data_1D0N
# 
_entry.id   1D0N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1D0N         
RCSB  RCSB009686   
WWPDB D_1000009686 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1D0N 
_pdbx_database_status.recvd_initial_deposition_date   1999-09-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Burtnick, L.D.' 1 
'Robinson, R.'   2 
'Li, C.'         3 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of plasma gelsolin: implications for actin severing, capping, and nucleation.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            90 
_citation.page_first                661 
_citation.page_last                 670 
_citation.year                      1997 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9288746 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(00)80527-9' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Burtnick, L.D.'   1 ? 
primary 'Koepf, E.K.'      2 ? 
primary 'Grimes, J.'       3 ? 
primary 'Jones, E.Y.'      4 ? 
primary 'Stuart, D.I.'     5 ? 
primary 'McLaughlin, P.J.' 6 ? 
primary 'Robinson, R.C.'   7 ? 
# 
_cell.entry_id           1D0N 
_cell.length_a           169.400 
_cell.length_b           169.400 
_cell.length_c           154.200 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1D0N 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'HORSE PLASMA GELSOLIN' 80691.547 2   ? ? ? ? 
2 water   nat water                   18.015    284 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGILQYDLHYWLGNECSQDESGAAAIFTV
QLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLLQVKGRRVVRATEVPVSWESFNNG
DCFILDLGNNIYQWCGSKSNRFERLKATQVSKGIRDNERSGRAQVSVFEEGAEPEAMLQVLGPKPTLPEATEDTVKEDAA
NRKLAKLYKVSNGAGPMVVSLVADENPFAQGALRSEDCFILDHGKDGKIFVWKGKQANMEERKAALKTASDFISKMDYPK
QTQVSVLPEGGETPLFRQFFKNWRDPDQTEGLGLAYLSSHIAHVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRVE
GSNKVPVDPATYGQFYGGDSYIILYNYRHGSRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPA
HLMSLFGGKPMIVYKGGTSREGGQTAPASTRLFQVRASSSGATRAVEIIPKAGALNSNDAFVLKTPSAAYLWVGAGASEA
EKTGAQELLRVLRAQPVQVAEGSEPDSFWEALGGKATYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGEFMQEDL
ATDDVMLLDTWDQVFVWVGKDSQDEEKTEALTSAKRYIDTDPAHRDRRTPITVVKQGFEPPSFVGWFLGWDDSYWSVDPL
DRALAELAA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGILQYDLHYWLGNECSQDESGAAAIFTV
QLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLLQVKGRRVVRATEVPVSWESFNNG
DCFILDLGNNIYQWCGSKSNRFERLKATQVSKGIRDNERSGRAQVSVFEEGAEPEAMLQVLGPKPTLPEATEDTVKEDAA
NRKLAKLYKVSNGAGPMVVSLVADENPFAQGALRSEDCFILDHGKDGKIFVWKGKQANMEERKAALKTASDFISKMDYPK
QTQVSVLPEGGETPLFRQFFKNWRDPDQTEGLGLAYLSSHIAHVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRVE
GSNKVPVDPATYGQFYGGDSYIILYNYRHGSRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPA
HLMSLFGGKPMIVYKGGTSREGGQTAPASTRLFQVRASSSGATRAVEIIPKAGALNSNDAFVLKTPSAAYLWVGAGASEA
EKTGAQELLRVLRAQPVQVAEGSEPDSFWEALGGKATYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEVPGEFMQEDL
ATDDVMLLDTWDQVFVWVGKDSQDEEKTEALTSAKRYIDTDPAHRDRRTPITVVKQGFEPPSFVGWFLGWDDSYWSVDPL
DRALAELAA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   GLU n 
1 3   HIS n 
1 4   PRO n 
1 5   GLU n 
1 6   PHE n 
1 7   LEU n 
1 8   LYS n 
1 9   ALA n 
1 10  GLY n 
1 11  LYS n 
1 12  GLU n 
1 13  PRO n 
1 14  GLY n 
1 15  LEU n 
1 16  GLN n 
1 17  ILE n 
1 18  TRP n 
1 19  ARG n 
1 20  VAL n 
1 21  GLU n 
1 22  LYS n 
1 23  PHE n 
1 24  ASP n 
1 25  LEU n 
1 26  VAL n 
1 27  PRO n 
1 28  VAL n 
1 29  PRO n 
1 30  PRO n 
1 31  ASN n 
1 32  LEU n 
1 33  TYR n 
1 34  GLY n 
1 35  ASP n 
1 36  PHE n 
1 37  PHE n 
1 38  THR n 
1 39  GLY n 
1 40  ASP n 
1 41  ALA n 
1 42  TYR n 
1 43  VAL n 
1 44  ILE n 
1 45  LEU n 
1 46  LYS n 
1 47  THR n 
1 48  VAL n 
1 49  GLN n 
1 50  LEU n 
1 51  ARG n 
1 52  ASN n 
1 53  GLY n 
1 54  ILE n 
1 55  LEU n 
1 56  GLN n 
1 57  TYR n 
1 58  ASP n 
1 59  LEU n 
1 60  HIS n 
1 61  TYR n 
1 62  TRP n 
1 63  LEU n 
1 64  GLY n 
1 65  ASN n 
1 66  GLU n 
1 67  CYS n 
1 68  SER n 
1 69  GLN n 
1 70  ASP n 
1 71  GLU n 
1 72  SER n 
1 73  GLY n 
1 74  ALA n 
1 75  ALA n 
1 76  ALA n 
1 77  ILE n 
1 78  PHE n 
1 79  THR n 
1 80  VAL n 
1 81  GLN n 
1 82  LEU n 
1 83  ASP n 
1 84  ASP n 
1 85  TYR n 
1 86  LEU n 
1 87  ASN n 
1 88  GLY n 
1 89  ARG n 
1 90  ALA n 
1 91  VAL n 
1 92  GLN n 
1 93  HIS n 
1 94  ARG n 
1 95  GLU n 
1 96  VAL n 
1 97  GLN n 
1 98  GLY n 
1 99  PHE n 
1 100 GLU n 
1 101 SER n 
1 102 ALA n 
1 103 THR n 
1 104 PHE n 
1 105 LEU n 
1 106 GLY n 
1 107 TYR n 
1 108 PHE n 
1 109 LYS n 
1 110 SER n 
1 111 GLY n 
1 112 LEU n 
1 113 LYS n 
1 114 TYR n 
1 115 LYS n 
1 116 LYS n 
1 117 GLY n 
1 118 GLY n 
1 119 VAL n 
1 120 ALA n 
1 121 SER n 
1 122 GLY n 
1 123 PHE n 
1 124 LYS n 
1 125 HIS n 
1 126 VAL n 
1 127 VAL n 
1 128 PRO n 
1 129 ASN n 
1 130 GLU n 
1 131 VAL n 
1 132 VAL n 
1 133 VAL n 
1 134 GLN n 
1 135 ARG n 
1 136 LEU n 
1 137 LEU n 
1 138 GLN n 
1 139 VAL n 
1 140 LYS n 
1 141 GLY n 
1 142 ARG n 
1 143 ARG n 
1 144 VAL n 
1 145 VAL n 
1 146 ARG n 
1 147 ALA n 
1 148 THR n 
1 149 GLU n 
1 150 VAL n 
1 151 PRO n 
1 152 VAL n 
1 153 SER n 
1 154 TRP n 
1 155 GLU n 
1 156 SER n 
1 157 PHE n 
1 158 ASN n 
1 159 ASN n 
1 160 GLY n 
1 161 ASP n 
1 162 CYS n 
1 163 PHE n 
1 164 ILE n 
1 165 LEU n 
1 166 ASP n 
1 167 LEU n 
1 168 GLY n 
1 169 ASN n 
1 170 ASN n 
1 171 ILE n 
1 172 TYR n 
1 173 GLN n 
1 174 TRP n 
1 175 CYS n 
1 176 GLY n 
1 177 SER n 
1 178 LYS n 
1 179 SER n 
1 180 ASN n 
1 181 ARG n 
1 182 PHE n 
1 183 GLU n 
1 184 ARG n 
1 185 LEU n 
1 186 LYS n 
1 187 ALA n 
1 188 THR n 
1 189 GLN n 
1 190 VAL n 
1 191 SER n 
1 192 LYS n 
1 193 GLY n 
1 194 ILE n 
1 195 ARG n 
1 196 ASP n 
1 197 ASN n 
1 198 GLU n 
1 199 ARG n 
1 200 SER n 
1 201 GLY n 
1 202 ARG n 
1 203 ALA n 
1 204 GLN n 
1 205 VAL n 
1 206 SER n 
1 207 VAL n 
1 208 PHE n 
1 209 GLU n 
1 210 GLU n 
1 211 GLY n 
1 212 ALA n 
1 213 GLU n 
1 214 PRO n 
1 215 GLU n 
1 216 ALA n 
1 217 MET n 
1 218 LEU n 
1 219 GLN n 
1 220 VAL n 
1 221 LEU n 
1 222 GLY n 
1 223 PRO n 
1 224 LYS n 
1 225 PRO n 
1 226 THR n 
1 227 LEU n 
1 228 PRO n 
1 229 GLU n 
1 230 ALA n 
1 231 THR n 
1 232 GLU n 
1 233 ASP n 
1 234 THR n 
1 235 VAL n 
1 236 LYS n 
1 237 GLU n 
1 238 ASP n 
1 239 ALA n 
1 240 ALA n 
1 241 ASN n 
1 242 ARG n 
1 243 LYS n 
1 244 LEU n 
1 245 ALA n 
1 246 LYS n 
1 247 LEU n 
1 248 TYR n 
1 249 LYS n 
1 250 VAL n 
1 251 SER n 
1 252 ASN n 
1 253 GLY n 
1 254 ALA n 
1 255 GLY n 
1 256 PRO n 
1 257 MET n 
1 258 VAL n 
1 259 VAL n 
1 260 SER n 
1 261 LEU n 
1 262 VAL n 
1 263 ALA n 
1 264 ASP n 
1 265 GLU n 
1 266 ASN n 
1 267 PRO n 
1 268 PHE n 
1 269 ALA n 
1 270 GLN n 
1 271 GLY n 
1 272 ALA n 
1 273 LEU n 
1 274 ARG n 
1 275 SER n 
1 276 GLU n 
1 277 ASP n 
1 278 CYS n 
1 279 PHE n 
1 280 ILE n 
1 281 LEU n 
1 282 ASP n 
1 283 HIS n 
1 284 GLY n 
1 285 LYS n 
1 286 ASP n 
1 287 GLY n 
1 288 LYS n 
1 289 ILE n 
1 290 PHE n 
1 291 VAL n 
1 292 TRP n 
1 293 LYS n 
1 294 GLY n 
1 295 LYS n 
1 296 GLN n 
1 297 ALA n 
1 298 ASN n 
1 299 MET n 
1 300 GLU n 
1 301 GLU n 
1 302 ARG n 
1 303 LYS n 
1 304 ALA n 
1 305 ALA n 
1 306 LEU n 
1 307 LYS n 
1 308 THR n 
1 309 ALA n 
1 310 SER n 
1 311 ASP n 
1 312 PHE n 
1 313 ILE n 
1 314 SER n 
1 315 LYS n 
1 316 MET n 
1 317 ASP n 
1 318 TYR n 
1 319 PRO n 
1 320 LYS n 
1 321 GLN n 
1 322 THR n 
1 323 GLN n 
1 324 VAL n 
1 325 SER n 
1 326 VAL n 
1 327 LEU n 
1 328 PRO n 
1 329 GLU n 
1 330 GLY n 
1 331 GLY n 
1 332 GLU n 
1 333 THR n 
1 334 PRO n 
1 335 LEU n 
1 336 PHE n 
1 337 ARG n 
1 338 GLN n 
1 339 PHE n 
1 340 PHE n 
1 341 LYS n 
1 342 ASN n 
1 343 TRP n 
1 344 ARG n 
1 345 ASP n 
1 346 PRO n 
1 347 ASP n 
1 348 GLN n 
1 349 THR n 
1 350 GLU n 
1 351 GLY n 
1 352 LEU n 
1 353 GLY n 
1 354 LEU n 
1 355 ALA n 
1 356 TYR n 
1 357 LEU n 
1 358 SER n 
1 359 SER n 
1 360 HIS n 
1 361 ILE n 
1 362 ALA n 
1 363 HIS n 
1 364 VAL n 
1 365 GLU n 
1 366 ARG n 
1 367 VAL n 
1 368 PRO n 
1 369 PHE n 
1 370 ASP n 
1 371 ALA n 
1 372 ALA n 
1 373 THR n 
1 374 LEU n 
1 375 HIS n 
1 376 THR n 
1 377 SER n 
1 378 THR n 
1 379 ALA n 
1 380 MET n 
1 381 ALA n 
1 382 ALA n 
1 383 GLN n 
1 384 HIS n 
1 385 GLY n 
1 386 MET n 
1 387 ASP n 
1 388 ASP n 
1 389 ASP n 
1 390 GLY n 
1 391 THR n 
1 392 GLY n 
1 393 GLN n 
1 394 LYS n 
1 395 GLN n 
1 396 ILE n 
1 397 TRP n 
1 398 ARG n 
1 399 VAL n 
1 400 GLU n 
1 401 GLY n 
1 402 SER n 
1 403 ASN n 
1 404 LYS n 
1 405 VAL n 
1 406 PRO n 
1 407 VAL n 
1 408 ASP n 
1 409 PRO n 
1 410 ALA n 
1 411 THR n 
1 412 TYR n 
1 413 GLY n 
1 414 GLN n 
1 415 PHE n 
1 416 TYR n 
1 417 GLY n 
1 418 GLY n 
1 419 ASP n 
1 420 SER n 
1 421 TYR n 
1 422 ILE n 
1 423 ILE n 
1 424 LEU n 
1 425 TYR n 
1 426 ASN n 
1 427 TYR n 
1 428 ARG n 
1 429 HIS n 
1 430 GLY n 
1 431 SER n 
1 432 ARG n 
1 433 GLN n 
1 434 GLY n 
1 435 GLN n 
1 436 ILE n 
1 437 ILE n 
1 438 TYR n 
1 439 ASN n 
1 440 TRP n 
1 441 GLN n 
1 442 GLY n 
1 443 ALA n 
1 444 GLN n 
1 445 SER n 
1 446 THR n 
1 447 GLN n 
1 448 ASP n 
1 449 GLU n 
1 450 VAL n 
1 451 ALA n 
1 452 ALA n 
1 453 SER n 
1 454 ALA n 
1 455 ILE n 
1 456 LEU n 
1 457 THR n 
1 458 ALA n 
1 459 GLN n 
1 460 LEU n 
1 461 ASP n 
1 462 GLU n 
1 463 GLU n 
1 464 LEU n 
1 465 GLY n 
1 466 GLY n 
1 467 THR n 
1 468 PRO n 
1 469 VAL n 
1 470 GLN n 
1 471 SER n 
1 472 ARG n 
1 473 VAL n 
1 474 VAL n 
1 475 GLN n 
1 476 GLY n 
1 477 LYS n 
1 478 GLU n 
1 479 PRO n 
1 480 ALA n 
1 481 HIS n 
1 482 LEU n 
1 483 MET n 
1 484 SER n 
1 485 LEU n 
1 486 PHE n 
1 487 GLY n 
1 488 GLY n 
1 489 LYS n 
1 490 PRO n 
1 491 MET n 
1 492 ILE n 
1 493 VAL n 
1 494 TYR n 
1 495 LYS n 
1 496 GLY n 
1 497 GLY n 
1 498 THR n 
1 499 SER n 
1 500 ARG n 
1 501 GLU n 
1 502 GLY n 
1 503 GLY n 
1 504 GLN n 
1 505 THR n 
1 506 ALA n 
1 507 PRO n 
1 508 ALA n 
1 509 SER n 
1 510 THR n 
1 511 ARG n 
1 512 LEU n 
1 513 PHE n 
1 514 GLN n 
1 515 VAL n 
1 516 ARG n 
1 517 ALA n 
1 518 SER n 
1 519 SER n 
1 520 SER n 
1 521 GLY n 
1 522 ALA n 
1 523 THR n 
1 524 ARG n 
1 525 ALA n 
1 526 VAL n 
1 527 GLU n 
1 528 ILE n 
1 529 ILE n 
1 530 PRO n 
1 531 LYS n 
1 532 ALA n 
1 533 GLY n 
1 534 ALA n 
1 535 LEU n 
1 536 ASN n 
1 537 SER n 
1 538 ASN n 
1 539 ASP n 
1 540 ALA n 
1 541 PHE n 
1 542 VAL n 
1 543 LEU n 
1 544 LYS n 
1 545 THR n 
1 546 PRO n 
1 547 SER n 
1 548 ALA n 
1 549 ALA n 
1 550 TYR n 
1 551 LEU n 
1 552 TRP n 
1 553 VAL n 
1 554 GLY n 
1 555 ALA n 
1 556 GLY n 
1 557 ALA n 
1 558 SER n 
1 559 GLU n 
1 560 ALA n 
1 561 GLU n 
1 562 LYS n 
1 563 THR n 
1 564 GLY n 
1 565 ALA n 
1 566 GLN n 
1 567 GLU n 
1 568 LEU n 
1 569 LEU n 
1 570 ARG n 
1 571 VAL n 
1 572 LEU n 
1 573 ARG n 
1 574 ALA n 
1 575 GLN n 
1 576 PRO n 
1 577 VAL n 
1 578 GLN n 
1 579 VAL n 
1 580 ALA n 
1 581 GLU n 
1 582 GLY n 
1 583 SER n 
1 584 GLU n 
1 585 PRO n 
1 586 ASP n 
1 587 SER n 
1 588 PHE n 
1 589 TRP n 
1 590 GLU n 
1 591 ALA n 
1 592 LEU n 
1 593 GLY n 
1 594 GLY n 
1 595 LYS n 
1 596 ALA n 
1 597 THR n 
1 598 TYR n 
1 599 ARG n 
1 600 THR n 
1 601 SER n 
1 602 PRO n 
1 603 ARG n 
1 604 LEU n 
1 605 LYS n 
1 606 ASP n 
1 607 LYS n 
1 608 LYS n 
1 609 MET n 
1 610 ASP n 
1 611 ALA n 
1 612 HIS n 
1 613 PRO n 
1 614 PRO n 
1 615 ARG n 
1 616 LEU n 
1 617 PHE n 
1 618 ALA n 
1 619 CYS n 
1 620 SER n 
1 621 ASN n 
1 622 LYS n 
1 623 ILE n 
1 624 GLY n 
1 625 ARG n 
1 626 PHE n 
1 627 VAL n 
1 628 ILE n 
1 629 GLU n 
1 630 GLU n 
1 631 VAL n 
1 632 PRO n 
1 633 GLY n 
1 634 GLU n 
1 635 PHE n 
1 636 MET n 
1 637 GLN n 
1 638 GLU n 
1 639 ASP n 
1 640 LEU n 
1 641 ALA n 
1 642 THR n 
1 643 ASP n 
1 644 ASP n 
1 645 VAL n 
1 646 MET n 
1 647 LEU n 
1 648 LEU n 
1 649 ASP n 
1 650 THR n 
1 651 TRP n 
1 652 ASP n 
1 653 GLN n 
1 654 VAL n 
1 655 PHE n 
1 656 VAL n 
1 657 TRP n 
1 658 VAL n 
1 659 GLY n 
1 660 LYS n 
1 661 ASP n 
1 662 SER n 
1 663 GLN n 
1 664 ASP n 
1 665 GLU n 
1 666 GLU n 
1 667 LYS n 
1 668 THR n 
1 669 GLU n 
1 670 ALA n 
1 671 LEU n 
1 672 THR n 
1 673 SER n 
1 674 ALA n 
1 675 LYS n 
1 676 ARG n 
1 677 TYR n 
1 678 ILE n 
1 679 ASP n 
1 680 THR n 
1 681 ASP n 
1 682 PRO n 
1 683 ALA n 
1 684 HIS n 
1 685 ARG n 
1 686 ASP n 
1 687 ARG n 
1 688 ARG n 
1 689 THR n 
1 690 PRO n 
1 691 ILE n 
1 692 THR n 
1 693 VAL n 
1 694 VAL n 
1 695 LYS n 
1 696 GLN n 
1 697 GLY n 
1 698 PHE n 
1 699 GLU n 
1 700 PRO n 
1 701 PRO n 
1 702 SER n 
1 703 PHE n 
1 704 VAL n 
1 705 GLY n 
1 706 TRP n 
1 707 PHE n 
1 708 LEU n 
1 709 GLY n 
1 710 TRP n 
1 711 ASP n 
1 712 ASP n 
1 713 SER n 
1 714 TYR n 
1 715 TRP n 
1 716 SER n 
1 717 VAL n 
1 718 ASP n 
1 719 PRO n 
1 720 LEU n 
1 721 ASP n 
1 722 ARG n 
1 723 ALA n 
1 724 LEU n 
1 725 ALA n 
1 726 GLU n 
1 727 LEU n 
1 728 ALA n 
1 729 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                horse 
_entity_src_nat.pdbx_organism_scientific   'Equus caballus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9796 
_entity_src_nat.genus                      Equus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     PLASMA 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GELS_HORSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q28372 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1D0N A 1 ? 729 ? Q28372 2 ? 730 ? 27 755 
2 1 1D0N B 1 ? 729 ? Q28372 2 ? 730 ? 27 755 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1D0N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   3 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.43 
_exptl_crystal.density_percent_sol   64.10 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            291.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    'ammonium sulfate, Tris-HCl, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 18K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           291.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1994-09-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.87 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SRS BEAMLINE PX9.6' 
_diffrn_source.pdbx_synchrotron_site       SRS 
_diffrn_source.pdbx_synchrotron_beamline   PX9.6 
_diffrn_source.pdbx_wavelength             0.87 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1D0N 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   65683 
_reflns.number_all                   71395 
_reflns.percent_possible_obs         92 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        23.7 
_reflns.B_iso_Wilson_estimate        22.81 
_reflns.pdbx_redundancy              3.44 
_reflns.R_free_details               ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   82 
_reflns_shell.Rmerge_I_obs           0.246 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        2.12 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6242 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1D0N 
_refine.ls_number_reflns_obs                     65683 
_refine.ls_number_reflns_all                     71395 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    92.0 
_refine.ls_R_factor_obs                          0.2116 
_refine.ls_R_factor_all                          0.2116 
_refine.ls_R_factor_R_work                       0.2049 
_refine.ls_R_factor_R_free                       0.2376 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3617 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11382 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             284 
_refine_hist.number_atoms_total               11666 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.339 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1D0N 
_struct.title                     'THE CRYSTAL STRUCTURE OF CALCIUM-FREE EQUINE PLASMA GELSOLIN.' 
_struct.pdbx_descriptor           'HORSE PLASMA GELSOLIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1D0N 
_struct_keywords.pdbx_keywords   'CONTRACTILE PROTEIN' 
_struct_keywords.text            'MIXED ALPHA-BETA STRUCTURE, ACTIN-BINDING PROTEIN, PROTEIN DOMAIN PACKING, CONTRACTILE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 5   ? ALA A 9   ? GLU A 31  ALA A 35  5 ? 5  
HELX_P HELX_P2  2  PRO A 29  ? TYR A 33  ? PRO A 55  TYR A 59  5 ? 5  
HELX_P HELX_P3  3  SER A 68  ? LEU A 86  ? SER A 94  LEU A 112 1 ? 19 
HELX_P HELX_P4  4  SER A 101 ? TYR A 107 ? SER A 127 TYR A 133 1 ? 7  
HELX_P HELX_P5  5  SER A 153 ? PHE A 157 ? SER A 179 PHE A 183 5 ? 5  
HELX_P HELX_P6  6  ASN A 180 ? GLU A 198 ? ASN A 206 GLU A 224 1 ? 19 
HELX_P HELX_P7  7  ARG A 199 ? ARG A 202 ? ARG A 225 ARG A 228 5 ? 4  
HELX_P HELX_P8  8  PRO A 214 ? GLY A 222 ? PRO A 240 GLY A 248 1 ? 9  
HELX_P HELX_P9  9  THR A 231 ? VAL A 235 ? THR A 257 VAL A 261 5 ? 5  
HELX_P HELX_P10 10 ALA A 269 ? LEU A 273 ? ALA A 295 LEU A 299 5 ? 5  
HELX_P HELX_P11 11 GLY A 284 ? ASP A 286 ? GLY A 310 ASP A 312 5 ? 3  
HELX_P HELX_P12 12 ASN A 298 ? LYS A 303 ? ASN A 324 LYS A 329 1 ? 6  
HELX_P HELX_P13 13 ALA A 304 ? MET A 316 ? ALA A 330 MET A 342 1 ? 13 
HELX_P HELX_P14 14 THR A 333 ? GLN A 338 ? THR A 359 GLN A 364 1 ? 6  
HELX_P HELX_P15 15 SER A 358 ? ALA A 362 ? SER A 384 ALA A 388 5 ? 5  
HELX_P HELX_P16 16 THR A 373 ? THR A 376 ? THR A 399 THR A 402 5 ? 4  
HELX_P HELX_P17 17 SER A 377 ? GLY A 385 ? SER A 403 GLY A 411 1 ? 9  
HELX_P HELX_P18 18 ASP A 408 ? TYR A 412 ? ASP A 434 TYR A 438 5 ? 5  
HELX_P HELX_P19 19 THR A 446 ? GLU A 463 ? THR A 472 GLU A 489 1 ? 18 
HELX_P HELX_P20 20 PRO A 479 ? SER A 484 ? PRO A 505 SER A 510 1 ? 6  
HELX_P HELX_P21 21 LYS A 531 ? LEU A 535 ? LYS A 557 LEU A 561 5 ? 5  
HELX_P HELX_P22 22 SER A 558 ? ARG A 573 ? SER A 584 ARG A 599 1 ? 16 
HELX_P HELX_P23 23 PRO A 585 ? ALA A 591 ? PRO A 611 ALA A 617 1 ? 7  
HELX_P HELX_P24 24 LYS A 607 ? HIS A 612 ? LYS A 633 HIS A 638 1 ? 6  
HELX_P HELX_P25 25 MET A 636 ? LEU A 640 ? MET A 662 LEU A 666 5 ? 5  
HELX_P HELX_P26 26 GLN A 663 ? THR A 668 ? GLN A 689 THR A 694 1 ? 6  
HELX_P HELX_P27 27 GLU A 669 ? ASP A 681 ? GLU A 695 ASP A 707 1 ? 13 
HELX_P HELX_P28 28 PRO A 700 ? GLY A 705 ? PRO A 726 GLY A 731 1 ? 6  
HELX_P HELX_P29 29 ASP A 711 ? SER A 716 ? ASP A 737 SER A 742 5 ? 6  
HELX_P HELX_P30 30 ASP A 718 ? ALA A 728 ? ASP A 744 ALA A 754 1 ? 11 
HELX_P HELX_P31 31 PRO B 29  ? TYR B 33  ? PRO B 55  TYR B 59  5 ? 5  
HELX_P HELX_P32 32 SER B 68  ? LEU B 86  ? SER B 94  LEU B 112 1 ? 19 
HELX_P HELX_P33 33 SER B 101 ? GLY B 106 ? SER B 127 GLY B 132 1 ? 6  
HELX_P HELX_P34 34 GLY B 118 ? GLY B 122 ? GLY B 144 GLY B 148 5 ? 5  
HELX_P HELX_P35 35 SER B 153 ? PHE B 157 ? SER B 179 PHE B 183 5 ? 5  
HELX_P HELX_P36 36 ASN B 180 ? GLU B 198 ? ASN B 206 GLU B 224 1 ? 19 
HELX_P HELX_P37 37 ARG B 199 ? ARG B 202 ? ARG B 225 ARG B 228 5 ? 4  
HELX_P HELX_P38 38 PRO B 214 ? GLY B 222 ? PRO B 240 GLY B 248 1 ? 9  
HELX_P HELX_P39 39 GLY B 271 ? LEU B 273 ? GLY B 297 LEU B 299 5 ? 3  
HELX_P HELX_P40 40 GLY B 284 ? ASP B 286 ? GLY B 310 ASP B 312 5 ? 3  
HELX_P HELX_P41 41 ASN B 298 ? LYS B 303 ? ASN B 324 LYS B 329 1 ? 6  
HELX_P HELX_P42 42 ALA B 304 ? MET B 316 ? ALA B 330 MET B 342 1 ? 13 
HELX_P HELX_P43 43 THR B 333 ? GLN B 338 ? THR B 359 GLN B 364 1 ? 6  
HELX_P HELX_P44 44 SER B 358 ? ALA B 362 ? SER B 384 ALA B 388 5 ? 5  
HELX_P HELX_P45 45 ASP B 370 ? HIS B 375 ? ASP B 396 HIS B 401 1 ? 6  
HELX_P HELX_P46 46 SER B 377 ? GLY B 385 ? SER B 403 GLY B 411 1 ? 9  
HELX_P HELX_P47 47 ASP B 408 ? TYR B 412 ? ASP B 434 TYR B 438 5 ? 5  
HELX_P HELX_P48 48 THR B 446 ? LEU B 464 ? THR B 472 LEU B 490 1 ? 19 
HELX_P HELX_P49 49 PRO B 479 ? SER B 484 ? PRO B 505 SER B 510 1 ? 6  
HELX_P HELX_P50 50 LEU B 485 ? GLY B 487 ? LEU B 511 GLY B 513 5 ? 3  
HELX_P HELX_P51 51 LYS B 531 ? LEU B 535 ? LYS B 557 LEU B 561 5 ? 5  
HELX_P HELX_P52 52 SER B 558 ? ARG B 573 ? SER B 584 ARG B 599 1 ? 16 
HELX_P HELX_P53 53 PRO B 585 ? LEU B 592 ? PRO B 611 LEU B 618 1 ? 8  
HELX_P HELX_P54 54 LYS B 607 ? HIS B 612 ? LYS B 633 HIS B 638 1 ? 6  
HELX_P HELX_P55 55 MET B 636 ? LEU B 640 ? MET B 662 LEU B 666 5 ? 5  
HELX_P HELX_P56 56 GLN B 663 ? GLU B 669 ? GLN B 689 GLU B 695 1 ? 7  
HELX_P HELX_P57 57 GLU B 669 ? ASP B 681 ? GLU B 695 ASP B 707 1 ? 13 
HELX_P HELX_P58 58 PRO B 700 ? GLY B 705 ? PRO B 726 GLY B 731 1 ? 6  
HELX_P HELX_P59 59 ASP B 718 ? ALA B 728 ? ASP B 744 ALA B 754 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 162 SG ? ? ? 1_555 A CYS 175 SG ? ? A CYS 188 A CYS 201 1_555 ? ? ? ? ? ? ? 2.020 ? 
disulf2 disulf ? ? B CYS 162 SG ? ? ? 1_555 B CYS 175 SG ? ? B CYS 188 B CYS 201 1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 266 A . ? ASN 292 A PRO 267 A ? PRO 293 A 1 -0.06 
2 ASN 266 B . ? ASN 292 B PRO 267 B ? PRO 293 B 1 -0.66 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 10 ? 
B ? 7  ? 
C ? 10 ? 
D ? 5  ? 
E ? 2  ? 
F ? 10 ? 
G ? 7  ? 
H ? 2  ? 
I ? 10 ? 
