A 1 18 ? -4.926  2.708   6.341   1.00 0.00 ? 18 PRO A C    13 
ATOM 10959 O O    . PRO A 1 18 ? -5.528  3.751   6.117   1.00 0.00 ? 18 PRO A O    13 
ATOM 10960 C CB   . PRO A 1 18 ? -5.528  2.048   8.692   1.00 0.00 ? 18 PRO A CB   13 
ATOM 10961 C CG   . PRO A 1 18 ? -5.969  3.386   9.293   1.00 0.00 ? 18 PRO A CG   13 
ATOM 10962 C CD   . PRO A 1 18 ? -4.687  4.223   9.354   1.00 0.00 ? 18 PRO A CD   13 
ATOM 10963 H HA   . PRO A 1 18 ? -3.644  1.606   7.728   1.00 0.00 ? 18 PRO A HA   13 
ATOM 10964 H HB2  . PRO A 1 18 ? -6.341  1.508   8.204   1.00 0.00 ? 18 PRO A HB2  13 
ATOM 10965 H HB3  . PRO A 1 18 ? -5.146  1.408   9.488   1.00 0.00 ? 18 PRO A HB3  13 
ATOM 10966 H HG2  . PRO A 1 18 ? -6.684  3.866   8.623   1.00 0.00 ? 18 PRO A HG2  13 
ATOM 10967 H HG3  . PRO A 1 18 ? -6.445  3.274   10.267  1.00 0.00 ? 18 PRO A HG3  13 
ATOM 10968 H HD2  . PRO A 1 18 ? -4.871  5.271   9.101   1.00 0.00 ? 18 PRO A HD2  13 
ATOM 10969 H HD3  . PRO A 1 18 ? -4.233  4.159   10.347  1.00 0.00 ? 18 PRO A HD3  13 
ATOM 10970 N N    . PHE A 1 19 ? -4.711  1.746   5.417   1.00 0.00 ? 19 PHE A N    13 
ATOM 10971 C CA   . PHE A 1 19 ? -5.276  1.848   4.068   1.00 0.00 ? 19 PHE A CA   13 
ATOM 10972 C C    . PHE A 1 19 ? -6.347  0.754   3.960   1.00 0.00 ? 19 PHE A C    13 
ATOM 10973 O O    . PHE A 1 19 ? -6.206  -0.334  4.507   1.00 0.00 ? 19 PHE A O    13 
ATOM 10974 C CB   . PHE A 1 19 ? -4.251  1.725   2.917   1.00 0.00 ? 19 PHE A CB   13 
ATOM 10975 C CG   . PHE A 1 19 ? -3.539  0.346   2.851   1.00 0.00 ? 19 PHE A CG   13 
ATOM 10976 C CD1  . PHE A 1 19 ? -2.494  0.028   3.750   1.00 0.00 ? 19 PHE A CD1  13 
ATOM 10977 C CD2  . PHE A 1 19 ? -3.875  -0.645  1.896   1.00 0.00 ? 19 PHE A CD2  13 
ATOM 10978 C CE1  . PHE A 1 19 ? -1.761  -1.177  3.623   1.00 0.00 ? 19 PHE A CE1  13 
ATOM 10979 C CE2  . PHE A 1 19 ? -3.162  -1.831  1.798   1.00 0.00 ? 19 PHE A CE2  13 
ATOM 10980 C CZ   . PHE A 1 19 ? -2.096  -2.087  2.638   1.00 0.00 ? 19 PHE A CZ   13 
ATOM 10981 H H    . PHE A 1 19 ? -4.237  0.905   5.691   1.00 0.00 ? 19 PHE A H    13 
ATOM 10982 H HA   . PHE A 1 19 ? -5.771  2.817   3.973   1.00 0.00 ? 19 PHE A HA   13 
ATOM 10983 H HB2  . PHE A 1 19 ? -4.842  1.980   2.015   1.00 0.00 ? 19 PHE A HB2  13 
ATOM 10984 H HB3  . PHE A 1 19 ? -3.536  2.575   2.963   1.00 0.00 ? 19 PHE A HB3  13 
ATOM 10985 H HD1  . PHE A 1 19 ? -2.295  0.724   4.574   1.00 0.00 ? 19 PHE A HD1  13 
ATOM 10986 H HD2  . PHE A 1 19 ? -4.681  -0.641  1.170   1.00 0.00 ? 19 PHE A HD2  13 
ATOM 10987 H HE1  . PHE A 1 19 ? -0.915  -1.538  4.224   1.00 0.00 ? 19 PHE A HE1  13 
ATOM 10988 H HE2  . PHE A 1 19 ? -3.451  -2.561  1.053   1.00 0.00 ? 19 PHE A HE2  13 
ATOM 10989 H HZ   . PHE A 1 19 ? -1.519  -2.998  2.542   1.00 0.00 ? 19 PHE A HZ   13 
ATOM 10990 N N    . ARG A 1 20 ? -7.435  1.113   3.259   1.00 0.00 ? 20 ARG A N    13 
ATOM 10991 C CA   . ARG A 1 20 ? -8.578  0.220   3.106   1.00 0.00 ? 20 ARG A CA   13 
ATOM 10992 C C    . ARG A 1 20 ? -8.541  -0.394  1.694   1.00 0.00 ? 20 ARG A C    13 
ATOM 10993 O O    . ARG A 1 20 ? -8.505  0.322   0.700   1.00 0.00 ? 20 ARG A O    13 
ATOM 10994 C CB   . ARG A 1 20 ? -9.848  1.063   3.325   1.00 0.00 ? 20 ARG A CB   13 
ATOM 10995 C CG   . ARG A 1 20 ? -11.078 0.292   3.819   1.00 0.00 ? 20 ARG A CG   13 
ATOM 10996 C CD   . ARG A 1 20 ? -11.674 -0.753  2.826   1.00 0.00 ? 20 ARG A CD   13 
ATOM 10997 N NE   . ARG A 1 20 ? -11.600 -0.388  1.385   1.00 0.00 ? 20 ARG A NE   13 
ATOM 10998 C CZ   . ARG A 1 20 ? -12.116 0.744   0.865   1.00 0.00 ? 20 ARG A CZ   13 
ATOM 10999 N NH1  . ARG A 1 20 ? -12.681 1.680   1.613   1.00 0.00 ? 20 ARG A NH1  13 
ATOM 11000 N NH2  . ARG A 1 20 ? -12.033 0.931   -0.438  1.00 0.00 ? 20 ARG A NH2  13 
ATOM 11001 H H    . ARG A 1 20 ? -7.480  2.028   2.851   1.00 0.00 ? 20 ARG A H    13 
ATOM 11002 H HA   . ARG A 1 20 ? -8.496  -0.554  3.871   1.00 0.00 ? 20 ARG A HA   13 
ATOM 11003 H HB2  . ARG A 1 20 ? -9.631  1.801   4.099   1.00 0.00 ? 20 ARG A HB2  13 
ATOM 11004 H HB3  . ARG A 1 20 ? -10.079 1.653   2.438   1.00 0.00 ? 20 ARG A HB3  13 
ATOM 11005 H HG2  . ARG A 1 20 ? -10.805 -0.191  4.764   1.00 0.00 ? 20 ARG A HG2  13 
ATOM 11006 H HG3  . ARG A 1 20 ? -11.825 1.036   4.127   1.00 0.00 ? 20 ARG A HG3  13 
ATOM 11007 H HD2  . ARG A 1 20 ? -11.147 -1.709  2.937   1.00 0.00 ? 20 ARG A HD2  13 
ATOM 11008 H HD3  . ARG A 1 20 ? -12.727 -0.952  3.080   1.00 0.00 ? 20 ARG A HD3  13 
ATOM 11009 H HE   . ARG A 1 20 ? -11.143 -0.902  0.628   1.00 0.00 ? 20 ARG A HE   13 
ATOM 11010 H HH11 . ARG A 1 20 ? -12.803 1.558   2.595   1.00 0.00 ? 20 ARG A HH11 13 
ATOM 11011 H HH12 . ARG A 1 20 ? -12.970 2.537   1.158   1.00 0.00 ? 20 ARG A HH12 13 
ATOM 11012 H HH21 . ARG A 1 20 ? -11.696 0.196   -1.038  1.00 0.00 ? 20 ARG A HH21 13 
ATOM 11013 H HH22 . ARG A 1 20 ? -12.279 1.822   -0.858  1.00 0.00 ? 20 ARG A HH22 13 
ATOM 11014 N N    . PHE A 1 21 ? -8.547  -1.738  1.665   1.00 0.00 ? 21 PHE A N    13 
ATOM 11015 C CA   . PHE A 1 21 ? -8.484  -2.504  0.422   1.00 0.00 ? 21 PHE A CA   13 
ATOM 11016 C C    . PHE A 1 21 ? -9.424  -3.716  0.584   1.00 0.00 ? 21 PHE A C    13 
ATOM 11017 O O    . PHE A 1 21 ? -9.513  -4.306  1.648   1.00 0.00 ? 21 PHE A O    13 
ATOM 11018 C CB   . PHE A 1 21 ? -7.018  -2.910  0.220   1.00 0.00 ? 21 PHE A CB   13 
ATOM 11019 C CG   . PHE A 1 21 ? -6.818  -4.006  -0.787  1.00 0.00 ? 21 PHE A CG   13 
ATOM 11020 C CD1  . PHE A 1 21 ? -7.220  -3.842  -2.100  1.00 0.00 ? 21 PHE A CD1  13 
ATOM 11021 C CD2  . PHE A 1 21 ? -6.203  -5.191  -0.419  1.00 0.00 ? 21 PHE A CD2  13 
ATOM 11022 C CE1  . PHE A 1 21 ? -6.933  -4.800  -3.064  1.00 0.00 ? 21 PHE A CE1  13 
ATOM 11023 C CE2  . PHE A 1 21 ? -5.924  -6.165  -1.367  1.00 0.00 ? 21 PHE A CE2  13 
ATOM 11024 C CZ   . PHE A 1 21 ? -6.270  -5.964  -2.698  1.00 0.00 ? 21 PHE A CZ   13 
ATOM 11025 H H    . PHE A 1 21 ? -8.587  -2.262  2.526   1.00 0.00 ? 21 PHE A H    13 
ATOM 11026 H HA   . PHE A 1 21 ? -8.821  -1.910  -0.435  1.00 0.00 ? 21 PHE A HA   13 
ATOM 11027 H HB2  . PHE A 1 21 ? -6.432  -2.040  -0.092  1.00 0.00 ? 21 PHE A HB2  13 
ATOM 11028 H HB3  . PHE A 1 21 ? -6.602  -3.270  1.159   1.00 0.00 ? 21 PHE A HB3  13 
ATOM 11029 H HD1  . PHE A 1 21 ? -7.795  -2.965  -2.330  1.00 0.00 ? 21 PHE A HD1  13 
ATOM 11030 H HD2  . PHE A 1 21 ? -5.970  -5.351  0.621   1.00 0.00 ? 21 PHE A HD2  13 
ATOM 11031 H HE1  . PHE A 1 21 ? -7.240  -4.643  -4.088  1.00 0.00 ? 21 PHE A HE1  13 
ATOM 11032 H HE2  . PHE A 1 21 ? -5.451  -7.082  -1.059  1.00 0.00 ? 21 PHE A HE2  13 
ATOM 11033 H HZ   . PHE A 1 21 ? -6.038  -6.719  -3.435  1.00 0.00 ? 21 PHE A HZ   13 
ATOM 11034 N N    . GLN A 1 22 ? -10.148 -4.045  -0.494  1.00 0.00 ? 22 GLN A N    13 
ATOM 11035 C CA   . GLN A 1 22 ? -11.110 -5.151  -0.505  1.00 0.00 ? 22 GLN A CA   13 
ATOM 11036 C C    . GLN A 1 22 ? -12.196 -5.040  0.601   1.00 0.00 ? 22 GLN A C    13 
ATOM 11037 O O    . GLN A 1 22 ? -12.817 -6.031  0.959   1.00 0.00 ? 22 GLN A O    13 
ATOM 11038 C CB   . GLN A 1 22 ? -10.452 -6.555  -0.363  1.00 0.00 ? 22 GLN A CB   13 
ATOM 11039 C CG   . GLN A 1 22 ? -9.376  -6.938  -1.402  1.00 0.00 ? 22 GLN A CG   13 
ATOM 11040 C CD   . GLN A 1 22 ? -8.542  -8.161  -0.962  1.00 0.00 ? 22 GLN A CD   13 
ATOM 11041 O OE1  . GLN A 1 22 ? -8.352  -9.086  -1.738  1.00 0.00 ? 22 GLN A OE1  13 
ATOM 11042 N NE2  . GLN A 1 22 ? -8.056  -8.151  0.288   1.00 0.00 ? 22 GLN A NE2  13 
ATOM 11043 H H    . GLN A 1 22 ? -10.038 -3.490  -1.327  1.00 0.00 ? 22 GLN A H    13 
ATOM 11044 H HA   . GLN A 1 22 ? -11.604 -5.004  -1.460  1.00 0.00 ? 22 GLN A HA   13 
ATOM 11045 H HB2  . GLN A 1 22 ? -10.035 -6.613  0.644   1.00 0.00 ? 22 GLN A HB2  13 
ATOM 11046 H HB3  . GLN A 1 22 ? -11.223 -7.327  -0.405  1.00 0.00 ? 22 GLN A HB3  13 
ATOM 11047 H HG2  . GLN A 1 22 ? -9.818  -7.281  -2.360  1.00 0.00 ? 22 GLN A HG2  13 
ATOM 11048 H HG3  . GLN A 1 22 ? -8.719  -6.071  -1.550  1.00 0.00 ? 22 GLN A HG3  13 
ATOM 11049 H HE21 . GLN A 1 22 ? -8.148  -7.446  0.997   1.00 0.00 ? 22 GLN A HE21 13 
ATOM 11050 H HE22 . GLN A 1 22 ? -7.511  -8.943  0.581   1.00 0.00 ? 22 GLN A HE22 13 
ATOM 11051 N N    . GLY A 1 23 ? -12.386 -3.819  1.141   1.00 0.00 ? 23 GLY A N    13 
ATOM 11052 C CA   . GLY A 1 23 ? -13.366 -3.660  2.221   1.00 0.00 ? 23 GLY A CA   13 
ATOM 11053 C C    . GLY A 1 23 ? -12.773 -3.928  3.626   1.00 0.00 ? 23 GLY A C    13 
ATOM 11054 O O    . GLY A 1 23 ? -13.471 -3.842  4.628   1.00 0.00 ? 23 GLY A O    13 
ATOM 11055 H H    . GLY A 1 23 ? -11.851 -3.054  0.787   1.00 0.00 ? 23 GLY A H    13 
ATOM 11056 H HA2  . GLY A 1 23 ? -13.734 -2.634  2.164   1.00 0.00 ? 23 GLY A HA2  13 
ATOM 11057 H HA3  . GLY A 1 23 ? -14.203 -4.347  2.049   1.00 0.00 ? 23 GLY A HA3  13 
ATOM 11058 N N    . THR A 1 24 ? -11.463 -4.231  3.642   1.00 0.00 ? 24 THR A N    13 
ATOM 11059 C CA   . THR A 1 24 ? -10.703 -4.545  4.849   1.00 0.00 ? 24 THR A CA   13 