J ? 7  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
A 2 3  ? anti-parallel 
A 3 4  ? anti-parallel 
A 4 5  ? parallel      
A 5 6  ? anti-parallel 
A 6 7  ? parallel      
A 7 8  ? anti-parallel 
A 8 9  ? anti-parallel 
A 9 10 ? anti-parallel 
B 1 2  ? parallel      
B 2 3  ? parallel      
B 3 4  ? anti-parallel 
B 4 5  ? anti-parallel 
B 5 6  ? anti-parallel 
B 6 7  ? parallel      
C 1 2  ? anti-parallel 
C 2 3  ? anti-parallel 
C 3 4  ? anti-parallel 
C 4 5  ? parallel      
C 5 6  ? anti-parallel 
C 6 7  ? parallel      
C 7 8  ? anti-parallel 
C 8 9  ? anti-parallel 
C 9 10 ? anti-parallel 
D 1 2  ? parallel      
D 2 3  ? parallel      
D 3 4  ? anti-parallel 
D 4 5  ? anti-parallel 
E 1 2  ? parallel      
F 1 2  ? anti-parallel 
F 2 3  ? anti-parallel 
F 3 4  ? anti-parallel 
F 4 5  ? parallel      
F 5 6  ? anti-parallel 
F 6 7  ? parallel      
F 7 8  ? anti-parallel 
F 8 9  ? anti-parallel 
F 9 10 ? anti-parallel 
G 1 2  ? parallel      
G 2 3  ? parallel      
G 3 4  ? anti-parallel 
G 4 5  ? anti-parallel 
G 5 6  ? anti-parallel 
G 6 7  ? parallel      
H 1 2  ? parallel      
I 1 2  ? anti-parallel 
I 2 3  ? anti-parallel 
I 3 4  ? anti-parallel 
I 4 5  ? parallel      
I 5 6  ? anti-parallel 
I 6 7  ? parallel      
I 7 8  ? anti-parallel 
I 8 9  ? anti-parallel 
I 9 10 ? anti-parallel 
J 1 2  ? parallel      
J 2 3  ? parallel      
J 3 4  ? anti-parallel 
J 4 5  ? anti-parallel 
J 5 6  ? anti-parallel 
J 6 7  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 25  ? PRO A 27  ? LEU A 51  PRO A 53  
A 2  GLY A 14  ? VAL A 20  ? GLY A 40  VAL A 46  
A 3  ALA A 41  ? GLN A 49  ? ALA A 67  GLN A 75  
A 4  LEU A 55  ? LEU A 63  ? LEU A 81  LEU A 89  
A 5  VAL A 91  ? VAL A 96  ? VAL A 117 VAL A 122 
A 6  GLN A 323 ? PRO A 328 ? GLN A 349 PRO A 354 
A 7  LYS A 288 ? LYS A 293 ? LYS A 314 LYS A 319 
A 8  CYS A 278 ? HIS A 283 ? CYS A 304 HIS A 309 
A 9  LYS A 246 ? SER A 251 ? LYS A 272 SER A 277 
A 10 VAL A 258 ? ALA A 263 ? VAL A 284 ALA A 289 
B 1  ASP A 35  ? PHE A 37  ? ASP A 61  PHE A 63  
B 2  LEU A 112 ? LYS A 115 ? LEU A 138 LYS A 141 
B 3  ARG A 146 ? VAL A 150 ? ARG A 172 VAL A 176 
B 4  ARG A 135 ? LYS A 140 ? ARG A 161 LYS A 166 
B 5  CYS A 162 ? ASP A 166 ? CYS A 188 ASP A 192 
B 6  ASN A 170 ? CYS A 175 ? ASN A 196 CYS A 201 
B 7  GLN A 204 ? GLU A 209 ? GLN A 230 GLU A 235 
C 1  ASN A 403 ? PRO A 406 ? ASN A 429 PRO A 432 
C 2  LYS A 394 ? GLU A 400 ? LYS A 420 GLU A 426 
C 3  SER A 420 ? HIS A 429 ? SER A 446 HIS A 455 
C 4  ARG A 432 ? GLN A 441 ? ARG A 458 GLN A 467 
C 5  VAL A 469 ? VAL A 474 ? VAL A 495 VAL A 500 
C 6  ILE A 691 ? LYS A 695 ? ILE A 717 LYS A 721 
C 7  VAL A 654 ? VAL A 658 ? VAL A 680 VAL A 684 
C 8  VAL A 645 ? ASP A 649 ? VAL A 671 ASP A 675 
C 9  ARG A 615 ? SER A 620 ? ARG A 641 SER A 646 
C 10 VAL A 627 ? GLU A 630 ? VAL A 653 GLU A 656 
D 1  GLN A 414 ? TYR A 416 ? GLN A 440 TYR A 442 
D 2  MET A 491 ? TYR A 494 ? MET A 517 TYR A 520 
D 3  THR A 523 ? ILE A 528 ? THR A 549 ILE A 554 
D 4  ARG A 511 ? ALA A 517 ? ARG A 537 ALA A 543 
D 5  ALA A 540 ? LYS A 544 ? ALA A 566 LYS A 570 
E 1  TRP A 552 ? VAL A 553 ? TRP A 578 VAL A 579 
E 2  VAL A 579 ? ALA A 580 ? VAL A 605 ALA A 606 
F 1  LEU B 25  ? PRO B 27  ? LEU B 51  PRO B 53  
F 2  GLY B 14  ? VAL B 20  ? GLY B 40  VAL B 46  
F 3  ALA B 41  ? GLN B 49  ? ALA B 67  GLN B 75  
F 4  LEU B 55  ? LEU B 63  ? LEU B 81  LEU B 89  
F 5  VAL B 91  ? VAL B 96  ? VAL B 117 VAL B 122 
F 6  GLN B 323 ? PRO B 328 ? GLN B 349 PRO B 354 
F 7  LYS B 288 ? LYS B 293 ? LYS B 314 LYS B 319 
F 8  CYS B 278 ? HIS B 283 ? CYS B 304 HIS B 309 
F 9  LYS B 246 ? SER B 251 ? LYS B 272 SER B 277 
F 10 VAL B 258 ? ALA B 263 ? VAL B 284 ALA B 289 
G 1  ASP B 35  ? PHE B 37  ? ASP B 61  PHE B 63  
G 2  LEU B 112 ? LYS B 115 ? LEU B 138 LYS B 141 
G 3  ARG B 146 ? VAL B 150 ? ARG B 172 VAL B 176 
G 4  ARG B 135 ? LYS B 140 ? ARG B 161 LYS B 166 
G 5  CYS B 162 ? ASP B 166 ? CYS B 188 ASP B 192 
G 6  ASN B 170 ? CYS B 175 ? ASN B 196 CYS B 201 
G 7  GLN B 204 ? GLU B 209 ? GLN B 230 GLU B 235 
H 1  PHE B 268 ? ALA B 269 ? PHE B 294 ALA B 295 
H 2  PHE B 340 ? LYS B 341 ? PHE B 366 LYS B 367 
I 1  ASN B 403 ? PRO B 406 ? ASN B 429 PRO B 432 
I 2  LYS B 394 ? GLU B 400 ? LYS B 420 GLU B 426 
I 3  SER B 420 ? HIS B 429 ? SER B 446 HIS B 455 
I 4  ARG B 432 ? GLN B 441 ? ARG B 458 GLN B 467 
I 5  VAL B 469 ? VAL B 474 ? VAL B 495 VAL B 500 
I 6  ILE B 691 ? LYS B 695 ? ILE B 717 LYS B 721 
I 7  VAL B 654 ? VAL B 658 ? VAL B 680 VAL B 684 
I 8  VAL B 645 ? ASP B 649 ? VAL B 671 ASP B 675 
I 9  ARG B 615 ? SER B 620 ? ARG B 641 SER B 646 
I 10 VAL B 627 ? GLU B 630 ? VAL B 653 GLU B 656 
J 1  GLN B 414 ? TYR B 416 ? GLN B 440 TYR B 442 
J 2  MET B 491 ? TYR B 494 ? MET B 517 TYR B 520 
J 3  THR B 523 ? ILE B 528 ? THR B 549 ILE B 554 
J 4  ARG B 511 ? ALA B 517 ? ARG B 537 ALA B 543 
J 5  ALA B 540 ? LYS B 544 ? ALA B 566 LYS B 570 
J 6  ALA B 549 ? VAL B 553 ? ALA B 575 VAL B 579 
J 7  PRO B 576 ? ALA B 580 ? PRO B 602 ALA B 606 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  O VAL A 26  ? O VAL A 52  N ARG A 19  ? N ARG A 45  
A 2 3  N VAL A 20  ? N VAL A 46  O ALA A 41  ? O ALA A 67  
A 3 4  O VAL A 48  ? O VAL A 74  N GLN A 56  ? N GLN A 82  
A 4 5  N LEU A 59  ? N LEU A 85  O VAL A 91  ? O VAL A 117 
A 5 6  N ARG A 94  ? N ARG A 120 O VAL A 324 ? O VAL A 350 
A 6 7  O GLN A 323 ? O GLN A 349 N ILE A 289 ? N ILE A 315 
A 7 8  N TRP A 292 ? N TRP A 318 O PHE A 279 ? O PHE A 305 
A 8 9  N ASP A 282 ? N ASP A 308 O LYS A 246 ? O LYS A 272 
A 9 10 N SER A 251 ? N SER A 277 O VAL A 258 ? O VAL A 284 
B 1 2  N PHE A 36  ? N PHE A 62  O LYS A 113 ? O LYS A 139 
B 2 3  N TYR A 114 ? N TYR A 140 O ALA A 147 ? O ALA A 173 
B 3 4  N VAL A 150 ? N VAL A 176 O LEU A 136 ? O LEU A 162 
B 4 5  N VAL A 139 ? N VAL A 165 O CYS A 162 ? O CYS A 188 
B 5 6  N LEU A 165 ? N LEU A 191 O TYR A 172 ? O TYR A 198 
B 6 7  N ILE A 171 ? N ILE A 197 O GLN A 204 ? O GLN A 230 
C 1 2  N VAL A 405 ? N VAL A 431 O ARG A 398 ? O ARG A 424 
C 2 3  N VAL A 399 ? N VAL A 425 O SER A 420 ? O SER A 446 
C 3 4  N HIS A 429 ? N HIS A 455 O ARG A 432 ? O ARG A 458 
C 4 5  N ILE A 437 ? N ILE A 463 O VAL A 469 ? O VAL A 495 
C 5 6  N ARG A 472 ? N ARG A 498 O ILE A 691 ? O ILE A 717 
C 6 7  N THR A 692 ? N THR A 718 O VAL A 654 ? O VAL A 680 
C 7 8  N TRP A 657 ? N TRP A 683 O MET A 646 ? O MET A 672 
C 8 9  N ASP A 649 ? N ASP A 675 O ARG A 615 ? O ARG A 641 
C 9 10 O SER A 620 ? O SER A 646 N VAL A 627 ? N VAL A 653 
D 1 2  N PHE A 415 ? N PHE A 441 O ILE A 492 ? O ILE A 518 
D 2 3  N MET A 491 ? N MET A 517 O THR A 523 ? O THR A 549 
D 3 4  N ILE A 528 ? N ILE A 554 O LEU A 512 ? O LEU A 538 
D 4 5  N VAL A 515 ? N VAL A 541 O ALA A 540 ? O ALA A 566 
E 1 2  N VAL A 553 ? N VAL A 579 O VAL A 579 ? O VAL A 605 
F 1 2  O VAL B 26  ? O VAL B 52  N ARG B 19  ? N ARG B 45  
F 2 3  N VAL B 20  ? N VAL B 46  O ALA B 41  ? O ALA B 67  
F 3 4  O VAL B 48  ? O VAL B 74  N GLN B 56  ? N GLN B 82  
F 4 5  N LEU B 59  ? N LEU B 85  O VAL B 91  ? O VAL B 117 
F 5 6  N ARG B 94  ? N ARG B 120 O VAL B 324 ? O VAL B 350 
F 6 7  O GLN B 323 ? O GLN B 349 N ILE B 289 ? N ILE B 315 
F 7 8  N TRP B 292 ? N TRP B 318 O PHE B 279 ? O PHE B 305 
F 8 9  N ASP B 282 ? N ASP B 308 O LYS B 246 ? O LYS B 272 
F 9 10 N SER B 251 ? N SER B 277 O VAL B 258 ? O VAL B 284 
G 1 2  N PHE B 36  ? N PHE B 62  O LYS B 113 ? O LYS B 139 
G 2 3  O LEU B 112 ? O LEU B 138 N ALA B 147 ? N ALA B 173 
G 3 4  N VAL B 150 ? N VAL B 176 O LEU B 136 ? O LEU B 162 
G 4 5  N VAL B 139 ? N VAL B 165 O CYS B 162 ? O CYS B 188 
G 5 6  N LEU B 165 ? N LEU B 191 O TYR B 172 ? O TYR B 198 
G 6 7  N ILE B 171 ? N ILE B 197 O GLN B 204 ? O GLN B 230 
H 1 2  O PHE B 268 ? O PHE B 294 N LYS B 341 ? N LYS B 367 
I 1 2  N VAL B 405 ? N VAL B 431 O ARG B 398 ? O ARG B 424 
I 2 3  N VAL B 399 ? N VAL B 425 O SER B 420 ? O SER B 446 
I 3 4  N HIS B 429 ? N HIS B 455 O ARG B 432 ? O ARG B 458 
I 4 5  O GLN B 435 ? O GLN B 461 N VAL B 469 ? N VAL B 495 
I 5 6  N ARG B 472 ? N ARG B 498 O ILE B 691 ? O ILE B 717 
I 6 7  N THR B 692 ? N THR B 718 O VAL B 654 ? O VAL B 680 
I 7 8  N TRP B 657 ? N TRP B 683 O MET B 646 ? O MET B 672 
I 8 9  N ASP B 649 ? N ASP B 675 O ARG B 615 ? O ARG B 641 
I 9 10 O SER B 620 ? O SER B 646 N VAL B 627 ? N VAL B 653 
J 1 2  N PHE B 415 ? N PHE B 441 O ILE B 492 ? O ILE B 518 
J 2 3  N MET B 491 ? N MET B 517 O THR B 523 ? O THR B 549 
J 3 4  N ILE B 528 ? N ILE B 554 O LEU B 512 ? O LEU B 538 
J 4 5  N VAL B 515 ? N VAL B 541 O ALA B 540 ? O ALA B 566 
J 5 6  O LEU B 543 ? O LEU B 569 N TYR B 550 ? N TYR B 576 
J 6 7  N LEU B 551 ? N LEU B 577 O VAL B 577 ? O VAL B 603 
# 
_database_PDB_matrix.entry_id          1D0N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1D0N 
_atom_sites.fract_transf_matrix[1][1]   0.005903 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005903 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006485 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . VAL A 1 1   ? 54.696  54.663  -28.167 1.00 73.19  ? 27  VAL A N   1 
ATOM   2     C CA  . VAL A 1 1   ? 54.503  54.303  -26.729 1.00 73.83  ? 27  VAL A CA  1 
ATOM   3     C C   . VAL A 1 1   ? 53.014  54.029  -26.447 1.00 72.12  ? 27  VAL A C   1 
ATOM   4     O O   . VAL A 1 1   ? 52.663  53.057  -25.776 1.00 72.56  ? 27  VAL A O   1 
ATOM   5     C CB  . VAL A 1 1   ? 55.023  55.442  -25.821 1.00 75.79  ? 27  VAL A CB  1 
ATOM   6     C CG1 . VAL A 1 1   ? 55.247  54.928  -24.404 1.00 75.34  ? 27  VAL A CG1 1 
ATOM   7     C CG2 . VAL A 1 1   ? 56.314  56.010  -26.402 1.00 75.83  ? 27  VAL A CG2 1 
ATOM   8     N N   . GLU A 1 2   ? 52.156  54.904  -26.961 1.00 69.41  ? 28  GLU A N   1 
ATOM   9     C CA  . GLU A 1 2   ? 50.696  54.797  -26.855 1.00 67.53  ? 28  GLU A CA  1 
ATOM   10    C C   . GLU A 1 2   ? 49.984  54.545  -25.516 1.00 62.65  ? 28  GLU A C   1 
ATOM   11    O O   . GLU A 1 2   ? 48.758  54.422  -25.506 1.00 65.52  ? 28  GLU A O   1 
ATOM   12    C CB  . GLU A 1 2   ? 50.191  53.767  -27.881 1.00 71.67  ? 28  GLU A CB  1 
ATOM   13    C CG  . GLU A 1 2   ? 50.837  52.390  -27.766 1.00 77.39  ? 28  GLU A CG  1 
ATOM   14    C CD  . GLU A 1 2   ? 50.574  51.510  -28.977 1.00 81.49  ? 28  GLU A CD  1 
ATOM   15    O OE1 . GLU A 1 2   ? 50.214  52.052  -30.046 1.00 82.41  ? 28  GLU A OE1 1 
ATOM   16    O OE2 . GLU A 1 2   ? 50.745  50.275  -28.865 1.00 83.64  ? 28  GLU A OE2 1 
ATOM   17    N N   . HIS A 1 3   ? 50.716  54.468  -24.405 1.00 53.02  ? 29  HIS A N   1 
ATOM   18    C CA  . HIS A 1 3   ? 50.121  54.249  -23.073 1.00 42.65  ? 29  HIS A CA  1 
ATOM   19    C C   . HIS A 1 3   ? 49.940  52.792  -22.670 1.00 36.97  ? 29  HIS A C   1 
ATOM   20    O O   . HIS A 1 3   ? 49.146  52.064  -23.251 1.00 34.57  ? 29  HIS A O   1 
ATOM   21    C CB  . HIS A 1 3   ? 48.758  54.950  -22.921 1.00 40.68  ? 29  HIS A CB  1 
ATOM   22    C CG  . HIS A 1 3   ? 48.356  55.157  -21.492 1.00 36.95  ? 29  HIS A CG  1 
ATOM   23    N ND1 . HIS A 1 3   ? 48.241  54.115  -20.594 1.00 36.77  ? 29  HIS A ND1 1 
ATOM   24    C CD2 . HIS A 1 3   ? 48.162  56.289  -20.777 1.00 34.41  ? 29  HIS A CD2 1 
ATOM   25    C CE1 . HIS A 1 3   ? 48.006  54.598  -19.388 1.00 34.66  ? 29  HIS A CE1 1 
ATOM   26    N NE2 . HIS A 1 3   ? 47.955  55.915  -19.471 1.00 36.08  ? 29  HIS A NE2 1 
ATOM   27    N N   . PRO A 1 4   ? 50.657  52.366  -21.628 1.00 34.88  ? 30  PRO A N   1 
ATOM   28    C CA  . PRO A 1 4   ? 50.633  51.007  -21.083 1.00 32.90  ? 30  PRO A CA  1 
ATOM   29    C C   . PRO A 1 4   ? 49.284  50.343  -20.796 1.00 31.08  ? 30  PRO A C   1 
ATOM   30    O O   . PRO A 1 4   ? 49.157  49.130  -20.963 1.00 33.82  ? 30  PRO A O   1 
ATOM   31    C CB  . PRO A 1 4   ? 51.502  51.118  -19.825 1.00 32.89  ? 30  PRO A CB  1 
ATOM   32    C CG  . PRO A 1 4   ? 51.457  52.569  -19.483 1.00 33.83  ? 30  PRO A CG  1 
ATOM   33    C CD  . PRO A 1 4   ? 51.525  53.237  -20.817 1.00 32.64  ? 30  PRO A CD  1 
ATOM   34    N N   . GLU A 1 5   ? 48.282  51.092  -20.352 1.00 26.29  ? 31  GLU A N   1 
ATOM   35    C CA  . GLU A 1 5   ? 47.002  50.447  -20.084 1.00 27.12  ? 31  GLU A CA  1 
ATOM   36    C C   . GLU A 1 5   ? 46.298  49.968  -21.365 1.00 25.02  ? 31  GLU A C   1 
ATOM   37    O O   . GLU A 1 5   ? 45.603  48.950  -21.348 1.00 24.97  ? 31  GLU A O   1 
ATOM   38    C CB  . GLU A 1 5   ? 46.084  51.365  -19.276 1.00 27.56  ? 31  GLU A CB  1 
ATOM   39    C CG  . GLU A 1 5   ? 46.560  51.597  -17.853 1.00 26.08  ? 31  GLU A CG  1 
ATOM   40    C CD  . GLU A 1 5   ? 46.819  50.307  -17.080 1.00 27.21  ? 31  GLU A CD  1 
ATOM   41    O OE1 . GLU A 1 5   ? 45.890  49.484  -16.935 1.00 31.93  ? 31  GLU A OE1 1 
ATOM   42    O OE2 . GLU A 1 5   ? 47.955  50.116  -16.599 1.00 25.25  ? 31  GLU A OE2 1 
ATOM   43    N N   . PHE A 1 6   ? 46.484  50.690  -22.467 1.00 21.61  ? 32  PHE A N   1 
ATOM   44    C CA  . PHE A 1 6   ? 45.883  50.299  -23.746 1.00 22.55  ? 32  PHE A CA  1 
ATOM   45    C C   . PHE A 1 6   ? 46.287  48.859  -24.116 1.00 22.37  ? 32  PHE A C   1 
ATOM   46    O O   . PHE A 1 6   ? 45.491  48.088  -24.653 1.00 21.19  ? 32  PHE A O   1 
ATOM   47    C CB  . PHE A 1 6   ? 46.336  51.254  -24.862 1.00 21.03  ? 32  PHE A CB  1 
ATOM   48    C CG  . PHE A 1 6   ? 45.657  52.597  -24.848 1.00 20.54  ? 32  PHE A CG  1 
ATOM   49    C CD1 . PHE A 1 6   ? 45.167  53.143  -23.673 1.00 26.20  ? 32  PHE A CD1 1 
ATOM   50    C CD2 . PHE A 1 6   ? 45.545  53.336  -26.019 1.00 23.01  ? 32  PHE A CD2 1 
ATOM   51    C CE1 . PHE A 1 6   ? 44.570  54.416  -23.660 1.00 28.64  ? 32  PHE A CE1 1 
ATOM   52    C CE2 . PHE A 1 6   ? 44.955  54.605  -26.025 1.00 24.79  ? 32  PHE A CE2 1 
ATOM   53    C CZ  . PHE A 1 6   ? 44.465  55.146  -24.843 1.00 28.16  ? 32  PHE A CZ  1 
ATOM   54    N N   . LEU A 1 7   ? 47.533  48.502  -23.831 1.00 24.46  ? 33  LEU A N   1 
ATOM   55    C CA  . LEU A 1 7   ? 48.018  47.164  -24.147 1.00 25.17  ? 33  LEU A CA  1 
ATOM   56    C C   . LEU A 1 7   ? 47.356  46.067  -23.319 1.00 27.06  ? 33  LEU A C   1 
ATOM   57    O O   . LEU A 1 7   ? 47.542  44.890  -23.614 1.00 29.40  ? 33  LEU A O   1 
ATOM   58    C CB  . LEU A 1 7   ? 49.532  47.080  -23.947 1.00 22.97  ? 33  LEU A CB  1 
ATOM   59    C CG  . LEU A 1 7   ? 50.433  48.055  -24.698 1.00 22.91  ? 33  LEU A CG  1 
ATOM   60    C CD1 . LEU A 1 7   ? 51.889  47.720  -24.374 1.00 23.45  ? 33  LEU A CD1 1 
ATOM   61    C CD2 . LEU A 1 7   ? 50.183  47.972  -26.189 1.00 22.27  ? 33  LEU A CD2 1 
ATOM   62    N N   . LYS A 1 8   ? 46.611  46.431  -22.274 1.00 27.10  ? 34  LYS A N   1 
ATOM   63    C CA  . LYS A 1 8   ? 45.931  45.421  -21.454 1.00 27.93  ? 34  LYS A CA  1 
ATOM   64    C C   . LYS A 1 8   ? 44.439  45.399  -21.776 1.00 28.10  ? 34  LYS A C   1 
ATOM   65    O O   . LYS A 1 8   ? 43.726  44.451  -21.435 1.00 27.41  ? 34  LYS A O   1 
ATOM   66    C CB  . LYS A 1 8   ? 46.058  45.732  -19.961 1.00 30.12  ? 34  LYS A CB  1 
ATOM   67    C CG  . LYS A 1 8   ? 47.452  45.894  -19.385 1.00 34.68  ? 34  LYS A CG  1 
ATOM   68    C CD  . LYS A 1 8   ? 47.314  46.340  -17.919 1.00 36.55  ? 34  LYS A CD  1 
ATOM   69    C CE  . LYS A 1 8   ? 48.642  46.749  -17.297 1.00 39.63  ? 34  LYS A CE  1 
ATOM   70    N NZ  . LYS A 1 8   ? 48.465  47.222  -15.889 1.00 41.19  ? 34  LYS A NZ  1 
ATOM   71    N N   . ALA A 1 9   ? 43.986  46.460  -22.438 1.00 27.69  ? 35  ALA A N   1 
ATOM   72    C CA  . ALA A 1 9   ? 42.582  46.663  -22.769 1.00 26.83  ? 35  ALA A CA  1 
ATOM   73    C C   . ALA A 1 9   ? 41.929  45.787  -23.830 1.00 26.84  ? 35  ALA A C   1 
ATOM   74    O O   . ALA A 1 9   ? 42.444  45.639  -24.933 1.00 25.53  ? 35  ALA A O   1 
ATOM   75    C CB  . ALA A 1 9   ? 42.368  48.133  -23.125 1.00 24.59  ? 35  ALA A CB  1 
ATOM   76    N N   . GLY A 1 10  ? 40.769  45.236  -23.473 1.00 27.74  ? 36  GLY A N   1 
ATOM   77    C CA  . GLY A 1 10  ? 39.983  44.407  -24.373 1.00 28.73  ? 36  GLY A CA  1 
ATOM   78    C C   . GLY A 1 10  ? 40.633  43.169  -24.953 1.00 30.78  ? 36  GLY A C   1 
ATOM   79    O O   . GLY A 1 10  ? 40.335  42.787  -26.081 1.00 31.46  ? 36  GLY A O   1 
ATOM   80    N N   . LYS A 1 11  ? 41.506  42.527  -24.189 1.00 33.23  ? 37  LYS A N   1 
ATOM   81    C CA  . LYS A 1 11  ? 42.183  41.336  -24.678 1.00 36.25  ? 37  LYS A CA  1 
ATOM   82    C C   . LYS A 1 11  ? 41.339  40.075  -24.554 1.00 35.50  ? 37  LYS A C   1 
ATOM   83    O O   . LYS A 1 11  ? 41.573  39.097  -25.257 1.00 35.22  ? 37  LYS A O   1 
ATOM   84    C CB  . LYS A 1 11  ? 43.515  41.161  -23.942 1.00 38.65  ? 37  LYS A CB  1 
ATOM   85    C CG  . LYS A 1 11  ? 44.509  42.280  -24.239 1.00 41.08  ? 37  LYS A CG  1 
ATOM   86    C CD  . LYS A 1 11  ? 44.819  42.339  -25.733 1.00 45.02  ? 37  LYS A CD  1 
ATOM   87    C CE  . LYS A 1 11  ? 45.703  43.531  -26.089 1.00 48.89  ? 37  LYS A CE  1 
ATOM   88    N NZ  . LYS A 1 11  ? 46.144  43.526  -27.526 1.00 50.50  ? 37  LYS A NZ  1 
ATOM   89    N N   . GLU A 1 12  ? 40.350  40.101  -23.668 1.00 35.99  ? 38  GLU A N   1 
ATOM   90    C CA  . GLU A 1 12  ? 39.477  38.946  -23.476 1.00 39.17  ? 38  GLU A CA  1 
ATOM   91    C C   . GLU A 1 12  ? 38.181  39.395  -22.827 1.00 36.19  ? 38  GLU A C   1 
ATOM   92    O O   . GLU A 1 12  ? 38.119  40.464  -22.227 1.00 37.74  ? 38  GLU A O   1 
ATOM   93    C CB  . GLU A 1 12  ? 40.164  37.895  -22.598 1.00 43.28  ? 38  GLU A CB  1 
ATOM   94    C CG  . GLU A 1 12  ? 40.567  38.411  -21.227 1.00 52.14  ? 38  GLU A CG  1 
ATOM   95    C CD  . GLU A 1 12  ? 41.620  37.549  -20.542 1.00 56.15  ? 38  GLU A CD  1 
ATOM   96    O OE1 . GLU A 1 12  ? 41.286  36.441  -20.065 1.00 59.74  ? 38  GLU A OE1 1 
ATOM   97    O OE2 . GLU A 1 12  ? 42.789  37.989  -20.487 1.00 57.94  ? 38  GLU A OE2 1 
ATOM   98    N N   . PRO A 1 13  ? 37.124  38.572  -22.932 1.00 33.67  ? 39  PRO A N   1 
ATOM   99    C CA  . PRO A 1 13  ? 35.827  38.934  -22.341 1.00 30.56  ? 39  PRO A CA  1 
ATOM   100   C C   . PRO A 1 13  ? 35.927  39.362  -20.883 1.00 26.71  ? 39  PRO A C   1 
ATOM   101   O O   . PRO A 1 13  ? 36.556  38.698  -20.065 1.00 26.17  ? 39  PRO A O   1 
ATOM   102   C CB  . PRO A 1 13  ? 35.011  37.653  -22.511 1.00 32.32  ? 39  PRO A CB  1 
ATOM   103   C CG  . PRO A 1 13  ? 35.593  37.047  -23.753 1.00 31.12  ? 39  PRO A CG  1 
ATOM   104   C CD  . PRO A 1 13  ? 37.071  37.243  -23.554 1.00 30.09  ? 39  PRO A CD  1 
ATOM   105   N N   . GLY A 1 14  ? 35.298  40.486  -20.560 1.00 23.75  ? 40  GLY A N   1 
ATOM   106   C CA  . GLY A 1 14  ? 35.335  40.962  -19.196 1.00 19.17  ? 40  GLY A CA  1 
ATOM   107   C C   . GLY A 1 14  ? 35.040  42.435  -18.999 1.00 18.59  ? 40  GLY A C   1 
ATOM   108   O O   . GLY A 1 14  ? 34.624  43.160  -19.908 1.00 17.16  ? 40  GLY A O   1 
ATOM   109   N N   . LEU A 1 15  ? 35.266  42.885  -17.779 1.00 16.01  ? 41  LEU A N   1 
ATOM   110   C CA  . LEU A 1 15  ? 35.015  44.266  -17.439 1.00 16.25  ? 41  LEU A CA  1 
ATOM   111   C C   . LEU A 1 15  ? 36.288  44.874  -16.884 1.00 15.63  ? 41  LEU A C   1 
ATOM   112   O O   . LEU A 1 15  ? 36.924  44.291  -16.010 1.00 18.13  ? 41  LEU A O   1 
ATOM   113   C CB  . LEU A 1 15  ? 33.889  44.345  -16.395 1.00 14.14  ? 41  LEU A CB  1 
ATOM   114   C CG  . LEU A 1 15  ? 33.451  45.721  -15.889 1.00 14.98  ? 41  LEU A CG  1 
ATOM   115   C CD1 . LEU A 1 15  ? 32.927  46.522  -17.056 1.00 15.60  ? 41  LEU A CD1 1 
ATOM   116   C CD2 . LEU A 1 15  ? 32.375  45.590  -14.829 1.00 9.46   ? 41  LEU A CD2 1 
ATOM   117   N N   . GLN A 1 16  ? 36.665  46.032  -17.416 1.00 16.30  ? 42  GLN A N   1 
ATOM   118   C CA  . GLN A 1 16  ? 37.846  46.755  -16.955 1.00 18.11  ? 42  GLN A CA  1 
ATOM   119   C C   . GLN A 1 16  ? 37.414  48.173  -16.618 1.00 19.91  ? 42  GLN A C   1 
ATOM   120   O O   . GLN A 1 16  ? 36.574  48.762  -17.310 1.00 21.23  ? 42  GLN A O   1 
ATOM   121   C CB  . GLN A 1 16  ? 38.931  46.786  -18.031 1.00 17.90  ? 42  GLN A CB  1 
ATOM   122   C CG  . GLN A 1 16  ? 39.610  45.442  -18.246 1.00 23.31  ? 42  GLN A CG  1 
ATOM   123   C CD  . GLN A 1 16  ? 40.428  45.414  -19.518 1.00 25.56  ? 42  GLN A CD  1 
ATOM   124   O OE1 . GLN A 1 16  ? 39.902  45.661  -20.598 1.00 26.93  ? 42  GLN A OE1 1 
ATOM   125   N NE2 . GLN A 1 16  ? 41.723  45.117  -19.399 1.00 25.84  ? 42  GLN A NE2 1 
ATOM   126   N N   . ILE A 1 17  ? 37.975  48.712  -15.545 1.00 17.87  ? 43  ILE A N   1 
ATOM   127   C CA  . ILE A 1 17  ? 37.640  50.054  -15.122 1.00 14.61  ? 43  ILE A CA  1 
ATOM   128   C C   . ILE A 1 17  ? 38.876  50.802  -14.650 1.00 13.89  ? 43  ILE A C   1 
ATOM   129   O O   . ILE A 1 17  ? 39.654  50.295  -13.840 1.00 11.74  ? 43  ILE A O   1 
ATOM   130   C CB  . ILE A 1 17  ? 36.622  50.043  -13.961 1.00 16.15  ? 43  ILE A CB  1 
ATOM   131   C CG1 . ILE A 1 17  ? 35.356  49.319  -14.392 1.00 10.95  ? 43  ILE A CG1 1 
ATOM   132   C CG2 . ILE A 1 17  ? 36.324  51.490  -13.503 1.00 15.18  ? 43  ILE A CG2 1 
ATOM   133   C CD1 . ILE A 1 17  ? 34.240  49.435  -13.399 1.00 13.48  ? 43  ILE A CD1 1 
ATOM   134   N N   . TRP A 1 18  ? 39.027  52.019  -15.157 1.00 12.99  ? 44  TRP A N   1 
ATOM   135   C CA  . TRP A 1 18  ? 40.136  52.887  -14.801 1.00 14.54  ? 44  TRP A CA  1 
ATOM   136   C C   . TRP A 1 18  ? 39.555  54.214  -14.373 1.00 15.50  ? 44  TRP A C   1 
ATOM   137   O O   . TRP A 1 18  ? 38.507  54.646  -14.850 1.00 13.50  ? 44  TRP A O   1 
ATOM   138   C CB  . TRP A 1 18  ? 41.051  53.180  -15.999 1.00 16.89  ? 44  TRP A CB  1 
ATOM   139   C CG  . TRP A 1 18  ? 41.734  52.011  -16.615 1.00 14.17  ? 44  TRP A CG  1 
ATOM   140   C CD1 . TRP A 1 18  ? 42.958  51.514  -16.293 1.00 14.44  ? 44  TRP A CD1 1 
ATOM   141   C CD2 . TRP A 1 18  ? 41.262  51.237  -17.723 1.00 15.72  ? 44  TRP A CD2 1 
ATOM   142   N NE1 . TRP A 1 18  ? 43.288  50.477  -17.136 1.00 19.06  ? 44  TRP A NE1 1 
ATOM   143   C CE2 . TRP A 1 18  ? 42.262  50.286  -18.025 1.00 17.80  ? 44  TRP A CE2 1 
ATOM   144   C CE3 . TRP A 1 18  ? 40.089  51.253  -18.489 1.00 15.95  ? 44  TRP A CE3 1 
ATOM   145   C CZ2 . TRP A 1 18  ? 42.130  49.359  -19.068 1.00 17.37  ? 44  TRP A CZ2 1 
ATOM   146   C CZ3 . TRP A 1 18  ? 39.955  50.332  -19.528 1.00 19.07  ? 44  TRP A CZ3 1 
ATOM   147   C CH2 . TRP A 1 18  ? 40.972  49.398  -19.807 1.00 18.83  ? 44  TRP A CH2 1 
ATOM   148   N N   . ARG A 1 19  ? 40.263  54.872  -13.480 1.00 17.76  ? 45  ARG A N   1 
ATOM   149   C CA  . ARG A 1 19  ? 39.850  56.178  -13.020 1.00 19.00  ? 45  ARG A CA  1 
ATOM   150   C C   . ARG A 1 19  ? 40.860  57.130  -13.664 1.00 20.61  ? 45  ARG A C   1 
ATOM   151   O O   . ARG A 1 19  ? 42.044  56.807  -13.779 1.00 21.43  ? 45  ARG A O   1 
ATOM   152   C CB  . ARG A 1 19  ? 39.952  56.205  -11.510 1.00 16.59  ? 45  ARG A CB  1 
ATOM   153   C CG  . ARG A 1 19  ? 39.590  57.483  -10.806 1.00 14.83  ? 45  ARG A CG  1 
ATOM   154   C CD  . ARG A 1 19  ? 40.298  57.364  -9.477  1.00 18.92  ? 45  ARG A CD  1 
ATOM   155   N NE  . ARG A 1 19  ? 39.986  58.374  -8.489  1.00 17.03  ? 45  ARG A NE  1 
ATOM   156   C CZ  . ARG A 1 19  ? 40.755  58.605  -7.435  1.00 13.94  ? 45  ARG A CZ  1 
ATOM   157   N NH1 . ARG A 1 19  ? 41.859  57.893  -7.269  1.00 10.99  ? 45  ARG A NH1 1 
ATOM   158   N NH2 . ARG A 1 19  ? 40.419  59.533  -6.551  1.00 12.43  ? 45  ARG A NH2 1 
ATOM   159   N N   . VAL A 1 20  ? 40.402  58.275  -14.135 1.00 20.17  ? 46  VAL A N   1 
ATOM   160   C CA  . VAL A 1 20  ? 41.332  59.222  -14.718 1.00 21.17  ? 46  VAL A CA  1 
ATOM   161   C C   . VAL A 1 20  ? 41.954  60.024  -13.564 1.00 22.55  ? 46  VAL A C   1 
ATOM   162   O O   . VAL A 1 20  ? 41.239  60.629  -12.774 1.00 23.26  ? 46  VAL A O   1 
ATOM   163   C CB  . VAL A 1 20  ? 40.611  60.165  -15.690 1.00 19.56  ? 46  VAL A CB  1 
ATOM   164   C CG1 . VAL A 1 20  ? 41.599  61.106  -16.318 1.00 20.03  ? 46  VAL A CG1 1 
ATOM   165   C CG2 . VAL A 1 20  ? 39.900  59.349  -16.765 1.00 20.11  ? 46  VAL A CG2 1 
ATOM   166   N N   . GLU A 1 21  ? 43.280  60.001  -13.447 1.00 22.56  ? 47  GLU A N   1 
ATOM   167   C CA  . GLU A 1 21  ? 43.961  60.734  -12.386 1.00 24.37  ? 47  GLU A CA  1 
ATOM   168   C C   . GLU A 1 21  ? 45.078  61.569  -12.991 1.00 26.01  ? 47  GLU A C   1 
ATOM   169   O O   . GLU A 1 21  ? 46.093  61.024  -13.416 1.00 27.17  ? 47  GLU A O   1 
ATOM   170   C CB  . GLU A 1 21  ? 44.547  59.766  -11.357 1.00 24.11  ? 47  GLU A CB  1 
ATOM   171   C CG  . GLU A 1 21  ? 43.660  58.560  -11.073 1.00 24.57  ? 47  GLU A CG  1 
ATOM   172   C CD  . GLU A 1 21  ? 44.051  57.812  -9.811  1.00 24.81  ? 47  GLU A CD  1 
ATOM   173   O OE1 . GLU A 1 21  ? 45.154  58.050  -9.274  1.00 23.15  ? 47  GLU A OE1 1 
ATOM   174   O OE2 . GLU A 1 21  ? 43.247  56.976  -9.353  1.00 28.05  ? 47  GLU A OE2 1 
ATOM   175   N N   . LYS A 1 22  ? 44.888  62.888  -13.029 1.00 26.98  ? 48  LYS A N   1 
ATOM   176   C CA  . LYS A 1 22  ? 45.882  63.802  -13.587 1.00 28.65  ? 48  LYS A CA  1 
ATOM   177   C C   . LYS A 1 22  ? 46.321  63.367  -14.985 1.00 28.60  ? 48  LYS A C   1 
ATOM   178   O O   . LYS A 1 22  ? 47.509  63.184  -15.247 1.00 31.50  ? 48  LYS A O   1 
ATOM   179   C CB  . LYS A 1 22  ? 47.106  63.881  -12.668 1.00 31.14  ? 48  LYS A CB  1 
ATOM   180   C CG  . LYS A 1 22  ? 46.791  64.443  -11.301 1.00 38.69  ? 48  LYS A CG  1 
ATOM   181   C CD  . LYS A 1 22  ? 47.956  64.281  -10.320 1.00 44.84  ? 48  LYS A CD  1 
ATOM   182   C CE  . LYS A 1 22  ? 47.544  64.735  -8.910  1.00 47.50  ? 48  LYS A CE  1 
ATOM   183   N NZ  . LYS A 1 22  ? 48.595  64.511  -7.875  1.00 48.02  ? 48  LYS A NZ  1 
ATOM   184   N N   . PHE A 1 23  ? 45.349  63.207  -15.874 1.00 26.53  ? 49  PHE A N   1 
ATOM   185   C CA  . PHE A 1 23  ? 45.591  62.799  -17.251 1.00 23.13  ? 49  PHE A CA  1 
ATOM   186   C C   . PHE A 1 23  ? 46.322  61.469  -17.353 1.00 22.50  ? 49  PHE A C   1 
ATOM   187   O O   . PHE A 1 23  ? 47.270  61.329  -18.110 1.00 22.00  ? 49  PHE A O   1 
ATOM   188   C CB  . PHE A 1 23  ? 46.374  63.876  -18.014 1.00 24.29  ? 49  PHE A CB  1 
ATOM   189   C CG  . PHE A 1 23  ? 46.148  63.844  -19.507 1.00 26.22  ? 49  PHE A CG  1 
ATOM   190   C CD1 . PHE A 1 23  ? 46.949  64.586  -20.360 1.00 29.85  ? 49  PHE A CD1 1 
ATOM   191   C CD2 . PHE A 1 23  ? 45.141  63.050  -20.062 1.00 29.56  ? 49  PHE A CD2 1 
ATOM   192   C CE1 . PHE A 1 23  ? 46.755  64.541  -21.743 1.00 29.82  ? 49  PHE A CE1 1 
ATOM   193   C CE2 . PHE A 1 23  ? 44.940  62.999  -21.434 1.00 27.82  ? 49  PHE A CE2 1 
ATOM   194   C CZ  . PHE A 1 23  ? 45.752  63.744  -22.277 1.00 31.25  ? 49  PHE A CZ  1 
ATOM   195   N N   . ASP A 1 24  ? 45.863  60.489  -16.590 1.00 24.71  ? 50  ASP A N   1 
ATOM   196   C CA  . ASP A 1 24  ? 46.450  59.157  -16.610 1.00 24.53  ? 50  ASP A CA  1 
ATOM   197   C C   . ASP A 1 24  ? 45.349  58.153  -16.274 1.00 22.98  ? 50  ASP A C   1 
ATOM   198   O O   . ASP A 1 24  ? 44.376  58.498  -15.610 1.00 22.26  ? 50  ASP A O   1 
ATOM   199   C CB  . ASP A 1 24  ? 47.587  59.080  -15.592 1.00 25.47  ? 50  ASP A CB  1 
ATOM   200   C CG  . ASP A 1 24  ? 48.480  57.874  -15.800 1.00 26.87  ? 50  ASP A CG  1 
ATOM   201   O OD1 . ASP A 1 24  ? 48.553  57.375  -16.941 1.00 27.53  ? 50  ASP A OD1 1 
ATOM   202   O OD2 . ASP A 1 24  ? 49.127  57.439  -14.820 1.00 29.70  ? 50  ASP A OD2 1 
ATOM   203   N N   . LEU A 1 25  ? 45.484  56.923  -16.755 1.00 22.61  ? 51  LEU A N   1 
ATOM   204   C CA  . LEU A 1 25  ? 44.490  55.890  -16.477 1.00 22.25  ? 51  LEU A CA  1 
ATOM   205   C C   . LEU A 1 25  ? 45.021  54.972  -15.389 1.00 21.78  ? 51  LEU A C   1 
ATOM   206   O O   . LEU A 1 25  ? 46.042  54.309  -15.573 1.00 23.33  ? 51  LEU A O   1 
ATOM   207   C CB  . LEU A 1 25  ? 44.204  55.069  -17.732 1.00 22.91  ? 51  LEU A CB  1 
ATOM   208   C CG  . LEU A 1 25  ? 43.619  55.835  -18.918 1.00 23.58  ? 51  LEU A CG  1 
ATOM   209   C CD1 . LEU A 1 25  ? 43.587  54.940  -20.139 1.00 23.38  ? 51  LEU A CD1 1 
ATOM   210   C CD2 . LEU A 1 25  ? 42.222  56.311  -18.572 1.00 25.87  ? 51  LEU A CD2 1 
ATOM   211   N N   . VAL A 1 26  ? 44.332  54.936  -14.252 1.00 20.50  ? 52  VAL A N   1 
ATOM   212   C CA  . VAL A 1 26  ? 44.750  54.094  -13.139 1.00 16.83  ? 52  VAL A CA  1 
ATOM   213   C C   . VAL A 1 26  ? 43.707  53.043  -12.826 1.00 16.23  ? 52  VAL A C   1 
ATOM   214   O O   . VAL A 1 26  ? 42.565  53.354  -12.491 1.00 18.48  ? 52  VAL A O   1 
ATOM   215   C CB  . VAL A 1 26  ? 44.997  54.916  -11.863 1.00 18.80  ? 52  VAL A CB  1 
ATOM   216   C CG1 . VAL A 1 26  ? 45.664  54.046  -10.820 1.00 15.36  ? 52  VAL A CG1 1 
ATOM   217   C CG2 . VAL A 1 26  ? 45.856  56.135  -12.179 1.00 17.72  ? 52  VAL A CG2 1 
ATOM   218   N N   . PRO A 1 27  ? 44.090  51.771  -12.937 1.00 15.80  ? 53  PRO A N   1 
ATOM   219   C CA  . PRO A 1 27  ? 43.206  50.637  -12.668 1.00 16.06  ? 53  PRO A CA  1 
ATOM   220   C C   . PRO A 1 27  ? 42.491  50.730  -11.327 1.00 17.27  ? 53  PRO A C   1 
ATOM   221   O O   . PRO A 1 27  ? 43.105  51.064  -10.318 1.00 20.30  ? 53  PRO A O   1 
ATOM   222   C CB  . PRO A 1 27  ? 44.163  49.441  -12.702 1.00 14.44  ? 53  PRO A CB  1 
ATOM   223   C CG  . PRO A 1 27  ? 45.182  49.867  -13.716 1.00 14.25  ? 53  PRO A CG  1 
ATOM   224   C CD  . PRO A 1 27  ? 45.427  51.314  -13.360 1.00 17.01  ? 53  PRO A CD  1 
ATOM   225   N N   . VAL A 1 28  ? 41.195  50.441  -11.318 1.00 17.50  ? 54  VAL A N   1 
ATOM   226   C CA  . VAL A 1 28  ? 40.440  50.423  -10.077 1.00 18.55  ? 54  VAL A CA  1 
ATOM   227   C C   . VAL A 1 28  ? 40.503  48.956  -9.623  1.00 21.06  ? 54  VAL A C   1 
ATOM   228   O O   . VAL A 1 28  ? 40.395  48.042  -10.450 1.00 21.27  ? 54  VAL A O   1 
ATOM   229   C CB  . VAL A 1 28  ? 38.951  50.835  -10.281 1.00 18.05  ? 54  VAL A CB  1 
ATOM   230   C CG1 . VAL A 1 28  ? 38.170  50.568  -8.998  1.00 15.16  ? 54  VAL A CG1 1 
ATOM   231   C CG2 . VAL A 1 28  ? 38.846  52.321  -10.638 1.00 12.57  ? 54  VAL A CG2 1 
ATOM   232   N N   . PRO A 1 29  ? 40.703  48.708  -8.316  1.00 20.70  ? 55  PRO A N   1 
ATOM   233   C CA  . PRO A 1 29  ? 40.775  47.326  -7.816  1.00 20.15  ? 55  PRO A CA  1 
ATOM   234   C C   . PRO A 1 29  ? 39.492  46.594  -8.180  1.00 20.08  ? 55  PRO A C   1 
ATOM   235   O O   . PRO A 1 29  ? 38.411  47.081  -7.880  1.00 22.13  ? 55  PRO A O   1 
ATOM   236   C CB  . PRO A 1 29  ? 40.931  47.518  -6.313  1.00 19.70  ? 55  PRO A CB  1 
ATOM   237   C CG  . PRO A 1 29  ? 41.691  48.820  -6.223  1.00 19.24  ? 55  PRO A CG  1 
ATOM   238   C CD  . PRO A 1 29  ? 40.971  49.672  -7.236  1.00 20.75  ? 55  PRO A CD  1 
ATOM   239   N N   . PRO A 1 30  ? 39.595  45.415  -8.822  1.00 19.48  ? 56  PRO A N   1 
ATOM   240   C CA  . PRO A 1 30  ? 38.425  44.623  -9.233  1.00 21.18  ? 56  PRO A CA  1 
ATOM   241   C C   . PRO A 1 30  ? 37.348  44.422  -8.164  1.00 22.16  ? 56  PRO A C   1 
ATOM   242   O O   . PRO A 1 30  ? 36.157  44.417  -8.480  1.00 21.74  ? 56  PRO A O   1 
ATOM   243   C CB  . PRO A 1 30  ? 39.037  43.294  -9.692  1.00 20.90  ? 56  PRO A CB  1 
ATOM   244   C CG  . PRO A 1 30  ? 40.398  43.676  -10.147 1.00 20.36  ? 56  PRO A CG  1 
ATOM   245   C CD  . PRO A 1 30  ? 40.836  44.664  -9.080  1.00 21.18  ? 56  PRO A CD  1 
ATOM   246   N N   . ASN A 1 31  ? 37.758  44.248  -6.911  1.00 21.30  ? 57  ASN A N   1 
ATOM   247   C CA  . ASN A 1 31  ? 36.793  44.055  -5.835  1.00 23.46  ? 57  ASN A CA  1 
ATOM   248   C C   . ASN A 1 31  ? 36.034  45.333  -5.493  1.00 22.73  ? 57  ASN A C   1 
ATOM   249   O O   . ASN A 1 31  ? 35.058  45.293  -4.738  1.00 21.00  ? 57  ASN A O   1 
ATOM   250   C CB  . ASN A 1 31  ? 37.480  43.496  -4.579  1.00 27.75  ? 57  ASN A CB  1 
ATOM   251   C CG  . ASN A 1 31  ? 38.788  44.214  -4.245  1.00 36.64  ? 57  ASN A CG  1 
ATOM   252   O OD1 . ASN A 1 31  ? 39.732  44.226  -5.045  1.00 36.45  ? 57  ASN A OD1 1 
ATOM   253   N ND2 . ASN A 1 31  ? 38.854  44.803  -3.048  1.00 39.40  ? 57  ASN A ND2 1 
ATOM   254   N N   . LEU A 1 32  ? 36.466  46.463  -6.056  1.00 21.96  ? 58  LEU A N   1 
ATOM   255   C CA  . LEU A 1 32  ? 35.794  47.742  -5.795  1.00 22.16  ? 58  LEU A CA  1 
ATOM   256   C C   . LEU A 1 32  ? 34.949  48.272  -6.966  1.00 21.26  ? 58  LEU A C   1 
ATOM   257   O O   . LEU A 1 32  ? 34.406  49.380  -6.889  1.00 19.60  ? 58  LEU A O   1 
ATOM   258   C CB  . LEU A 1 32  ? 36.805  48.817  -5.369  1.00 18.36  ? 58  LEU A CB  1 
ATOM   259   C CG  . LEU A 1 32  ? 37.555  48.544  -4.061  1.00 21.50  ? 58  LEU A CG  1 
ATOM   260   C CD1 . LEU A 1 32  ? 38.511  49.686  -3.779  1.00 19.93  ? 58  LEU A CD1 1 
ATOM   261   C CD2 . LEU A 1 32  ? 36.579  48.363  -2.913  1.00 19.90  ? 58  LEU A CD2 1 
ATOM   262   N N   . TYR A 1 33  ? 34.837  47.496  -8.042  1.00 18.42  ? 59  TYR A N   1 
ATOM   263   C CA  . TYR A 1 33  ? 34.031  47.926  -9.174  1.00 17.63  ? 59  TYR A CA  1 
ATOM   264   C C   . TYR A 1 33  ? 32.635  48.238  -8.683  1.00 18.20  ? 59  TYR A C   1 
ATOM   265   O O   . TYR A 1 33  ? 32.038  47.444  -7.969  1.00 19.71  ? 59  TYR A O   1 
ATOM   266   C CB  . TYR A 1 33  ? 33.938  46.836  -10.232 1.00 16.17  ? 59  TYR A CB  1 
ATOM   267   C CG  . TYR A 1 33  ? 35.182  46.647  -11.056 1.00 18.11  ? 59  TYR A CG  1 
ATOM   268   C CD1 . TYR A 1 33  ? 36.318  47.429  -10.837 1.00 19.10  ? 59  TYR A CD1 1 
ATOM   269   C CD2 . TYR A 1 33  ? 35.231  45.673  -12.049 1.00 14.92  ? 59  TYR A CD2 1 
ATOM   270   C CE1 . TYR A 1 33  ? 37.473  47.243  -11.588 1.00 20.65  ? 59  TYR A CE1 1 
ATOM   271   C CE2 . TYR A 1 33  ? 36.381  45.474  -12.804 1.00 19.68  ? 59  TYR A CE2 1 
ATOM   272   C CZ  . TYR A 1 33  ? 37.501  46.262  -12.575 1.00 22.54  ? 59  TYR A CZ  1 
ATOM   273   O OH  . TYR A 1 33  ? 38.643  46.082  -13.342 1.00 21.53  ? 59  TYR A OH  1 
ATOM   274   N N   . GLY A 1 34  ? 32.111  49.390  -9.084  1.00 20.73  ? 60  GLY A N   1 
ATOM   275   C CA  . GLY A 1 34  ? 30.786  49.788  -8.660  1.00 19.76  ? 60  GLY A CA  1 
ATOM   276   C C   . GLY A 1 34  ? 30.901  51.021  -7.790  1.00 21.48  ? 60  GLY A C   1 
ATOM   277   O O   . GLY A 1 34  ? 29.922  51.735  -7.584  1.00 21.23  ? 60  GLY A O   1 
ATOM   278   N N   . ASP A 1 35  ? 32.105  51.258  -7.266  1.00 21.76  ? 61  ASP A N   1 
ATOM   279   C CA  . ASP A 1 35  ? 32.380  52.428  -6.432  1.00 21.63  ? 61  ASP A CA  1 
ATOM   280   C C   . ASP A 1 35  ? 32.957  53.511  -7.328  1.00 20.59  ? 61  ASP A C   1 
ATOM   281   O O   . ASP A 1 35  ? 33.933  53.278  -8.042  1.00 21.28  ? 61  ASP A O   1 
ATOM   282   C CB  . ASP A 1 35  ? 33.411  52.109  -5.345  1.00 23.80  ? 61  ASP A CB  1 
ATOM   283   C CG  . ASP A 1 35  ? 32.860  51.234  -4.239  1.00 25.98  ? 61  ASP A CG  1 
ATOM   284   O OD1 . ASP A 1 35  ? 31.706  50.777  -4.333  1.00 24.31  ? 61  ASP A OD1 1 
ATOM   285   O OD2 . ASP A 1 35  ? 33.602  51.006  -3.266  1.00 28.66  ? 61  ASP A OD2 1 
ATOM   286   N N   . PHE A 1 36  ? 32.357  54.695  -7.288  1.00 20.74  ? 62  PHE A N   1 
ATOM   287   C CA  . PHE A 1 36  ? 32.826  55.815  -8.097  1.00 19.07  ? 62  PHE A CA  1 
ATOM   288   C C   . PHE A 1 36  ? 32.891  57.080  -7.256  1.00 19.63  ? 62  PHE A C   1 
ATOM   289   O O   . PHE A 1 36  ? 31.927  57.420  -6.578  1.00 22.48  ? 62  PHE A O   1 
ATOM   290   C CB  . PHE A 1 36  ? 31.871  56.075  -9.266  1.00 17.59  ? 62  PHE A CB  1 
ATOM   291   C CG  . PHE A 1 36  ? 31.800  54.961  -10.261 1.00 17.27  ? 62  PHE A CG  1 
ATOM   292   C CD1 . PHE A 1 36  ? 32.755  54.849  -11.261 1.00 15.56  ? 62  PHE A CD1 1 
ATOM   293   C CD2 . PHE A 1 36  ? 30.778  54.018  -10.195 1.00 17.34  ? 62  PHE A CD2 1 
ATOM   294   C CE1 . PHE A 1 36  ? 32.694  53.814  -12.188 1.00 18.60  ? 62  PHE A CE1 1 
ATOM   295   C CE2 . PHE A 1 36  ? 30.704  52.975  -11.117 1.00 18.72  ? 62  PHE A CE2 1 
ATOM   296   C CZ  . PHE A 1 36  ? 31.661  52.869  -12.116 1.00 19.27  ? 62  PHE A CZ  1 
ATOM   297   N N   . PHE A 1 37  ? 34.021  57.779  -7.301  1.00 17.67  ? 63  PHE A N   1 
ATOM   298   C CA  . PHE A 1 37  ? 34.148  59.028  -6.572  1.00 17.51  ? 63  PHE A CA  1 
ATOM   299   C C   . PHE A 1 37  ? 33.397  60.149  -7.317  1.00 17.36  ? 63  PHE A C   1 
ATOM   300   O O   . PHE A 1 37  ? 33.628  60.408  -8.495  1.00 16.48  ? 63  PHE A O   1 
ATOM   301   C CB  . PHE A 1 37  ? 35.623  59.397  -6.394  1.00 17.15  ? 63  PHE A CB  1 
ATOM   302   C CG  . PHE A 1 37  ? 36.307  58.643  -5.284  1.00 17.38  ? 63  PHE A CG  1 
ATOM   303   C CD1 . PHE A 1 37  ? 37.192  57.607  -5.565  1.00 17.59  ? 63  PHE A CD1 1 
ATOM   304   C CD2 . PHE A 1 37  ? 36.099  59.000  -3.950  1.00 16.30  ? 63  PHE A CD2 1 
ATOM   305   C CE1 . PHE A 1 37  ? 37.863  56.942  -4.533  1.00 16.39  ? 63  PHE A CE1 1 
ATOM   306   C CE2 . PHE A 1 37  ? 36.766  58.340  -2.914  1.00 10.87  ? 63  PHE A CE2 1 
ATOM   307   C CZ  . PHE A 1 37  ? 37.645  57.316  -3.204  1.00 13.99  ? 63  PHE A CZ  1 
ATOM   308   N N   . THR A 1 38  ? 32.501  60.816  -6.612  1.00 17.69  ? 64  THR A N   1 
ATOM   309   C CA  . THR A 1 38  ? 31.691  61.881  -7.189  1.00 20.62  ? 64  THR A CA  1 
ATOM   310   C C   . THR A 1 38  ? 32.408  63.050  -7.887  1.00 22.83  ? 64  THR A C   1 
ATOM   311   O O   . THR A 1 38  ? 31.818  63.727  -8.740  1.00 21.78  ? 64  THR A O   1 
ATOM   312   C CB  . THR A 1 38  ? 30.743  62.409  -6.117  1.00 19.39  ? 64  THR A CB  1 
ATOM   313   O OG1 . THR A 1 38  ? 29.697  61.445  -5.929  1.00 24.79  ? 64  THR A OG1 1 
ATOM   314   C CG2 . THR A 1 38  ? 30.148  63.714  -6.520  1.00 23.66  ? 64  THR A CG2 1 
ATOM   315   N N   . GLY A 1 39  ? 33.672  63.278  -7.536  1.00 22.07  ? 65  GLY A N   1 
ATOM   316   C CA  . GLY A 1 39  ? 34.426  64.353  -8.147  1.00 22.32  ? 65  GLY A CA  1 
ATOM   317   C C   . GLY A 1 39  ? 35.471  63.848  -9.122  1.00 25.93  ? 65  GLY A C   1 
ATOM   318   O O   . GLY A 1 39  ? 36.436  64.555  -9.431  1.00 27.65  ? 65  GLY A O   1 
ATOM   319   N N   . ASP A 1 40  ? 35.288  62.622  -9.608  1.00 25.59  ? 66  ASP A N   1 
ATOM   320   C CA  . ASP A 1 40  ? 36.227  62.031  -10.557 1.00 21.99  ? 66  ASP A CA  1 
ATOM   321   C C   . ASP A 1 40  ? 35.557  61.604  -11.849 1.00 20.51  ? 66  ASP A C   1 
ATOM   322   O O   . ASP A 1 40  ? 34.338  61.643  -11.977 1.00 20.84  ? 66  ASP A O   1 
ATOM   323   C CB  . ASP A 1 40  ? 36.918  60.816  -9.937  1.00 20.58  ? 66  ASP A CB  1 
ATOM   324   C CG  . ASP A 1 40  ? 37.986  61.195  -8.937  1.00 19.65  ? 66  ASP A CG  1 
ATOM   325   O OD1 . ASP A 1 40  ? 38.274  60.367  -8.050  1.00 15.74  ? 66  ASP A OD1 1 
ATOM   326   O OD2 . ASP A 1 40  ? 38.546  62.307  -9.037  1.00 20.88  ? 66  ASP A OD2 1 
ATOM   327   N N   . ALA A 1 41  ? 36.377  61.195  -12.808 1.00 21.03  ? 67  ALA A N   1 
ATOM   328   C CA  . ALA A 1 41  ? 35.893  60.718  -14.102 1.00 18.24  ? 67  ALA A CA  1 
ATOM   329   C C   . ALA A 1 41  ? 36.504  59.336  -14.291 1.00 14.60  ? 67  ALA A C   1 
ATOM   330   O O   . ALA A 1 41  ? 37.635  59.108  -13.877 1.00 12.14  ? 67  ALA A O   1 
ATOM   331   C CB  . ALA A 1 41  ? 36.345  61.656  -15.222 1.00 18.72  ? 67  ALA A CB  1 
ATOM   332   N N   . TYR A 1 42  ? 35.755  58.422  -14.900 1.00 13.09  ? 68  TYR A N   1 
ATOM   333   C CA  . TYR A 1 42  ? 36.238  57.068  -15.123 1.00 12.54  ? 68  TYR A CA  1 
ATOM   334   C C   . TYR A 1 42  ? 36.045  56.616  -16.558 1.00 13.97  ? 68  TYR A C   1 
ATOM   335   O O   . TYR A 1 42  ? 35.238  57.177  -17.303 1.00 13.54  ? 68  TYR A O   1 
ATOM   336   C CB  . TYR A 1 42  ? 35.510  56.066  -14.222 1.00 15.06  ? 68  TYR A CB  1 
ATOM   337   C CG  . TYR A 1 42  ? 35.720  56.229  -12.736 1.00 13.58  ? 68  TYR A CG  1 
ATOM   338   C CD1 . TYR A 1 42  ? 35.174  57.317  -12.042 1.00 18.90  ? 68  TYR A CD1 1 
ATOM   339   C CD2 . TYR A 1 42  ? 36.435  55.277  -12.011 1.00 13.53  ? 68  TYR A CD2 1 
ATOM   340   C CE1 . TYR A 1 42  ? 35.335  57.448  -10.658 1.00 12.25  ? 68  TYR A CE1 1 
ATOM   341   C CE2 . TYR A 1 42  ? 36.602  55.396  -10.630 1.00 12.36  ? 68  TYR A CE2 1 
ATOM   342   C CZ  . TYR A 1 42  ? 36.050  56.480  -9.967  1.00 13.76  ? 68  TYR A CZ  1 
ATOM   343   O OH  . TYR A 1 42  ? 36.217  56.592  -8.618  1.00 15.13  ? 68  TYR A OH  1 
ATOM   344   N N   . VAL A 1 43  ? 36.794  55.582  -16.932 1.00 14.53  ? 69  VAL A N   1 
ATOM   345   C CA  . VAL A 1 43  ? 36.721  54.987  -18.262 1.00 13.38  ? 69  VAL A CA  1 
ATOM   346   C C   . VAL A 1 43  ? 36.436  53.515  -18.016 1.00 12.23  ? 69  VAL A C   1 
ATOM   347   O O   . VAL A 1 43  ? 37.171  52.858  -17.287 1.00 11.13  ? 69  VAL A O   1 
ATOM   348   C CB  . VAL A 1 43  ? 38.059  55.122  -19.045 1.00 16.40  ? 69  VAL A CB  1 
ATOM   349   C CG1 . VAL A 1 43  ? 38.003  54.280  -20.327 1.00 15.83  ? 69  VAL A CG1 1 
ATOM   350   C CG2 . VAL A 1 43  ? 38.310  56.574  -19.406 1.00 14.07  ? 69  VAL A CG2 1 
ATOM   351   N N   . ILE A 1 44  ? 35.365  53.013  -18.619 1.00 15.18  ? 70  ILE A N   1 
ATOM   352   C CA  . ILE A 1 44  ? 34.944  51.625  -18.453 1.00 15.02  ? 70  ILE A CA  1 
ATOM   353   C C   . ILE A 1 44  ? 34.870  50.899  -19.799 1.00 20.24  ? 70  ILE A C   1 
ATOM   354   O O   . ILE A 1 44  ? 34.121  51.309  -20.701 1.00 22.27  ? 70  ILE A O   1 
ATOM   355   C CB  . ILE A 1 44  ? 33.549  51.560  -17.781 1.00 14.10  ? 70  ILE A CB  1 
ATOM   356   C CG1 . ILE A 1 44  ? 33.594  52.221  -16.399 1.00 15.63  ? 70  ILE A CG1 1 
ATOM   357   C CG2 . ILE A 1 44  ? 33.082  50.133  -17.658 1.00 20.66  ? 70  ILE A CG2 1 
ATOM   358   C CD1 . ILE A 1 44  ? 33.452  53.741  -16.426 1.00 8.01   ? 70  ILE A CD1 1 
ATOM   359   N N   . LEU A 1 45  ? 35.660  49.836  -19.948 1.00 19.73  ? 71  LEU A N   1 
ATOM   360   C CA  . LEU A 1 45  ? 35.640  49.055  -21.183 1.00 18.76  ? 71  LEU A CA  1 
ATOM   361   C C   . LEU A 1 45  ? 35.043  47.678  -20.916 1.00 17.93  ? 71  LEU A C   1 
ATOM   362   O O   . LEU A 1 45  ? 35.542  46.930  -20.080 1.00 15.21  ? 71  LEU A O   1 
ATOM   363   C CB  . LEU A 1 45  ? 37.052  48.897  -21.777 1.00 18.11  ? 71  LEU A CB  1 
ATOM   364   C CG  . LEU A 1 45  ? 37.148  47.913  -22.958 1.00 14.11  ? 71  LEU A CG  1 
ATOM   365   C CD1 . LEU A 1 45  ? 36.185  48.324  -24.073 1.00 16.31  ? 71  LEU A CD1 1 
ATOM   366   C CD2 . LEU A 1 45  ? 38.559  47.876  -23.491 1.00 16.21  ? 71  LEU A CD2 1 
ATOM   367   N N   . LYS A 1 46  ? 33.965  47.363  -21.624 1.00 18.14  ? 72  LYS A N   1 
ATOM   368   C CA  . LYS A 1 46  ? 33.294  46.071  -21.477 1.00 19.74  ? 72  LYS A CA  1 
ATOM   369   C C   . LYS A 1 46  ? 33.539  45.260  -22.736 1.00 19.77  ? 72  LYS A C   1 
ATOM   370   O O   . LYS A 1 46  ? 33.211  45.700  -23.843 1.00 20.59  ? 72  LYS A O   1 
ATOM   371   C CB  . LYS A 1 46  ? 31.788  46.269  -21.269 1.00 21.82  ? 72  LYS A CB  1 
ATOM   372   C CG  . LYS A 1 46  ? 30.950  45.000  -21.367 1.00 22.65  ? 72  LYS A CG  1 