ATOM 11060 C C    . THR A 1 24 ? -9.669  -3.430  5.097   1.00 0.00 ? 24 THR A C    13 
ATOM 11061 O O    . THR A 1 24 ? -9.132  -2.847  4.166   1.00 0.00 ? 24 THR A O    13 
ATOM 11062 C CB   . THR A 1 24 ? -9.994  -5.888  4.585   1.00 0.00 ? 24 THR A CB   13 
ATOM 11063 O OG1  . THR A 1 24 ? -11.001 -6.818  4.218   1.00 0.00 ? 24 THR A OG1  13 
ATOM 11064 C CG2  . THR A 1 24 ? -9.206  -6.411  5.798   1.00 0.00 ? 24 THR A CG2  13 
ATOM 11065 H H    . THR A 1 24 ? -10.952 -4.288  2.787   1.00 0.00 ? 24 THR A H    13 
ATOM 11066 H HA   . THR A 1 24 ? -11.390 -4.619  5.694   1.00 0.00 ? 24 THR A HA   13 
ATOM 11067 H HB   . THR A 1 24 ? -9.306  -5.746  3.742   1.00 0.00 ? 24 THR A HB   13 
ATOM 11068 H HG1  . THR A 1 24 ? -10.615 -7.638  3.925   1.00 0.00 ? 24 THR A HG1  13 
ATOM 11069 H HG21 . THR A 1 24 ? -8.426  -5.711  6.101   1.00 0.00 ? 24 THR A HG21 13 
ATOM 11070 H HG22 . THR A 1 24 ? -8.706  -7.354  5.577   1.00 0.00 ? 24 THR A HG22 13 
ATOM 11071 H HG23 . THR A 1 24 ? -9.863  -6.570  6.654   1.00 0.00 ? 24 THR A HG23 13 
ATOM 11072 N N    . SER A 1 25 ? -9.416  -3.164  6.391   1.00 0.00 ? 25 SER A N    13 
ATOM 11073 C CA   . SER A 1 25 ? -8.444  -2.163  6.809   1.00 0.00 ? 25 SER A CA   13 
ATOM 11074 C C    . SER A 1 25 ? -7.095  -2.859  7.093   1.00 0.00 ? 25 SER A C    13 
ATOM 11075 O O    . SER A 1 25 ? -7.036  -3.903  7.730   1.00 0.00 ? 25 SER A O    13 
ATOM 11076 C CB   . SER A 1 25 ? -9.014  -1.489  8.065   1.00 0.00 ? 25 SER A CB   13 
ATOM 11077 O OG   . SER A 1 25 ? -9.800  -2.438  8.782   1.00 0.00 ? 25 SER A OG   13 
ATOM 11078 H H    . SER A 1 25 ? -9.857  -3.632  7.160   1.00 0.00 ? 25 SER A H    13 
ATOM 11079 H HA   . SER A 1 25 ? -8.313  -1.432  6.009   1.00 0.00 ? 25 SER A HA   13 
ATOM 11080 H HB2  . SER A 1 25 ? -8.210  -1.080  8.689   1.00 0.00 ? 25 SER A HB2  13 
ATOM 11081 H HB3  . SER A 1 25 ? -9.652  -0.655  7.754   1.00 0.00 ? 25 SER A HB3  13 
ATOM 11082 H HG   . SER A 1 25 ? -10.134 -2.068  9.597   1.00 0.00 ? 25 SER A HG   13 
ATOM 11083 N N    . TYR A 1 26 ? -6.027  -2.227  6.570   1.00 0.00 ? 26 TYR A N    13 
ATOM 11084 C CA   . TYR A 1 26 ? -4.666  -2.735  6.701   1.00 0.00 ? 26 TYR A CA   13 
ATOM 11085 C C    . TYR A 1 26 ? -3.771  -1.640  7.284   1.00 0.00 ? 26 TYR A C    13 
ATOM 11086 O O    . TYR A 1 26 ? -3.815  -0.503  6.835   1.00 0.00 ? 26 TYR A O    13 
ATOM 11087 C CB   . TYR A 1 26 ? -4.123  -3.069  5.311   1.00 0.00 ? 26 TYR A CB   13 
ATOM 11088 C CG   . TYR A 1 26 ? -4.924  -4.137  4.629   1.00 0.00 ? 26 TYR A CG   13 
ATOM 11089 C CD1  . TYR A 1 26 ? -6.011  -3.806  3.831   1.00 0.00 ? 26 TYR A CD1  13 
ATOM 11090 C CD2  . TYR A 1 26 ? -4.581  -5.473  4.775   1.00 0.00 ? 26 TYR A CD2  13 
ATOM 11091 C CE1  . TYR A 1 26 ? -6.723  -4.802  3.187   1.00 0.00 ? 26 TYR A CE1  13 
ATOM 11092 C CE2  . TYR A 1 26 ? -5.303  -6.462  4.127   1.00 0.00 ? 26 TYR A CE2  13 
ATOM 11093 C CZ   . TYR A 1 26 ? -6.383  -6.131  3.328   1.00 0.00 ? 26 TYR A CZ   13 
ATOM 11094 O OH   . TYR A 1 26 ? -7.120  -7.089  2.658   1.00 0.00 ? 26 TYR A OH   13 
ATOM 11095 H H    . TYR A 1 26 ? -6.141  -1.379  6.047   1.00 0.00 ? 26 TYR A H    13 
ATOM 11096 H HA   . TYR A 1 26 ? -4.660  -3.610  7.355   1.00 0.00 ? 26 TYR A HA   13 
ATOM 11097 H HB2  . TYR A 1 26 ? -4.155  -2.171  4.685   1.00 0.00 ? 26 TYR A HB2  13 
ATOM 11098 H HB3  . TYR A 1 26 ? -3.084  -3.407  5.388   1.00 0.00 ? 26 TYR A HB3  13 
ATOM 11099 H HD1  . TYR A 1 26 ? -6.314  -2.777  3.698   1.00 0.00 ? 26 TYR A HD1  13 
ATOM 11100 H HD2  . TYR A 1 26 ? -3.744  -5.749  5.391   1.00 0.00 ? 26 TYR A HD2  13 
ATOM 11101 H HE1  . TYR A 1 26 ? -7.529  -4.541  2.536   1.00 0.00 ? 26 TYR A HE1  13 
ATOM 11102 H HE2  . TYR A 1 26 ? -5.002  -7.487  4.224   1.00 0.00 ? 26 TYR A HE2  13 
ATOM 11103 H HH   . TYR A 1 26 ? -6.536  -7.813  2.398   1.00 0.00 ? 26 TYR A HH   13 
ATOM 11104 N N    . ASP A 1 27 ? -2.952  -2.049  8.273   1.00 0.00 ? 27 ASP A N    13 
ATOM 11105 C CA   . ASP A 1 27 ? -2.021  -1.127  8.929   1.00 0.00 ? 27 ASP A CA   13 
ATOM 11106 C C    . ASP A 1 27 ? -0.571  -1.652  8.803   1.00 0.00 ? 27 ASP A C    13 
ATOM 11107 O O    . ASP A 1 27 ? 0.285   -1.425  9.645   1.00 0.00 ? 27 ASP A O    13 
ATOM 11108 C CB   . ASP A 1 27 ? -2.478  -0.947  10.390  1.00 0.00 ? 27 ASP A CB   13 
ATOM 11109 C CG   . ASP A 1 27 ? -2.118  0.445   10.936  1.00 0.00 ? 27 ASP A CG   13 
ATOM 11110 O OD1  . ASP A 1 27 ? -2.595  1.430   10.373  1.00 0.00 ? 27 ASP A OD1  13 
ATOM 11111 O OD2  . ASP A 1 27 ? -1.386  0.531   11.919  1.00 0.00 ? 27 ASP A OD2  13 
ATOM 11112 H H    . ASP A 1 27 ? -2.999  -2.997  8.583   1.00 0.00 ? 27 ASP A H    13 
ATOM 11113 H HA   . ASP A 1 27 ? -2.054  -0.168  8.408   1.00 0.00 ? 27 ASP A HA   13 
ATOM 11114 H HB2  . ASP A 1 27 ? -3.563  -1.031  10.455  1.00 0.00 ? 27 ASP A HB2  13 
ATOM 11115 H HB3  . ASP A 1 27 ? -2.066  -1.722  11.038  1.00 0.00 ? 27 ASP A HB3  13 
ATOM 11116 N N    . SER A 1 28 ? -0.347  -2.395  7.699   1.00 0.00 ? 28 SER A N    13 
ATOM 11117 C CA   . SER A 1 28 ? 0.971   -2.956  7.423   1.00 0.00 ? 28 SER A CA   13 
ATOM 11118 C C    . SER A 1 28 ? 0.936   -3.425  5.965   1.00 0.00 ? 28 SER A C    13 
ATOM 11119 O O    . SER A 1 28 ? -0.134  -3.509  5.369   1.00 0.00 ? 28 SER A O    13 
ATOM 11120 C CB   . SER A 1 28 ? 1.276   -4.117  8.400   1.00 0.00 ? 28 SER A CB   13 
ATOM 11121 O OG   . SER A 1 28 ? 0.258   -5.103  8.344   1.00 0.00 ? 28 SER A OG   13 
ATOM 11122 H H    . SER A 1 28 ? -1.041  -2.577  7.000   1.00 0.00 ? 28 SER A H    13 
ATOM 11123 H HA   . SER A 1 28 ? 1.702   -2.144  7.487   1.00 0.00 ? 28 SER A HA   13 
ATOM 11124 H HB2  . SER A 1 28 ? 2.219   -4.613  8.101   1.00 0.00 ? 28 SER A HB2  13 
ATOM 11125 H HB3  . SER A 1 28 ? 1.341   -3.749  9.449   1.00 0.00 ? 28 SER A HB3  13 
ATOM 11126 H HG   . SER A 1 28 ? -0.589  -4.698  8.499   1.00 0.00 ? 28 SER A HG   13 
ATOM 11127 N N    . CYS A 1 29 ? 2.135   -3.689  5.417   1.00 0.00 ? 29 CYS A N    13 
ATOM 11128 C CA   . CYS A 1 29 ? 2.222   -4.117  4.025   1.00 0.00 ? 29 CYS A CA   13 
ATOM 11129 C C    . CYS A 1 29 ? 1.519   -5.491  3.826   1.00 0.00 ? 29 CYS A C    13 
ATOM 11130 O O    . CYS A 1 29 ? 1.695   -6.377  4.658   1.00 0.00 ? 29 CYS A O    13 
ATOM 11131 C CB   . CYS A 1 29 ? 3.688   -4.301  3.665   1.00 0.00 ? 29 CYS A CB   13 
ATOM 11132 S SG   . CYS A 1 29 ? 4.758   -2.946  4.177   1.00 0.00 ? 29 CYS A SG   13 
ATOM 11133 H H    . CYS A 1 29 ? 2.981   -3.611  5.955   1.00 0.00 ? 29 CYS A H    13 
ATOM 11134 H HA   . CYS A 1 29 ? 1.832   -3.284  3.436   1.00 0.00 ? 29 CYS A HA   13 
ATOM 11135 H HB2  . CYS A 1 29 ? 4.081   -5.211  4.131   1.00 0.00 ? 29 CYS A HB2  13 
ATOM 11136 H HB3  . CYS A 1 29 ? 3.740   -4.403  2.579   1.00 0.00 ? 29 CYS A HB3  13 
ATOM 11137 N N    . THR A 1 30 ? 0.766   -5.665  2.716   1.00 0.00 ? 30 THR A N    13 
ATOM 11138 C CA   . THR A 1 30 ? 0.113   -6.951  2.427   1.00 0.00 ? 30 THR A CA   13 
ATOM 11139 C C    . THR A 1 30 ? 0.667   -7.514  1.109   1.00 0.00 ? 30 THR A C    13 
ATOM 11140 O O    . THR A 1 30 ? 1.259   -6.794  0.322   1.00 0.00 ? 30 THR A O    13 
ATOM 11141 C CB   . THR A 1 30 ? -1.418  -6.801  2.364   1.00 0.00 ? 30 THR A CB   13 
ATOM 11142 O OG1  . THR A 1 30 ? -1.951  -8.106  2.200   1.00 0.00 ? 30 THR A OG1  13 
ATOM 11143 C CG2  . THR A 1 30 ? -1.889  -5.879  1.215   1.00 0.00 ? 30 THR A CG2  13 
ATOM 11144 H H    . THR A 1 30 ? 0.662   -4.932  2.038   1.00 0.00 ? 30 THR A H    13 
ATOM 11145 H HA   . THR A 1 30 ? 0.363   -7.661  3.215   1.00 0.00 ? 30 THR A HA   13 
ATOM 11146 H HB   . THR A 1 30 ? -1.739  -6.405  3.340   1.00 0.00 ? 30 THR A HB   13 
ATOM 11147 H HG1  . THR A 1 30 ? -2.913  -8.068  2.167   1.00 0.00 ? 30 THR A HG1  13 
ATOM 11148 H HG21 . THR A 1 30 ? -2.960  -5.674  1.262   1.00 0.00 ? 30 THR A HG21 13 
ATOM 11149 H HG22 . THR A 1 30 ? -1.695  -6.334  0.241   1.00 0.00 ? 30 THR A HG22 13 
ATOM 11150 H HG23 . THR A 1 30 ? -1.375  -4.917  1.221   1.00 0.00 ? 30 THR A HG23 13 
ATOM 11151 N N    . THR A 1 31 ? 0.438   -8.828  0.920   1.00 0.00 ? 31 THR A N    13 
ATOM 11152 C CA   . THR A 1 31 ? 0.879   -9.528  -0.291  1.00 0.00 ? 31 THR A CA   13 
ATOM 11153 C C    . THR A 1 31 ? -0.304  -9.836  -1.221  1.00 0.00 ? 31 THR A C    13 
ATOM 11154 O O    . THR A 1 31 ? -0.131  -10.342 -2.323  1.00 0.00 ? 31 THR A O    13 
ATOM 11155 C CB   . THR A 1 31 ? 1.651   -10.819 0.068   1.00 0.00 ? 31 THR A CB   13 
ATOM 11156 O OG1  . THR A 1 31 ? 1.944   -10.824 1.461   1.00 0.00 ? 31 THR A OG1  13 
ATOM 11157 C CG2  . THR A 1 31 ? 2.945   -10.931 -0.759  1.00 0.00 ? 31 THR A CG2  13 
ATOM 11158 H H    . THR A 1 31 ? -0.062  -9.310  1.640   1.00 0.00 ? 31 THR A H    13 
ATOM 11159 H HA   . THR A 1 31 ? 1.517   -8.861  -0.865  1.00 0.00 ? 31 THR A HA   13 
ATOM 11160 H HB   . THR A 1 31 ? 1.023   -11.691 -0.167  1.00 0.00 ? 31 THR A HB   13 
ATOM 11161 H HG1  . THR A 1 31 ? 2.411   -11.623 1.682   1.00 0.00 ? 31 THR A HG1  13 
ATOM 11162 H HG21 . THR A 1 31 ? 2.728   -10.849 -1.826  1.00 0.00 ? 31 THR A HG21 13 