ATOM   373   C CD  . LYS A 1 46  ? 31.193  44.040  -20.218 1.00 21.55  ? 72  LYS A CD  1 
ATOM   374   C CE  . LYS A 1 46  ? 30.295  42.818  -20.353 1.00 25.41  ? 72  LYS A CE  1 
ATOM   375   N NZ  . LYS A 1 46  ? 30.402  41.871  -19.194 1.00 29.11  ? 72  LYS A NZ  1 
ATOM   376   N N   . THR A 1 47  ? 34.125  44.082  -22.576 1.00 17.58  ? 73  THR A N   1 
ATOM   377   C CA  . THR A 1 47  ? 34.405  43.256  -23.731 1.00 18.14  ? 73  THR A CA  1 
ATOM   378   C C   . THR A 1 47  ? 33.495  42.036  -23.778 1.00 19.83  ? 73  THR A C   1 
ATOM   379   O O   . THR A 1 47  ? 33.353  41.311  -22.796 1.00 21.35  ? 73  THR A O   1 
ATOM   380   C CB  . THR A 1 47  ? 35.893  42.823  -23.750 1.00 18.54  ? 73  THR A CB  1 
ATOM   381   O OG1 . THR A 1 47  ? 36.730  43.983  -23.895 1.00 14.81  ? 73  THR A OG1 1 
ATOM   382   C CG2 . THR A 1 47  ? 36.158  41.871  -24.908 1.00 15.86  ? 73  THR A CG2 1 
ATOM   383   N N   . VAL A 1 48  ? 32.871  41.821  -24.928 1.00 19.36  ? 74  VAL A N   1 
ATOM   384   C CA  . VAL A 1 48  ? 31.970  40.689  -25.110 1.00 18.45  ? 74  VAL A CA  1 
ATOM   385   C C   . VAL A 1 48  ? 32.410  39.830  -26.290 1.00 18.29  ? 74  VAL A C   1 
ATOM   386   O O   . VAL A 1 48  ? 32.940  40.332  -27.288 1.00 15.33  ? 74  VAL A O   1 
ATOM   387   C CB  . VAL A 1 48  ? 30.502  41.169  -25.365 1.00 20.16  ? 74  VAL A CB  1 
ATOM   388   C CG1 . VAL A 1 48  ? 29.658  40.026  -25.871 1.00 18.86  ? 74  VAL A CG1 1 
ATOM   389   C CG2 . VAL A 1 48  ? 29.888  41.721  -24.080 1.00 20.64  ? 74  VAL A CG2 1 
ATOM   390   N N   . GLN A 1 49  ? 32.200  38.527  -26.178 1.00 19.44  ? 75  GLN A N   1 
ATOM   391   C CA  . GLN A 1 49  ? 32.552  37.653  -27.282 1.00 20.85  ? 75  GLN A CA  1 
ATOM   392   C C   . GLN A 1 49  ? 31.321  37.420  -28.137 1.00 22.23  ? 75  GLN A C   1 
ATOM   393   O O   . GLN A 1 49  ? 30.305  36.931  -27.647 1.00 19.49  ? 75  GLN A O   1 
ATOM   394   C CB  . GLN A 1 49  ? 33.072  36.305  -26.790 1.00 21.69  ? 75  GLN A CB  1 
ATOM   395   C CG  . GLN A 1 49  ? 33.558  35.409  -27.912 1.00 19.61  ? 75  GLN A CG  1 
ATOM   396   C CD  . GLN A 1 49  ? 34.125  34.091  -27.409 1.00 26.41  ? 75  GLN A CD  1 
ATOM   397   O OE1 . GLN A 1 49  ? 33.394  33.240  -26.910 1.00 28.36  ? 75  GLN A OE1 1 
ATOM   398   N NE2 . GLN A 1 49  ? 35.440  33.922  -27.536 1.00 29.09  ? 75  GLN A NE2 1 
ATOM   399   N N   . LEU A 1 50  ? 31.406  37.789  -29.411 1.00 23.55  ? 76  LEU A N   1 
ATOM   400   C CA  . LEU A 1 50  ? 30.291  37.570  -30.318 1.00 25.36  ? 76  LEU A CA  1 
ATOM   401   C C   . LEU A 1 50  ? 30.214  36.062  -30.585 1.00 26.46  ? 76  LEU A C   1 
ATOM   402   O O   . LEU A 1 50  ? 31.125  35.315  -30.230 1.00 26.96  ? 76  LEU A O   1 
ATOM   403   C CB  . LEU A 1 50  ? 30.514  38.339  -31.620 1.00 24.58  ? 76  LEU A CB  1 
ATOM   404   C CG  . LEU A 1 50  ? 30.565  39.870  -31.517 1.00 23.60  ? 76  LEU A CG  1 
ATOM   405   C CD1 . LEU A 1 50  ? 30.797  40.462  -32.888 1.00 18.79  ? 76  LEU A CD1 1 
ATOM   406   C CD2 . LEU A 1 50  ? 29.265  40.396  -30.941 1.00 25.39  ? 76  LEU A CD2 1 
ATOM   407   N N   . ARG A 1 51  ? 29.135  35.611  -31.210 1.00 27.64  ? 77  ARG A N   1 
ATOM   408   C CA  . ARG A 1 51  ? 28.975  34.186  -31.477 1.00 28.17  ? 77  ARG A CA  1 
ATOM   409   C C   . ARG A 1 51  ? 30.008  33.599  -32.433 1.00 27.71  ? 77  ARG A C   1 
ATOM   410   O O   . ARG A 1 51  ? 30.291  32.405  -32.369 1.00 30.58  ? 77  ARG A O   1 
ATOM   411   C CB  . ARG A 1 51  ? 27.565  33.901  -31.984 1.00 27.88  ? 77  ARG A CB  1 
ATOM   412   C CG  . ARG A 1 51  ? 26.477  34.336  -31.012 1.00 34.49  ? 77  ARG A CG  1 
ATOM   413   C CD  . ARG A 1 51  ? 25.104  33.979  -31.540 1.00 40.77  ? 77  ARG A CD  1 
ATOM   414   N NE  . ARG A 1 51  ? 25.021  32.546  -31.804 1.00 48.51  ? 77  ARG A NE  1 
ATOM   415   C CZ  . ARG A 1 51  ? 24.129  31.977  -32.607 1.00 50.12  ? 77  ARG A CZ  1 
ATOM   416   N NH1 . ARG A 1 51  ? 23.225  32.716  -33.238 1.00 52.22  ? 77  ARG A NH1 1 
ATOM   417   N NH2 . ARG A 1 51  ? 24.148  30.664  -32.779 1.00 52.81  ? 77  ARG A NH2 1 
ATOM   418   N N   . ASN A 1 52  ? 30.581  34.421  -33.310 1.00 25.70  ? 78  ASN A N   1 
ATOM   419   C CA  . ASN A 1 52  ? 31.589  33.918  -34.241 1.00 22.07  ? 78  ASN A CA  1 
ATOM   420   C C   . ASN A 1 52  ? 32.988  33.960  -33.628 1.00 21.52  ? 78  ASN A C   1 
ATOM   421   O O   . ASN A 1 52  ? 33.981  33.780  -34.327 1.00 21.98  ? 78  ASN A O   1 
ATOM   422   C CB  . ASN A 1 52  ? 31.579  34.720  -35.550 1.00 23.36  ? 78  ASN A CB  1 
ATOM   423   C CG  . ASN A 1 52  ? 31.745  36.219  -35.329 1.00 27.84  ? 78  ASN A CG  1 
ATOM   424   O OD1 . ASN A 1 52  ? 32.238  36.660  -34.285 1.00 29.36  ? 78  ASN A OD1 1 
ATOM   425   N ND2 . ASN A 1 52  ? 31.344  37.009  -36.318 1.00 27.35  ? 78  ASN A ND2 1 
ATOM   426   N N   . GLY A 1 53  ? 33.062  34.202  -32.323 1.00 19.65  ? 79  GLY A N   1 
ATOM   427   C CA  . GLY A 1 53  ? 34.349  34.253  -31.652 1.00 18.85  ? 79  GLY A CA  1 
ATOM   428   C C   . GLY A 1 53  ? 35.009  35.626  -31.616 1.00 23.06  ? 79  GLY A C   1 
ATOM   429   O O   . GLY A 1 53  ? 35.944  35.846  -30.839 1.00 22.62  ? 79  GLY A O   1 
ATOM   430   N N   . ILE A 1 54  ? 34.529  36.547  -32.449 1.00 23.08  ? 80  ILE A N   1 
ATOM   431   C CA  . ILE A 1 54  ? 35.073  37.897  -32.516 1.00 25.49  ? 80  ILE A CA  1 
ATOM   432   C C   . ILE A 1 54  ? 34.751  38.664  -31.215 1.00 26.49  ? 80  ILE A C   1 
ATOM   433   O O   . ILE A 1 54  ? 33.837  38.279  -30.466 1.00 24.34  ? 80  ILE A O   1 
ATOM   434   C CB  . ILE A 1 54  ? 34.473  38.669  -33.733 1.00 32.56  ? 80  ILE A CB  1 
ATOM   435   C CG1 . ILE A 1 54  ? 34.774  37.944  -35.057 1.00 29.94  ? 80  ILE A CG1 1 
ATOM   436   C CG2 . ILE A 1 54  ? 35.028  40.081  -33.777 1.00 39.03  ? 80  ILE A CG2 1 
ATOM   437   C CD1 . ILE A 1 54  ? 36.231  37.795  -35.384 1.00 30.85  ? 80  ILE A CD1 1 
ATOM   438   N N   . LEU A 1 55  ? 35.503  39.737  -30.949 1.00 22.76  ? 81  LEU A N   1 
ATOM   439   C CA  . LEU A 1 55  ? 35.293  40.555  -29.748 1.00 21.96  ? 81  LEU A CA  1 
ATOM   440   C C   . LEU A 1 55  ? 34.543  41.860  -30.007 1.00 20.46  ? 81  LEU A C   1 
ATOM   441   O O   . LEU A 1 55  ? 34.785  42.544  -30.997 1.00 24.49  ? 81  LEU A O   1 
ATOM   442   C CB  . LEU A 1 55  ? 36.631  40.866  -29.074 1.00 19.24  ? 81  LEU A CB  1 
ATOM   443   C CG  . LEU A 1 55  ? 37.378  39.664  -28.497 1.00 17.21  ? 81  LEU A CG  1 
ATOM   444   C CD1 . LEU A 1 55  ? 38.667  40.139  -27.822 1.00 16.30  ? 81  LEU A CD1 1 
ATOM   445   C CD2 . LEU A 1 55  ? 36.483  38.933  -27.495 1.00 15.38  ? 81  LEU A CD2 1 
ATOM   446   N N   . GLN A 1 56  ? 33.626  42.192  -29.106 1.00 20.20  ? 82  GLN A N   1 
ATOM   447   C CA  . GLN A 1 56  ? 32.815  43.405  -29.202 1.00 20.13  ? 82  GLN A CA  1 
ATOM   448   C C   . GLN A 1 56  ? 33.170  44.330  -28.040 1.00 18.96  ? 82  GLN A C   1 
ATOM   449   O O   . GLN A 1 56  ? 33.418  43.858  -26.928 1.00 17.60  ? 82  GLN A O   1 
ATOM   450   C CB  . GLN A 1 56  ? 31.337  43.021  -29.151 1.00 23.49  ? 82  GLN A CB  1 
ATOM   451   C CG  . GLN A 1 56  ? 30.361  44.146  -28.858 1.00 26.02  ? 82  GLN A CG  1 
ATOM   452   C CD  . GLN A 1 56  ? 28.975  43.596  -28.593 1.00 26.11  ? 82  GLN A CD  1 
ATOM   453   O OE1 . GLN A 1 56  ? 28.461  42.824  -29.386 1.00 30.84  ? 82  GLN A OE1 1 
ATOM   454   N NE2 . GLN A 1 56  ? 28.371  43.983  -27.476 1.00 28.55  ? 82  GLN A NE2 1 
ATOM   455   N N   . TYR A 1 57  ? 33.183  45.640  -28.296 1.00 18.90  ? 83  TYR A N   1 
ATOM   456   C CA  . TYR A 1 57  ? 33.563  46.623  -27.275 1.00 19.61  ? 83  TYR A CA  1 
ATOM   457   C C   . TYR A 1 57  ? 32.586  47.745  -26.990 1.00 20.11  ? 83  TYR A C   1 
ATOM   458   O O   . TYR A 1 57  ? 32.125  48.424  -27.899 1.00 23.35  ? 83  TYR A O   1 
ATOM   459   C CB  . TYR A 1 57  ? 34.901  47.289  -27.631 1.00 18.03  ? 83  TYR A CB  1 
ATOM   460   C CG  . TYR A 1 57  ? 36.042  46.337  -27.919 1.00 20.40  ? 83  TYR A CG  1 
ATOM   461   C CD1 . TYR A 1 57  ? 36.575  46.221  -29.206 1.00 21.06  ? 83  TYR A CD1 1 
ATOM   462   C CD2 . TYR A 1 57  ? 36.591  45.555  -26.907 1.00 20.50  ? 83  TYR A CD2 1 
ATOM   463   C CE1 . TYR A 1 57  ? 37.629  45.345  -29.472 1.00 23.23  ? 83  TYR A CE1 1 
ATOM   464   C CE2 . TYR A 1 57  ? 37.638  44.682  -27.159 1.00 22.24  ? 83  TYR A CE2 1 
ATOM   465   C CZ  . TYR A 1 57  ? 38.159  44.580  -28.438 1.00 23.74  ? 83  TYR A CZ  1 
ATOM   466   O OH  . TYR A 1 57  ? 39.229  43.735  -28.666 1.00 24.38  ? 83  TYR A OH  1 
ATOM   467   N N   . ASP A 1 58  ? 32.289  47.936  -25.709 1.00 20.79  ? 84  ASP A N   1 
ATOM   468   C CA  . ASP A 1 58  ? 31.439  49.029  -25.257 1.00 21.00  ? 84  ASP A CA  1 
ATOM   469   C C   . ASP A 1 58  ? 32.334  49.927  -24.401 1.00 21.54  ? 84  ASP A C   1 
ATOM   470   O O   . ASP A 1 58  ? 32.864  49.501  -23.357 1.00 19.40  ? 84  ASP A O   1 
ATOM   471   C CB  . ASP A 1 58  ? 30.267  48.513  -24.437 1.00 22.97  ? 84  ASP A CB  1 
ATOM   472   C CG  . ASP A 1 58  ? 29.130  48.032  -25.307 1.00 25.83  ? 84  ASP A CG  1 
ATOM   473   O OD1 . ASP A 1 58  ? 28.415  48.883  -25.879 1.00 21.93  ? 84  ASP A OD1 1 
ATOM   474   O OD2 . ASP A 1 58  ? 28.967  46.800  -25.429 1.00 30.68  ? 84  ASP A OD2 1 
ATOM   475   N N   . LEU A 1 59  ? 32.528  51.158  -24.870 1.00 17.64  ? 85  LEU A N   1 
ATOM   476   C CA  . LEU A 1 59  ? 33.375  52.111  -24.173 1.00 18.26  ? 85  LEU A CA  1 
ATOM   477   C C   . LEU A 1 59  ? 32.528  53.169  -23.500 1.00 19.15  ? 85  LEU A C   1 
ATOM   478   O O   . LEU A 1 59  ? 31.786  53.882  -24.169 1.00 20.94  ? 85  LEU A O   1 
ATOM   479   C CB  . LEU A 1 59  ? 34.312  52.790  -25.168 1.00 14.99  ? 85  LEU A CB  1 
ATOM   480   C CG  . LEU A 1 59  ? 35.824  52.609  -25.048 1.00 16.35  ? 85  LEU A CG  1 
ATOM   481   C CD1 . LEU A 1 59  ? 36.502  53.309  -26.213 1.00 10.55  ? 85  LEU A CD1 1 
ATOM   482   C CD2 . LEU A 1 59  ? 36.320  53.162  -23.737 1.00 12.70  ? 85  LEU A CD2 1 
ATOM   483   N N   . HIS A 1 60  ? 32.621  53.269  -22.180 1.00 18.11  ? 86  HIS A N   1 
ATOM   484   C CA  . HIS A 1 60  ? 31.871  54.294  -21.462 1.00 19.22  ? 86  HIS A CA  1 
ATOM   485   C C   . HIS A 1 60  ? 32.842  55.145  -20.655 1.00 19.52  ? 86  HIS A C   1 
ATOM   486   O O   . HIS A 1 60  ? 33.858  54.645  -20.163 1.00 20.57  ? 86  HIS A O   1 
ATOM   487   C CB  . HIS A 1 60  ? 30.882  53.715  -20.428 1.00 16.90  ? 86  HIS A CB  1 
ATOM   488   C CG  . HIS A 1 60  ? 30.116  52.509  -20.878 1.00 21.46  ? 86  HIS A CG  1 
ATOM   489   N ND1 . HIS A 1 60  ? 28.739  52.444  -20.817 1.00 17.83  ? 86  HIS A ND1 1 
ATOM   490   C CD2 . HIS A 1 60  ? 30.530  51.284  -21.284 1.00 22.21  ? 86  HIS A CD2 1 
ATOM   491   C CE1 . HIS A 1 60  ? 28.340  51.232  -21.161 1.00 17.15  ? 86  HIS A CE1 1 
ATOM   492   N NE2 . HIS A 1 60  ? 29.408  50.509  -21.448 1.00 20.77  ? 86  HIS A NE2 1 
ATOM   493   N N   . TYR A 1 61  ? 32.555  56.436  -20.550 1.00 19.35  ? 87  TYR A N   1 
ATOM   494   C CA  . TYR A 1 61  ? 33.341  57.286  -19.670 1.00 19.93  ? 87  TYR A CA  1 
ATOM   495   C C   . TYR A 1 61  ? 32.242  57.820  -18.780 1.00 19.40  ? 87  TYR A C   1 
ATOM   496   O O   . TYR A 1 61  ? 31.150  58.144  -19.244 1.00 22.34  ? 87  TYR A O   1 
ATOM   497   C CB  . TYR A 1 61  ? 34.146  58.391  -20.388 1.00 19.98  ? 87  TYR A CB  1 
ATOM   498   C CG  . TYR A 1 61  ? 33.413  59.434  -21.187 1.00 21.41  ? 87  TYR A CG  1 
ATOM   499   C CD1 . TYR A 1 61  ? 33.543  60.792  -20.869 1.00 23.11  ? 87  TYR A CD1 1 
ATOM   500   C CD2 . TYR A 1 61  ? 32.699  59.093  -22.334 1.00 22.35  ? 87  TYR A CD2 1 
ATOM   501   C CE1 . TYR A 1 61  ? 32.987  61.787  -21.680 1.00 19.76  ? 87  TYR A CE1 1 
ATOM   502   C CE2 . TYR A 1 61  ? 32.138  60.077  -23.154 1.00 22.99  ? 87  TYR A CE2 1 
ATOM   503   C CZ  . TYR A 1 61  ? 32.295  61.421  -22.823 1.00 24.22  ? 87  TYR A CZ  1 
ATOM   504   O OH  . TYR A 1 61  ? 31.804  62.387  -23.666 1.00 21.35  ? 87  TYR A OH  1 
ATOM   505   N N   . TRP A 1 62  ? 32.519  57.829  -17.488 1.00 19.41  ? 88  TRP A N   1 
ATOM   506   C CA  . TRP A 1 62  ? 31.566  58.242  -16.466 1.00 18.46  ? 88  TRP A CA  1 
ATOM   507   C C   . TRP A 1 62  ? 31.964  59.572  -15.819 1.00 17.60  ? 88  TRP A C   1 
ATOM   508   O O   . TRP A 1 62  ? 33.130  59.793  -15.500 1.00 18.08  ? 88  TRP A O   1 
ATOM   509   C CB  . TRP A 1 62  ? 31.512  57.135  -15.415 1.00 15.09  ? 88  TRP A CB  1 
ATOM   510   C CG  . TRP A 1 62  ? 30.508  57.330  -14.341 1.00 16.11  ? 88  TRP A CG  1 
ATOM   511   C CD1 . TRP A 1 62  ? 29.229  56.856  -14.316 1.00 14.19  ? 88  TRP A CD1 1 
ATOM   512   C CD2 . TRP A 1 62  ? 30.713  58.005  -13.097 1.00 14.67  ? 88  TRP A CD2 1 
ATOM   513   N NE1 . TRP A 1 62  ? 28.626  57.184  -13.129 1.00 14.27  ? 88  TRP A NE1 1 
ATOM   514   C CE2 . TRP A 1 62  ? 29.511  57.892  -12.359 1.00 16.08  ? 88  TRP A CE2 1 
ATOM   515   C CE3 . TRP A 1 62  ? 31.792  58.696  -12.534 1.00 11.87  ? 88  TRP A CE3 1 
ATOM   516   C CZ2 . TRP A 1 62  ? 29.359  58.447  -11.079 1.00 14.11  ? 88  TRP A CZ2 1 
ATOM   517   C CZ3 . TRP A 1 62  ? 31.641  59.247  -11.261 1.00 13.27  ? 88  TRP A CZ3 1 
ATOM   518   C CH2 . TRP A 1 62  ? 30.432  59.118  -10.550 1.00 12.28  ? 88  TRP A CH2 1 
ATOM   519   N N   . LEU A 1 63  ? 30.990  60.449  -15.610 1.00 17.99  ? 89  LEU A N   1 
ATOM   520   C CA  . LEU A 1 63  ? 31.251  61.759  -15.013 1.00 17.98  ? 89  LEU A CA  1 
ATOM   521   C C   . LEU A 1 63  ? 30.498  61.963  -13.698 1.00 19.29  ? 89  LEU A C   1 
ATOM   522   O O   . LEU A 1 63  ? 29.273  61.844  -13.656 1.00 19.25  ? 89  LEU A O   1 
ATOM   523   C CB  . LEU A 1 63  ? 30.836  62.859  -15.994 1.00 15.40  ? 89  LEU A CB  1 
ATOM   524   C CG  . LEU A 1 63  ? 31.329  62.770  -17.445 1.00 16.83  ? 89  LEU A CG  1 
ATOM   525   C CD1 . LEU A 1 63  ? 30.579  63.817  -18.282 1.00 11.30  ? 89  LEU A CD1 1 
ATOM   526   C CD2 . LEU A 1 63  ? 32.867  62.972  -17.519 1.00 11.83  ? 89  LEU A CD2 1 
ATOM   527   N N   . GLY A 1 64  ? 31.228  62.266  -12.628 1.00 21.85  ? 90  GLY A N   1 
ATOM   528   C CA  . GLY A 1 64  ? 30.590  62.514  -11.341 1.00 25.99  ? 90  GLY A CA  1 
ATOM   529   C C   . GLY A 1 64  ? 30.000  63.914  -11.340 1.00 28.52  ? 90  GLY A C   1 
ATOM   530   O O   . GLY A 1 64  ? 30.373  64.735  -12.179 1.00 30.60  ? 90  GLY A O   1 
ATOM   531   N N   . ASN A 1 65  ? 29.081  64.203  -10.425 1.00 30.44  ? 91  ASN A N   1 
ATOM   532   C CA  . ASN A 1 65  ? 28.466  65.531  -10.372 1.00 32.03  ? 91  ASN A CA  1 
ATOM   533   C C   . ASN A 1 65  ? 29.423  66.641  -9.944  1.00 32.25  ? 91  ASN A C   1 
ATOM   534   O O   . ASN A 1 65  ? 29.267  67.787  -10.356 1.00 31.41  ? 91  ASN A O   1 
ATOM   535   C CB  . ASN A 1 65  ? 27.272  65.527  -9.424  1.00 38.11  ? 91  ASN A CB  1 
ATOM   536   C CG  . ASN A 1 65  ? 26.087  64.795  -9.990  1.00 44.57  ? 91  ASN A CG  1 
ATOM   537   O OD1 . ASN A 1 65  ? 25.150  64.457  -9.265  1.00 47.15  ? 91  ASN A OD1 1 
ATOM   538   N ND2 . ASN A 1 65  ? 26.109  64.553  -11.300 1.00 48.04  ? 91  ASN A ND2 1 
ATOM   539   N N   . GLU A 1 66  ? 30.404  66.302  -9.111  1.00 32.31  ? 92  GLU A N   1 
ATOM   540   C CA  . GLU A 1 66  ? 31.374  67.285  -8.620  1.00 33.98  ? 92  GLU A CA  1 
ATOM   541   C C   . GLU A 1 66  ? 32.681  67.194  -9.402  1.00 34.09  ? 92  GLU A C   1 
ATOM   542   O O   . GLU A 1 66  ? 33.743  67.594  -8.919  1.00 32.75  ? 92  GLU A O   1 
ATOM   543   C CB  . GLU A 1 66  ? 31.642  67.053  -7.128  1.00 31.44  ? 92  GLU A CB  1 
ATOM   544   C CG  . GLU A 1 66  ? 30.381  66.865  -6.324  1.00 31.43  ? 92  GLU A CG  1 
ATOM   545   C CD  . GLU A 1 66  ? 29.435  68.036  -6.447  1.00 37.00  ? 92  GLU A CD  1 
ATOM   546   O OE1 . GLU A 1 66  ? 28.227  67.854  -6.169  1.00 37.52  ? 92  GLU A OE1 1 
ATOM   547   O OE2 . GLU A 1 66  ? 29.900  69.141  -6.814  1.00 37.94  ? 92  GLU A OE2 1 
ATOM   548   N N   . CYS A 1 67  ? 32.584  66.659  -10.612 1.00 35.48  ? 93  CYS A N   1 
ATOM   549   C CA  . CYS A 1 67  ? 33.730  66.486  -11.495 1.00 40.44  ? 93  CYS A CA  1 
ATOM   550   C C   . CYS A 1 67  ? 33.990  67.758  -12.304 1.00 44.54  ? 93  CYS A C   1 
ATOM   551   O O   . CYS A 1 67  ? 33.056  68.366  -12.823 1.00 44.00  ? 93  CYS A O   1 
ATOM   552   C CB  . CYS A 1 67  ? 33.455  65.313  -12.442 1.00 38.57  ? 93  CYS A CB  1 
ATOM   553   S SG  . CYS A 1 67  ? 34.697  65.039  -13.701 1.00 29.25  ? 93  CYS A SG  1 
ATOM   554   N N   . SER A 1 68  ? 35.257  68.148  -12.419 1.00 49.33  ? 94  SER A N   1 
ATOM   555   C CA  . SER A 1 68  ? 35.621  69.352  -13.164 1.00 56.87  ? 94  SER A CA  1 
ATOM   556   C C   . SER A 1 68  ? 35.556  69.174  -14.685 1.00 60.79  ? 94  SER A C   1 
ATOM   557   O O   . SER A 1 68  ? 34.881  68.279  -15.196 1.00 61.02  ? 94  SER A O   1 
ATOM   558   C CB  . SER A 1 68  ? 37.031  69.820  -12.775 1.00 56.74  ? 94  SER A CB  1 
ATOM   559   O OG  . SER A 1 68  ? 38.024  69.005  -13.370 1.00 58.03  ? 94  SER A OG  1 
ATOM   560   N N   . GLN A 1 69  ? 36.271  70.044  -15.397 1.00 65.63  ? 95  GLN A N   1 
ATOM   561   C CA  . GLN A 1 69  ? 36.309  70.033  -16.858 1.00 67.95  ? 95  GLN A CA  1 
ATOM   562   C C   . GLN A 1 69  ? 37.615  69.452  -17.393 1.00 65.58  ? 95  GLN A C   1 
ATOM   563   O O   . GLN A 1 69  ? 37.658  68.905  -18.499 1.00 64.74  ? 95  GLN A O   1 
ATOM   564   C CB  . GLN A 1 69  ? 36.086  71.465  -17.378 1.00 72.08  ? 95  GLN A CB  1 
ATOM   565   C CG  . GLN A 1 69  ? 36.170  71.639  -18.891 1.00 78.23  ? 95  GLN A CG  1 
ATOM   566   C CD  . GLN A 1 69  ? 37.593  71.854  -19.378 1.00 80.84  ? 95  GLN A CD  1 
ATOM   567   O OE1 . GLN A 1 69  ? 38.281  72.774  -18.927 1.00 80.79  ? 95  GLN A OE1 1 
ATOM   568   N NE2 . GLN A 1 69  ? 38.040  71.009  -20.305 1.00 83.03  ? 95  GLN A NE2 1 
ATOM   569   N N   . ASP A 1 70  ? 38.684  69.567  -16.611 1.00 65.00  ? 96  ASP A N   1 
ATOM   570   C CA  . ASP A 1 70  ? 39.982  69.034  -17.034 1.00 64.57  ? 96  ASP A CA  1 
ATOM   571   C C   . ASP A 1 70  ? 39.964  67.504  -16.925 1.00 60.82  ? 96  ASP A C   1 
ATOM   572   O O   . ASP A 1 70  ? 40.557  66.809  -17.738 1.00 58.28  ? 96  ASP A O   1 
ATOM   573   C CB  . ASP A 1 70  ? 41.099  69.599  -16.140 1.00 68.03  ? 96  ASP A CB  1 
ATOM   574   C CG  . ASP A 1 70  ? 41.828  70.764  -16.802 1.00 71.51  ? 96  ASP A CG  1 
ATOM   575   O OD1 . ASP A 1 70  ? 41.156  71.739  -17.212 1.00 72.71  ? 96  ASP A OD1 1 
ATOM   576   O OD2 . ASP A 1 70  ? 43.077  70.705  -16.913 1.00 71.17  ? 96  ASP A OD2 1 
ATOM   577   N N   . GLU A 1 71  ? 39.250  67.013  -15.918 1.00 58.55  ? 97  GLU A N   1 
ATOM   578   C CA  . GLU A 1 71  ? 39.133  65.588  -15.682 1.00 53.35  ? 97  GLU A CA  1 
ATOM   579   C C   . GLU A 1 71  ? 38.186  64.899  -16.653 1.00 48.14  ? 97  GLU A C   1 
ATOM   580   O O   . GLU A 1 71  ? 38.497  63.829  -17.192 1.00 45.29  ? 97  GLU A O   1 
ATOM   581   C CB  . GLU A 1 71  ? 38.706  65.326  -14.229 1.00 55.62  ? 97  GLU A CB  1 
ATOM   582   C CG  . GLU A 1 71  ? 39.720  65.831  -13.212 1.00 58.01  ? 97  GLU A CG  1 
ATOM   583   C CD  . GLU A 1 71  ? 41.079  65.099  -13.265 1.00 59.30  ? 97  GLU A CD  1 
ATOM   584   O OE1 . GLU A 1 71  ? 41.263  64.176  -14.097 1.00 60.37  ? 97  GLU A OE1 1 
ATOM   585   O OE2 . GLU A 1 71  ? 41.970  65.448  -12.461 1.00 57.52  ? 97  GLU A OE2 1 
ATOM   586   N N   . SER A 1 72  ? 37.021  65.515  -16.881 1.00 43.85  ? 98  SER A N   1 
ATOM   587   C CA  . SER A 1 72  ? 36.043  64.989  -17.816 1.00 41.68  ? 98  SER A CA  1 
ATOM   588   C C   . SER A 1 72  ? 36.622  65.124  -19.222 1.00 38.65  ? 98  SER A C   1 
ATOM   589   O O   . SER A 1 72  ? 36.285  64.352  -20.115 1.00 36.88  ? 98  SER A O   1 
ATOM   590   C CB  . SER A 1 72  ? 34.699  65.739  -17.700 1.00 42.87  ? 98  SER A CB  1 
ATOM   591   O OG  . SER A 1 72  ? 34.796  67.143  -17.881 1.00 43.08  ? 98  SER A OG  1 
ATOM   592   N N   . GLY A 1 73  ? 37.484  66.127  -19.404 1.00 34.20  ? 99  GLY A N   1 
ATOM   593   C CA  . GLY A 1 73  ? 38.121  66.328  -20.694 1.00 27.28  ? 99  GLY A CA  1 
ATOM   594   C C   . GLY A 1 73  ? 39.078  65.173  -20.933 1.00 24.91  ? 99  GLY A C   1 
ATOM   595   O O   . GLY A 1 73  ? 39.067  64.537  -21.989 1.00 24.59  ? 99  GLY A O   1 
ATOM   596   N N   . ALA A 1 74  ? 39.906  64.890  -19.934 1.00 21.78  ? 100 ALA A N   1 
ATOM   597   C CA  . ALA A 1 74  ? 40.855  63.794  -20.034 1.00 21.66  ? 100 ALA A CA  1 
ATOM   598   C C   . ALA A 1 74  ? 40.108  62.491  -20.349 1.00 20.88  ? 100 ALA A C   1 
ATOM   599   O O   . ALA A 1 74  ? 40.591  61.648  -21.108 1.00 20.59  ? 100 ALA A O   1 
ATOM   600   C CB  . ALA A 1 74  ? 41.632  63.658  -18.724 1.00 19.03  ? 100 ALA A CB  1 
ATOM   601   N N   . ALA A 1 75  ? 38.921  62.341  -19.776 1.00 17.93  ? 101 ALA A N   1 
ATOM   602   C CA  . ALA A 1 75  ? 38.131  61.146  -19.996 1.00 16.52  ? 101 ALA A CA  1 
ATOM   603   C C   . ALA A 1 75  ? 37.674  61.021  -21.435 1.00 14.66  ? 101 ALA A C   1 
ATOM   604   O O   . ALA A 1 75  ? 37.824  59.974  -22.048 1.00 17.87  ? 101 ALA A O   1 
ATOM   605   C CB  . ALA A 1 75  ? 36.931  61.135  -19.066 1.00 19.14  ? 101 ALA A CB  1 
ATOM   606   N N   . ALA A 1 76  ? 37.102  62.087  -21.971 1.00 17.41  ? 102 ALA A N   1 
ATOM   607   C CA  . ALA A 1 76  ? 36.620  62.073  -23.346 1.00 18.56  ? 102 ALA A CA  1 
ATOM   608   C C   . ALA A 1 76  ? 37.786  61.802  -24.282 1.00 20.43  ? 102 ALA A C   1 
ATOM   609   O O   . ALA A 1 76  ? 37.648  61.076  -25.269 1.00 19.60  ? 102 ALA A O   1 
ATOM   610   C CB  . ALA A 1 76  ? 35.968  63.407  -23.686 1.00 19.58  ? 102 ALA A CB  1 
ATOM   611   N N   . ILE A 1 77  ? 38.939  62.379  -23.962 1.00 19.08  ? 103 ILE A N   1 
ATOM   612   C CA  . ILE A 1 77  ? 40.129  62.194  -24.782 1.00 20.06  ? 103 ILE A CA  1 
ATOM   613   C C   . ILE A 1 77  ? 40.554  60.729  -24.830 1.00 19.29  ? 103 ILE A C   1 
ATOM   614   O O   . ILE A 1 77  ? 40.903  60.219  -25.891 1.00 19.20  ? 103 ILE A O   1 
ATOM   615   C CB  . ILE A 1 77  ? 41.317  63.046  -24.255 1.00 20.96  ? 103 ILE A CB  1 
ATOM   616   C CG1 . ILE A 1 77  ? 41.043  64.531  -24.490 1.00 19.59  ? 103 ILE A CG1 1 
ATOM   617   C CG2 . ILE A 1 77  ? 42.604  62.644  -24.956 1.00 19.38  ? 103 ILE A CG2 1 
ATOM   618   C CD1 . ILE A 1 77  ? 42.006  65.450  -23.747 1.00 22.67  ? 103 ILE A CD1 1 
ATOM   619   N N   . PHE A 1 78  ? 40.520  60.060  -23.681 1.00 20.34  ? 104 PHE A N   1 
ATOM   620   C CA  . PHE A 1 78  ? 40.912  58.655  -23.596 1.00 20.52  ? 104 PHE A CA  1 
ATOM   621   C C   . PHE A 1 78  ? 39.937  57.730  -24.311 1.00 21.82  ? 104 PHE A C   1 
ATOM   622   O O   . PHE A 1 78  ? 40.343  56.762  -24.946 1.00 23.06  ? 104 PHE A O   1 
ATOM   623   C CB  . PHE A 1 78  ? 41.054  58.241  -22.132 1.00 22.00  ? 104 PHE A CB  1 
ATOM   624   C CG  . PHE A 1 78  ? 42.367  58.633  -21.515 1.00 20.42  ? 104 PHE A CG  1 
ATOM   625   C CD1 . PHE A 1 78  ? 42.404  59.311  -20.306 1.00 20.36  ? 104 PHE A CD1 1 
ATOM   626   C CD2 . PHE A 1 78  ? 43.570  58.305  -22.141 1.00 22.57  ? 104 PHE A CD2 1 
ATOM   627   C CE1 . PHE A 1 78  ? 43.617  59.662  -19.714 1.00 22.30  ? 104 PHE A CE1 1 
ATOM   628   C CE2 . PHE A 1 78  ? 44.797  58.646  -21.563 1.00 24.12  ? 104 PHE A CE2 1 
ATOM   629   C CZ  . PHE A 1 78  ? 44.819  59.331  -20.341 1.00 25.11  ? 104 PHE A CZ  1 
ATOM   630   N N   . THR A 1 79  ? 38.648  58.027  -24.214 1.00 22.75  ? 105 THR A N   1 
ATOM   631   C CA  . THR A 1 79  ? 37.637  57.213  -24.880 1.00 23.35  ? 105 THR A CA  1 
ATOM   632   C C   . THR A 1 79  ? 37.892  57.223  -26.398 1.00 24.91  ? 105 THR A C   1 
ATOM   633   O O   . THR A 1 79  ? 37.883  56.181  -27.058 1.00 22.49  ? 105 THR A O   1 
ATOM   634   C CB  . THR A 1 79  ? 36.233  57.777  -24.594 1.00 22.21  ? 105 THR A CB  1 
ATOM   635   O OG1 . THR A 1 79  ? 36.043  57.856  -23.179 1.00 18.90  ? 105 THR A OG1 1 
ATOM   636   C CG2 . THR A 1 79  ? 35.157  56.908  -25.213 1.00 15.68  ? 105 THR A CG2 1 
ATOM   637   N N   . VAL A 1 80  ? 38.128  58.416  -26.933 1.00 25.14  ? 106 VAL A N   1 
ATOM   638   C CA  . VAL A 1 80  ? 38.385  58.604  -28.356 1.00 25.92  ? 106 VAL A CA  1 
ATOM   639   C C   . VAL A 1 80  ? 39.633  57.863  -28.824 1.00 27.14  ? 106 VAL A C   1 
ATOM   640   O O   . VAL A 1 80  ? 39.589  57.102  -29.793 1.00 27.39  ? 106 VAL A O   1 
ATOM   641   C CB  . VAL A 1 80  ? 38.556  60.113  -28.681 1.00 27.58  ? 106 VAL A CB  1 
ATOM   642   C CG1 . VAL A 1 80  ? 39.161  60.303  -30.069 1.00 24.04  ? 106 VAL A CG1 1 
ATOM   643   C CG2 . VAL A 1 80  ? 37.206  60.811  -28.591 1.00 25.41  ? 106 VAL A CG2 1 
ATOM   644   N N   . GLN A 1 81  ? 40.744  58.095  -28.131 1.00 26.56  ? 107 GLN A N   1 
ATOM   645   C CA  . GLN A 1 81  ? 42.010  57.472  -28.485 1.00 24.92  ? 107 GLN A CA  1 
ATOM   646   C C   . GLN A 1 81  ? 42.045  55.975  -28.206 1.00 25.47  ? 107 GLN A C   1 
ATOM   647   O O   . GLN A 1 81  ? 42.788  55.237  -28.852 1.00 26.62  ? 107 GLN A O   1 
ATOM   648   C CB  . GLN A 1 81  ? 43.152  58.190  -27.760 1.00 24.10  ? 107 GLN A CB  1 
ATOM   649   C CG  . GLN A 1 81  ? 43.105  59.701  -27.978 1.00 28.39  ? 107 GLN A CG  1 
ATOM   650   C CD  . GLN A 1 81  ? 44.312  60.442  -27.432 1.00 28.51  ? 107 GLN A CD  1 
ATOM   651   O OE1 . GLN A 1 81  ? 44.889  60.062  -26.407 1.00 27.32  ? 107 GLN A OE1 1 
ATOM   652   N NE2 . GLN A 1 81  ? 44.684  61.524  -28.103 1.00 26.59  ? 107 GLN A NE2 1 
ATOM   653   N N   . LEU A 1 82  ? 41.246  55.522  -27.248 1.00 24.70  ? 108 LEU A N   1 
ATOM   654   C CA  . LEU A 1 82  ? 41.214  54.105  -26.927 1.00 25.72  ? 108 LEU A CA  1 
ATOM   655   C C   . LEU A 1 82  ? 40.404  53.413  -28.015 1.00 25.56  ? 108 LEU A C   1 
ATOM   656   O O   . LEU A 1 82  ? 40.693  52.284  -28.409 1.00 25.19  ? 108 LEU A O   1 
ATOM   657   C CB  . LEU A 1 82  ? 40.560  53.876  -25.569 1.00 27.53  ? 108 LEU A CB  1 
ATOM   658   C CG  . LEU A 1 82  ? 41.093  52.698  -24.753 1.00 29.48  ? 108 LEU A CG  1 
ATOM   659   C CD1 . LEU A 1 82  ? 40.216  52.522  -23.524 1.00 34.17  ? 108 LEU A CD1 1 
ATOM   660   C CD2 . LEU A 1 82  ? 41.107  51.433  -25.575 1.00 27.51  ? 108 LEU A CD2 1 
ATOM   661   N N   . ASP A 1 83  ? 39.379  54.095  -28.501 1.00 25.36  ? 109 ASP A N   1 
ATOM   662   C CA  . ASP A 1 83  ? 38.570  53.524  -29.560 1.00 28.85  ? 109 ASP A CA  1 
ATOM   663   C C   . ASP A 1 83  ? 39.430  53.385  -30.812 1.00 30.15  ? 109 ASP A C   1 
ATOM   664   O O   . ASP A 1 83  ? 39.310  52.419  -31.560 1.00 30.70  ? 109 ASP A O   1 
ATOM   665   C CB  . ASP A 1 83  ? 37.377  54.415  -29.868 1.00 26.69  ? 109 ASP A CB  1 
ATOM   666   C CG  . ASP A 1 83  ? 36.665  53.985  -31.116 1.00 25.73  ? 109 ASP A CG  1 
ATOM   667   O OD1 . ASP A 1 83  ? 36.196  52.833  -31.155 1.00 29.38  ? 109 ASP A OD1 1 
ATOM   668   O OD2 . ASP A 1 83  ? 36.587  54.788  -32.062 1.00 27.70  ? 109 ASP A OD2 1 
ATOM   669   N N   . ASP A 1 84  ? 40.299  54.364  -31.027 1.00 31.57  ? 110 ASP A N   1 
ATOM   670   C CA  . ASP A 1 84  ? 41.182  54.355  -32.178 1.00 35.20  ? 110 ASP A CA  1 
ATOM   671   C C   . ASP A 1 84  ? 42.142  53.175  -32.068 1.00 35.03  ? 110 ASP A C   1 
ATOM   672   O O   . ASP A 1 84  ? 42.378  52.463  -33.043 1.00 34.15  ? 110 ASP A O   1 
ATOM   673   C CB  . ASP A 1 84  ? 41.969  55.668  -32.244 1.00 40.74  ? 110 ASP A CB  1 
ATOM   674   C CG  . ASP A 1 84  ? 42.794  55.789  -33.511 1.00 45.18  ? 110 ASP A CG  1 
ATOM   675   O OD1 . ASP A 1 84  ? 43.716  56.631  -33.542 1.00 50.76  ? 110 ASP A OD1 1 
ATOM   676   O OD2 . ASP A 1 84  ? 42.521  55.049  -34.478 1.00 48.05  ? 110 ASP A OD2 1 
ATOM   677   N N   . TYR A 1 85  ? 42.691  52.972  -30.873 1.00 35.51  ? 111 TYR A N   1 
ATOM   678   C CA  . TYR A 1 85  ? 43.620  51.877  -30.639 1.00 35.05  ? 111 TYR A CA  1 
ATOM   679   C C   . TYR A 1 85  ? 42.944  50.527  -30.878 1.00 36.39  ? 111 TYR A C   1 
ATOM   680   O O   . TYR A 1 85  ? 43.603  49.539  -31.209 1.00 37.88  ? 111 TYR A O   1 
ATOM   681   C CB  . TYR A 1 85  ? 44.146  51.924  -29.210 1.00 34.34  ? 111 TYR A CB  1 
ATOM   682   C CG  . TYR A 1 85  ? 45.063  50.770  -28.891 1.00 35.20  ? 111 TYR A CG  1 
ATOM   683   C CD1 . TYR A 1 85  ? 46.400  50.781  -29.297 1.00 35.69  ? 111 TYR A CD1 1 
ATOM   684   C CD2 . TYR A 1 85  ? 44.590  49.654  -28.203 1.00 34.46  ? 111 TYR A CD2 1 
ATOM   685   C CE1 . TYR A 1 85  ? 47.241  49.706  -29.025 1.00 35.17  ? 111 TYR A CE1 1 
ATOM   686   C CE2 . TYR A 1 85  ? 45.420  48.577  -27.926 1.00 35.94  ? 111 TYR A CE2 1 
ATOM   687   C CZ  . TYR A 1 85  ? 46.742  48.613  -28.337 1.00 35.65  ? 111 TYR A CZ  1 
ATOM   688   O OH  . TYR A 1 85  ? 47.568  47.559  -28.045 1.00 40.85  ? 111 TYR A OH  1 
ATOM   689   N N   . LEU A 1 86  ? 41.628  50.486  -30.693 1.00 34.80  ? 112 LEU A N   1 
ATOM   690   C CA  . LEU A 1 86  ? 40.876  49.258  -30.894 1.00 35.39  ? 112 LEU A CA  1 
ATOM   691   C C   . LEU A 1 86  ? 40.279  49.232  -32.304 1.00 37.38  ? 112 LEU A C   1 
ATOM   692   O O   . LEU A 1 86  ? 39.317  48.519  -32.576 1.00 39.13  ? 112 LEU A O   1 
ATOM   693   C CB  . LEU A 1 86  ? 39.784  49.136  -29.823 1.00 32.44  ? 112 LEU A CB  1 
ATOM   694   C CG  . LEU A 1 86  ? 40.291  49.000  -28.375 1.00 32.02  ? 112 LEU A CG  1 
ATOM   695   C CD1 . LEU A 1 86  ? 39.148  49.135  -27.391 1.00 27.70  ? 112 LEU A CD1 1 
ATOM   696   C CD2 . LEU A 1 86  ? 40.978  47.666  -28.202 1.00 30.02  ? 112 LEU A CD2 1 
ATOM   697   N N   . ASN A 1 87  ? 40.867  50.027  -33.191 1.00 39.10  ? 113 ASN A N   1 
ATOM   698   C CA  . ASN A 1 87  ? 40.449  50.114  -34.589 1.00 42.96  ? 113 ASN A CA  1 
ATOM   699   C C   . ASN A 1 87  ? 39.083  50.743  -34.843 1.00 42.31  ? 113 ASN A C   1 
ATOM   700   O O   . ASN A 1 87  ? 38.360  50.326  -35.749 1.00 41.38  ? 113 ASN A O   1 
ATOM   701   C CB  . ASN A 1 87  ? 40.509  48.725  -35.230 1.00 45.52  ? 113 ASN A CB  1 
ATOM   702   C CG  . ASN A 1 87  ? 41.891  48.107  -35.126 1.00 50.27  ? 113 ASN A CG  1 
ATOM   703   O OD1 . ASN A 1 87  ? 42.893  48.740  -35.479 1.00 51.10  ? 113 ASN A OD1 1 
ATOM   704   N ND2 . ASN A 1 87  ? 41.956  46.869  -34.640 1.00 51.47  ? 113 ASN A ND2 1 
ATOM   705   N N   . GLY A 1 88  ? 38.747  51.755  -34.046 1.00 42.95  ? 114 GLY A N   1 
ATOM   706   C CA  . GLY A 1 88  ? 37.477  52.455  -34.187 1.00 42.34  ? 114 GLY A CA  1 
ATOM   707   C C   . GLY A 1 88  ? 36.244  51.598  -34.401 1.00 41.87  ? 114 GLY A C   1 
ATOM   708   O O   . GLY A 1 88  ? 35.409  51.910  -35.249 1.00 42.36  ? 114 GLY A O   1 
ATOM   709   N N   . ARG A 1 89  ? 36.112  50.521  -33.632 1.00 41.62  ? 115 ARG A N   1 
ATOM   710   C CA  . ARG A 1 89  ? 34.960  49.642  -33.777 1.00 43.01  ? 115 ARG A CA  1 
ATOM   711   C C   . ARG A 1 89  ? 34.149  49.540  -32.487 1.00 38.91  ? 115 ARG A C   1 
ATOM   712   O O   . ARG A 1 89  ? 33.216  48.753  -32.391 1.00 37.42  ? 115 ARG A O   1 
ATOM   713   C CB  . ARG A 1 89  ? 35.414  48.250  -34.214 1.00 47.68  ? 115 ARG A CB  1 
ATOM   714   C CG  . ARG A 1 89  ? 36.381  47.595  -33.258 1.00 55.60  ? 115 ARG A CG  1 
ATOM   715   C CD  . ARG A 1 89  ? 36.585  46.126  -33.611 1.00 63.65  ? 115 ARG A CD  1 
ATOM   716   N NE  . ARG A 1 89  ? 37.056  45.942  -34.982 1.00 70.26  ? 115 ARG A NE  1 
ATOM   717   C CZ  . ARG A 1 89  ? 37.237  44.755  -35.553 1.00 73.99  ? 115 ARG A CZ  1 
ATOM   718   N NH1 . ARG A 1 89  ? 36.984  43.645  -34.868 1.00 75.54  ? 115 ARG A NH1 1 
ATOM   719   N NH2 . ARG A 1 89  ? 37.675  44.675  -36.805 1.00 73.89  ? 115 ARG A NH2 1 
ATOM   720   N N   . ALA A 1 90  ? 34.501  50.348  -31.498 1.00 34.73  ? 116 ALA A N   1 
ATOM   721   C CA  . ALA A 1 90  ? 33.788  50.322  -30.235 1.00 31.65  ? 116 ALA A CA  1 
ATOM   722   C C   . ALA A 1 90  ? 32.573  51.225  -30.237 1.00 29.54  ? 116 ALA A C   1 
ATOM   723   O O   . ALA A 1 90  ? 32.520  52.225  -30.950 1.00 30.30  ? 116 ALA A O   1 
ATOM   724   C CB  . ALA A 1 90  ? 34.707  50.739  -29.114 1.00 29.65  ? 116 ALA A CB  1 
ATOM   725   N N   . VAL A 1 91  ? 31.574  50.854  -29.454 1.00 24.90  ? 117 VAL A N   1 
ATOM   726   C CA  . VAL A 1 91  ? 30.415  51.706  -29.332 1.00 22.64  ? 117 VAL A CA  1 
ATOM   727   C C   . VAL A 1 91  ? 30.788  52.542  -28.110 1.00 20.58  ? 117 VAL A C   1 
ATOM   728   O O   . VAL A 1 91  ? 31.227  52.003  -27.088 1.00 17.62  ? 117 VAL A O   1 
ATOM   729   C CB  . VAL A 1 91  ? 29.137  50.905  -29.090 1.00 21.55  ? 117 VAL A CB  1 
ATOM   730   C CG1 . VAL A 1 91  ? 27.956  51.836  -29.043 1.00 19.36  ? 117 VAL A CG1 1 
ATOM   731   C CG2 . VAL A 1 91  ? 28.950  49.897  -30.212 1.00 26.67  ? 117 VAL A CG2 1 
ATOM   732   N N   . GLN A 1 92  ? 30.651  53.857  -28.234 1.00 20.92  ? 118 GLN A N   1 
ATOM   733   C CA  . GLN A 1 92  ? 31.013  54.771  -27.155 1.00 22.69  ? 118 GLN A CA  1 
ATOM   734   C C   . GLN A 1 92  ? 29.818  55.298  -26.366 1.00 20.69  ? 118 GLN A C   1 
ATOM   735   O O   . GLN A 1 92  ? 28.772  55.613  -26.923 1.00 18.79  ? 118 GLN A O   1 
ATOM   736   C CB  . GLN A 1 92  ? 31.845  55.914  -27.740 1.00 25.12  ? 118 GLN A CB  1 
ATOM   737   C CG  . GLN A 1 92  ? 33.033  55.370  -28.520 1.00 28.90  ? 118 GLN A CG  1 
ATOM   738   C CD  . GLN A 1 92  ? 33.901  56.435  -29.144 1.00 30.62  ? 118 GLN A CD  1 
ATOM   739   O OE1 . GLN A 1 92  ? 33.470  57.177  -30.018 1.00 32.29  ? 118 GLN A OE1 1 
ATOM   740   N NE2 . GLN A 1 92  ? 35.143  56.507  -28.698 1.00 36.21  ? 118 GLN A NE2 1 
ATOM   741   N N   . HIS A 1 93  ? 29.990  55.371  -25.054 1.00 21.13  ? 119 HIS A N   1 
ATOM   742   C CA  . HIS A 1 93  ? 28.937  55.826  -24.163 1.00 20.73  ? 119 HIS A CA  1 
ATOM   743   C C   . HIS A 1 93  ? 29.425  56.888  -23.189 1.00 19.77  ? 119 HIS A C   1 
ATOM   744   O O   . HIS A 1 93  ? 30.501  56.762  -22.605 1.00 20.12  ? 119 HIS A O   1 
ATOM   745   C CB  . HIS A 1 93  ? 28.397  54.656  -23.336 1.00 21.88  ? 119 HIS A CB  1 
ATOM   746   C CG  . HIS A 1 93  ? 27.958  53.479  -24.149 1.00 23.36  ? 119 HIS A CG  1 
ATOM   747   N ND1 . HIS A 1 93  ? 26.755  53.442  -24.819 1.00 22.84  ? 119 HIS A ND1 1 
ATOM   748   C CD2 . HIS A 1 93  ? 28.555  52.284  -24.376 1.00 21.52  ? 119 HIS A CD2 1 
ATOM   749   C CE1 . HIS A 1 93  ? 26.627  52.273  -25.423 1.00 23.81  ? 119 HIS A CE1 1 
ATOM   750   N NE2 . HIS A 1 93  ? 27.705  51.552  -25.169 1.00 22.77  ? 119 HIS A NE2 1 
ATOM   751   N N   . ARG A 1 94  ? 28.627  57.935  -23.025 1.00 20.25  ? 120 ARG A N   1 
ATOM   752   C CA  . ARG A 1 94  ? 28.925  58.988  -22.068 1.00 22.67  ? 120 ARG A CA  1 
ATOM   753   C C   . ARG A 1 94  ? 27.885  58.767  -20.972 1.00 22.43  ? 120 ARG A C   1 
ATOM   754   O O   . ARG A 1 94  ? 26.688  58.710  -21.245 1.00 21.28  ? 120 ARG A O   1 
ATOM   755   C CB  . ARG A 1 94  ? 28.749  60.360  -22.706 1.00 25.36  ? 120 ARG A CB  1 
ATOM   756   C CG  . ARG A 1 94  ? 28.841  61.524  -21.738 1.00 28.47  ? 120 ARG A CG  1 
ATOM   757   C CD  . ARG A 1 94  ? 28.819  62.843  -22.490 1.00 33.60  ? 120 ARG A CD  1 
ATOM   758   N NE  . ARG A 1 94  ? 28.604  63.972  -21.597 1.00 37.71  ? 120 ARG A NE  1 
ATOM   759   C CZ  . ARG A 1 94  ? 27.409  64.430  -21.243 1.00 39.70  ? 120 ARG A CZ  1 
ATOM   760   N NH1 . ARG A 1 94  ? 26.307  63.864  -21.718 1.00 36.33  ? 120 ARG A NH1 1 
ATOM   761   N NH2 . ARG A 1 94  ? 27.317  65.443  -20.388 1.00 41.13  ? 120 ARG A NH2 1 
ATOM   762   N N   . GLU A 1 95  ? 28.337  58.598  -19.739 1.00 22.60  ? 121 GLU A N   1 
ATOM   763   C CA  . GLU A 1 95  ? 27.411  58.365  -18.641 1.00 23.72  ? 121 GLU A CA  1 
ATOM   764   C C   . GLU A 1 95  ? 27.577  59.452  -17.599 1.00 23.86  ? 121 GLU A C   1 
ATOM   765   O O   . GLU A 1 95  ? 28.699  59.802  -17.244 1.00 25.49  ? 121 GLU A O   1 
ATOM   766   C CB  . GLU A 1 95  ? 27.684  57.009  -17.970 1.00 26.39  ? 121 GLU A CB  1 
ATOM   767   C CG  . GLU A 1 95  ? 27.878  55.805  -18.907 1.00 26.96  ? 121 GLU A CG  1 
ATOM   768   C CD  . GLU A 1 95  ? 26.589  55.260  -19.511 1.00 28.63  ? 121 GLU A CD  1 
ATOM   769   O OE1 . GLU A 1 95  ? 26.680  54.288  -20.284 1.00 27.21  ? 121 GLU A OE1 1 
ATOM   770   O OE2 . GLU A 1 95  ? 25.491  55.787  -19.224 1.00 27.38  ? 121 GLU A OE2 1 
ATOM   771   N N   . VAL A 1 96  ? 26.468  59.988  -17.104 1.00 23.20  ? 122 VAL A N   1 
ATOM   772   C CA  . VAL A 1 96  ? 26.541  61.003  -16.064 1.00 22.04  ? 122 VAL A CA  1 
ATOM   773   C C   . VAL A 1 96  ? 25.880  60.443  -14.804 1.00 21.93  ? 122 VAL A C   1 
ATOM   774   O O   . VAL A 1 96  ? 24.835  59.800  -14.867 1.00 19.19  ? 122 VAL A O   1 
ATOM   775   C CB  . VAL A 1 96  ? 25.833  62.326  -16.482 1.00 25.92  ? 122 VAL A CB  1 
ATOM   776   C CG1 . VAL A 1 96  ? 25.903  63.336  -15.336 1.00 21.65  ? 122 VAL A CG1 1 
ATOM   777   C CG2 . VAL A 1 96  ? 26.488  62.913  -17.744 1.00 21.86  ? 122 VAL A CG2 1 
ATOM   778   N N   . GLN A 1 97  ? 26.513  60.688  -13.664 1.00 22.99  ? 123 GLN A N   1 
ATOM   779   C CA  . GLN A 1 97  ? 26.027  60.226  -12.363 1.00 23.47  ? 123 GLN A CA  1 
ATOM   780   C C   . GLN A 1 97  ? 24.516  60.378  -12.192 1.00 21.27  ? 123 GLN A C   1 
ATOM   781   O O   . GLN A 1 97  ? 23.953  61.430  -12.470 1.00 21.70  ? 123 GLN A O   1 
ATOM   782   C CB  . GLN A 1 97  ? 26.735  61.008  -11.247 1.00 25.88  ? 123 GLN A CB  1 
ATOM   783   C CG  . GLN A 1 97  ? 26.403  60.555  -9.826  1.00 22.12  ? 123 GLN A CG  1 
ATOM   784   C CD  . GLN A 1 97  ? 26.942  61.511  -8.779  1.00 21.59  ? 123 GLN A CD  1 
ATOM   785   O OE1 . GLN A 1 97  ? 27.982  62.141  -8.970  1.00 20.68  ? 123 GLN A OE1 1 
ATOM   786   N NE2 . GLN A 1 97  ? 26.243  61.614  -7.660  1.00 20.92  ? 123 GLN A NE2 1 
ATOM   787   N N   . GLY A 1 98  ? 23.869  59.327  -11.714 1.00 21.16  ? 124 GLY A N   1 
ATOM   788   C CA  . GLY A 1 98  ? 22.434  59.385  -11.503 1.00 22.00  ? 124 GLY A CA  1 
ATOM   789   C C   . GLY A 1 98  ? 21.595  59.159  -12.749 1.00 23.69  ? 124 GLY A C   1 
ATOM   790   O O   . GLY A 1 98  ? 20.397  58.889  -12.648 1.00 21.74  ? 124 GLY A O   1 
ATOM   791   N N   . PHE A 1 99  ? 22.216  59.249  -13.923 1.00 24.59  ? 125 PHE A N   1 
ATOM   792   C CA  . PHE A 1 99  ? 21.481  59.061  -15.165 1.00 25.79  ? 125 PHE A CA  1 
ATOM   793   C C   . PHE A 1 99  ? 22.148  58.145  -16.162 1.00 25.05  ? 125 PHE A C   1 
ATOM   794   O O   . PHE A 1 99  ? 21.929  58.291  -17.366 1.00 26.99  ? 125 PHE A O   1 
ATOM   795   C CB  . PHE A 1 99  ? 21.228  60.413  -15.831 1.00 29.14  ? 125 PHE A CB  1 
ATOM   796   C CG  . PHE A 1 99  ? 20.506  61.379  -14.952 1.00 32.49  ? 125 PHE A CG  1 
ATOM   797   C CD1 . PHE A 1 99  ? 21.200  62.140  -14.019 1.00 32.98  ? 125 PHE A CD1 1 
ATOM   798   C CD2 . PHE A 1 99  ? 19.121  61.467  -14.994 1.00 33.02  ? 125 PHE A CD2 1 
ATOM   799   C CE1 . PHE A 1 99  ? 20.525  62.968  -13.137 1.00 35.74  ? 125 PHE A CE1 1 
ATOM   800   C CE2 . PHE A 1 99  ? 18.439  62.292  -14.113 1.00 34.54  ? 125 PHE A CE2 1 
ATOM   801   C CZ  . PHE A 1 99  ? 19.142  63.042  -13.183 1.00 34.68  ? 125 PHE A CZ  1 
ATOM   802   N N   . GLU A 1 100 ? 22.948  57.194  -15.689 1.00 23.36  ? 126 GLU A N   1 
ATOM   803   C CA  . GLU A 1 100 ? 23.622  56.305  -16.629 1.00 25.18  ? 126 GLU A CA  1 
ATOM   804   C C   . GLU A 1 100 ? 22.685  55.317  -17.333 1.00 22.63  ? 126 GLU A C   1 
ATOM   805   O O   . GLU A 1 100 ? 21.590  55.025  -16.851 1.00 22.80  ? 126 GLU A O   1 
ATOM   806   C CB  . GLU A 1 100 ? 24.809  55.588  -15.949 1.00 23.34  ? 126 GLU A CB  1 
ATOM   807   C CG  . GLU A 1 100 ? 24.571  55.081  -14.549 1.00 27.38  ? 126 GLU A CG  1 
ATOM   808   C CD  . GLU A 1 100 ? 24.550  56.175  -13.503 1.00 24.82  ? 126 GLU A CD  1 
ATOM   809   O OE1 . GLU A 1 100 ? 25.619  56.536  -12.962 1.00 21.23  ? 126 GLU A OE1 1 
ATOM   810   O OE2 . GLU A 1 100 ? 23.448  56.671  -13.224 1.00 25.27  ? 126 GLU A OE2 1 
ATOM   811   N N   . SER A 1 101 ? 23.116  54.824  -18.491 1.00 22.76  ? 127 SER A N   1 
ATOM   812   C CA  . SER A 1 101 ? 22.320  53.885  -19.298 1.00 20.80  ? 127 SER A CA  1 
ATOM   813   C C   . SER A 1 101 ? 22.070  52.504  -18.683 1.00 21.40  ? 127 SER A C   1 
ATOM   814   O O   . SER A 1 101 ? 22.781  52.062  -17.774 1.00 21.89  ? 127 SER A O   1 
ATOM   815   C CB  . SER A 1 101 ? 22.971  53.698  -20.674 1.00 19.06  ? 127 SER A CB  1 
ATOM   816   O OG  . SER A 1 101 ? 24.254  53.098  -20.565 1.00 15.26  ? 127 SER A OG  1 
ATOM   817   N N   . ALA A 1 102 ? 21.051  51.823  -19.202 1.00 20.95  ? 128 ALA A N   1 
ATOM   818   C CA  . ALA A 1 102 ? 20.681  50.489  -18.734 1.00 18.05  ? 128 ALA A CA  1 
ATOM   819   C C   . ALA A 1 102 ? 21.820  49.510  -19.021 1.00 17.91  ? 128 ALA A C   1 
ATOM   820   O O   . ALA A 1 102 ? 22.062  48.589  -18.247 1.00 15.76  ? 128 ALA A O   1 
ATOM   821   C CB  . ALA A 1 102 ? 19.386  50.029  -19.424 1.00 17.90  ? 128 ALA A CB  1 
ATOM   822   N N   . THR A 1 103 ? 22.512  49.722  -20.140 1.00 19.64  ? 129 THR A N   1 
ATOM   823   C CA  . THR A 1 103 ? 23.643  48.888  -20.540 1.00 20.51  ? 129 THR A CA  1 
ATOM   824   C C   . THR A 1 103 ? 24.703  49.002  -19.434 1.00 21.28  ? 129 THR A C   1 
ATOM   825   O O   . THR A 1 103 ? 25.185  47.999  -18.884 1.00 20.28  ? 129 THR A O   1 
ATOM   826   C CB  . THR A 1 103 ? 24.238  49.405  -21.863 1.00 23.41  ? 129 THR A CB  1 
ATOM   827   O OG1 . THR A 1 103 ? 23.207  49.456  -22.853 1.00 31.70  ? 129 THR A OG1 1 
ATOM   828   C CG2 . THR A 1 103 ? 25.354  48.512  -22.350 1.00 22.23  ? 129 THR A CG2 1 
ATOM   829   N N   . PHE A 1 104 ? 25.051  50.240  -19.105 1.00 19.56  ? 130 PHE A N   1 
ATOM   830   C CA  . PHE A 1 104 ? 26.030  50.492  -18.062 1.00 19.72  ? 130 PHE A CA  1 
ATOM   831   C C   . PHE A 1 104 ? 25.610  49.900  -16.712 1.00 19.62  ? 130 PHE A C   1 
ATOM   832   O O   . PHE A 1 104 ? 26.362  49.130  -16.119 1.00 17.56  ? 130 PHE A O   1 
ATOM   833   C CB  . PHE A 1 104 ? 26.237  51.989  -17.895 1.00 19.38  ? 130 PHE A CB  1 
ATOM   834   C CG  . PHE A 1 104 ? 27.326  52.342  -16.927 1.00 19.92  ? 130 PHE A CG  1 
ATOM   835   C CD1 . PHE A 1 104 ? 28.661  52.209  -17.291 1.00 19.28  ? 130 PHE A CD1 1 
ATOM   836   C CD2 . PHE A 1 104 ? 27.020  52.855  -15.670 1.00 19.36  ? 130 PHE A CD2 1 
ATOM   837   C CE1 . PHE A 1 104 ? 29.672  52.592  -16.422 1.00 20.03  ? 130 PHE A CE1 1 
ATOM   838   C CE2 . PHE A 1 104 ? 28.029  53.242  -14.793 1.00 19.74  ? 130 PHE A CE2 1 
ATOM   839   C CZ  . PHE A 1 104 ? 29.356  53.111  -15.173 1.00 17.63  ? 130 PHE A CZ  1 
ATOM   840   N N   . LEU A 1 105 ? 24.414  50.262  -16.235 1.00 18.19  ? 131 LEU A N   1 
ATOM   841   C CA  . LEU A 1 105 ? 23.916  49.783  -14.937 1.00 20.18  ? 131 LEU A CA  1 
ATOM   842   C C   . LEU A 1 105 ? 23.866  48.260  -14.845 1.00 21.11  ? 131 LEU A C   1 
ATOM   843   O O   . LEU A 1 105 ? 24.015  47.685  -13.764 1.00 22.53  ? 131 LEU A O   1 
ATOM   844   C CB  . LEU A 1 105 ? 22.524  50.370  -14.636 1.00 19.64  ? 131 LEU A CB  1 