ATOM 11163 H HG22 . THR A 1 31 ? 3.454   -11.883 -0.609  1.00 0.00 ? 31 THR A HG22 13 
ATOM 11164 H HG23 . THR A 1 31 ? 3.643   -10.132 -0.508  1.00 0.00 ? 31 THR A HG23 13 
ATOM 11165 N N    . GLU A 1 32 ? -1.517  -9.518  -0.734  1.00 0.00 ? 32 GLU A N    13 
ATOM 11166 C CA   . GLU A 1 32 ? -2.702  -9.794  -1.539  1.00 0.00 ? 32 GLU A CA   13 
ATOM 11167 C C    . GLU A 1 32 ? -2.622  -9.051  -2.887  1.00 0.00 ? 32 GLU A C    13 
ATOM 11168 O O    . GLU A 1 32 ? -2.576  -7.829  -2.933  1.00 0.00 ? 32 GLU A O    13 
ATOM 11169 C CB   . GLU A 1 32 ? -3.924  -9.297  -0.768  1.00 0.00 ? 32 GLU A CB   13 
ATOM 11170 C CG   . GLU A 1 32 ? -4.223  -10.103 0.509   1.00 0.00 ? 32 GLU A CG   13 
ATOM 11171 C CD   . GLU A 1 32 ? -5.099  -9.264  1.444   1.00 0.00 ? 32 GLU A CD   13 
ATOM 11172 O OE1  . GLU A 1 32 ? -4.695  -8.158  1.783   1.00 0.00 ? 32 GLU A OE1  13 
ATOM 11173 O OE2  . GLU A 1 32 ? -6.184  -9.690  1.824   1.00 0.00 ? 32 GLU A OE2  13 
ATOM 11174 H H    . GLU A 1 32 ? -1.619  -9.089  0.166   1.00 0.00 ? 32 GLU A H    13 
ATOM 11175 H HA   . GLU A 1 32 ? -2.751  -10.873 -1.699  1.00 0.00 ? 32 GLU A HA   13 
ATOM 11176 H HB2  . GLU A 1 32 ? -3.733  -8.251  -0.521  1.00 0.00 ? 32 GLU A HB2  13 
ATOM 11177 H HB3  . GLU A 1 32 ? -4.813  -9.309  -1.401  1.00 0.00 ? 32 GLU A HB3  13 
ATOM 11178 H HG2  . GLU A 1 32 ? -4.731  -11.036 0.264   1.00 0.00 ? 32 GLU A HG2  13 
ATOM 11179 H HG3  . GLU A 1 32 ? -3.313  -10.372 1.046   1.00 0.00 ? 32 GLU A HG3  13 
ATOM 11180 N N    . GLY A 1 33 ? -2.612  -9.857  -3.965  1.00 0.00 ? 33 GLY A N    13 
ATOM 11181 C CA   . GLY A 1 33 ? -2.570  -9.294  -5.312  1.00 0.00 ? 33 GLY A CA   13 
ATOM 11182 C C    . GLY A 1 33 ? -1.196  -9.423  -5.982  1.00 0.00 ? 33 GLY A C    13 
ATOM 11183 O O    . GLY A 1 33 ? -1.083  -9.207  -7.181  1.00 0.00 ? 33 GLY A O    13 
ATOM 11184 H H    . GLY A 1 33 ? -2.635  -10.846 -3.829  1.00 0.00 ? 33 GLY A H    13 
ATOM 11185 H HA2  . GLY A 1 33 ? -3.300  -9.856  -5.901  1.00 0.00 ? 33 GLY A HA2  13 
ATOM 11186 H HA3  . GLY A 1 33 ? -2.864  -8.239  -5.289  1.00 0.00 ? 33 GLY A HA3  13 
ATOM 11187 N N    . ARG A 1 34 ? -0.169  -9.789  -5.185  1.00 0.00 ? 34 ARG A N    13 
ATOM 11188 C CA   . ARG A 1 34 ? 1.165   -9.943  -5.806  1.00 0.00 ? 34 ARG A CA   13 
ATOM 11189 C C    . ARG A 1 34 ? 1.620   -11.400 -5.682  1.00 0.00 ? 34 ARG A C    13 
ATOM 11190 O O    . ARG A 1 34 ? 1.554   -12.017 -4.628  1.00 0.00 ? 34 ARG A O    13 
ATOM 11191 C CB   . ARG A 1 34 ? 2.191   -9.055  -5.097  1.00 0.00 ? 34 ARG A CB   13 
ATOM 11192 C CG   . ARG A 1 34 ? 1.870   -7.562  -5.248  1.00 0.00 ? 34 ARG A CG   13 
ATOM 11193 C CD   . ARG A 1 34 ? 3.116   -6.684  -5.013  1.00 0.00 ? 34 ARG A CD   13 
ATOM 11194 N NE   . ARG A 1 34 ? 3.953   -6.713  -6.224  1.00 0.00 ? 34 ARG A NE   13 
ATOM 11195 C CZ   . ARG A 1 34 ? 3.868   -5.775  -7.197  1.00 0.00 ? 34 ARG A CZ   13 
ATOM 11196 N NH1  . ARG A 1 34 ? 3.018   -4.761  -7.084  1.00 0.00 ? 34 ARG A NH1  13 
ATOM 11197 N NH2  . ARG A 1 34 ? 4.639   -5.883  -8.270  1.00 0.00 ? 34 ARG A NH2  13 
ATOM 11198 H H    . ARG A 1 34 ? -0.330  -9.957  -4.194  1.00 0.00 ? 34 ARG A H    13 
ATOM 11199 H HA   . ARG A 1 34 ? 1.169   -9.673  -6.885  1.00 0.00 ? 34 ARG A HA   13 
ATOM 11200 H HB2  . ARG A 1 34 ? 2.209   -9.311  -4.009  1.00 0.00 ? 34 ARG A HB2  13 
ATOM 11201 H HB3  . ARG A 1 34 ? 3.156   -9.246  -5.615  1.00 0.00 ? 34 ARG A HB3  13 
ATOM 11202 H HG2  . ARG A 1 34 ? 1.484   -7.363  -6.249  1.00 0.00 ? 34 ARG A HG2  13 
ATOM 11203 H HG3  . ARG A 1 34 ? 1.047   -7.312  -4.576  1.00 0.00 ? 34 ARG A HG3  13 
ATOM 11204 H HD2  . ARG A 1 34 ? 2.847   -5.645  -4.787  1.00 0.00 ? 34 ARG A HD2  13 
ATOM 11205 H HD3  . ARG A 1 34 ? 3.726   -7.054  -4.176  1.00 0.00 ? 34 ARG A HD3  13 
ATOM 11206 H HE   . ARG A 1 34 ? 4.586   -7.488  -6.403  1.00 0.00 ? 34 ARG A HE   13 
ATOM 11207 H HH11 . ARG A 1 34 ? 2.409   -4.730  -6.294  1.00 0.00 ? 34 ARG A HH11 13 
ATOM 11208 H HH12 . ARG A 1 34 ? 2.954   -4.006  -7.755  1.00 0.00 ? 34 ARG A HH12 13 
ATOM 11209 H HH21 . ARG A 1 34 ? 5.251   -6.688  -8.330  1.00 0.00 ? 34 ARG A HH21 13 
ATOM 11210 H HH22 . ARG A 1 34 ? 4.629   -5.216  -9.012  1.00 0.00 ? 34 ARG A HH22 13 
ATOM 11211 N N    . THR A 1 35 ? 2.115   -11.888 -6.829  1.00 0.00 ? 35 THR A N    13 
ATOM 11212 C CA   . THR A 1 35 ? 2.617   -13.245 -6.959  1.00 0.00 ? 35 THR A CA   13 
ATOM 11213 C C    . THR A 1 35 ? 4.138   -13.232 -7.212  1.00 0.00 ? 35 THR A C    13 
ATOM 11214 O O    . THR A 1 35 ? 4.717   -14.232 -7.615  1.00 0.00 ? 35 THR A O    13 
ATOM 11215 C CB   . THR A 1 35 ? 1.869   -13.855 -8.153  1.00 0.00 ? 35 THR A CB   13 
ATOM 11216 O OG1  . THR A 1 35 ? 1.842   -12.857 -9.165  1.00 0.00 ? 35 THR A OG1  13 
ATOM 11217 C CG2  . THR A 1 35 ? 0.433   -14.245 -7.764  1.00 0.00 ? 35 THR A CG2  13 
ATOM 11218 H H    . THR A 1 35 ? 2.118   -11.369 -7.686  1.00 0.00 ? 35 THR A H    13 
ATOM 11219 H HA   . THR A 1 35 ? 2.426   -13.805 -6.041  1.00 0.00 ? 35 THR A HA   13 
ATOM 11220 H HB   . THR A 1 35 ? 2.407   -14.745 -8.502  1.00 0.00 ? 35 THR A HB   13 
ATOM 11221 H HG1  . THR A 1 35 ? 1.412   -13.187 -9.949  1.00 0.00 ? 35 THR A HG1  13 
ATOM 11222 H HG21 . THR A 1 35 ? -0.150  -13.371 -7.472  1.00 0.00 ? 35 THR A HG21 13 
ATOM 11223 H HG22 . THR A 1 35 ? 0.435   -14.935 -6.920  1.00 0.00 ? 35 THR A HG22 13 
ATOM 11224 H HG23 . THR A 1 35 ? -0.092  -14.739 -8.582  1.00 0.00 ? 35 THR A HG23 13 
ATOM 11225 N N    . ASP A 1 36 ? 4.746   -12.057 -6.938  1.00 0.00 ? 36 ASP A N    13 
ATOM 11226 C CA   . ASP A 1 36 ? 6.180   -11.863 -7.156  1.00 0.00 ? 36 ASP A CA   13 
ATOM 11227 C C    . ASP A 1 36 ? 6.980   -11.886 -5.835  1.00 0.00 ? 36 ASP A C    13 
ATOM 11228 O O    . ASP A 1 36 ? 8.202   -11.797 -5.841  1.00 0.00 ? 36 ASP A O    13 
ATOM 11229 C CB   . ASP A 1 36 ? 6.401   -10.549 -7.931  1.00 0.00 ? 36 ASP A CB   13 
ATOM 11230 C CG   . ASP A 1 36 ? 5.878   -9.285  -7.227  1.00 0.00 ? 36 ASP A CG   13 
ATOM 11231 O OD1  . ASP A 1 36 ? 5.495   -9.338  -6.060  1.00 0.00 ? 36 ASP A OD1  13 
ATOM 11232 O OD2  . ASP A 1 36 ? 5.855   -8.231  -7.857  1.00 0.00 ? 36 ASP A OD2  13 
ATOM 11233 H H    . ASP A 1 36 ? 4.236   -11.253 -6.630  1.00 0.00 ? 36 ASP A H    13 
ATOM 11234 H HA   . ASP A 1 36 ? 6.557   -12.687 -7.764  1.00 0.00 ? 36 ASP A HA   13 
ATOM 11235 H HB2  . ASP A 1 36 ? 7.463   -10.409 -8.136  1.00 0.00 ? 36 ASP A HB2  13 
ATOM 11236 H HB3  . ASP A 1 36 ? 5.901   -10.616 -8.897  1.00 0.00 ? 36 ASP A HB3  13 
ATOM 11237 N N    . GLY A 1 37 ? 6.240   -12.058 -4.716  1.00 0.00 ? 37 GLY A N    13 
ATOM 11238 C CA   . GLY A 1 37 ? 6.883   -12.198 -3.412  1.00 0.00 ? 37 GLY A CA   13 
ATOM 11239 C C    . GLY A 1 37 ? 6.916   -10.914 -2.580  1.00 0.00 ? 37 GLY A C    13 
ATOM 11240 O O    . GLY A 1 37 ? 7.269   -10.950 -1.408  1.00 0.00 ? 37 GLY A O    13 
ATOM 11241 H H    . GLY A 1 37 ? 5.247   -12.113 -4.776  1.00 0.00 ? 37 GLY A H    13 
ATOM 11242 H HA2  . GLY A 1 37 ? 6.333   -12.968 -2.867  1.00 0.00 ? 37 GLY A HA2  13 
ATOM 11243 H HA3  . GLY A 1 37 ? 7.920   -12.521 -3.561  1.00 0.00 ? 37 GLY A HA3  13 
ATOM 11244 N N    . TYR A 1 38 ? 6.577   -9.780  -3.220  1.00 0.00 ? 38 TYR A N    13 
ATOM 11245 C CA   . TYR A 1 38 ? 6.714   -8.505  -2.513  1.00 0.00 ? 38 TYR A CA   13 
ATOM 11246 C C    . TYR A 1 38 ? 5.399   -8.091  -1.841  1.00 0.00 ? 38 TYR A C    13 
ATOM 11247 O O    . TYR A 1 38 ? 4.305   -8.370  -2.315  1.00 0.00 ? 38 TYR A O    13 
ATOM 11248 C CB   . TYR A 1 38 ? 7.285   -7.460  -3.491  1.00 0.00 ? 38 TYR A CB   13 
ATOM 11249 C CG   . TYR A 1 38 ? 8.459   -8.058  -4.228  1.00 0.00 ? 38 TYR A CG   13 
ATOM 11250 C CD1  . TYR A 1 38 ? 9.515   -8.653  -3.550  1.00 0.00 ? 38 TYR A CD1  13 
ATOM 11251 C CD2  . TYR A 1 38 ? 8.487   -8.102  -5.610  1.00 0.00 ? 38 TYR A CD2  13 
ATOM 11252 C CE1  . TYR A 1 38 ? 10.514  -9.317  -4.225  1.00 0.00 ? 38 TYR A CE1  13 
ATOM 11253 C CE2  . TYR A 1 38 ? 9.483   -8.766  -6.288  1.00 0.00 ? 38 TYR A CE2  13 
ATOM 11254 C CZ   . TYR A 1 38 ? 10.503  -9.395  -5.602  1.00 0.00 ? 38 TYR A CZ   13 
ATOM 11255 O OH   . TYR A 1 38 ? 11.478  -10.100 -6.272  1.00 0.00 ? 38 TYR A OH   13 
ATOM 11256 H H    . TYR A 1 38 ? 6.279   -9.783  -4.179  1.00 0.00 ? 38 TYR A H    13 
ATOM 11257 H HA   . TYR A 1 38 ? 7.448   -8.639  -1.715  1.00 0.00 ? 38 TYR A HA   13 
ATOM 11258 H HB2  . TYR A 1 38 ? 6.524   -7.152  -4.212  1.00 0.00 ? 38 TYR A HB2  13 
ATOM 11259 H HB3  . TYR A 1 38 ? 7.602   -6.561  -2.964  1.00 0.00 ? 38 TYR A HB3  13 
ATOM 11260 H HD1  . TYR A 1 38 ? 9.598   -8.657  -2.488  1.00 0.00 ? 38 TYR A HD1  13 
ATOM 11261 H HD2  . TYR A 1 38 ? 7.733   -7.654  -6.214  1.00 0.00 ? 38 TYR A HD2  13 
ATOM 11262 H HE1  . TYR A 1 38 ? 11.267  -9.783  -3.633  1.00 0.00 ? 38 TYR A HE1  13 
ATOM 11263 H HE2  . TYR A 1 38 ? 9.398   -8.780  -7.348  1.00 0.00 ? 38 TYR A HE2  13 
ATOM 11264 H HH   . TYR A 1 38 ? 11.058  -10.820 -6.728  1.00 0.00 ? 38 TYR A HH   13 