ATOM   845   C CG  . LEU A 1 105 ? 22.412  51.906  -14.555 1.00 18.68  ? 131 LEU A CG  1 
ATOM   846   C CD1 . LEU A 1 105 ? 20.952  52.301  -14.476 1.00 17.56  ? 131 LEU A CD1 1 
ATOM   847   C CD2 . LEU A 1 105 ? 23.177  52.441  -13.346 1.00 11.87  ? 131 LEU A CD2 1 
ATOM   848   N N   . GLY A 1 106 ? 23.664  47.613  -15.987 1.00 22.56  ? 132 GLY A N   1 
ATOM   849   C CA  . GLY A 1 106 ? 23.621  46.166  -16.022 1.00 21.14  ? 132 GLY A CA  1 
ATOM   850   C C   . GLY A 1 106 ? 24.915  45.503  -15.585 1.00 22.09  ? 132 GLY A C   1 
ATOM   851   O O   . GLY A 1 106 ? 24.883  44.359  -15.149 1.00 21.98  ? 132 GLY A O   1 
ATOM   852   N N   . TYR A 1 107 ? 26.045  46.209  -15.696 1.00 23.69  ? 133 TYR A N   1 
ATOM   853   C CA  . TYR A 1 107 ? 27.354  45.668  -15.303 1.00 24.09  ? 133 TYR A CA  1 
ATOM   854   C C   . TYR A 1 107 ? 27.510  45.506  -13.796 1.00 24.98  ? 133 TYR A C   1 
ATOM   855   O O   . TYR A 1 107 ? 28.393  44.793  -13.327 1.00 27.58  ? 133 TYR A O   1 
ATOM   856   C CB  . TYR A 1 107 ? 28.504  46.571  -15.762 1.00 23.61  ? 133 TYR A CB  1 
ATOM   857   C CG  . TYR A 1 107 ? 28.527  46.933  -17.226 1.00 23.28  ? 133 TYR A CG  1 
ATOM   858   C CD1 . TYR A 1 107 ? 28.098  46.037  -18.203 1.00 23.98  ? 133 TYR A CD1 1 
ATOM   859   C CD2 . TYR A 1 107 ? 29.013  48.166  -17.637 1.00 21.29  ? 133 TYR A CD2 1 
ATOM   860   C CE1 . TYR A 1 107 ? 28.155  46.368  -19.559 1.00 22.63  ? 133 TYR A CE1 1 
ATOM   861   C CE2 . TYR A 1 107 ? 29.075  48.505  -18.982 1.00 23.37  ? 133 TYR A CE2 1 
ATOM   862   C CZ  . TYR A 1 107 ? 28.643  47.607  -19.937 1.00 19.63  ? 133 TYR A CZ  1 
ATOM   863   O OH  . TYR A 1 107 ? 28.692  47.962  -21.261 1.00 16.79  ? 133 TYR A OH  1 
ATOM   864   N N   . PHE A 1 108 ? 26.671  46.183  -13.033 1.00 25.59  ? 134 PHE A N   1 
ATOM   865   C CA  . PHE A 1 108 ? 26.782  46.103  -11.591 1.00 28.90  ? 134 PHE A CA  1 
ATOM   866   C C   . PHE A 1 108 ? 25.477  45.585  -10.979 1.00 33.65  ? 134 PHE A C   1 
ATOM   867   O O   . PHE A 1 108 ? 24.536  46.344  -10.726 1.00 35.14  ? 134 PHE A O   1 
ATOM   868   C CB  . PHE A 1 108 ? 27.157  47.488  -11.041 1.00 22.93  ? 134 PHE A CB  1 
ATOM   869   C CG  . PHE A 1 108 ? 28.197  48.202  -11.868 1.00 17.89  ? 134 PHE A CG  1 
ATOM   870   C CD1 . PHE A 1 108 ? 27.819  49.076  -12.881 1.00 18.58  ? 134 PHE A CD1 1 
ATOM   871   C CD2 . PHE A 1 108 ? 29.555  47.962  -11.668 1.00 14.87  ? 134 PHE A CD2 1 
ATOM   872   C CE1 . PHE A 1 108 ? 28.776  49.706  -13.693 1.00 14.79  ? 134 PHE A CE1 1 
ATOM   873   C CE2 . PHE A 1 108 ? 30.516  48.578  -12.465 1.00 16.80  ? 134 PHE A CE2 1 
ATOM   874   C CZ  . PHE A 1 108 ? 30.124  49.456  -13.486 1.00 17.06  ? 134 PHE A CZ  1 
ATOM   875   N N   . LYS A 1 109 ? 25.419  44.281  -10.752 1.00 38.28  ? 135 LYS A N   1 
ATOM   876   C CA  . LYS A 1 109 ? 24.217  43.699  -10.184 1.00 43.40  ? 135 LYS A CA  1 
ATOM   877   C C   . LYS A 1 109 ? 24.098  44.079  -8.728  1.00 40.96  ? 135 LYS A C   1 
ATOM   878   O O   . LYS A 1 109 ? 23.038  44.479  -8.268  1.00 40.96  ? 135 LYS A O   1 
ATOM   879   C CB  . LYS A 1 109 ? 24.222  42.174  -10.343 1.00 48.33  ? 135 LYS A CB  1 
ATOM   880   C CG  . LYS A 1 109 ? 23.501  41.685  -11.616 1.00 52.28  ? 135 LYS A CG  1 
ATOM   881   C CD  . LYS A 1 109 ? 22.023  42.103  -11.616 1.00 51.78  ? 135 LYS A CD  1 
ATOM   882   C CE  . LYS A 1 109 ? 21.270  41.561  -12.828 1.00 51.87  ? 135 LYS A CE  1 
ATOM   883   N NZ  . LYS A 1 109 ? 19.824  41.972  -12.833 1.00 49.32  ? 135 LYS A NZ  1 
ATOM   884   N N   . SER A 1 110 ? 25.199  43.971  -8.007  1.00 39.95  ? 136 SER A N   1 
ATOM   885   C CA  . SER A 1 110 ? 25.189  44.317  -6.600  1.00 40.96  ? 136 SER A CA  1 
ATOM   886   C C   . SER A 1 110 ? 24.723  45.757  -6.380  1.00 37.92  ? 136 SER A C   1 
ATOM   887   O O   . SER A 1 110 ? 24.172  46.072  -5.335  1.00 39.97  ? 136 SER A O   1 
ATOM   888   C CB  . SER A 1 110 ? 26.588  44.123  -6.014  1.00 45.99  ? 136 SER A CB  1 
ATOM   889   O OG  . SER A 1 110 ? 27.073  42.811  -6.273  1.00 52.33  ? 136 SER A OG  1 
ATOM   890   N N   . GLY A 1 111 ? 24.943  46.626  -7.361  1.00 35.59  ? 137 GLY A N   1 
ATOM   891   C CA  . GLY A 1 111 ? 24.539  48.017  -7.225  1.00 29.69  ? 137 GLY A CA  1 
ATOM   892   C C   . GLY A 1 111 ? 25.668  49.023  -7.404  1.00 27.53  ? 137 GLY A C   1 
ATOM   893   O O   . GLY A 1 111 ? 26.826  48.658  -7.623  1.00 25.08  ? 137 GLY A O   1 
ATOM   894   N N   . LEU A 1 112 ? 25.335  50.304  -7.301  1.00 25.44  ? 138 LEU A N   1 
ATOM   895   C CA  . LEU A 1 112 ? 26.331  51.360  -7.464  1.00 26.11  ? 138 LEU A CA  1 
ATOM   896   C C   . LEU A 1 112 ? 26.615  52.118  -6.169  1.00 25.68  ? 138 LEU A C   1 
ATOM   897   O O   . LEU A 1 112 ? 25.760  52.227  -5.294  1.00 25.09  ? 138 LEU A O   1 
ATOM   898   C CB  . LEU A 1 112 ? 25.878  52.347  -8.547  1.00 25.14  ? 138 LEU A CB  1 
ATOM   899   C CG  . LEU A 1 112 ? 26.597  52.274  -9.892  1.00 23.26  ? 138 LEU A CG  1 
ATOM   900   C CD1 . LEU A 1 112 ? 26.549  50.875  -10.418 1.00 24.82  ? 138 LEU A CD1 1 
ATOM   901   C CD2 . LEU A 1 112 ? 25.958  53.219  -10.874 1.00 25.50  ? 138 LEU A CD2 1 
ATOM   902   N N   . LYS A 1 113 ? 27.825  52.648  -6.057  1.00 27.91  ? 139 LYS A N   1 
ATOM   903   C CA  . LYS A 1 113 ? 28.220  53.393  -4.870  1.00 26.03  ? 139 LYS A CA  1 
ATOM   904   C C   . LYS A 1 113 ? 28.837  54.737  -5.273  1.00 25.33  ? 139 LYS A C   1 
ATOM   905   O O   . LYS A 1 113 ? 29.831  54.782  -6.007  1.00 23.01  ? 139 LYS A O   1 
ATOM   906   C CB  . LYS A 1 113 ? 29.223  52.570  -4.056  1.00 28.16  ? 139 LYS A CB  1 
ATOM   907   C CG  . LYS A 1 113 ? 29.079  52.743  -2.561  1.00 33.48  ? 139 LYS A CG  1 
ATOM   908   C CD  . LYS A 1 113 ? 30.125  51.954  -1.786  1.00 38.91  ? 139 LYS A CD  1 
ATOM   909   C CE  . LYS A 1 113 ? 29.893  50.459  -1.864  1.00 39.21  ? 139 LYS A CE  1 
ATOM   910   N NZ  . LYS A 1 113 ? 31.039  49.717  -1.265  1.00 39.50  ? 139 LYS A NZ  1 
ATOM   911   N N   . TYR A 1 114 ? 28.231  55.827  -4.799  1.00 22.34  ? 140 TYR A N   1 
ATOM   912   C CA  . TYR A 1 114 ? 28.700  57.179  -5.089  1.00 20.82  ? 140 TYR A CA  1 
ATOM   913   C C   . TYR A 1 114 ? 29.400  57.714  -3.841  1.00 19.73  ? 140 TYR A C   1 
ATOM   914   O O   . TYR A 1 114 ? 28.748  58.004  -2.842  1.00 23.76  ? 140 TYR A O   1 
ATOM   915   C CB  . TYR A 1 114 ? 27.510  58.076  -5.445  1.00 21.23  ? 140 TYR A CB  1 
ATOM   916   C CG  . TYR A 1 114 ? 26.756  57.680  -6.697  1.00 21.37  ? 140 TYR A CG  1 
ATOM   917   C CD1 . TYR A 1 114 ? 25.439  58.096  -6.893  1.00 23.14  ? 140 TYR A CD1 1 
ATOM   918   C CD2 . TYR A 1 114 ? 27.356  56.905  -7.694  1.00 22.00  ? 140 TYR A CD2 1 
ATOM   919   C CE1 . TYR A 1 114 ? 24.734  57.752  -8.048  1.00 23.63  ? 140 TYR A CE1 1 
ATOM   920   C CE2 . TYR A 1 114 ? 26.662  56.558  -8.858  1.00 22.09  ? 140 TYR A CE2 1 
ATOM   921   C CZ  . TYR A 1 114 ? 25.350  56.987  -9.025  1.00 23.16  ? 140 TYR A CZ  1 
ATOM   922   O OH  . TYR A 1 114 ? 24.652  56.670  -10.168 1.00 25.07  ? 140 TYR A OH  1 
ATOM   923   N N   . LYS A 1 115 ? 30.719  57.852  -3.901  1.00 17.33  ? 141 LYS A N   1 
ATOM   924   C CA  . LYS A 1 115 ? 31.505  58.312  -2.752  1.00 19.10  ? 141 LYS A CA  1 
ATOM   925   C C   . LYS A 1 115 ? 31.836  59.798  -2.775  1.00 19.34  ? 141 LYS A C   1 
ATOM   926   O O   . LYS A 1 115 ? 31.956  60.403  -3.842  1.00 20.79  ? 141 LYS A O   1 
ATOM   927   C CB  . LYS A 1 115 ? 32.813  57.515  -2.679  1.00 17.50  ? 141 LYS A CB  1 
ATOM   928   C CG  . LYS A 1 115 ? 32.632  55.997  -2.721  1.00 15.87  ? 141 LYS A CG  1 
ATOM   929   C CD  . LYS A 1 115 ? 33.958  55.277  -2.995  1.00 17.42  ? 141 LYS A CD  1 
ATOM   930   C CE  . LYS A 1 115 ? 34.994  55.526  -1.900  1.00 12.93  ? 141 LYS A CE  1 
ATOM   931   N NZ  . LYS A 1 115 ? 34.456  55.165  -0.555  1.00 15.37  ? 141 LYS A NZ  1 
ATOM   932   N N   . LYS A 1 116 ? 31.993  60.388  -1.597  1.00 19.39  ? 142 LYS A N   1 
ATOM   933   C CA  . LYS A 1 116 ? 32.343  61.805  -1.519  1.00 22.10  ? 142 LYS A CA  1 
ATOM   934   C C   . LYS A 1 116 ? 33.835  61.934  -1.741  1.00 21.83  ? 142 LYS A C   1 
ATOM   935   O O   . LYS A 1 116 ? 34.612  61.097  -1.276  1.00 21.66  ? 142 LYS A O   1 
ATOM   936   C CB  . LYS A 1 116 ? 32.003  62.384  -0.148  1.00 21.32  ? 142 LYS A CB  1 
ATOM   937   C CG  . LYS A 1 116 ? 30.534  62.358  0.162   1.00 29.52  ? 142 LYS A CG  1 
ATOM   938   C CD  . LYS A 1 116 ? 29.845  63.656  -0.245  1.00 37.18  ? 142 LYS A CD  1 
ATOM   939   C CE  . LYS A 1 116 ? 29.721  64.593  0.957   1.00 39.94  ? 142 LYS A CE  1 
ATOM   940   N NZ  . LYS A 1 116 ? 28.864  65.794  0.675   1.00 43.12  ? 142 LYS A NZ  1 
ATOM   941   N N   . GLY A 1 117 ? 34.236  62.969  -2.469  1.00 19.67  ? 143 GLY A N   1 
ATOM   942   C CA  . GLY A 1 117 ? 35.649  63.175  -2.697  1.00 19.79  ? 143 GLY A CA  1 
ATOM   943   C C   . GLY A 1 117 ? 36.110  62.865  -4.097  1.00 22.42  ? 143 GLY A C   1 
ATOM   944   O O   . GLY A 1 117 ? 35.296  62.683  -4.998  1.00 22.96  ? 143 GLY A O   1 
ATOM   945   N N   . GLY A 1 118 ? 37.430  62.807  -4.266  1.00 23.08  ? 144 GLY A N   1 
ATOM   946   C CA  . GLY A 1 118 ? 38.024  62.527  -5.557  1.00 23.50  ? 144 GLY A CA  1 
ATOM   947   C C   . GLY A 1 118 ? 39.525  62.757  -5.545  1.00 25.37  ? 144 GLY A C   1 
ATOM   948   O O   . GLY A 1 118 ? 40.152  62.786  -4.488  1.00 28.13  ? 144 GLY A O   1 
ATOM   949   N N   . VAL A 1 119 ? 40.108  62.932  -6.722  1.00 25.89  ? 145 VAL A N   1 
ATOM   950   C CA  . VAL A 1 119 ? 41.542  63.149  -6.832  1.00 25.91  ? 145 VAL A CA  1 
ATOM   951   C C   . VAL A 1 119 ? 41.993  64.512  -6.296  1.00 27.19  ? 145 VAL A C   1 
ATOM   952   O O   . VAL A 1 119 ? 43.009  64.608  -5.592  1.00 27.40  ? 145 VAL A O   1 
ATOM   953   C CB  . VAL A 1 119 ? 41.996  62.988  -8.302  1.00 24.24  ? 145 VAL A CB  1 
ATOM   954   C CG1 . VAL A 1 119 ? 43.492  63.234  -8.435  1.00 19.30  ? 145 VAL A CG1 1 
ATOM   955   C CG2 . VAL A 1 119 ? 41.659  61.598  -8.775  1.00 21.94  ? 145 VAL A CG2 1 
ATOM   956   N N   . ALA A 1 120 ? 41.248  65.563  -6.621  1.00 26.74  ? 146 ALA A N   1 
ATOM   957   C CA  . ALA A 1 120 ? 41.609  66.897  -6.161  1.00 27.88  ? 146 ALA A CA  1 
ATOM   958   C C   . ALA A 1 120 ? 41.620  66.947  -4.630  1.00 30.31  ? 146 ALA A C   1 
ATOM   959   O O   . ALA A 1 120 ? 42.314  67.779  -4.040  1.00 33.62  ? 146 ALA A O   1 
ATOM   960   C CB  . ALA A 1 120 ? 40.636  67.934  -6.722  1.00 21.79  ? 146 ALA A CB  1 
ATOM   961   N N   . SER A 1 121 ? 40.867  66.044  -4.000  1.00 30.18  ? 147 SER A N   1 
ATOM   962   C CA  . SER A 1 121 ? 40.765  65.960  -2.535  1.00 31.02  ? 147 SER A CA  1 
ATOM   963   C C   . SER A 1 121 ? 41.723  64.930  -1.923  1.00 29.88  ? 147 SER A C   1 
ATOM   964   O O   . SER A 1 121 ? 41.758  64.742  -0.708  1.00 30.94  ? 147 SER A O   1 
ATOM   965   C CB  . SER A 1 121 ? 39.337  65.585  -2.121  1.00 29.99  ? 147 SER A CB  1 
ATOM   966   O OG  . SER A 1 121 ? 38.381  66.431  -2.722  1.00 32.70  ? 147 SER A OG  1 
ATOM   967   N N   . GLY A 1 122 ? 42.472  64.237  -2.766  1.00 29.84  ? 148 GLY A N   1 
ATOM   968   C CA  . GLY A 1 122 ? 43.411  63.256  -2.257  1.00 30.11  ? 148 GLY A CA  1 
ATOM   969   C C   . GLY A 1 122 ? 42.822  61.930  -1.823  1.00 29.33  ? 148 GLY A C   1 
ATOM   970   O O   . GLY A 1 122 ? 43.389  61.250  -0.976  1.00 31.91  ? 148 GLY A O   1 
ATOM   971   N N   . PHE A 1 123 ? 41.684  61.555  -2.389  1.00 29.23  ? 149 PHE A N   1 
ATOM   972   C CA  . PHE A 1 123 ? 41.066  60.287  -2.042  1.00 28.21  ? 149 PHE A CA  1 
ATOM   973   C C   . PHE A 1 123 ? 41.342  59.251  -3.118  1.00 28.70  ? 149 PHE A C   1 
ATOM   974   O O   . PHE A 1 123 ? 41.473  59.578  -4.295  1.00 25.82  ? 149 PHE A O   1 
ATOM   975   C CB  . PHE A 1 123 ? 39.566  60.465  -1.874  1.00 32.47  ? 149 PHE A CB  1 
ATOM   976   C CG  . PHE A 1 123 ? 39.201  61.335  -0.720  1.00 40.14  ? 149 PHE A CG  1 
ATOM   977   C CD1 . PHE A 1 123 ? 38.457  62.492  -0.912  1.00 43.13  ? 149 PHE A CD1 1 
ATOM   978   C CD2 . PHE A 1 123 ? 39.632  61.018  0.561   1.00 43.73  ? 149 PHE A CD2 1 
ATOM   979   C CE1 . PHE A 1 123 ? 38.154  63.325  0.153   1.00 45.35  ? 149 PHE A CE1 1 
ATOM   980   C CE2 . PHE A 1 123 ? 39.336  61.843  1.636   1.00 46.80  ? 149 PHE A CE2 1 
ATOM   981   C CZ  . PHE A 1 123 ? 38.594  63.001  1.431   1.00 48.53  ? 149 PHE A CZ  1 
ATOM   982   N N   . LYS A 1 124 ? 41.446  57.996  -2.712  1.00 28.00  ? 150 LYS A N   1 
ATOM   983   C CA  . LYS A 1 124 ? 41.687  56.949  -3.675  1.00 29.53  ? 150 LYS A CA  1 
ATOM   984   C C   . LYS A 1 124 ? 41.009  55.659  -3.289  1.00 28.03  ? 150 LYS A C   1 
ATOM   985   O O   . LYS A 1 124 ? 40.593  55.488  -2.155  1.00 26.02  ? 150 LYS A O   1 
ATOM   986   C CB  . LYS A 1 124 ? 43.186  56.741  -3.848  1.00 33.28  ? 150 LYS A CB  1 
ATOM   987   C CG  . LYS A 1 124 ? 43.949  56.534  -2.573  1.00 38.41  ? 150 LYS A CG  1 
ATOM   988   C CD  . LYS A 1 124 ? 45.448  56.649  -2.843  1.00 46.13  ? 150 LYS A CD  1 
ATOM   989   C CE  . LYS A 1 124 ? 45.821  58.064  -3.285  1.00 49.10  ? 150 LYS A CE  1 
ATOM   990   N NZ  . LYS A 1 124 ? 47.270  58.180  -3.619  1.00 53.37  ? 150 LYS A NZ  1 
ATOM   991   N N   . HIS A 1 125 ? 40.878  54.758  -4.252  1.00 31.15  ? 151 HIS A N   1 
ATOM   992   C CA  . HIS A 1 125 ? 40.250  53.468  -4.005  1.00 34.89  ? 151 HIS A CA  1 
ATOM   993   C C   . HIS A 1 125 ? 41.216  52.579  -3.239  1.00 41.58  ? 151 HIS A C   1 
ATOM   994   O O   . HIS A 1 125 ? 42.001  51.841  -3.830  1.00 43.08  ? 151 HIS A O   1 
ATOM   995   C CB  . HIS A 1 125 ? 39.891  52.818  -5.329  1.00 26.48  ? 151 HIS A CB  1 
ATOM   996   C CG  . HIS A 1 125 ? 38.827  53.544  -6.080  1.00 23.68  ? 151 HIS A CG  1 
ATOM   997   N ND1 . HIS A 1 125 ? 37.509  53.552  -5.678  1.00 21.87  ? 151 HIS A ND1 1 
ATOM   998   C CD2 . HIS A 1 125 ? 38.878  54.268  -7.222  1.00 22.81  ? 151 HIS A CD2 1 
ATOM   999   C CE1 . HIS A 1 125 ? 36.792  54.241  -6.546  1.00 19.39  ? 151 HIS A CE1 1 
ATOM   1000  N NE2 . HIS A 1 125 ? 37.599  54.686  -7.492  1.00 23.27  ? 151 HIS A NE2 1 
ATOM   1001  N N   . VAL A 1 126 ? 41.171  52.653  -1.919  1.00 49.88  ? 152 VAL A N   1 
ATOM   1002  C CA  . VAL A 1 126 ? 42.082  51.849  -1.134  1.00 61.48  ? 152 VAL A CA  1 
ATOM   1003  C C   . VAL A 1 126 ? 41.396  51.245  0.078   1.00 69.41  ? 152 VAL A C   1 
ATOM   1004  O O   . VAL A 1 126 ? 40.773  51.953  0.879   1.00 71.19  ? 152 VAL A O   1 
ATOM   1005  C CB  . VAL A 1 126 ? 43.306  52.682  -0.670  1.00 60.33  ? 152 VAL A CB  1 
ATOM   1006  C CG1 . VAL A 1 126 ? 42.911  53.623  0.455   1.00 59.60  ? 152 VAL A CG1 1 
ATOM   1007  C CG2 . VAL A 1 126 ? 44.426  51.754  -0.231  1.00 62.89  ? 152 VAL A CG2 1 
ATOM   1008  N N   . VAL A 1 127 ? 41.510  49.926  0.200   1.00 76.57  ? 153 VAL A N   1 
ATOM   1009  C CA  . VAL A 1 127 ? 40.911  49.215  1.317   1.00 84.00  ? 153 VAL A CA  1 
ATOM   1010  C C   . VAL A 1 127 ? 41.944  48.403  2.101   1.00 87.85  ? 153 VAL A C   1 
ATOM   1011  O O   . VAL A 1 127 ? 41.949  47.172  2.055   1.00 87.65  ? 153 VAL A O   1 
ATOM   1012  C CB  . VAL A 1 127 ? 39.768  48.280  0.841   1.00 84.81  ? 153 VAL A CB  1 
ATOM   1013  C CG1 . VAL A 1 127 ? 38.565  49.115  0.405   1.00 85.12  ? 153 VAL A CG1 1 
ATOM   1014  C CG2 . VAL A 1 127 ? 40.252  47.394  -0.309  1.00 85.65  ? 153 VAL A CG2 1 
ATOM   1015  N N   . PRO A 1 128 ? 42.848  49.094  2.822   1.00 91.56  ? 154 PRO A N   1 
ATOM   1016  C CA  . PRO A 1 128 ? 43.869  48.398  3.612   1.00 94.01  ? 154 PRO A CA  1 
ATOM   1017  C C   . PRO A 1 128 ? 43.182  47.471  4.609   1.00 96.21  ? 154 PRO A C   1 
ATOM   1018  O O   . PRO A 1 128 ? 41.956  47.503  4.753   1.00 97.65  ? 154 PRO A O   1 
ATOM   1019  C CB  . PRO A 1 128 ? 44.606  49.543  4.302   1.00 93.34  ? 154 PRO A CB  1 
ATOM   1020  C CG  . PRO A 1 128 ? 44.523  50.639  3.286   1.00 93.78  ? 154 PRO A CG  1 
ATOM   1021  C CD  . PRO A 1 128 ? 43.077  50.549  2.845   1.00 92.68  ? 154 PRO A CD  1 
ATOM   1022  N N   . ASN A 1 129 ? 43.961  46.644  5.297   1.00 96.99  ? 155 ASN A N   1 
ATOM   1023  C CA  . ASN A 1 129 ? 43.387  45.725  6.271   1.00 96.94  ? 155 ASN A CA  1 
ATOM   1024  C C   . ASN A 1 129 ? 42.908  46.481  7.510   1.00 95.60  ? 155 ASN A C   1 
ATOM   1025  O O   . ASN A 1 129 ? 41.716  46.471  7.833   1.00 95.96  ? 155 ASN A O   1 
ATOM   1026  C CB  . ASN A 1 129 ? 44.416  44.656  6.648   1.00 98.39  ? 155 ASN A CB  1 
ATOM   1027  C CG  . ASN A 1 129 ? 44.763  43.745  5.478   1.00 99.75  ? 155 ASN A CG  1 
ATOM   1028  O OD1 . ASN A 1 129 ? 43.925  42.975  5.001   1.00 99.50  ? 155 ASN A OD1 1 
ATOM   1029  N ND2 . ASN A 1 129 ? 46.002  43.837  5.005   1.00 100.41 ? 155 ASN A ND2 1 
ATOM   1030  N N   . GLU A 1 130 ? 43.834  47.139  8.199   1.00 92.86  ? 156 GLU A N   1 
ATOM   1031  C CA  . GLU A 1 130 ? 43.483  47.906  9.387   1.00 89.97  ? 156 GLU A CA  1 
ATOM   1032  C C   . GLU A 1 130 ? 43.019  49.286  8.932   1.00 86.28  ? 156 GLU A C   1 
ATOM   1033  O O   . GLU A 1 130 ? 43.841  50.129  8.563   1.00 86.51  ? 156 GLU A O   1 
ATOM   1034  C CB  . GLU A 1 130 ? 44.698  48.074  10.300  1.00 92.44  ? 156 GLU A CB  1 
ATOM   1035  C CG  . GLU A 1 130 ? 45.498  46.813  10.561  1.00 95.00  ? 156 GLU A CG  1 
ATOM   1036  C CD  . GLU A 1 130 ? 46.694  47.082  11.454  1.00 96.43  ? 156 GLU A CD  1 
ATOM   1037  O OE1 . GLU A 1 130 ? 46.486  47.390  12.648  1.00 97.52  ? 156 GLU A OE1 1 
ATOM   1038  O OE2 . GLU A 1 130 ? 47.839  47.000  10.960  1.00 96.30  ? 156 GLU A OE2 1 
ATOM   1039  N N   . VAL A 1 131 ? 41.712  49.524  8.949   1.00 80.58  ? 157 VAL A N   1 
ATOM   1040  C CA  . VAL A 1 131 ? 41.197  50.821  8.525   1.00 74.60  ? 157 VAL A CA  1 
ATOM   1041  C C   . VAL A 1 131 ? 40.126  51.378  9.457   1.00 69.23  ? 157 VAL A C   1 
ATOM   1042  O O   . VAL A 1 131 ? 39.312  50.641  10.019  1.00 68.52  ? 157 VAL A O   1 
ATOM   1043  C CB  . VAL A 1 131 ? 40.625  50.760  7.082   1.00 75.38  ? 157 VAL A CB  1 
ATOM   1044  C CG1 . VAL A 1 131 ? 40.191  52.151  6.632   1.00 75.00  ? 157 VAL A CG1 1 
ATOM   1045  C CG2 . VAL A 1 131 ? 41.675  50.211  6.127   1.00 74.95  ? 157 VAL A CG2 1 
ATOM   1046  N N   . VAL A 1 132 ? 40.151  52.696  9.616   1.00 62.20  ? 158 VAL A N   1 
ATOM   1047  C CA  . VAL A 1 132 ? 39.201  53.404  10.458  1.00 54.46  ? 158 VAL A CA  1 
ATOM   1048  C C   . VAL A 1 132 ? 38.217  54.119  9.539   1.00 49.50  ? 158 VAL A C   1 
ATOM   1049  O O   . VAL A 1 132 ? 38.615  54.926  8.699   1.00 49.44  ? 158 VAL A O   1 
ATOM   1050  C CB  . VAL A 1 132 ? 39.917  54.444  11.335  1.00 52.78  ? 158 VAL A CB  1 
ATOM   1051  C CG1 . VAL A 1 132 ? 38.925  55.113  12.264  1.00 53.27  ? 158 VAL A CG1 1 
ATOM   1052  C CG2 . VAL A 1 132 ? 41.024  53.775  12.121  1.00 51.54  ? 158 VAL A CG2 1 
ATOM   1053  N N   . VAL A 1 133 ? 36.935  53.821  9.692   1.00 42.93  ? 159 VAL A N   1 
ATOM   1054  C CA  . VAL A 1 133 ? 35.931  54.443  8.847   1.00 38.89  ? 159 VAL A CA  1 
ATOM   1055  C C   . VAL A 1 133 ? 34.677  54.890  9.597   1.00 35.23  ? 159 VAL A C   1 
ATOM   1056  O O   . VAL A 1 133 ? 34.252  54.281  10.578  1.00 33.85  ? 159 VAL A O   1 
ATOM   1057  C CB  . VAL A 1 133 ? 35.519  53.494  7.684   1.00 39.44  ? 159 VAL A CB  1 
ATOM   1058  C CG1 . VAL A 1 133 ? 35.093  52.169  8.234   1.00 41.15  ? 159 VAL A CG1 1 
ATOM   1059  C CG2 . VAL A 1 133 ? 34.370  54.095  6.882   1.00 41.39  ? 159 VAL A CG2 1 
ATOM   1060  N N   . GLN A 1 134 ? 34.102  55.980  9.119   1.00 29.63  ? 160 GLN A N   1 
ATOM   1061  C CA  . GLN A 1 134 ? 32.898  56.524  9.692   1.00 28.12  ? 160 GLN A CA  1 
ATOM   1062  C C   . GLN A 1 134 ? 32.169  57.223  8.552   1.00 26.71  ? 160 GLN A C   1 
ATOM   1063  O O   . GLN A 1 134 ? 32.431  58.391  8.268   1.00 29.10  ? 160 GLN A O   1 
ATOM   1064  C CB  . GLN A 1 134 ? 33.248  57.521  10.794  1.00 30.26  ? 160 GLN A CB  1 
ATOM   1065  C CG  . GLN A 1 134 ? 32.036  58.206  11.396  1.00 34.31  ? 160 GLN A CG  1 
ATOM   1066  C CD  . GLN A 1 134 ? 32.394  59.139  12.532  1.00 39.16  ? 160 GLN A CD  1 
ATOM   1067  O OE1 . GLN A 1 134 ? 32.897  58.709  13.571  1.00 39.46  ? 160 GLN A OE1 1 
ATOM   1068  N NE2 . GLN A 1 134 ? 32.136  60.430  12.340  1.00 40.36  ? 160 GLN A NE2 1 
ATOM   1069  N N   . ARG A 1 135 ? 31.272  56.501  7.888   1.00 22.83  ? 161 ARG A N   1 
ATOM   1070  C CA  . ARG A 1 135 ? 30.509  57.059  6.771   1.00 19.08  ? 161 ARG A CA  1 
ATOM   1071  C C   . ARG A 1 135 ? 29.060  56.593  6.812   1.00 18.22  ? 161 ARG A C   1 
ATOM   1072  O O   . ARG A 1 135 ? 28.739  55.571  7.422   1.00 17.92  ? 161 ARG A O   1 
ATOM   1073  C CB  . ARG A 1 135 ? 31.124  56.647  5.427   1.00 17.87  ? 161 ARG A CB  1 
ATOM   1074  C CG  . ARG A 1 135 ? 31.134  55.148  5.187   1.00 15.60  ? 161 ARG A CG  1 
ATOM   1075  C CD  . ARG A 1 135 ? 31.464  54.811  3.747   1.00 14.27  ? 161 ARG A CD  1 
ATOM   1076  N NE  . ARG A 1 135 ? 31.611  53.370  3.542   1.00 14.12  ? 161 ARG A NE  1 
ATOM   1077  C CZ  . ARG A 1 135 ? 31.939  52.812  2.382   1.00 14.57  ? 161 ARG A CZ  1 
ATOM   1078  N NH1 . ARG A 1 135 ? 32.150  53.577  1.318   1.00 15.85  ? 161 ARG A NH1 1 
ATOM   1079  N NH2 . ARG A 1 135 ? 32.066  51.489  2.284   1.00 16.01  ? 161 ARG A NH2 1 
ATOM   1080  N N   . LEU A 1 136 ? 28.193  57.348  6.143   1.00 16.51  ? 162 LEU A N   1 
ATOM   1081  C CA  . LEU A 1 136 ? 26.779  57.033  6.094   1.00 18.76  ? 162 LEU A CA  1 
ATOM   1082  C C   . LEU A 1 136 ? 26.378  56.921  4.637   1.00 18.55  ? 162 LEU A C   1 
ATOM   1083  O O   . LEU A 1 136 ? 26.658  57.808  3.834   1.00 17.35  ? 162 LEU A O   1 
ATOM   1084  C CB  . LEU A 1 136 ? 25.963  58.143  6.768   1.00 18.00  ? 162 LEU A CB  1 
ATOM   1085  C CG  . LEU A 1 136 ? 24.617  57.872  7.469   1.00 17.06  ? 162 LEU A CG  1 
ATOM   1086  C CD1 . LEU A 1 136 ? 23.573  58.791  6.894   1.00 18.11  ? 162 LEU A CD1 1 
ATOM   1087  C CD2 . LEU A 1 136 ? 24.185  56.426  7.342   1.00 15.94  ? 162 LEU A CD2 1 
ATOM   1088  N N   . LEU A 1 137 ? 25.718  55.828  4.298   1.00 19.81  ? 163 LEU A N   1 
ATOM   1089  C CA  . LEU A 1 137 ? 25.273  55.630  2.927   1.00 22.69  ? 163 LEU A CA  1 
ATOM   1090  C C   . LEU A 1 137 ? 23.749  55.588  2.870   1.00 22.38  ? 163 LEU A C   1 
ATOM   1091  O O   . LEU A 1 137 ? 23.096  54.926  3.685   1.00 20.93  ? 163 LEU A O   1 
ATOM   1092  C CB  . LEU A 1 137 ? 25.880  54.336  2.366   1.00 22.28  ? 163 LEU A CB  1 
ATOM   1093  C CG  . LEU A 1 137 ? 27.413  54.398  2.308   1.00 21.32  ? 163 LEU A CG  1 
ATOM   1094  C CD1 . LEU A 1 137 ? 28.022  53.164  2.937   1.00 21.84  ? 163 LEU A CD1 1 
ATOM   1095  C CD2 . LEU A 1 137 ? 27.852  54.565  0.870   1.00 19.13  ? 163 LEU A CD2 1 
ATOM   1096  N N   . GLN A 1 138 ? 23.186  56.336  1.928   1.00 20.92  ? 164 GLN A N   1 
ATOM   1097  C CA  . GLN A 1 138 ? 21.743  56.360  1.748   1.00 23.02  ? 164 GLN A CA  1 
ATOM   1098  C C   . GLN A 1 138 ? 21.438  55.452  0.569   1.00 21.84  ? 164 GLN A C   1 
ATOM   1099  O O   . GLN A 1 138 ? 21.904  55.706  -0.533  1.00 20.95  ? 164 GLN A O   1 
ATOM   1100  C CB  . GLN A 1 138 ? 21.240  57.776  1.435   1.00 20.43  ? 164 GLN A CB  1 
ATOM   1101  C CG  . GLN A 1 138 ? 19.741  57.798  1.145   1.00 23.27  ? 164 GLN A CG  1 
ATOM   1102  C CD  . GLN A 1 138 ? 19.176  59.181  0.871   1.00 23.98  ? 164 GLN A CD  1 
ATOM   1103  O OE1 . GLN A 1 138 ? 17.957  59.353  0.810   1.00 25.20  ? 164 GLN A OE1 1 
ATOM   1104  N NE2 . GLN A 1 138 ? 20.049  60.167  0.696   1.00 23.11  ? 164 GLN A NE2 1 
ATOM   1105  N N   . VAL A 1 139 ? 20.670  54.393  0.794   1.00 21.64  ? 165 VAL A N   1 
ATOM   1106  C CA  . VAL A 1 139 ? 20.341  53.483  -0.299  1.00 23.58  ? 165 VAL A CA  1 
ATOM   1107  C C   . VAL A 1 139 ? 18.996  53.824  -0.908  1.00 25.54  ? 165 VAL A C   1 
ATOM   1108  O O   . VAL A 1 139 ? 18.009  53.997  -0.199  1.00 25.32  ? 165 VAL A O   1 
ATOM   1109  C CB  . VAL A 1 139 ? 20.295  52.012  0.159   1.00 21.25  ? 165 VAL A CB  1 
ATOM   1110  C CG1 . VAL A 1 139 ? 20.030  51.114  -1.037  1.00 19.90  ? 165 VAL A CG1 1 
ATOM   1111  C CG2 . VAL A 1 139 ? 21.598  51.629  0.826   1.00 20.18  ? 165 VAL A CG2 1 
ATOM   1112  N N   . LYS A 1 140 ? 18.964  53.915  -2.232  1.00 29.66  ? 166 LYS A N   1 
ATOM   1113  C CA  . LYS A 1 140 ? 17.737  54.229  -2.952  1.00 32.86  ? 166 LYS A CA  1 
ATOM   1114  C C   . LYS A 1 140 ? 17.656  53.346  -4.191  1.00 34.98  ? 166 LYS A C   1 
ATOM   1115  O O   . LYS A 1 140 ? 18.682  52.980  -4.767  1.00 34.80  ? 166 LYS A O   1 
ATOM   1116  C CB  . LYS A 1 140 ? 17.749  55.699  -3.375  1.00 34.64  ? 166 LYS A CB  1 
ATOM   1117  C CG  . LYS A 1 140 ? 16.563  56.529  -2.908  1.00 35.35  ? 166 LYS A CG  1 
ATOM   1118  C CD  . LYS A 1 140 ? 16.934  58.011  -2.929  1.00 37.77  ? 166 LYS A CD  1 
ATOM   1119  C CE  . LYS A 1 140 ? 15.729  58.931  -2.721  1.00 41.32  ? 166 LYS A CE  1 
ATOM   1120  N NZ  . LYS A 1 140 ? 14.987  58.696  -1.447  1.00 43.34  ? 166 LYS A NZ  1 
ATOM   1121  N N   . GLY A 1 141 ? 16.438  52.998  -4.597  1.00 35.74  ? 167 GLY A N   1 
ATOM   1122  C CA  . GLY A 1 141 ? 16.278  52.187  -5.788  1.00 34.39  ? 167 GLY A CA  1 
ATOM   1123  C C   . GLY A 1 141 ? 15.598  50.855  -5.568  1.00 34.19  ? 167 GLY A C   1 
ATOM   1124  O O   . GLY A 1 141 ? 15.724  50.246  -4.508  1.00 33.49  ? 167 GLY A O   1 
ATOM   1125  N N   . ARG A 1 142 ? 14.884  50.403  -6.594  1.00 36.57  ? 168 ARG A N   1 
ATOM   1126  C CA  . ARG A 1 142 ? 14.162  49.138  -6.556  1.00 39.29  ? 168 ARG A CA  1 
ATOM   1127  C C   . ARG A 1 142 ? 14.700  48.240  -7.668  1.00 38.21  ? 168 ARG A C   1 
ATOM   1128  O O   . ARG A 1 142 ? 14.948  47.058  -7.449  1.00 39.23  ? 168 ARG A O   1 
ATOM   1129  C CB  . ARG A 1 142 ? 12.668  49.401  -6.757  1.00 42.83  ? 168 ARG A CB  1 
ATOM   1130  C CG  . ARG A 1 142 ? 11.739  48.313  -6.272  1.00 44.21  ? 168 ARG A CG  1 
ATOM   1131  C CD  . ARG A 1 142 ? 10.296  48.763  -6.446  1.00 47.39  ? 168 ARG A CD  1 
ATOM   1132  N NE  . ARG A 1 142 ? 9.344   47.756  -5.992  1.00 50.53  ? 168 ARG A NE  1 
ATOM   1133  C CZ  . ARG A 1 142 ? 8.996   47.563  -4.726  1.00 51.25  ? 168 ARG A CZ  1 
ATOM   1134  N NH1 . ARG A 1 142 ? 9.518   48.318  -3.767  1.00 55.25  ? 168 ARG A NH1 1 
ATOM   1135  N NH2 . ARG A 1 142 ? 8.138   46.599  -4.422  1.00 50.70  ? 168 ARG A NH2 1 
ATOM   1136  N N   . ARG A 1 143 ? 14.893  48.806  -8.858  1.00 38.19  ? 169 ARG A N   1 
ATOM   1137  C CA  . ARG A 1 143 ? 15.415  48.039  -9.993  1.00 39.75  ? 169 ARG A CA  1 
ATOM   1138  C C   . ARG A 1 143 ? 16.930  48.225  -10.083 1.00 38.42  ? 169 ARG A C   1 
ATOM   1139  O O   . ARG A 1 143 ? 17.679  47.283  -10.333 1.00 38.08  ? 169 ARG A O   1 
ATOM   1140  C CB  . ARG A 1 143 ? 14.751  48.491  -11.302 1.00 39.72  ? 169 ARG A CB  1 
ATOM   1141  C CG  . ARG A 1 143 ? 13.707  49.578  -11.119 1.00 41.70  ? 169 ARG A CG  1 
ATOM   1142  C CD  . ARG A 1 143 ? 12.280  49.073  -11.259 1.00 42.46  ? 169 ARG A CD  1 
ATOM   1143  N NE  . ARG A 1 143 ? 12.035  47.825  -10.545 1.00 42.65  ? 169 ARG A NE  1 
ATOM   1144  C CZ  . ARG A 1 143 ? 10.906  47.546  -9.904  1.00 45.71  ? 169 ARG A CZ  1 
ATOM   1145  N NH1 . ARG A 1 143 ? 9.916   48.431  -9.870  1.00 45.15  ? 169 ARG A NH1 1 
ATOM   1146  N NH2 . ARG A 1 143 ? 10.754  46.368  -9.317  1.00 48.22  ? 169 ARG A NH2 1 
ATOM   1147  N N   . VAL A 1 144 ? 17.369  49.456  -9.877  1.00 37.77  ? 170 VAL A N   1 
ATOM   1148  C CA  . VAL A 1 144 ? 18.784  49.788  -9.900  1.00 36.49  ? 170 VAL A CA  1 
ATOM   1149  C C   . VAL A 1 144 ? 19.080  50.433  -8.550  1.00 33.90  ? 170 VAL A C   1 
ATOM   1150  O O   . VAL A 1 144 ? 18.527  51.483  -8.231  1.00 33.55  ? 170 VAL A O   1 
ATOM   1151  C CB  . VAL A 1 144 ? 19.101  50.766  -11.063 1.00 38.19  ? 170 VAL A CB  1 
ATOM   1152  C CG1 . VAL A 1 144 ? 17.862  51.572  -11.420 1.00 39.52  ? 170 VAL A CG1 1 
ATOM   1153  C CG2 . VAL A 1 144 ? 20.235  51.703  -10.676 1.00 39.22  ? 170 VAL A CG2 1 
ATOM   1154  N N   . VAL A 1 145 ? 19.931  49.803  -7.746  1.00 30.89  ? 171 VAL A N   1 
ATOM   1155  C CA  . VAL A 1 145 ? 20.226  50.368  -6.433  1.00 30.58  ? 171 VAL A CA  1 
ATOM   1156  C C   . VAL A 1 145 ? 21.462  51.258  -6.417  1.00 26.39  ? 171 VAL A C   1 
ATOM   1157  O O   . VAL A 1 145 ? 22.545  50.884  -6.877  1.00 23.66  ? 171 VAL A O   1 
ATOM   1158  C CB  . VAL A 1 145 ? 20.361  49.264  -5.331  1.00 29.96  ? 171 VAL A CB  1 
ATOM   1159  C CG1 . VAL A 1 145 ? 19.532  48.066  -5.709  1.00 32.86  ? 171 VAL A CG1 1 
ATOM   1160  C CG2 . VAL A 1 145 ? 21.803  48.874  -5.118  1.00 31.30  ? 171 VAL A CG2 1 
ATOM   1161  N N   . ARG A 1 146 ? 21.272  52.452  -5.878  1.00 23.25  ? 172 ARG A N   1 
ATOM   1162  C CA  . ARG A 1 146 ? 22.340  53.418  -5.781  1.00 23.14  ? 172 ARG A CA  1 
ATOM   1163  C C   . ARG A 1 146 ? 22.544  53.779  -4.316  1.00 22.80  ? 172 ARG A C   1 
ATOM   1164  O O   . ARG A 1 146 ? 21.600  54.179  -3.622  1.00 21.75  ? 172 ARG A O   1 
ATOM   1165  C CB  . ARG A 1 146 ? 21.989  54.679  -6.577  1.00 24.40  ? 172 ARG A CB  1 
ATOM   1166  C CG  . ARG A 1 146 ? 21.799  54.480  -8.072  1.00 23.15  ? 172 ARG A CG  1 
ATOM   1167  C CD  . ARG A 1 146 ? 21.565  55.823  -8.720  1.00 22.81  ? 172 ARG A CD  1 
ATOM   1168  N NE  . ARG A 1 146 ? 21.703  55.801  -10.172 1.00 22.65  ? 172 ARG A NE  1 
ATOM   1169  C CZ  . ARG A 1 146 ? 20.773  55.376  -11.019 1.00 21.10  ? 172 ARG A CZ  1 
ATOM   1170  N NH1 . ARG A 1 146 ? 19.613  54.927  -10.567 1.00 19.01  ? 172 ARG A NH1 1 
ATOM   1171  N NH2 . ARG A 1 146 ? 21.010  55.405  -12.325 1.00 19.21  ? 172 ARG A NH2 1 
ATOM   1172  N N   . ALA A 1 147 ? 23.780  53.623  -3.849  1.00 21.11  ? 173 ALA A N   1 
ATOM   1173  C CA  . ALA A 1 147 ? 24.133  53.947  -2.476  1.00 18.63  ? 173 ALA A CA  1 
ATOM   1174  C C   . ALA A 1 147 ? 25.049  55.166  -2.524  1.00 19.00  ? 173 ALA A C   1 
ATOM   1175  O O   . ALA A 1 147 ? 26.149  55.114  -3.070  1.00 20.48  ? 173 ALA A O   1 
ATOM   1176  C CB  . ALA A 1 147 ? 24.824  52.774  -1.821  1.00 13.31  ? 173 ALA A CB  1 
ATOM   1177  N N   . THR A 1 148 ? 24.566  56.263  -1.953  1.00 19.24  ? 174 THR A N   1 
ATOM   1178  C CA  . THR A 1 148 ? 25.279  57.528  -1.929  1.00 19.32  ? 174 THR A CA  1 
ATOM   1179  C C   . THR A 1 148 ? 25.763  57.923  -0.541  1.00 19.71  ? 174 THR A C   1 
ATOM   1180  O O   . THR A 1 148 ? 24.985  57.926  0.411   1.00 18.72  ? 174 THR A O   1 
ATOM   1181  C CB  . THR A 1 148 ? 24.372  58.659  -2.434  1.00 20.33  ? 174 THR A CB  1 
ATOM   1182  O OG1 . THR A 1 148 ? 23.883  58.332  -3.739  1.00 20.83  ? 174 THR A OG1 1 
ATOM   1183  C CG2 . THR A 1 148 ? 25.141  59.971  -2.490  1.00 24.18  ? 174 THR A CG2 1 
ATOM   1184  N N   . GLU A 1 149 ? 27.045  58.271  -0.431  1.00 21.24  ? 175 GLU A N   1 
ATOM   1185  C CA  . GLU A 1 149 ? 27.608  58.699  0.850   1.00 19.77  ? 175 GLU A CA  1 
ATOM   1186  C C   . GLU A 1 149 ? 27.008  60.055  1.163   1.00 18.90  ? 175 GLU A C   1 
ATOM   1187  O O   . GLU A 1 149 ? 26.968  60.922  0.297   1.00 21.29  ? 175 GLU A O   1 
ATOM   1188  C CB  . GLU A 1 149 ? 29.130  58.796  0.771   1.00 16.17  ? 175 GLU A CB  1 
ATOM   1189  C CG  . GLU A 1 149 ? 29.799  57.450  0.773   1.00 17.35  ? 175 GLU A CG  1 
ATOM   1190  C CD  . GLU A 1 149 ? 31.308  57.540  0.698   1.00 21.50  ? 175 GLU A CD  1 
ATOM   1191  O OE1 . GLU A 1 149 ? 31.978  56.497  0.890   1.00 21.09  ? 175 GLU A OE1 1 
ATOM   1192  O OE2 . GLU A 1 149 ? 31.824  58.647  0.442   1.00 21.38  ? 175 GLU A OE2 1 
ATOM   1193  N N   . VAL A 1 150 ? 26.509  60.217  2.385   1.00 18.20  ? 176 VAL A N   1 
ATOM   1194  C CA  . VAL A 1 150 ? 25.880  61.466  2.810   1.00 15.50  ? 176 VAL A CA  1 
ATOM   1195  C C   . VAL A 1 150 ? 26.481  61.841  4.147   1.00 15.30  ? 176 VAL A C   1 
ATOM   1196  O O   . VAL A 1 150 ? 27.161  61.028  4.762   1.00 16.34  ? 176 VAL A O   1 
ATOM   1197  C CB  . VAL A 1 150 ? 24.334  61.293  2.949   1.00 16.39  ? 176 VAL A CB  1 
ATOM   1198  C CG1 . VAL A 1 150 ? 23.709  61.119  1.594   1.00 10.75  ? 176 VAL A CG1 1 
ATOM   1199  C CG2 . VAL A 1 150 ? 24.002  60.069  3.798   1.00 14.45  ? 176 VAL A CG2 1 
ATOM   1200  N N   . PRO A 1 151 ? 26.253  63.078  4.617   1.00 16.46  ? 177 PRO A N   1 
ATOM   1201  C CA  . PRO A 1 151 ? 26.817  63.485  5.913   1.00 16.65  ? 177 PRO A CA  1 
ATOM   1202  C C   . PRO A 1 151 ? 26.342  62.556  7.027   1.00 17.61  ? 177 PRO A C   1 
ATOM   1203  O O   . PRO A 1 151 ? 25.186  62.135  7.029   1.00 18.90  ? 177 PRO A O   1 
ATOM   1204  C CB  . PRO A 1 151 ? 26.294  64.912  6.090   1.00 18.04  ? 177 PRO A CB  1 
ATOM   1205  C CG  . PRO A 1 151 ? 26.140  65.403  4.667   1.00 17.75  ? 177 PRO A CG  1 
ATOM   1206  C CD  . PRO A 1 151 ? 25.532  64.197  3.980   1.00 16.38  ? 177 PRO A CD  1 
ATOM   1207  N N   . VAL A 1 152 ? 27.236  62.226  7.959   1.00 16.85  ? 178 VAL A N   1 
ATOM   1208  C CA  . VAL A 1 152 ? 26.891  61.352  9.074   1.00 17.94  ? 178 VAL A CA  1 
ATOM   1209  C C   . VAL A 1 152 ? 26.040  62.140  10.058  1.00 19.91  ? 178 VAL A C   1 
ATOM   1210  O O   . VAL A 1 152 ? 26.568  62.786  10.959  1.00 22.16  ? 178 VAL A O   1 
ATOM   1211  C CB  . VAL A 1 152 ? 28.159  60.850  9.784   1.00 18.02  ? 178 VAL A CB  1 
ATOM   1212  C CG1 . VAL A 1 152 ? 27.799  60.050  11.030  1.00 13.86  ? 178 VAL A CG1 1 
ATOM   1213  C CG2 . VAL A 1 152 ? 28.957  59.999  8.835   1.00 16.10  ? 178 VAL A CG2 1 
ATOM   1214  N N   . SER A 1 153 ? 24.724  62.072  9.893   1.00 20.88  ? 179 SER A N   1 
ATOM   1215  C CA  . SER A 1 153 ? 23.815  62.826  10.744  1.00 22.58  ? 179 SER A CA  1 
ATOM   1216  C C   . SER A 1 153 ? 22.355  62.449  10.549  1.00 23.01  ? 179 SER A C   1 
ATOM   1217  O O   . SER A 1 153 ? 21.984  61.924  9.507   1.00 24.37  ? 179 SER A O   1 
ATOM   1218  C CB  . SER A 1 153 ? 23.968  64.313  10.449  1.00 23.69  ? 179 SER A CB  1 
ATOM   1219  O OG  . SER A 1 153 ? 22.735  64.978  10.635  1.00 27.16  ? 179 SER A OG  1 
ATOM   1220  N N   . TRP A 1 154 ? 21.529  62.747  11.548  1.00 22.33  ? 180 TRP A N   1 
ATOM   1221  C CA  . TRP A 1 154 ? 20.103  62.448  11.480  1.00 23.46  ? 180 TRP A CA  1 
ATOM   1222  C C   . TRP A 1 154 ? 19.415  63.271  10.414  1.00 24.19  ? 180 TRP A C   1 
ATOM   1223  O O   . TRP A 1 154 ? 18.350  62.901  9.928   1.00 27.45  ? 180 TRP A O   1 
ATOM   1224  C CB  . TRP A 1 154 ? 19.422  62.725  12.822  1.00 24.16  ? 180 TRP A CB  1 
ATOM   1225  C CG  . TRP A 1 154 ? 19.531  61.614  13.782  1.00 23.21  ? 180 TRP A CG  1 
ATOM   1226  C CD1 . TRP A 1 154 ? 20.104  61.649  15.021  1.00 23.21  ? 180 TRP A CD1 1 
ATOM   1227  C CD2 . TRP A 1 154 ? 19.087  60.272  13.579  1.00 22.61  ? 180 TRP A CD2 1 
ATOM   1228  N NE1 . TRP A 1 154 ? 20.050  60.403  15.601  1.00 25.16  ? 180 TRP A NE1 1 
ATOM   1229  C CE2 . TRP A 1 154 ? 19.434  59.539  14.734  1.00 24.84  ? 180 TRP A CE2 1 
ATOM   1230  C CE3 . TRP A 1 154 ? 18.440  59.616  12.524  1.00 23.82  ? 180 TRP A CE3 1 
ATOM   1231  C CZ2 . TRP A 1 154 ? 19.147  58.180  14.865  1.00 22.31  ? 180 TRP A CZ2 1 
ATOM   1232  C CZ3 . TRP A 1 154 ? 18.156  58.271  12.652  1.00 21.80  ? 180 TRP A CZ3 1 
ATOM   1233  C CH2 . TRP A 1 154 ? 18.514  57.564  13.816  1.00 26.59  ? 180 TRP A CH2 1 
ATOM   1234  N N   . GLU A 1 155 ? 20.023  64.394  10.059  1.00 26.16  ? 181 GLU A N   1 
ATOM   1235  C CA  . GLU A 1 155 ? 19.457  65.277  9.051   1.00 29.16  ? 181 GLU A CA  1 
ATOM   1236  C C   . GLU A 1 155 ? 19.438  64.679  7.646   1.00 26.13  ? 181 GLU A C   1 
ATOM   1237  O O   . GLU A 1 155 ? 18.715  65.157  6.779   1.00 24.04  ? 181 GLU A O   1 
ATOM   1238  C CB  . GLU A 1 155 ? 20.212  66.609  9.049   1.00 36.34  ? 181 GLU A CB  1 
ATOM   1239  C CG  . GLU A 1 155 ? 20.095  67.348  10.372  1.00 48.64  ? 181 GLU A CG  1 
ATOM   1240  C CD  . GLU A 1 155 ? 20.652  68.757  10.311  1.00 57.21  ? 181 GLU A CD  1 
ATOM   1241  O OE1 . GLU A 1 155 ? 20.169  69.544  9.463   1.00 62.54  ? 181 GLU A OE1 1 
ATOM   1242  O OE2 . GLU A 1 155 ? 21.565  69.079  11.112  1.00 59.31  ? 181 GLU A OE2 1 
ATOM   1243  N N   . SER A 1 156 ? 20.220  63.626  7.426   1.00 24.56  ? 182 SER A N   1 
ATOM   1244  C CA  . SER A 1 156 ? 20.279  62.981  6.114   1.00 21.87  ? 182 SER A CA  1 
ATOM   1245  C C   . SER A 1 156 ? 19.208  61.901  5.984   1.00 22.18  ? 182 SER A C   1 
ATOM   1246  O O   . SER A 1 156 ? 18.929  61.414  4.889   1.00 22.35  ? 182 SER A O   1 
ATOM   1247  C CB  . SER A 1 156 ? 21.656  62.334  5.905   1.00 22.25  ? 182 SER A CB  1 
ATOM   1248  O OG  . SER A 1 156 ? 22.724  63.258  6.043   1.00 18.45  ? 182 SER A OG  1 
ATOM   1249  N N   . PHE A 1 157 ? 18.610  61.545  7.115   1.00 19.12  ? 183 PHE A N   1 
ATOM   1250  C CA  . PHE A 1 157 ? 17.612  60.493  7.185   1.00 20.86  ? 183 PHE A CA  1 
ATOM   1251  C C   . PHE A 1 157 ? 16.193  60.868  6.785   1.00 23.18  ? 183 PHE A C   1 
ATOM   1252  O O   . PHE A 1 157 ? 15.876  62.031  6.598   1.00 25.38  ? 183 PHE A O   1 
ATOM   1253  C CB  . PHE A 1 157 ? 17.561  59.954  8.613   1.00 22.20  ? 183 PHE A CB  1 
ATOM   1254  C CG  . PHE A 1 157 ? 18.703  59.049  8.978   1.00 21.46  ? 183 PHE A CG  1 
ATOM   1255  C CD1 . PHE A 1 157 ? 18.501  57.677  9.104   1.00 18.58  ? 183 PHE A CD1 1 
ATOM   1256  C CD2 . PHE A 1 157 ? 19.957  59.571  9.261   1.00 22.23  ? 183 PHE A CD2 1 
ATOM   1257  C CE1 . PHE A 1 157 ? 19.524  56.838  9.520   1.00 20.14  ? 183 PHE A CE1 1 
ATOM   1258  C CE2 . PHE A 1 157 ? 20.998  58.741  9.677   1.00 25.01  ? 183 PHE A CE2 1 
ATOM   1259  C CZ  . PHE A 1 157 ? 20.780  57.369  9.810   1.00 24.03  ? 183 PHE A CZ  1 
ATOM   1260  N N   . ASN A 1 158 ? 15.348  59.849  6.664   1.00 22.55  ? 184 ASN A N   1 
ATOM   1261  C CA  . ASN A 1 158 ? 13.930  59.998  6.363   1.00 25.24  ? 184 ASN A CA  1 
ATOM   1262  C C   . ASN A 1 158 ? 13.333  58.642  6.738   1.00 25.30  ? 184 ASN A C   1 
ATOM   1263  O O   . ASN A 1 158 ? 14.082  57.695  6.980   1.00 22.52  ? 184 ASN A O   1 
ATOM   1264  C CB  . ASN A 1 158 ? 13.680  60.333  4.887   1.00 26.32  ? 184 ASN A CB  1 
ATOM   1265  C CG  . ASN A 1 158 ? 14.066  59.209  3.952   1.00 29.49  ? 184 ASN A CG  1 
ATOM   1266  O OD1 . ASN A 1 158 ? 13.675  58.055  4.147   1.00 33.19  ? 184 ASN A OD1 1 
ATOM   1267  N ND2 . ASN A 1 158 ? 14.823  59.540  2.913   1.00 26.28  ? 184 ASN A ND2 1 
ATOM   1268  N N   . ASN A 1 159 ? 12.007  58.532  6.798   1.00 25.63  ? 185 ASN A N   1 
ATOM   1269  C CA  . ASN A 1 159 ? 11.394  57.266  7.198   1.00 25.86  ? 185 ASN A CA  1 
ATOM   1270  C C   . ASN A 1 159 ? 11.061  56.283  6.080   1.00 25.60  ? 185 ASN A C   1 
ATOM   1271  O O   . ASN A 1 159 ? 10.514  55.204  6.335   1.00 25.12  ? 185 ASN A O   1 
ATOM   1272  C CB  . ASN A 1 159 ? 10.138  57.517  8.054   1.00 27.65  ? 185 ASN A CB  1 
ATOM   1273  C CG  . ASN A 1 159 ? 9.087   58.367  7.345   1.00 27.86  ? 185 ASN A CG  1 
ATOM   1274  O OD1 . ASN A 1 159 ? 8.932   58.308  6.124   1.00 29.72  ? 185 ASN A OD1 1 
ATOM   1275  N ND2 . ASN A 1 159 ? 8.343   59.145  8.119   1.00 25.87  ? 185 ASN A ND2 1 
ATOM   1276  N N   . GLY A 1 160 ? 11.416  56.638  4.851   1.00 27.06  ? 186 GLY A N   1 
ATOM   1277  C CA  . GLY A 1 160 ? 11.132  55.763  3.729   1.00 26.53  ? 186 GLY A CA  1 
ATOM   1278  C C   . GLY A 1 160 ? 12.289  54.935  3.193   1.00 27.20  ? 186 GLY A C   1 
ATOM   1279  O O   . GLY A 1 160 ? 12.072  53.842  2.680   1.00 29.27  ? 186 GLY A O   1 
ATOM   1280  N N   . ASP A 1 161 ? 13.517  55.428  3.314   1.00 26.13  ? 187 ASP A N   1 
ATOM   1281  C CA  . ASP A 1 161 ? 14.670  54.700  2.785   1.00 24.09  ? 187 ASP A CA  1 
ATOM   1282  C C   . ASP A 1 161 ? 15.421  53.859  3.811   1.00 24.67  ? 187 ASP A C   1 
ATOM   1283  O O   . ASP A 1 161 ? 15.045  53.779  4.985   1.00 24.95  ? 187 ASP A O   1 
ATOM   1284  C CB  . ASP A 1 161 ? 15.655  55.689  2.163   1.00 19.95  ? 187 ASP A CB  1 
ATOM   1285  C CG  . ASP A 1 161 ? 15.008  56.582  1.119   1.00 24.56  ? 187 ASP A CG  1 
ATOM   1286  O OD1 . ASP A 1 161 ? 15.471  57.735  0.941   1.00 23.39  ? 187 ASP A OD1 1 
ATOM   1287  O OD2 . ASP A 1 161 ? 14.041  56.130  0.468   1.00 27.62  ? 187 ASP A OD2 1 
ATOM   1288  N N   . CYS A 1 162 ? 16.480  53.208  3.347   1.00 22.52  ? 188 CYS A N   1 
ATOM   1289  C CA  . CYS A 1 162 ? 17.332  52.433  4.234   1.00 23.41  ? 188 CYS A CA  1 
ATOM   1290  C C   . CYS A 1 162 ? 18.674  53.135  4.204   1.00 21.53  ? 188 CYS A C   1 
ATOM   1291  O O   . CYS A 1 162 ? 19.100  53.621  3.160   1.00 22.32  ? 188 CYS A O   1 
ATOM   1292  C CB  . CYS A 1 162 ? 17.532  51.013  3.746   1.00 23.31  ? 188 CYS A CB  1 
ATOM   1293  S SG  . CYS A 1 162 ? 16.093  49.913  3.815   1.00 24.84  ? 188 CYS A SG  1 
ATOM   1294  N N   . PHE A 1 163 ? 19.334  53.188  5.350   1.00 19.66  ? 189 PHE A N   1 
ATOM   1295  C CA  . PHE A 1 163 ? 20.626  53.830  5.443   1.00 19.68  ? 189 PHE A CA  1 
ATOM   1296  C C   . PHE A 1 163 ? 21.610  52.846  6.041   1.00 20.09  ? 189 PHE A C   1 
ATOM   1297  O O   . PHE A 1 163 ? 21.227  51.973  6.809   1.00 20.40  ? 189 PHE A O   1 
ATOM   1298  C CB  . PHE A 1 163 ? 20.543  55.077  6.331   1.00 19.67  ? 189 PHE A CB  1 
ATOM   1299  C CG  . PHE A 1 163 ? 19.650  56.150  5.782   1.00 21.46  ? 189 PHE A CG  1 
ATOM   1300  C CD1 . PHE A 1 163 ? 18.265  55.992  5.788   1.00 21.28  ? 189 PHE A CD1 1 
ATOM   1301  C CD2 . PHE A 1 163 ? 20.195  57.311  5.229   1.00 21.53  ? 189 PHE A CD2 1 
ATOM   1302  C CE1 . PHE A 1 163 ? 17.431  56.968  5.249   1.00 21.81  ? 189 PHE A CE1 1 
ATOM   1303  C CE2 . PHE A 1 163 ? 19.372  58.300  4.682   1.00 21.06  ? 189 PHE A CE2 1 
ATOM   1304  C CZ  . PHE A 1 163 ? 17.985  58.128  4.692   1.00 25.38  ? 189 PHE A CZ  1 
ATOM   1305  N N   . ILE A 1 164 ? 22.880  52.992  5.687   1.00 20.72  ? 190 ILE A N   1 
ATOM   1306  C CA  . ILE A 1 164 ? 23.906  52.116  6.219   1.00 20.91  ? 190 ILE A CA  1 
ATOM   1307  C C   . ILE A 1 164 ? 24.955  52.946  6.920   1.00 20.20  ? 190 ILE A C   1 
ATOM   1308  O O   . ILE A 1 164 ? 25.600  53.784  6.295   1.00 21.66  ? 190 ILE A O   1 
ATOM   1309  C CB  . ILE A 1 164 ? 24.599  51.312  5.107   1.00 21.83  ? 190 ILE A CB  1 
ATOM   1310  C CG1 . ILE A 1 164 ? 23.580  50.427  4.388   1.00 20.97  ? 190 ILE A CG1 1 
ATOM   1311  C CG2 . ILE A 1 164 ? 25.702  50.466  5.713   1.00 24.11  ? 190 ILE A CG2 1 
ATOM   1312  C CD1 . ILE A 1 164 ? 24.057  49.897  3.064   1.00 24.27  ? 190 ILE A CD1 1 
ATOM   1313  N N   . LEU A 1 165 ? 25.109  52.727  8.223   1.00 21.09  ? 191 LEU A N   1 
ATOM   1314  C CA  . LEU A 1 165 ? 26.111  53.444  8.997   1.00 19.77  ? 191 LEU A CA  1 
ATOM   1315  C C   . LEU A 1 165 ? 27.304  52.530  9.065   1.00 19.82  ? 191 LEU A C   1 
ATOM   1316  O O   . LEU A 1 165 ? 27.321  51.578  9.841   1.00 22.13  ? 191 LEU A O   1 