ATOM 11265 N N    . ARG A 1 39 ? 5.597   -7.417  -0.692  1.00 0.00 ? 39 ARG A N    13 
ATOM 11266 C CA   . ARG A 1 39 ? 4.436   -6.910  0.073   1.00 0.00 ? 39 ARG A CA   13 
ATOM 11267 C C    . ARG A 1 39 ? 4.344   -5.410  -0.262  1.00 0.00 ? 39 ARG A C    13 
ATOM 11268 O O    . ARG A 1 39 ? 5.367   -4.736  -0.328  1.00 0.00 ? 39 ARG A O    13 
ATOM 11269 C CB   . ARG A 1 39 ? 4.674   -7.157  1.579   1.00 0.00 ? 39 ARG A CB   13 
ATOM 11270 C CG   . ARG A 1 39 ? 4.776   -8.638  1.967   1.00 0.00 ? 39 ARG A CG   13 
ATOM 11271 C CD   . ARG A 1 39 ? 4.906   -8.800  3.499   1.00 0.00 ? 39 ARG A CD   13 
ATOM 11272 N NE   . ARG A 1 39 ? 3.653   -8.450  4.186   1.00 0.00 ? 39 ARG A NE   13 
ATOM 11273 C CZ   . ARG A 1 39 ? 2.734   -9.353  4.599   1.00 0.00 ? 39 ARG A CZ   13 
ATOM 11274 N NH1  . ARG A 1 39 ? 2.916   -10.653 4.396   1.00 0.00 ? 39 ARG A NH1  13 
ATOM 11275 N NH2  . ARG A 1 39 ? 1.642   -8.917  5.218   1.00 0.00 ? 39 ARG A NH2  13 
ATOM 11276 H H    . ARG A 1 39 ? 6.571   -7.243  -0.452  1.00 0.00 ? 39 ARG A H    13 
ATOM 11277 H HA   . ARG A 1 39 ? 3.481   -7.382  -0.228  1.00 0.00 ? 39 ARG A HA   13 
ATOM 11278 H HB2  . ARG A 1 39 ? 5.581   -6.646  1.897   1.00 0.00 ? 39 ARG A HB2  13 
ATOM 11279 H HB3  . ARG A 1 39 ? 3.865   -6.738  2.170   1.00 0.00 ? 39 ARG A HB3  13 
ATOM 11280 H HG2  . ARG A 1 39 ? 3.873   -9.159  1.630   1.00 0.00 ? 39 ARG A HG2  13 
ATOM 11281 H HG3  . ARG A 1 39 ? 5.637   -9.087  1.443   1.00 0.00 ? 39 ARG A HG3  13 
ATOM 11282 H HD2  . ARG A 1 39 ? 5.207   -9.809  3.785   1.00 0.00 ? 39 ARG A HD2  13 
ATOM 11283 H HD3  . ARG A 1 39 ? 5.665   -8.128  3.906   1.00 0.00 ? 39 ARG A HD3  13 
ATOM 11284 H HE   . ARG A 1 39 ? 3.436   -7.489  4.393   1.00 0.00 ? 39 ARG A HE   13 
ATOM 11285 H HH11 . ARG A 1 39 ? 3.745   -10.952 3.925   1.00 0.00 ? 39 ARG A HH11 13 
ATOM 11286 H HH12 . ARG A 1 39 ? 2.251   -11.335 4.696   1.00 0.00 ? 39 ARG A HH12 13 
ATOM 11287 H HH21 . ARG A 1 39 ? 1.508   -7.918  5.300   1.00 0.00 ? 39 ARG A HH21 13 
ATOM 11288 H HH22 . ARG A 1 39 ? 0.948   -9.529  5.593   1.00 0.00 ? 39 ARG A HH22 13 
ATOM 11289 N N    . TRP A 1 40 ? 3.103   -4.933  -0.500  1.00 0.00 ? 40 TRP A N    13 
ATOM 11290 C CA   . TRP A 1 40 ? 2.842   -3.551  -0.874  1.00 0.00 ? 40 TRP A CA   13 
ATOM 11291 C C    . TRP A 1 40 ? 1.954   -2.874  0.186   1.00 0.00 ? 40 TRP A C    13 
ATOM 11292 O O    . TRP A 1 40 ? 1.312   -3.536  0.994   1.00 0.00 ? 40 TRP A O    13 
ATOM 11293 C CB   . TRP A 1 40 ? 2.166   -3.524  -2.262  1.00 0.00 ? 40 TRP A CB   13 
ATOM 11294 C CG   . TRP A 1 40 ? 0.814   -4.224  -2.249  1.00 0.00 ? 40 TRP A CG   13 
ATOM 11295 C CD1  . TRP A 1 40 ? 0.597   -5.593  -2.439  1.00 0.00 ? 40 TRP A CD1  13 
ATOM 11296 C CD2  . TRP A 1 40 ? -0.494  -3.638  -2.060  1.00 0.00 ? 40 TRP A CD2  13 
ATOM 11297 N NE1  . TRP A 1 40 ? -0.728  -5.856  -2.384  1.00 0.00 ? 40 TRP A NE1  13 
ATOM 11298 C CE2  . TRP A 1 40 ? -1.432  -4.690  -2.150  1.00 0.00 ? 40 TRP A CE2  13 
ATOM 11299 C CE3  . TRP A 1 40 ? -0.931  -2.363  -1.819  1.00 0.00 ? 40 TRP A CE3  13 
ATOM 11300 C CZ2  . TRP A 1 40 ? -2.766  -4.441  -2.008  1.00 0.00 ? 40 TRP A CZ2  13 
ATOM 11301 C CZ3  . TRP A 1 40 ? -2.298  -2.099  -1.666  1.00 0.00 ? 40 TRP A CZ3  13 
ATOM 11302 C CH2  . TRP A 1 40 ? -3.216  -3.147  -1.762  1.00 0.00 ? 40 TRP A CH2  13 
ATOM 11303 H H    . TRP A 1 40 ? 2.286   -5.508  -0.439  1.00 0.00 ? 40 TRP A H    13 
ATOM 11304 H HA   . TRP A 1 40 ? 3.802   -3.046  -0.905  1.00 0.00 ? 40 TRP A HA   13 
ATOM 11305 H HB2  . TRP A 1 40 ? 2.048   -2.504  -2.619  1.00 0.00 ? 40 TRP A HB2  13 
ATOM 11306 H HB3  . TRP A 1 40 ? 2.805   -4.011  -2.997  1.00 0.00 ? 40 TRP A HB3  13 
ATOM 11307 H HD1  . TRP A 1 40 ? 1.353   -6.345  -2.585  1.00 0.00 ? 40 TRP A HD1  13 
ATOM 11308 H HE1  . TRP A 1 40 ? -1.154  -6.735  -2.495  1.00 0.00 ? 40 TRP A HE1  13 
ATOM 11309 H HE3  . TRP A 1 40 ? -0.193  -1.580  -1.755  1.00 0.00 ? 40 TRP A HE3  13 
ATOM 11310 H HZ2  . TRP A 1 40 ? -3.465  -5.259  -2.091  1.00 0.00 ? 40 TRP A HZ2  13 
ATOM 11311 H HZ3  . TRP A 1 40 ? -2.666  -1.097  -1.470  1.00 0.00 ? 40 TRP A HZ3  13 
ATOM 11312 H HH2  . TRP A 1 40 ? -4.277  -2.974  -1.649  1.00 0.00 ? 40 TRP A HH2  13 
ATOM 11313 N N    . CYS A 1 41 ? 1.944   -1.527  0.128   1.00 0.00 ? 41 CYS A N    13 
ATOM 11314 C CA   . CYS A 1 41 ? 1.110   -0.710  0.998   1.00 0.00 ? 41 CYS A CA   13 
ATOM 11315 C C    . CYS A 1 41 ? 0.271   0.225   0.117   1.00 0.00 ? 41 CYS A C    13 
ATOM 11316 O O    . CYS A 1 41 ? 0.737   0.700   -0.913  1.00 0.00 ? 41 CYS A O    13 
ATOM 11317 C CB   . CYS A 1 41 ? 1.989   0.140   1.921   1.00 0.00 ? 41 CYS A CB   13 
ATOM 11318 S SG   . CYS A 1 41 ? 2.911   1.428   1.017   1.00 0.00 ? 41 CYS A SG   13 
ATOM 11319 H H    . CYS A 1 41 ? 2.489   -1.022  -0.541  1.00 0.00 ? 41 CYS A H    13 
ATOM 11320 H HA   . CYS A 1 41 ? 0.466   -1.373  1.577   1.00 0.00 ? 41 CYS A HA   13 
ATOM 11321 H HB2  . CYS A 1 41 ? 1.247   0.664   2.579   1.00 0.00 ? 41 CYS A HB2  13 
ATOM 11322 H HB3  . CYS A 1 41 ? 2.726   -0.536  2.433   1.00 0.00 ? 41 CYS A HB3  13 
ATOM 11323 N N    . GLY A 1 42 ? -0.972  0.481   0.565   1.00 0.00 ? 42 GLY A N    13 
ATOM 11324 C CA   . GLY A 1 42 ? -1.788  1.453   -0.154  1.00 0.00 ? 42 GLY A CA   13 
ATOM 11325 C C    . GLY A 1 42 ? -1.293  2.848   0.242   1.00 0.00 ? 42 GLY A C    13 
ATOM 11326 O O    . GLY A 1 42 ? -0.657  3.010   1.278   1.00 0.00 ? 42 GLY A O    13 
ATOM 11327 H H    . GLY A 1 42 ? -1.323  0.074   1.410   1.00 0.00 ? 42 GLY A H    13 
ATOM 11328 H HA2  . GLY A 1 42 ? -1.692  1.283   -1.230  1.00 0.00 ? 42 GLY A HA2  13 
ATOM 11329 H HA3  . GLY A 1 42 ? -2.824  1.319   0.158   1.00 0.00 ? 42 GLY A HA3  13 
ATOM 11330 N N    . THR A 1 43 ? -1.603  3.833   -0.621  1.00 0.00 ? 43 THR A N    13 
ATOM 11331 C CA   . THR A 1 43 ? -1.130  5.197   -0.358  1.00 0.00 ? 43 THR A CA   13 
ATOM 11332 C C    . THR A 1 43 ? -2.277  6.184   -0.122  1.00 0.00 ? 43 THR A C    13 
ATOM 11333 O O    . THR A 1 43 ? -2.086  7.392   -0.163  1.00 0.00 ? 43 THR A O    13 
ATOM 11334 C CB   . THR A 1 43 ? -0.212  5.660   -1.509  1.00 0.00 ? 43 THR A CB   13 
ATOM 11335 O OG1  . THR A 1 43 ? -0.155  4.712   -2.556  1.00 0.00 ? 43 THR A OG1  13 
ATOM 11336 C CG2  . THR A 1 43 ? 1.225   5.818   -1.029  1.00 0.00 ? 43 THR A CG2  13 
ATOM 11337 H H    . THR A 1 43 ? -2.104  3.614   -1.459  1.00 0.00 ? 43 THR A H    13 
ATOM 11338 H HA   . THR A 1 43 ? -0.577  5.201   0.582   1.00 0.00 ? 43 THR A HA   13 
ATOM 11339 H HB   . THR A 1 43 ? -0.523  6.628   -1.920  1.00 0.00 ? 43 THR A HB   13 
ATOM 11340 H HG1  . THR A 1 43 ? -1.032  4.524   -2.887  1.00 0.00 ? 43 THR A HG1  13 
ATOM 11341 H HG21 . THR A 1 43 ? 1.869   6.117   -1.850  1.00 0.00 ? 43 THR A HG21 13 
ATOM 11342 H HG22 . THR A 1 43 ? 1.616   4.882   -0.629  1.00 0.00 ? 43 THR A HG22 13 
ATOM 11343 H HG23 . THR A 1 43 ? 1.293   6.586   -0.262  1.00 0.00 ? 43 THR A HG23 13 
ATOM 11344 N N    . THR A 1 44 ? -3.462  5.615   0.143   1.00 0.00 ? 44 THR A N    13 
ATOM 11345 C CA   . THR A 1 44 ? -4.626  6.433   0.426   1.00 0.00 ? 44 THR A CA   13 
ATOM 11346 C C    . THR A 1 44 ? -5.452  5.666   1.456   1.00 0.00 ? 44 THR A C    13 
ATOM 11347 O O    . THR A 1 44 ? -5.188  4.504   1.746   1.00 0.00 ? 44 THR A O    13 
ATOM 11348 C CB   . THR A 1 44 ? -5.426  6.692   -0.864  1.00 0.00 ? 44 THR A CB   13 
ATOM 11349 O OG1  . THR A 1 44 ? -5.828  5.441   -1.406  1.00 0.00 ? 44 THR A OG1  13 
ATOM 11350 C CG2  . THR A 1 44 ? -4.601  7.484   -1.890  1.00 0.00 ? 44 THR A CG2  13 
ATOM 11351 H H    . THR A 1 44 ? -3.612  4.628   0.187   1.00 0.00 ? 44 THR A H    13 
ATOM 11352 H HA   . THR A 1 44 ? -4.299  7.369   0.883   1.00 0.00 ? 44 THR A HA   13 
ATOM 11353 H HB   . THR A 1 44 ? -6.302  7.296   -0.598  1.00 0.00 ? 44 THR A HB   13 
ATOM 11354 H HG1  . THR A 1 44 ? -6.517  5.576   -2.072  1.00 0.00 ? 44 THR A HG1  13 
ATOM 11355 H HG21 . THR A 1 44 ? -4.125  8.346   -1.424  1.00 0.00 ? 44 THR A HG21 13 
ATOM 11356 H HG22 . THR A 1 44 ? -5.217  7.871   -2.698  1.00 0.00 ? 44 THR A HG22 13 
ATOM 11357 H HG23 . THR A 1 44 ? -3.821  6.869   -2.339  1.00 0.00 ? 44 THR A HG23 13 
ATOM 11358 N N    . GLU A 1 45 ? -6.454  6.388   1.986   1.00 0.00 ? 45 GLU A N    13 
ATOM 11359 C CA   . GLU A 1 45 ? -7.383  5.786   2.935   1.00 0.00 ? 45 GLU A CA   13 
ATOM 11360 C C    . GLU A 1 45 ? -8.229  4.710   2.221   1.00 0.00 ? 45 GLU A C    13 
ATOM 11361 O O    . GLU A 1 45 ? -8.497  3.649   2.769   1.00 0.00 ? 45 GLU A O    13 
ATOM 11362 C CB   . GLU A 1 45 ? -8.238  6.844   3.684   1.00 0.00 ? 45 GLU A CB   13 
ATOM 11363 C CG   . GLU A 1 45 ? -8.470  8.199   2.978   1.00 0.00 ? 45 GLU A CG   13 
ATOM 11364 C CD   . GLU A 1 45 ? -9.092  8.071   1.582   1.00 0.00 ? 45 GLU A CD   13 
ATOM 11365 O OE1  . GLU A 1 45 ? -10.312 8.046   1.470   1.00 0.00 ? 45 GLU A OE1  13 
ATOM 11366 O OE2  . GLU A 1 45 ? -8.352  7.995   0.602   1.00 0.00 ? 45 GLU A OE2  13 
ATOM 11367 H H    . GLU A 1 45 ? -6.603  7.320   1.654   1.00 0.00 ? 45 GLU A H    13 
ATOM 11368 H HA   . GLU A 1 45 ? -6.773  5.255   3.670   1.00 0.00 ? 45 GLU A HA   13 
ATOM 11369 H HB2  . GLU A 1 45 ? -9.253  6.398   3.879   1.00 0.00 ? 45 GLU A HB2  13 
ATOM 11370 H HB3  . GLU A 1 45 ? -7.640  7.112   4.598   1.00 0.00 ? 45 GLU A HB3  13 
ATOM 11371 H HG2  . GLU A 1 45 ? -9.145  8.802   3.591   1.00 0.00 ? 45 GLU A HG2  13 
ATOM 11372 H HG3  . GLU A 1 45 ? -7.548  8.777   2.913   1.00 0.00 ? 45 GLU A HG3  13 
ATOM 11373 N N    . ASP A 1 46 ? -8.600  5.040   0.968   1.00 0.00 ? 46 ASP A N    13 
ATOM 11374 C CA   . ASP A 1 46 ? -9.395  4.139   0.126   1.00 0.00 ? 46 ASP A CA   13 
ATOM 11375 C C    . ASP A 1 46 ? -8.517  3.700   -1.057  1.00 0.00 ? 46 ASP A C    13 
ATOM 11376 O O    . ASP A 1 46 ? -8.416  4.367   -2.081  1.00 0.00 ? 46 ASP A O    13 
ATOM 11377 C CB   . ASP A 1 46 ? -10.699 4.828   -0.340  1.00 0.00 ? 46 ASP A CB   13 
ATOM 11378 C CG   . ASP A 1 46 ? -11.703 3.808   -0.869  1.00 0.00 ? 46 ASP A CG   13 
ATOM 11379 O OD1  . ASP A 1 46 ? -11.423 3.148   -1.865  1.00 0.00 ? 46 ASP A OD1  13 
ATOM 11380 O OD2  . ASP A 1 46 ? -12.753 3.619   -0.258  1.00 0.00 ? 46 ASP A OD2  13 
ATOM 11381 H H    . ASP A 1 46 ? -8.286  5.942   0.664   1.00 0.00 ? 46 ASP A H    13 
ATOM 11382 H HA   . ASP A 1 46 ? -9.654  3.274   0.740   1.00 0.00 ? 46 ASP A HA   13 
ATOM 11383 H HB2  . ASP A 1 46 ? -11.149 5.358   0.500   1.00 0.00 ? 46 ASP A HB2  13 
ATOM 11384 H HB3  . ASP A 1 46 ? -10.543 5.570   -1.119  1.00 0.00 ? 46 ASP A HB3  13 
ATOM 11385 N N    . TYR A 1 47 ? -7.860  2.543   -0.843  1.00 0.00 ? 47 TYR A N    13 
ATOM 11386 C CA   . TYR A 1 47 ? -6.952  2.053   -1.887  1.00 0.00 ? 47 TYR A CA   13 
ATOM 11387 C C    . TYR A 1 47 ? -7.727  1.618   -3.135  1.00 0.00 ? 47 TYR A C    13 
ATOM 11388 O O    . TYR A 1 47 ? -7.285  1.821   -4.260  1.00 0.00 ? 47 TYR A O    13 
ATOM 11389 C CB   . TYR A 1 47 ? -6.113  0.863   -1.377  1.00 0.00 ? 47 TYR A CB   13 
ATOM 11390 C CG   . TYR A 1 47 ? -5.284  0.297   -2.497  1.00 0.00 ? 47 TYR A CG   13 
ATOM 11391 C CD1  . TYR A 1 47 ? -4.140  0.942   -2.932  1.00 0.00 ? 47 TYR A CD1  13 
ATOM 11392 C CD2  . TYR A 1 47 ? -5.673  -0.869  -3.142  1.00 0.00 ? 47 TYR A CD2  13 
ATOM 11393 C CE1  . TYR A 1 47 ? -3.396  0.413   -3.968  1.00 0.00 ? 47 TYR A CE1  13 
ATOM 11394 C CE2  . TYR A 1 47 ? -4.916  -1.412  -4.166  1.00 0.00 ? 47 TYR A CE2  13 
ATOM 11395 C CZ   . TYR A 1 47 ? -3.763  -0.768  -4.582  1.00 0.00 ? 47 TYR A CZ   13 
ATOM 11396 O OH   . TYR A 1 47 ? -2.973  -1.278  -5.591  1.00 0.00 ? 47 TYR A OH   13 
ATOM 11397 H H    . TYR A 1 47 ? -8.045  2.043   0.015   1.00 0.00 ? 47 TYR A H    13 
ATOM 11398 H HA   . TYR A 1 47 ? -6.285  2.868   -2.212  1.00 0.00 ? 47 TYR A HA   13 
ATOM 11399 H HB2  . TYR A 1 47 ? -5.461  1.181   -0.563  1.00 0.00 ? 47 TYR A HB2  13 
ATOM 11400 H HB3  . TYR A 1 47 ? -6.730  0.048   -0.986  1.00 0.00 ? 47 TYR A HB3  13 
ATOM 11401 H HD1  . TYR A 1 47 ? -3.830  1.869   -2.486  1.00 0.00 ? 47 TYR A HD1  13 
ATOM 11402 H HD2  . TYR A 1 47 ? -6.595  -1.344  -2.871  1.00 0.00 ? 47 TYR A HD2  13 
ATOM 11403 H HE1  . TYR A 1 47 ? -2.523  0.932   -4.297  1.00 0.00 ? 47 TYR A HE1  13 
ATOM 11404 H HE2  . TYR A 1 47 ? -5.249  -2.331  -4.613  1.00 0.00 ? 47 TYR A HE2  13 
ATOM 11405 H HH   . TYR A 1 47 ? -2.836  -2.206  -5.454  1.00 0.00 ? 47 TYR A HH   13 
ATOM 11406 N N    . ASP A 1 48 ? -8.883  0.980   -2.872  1.00 0.00 ? 48 ASP A N    13 
ATOM 11407 C CA   . ASP A 1 48 ? -9.660  0.427   -3.974  1.00 0.00 ? 48 ASP A CA   13 
ATOM 11408 C C    . ASP A 1 48 ? -9.977  1.508   -5.029  1.00 0.00 ? 48 ASP A C    13 
ATOM 11409 O O    . ASP A 1 48 ? -9.935  1.276   -6.234  1.00 0.00 ? 48 ASP A O    13 
ATOM 11410 C CB   . ASP A 1 48 ? -10.956 -0.228  -3.450  1.00 0.00 ? 48 ASP A CB   13 
ATOM 11411 C CG   . ASP A 1 48 ? -10.658 -1.412  -2.508  1.00 0.00 ? 48 ASP A CG   13 
ATOM 11412 O OD1  . ASP A 1 48 ? -10.044 -2.377  -2.946  1.00 0.00 ? 48 ASP A OD1  13 
ATOM 11413 O OD2  . ASP A 1 48 ? -11.040 -1.368  -1.337  1.00 0.00 ? 48 ASP A OD2  13 
ATOM 11414 H H    . ASP A 1 48 ? -9.199  0.871   -1.930  1.00 0.00 ? 48 ASP A H    13 
ATOM 11415 H HA   . ASP A 1 48 ? -9.056  -0.350  -4.450  1.00 0.00 ? 48 ASP A HA   13 
ATOM 11416 H HB2  . ASP A 1 48 ? -11.585 0.510   -2.943  1.00 0.00 ? 48 ASP A HB2  13 
ATOM 11417 H HB3  . ASP A 1 48 ? -11.520 -0.638  -4.295  1.00 0.00 ? 48 ASP A HB3  13 
ATOM 11418 N N    . ARG A 1 49 ? -10.291 2.705   -4.503  1.00 0.00 ? 49 ARG A N    13 
ATOM 11419 C CA   . ARG A 1 49 ? -10.586 3.845   -5.360  1.00 0.00 ? 49 ARG A CA   13 
ATOM 11420 C C    . ARG A 1 49 ? -9.360  4.246   -6.224  1.00 0.00 ? 49 ARG A C    13 
ATOM 11421 O O    . ARG A 1 49 ? -9.436  4.209   -7.449  1.00 0.00 ? 49 ARG A O    13 
ATOM 11422 C CB   . ARG A 1 49 ? -11.115 5.008   -4.487  1.00 0.00 ? 49 ARG A CB   13 
ATOM 11423 C CG   . ARG A 1 49 ? -11.401 6.337   -5.215  1.00 0.00 ? 49 ARG A CG   13 
ATOM 11424 C CD   . ARG A 1 49 ? -10.640 7.503   -4.531  1.00 0.00 ? 49 ARG A CD   13 
ATOM 11425 N NE   . ARG A 1 49 ? -11.306 7.853   -3.268  1.00 0.00 ? 49 ARG A NE   13 
ATOM 11426 C CZ   . ARG A 1 49 ? -10.676 7.991   -2.074  1.00 0.00 ? 49 ARG A CZ   13 
ATOM 11427 N NH1  . ARG A 1 49 ? -9.365  7.840   -1.934  1.00 0.00 ? 49 ARG A NH1  13 
ATOM 11428 N NH2  . ARG A 1 49 ? -11.397 8.265   -0.993  1.00 0.00 ? 49 ARG A NH2  13 
ATOM 11429 H H    . ARG A 1 49 ? -10.310 2.809   -3.503  1.00 0.00 ? 49 ARG A H    13 
ATOM 11430 H HA   . ARG A 1 49 ? -11.374 3.507   -6.037  1.00 0.00 ? 49 ARG A HA   13 
ATOM 11431 H HB2  . ARG A 1 49 ? -12.027 4.677   -3.986  1.00 0.00 ? 49 ARG A HB2  13 
ATOM 11432 H HB3  . ARG A 1 49 ? -10.410 5.216   -3.684  1.00 0.00 ? 49 ARG A HB3  13 
ATOM 11433 H HG2  . ARG A 1 49 ? -11.134 6.264   -6.274  1.00 0.00 ? 49 ARG A HG2  13 
ATOM 11434 H HG3  . ARG A 1 49 ? -12.484 6.524   -5.222  1.00 0.00 ? 49 ARG A HG3  13 
ATOM 11435 H HD2  . ARG A 1 49 ? -9.596  7.231   -4.320  1.00 0.00 ? 49 ARG A HD2  13 
ATOM 11436 H HD3  . ARG A 1 49 ? -10.627 8.403   -5.154  1.00 0.00 ? 49 ARG A HD3  13 
ATOM 11437 H HE   . ARG A 1 49 ? -12.302 7.960   -3.279  1.00 0.00 ? 49 ARG A HE   13 
ATOM 11438 H HH11 . ARG A 1 49 ? -8.759  7.580   -2.702  1.00 0.00 ? 49 ARG A HH11 13 
ATOM 11439 H HH12 . ARG A 1 49 ? -8.935  7.959   -1.029  1.00 0.00 ? 49 ARG A HH12 13 
ATOM 11440 H HH21 . ARG A 1 49 ? -12.381 8.421   -1.029  1.00 0.00 ? 49 ARG A HH21 13 
ATOM 11441 H HH22 . ARG A 1 49 ? -10.941 8.298   -0.091  1.00 0.00 ? 49 ARG A HH22 13 
ATOM 11442 N N    . ASP A 1 50 ? -8.269  4.649   -5.543  1.00 0.00 ? 50 ASP A N    13 
ATOM 11443 C CA   . ASP A 1 50 ? -7.091  5.201   -6.225  1.00 0.00 ? 50 ASP A CA   13 
ATOM 11444 C C    . ASP A 1 50 ? -6.270  4.192   -7.061  1.00 0.00 ? 50 ASP A C    13 
ATOM 11445 O O    . ASP A 1 50 ? -5.883  4.474   -8.187  1.00 0.00 ? 50 ASP A O    13 
ATOM 11446 C CB   . ASP A 1 50 ? -6.182  5.876   -5.184  1.00 0.00 ? 50 ASP A CB   13 
ATOM 11447 C CG   . ASP A 1 50 ? -6.969  6.946   -4.419  1.00 0.00 ? 50 ASP A CG   13 
ATOM 11448 O OD1  . ASP A 1 50 ? -7.174  8.036   -4.941  1.00 0.00 ? 50 ASP A OD1  13 
ATOM 11449 O OD2  . ASP A 1 50 ? -7.386  6.678   -3.299  1.00 0.00 ? 50 ASP A OD2  13 
ATOM 11450 H H    . ASP A 1 50 ? -8.265  4.651   -4.539  1.00 0.00 ? 50 ASP A H    13 
ATOM 11451 H HA   . ASP A 1 50 ? -7.445  5.981   -6.903  1.00 0.00 ? 50 ASP A HA   13 
ATOM 11452 H HB2  . ASP A 1 50 ? -5.812  5.119   -4.469  1.00 0.00 ? 50 ASP A HB2  13 
ATOM 11453 H HB3  . ASP A 1 50 ? -5.354  6.399   -5.691  1.00 0.00 ? 50 ASP A HB3  13 
ATOM 11454 N N    . LYS A 1 51 ? -5.984  3.037   -6.429  1.00 0.00 ? 51 LYS A N    13 
ATOM 11455 C CA   . LYS A 1 51 ? -5.192  1.946   -7.020  1.00 0.00 ? 51 LYS A CA   13 
ATOM 11456 C C    . LYS A 1 51 ? -3.696  2.279   -7.123  1.00 0.00 ? 51 LYS A C    13 
ATOM 11457 O O    . LYS A 1 51 ? -2.981  1.749   -7.967  1.00 0.00 ? 51 LYS A O    13 
ATOM 11458 C CB   . LYS A 1 51 ? -5.694  1.468   -8.385  1.00 0.00 ? 51 LYS A CB   13 
ATOM 11459 C CG   . LYS A 1 51 ? -7.235  1.224   -8.341  1.00 0.00 ? 51 LYS A CG   13 
ATOM 11460 C CD   . LYS A 1 51 ? -7.875  2.009   -9.479  1.00 0.00 ? 51 LYS A CD   13 
ATOM 11461 C CE   . LYS A 1 51 ? -9.338  1.657   -9.754  1.00 0.00 ? 51 LYS A CE   13 
ATOM 11462 N NZ   . LYS A 1 51 ? -10.193 2.089   -8.657  1.00 0.00 ? 51 LYS A NZ   13 
ATOM 11463 H H    . LYS A 1 51 ? -6.392  2.899   -5.525  1.00 0.00 ? 51 LYS A H    13 
ATOM 11464 H HA   . LYS A 1 51 ? -5.331  1.112   -6.344  1.00 0.00 ? 51 LYS A HA   13 
ATOM 11465 H HB2  . LYS A 1 51 ? -5.460  2.306   -9.114  1.00 0.00 ? 51 LYS A HB2  13 
ATOM 11466 H HB3  . LYS A 1 51 ? -5.111  0.519   -8.596  1.00 0.00 ? 51 LYS A HB3  13 
ATOM 11467 H HG2  . LYS A 1 51 ? -7.546  0.174   -8.419  1.00 0.00 ? 51 LYS A HG2  13 
ATOM 11468 H HG3  . LYS A 1 51 ? -7.653  1.542   -7.382  1.00 0.00 ? 51 LYS A HG3  13 
ATOM 11469 H HD2  . LYS A 1 51 ? -7.770  3.080   -9.303  1.00 0.00 ? 51 LYS A HD2  13 
ATOM 11470 H HD3  . LYS A 1 51 ? -7.260  1.787   -10.343 1.00 0.00 ? 51 LYS A HD3  13 
ATOM 11471 H HE2  . LYS A 1 51 ? -9.679  2.158   -10.662 1.00 0.00 ? 51 LYS A HE2  13 
ATOM 11472 H HE3  . LYS A 1 51 ? -9.469  0.583   -9.898  1.00 0.00 ? 51 LYS A HE3  13 
ATOM 11473 H HZ1  . LYS A 1 51 ? -11.199 1.934   -8.854  1.00 0.00 ? 51 LYS A HZ1  13 
ATOM 11474 H HZ2  . LYS A 1 51 ? -10.019 3.099   -8.455  1.00 0.00 ? 51 LYS A HZ2  13 
ATOM 11475 H HZ3  . LYS A 1 51 ? -9.936  1.571   -7.789  1.00 0.00 ? 51 LYS A HZ3  13 
ATOM 11476 N N    . LYS A 1 52 ? -3.265  3.187   -6.232  1.00 0.00 ? 52 LYS A N    13 
ATOM 11477 C CA   . LYS A 1 52 ? -1.869  3.594   -6.231  1.00 0.00 ? 52 LYS A CA   13 
ATOM 11478 C C    . LYS A 1 52 ? -1.256  3.118   -4.905  1.00 0.00 ? 52 LYS A C    13 
ATOM 11479 O O    . LYS A 1 52 ? -1.870  3.261   -3.848  1.00 0.00 ? 52 LYS A O    13 
ATOM 11480 C CB   . LYS A 1 52 ? -1.768  5.118   -6.412  1.00 0.00 ? 52 LYS A CB   13 
ATOM 11481 C CG   . LYS A 1 52 ? -2.197  5.592   -7.824  1.00 0.00 ? 52 LYS A CG   13 
ATOM 11482 C CD   . LYS A 1 52 ? -1.002  6.030   -8.696  1.00 0.00 ? 52 LYS A CD   13 
ATOM 11483 C CE   . LYS A 1 52 ? -0.402  7.382   -8.262  1.00 0.00 ? 52 LYS A CE   13 
ATOM 11484 N NZ   . LYS A 1 52 ? -1.070  8.541   -8.848  1.00 0.00 ? 52 LYS A NZ   13 
ATOM 11485 H H    . LYS A 1 52 ? -3.891  3.569   -5.555  1.00 0.00 ? 52 LYS A H    13 
ATOM 11486 H HA   . LYS A 1 52 ? -1.369  3.068   -7.042  1.00 0.00 ? 52 LYS A HA   13 
ATOM 11487 H HB2  . LYS A 1 52 ? -2.365  5.620   -5.649  1.00 0.00 ? 52 LYS A HB2  13 
ATOM 11488 H HB3  . LYS A 1 52 ? -0.734  5.415   -6.244  1.00 0.00 ? 52 LYS A HB3  13 
ATOM 11489 H HG2  . LYS A 1 52 ? -2.734  4.791   -8.344  1.00 0.00 ? 52 LYS A HG2  13 
ATOM 11490 H HG3  . LYS A 1 52 ? -2.923  6.405   -7.751  1.00 0.00 ? 52 LYS A HG3  13 
ATOM 11491 H HD2  . LYS A 1 52 ? -0.194  5.255   -8.534  1.00 0.00 ? 52 LYS A HD2  13 
ATOM 11492 H HD3  . LYS A 1 52 ? -1.393  6.165   -9.749  1.00 0.00 ? 52 LYS A HD3  13 
ATOM 11493 H HE2  . LYS A 1 52 ? -0.403  7.512   -7.179  1.00 0.00 ? 52 LYS A HE2  13 
ATOM 11494 H HE3  . LYS A 1 52 ? 0.646   7.444   -8.572  1.00 0.00 ? 52 LYS A HE3  13 
ATOM 11495 H HZ1  . LYS A 1 52 ? -0.689  9.415   -8.411  1.00 0.00 ? 52 LYS A HZ1  13 
ATOM 11496 H HZ2  . LYS A 1 52 ? -2.104  8.519   -8.786  1.00 0.00 ? 52 LYS A HZ2  13 
ATOM 11497 H HZ3  . LYS A 1 52 ? -0.742  8.658   -9.837  1.00 0.00 ? 52 LYS A HZ3  13 
ATOM 11498 N N    . TYR A 1 53 ? -0.067  2.490   -5.035  1.00 0.00 ? 53 TYR A N    13 
ATOM 11499 C CA   . TYR A 1 53 ? 0.617   1.849   -3.922  1.00 0.00 ? 53 TYR A CA   13 
ATOM 11500 C C    . TYR A 1 53 ? 2.138   2.103   -3.965  1.00 0.00 ? 53 TYR A C    13 
ATOM 11501 O O    . TYR A 1 53 ? 2.713   2.649   -4.904  1.00 0.00 ? 53 TYR A O    13 
ATOM 11502 C CB   . TYR A 1 53 ? 0.354   0.321   -3.985  1.00 0.00 ? 53 TYR A CB   13 
ATOM 11503 C CG   . TYR A 1 53 ? 0.968   -0.373  -5.176  1.00 0.00 ? 53 TYR A CG   13 
ATOM 11504 C CD1  . TYR A 1 53 ? 0.272   -0.489  -6.371  1.00 0.00 ? 53 TYR A CD1  13 
ATOM 11505 C CD2  . TYR A 1 53 ? 2.235   -0.938  -5.089  1.00 0.00 ? 53 TYR A CD2  13 
ATOM 11506 C CE1  . TYR A 1 53 ? 0.812   -1.182  -7.447  1.00 0.00 ? 53 TYR A CE1  13 
ATOM 11507 C CE2  . TYR A 1 53 ? 2.781   -1.629  -6.157  1.00 0.00 ? 53 TYR A CE2  13 
ATOM 11508 C CZ   . TYR A 1 53 ? 2.069   -1.765  -7.337  1.00 0.00 ? 53 TYR A CZ   13 
ATOM 11509 O OH   . TYR A 1 53 ? 2.623   -2.500  -8.372  1.00 0.00 ? 53 TYR A OH   13 
ATOM 11510 H H    . TYR A 1 53 ? 0.397   2.447   -5.921  1.00 0.00 ? 53 TYR A H    13 
ATOM 11511 H HA   . TYR A 1 53 ? 0.223   2.277   -2.998  1.00 0.00 ? 53 TYR A HA   13 
ATOM 11512 H HB2  . TYR A 1 53 ? 0.731   -0.174  -3.095  1.00 0.00 ? 53 TYR A HB2  13 
ATOM 11513 H HB3  . TYR A 1 53 ? -0.709  0.095   -3.972  1.00 0.00 ? 53 TYR A HB3  13 
ATOM 11514 H HD1  . TYR A 1 53 ? -0.704  -0.040  -6.454  1.00 0.00 ? 53 TYR A HD1  13 
ATOM 11515 H HD2  . TYR A 1 53 ? 2.807   -0.846  -4.181  1.00 0.00 ? 53 TYR A HD2  13 
ATOM 11516 H HE1  . TYR A 1 53 ? 0.226   -1.264  -8.348  1.00 0.00 ? 53 TYR A HE1  13 
ATOM 11517 H HE2  . TYR A 1 53 ? 3.761   -2.065  -6.055  1.00 0.00 ? 53 TYR A HE2  13 
ATOM 11518 H HH   . TYR A 1 53 ? 2.496   -2.028  -9.189  1.00 0.00 ? 53 TYR A HH   13 
ATOM 11519 N N    . GLY A 1 54 ? 2.725   1.589   -2.873  1.00 0.00 ? 54 GLY A N    13 
ATOM 11520 C CA   . GLY A 1 54 ? 4.168   1.562   -2.627  1.00 0.00 ? 54 GLY A CA   13 
ATOM 11521 C C    . GLY A 1 54 ? 4.563   0.114   -2.244  1.00 0.00 ? 54 GLY A C    13 
ATOM 11522 O O    . GLY A 1 54 ? 3.689   -0.719  -2.031  1.00 0.00 ? 54 GLY A O    13 
ATOM 11523 H H    . GLY A 1 54 ? 2.064   1.188   -2.229  1.00 0.00 ? 54 GLY A H    13 
ATOM 11524 H HA2  . GLY A 1 54 ? 4.712   1.971   -3.487  1.00 0.00 ? 54 GLY A HA2  13 
ATOM 11525 H HA3  . GLY A 1 54 ? 4.345   2.216   -1.780  1.00 0.00 ? 54 GLY A HA3  13 
ATOM 11526 N N    . PHE A 1 55 ? 5.887   -0.159  -2.148  1.00 0.00 ? 55 PHE A N    13 
ATOM 11527 C CA   . PHE A 1 55 ? 6.366   -1.486  -1.741  1.00 0.00 ? 55 PHE A CA   13 
ATOM 11528 C C    . PHE A 1 55 ? 6.699   -1.333  -0.261  1.00 0.00 ? 55 PHE A C    13 
ATOM 11529 O O    . PHE A 1 55 ? 6.865   -0.220  0.216   1.00 0.00 ? 55 PHE A O    13 
ATOM 11530 C CB   . PHE A 1 55 ? 7.611   -1.994  -2.499  1.00 0.00 ? 55 PHE A CB   13 
ATOM 11531 C CG   . PHE A 1 55 ? 7.296   -2.443  -3.901  1.00 0.00 ? 55 PHE A CG   13 
ATOM 11532 C CD1  . PHE A 1 55 ? 6.770   -1.557  -4.828  1.00 0.00 ? 55 PHE A CD1  13 
ATOM 11533 C CD2  . PHE A 1 55 ? 7.540   -3.753  -4.298  1.00 0.00 ? 55 PHE A CD2  13 
ATOM 11534 C CE1  . PHE A 1 55 ? 6.509   -1.953  -6.130  1.00 0.00 ? 55 PHE A CE1  13 
ATOM 11535 C CE2  . PHE A 1 55 ? 7.266   -4.161  -5.596  1.00 0.00 ? 55 PHE A CE2  13 
ATOM 11536 C CZ   . PHE A 1 55 ? 6.755   -3.260  -6.519  1.00 0.00 ? 55 PHE A CZ   13 
ATOM 11537 H H    . PHE A 1 55 ? 6.593   0.529   -2.276  1.00 0.00 ? 55 PHE A H    13 
ATOM 11538 H HA   . PHE A 1 55 ? 5.570   -2.217  -1.849  1.00 0.00 ? 55 PHE A HA   13 
ATOM 11539 H HB2  . PHE A 1 55 ? 8.414   -1.251  -2.538  1.00 0.00 ? 55 PHE A HB2  13 
ATOM 11540 H HB3  . PHE A 1 55 ? 7.995   -2.879  -1.977  1.00 0.00 ? 55 PHE A HB3  13 
ATOM 11541 H HD1  . PHE A 1 55 ? 6.565   -0.546  -4.530  1.00 0.00 ? 55 PHE A HD1  13 
ATOM 11542 H HD2  . PHE A 1 55 ? 7.953   -4.462  -3.598  1.00 0.00 ? 55 PHE A HD2  13 
ATOM 11543 H HE1  . PHE A 1 55 ? 6.122   -1.229  -6.830  1.00 0.00 ? 55 PHE A HE1  13 
ATOM 11544 H HE2  . PHE A 1 55 ? 7.459   -5.181  -5.882  1.00 0.00 ? 55 PHE A HE2  13 
ATOM 11545 H HZ   . PHE A 1 55 ? 6.557   -3.571  -7.534  1.00 0.00 ? 55 PHE A HZ   13 
ATOM 11546 N N    . CYS A 1 56 ? 6.719   -2.490  0.426   1.00 0.00 ? 56 CYS A N    13 
ATOM 11547 C CA   . CYS A 1 56 ? 6.878   -2.454  1.913   1.00 0.00 ? 56 CYS A CA   13 
ATOM 11548 C C    . CYS A 1 56 ? 8.098   -1.619  2.363   1.00 0.00 ? 56 CYS A C    13 
ATOM 11549 O O    . CYS A 1 56 ? 9.231   -2.019  2.118   1.00 0.00 ? 56 CYS A O    13 
ATOM 11550 C CB   . CYS A 1 56 ? 7.105   -3.880  2.503   1.00 0.00 ? 56 CYS A CB   13 
ATOM 11551 S SG   . CYS A 1 56 ? 6.570   -3.890  4.234   1.00 0.00 ? 56 CYS A SG   13 
ATOM 11552 H H    . CYS A 1 56 ? 6.621   -3.284  -0.213  1.00 0.00 ? 56 CYS A H    13 
ATOM 11553 H HA   . CYS A 1 56 ? 5.999   -1.957  2.381   1.00 0.00 ? 56 CYS A HA   13 
ATOM 11554 H HB2  . CYS A 1 56 ? 6.596   -4.715  1.988   1.00 0.00 ? 56 CYS A HB2  13 
ATOM 11555 H HB3  . CYS A 1 56 ? 8.175   -4.139  2.486   1.00 0.00 ? 56 CYS A HB3  13 
ATOM 11556 N N    . PRO A 1 57 ? 7.863   -0.466  3.063   1.00 0.00 ? 57 PRO A N    13 
ATOM 11557 C CA   . PRO A 1 57 ? 8.982   0.254   3.663   1.00 0.00 ? 57 PRO A CA   13 
ATOM 11558 C C    . PRO A 1 57 ? 9.169   0.002   5.168   1.00 0.00 ? 57 PRO A C    13 
ATOM 11559 O O    . PRO A 1 57 ? 10.101  0.497   5.787   1.00 0.00 ? 57 PRO A O    13 
ATOM 11560 C CB   . PRO A 1 57 ? 8.613   1.715   3.416   1.00 0.00 ? 57 PRO A CB   13 
ATOM 11561 C CG   . PRO A 1 57 ? 7.088   1.734   3.202   1.00 0.00 ? 57 PRO A CG   13 
ATOM 11562 C CD   . PRO A 1 57 ? 6.600   0.288   3.158   1.00 0.00 ? 57 PRO A CD   13 
ATOM 11563 H HA   . PRO A 1 57 ? 9.921   -0.011  3.195   1.00 0.00 ? 57 PRO A HA   13 
ATOM 11564 H HB2  . PRO A 1 57 ? 8.957   2.382   4.206   1.00 0.00 ? 57 PRO A HB2  13 
ATOM 11565 H HB3  . PRO A 1 57 ? 9.101   2.046   2.499   1.00 0.00 ? 57 PRO A HB3  13 
ATOM 11566 H HG2  . PRO A 1 57 ? 6.544   2.242   3.986   1.00 0.00 ? 57 PRO A HG2  13 
ATOM 11567 H HG3  . PRO A 1 57 ? 6.866   2.248   2.264   1.00 0.00 ? 57 PRO A HG3  13 
ATOM 11568 H HD2  . PRO A 1 57 ? 6.039   0.041   4.090   1.00 0.00 ? 57 PRO A HD2  13 
ATOM 11569 H HD3  . PRO A 1 57 ? 5.965   0.203   2.264   1.00 0.00 ? 57 PRO A HD3  13 
ATOM 11570 N N    . GLU A 1 58 ? 8.220   -0.785  5.693   1.00 0.00 ? 58 GLU A N    13 
ATOM 11571 C CA   . GLU A 1 58 ? 8.159   -1.158  7.098   1.00 0.00 ? 58 GLU A CA   13 
ATOM 11572 C C    . GLU A 1 58 ? 6.994   -2.142  7.259   1.00 0.00 ? 58 GLU A C    13 
ATOM 11573 O O    . GLU A 1 58 ? 5.930   -1.937  6.692   1.00 0.00 ? 58 GLU A O    13 
ATOM 11574 C CB   . GLU A 1 58 ? 7.911   0.085   7.973   1.00 0.00 ? 58 GLU A CB   13 
ATOM 11575 C CG   . GLU A 1 58 ? 7.795   -0.203  9.482   1.00 0.00 ? 58 GLU A CG   13 
ATOM 11576 C CD   . GLU A 1 58 ? 9.046   -0.910  10.027  1.00 0.00 ? 58 GLU A CD   13 
ATOM 11577 O OE1  . GLU A 1 58 ? 9.131   -2.131  9.897   1.00 0.00 ? 58 GLU A OE1  13 
ATOM 11578 O OE2  . GLU A 1 58 ? 9.916   -0.235  10.571  1.00 0.00 ? 58 GLU A OE2  13 
ATOM 11579 H H    . GLU A 1 58 ? 7.525   -1.115  5.063   1.00 0.00 ? 58 GLU A H    13 
ATOM 11580 H HA   . GLU A 1 58 ? 9.107   -1.645  7.334   1.00 0.00 ? 58 GLU A HA   13 
ATOM 11581 H HB2  . GLU A 1 58 ? 8.739   0.783   7.815   1.00 0.00 ? 58 GLU A HB2  13 
ATOM 11582 H HB3  . GLU A 1 58 ? 6.987   0.572   7.641   1.00 0.00 ? 58 GLU A HB3  13 
ATOM 11583 H HG2  . GLU A 1 58 ? 7.653   0.731   10.027  1.00 0.00 ? 58 GLU A HG2  13 
ATOM 11584 H HG3  . GLU A 1 58 ? 6.922   -0.819  9.697   1.00 0.00 ? 58 GLU A HG3  13 
ATOM 11585 N N    . THR A 1 59 ? 7.280   -3.195  8.043   1.00 0.00 ? 59 THR A N    13 
ATOM 11586 C CA   . THR A 1 59 ? 6.404   -4.303  8.429   1.00 0.00 ? 59 THR A CA   13 
ATOM 11587 C C    . THR A 1 59 ? 7.294   -5.315  9.171   1.00 0.00 ? 59 THR A C    13 
ATOM 11588 O O    . THR A 1 59 ? 6.959   -5.815  10.238  1.00 0.00 ? 59 THR A O    13 
ATOM 11589 C CB   . THR A 1 59 ? 5.659   -4.988  7.250   1.00 0.00 ? 59 THR A CB   13 
ATOM 11590 O OG1  . THR A 1 59 ? 4.632   -4.165  6.725   1.00 0.00 ? 59 THR A OG1  13 
ATOM 11591 C CG2  . THR A 1 59 ? 4.932   -6.278  7.658   1.00 0.00 ? 59 THR A CG2  13 
ATOM 11592 H H    . THR A 1 59 ? 8.193   -3.157  8.465   1.00 0.00 ? 59 THR A H    13 
ATOM 11593 H HA   . THR A 1 59 ? 5.692   -3.894  9.146   1.00 0.00 ? 59 THR A HA   13 
ATOM 11594 H HB   . THR A 1 59 ? 6.374   -5.257  6.463   1.00 0.00 ? 59 THR A HB   13 
ATOM 11595 H HG1  . THR A 1 59 ? 5.031   -3.378  6.338   1.00 0.00 ? 59 THR A HG1  13 
ATOM 11596 H HG21 . THR A 1 59 ? 4.356   -6.677  6.823   1.00 0.00 ? 59 THR A HG21 13 
ATOM 11597 H HG22 . THR A 1 59 ? 4.240   -6.094  8.480   1.00 0.00 ? 59 THR A HG22 13 
ATOM 11598 H HG23 . THR A 1 59 ? 5.628   -7.055  7.973   1.00 0.00 ? 59 THR A HG23 13 
ATOM 11599 N N    . ALA A 1 60 ? 8.440   -5.569  8.515   1.00 0.00 ? 60 ALA A N    13 
ATOM 11600 C CA   . ALA A 1 60 ? 9.466   -6.477  8.996   1.00 0.00 ? 60 ALA A CA   13 
ATOM 11601 C C    . ALA A 1 60 ? 10.687  -6.319  8.072   1.00 0.00 ? 60 ALA A C    13 
ATOM 11602 O O    . ALA A 1 60 ? 11.776  -6.743  8.454   1.00 0.00 ? 60 ALA A O    13 
ATOM 11603 C CB   . ALA A 1 60 ? 8.971   -7.930  8.968   1.00 0.00 ? 60 ALA A CB   13 
ATOM 11604 O OXT  . ALA A 1 60 ? 10.529  -5.771  6.978   1.00 0.00 ? 60 ALA A OXT  13 
ATOM 11605 H H    . ALA A 1 60 ? 8.687   -5.139  7.645   1.00 0.00 ? 60 ALA A H    13 
ATOM 11606 H HA   . ALA A 1 60 ? 9.733   -6.160  10.006  1.00 0.00 ? 60 ALA A HA   13 
ATOM 11607 H HB1  . ALA A 1 60 ? 8.681   -8.226  7.959   1.00 0.00 ? 60 ALA A HB1  13 
ATOM 11608 H HB2  . ALA A 1 60 ? 8.111   -8.068  9.622   1.00 0.00 ? 60 ALA A HB2  13 
ATOM 11609 H HB3  . ALA A 1 60 ? 9.753   -8.611  9.304   1.00 0.00 ? 60 ALA A HB3  13 
ATOM 11610 N N    . THR A 1 1  ? 7.346   7.817   10.698  1.00 0.00 ? 1  THR A N    14 
ATOM 11611 C CA   . THR A 1 1  ? 7.973   6.780   9.899   1.00 0.00 ? 1  THR A CA   14 
ATOM 11612 C C    . THR A 1 1  ? 8.097   7.424   8.525   1.00 0.00 ? 1  THR A C    14 
ATOM 11613 O O    . THR A 1 1  ? 7.697   8.575   8.400   1.00 0.00 ? 1  THR A O    14 
ATOM 11614 C CB   . THR A 1 1  ? 7.020   5.568   9.927   1.00 0.00 ? 1  THR A CB   14 
ATOM 11615 O OG1  . THR A 1 1  ? 5.726   6.093   10.204  1.00 0.00 ? 1  THR A OG1  14 
ATOM 11616 C CG2  . THR A 1 1  ? 7.421   4.568   11.022  1.00 0.00 ? 1  THR A CG2  14 
ATOM 11617 H H1   . THR A 1 1  ? 7.755   7.922   11.644  1.00 0.00 ? 1  THR A H1   14 
ATOM 11618 H H2   . THR A 1 1  ? 6.349   7.499   10.740  1.00 0.00 ? 1  THR A H2   14 
ATOM 11619 H H3   . THR A 1 1  ? 7.403   8.687   10.116  1.00 0.00 ? 1  THR A H3   14 
ATOM 11620 H HA   . THR A 1 1  ? 8.970   6.570   10.289  1.00 0.00 ? 1  THR A HA   14 
ATOM 11621 H HB   . THR A 1 1  ? 7.028   5.053   8.958   1.00 0.00 ? 1  THR A HB   14 
ATOM 11622 H HG1  . THR A 1 1  ? 5.067   5.397   10.179  1.00 0.00 ? 1  THR A HG1  14 
ATOM 11623 H HG21 . THR A 1 1  ? 6.774   3.690   11.026  1.00 0.00 ? 1  THR A HG21 14 
ATOM 11624 H HG22 . THR A 1 1  ? 7.373   5.021   12.012  1.00 0.00 ? 1  THR A HG22 14 
ATOM 11625 H HG23 . THR A 1 1  ? 8.440   4.211   10.869  1.00 0.00 ? 1  THR A HG23 14 
ATOM 11626 N N    . ALA A 1 2  ? 8.645   6.678   7.548   1.00 0.00 ? 2  ALA A N    14 
ATOM 11627 C CA   . ALA A 1 2  ? 8.790   7.204   6.197   1.00 0.00 ? 2  ALA A CA   14 
ATOM 11628 C C    . ALA A 1 2  ? 8.611   6.025   5.236   1.00 0.00 ? 2  ALA A C    14 
ATOM 11629 O O    . ALA A 1 2  ? 9.408   5.096   5.220   1.00 0.00 ? 2  ALA A O    14 
ATOM 11630 C CB   . ALA A 1 2  ? 10.170  7.849   6.033   1.00 0.00 ? 2  ALA A CB   14 
ATOM 11631 H H    . ALA A 1 2  ? 8.969   5.741   7.693   1.00 0.00 ? 2  ALA A H    14 
ATOM 11632 H HA   . ALA A 1 2  ? 8.002   7.940   6.023   1.00 0.00 ? 2  ALA A HA   14 
ATOM 11633 H HB1  . ALA A 1 2  ? 10.270  8.291   5.042   1.00 0.00 ? 2  ALA A HB1  14 
ATOM 11634 H HB2  . ALA A 1 2  ? 10.973  7.123   6.163   1.00 0.00 ? 2  ALA A HB2  14 
ATOM 11635 H HB3  . ALA A 1 2  ? 10.317  8.647   6.761   1.00 0.00 ? 2  ALA A HB3  14 
ATOM 11636 N N    . LEU A 1 3  ? 7.499   6.103   4.486   1.00 0.00 ? 3  LEU A N    14 
ATOM 11637 C CA   . LEU A 1 3  ? 7.115   5.056   3.545   1.00 0.00 ? 3  LEU A CA   14 
ATOM 11638 C C    . LEU A 1 3  ? 7.086   5.685   2.137   1.00 0.00 ? 3  LEU A C    14 
ATOM 11639 O O    . LEU A 1 3  ? 6.062   6.158   1.653   1.00 0.00 ? 3  LEU A O    14 
ATOM 11640 C CB   . LEU A 1 3  ? 5.737   4.455   3.907   1.00 0.00 ? 3  LEU A CB   14 
ATOM 11641 C CG   . LEU A 1 3  ? 5.728   3.293   4.929   1.00 0.00 ? 3  LEU A CG   14 
ATOM 11642 C CD1  . LEU A 1 3  ? 5.979   1.930   4.272   1.00 0.00 ? 3  LEU A CD1  14 
ATOM 11643 C CD2  . LEU A 1 3  ? 6.648   3.496   6.137   1.00 0.00 ? 3  LEU A CD2  14 
ATOM 11644 H H    . LEU A 1 3  ? 6.941   6.928   4.555   1.00 0.00 ? 3  LEU A H    14 
ATOM 11645 H HA   . LEU A 1 3  ? 7.867   4.263   3.551   1.00 0.00 ? 3  LEU A HA   14 
ATOM 11646 H HB2  . LEU A 1 3  ? 5.063   5.249   4.335   1.00 0.00 ? 3  LEU A HB2  14 
ATOM 11647 H HB3  . LEU A 1 3  ? 5.393   3.998   2.948   1.00 0.00 ? 3  LEU A HB3  14 
ATOM 11648 H HG   . LEU A 1 3  ? 4.712   3.244   5.318   1.00 0.00 ? 3  LEU A HG   14 
ATOM 11649 H HD11 . LEU A 1 3  ? 5.237   1.726   3.500   1.00 0.00 ? 3  LEU A HD11 14 
ATOM 11650 H HD12 . LEU A 1 3  ? 5.903   1.125   5.003   1.00 0.00 ? 3  LEU A HD12 14 
ATOM 11651 H HD13 . LEU A 1 3  ? 6.965   1.884   3.811   1.00 0.00 ? 3  LEU A HD13 14 
ATOM 11652 H HD21 . LEU A 1 3  ? 6.466   2.727   6.888   1.00 0.00 ? 3  LEU A HD21 14 
ATOM 11653 H HD22 . LEU A 1 3  ? 6.484   4.465   6.604   1.00 0.00 ? 3  LEU A HD22 14 
ATOM 11654 H HD23 . LEU A 1 3  ? 7.696   3.415   5.849   1.00 0.00 ? 3  LEU A HD23 14 
ATOM 11655 N N    . PHE A 1 4  ? 8.295   5.642   1.546   1.00 0.00 ? 4  PHE A N    14 
ATOM 11656 C CA   . PHE A 1 4  ? 8.566   6.137   0.194   1.00 0.00 ? 4  PHE A CA   14 
ATOM 11657 C C    . PHE A 1 4  ? 7.841   5.215   -0.816  1.00 0.00 ? 4  PHE A C    14 
ATOM 11658 O O    . PHE A 1 4  ? 7.466   4.108   -0.461  1.00 0.00 ? 4  PHE A O    14 
ATOM 11659 C CB   . PHE A 1 4  ? 10.105  6.105   -0.014  1.00 0.00 ? 4  PHE A CB   14 
ATOM 11660 C CG   . PHE A 1 4  ? 10.846  6.806   1.094   1.00 0.00 ? 4  PHE A CG   14 
ATOM 11661 C CD1  . PHE A 1 4  ? 10.914  8.196   1.124   1.00 0.00 ? 4  PHE A CD1  14 
ATOM 11662 C CD2  . PHE A 1 4  ? 11.482  6.077   2.096   1.00 0.00 ? 4  PHE A CD2  14 
ATOM 11663 C CE1  . PHE A 1 4  ? 11.611  8.847   2.134   1.00 0.00 ? 4  PHE A CE1  14 
ATOM 11664 C CE2  . PHE A 1 4  ? 12.177  6.725   3.107   1.00 0.00 ? 4  PHE A CE2  14 
ATOM 11665 C CZ   . PHE A 1 4  ? 12.246  8.111   3.125   1.00 0.00 ? 4  PHE A CZ   14 
ATOM 11666 H H    . PHE A 1 4  ? 9.022   5.226   2.088   1.00 0.00 ? 4  PHE A H    14 
ATOM 11667 H HA   . PHE A 1 4  ? 8.159   7.150   0.147   1.00 0.00 ? 4  PHE A HA   14 
ATOM 11668 H HB2  . PHE A 1 4  ? 10.452  5.064   -0.045  1.00 0.00 ? 4  PHE A HB2  14 
ATOM 11669 H HB3  . PHE A 1 4  ? 10.426  6.576   -0.952  1.00 0.00 ? 4  PHE A HB3  14 
ATOM 11670 H HD1  . PHE A 1 4  ? 10.424  8.778   0.357   1.00 0.00 ? 4  PHE A HD1  14 
ATOM 11671 H HD2  . PHE A 1 4  ? 11.443  4.997   2.092   1.00 0.00 ? 4  PHE A HD2  14 
ATOM 11672 H HE1  . PHE A 1 4  ? 11.661  9.926   2.148   1.00 0.00 ? 4  PHE A HE1  14 
ATOM 11673 H HE2  . PHE A 1 4  ? 12.664  6.149   3.882   1.00 0.00 ? 4  PHE A HE2  14 
ATOM 11674 H HZ   . PHE A 1 4  ? 12.790  8.615   3.910   1.00 0.00 ? 4  PHE A HZ   14 
ATOM 11675 N N    . THR A 1 5  ? 7.696   5.665   -2.084  1.00 0.00 ? 5  THR A N    14 
ATOM 11676 C CA   . THR A 1 5  ? 6.998   4.821   -3.054  1.00 0.00 ? 5  THR A CA   14 
ATOM 11677 C C    . THR A 1 5  ? 7.943   3.776   -3.672  1.00 0.00 ? 5  THR A C    14 
ATOM 11678 O O    . THR A 1 5  ? 7.577   2.642   -3.961  1.00 0.00 ? 5  THR A O    14 
ATOM 11679 C CB   . THR A 1 5  ? 6.514   5.748   -4.173  1.00 0.00 ? 5  THR A CB   14 
ATOM 11680 O OG1  . THR A 1 5  ? 7.603   6.489   -4.708  1.00 0.00 ? 5  THR A OG1  14 
ATOM 11681 C CG2  . THR A 1 5  ? 5.539   6.816   -3.675  1.00 0.00 ? 5  THR A CG2  14 
ATOM 11682 H H    . THR A 1 5  ? 7.929   6.574   -2.431  1.00 0.00 ? 5  THR A H    14 
ATOM 11683 H HA   . THR A 1 5  ? 6.175   4.315   -2.560  1.00 0.00 ? 5  THR A HA   14 
ATOM 11684 H HB   . THR A 1 5  ? 6.024   5.121   -4.927  1.00 0.00 ? 5  THR A HB   14 
ATOM 11685 H HG1  . THR A 1 5  ? 8.088   5.982   -5.354  1.00 0.00 ? 5  THR A HG1  14 
ATOM 11686 H HG21 . THR A 1 5  ? 4.753   6.370   -3.074  1.00 0.00 ? 5  THR A HG21 14 
ATOM 11687 H HG22 . THR A 1 5  ? 5.067   7.330   -4.512  1.00 0.00 ? 5  THR A HG22 14 
ATOM 11688 H HG23 . THR A 1 5  ? 6.035   7.577   -3.067  1.00 0.00 ? 5  THR A HG23 14 
ATOM 11689 N N    . MET A 1 6  ? 9.180   4.286   -3.813  1.00 0.00 ? 6  MET A N    14 
ATOM 11690 C CA   . MET A 1 6  ? 10.393  3.608   -4.271  1.00 0.00 ? 6  MET A CA   14 
ATOM 11691 C C    . MET A 1 6  ? 10.134  2.313   -5.077  1.00 0.00 ? 6  MET A C    14 
ATOM 11692 O O    . MET A 1 6  ? 10.212  1.205   -4.564  1.00 0.00 ? 6  MET A O    14 
ATOM 11693 C CB   . MET A 1 6  ? 11.305  3.359   -3.049  1.00 0.00 ? 6  MET A CB   14 
ATOM 11694 C CG   . MET A 1 6  ? 10.566  2.769   -1.838  1.00 0.00 ? 6  MET A CG   14 
ATOM 11695 S SD   . MET A 1 6  ? 11.659  2.435   -0.448  1.00 0.00 ? 6  MET A SD   14 
ATOM 11696 C CE   . MET A 1 6  ? 10.387  2.084   0.782   1.00 0.00 ? 6  MET A CE   14 
ATOM 11697 H H    . MET A 1 6  ? 9.183   5.240   -3.523  1.00 0.00 ? 6  MET A H    14 
ATOM 11698 H HA   . MET A 1 6  ? 10.885  4.317   -4.938  1.00 0.00 ? 6  MET A HA   14 
ATOM 11699 H HB2  . MET A 1 6  ? 12.137  2.709   -3.327  1.00 0.00 ? 6  MET A HB2  14 
ATOM 11700 H HB3  . MET A 1 6  ? 11.755  4.305   -2.744  1.00 0.00 ? 6  MET A HB3  14 
ATOM 11701 H HG2  . MET A 1 6  ? 9.808   3.466   -1.488  1.00 0.00 ? 6  MET A HG2  14 
ATOM 11702 H HG3  . MET A 1 6  ? 10.040  1.854   -2.100  1.00 0.00 ? 6  MET A HG3  14 
ATOM 11703 H HE1  . MET A 1 6  ? 9.733   2.948   0.909   1.00 0.00 ? 6  MET A HE1  14 
ATOM 11704 H HE2  . MET A 1 6  ? 10.837  1.830   1.741   1.00 0.00 ? 6  MET A HE2  14 
ATOM 11705 H HE3  . MET A 1 6  ? 9.762   1.254   0.448   1.00 0.00 ? 6  MET A HE3  14 
ATOM 11706 N N    . GLY A 1 7  ? 9.841   2.537   -6.374  1.00 0.00 ? 7  GLY A N    14 
ATOM 11707 C CA   . GLY A 1 7  ? 9.591   1.439   -7.306  1.00 0.00 ? 7  GLY A CA   14 
ATOM 11708 C C    . GLY A 1 7  ? 8.122   1.409   -7.736  1.00 0.00 ? 7  GLY A C    14 
ATOM 11709 O O    . GLY A 1 7  ? 7.796   1.196   -8.896  1.00 0.00 ? 7  GLY A O    14 
ATOM 11710 H H    . GLY A 1 7  ? 9.790   3.475   -6.714  1.00 0.00 ? 7  GLY A H    14 
ATOM 11711 H HA2  . GLY A 1 7  ? 10.218  1.620   -8.182  1.00 0.00 ? 7  GLY A HA2  14 
ATOM 11712 H HA3  . GLY A 1 7  ? 9.865   0.482   -6.850  1.00 0.00 ? 7  GLY A HA3  14 
ATOM 11713 N N    . GLY A 1 8  ? 7.267   1.640   -6.722  1.00 0.00 ? 8  GLY A N    14 
ATOM 11714 C CA   . GLY A 1 8  ? 5.825   1.673   -6.945  1.00 0.00 ? 8  GLY A CA   14 
ATOM 11715 C C    . GLY A 1 8  ? 5.409   2.868   -7.837  1.00 0.00 ? 8  GLY A C    14 
ATOM 11716 O O    . GLY A 1 8  ? 6.254   3.583   -8.360  1.00 0.00 ? 8  GLY A O    14 
ATOM 11717 H H    . GLY A 1 8  ? 7.649   1.743   -5.802  1.00 0.00 ? 8  GLY A H    14 
ATOM 11718 H HA2  . GLY A 1 8  ? 5.543   0.736   -7.428  1.00 0.00 ? 8  GLY A HA2  14 
ATOM 11719 H HA3  . GLY A 1 8  ? 5.377   1.698   -5.961  1.00 0.00 ? 8  GLY A HA3  14 
ATOM 11720 N N    . ASN A 1 9  ? 4.075   3.019   -8.029  1.00 0.00 ? 9  ASN A N    14 
ATOM 11721 C CA   . ASN A 1 9  ? 3.554   3.994   -9.000  1.00 0.00 ? 9  ASN A CA   14 
ATOM 11722 C C    . ASN A 1 9  ? 2.705   5.119   -8.369  1.00 0.00 ? 9  ASN A C    14 
ATOM 11723 O O    . ASN A 1 9  ? 2.065   5.886   -9.074  1.00 0.00 ? 9  ASN A O    14 
ATOM 11724 C CB   . ASN A 1 9  ? 2.766   3.215   -10.083 1.00 0.00 ? 9  ASN A CB   14 
ATOM 11725 C CG   . ASN A 1 9  ? 1.431   2.608   -9.592  1.00 0.00 ? 9  ASN A CG   14 
ATOM 11726 O OD1  . ASN A 1 9  ? 0.872   3.025   -8.591  1.00 0.00 ? 9  ASN A OD1  14 
ATOM 11727 N ND2  . ASN A 1 9  ? 0.926   1.609   -10.336 1.00 0.00 ? 9  ASN A ND2  14 
ATOM 11728 H H    . ASN A 1 9  ? 3.404   2.469   -7.517  1.00 0.00 ? 9  ASN A H    14 
ATOM 11729 H HA   . ASN A 1 9  ? 4.406   4.482   -9.479  1.00 0.00 ? 9  ASN A HA   14 
ATOM 11730 H HB2  . ASN A 1 9  ? 2.539   3.877   -10.919 1.00 0.00 ? 9  ASN A HB2  14 
ATOM 11731 H HB3  . ASN A 1 9  ? 3.409   2.423   -10.469 1.00 0.00 ? 9  ASN A HB3  14 
ATOM 11732 H HD21 . ASN A 1 9  ? 1.358   1.243   -11.166 1.00 0.00 ? 9  ASN A HD21 14 
ATOM 11733 H HD22 . ASN A 1 9  ? 0.051   1.242   -9.996  1.00 0.00 ? 9  ASN A HD22 14 
ATOM 11734 N N    . ALA A 1 10 ? 2.752   5.175   -7.030  1.00 0.00 ? 10 ALA A N    14 
ATOM 11735 C CA   . ALA A 1 10 ? 2.013   6.064   -6.129  1.00 0.00 ? 10 ALA A CA   14 
ATOM 11736 C C    . ALA A 1 10 ? 2.112   7.601   -6.347  1.00 0.00 ? 10 ALA A C    14 
ATOM 11737 O O    . ALA A 1 10 ? 1.823   8.352   -5.425  1.00 0.00 ? 10 ALA A O    14 
ATOM 11738 C CB   . ALA A 1 10 ? 2.503   5.721   -4.710  1.00 0.00 ? 10 ALA A CB   14 
ATOM 11739 H H    . ALA A 1 10 ? 3.279   4.448   -6.590  1.00 0.00 ? 10 ALA A H    14 
ATOM 11740 H HA   . ALA A 1 10 ? 0.962   5.788   -6.227  1.00 0.00 ? 10 ALA A HA   14 
ATOM 11741 H HB1  . ALA A 1 10 ? 1.832   5.011   -4.230  1.00 0.00 ? 10 ALA A HB1  14 
ATOM 11742 H HB2  . ALA A 1 10 ? 2.575   6.589   -4.057  1.00 0.00 ? 10 ALA A HB2  14 
ATOM 11743 H HB3  . ALA A 1 10 ? 3.495   5.274   -4.724  1.00 0.00 ? 10 ALA A HB3  14 
ATOM 11744 N N    . GLU A 1 11 ? 2.532   8.082   -7.532  1.00 0.00 ? 11 GLU A N    14 
ATOM 11745 C CA   . GLU A 1 11 ? 2.620   9.531   -7.758  1.00 0.00 ? 11 GLU A CA   14 
ATOM 11746 C C    . GLU A 1 11 ? 3.618   10.228  -6.790  1.00 0.00 ? 11 GLU A C    14 
ATOM 11747 O O    . GLU A 1 11 ? 3.545   11.427  -6.558  1.00 0.00 ? 11 GLU A O    14 
ATOM 11748 C CB   . GLU A 1 11 ? 1.214   10.188  -7.667  1.00 0.00 ? 11 GLU A CB   14 
ATOM 11749 C CG   . GLU A 1 11 ? 0.800   10.954  -8.933  1.00 0.00 ? 11 GLU A CG   14 
ATOM 11750 C CD   . GLU A 1 11 ? 0.251   9.986   -9.982  1.00 0.00 ? 11 GLU A CD   14 
ATOM 11751 O OE1  . GLU A 1 11 ? 1.028   9.405   -10.739 1.00 0.00 ? 11 GLU A OE1  14 
ATOM 11752 O OE2  . GLU A 1 11 ? -0.962  9.781   -10.032 1.00 0.00 ? 11 GLU A OE2  14 
ATOM 11753 H H    . GLU A 1 11 ? 2.726   7.464   -8.292  1.00 0.00 ? 11 GLU A H    14 
ATOM 11754 H HA   . GLU A 1 11 ? 3.018   9.630   -8.768  1.00 0.00 ? 11 GLU A HA   14 
ATOM 11755 H HB2  . GLU A 1 11 ? 0.452   9.442   -7.438  1.00 0.00 ? 11 GLU A HB2  14 
ATOM 11756 H HB3  . GLU A 1 11 ? 1.163   10.878  -6.825  1.00 0.00 ? 11 GLU A HB3  14 
ATOM 11757 H HG2  . GLU A 1 11 ? 0.018   11.675  -8.693  1.00 0.00 ? 11 GLU A HG2  14 
ATOM 11758 H HG3  . GLU A 1 11 ? 1.634   11.521  -9.347  1.00 0.00 ? 11 GLU A HG3  14 
ATOM 11759 N N    . GLY A 1 12 ? 4.530   9.414   -6.209  1.00 0.00 ? 12 GLY A N    14 
ATOM 11760 C CA   . GLY A 1 12 ? 5.484   9.958   -5.229  1.00 0.00 ? 12 GLY A CA   14 
ATOM 11761 C C    . GLY A 1 12 ? 4.830   10.152  -3.837  1.00 0.00 ? 12 GLY A C    14 
ATOM 11762 O O    . GLY A 1 12 ? 5.492   10.556  -2.889  1.00 0.00 ? 12 GLY A O    14 
ATOM 11763 H H    . GLY A 1 12 ? 4.516   8.447   -6.463  1.00 0.00 ? 12 GLY A H    14 
ATOM 11764 H HA2  . GLY A 1 12 ? 6.307   9.189   -5.107  1.00 0.00 ? 12 GLY A HA2  14 
ATOM 11765 H HA3  . GLY A 1 12 ? 5.762   10.992  -5.593  1.00 0.00 ? 12 GLY A HA3  14 
ATOM 11766 N N    . GLN A 1 13 ? 3.511   9.870   -3.753  1.00 0.00 ? 13 GLN A N    14 
ATOM 11767 C CA   . GLN A 1 13 ? 2.791   10.028  -2.493  1.00 0.00 ? 13 GLN A CA   14 
ATOM 11768 C C    . GLN A 1 13 ? 3.216   8.914   -1.509  1.00 0.00 ? 13 GLN A C    14 
ATOM 11769 O O    . GLN A 1 13 ? 3.331   7.758   -1.891  1.00 0.00 ? 13 GLN A O    14 
ATOM 11770 C CB   . GLN A 1 13 ? 1.266   9.958   -2.718  1.00 0.00 ? 13 GLN A CB   14 
ATOM 11771 C CG   . GLN A 1 13 ? 0.680   11.132  -3.532  1.00 0.00 ? 13 GLN A CG   14 
ATOM 11772 C CD   . GLN A 1 13 ? 0.700   12.446  -2.723  1.00 0.00 ? 13 GLN A CD   14 
ATOM 11773 O OE1  . GLN A 1 13 ? 1.168   12.499  -1.595  1.00 0.00 ? 13 GLN A OE1  14 
ATOM 11774 N NE2  . GLN A 1 13 ? 0.126   13.493  -3.334  1.00 0.00 ? 13 GLN A NE2  14 
ATOM 11775 H H    . GLN A 1 13 ? 3.017   9.490