ATOM   1317  C CB  . LEU A 1 165 ? 25.625  53.731  10.418  1.00 21.21  ? 191 LEU A CB  1 
ATOM   1318  C CG  . LEU A 1 165 ? 26.631  54.552  11.233  1.00 21.00  ? 191 LEU A CG  1 
ATOM   1319  C CD1 . LEU A 1 165 ? 26.726  55.943  10.629  1.00 22.26  ? 191 LEU A CD1 1 
ATOM   1320  C CD2 . LEU A 1 165 ? 26.211  54.645  12.679  1.00 19.13  ? 191 LEU A CD2 1 
ATOM   1321  N N   . ASP A 1 166 ? 28.303  52.815  8.249   1.00 20.04  ? 192 ASP A N   1 
ATOM   1322  C CA  . ASP A 1 166 ? 29.493  51.987  8.203   1.00 22.35  ? 192 ASP A CA  1 
ATOM   1323  C C   . ASP A 1 166 ? 30.574  52.498  9.161   1.00 23.24  ? 192 ASP A C   1 
ATOM   1324  O O   . ASP A 1 166 ? 31.140  53.576  8.969   1.00 21.83  ? 192 ASP A O   1 
ATOM   1325  C CB  . ASP A 1 166 ? 29.988  51.926  6.757   1.00 21.65  ? 192 ASP A CB  1 
ATOM   1326  C CG  . ASP A 1 166 ? 31.318  51.239  6.619   1.00 23.01  ? 192 ASP A CG  1 
ATOM   1327  O OD1 . ASP A 1 166 ? 31.657  50.417  7.498   1.00 24.33  ? 192 ASP A OD1 1 
ATOM   1328  O OD2 . ASP A 1 166 ? 32.014  51.515  5.616   1.00 23.66  ? 192 ASP A OD2 1 
ATOM   1329  N N   . LEU A 1 167 ? 30.834  51.712  10.203  1.00 23.72  ? 193 LEU A N   1 
ATOM   1330  C CA  . LEU A 1 167 ? 31.827  52.055  11.213  1.00 24.84  ? 193 LEU A CA  1 
ATOM   1331  C C   . LEU A 1 167 ? 33.062  51.148  11.165  1.00 27.18  ? 193 LEU A C   1 
ATOM   1332  O O   . LEU A 1 167 ? 33.749  50.988  12.170  1.00 30.01  ? 193 LEU A O   1 
ATOM   1333  C CB  . LEU A 1 167 ? 31.208  51.979  12.622  1.00 25.55  ? 193 LEU A CB  1 
ATOM   1334  C CG  . LEU A 1 167 ? 30.362  53.104  13.253  1.00 24.54  ? 193 LEU A CG  1 
ATOM   1335  C CD1 . LEU A 1 167 ? 30.497  54.402  12.474  1.00 18.72  ? 193 LEU A CD1 1 
ATOM   1336  C CD2 . LEU A 1 167 ? 28.920  52.672  13.313  1.00 26.92  ? 193 LEU A CD2 1 
ATOM   1337  N N   . GLY A 1 168 ? 33.346  50.551  10.009  1.00 28.13  ? 194 GLY A N   1 
ATOM   1338  C CA  . GLY A 1 168 ? 34.502  49.678  9.893   1.00 26.94  ? 194 GLY A CA  1 
ATOM   1339  C C   . GLY A 1 168 ? 34.207  48.207  10.126  1.00 28.75  ? 194 GLY A C   1 
ATOM   1340  O O   . GLY A 1 168 ? 33.732  47.507  9.229   1.00 26.81  ? 194 GLY A O   1 
ATOM   1341  N N   . ASN A 1 169 ? 34.504  47.739  11.335  1.00 31.04  ? 195 ASN A N   1 
ATOM   1342  C CA  . ASN A 1 169 ? 34.278  46.347  11.723  1.00 34.11  ? 195 ASN A CA  1 
ATOM   1343  C C   . ASN A 1 169 ? 32.796  46.077  11.982  1.00 33.67  ? 195 ASN A C   1 
ATOM   1344  O O   . ASN A 1 169 ? 32.346  44.930  11.997  1.00 32.17  ? 195 ASN A O   1 
ATOM   1345  C CB  . ASN A 1 169 ? 35.094  46.025  12.975  1.00 39.19  ? 195 ASN A CB  1 
ATOM   1346  C CG  . ASN A 1 169 ? 36.586  46.052  12.713  1.00 47.66  ? 195 ASN A CG  1 
ATOM   1347  O OD1 . ASN A 1 169 ? 37.395  45.937  13.635  1.00 54.12  ? 195 ASN A OD1 1 
ATOM   1348  N ND2 . ASN A 1 169 ? 36.962  46.196  11.442  1.00 51.07  ? 195 ASN A ND2 1 
ATOM   1349  N N   . ASN A 1 170 ? 32.039  47.143  12.188  1.00 30.18  ? 196 ASN A N   1 
ATOM   1350  C CA  . ASN A 1 170 ? 30.621  47.008  12.425  1.00 29.93  ? 196 ASN A CA  1 
ATOM   1351  C C   . ASN A 1 170 ? 29.831  47.787  11.375  1.00 30.29  ? 196 ASN A C   1 
ATOM   1352  O O   . ASN A 1 170 ? 30.061  48.981  11.153  1.00 32.24  ? 196 ASN A O   1 
ATOM   1353  C CB  . ASN A 1 170 ? 30.293  47.485  13.840  1.00 31.94  ? 196 ASN A CB  1 
ATOM   1354  C CG  . ASN A 1 170 ? 30.657  46.454  14.891  1.00 32.52  ? 196 ASN A CG  1 
ATOM   1355  O OD1 . ASN A 1 170 ? 29.994  45.421  15.011  1.00 31.63  ? 196 ASN A OD1 1 
ATOM   1356  N ND2 . ASN A 1 170 ? 31.723  46.715  15.643  1.00 30.63  ? 196 ASN A ND2 1 
ATOM   1357  N N   . ILE A 1 171 ? 28.917  47.092  10.703  1.00 28.78  ? 197 ILE A N   1 
ATOM   1358  C CA  . ILE A 1 171 ? 28.101  47.717  9.680   1.00 28.67  ? 197 ILE A CA  1 
ATOM   1359  C C   . ILE A 1 171 ? 26.650  47.626  10.121  1.00 29.26  ? 197 ILE A C   1 
ATOM   1360  O O   . ILE A 1 171 ? 26.105  46.535  10.262  1.00 33.21  ? 197 ILE A O   1 
ATOM   1361  C CB  . ILE A 1 171 ? 28.296  47.025  8.309   1.00 28.21  ? 197 ILE A CB  1 
ATOM   1362  C CG1 . ILE A 1 171 ? 29.790  46.958  7.979   1.00 26.38  ? 197 ILE A CG1 1 
ATOM   1363  C CG2 . ILE A 1 171 ? 27.581  47.816  7.206   1.00 23.29  ? 197 ILE A CG2 1 
ATOM   1364  C CD1 . ILE A 1 171 ? 30.096  46.288  6.663   1.00 30.15  ? 197 ILE A CD1 1 
ATOM   1365  N N   . TYR A 1 172 ? 26.043  48.786  10.349  1.00 28.69  ? 198 TYR A N   1 
ATOM   1366  C CA  . TYR A 1 172 ? 24.654  48.889  10.794  1.00 29.17  ? 198 TYR A CA  1 
ATOM   1367  C C   . TYR A 1 172 ? 23.687  49.329  9.692   1.00 27.14  ? 198 TYR A C   1 
ATOM   1368  O O   . TYR A 1 172 ? 23.744  50.470  9.214   1.00 24.68  ? 198 TYR A O   1 
ATOM   1369  C CB  . TYR A 1 172 ? 24.552  49.892  11.957  1.00 27.50  ? 198 TYR A CB  1 
ATOM   1370  C CG  . TYR A 1 172 ? 25.345  49.509  13.177  1.00 25.36  ? 198 TYR A CG  1 
ATOM   1371  C CD1 . TYR A 1 172 ? 24.810  48.658  14.135  1.00 25.40  ? 198 TYR A CD1 1 
ATOM   1372  C CD2 . TYR A 1 172 ? 26.648  49.968  13.356  1.00 25.61  ? 198 TYR A CD2 1 
ATOM   1373  C CE1 . TYR A 1 172 ? 25.550  48.269  15.245  1.00 27.15  ? 198 TYR A CE1 1 
ATOM   1374  C CE2 . TYR A 1 172 ? 27.402  49.582  14.463  1.00 27.27  ? 198 TYR A CE2 1 
ATOM   1375  C CZ  . TYR A 1 172 ? 26.845  48.731  15.403  1.00 26.57  ? 198 TYR A CZ  1 
ATOM   1376  O OH  . TYR A 1 172 ? 27.578  48.330  16.492  1.00 29.30  ? 198 TYR A OH  1 
ATOM   1377  N N   . GLN A 1 173 ? 22.796  48.423  9.306   1.00 25.70  ? 199 GLN A N   1 
ATOM   1378  C CA  . GLN A 1 173 ? 21.792  48.728  8.298   1.00 25.28  ? 199 GLN A CA  1 
ATOM   1379  C C   . GLN A 1 173 ? 20.528  49.163  9.044   1.00 27.07  ? 199 GLN A C   1 
ATOM   1380  O O   . GLN A 1 173 ? 20.060  48.473  9.950   1.00 27.44  ? 199 GLN A O   1 
ATOM   1381  C CB  . GLN A 1 173 ? 21.503  47.503  7.441   1.00 23.41  ? 199 GLN A CB  1 
ATOM   1382  C CG  . GLN A 1 173 ? 20.568  47.794  6.304   1.00 26.13  ? 199 GLN A CG  1 
ATOM   1383  C CD  . GLN A 1 173 ? 20.341  46.592  5.426   1.00 27.39  ? 199 GLN A CD  1 
ATOM   1384  O OE1 . GLN A 1 173 ? 21.281  46.038  4.877   1.00 31.71  ? 199 GLN A OE1 1 
ATOM   1385  N NE2 . GLN A 1 173 ? 19.087  46.184  5.284   1.00 30.38  ? 199 GLN A NE2 1 
ATOM   1386  N N   . TRP A 1 174 ? 19.989  50.312  8.658   1.00 26.03  ? 200 TRP A N   1 
ATOM   1387  C CA  . TRP A 1 174 ? 18.808  50.882  9.287   1.00 25.67  ? 200 TRP A CA  1 
ATOM   1388  C C   . TRP A 1 174 ? 17.805  51.213  8.185   1.00 25.10  ? 200 TRP A C   1 
ATOM   1389  O O   . TRP A 1 174 ? 18.170  51.814  7.178   1.00 24.32  ? 200 TRP A O   1 
ATOM   1390  C CB  . TRP A 1 174 ? 19.222  52.156  10.040  1.00 27.23  ? 200 TRP A CB  1 
ATOM   1391  C CG  . TRP A 1 174 ? 18.117  52.923  10.738  1.00 29.07  ? 200 TRP A CG  1 
ATOM   1392  C CD1 . TRP A 1 174 ? 17.865  52.963  12.086  1.00 28.00  ? 200 TRP A CD1 1 
ATOM   1393  C CD2 . TRP A 1 174 ? 17.155  53.791  10.130  1.00 29.66  ? 200 TRP A CD2 1 
ATOM   1394  N NE1 . TRP A 1 174 ? 16.811  53.805  12.350  1.00 24.77  ? 200 TRP A NE1 1 
ATOM   1395  C CE2 . TRP A 1 174 ? 16.354  54.327  11.168  1.00 28.68  ? 200 TRP A CE2 1 
ATOM   1396  C CE3 . TRP A 1 174 ? 16.886  54.171  8.804   1.00 29.08  ? 200 TRP A CE3 1 
ATOM   1397  C CZ2 . TRP A 1 174 ? 15.306  55.223  10.923  1.00 28.54  ? 200 TRP A CZ2 1 
ATOM   1398  C CZ3 . TRP A 1 174 ? 15.845  55.061  8.561   1.00 29.04  ? 200 TRP A CZ3 1 
ATOM   1399  C CH2 . TRP A 1 174 ? 15.067  55.576  9.619   1.00 30.26  ? 200 TRP A CH2 1 
ATOM   1400  N N   . CYS A 1 175 ? 16.548  50.815  8.360   1.00 23.62  ? 201 CYS A N   1 
ATOM   1401  C CA  . CYS A 1 175 ? 15.534  51.111  7.353   1.00 24.04  ? 201 CYS A CA  1 
ATOM   1402  C C   . CYS A 1 175 ? 14.345  51.814  7.983   1.00 24.12  ? 201 CYS A C   1 
ATOM   1403  O O   . CYS A 1 175 ? 13.893  51.443  9.058   1.00 22.60  ? 201 CYS A O   1 
ATOM   1404  C CB  . CYS A 1 175 ? 15.053  49.838  6.664   1.00 23.50  ? 201 CYS A CB  1 
ATOM   1405  S SG  . CYS A 1 175 ? 16.246  48.962  5.590   1.00 24.96  ? 201 CYS A SG  1 
ATOM   1406  N N   . GLY A 1 176 ? 13.846  52.831  7.292   1.00 27.31  ? 202 GLY A N   1 
ATOM   1407  C CA  . GLY A 1 176 ? 12.720  53.599  7.784   1.00 30.05  ? 202 GLY A CA  1 
ATOM   1408  C C   . GLY A 1 176 ? 11.486  52.762  8.030   1.00 32.88  ? 202 GLY A C   1 
ATOM   1409  O O   . GLY A 1 176 ? 11.341  51.669  7.491   1.00 33.08  ? 202 GLY A O   1 
ATOM   1410  N N   . SER A 1 177 ? 10.588  53.286  8.853   1.00 35.50  ? 203 SER A N   1 
ATOM   1411  C CA  . SER A 1 177 ? 9.352   52.598  9.191   1.00 35.68  ? 203 SER A CA  1 
ATOM   1412  C C   . SER A 1 177 ? 8.445   52.411  7.975   1.00 36.26  ? 203 SER A C   1 
ATOM   1413  O O   . SER A 1 177 ? 7.620   51.500  7.951   1.00 36.77  ? 203 SER A O   1 
ATOM   1414  C CB  . SER A 1 177 ? 8.617   53.389  10.265  1.00 34.09  ? 203 SER A CB  1 
ATOM   1415  O OG  . SER A 1 177 ? 8.521   54.749  9.884   1.00 35.98  ? 203 SER A OG  1 
ATOM   1416  N N   . LYS A 1 178 ? 8.601   53.277  6.974   1.00 36.22  ? 204 LYS A N   1 
ATOM   1417  C CA  . LYS A 1 178 ? 7.794   53.209  5.759   1.00 35.34  ? 204 LYS A CA  1 
ATOM   1418  C C   . LYS A 1 178 ? 8.553   52.578  4.595   1.00 36.00  ? 204 LYS A C   1 
ATOM   1419  O O   . LYS A 1 178 ? 8.230   52.815  3.428   1.00 34.65  ? 204 LYS A O   1 
ATOM   1420  C CB  . LYS A 1 178 ? 7.324   54.608  5.346   1.00 34.56  ? 204 LYS A CB  1 
ATOM   1421  C CG  . LYS A 1 178 ? 6.388   55.278  6.333   1.00 38.66  ? 204 LYS A CG  1 
ATOM   1422  C CD  . LYS A 1 178 ? 5.613   56.425  5.687   1.00 41.85  ? 204 LYS A CD  1 
ATOM   1423  C CE  . LYS A 1 178 ? 4.755   55.922  4.531   1.00 46.04  ? 204 LYS A CE  1 
ATOM   1424  N NZ  . LYS A 1 178 ? 3.979   57.010  3.886   1.00 49.56  ? 204 LYS A NZ  1 
ATOM   1425  N N   . SER A 1 179 ? 9.568   51.781  4.903   1.00 36.35  ? 205 SER A N   1 
ATOM   1426  C CA  . SER A 1 179 ? 10.337  51.135  3.851   1.00 37.14  ? 205 SER A CA  1 
ATOM   1427  C C   . SER A 1 179 ? 9.634   49.842  3.477   1.00 38.06  ? 205 SER A C   1 
ATOM   1428  O O   . SER A 1 179 ? 9.042   49.184  4.329   1.00 36.65  ? 205 SER A O   1 
ATOM   1429  C CB  . SER A 1 179 ? 11.756  50.822  4.326   1.00 35.19  ? 205 SER A CB  1 
ATOM   1430  O OG  . SER A 1 179 ? 11.745  49.762  5.266   1.00 34.06  ? 205 SER A OG  1 
ATOM   1431  N N   . ASN A 1 180 ? 9.706   49.494  2.198   1.00 40.27  ? 206 ASN A N   1 
ATOM   1432  C CA  . ASN A 1 180 ? 9.100   48.280  1.671   1.00 41.71  ? 206 ASN A CA  1 
ATOM   1433  C C   . ASN A 1 180 ? 10.087  47.117  1.859   1.00 40.33  ? 206 ASN A C   1 
ATOM   1434  O O   . ASN A 1 180 ? 11.300  47.316  1.813   1.00 40.40  ? 206 ASN A O   1 
ATOM   1435  C CB  . ASN A 1 180 ? 8.790   48.484  0.186   1.00 48.16  ? 206 ASN A CB  1 
ATOM   1436  C CG  . ASN A 1 180 ? 7.748   47.516  -0.331  1.00 56.52  ? 206 ASN A CG  1 
ATOM   1437  O OD1 . ASN A 1 180 ? 7.949   46.297  -0.323  1.00 58.86  ? 206 ASN A OD1 1 
ATOM   1438  N ND2 . ASN A 1 180 ? 6.617   48.056  -0.787  1.00 58.31  ? 206 ASN A ND2 1 
ATOM   1439  N N   . ARG A 1 181 ? 9.575   45.909  2.072   1.00 37.90  ? 207 ARG A N   1 
ATOM   1440  C CA  . ARG A 1 181 ? 10.439  44.743  2.267   1.00 37.33  ? 207 ARG A CA  1 
ATOM   1441  C C   . ARG A 1 181 ? 11.415  44.510  1.112   1.00 35.72  ? 207 ARG A C   1 
ATOM   1442  O O   . ARG A 1 181 ? 12.561  44.107  1.335   1.00 36.98  ? 207 ARG A O   1 
ATOM   1443  C CB  . ARG A 1 181 ? 9.602   43.477  2.480   1.00 38.34  ? 207 ARG A CB  1 
ATOM   1444  C CG  . ARG A 1 181 ? 8.633   43.551  3.651   1.00 44.20  ? 207 ARG A CG  1 
ATOM   1445  C CD  . ARG A 1 181 ? 7.896   42.233  3.840   1.00 46.18  ? 207 ARG A CD  1 
ATOM   1446  N NE  . ARG A 1 181 ? 8.742   41.202  4.437   1.00 49.94  ? 207 ARG A NE  1 
ATOM   1447  C CZ  . ARG A 1 181 ? 9.175   41.226  5.696   1.00 51.15  ? 207 ARG A CZ  1 
ATOM   1448  N NH1 . ARG A 1 181 ? 8.844   42.232  6.500   1.00 52.38  ? 207 ARG A NH1 1 
ATOM   1449  N NH2 . ARG A 1 181 ? 9.937   40.241  6.157   1.00 51.83  ? 207 ARG A NH2 1 
ATOM   1450  N N   . PHE A 1 182 ? 10.968  44.755  -0.117  1.00 32.62  ? 208 PHE A N   1 
ATOM   1451  C CA  . PHE A 1 182 ? 11.821  44.555  -1.280  1.00 31.34  ? 208 PHE A CA  1 
ATOM   1452  C C   . PHE A 1 182 ? 13.019  45.513  -1.233  1.00 31.56  ? 208 PHE A C   1 
ATOM   1453  O O   . PHE A 1 182 ? 14.147  45.128  -1.536  1.00 29.42  ? 208 PHE A O   1 
ATOM   1454  C CB  . PHE A 1 182 ? 11.019  44.764  -2.568  1.00 30.21  ? 208 PHE A CB  1 
ATOM   1455  C CG  . PHE A 1 182 ? 11.731  44.289  -3.811  1.00 31.88  ? 208 PHE A CG  1 
ATOM   1456  C CD1 . PHE A 1 182 ? 11.946  42.933  -4.031  1.00 33.08  ? 208 PHE A CD1 1 
ATOM   1457  C CD2 . PHE A 1 182 ? 12.185  45.200  -4.765  1.00 31.89  ? 208 PHE A CD2 1 
ATOM   1458  C CE1 . PHE A 1 182 ? 12.605  42.487  -5.187  1.00 32.95  ? 208 PHE A CE1 1 
ATOM   1459  C CE2 . PHE A 1 182 ? 12.842  44.767  -5.918  1.00 32.02  ? 208 PHE A CE2 1 
ATOM   1460  C CZ  . PHE A 1 182 ? 13.051  43.408  -6.129  1.00 33.07  ? 208 PHE A CZ  1 
ATOM   1461  N N   . GLU A 1 183 ? 12.762  46.760  -0.852  1.00 33.66  ? 209 GLU A N   1 
ATOM   1462  C CA  . GLU A 1 183 ? 13.807  47.774  -0.727  1.00 34.04  ? 209 GLU A CA  1 
ATOM   1463  C C   . GLU A 1 183 ? 14.863  47.341  0.303   1.00 32.46  ? 209 GLU A C   1 
ATOM   1464  O O   . GLU A 1 183 ? 16.067  47.494  0.083   1.00 32.05  ? 209 GLU A O   1 
ATOM   1465  C CB  . GLU A 1 183 ? 13.180  49.113  -0.311  1.00 37.18  ? 209 GLU A CB  1 
ATOM   1466  C CG  . GLU A 1 183 ? 12.441  49.821  -1.439  1.00 43.85  ? 209 GLU A CG  1 
ATOM   1467  C CD  . GLU A 1 183 ? 11.498  50.920  -0.954  1.00 50.62  ? 209 GLU A CD  1 
ATOM   1468  O OE1 . GLU A 1 183 ? 10.923  51.603  -1.827  1.00 53.31  ? 209 GLU A OE1 1 
ATOM   1469  O OE2 . GLU A 1 183 ? 11.320  51.100  0.279   1.00 49.70  ? 209 GLU A OE2 1 
ATOM   1470  N N   . ARG A 1 184 ? 14.402  46.806  1.430   1.00 30.68  ? 210 ARG A N   1 
ATOM   1471  C CA  . ARG A 1 184 ? 15.296  46.341  2.482   1.00 30.52  ? 210 ARG A CA  1 
ATOM   1472  C C   . ARG A 1 184 ? 16.119  45.157  1.993   1.00 29.85  ? 210 ARG A C   1 
ATOM   1473  O O   . ARG A 1 184 ? 17.258  44.956  2.412   1.00 29.61  ? 210 ARG A O   1 
ATOM   1474  C CB  . ARG A 1 184 ? 14.493  45.916  3.707   1.00 30.83  ? 210 ARG A CB  1 
ATOM   1475  C CG  . ARG A 1 184 ? 13.606  46.994  4.255   1.00 31.93  ? 210 ARG A CG  1 
ATOM   1476  C CD  . ARG A 1 184 ? 12.882  46.486  5.467   1.00 35.22  ? 210 ARG A CD  1 
ATOM   1477  N NE  . ARG A 1 184 ? 11.631  47.199  5.649   1.00 40.21  ? 210 ARG A NE  1 
ATOM   1478  C CZ  . ARG A 1 184 ? 10.646  46.778  6.429   1.00 43.56  ? 210 ARG A CZ  1 
ATOM   1479  N NH1 . ARG A 1 184 ? 10.771  45.639  7.107   1.00 43.22  ? 210 ARG A NH1 1 
ATOM   1480  N NH2 . ARG A 1 184 ? 9.529   47.488  6.511   1.00 45.98  ? 210 ARG A NH2 1 
ATOM   1481  N N   . LEU A 1 185 ? 15.525  44.354  1.120   1.00 28.10  ? 211 LEU A N   1 
ATOM   1482  C CA  . LEU A 1 185 ? 16.224  43.212  0.566   1.00 27.19  ? 211 LEU A CA  1 
ATOM   1483  C C   . LEU A 1 185 ? 17.411  43.767  -0.209  1.00 25.19  ? 211 LEU A C   1 
ATOM   1484  O O   . LEU A 1 185 ? 18.543  43.322  -0.035  1.00 26.41  ? 211 LEU A O   1 
ATOM   1485  C CB  . LEU A 1 185 ? 15.299  42.431  -0.364  1.00 28.90  ? 211 LEU A CB  1 
ATOM   1486  C CG  . LEU A 1 185 ? 15.947  41.246  -1.075  1.00 29.48  ? 211 LEU A CG  1 
ATOM   1487  C CD1 . LEU A 1 185 ? 16.414  40.227  -0.050  1.00 28.71  ? 211 LEU A CD1 1 
ATOM   1488  C CD2 . LEU A 1 185 ? 14.946  40.640  -2.042  1.00 32.12  ? 211 LEU A CD2 1 
ATOM   1489  N N   . LYS A 1 186 ? 17.137  44.751  -1.060  1.00 25.83  ? 212 LYS A N   1 
ATOM   1490  C CA  . LYS A 1 186 ? 18.174  45.403  -1.857  1.00 28.27  ? 212 LYS A CA  1 
ATOM   1491  C C   . LYS A 1 186 ? 19.249  46.042  -0.983  1.00 25.86  ? 212 LYS A C   1 
ATOM   1492  O O   . LYS A 1 186 ? 20.437  45.892  -1.259  1.00 25.48  ? 212 LYS A O   1 
ATOM   1493  C CB  . LYS A 1 186 ? 17.563  46.476  -2.768  1.00 28.91  ? 212 LYS A CB  1 
ATOM   1494  C CG  . LYS A 1 186 ? 16.741  45.911  -3.923  1.00 36.08  ? 212 LYS A CG  1 
ATOM   1495  C CD  . LYS A 1 186 ? 17.584  45.005  -4.811  1.00 38.90  ? 212 LYS A CD  1 
ATOM   1496  C CE  . LYS A 1 186 ? 16.765  44.406  -5.940  1.00 43.84  ? 212 LYS A CE  1 
ATOM   1497  N NZ  . LYS A 1 186 ? 17.572  43.500  -6.808  1.00 45.13  ? 212 LYS A NZ  1 
ATOM   1498  N N   . ALA A 1 187 ? 18.832  46.754  0.063   1.00 23.26  ? 213 ALA A N   1 
ATOM   1499  C CA  . ALA A 1 187 ? 19.775  47.418  0.966   1.00 23.38  ? 213 ALA A CA  1 
ATOM   1500  C C   . ALA A 1 187 ? 20.778  46.415  1.522   1.00 24.53  ? 213 ALA A C   1 
ATOM   1501  O O   . ALA A 1 187 ? 21.974  46.695  1.637   1.00 20.89  ? 213 ALA A O   1 
ATOM   1502  C CB  . ALA A 1 187 ? 19.024  48.086  2.110   1.00 20.12  ? 213 ALA A CB  1 
ATOM   1503  N N   . THR A 1 188 ? 20.269  45.234  1.847   1.00 25.59  ? 214 THR A N   1 
ATOM   1504  C CA  . THR A 1 188 ? 21.071  44.163  2.402   1.00 28.05  ? 214 THR A CA  1 
ATOM   1505  C C   . THR A 1 188 ? 22.206  43.724  1.476   1.00 28.19  ? 214 THR A C   1 
ATOM   1506  O O   . THR A 1 188 ? 23.286  43.353  1.941   1.00 27.48  ? 214 THR A O   1 
ATOM   1507  C CB  . THR A 1 188 ? 20.162  42.964  2.748   1.00 29.35  ? 214 THR A CB  1 
ATOM   1508  O OG1 . THR A 1 188 ? 19.175  43.386  3.699   1.00 32.02  ? 214 THR A OG1 1 
ATOM   1509  C CG2 . THR A 1 188 ? 20.958  41.840  3.349   1.00 31.65  ? 214 THR A CG2 1 
ATOM   1510  N N   . GLN A 1 189 ? 21.975  43.764  0.168   1.00 28.79  ? 215 GLN A N   1 
ATOM   1511  C CA  . GLN A 1 189 ? 23.017  43.364  -0.767  1.00 29.68  ? 215 GLN A CA  1 
ATOM   1512  C C   . GLN A 1 189 ? 24.195  44.345  -0.752  1.00 27.67  ? 215 GLN A C   1 
ATOM   1513  O O   . GLN A 1 189 ? 25.345  43.956  -0.969  1.00 26.24  ? 215 GLN A O   1 
ATOM   1514  C CB  . GLN A 1 189 ? 22.441  43.246  -2.173  1.00 35.13  ? 215 GLN A CB  1 
ATOM   1515  C CG  . GLN A 1 189 ? 21.386  42.160  -2.319  1.00 44.28  ? 215 GLN A CG  1 
ATOM   1516  C CD  . GLN A 1 189 ? 21.065  41.865  -3.778  1.00 49.68  ? 215 GLN A CD  1 
ATOM   1517  O OE1 . GLN A 1 189 ? 20.634  42.748  -4.526  1.00 51.75  ? 215 GLN A OE1 1 
ATOM   1518  N NE2 . GLN A 1 189 ? 21.284  40.620  -4.192  1.00 53.56  ? 215 GLN A NE2 1 
ATOM   1519  N N   . VAL A 1 190 ? 23.899  45.618  -0.496  1.00 26.08  ? 216 VAL A N   1 
ATOM   1520  C CA  . VAL A 1 190 ? 24.931  46.649  -0.420  1.00 24.87  ? 216 VAL A CA  1 
ATOM   1521  C C   . VAL A 1 190 ? 25.773  46.424  0.840   1.00 23.48  ? 216 VAL A C   1 
ATOM   1522  O O   . VAL A 1 190 ? 27.000  46.516  0.798   1.00 23.73  ? 216 VAL A O   1 
ATOM   1523  C CB  . VAL A 1 190 ? 24.302  48.068  -0.376  1.00 23.82  ? 216 VAL A CB  1 
ATOM   1524  C CG1 . VAL A 1 190 ? 25.392  49.140  -0.281  1.00 21.92  ? 216 VAL A CG1 1 
ATOM   1525  C CG2 . VAL A 1 190 ? 23.457  48.295  -1.627  1.00 22.40  ? 216 VAL A CG2 1 
ATOM   1526  N N   . SER A 1 191 ? 25.103  46.119  1.947   1.00 23.16  ? 217 SER A N   1 
ATOM   1527  C CA  . SER A 1 191 ? 25.762  45.864  3.227   1.00 23.73  ? 217 SER A CA  1 
ATOM   1528  C C   . SER A 1 191 ? 26.657  44.629  3.141   1.00 24.82  ? 217 SER A C   1 
ATOM   1529  O O   . SER A 1 191 ? 27.786  44.619  3.645   1.00 24.67  ? 217 SER A O   1 
ATOM   1530  C CB  . SER A 1 191 ? 24.714  45.649  4.327   1.00 24.87  ? 217 SER A CB  1 
ATOM   1531  O OG  . SER A 1 191 ? 23.922  46.808  4.539   1.00 26.50  ? 217 SER A OG  1 
ATOM   1532  N N   . LYS A 1 192 ? 26.138  43.585  2.506   1.00 26.33  ? 218 LYS A N   1 
ATOM   1533  C CA  . LYS A 1 192 ? 26.872  42.333  2.339   1.00 28.04  ? 218 LYS A CA  1 
ATOM   1534  C C   . LYS A 1 192 ? 28.077  42.609  1.445   1.00 24.70  ? 218 LYS A C   1 
ATOM   1535  O O   . LYS A 1 192 ? 29.181  42.109  1.681   1.00 23.61  ? 218 LYS A O   1 
ATOM   1536  C CB  . LYS A 1 192 ? 25.945  41.291  1.700   1.00 34.94  ? 218 LYS A CB  1 
ATOM   1537  C CG  . LYS A 1 192 ? 26.525  39.903  1.517   1.00 43.82  ? 218 LYS A CG  1 
ATOM   1538  C CD  . LYS A 1 192 ? 25.434  38.920  1.066   1.00 52.76  ? 218 LYS A CD  1 
ATOM   1539  C CE  . LYS A 1 192 ? 24.254  38.906  2.063   1.00 59.31  ? 218 LYS A CE  1 
ATOM   1540  N NZ  . LYS A 1 192 ? 23.096  38.033  1.672   1.00 60.48  ? 218 LYS A NZ  1 
ATOM   1541  N N   . GLY A 1 193 ? 27.856  43.425  0.420   1.00 22.08  ? 219 GLY A N   1 
ATOM   1542  C CA  . GLY A 1 193 ? 28.930  43.771  -0.484  1.00 21.92  ? 219 GLY A CA  1 
ATOM   1543  C C   . GLY A 1 193 ? 30.063  44.478  0.241   1.00 21.73  ? 219 GLY A C   1 
ATOM   1544  O O   . GLY A 1 193 ? 31.242  44.203  -0.009  1.00 18.04  ? 219 GLY A O   1 
ATOM   1545  N N   . ILE A 1 194 ? 29.714  45.386  1.145   1.00 20.27  ? 220 ILE A N   1 
ATOM   1546  C CA  . ILE A 1 194 ? 30.735  46.108  1.888   1.00 22.98  ? 220 ILE A CA  1 
ATOM   1547  C C   . ILE A 1 194 ? 31.492  45.133  2.785   1.00 25.09  ? 220 ILE A C   1 
ATOM   1548  O O   . ILE A 1 194 ? 32.713  45.207  2.896   1.00 22.87  ? 220 ILE A O   1 
ATOM   1549  C CB  . ILE A 1 194 ? 30.130  47.217  2.758   1.00 20.85  ? 220 ILE A CB  1 
ATOM   1550  C CG1 . ILE A 1 194 ? 29.373  48.214  1.879   1.00 20.03  ? 220 ILE A CG1 1 
ATOM   1551  C CG2 . ILE A 1 194 ? 31.237  47.887  3.554   1.00 16.62  ? 220 ILE A CG2 1 
ATOM   1552  C CD1 . ILE A 1 194 ? 28.572  49.220  2.642   1.00 27.02  ? 220 ILE A CD1 1 
ATOM   1553  N N   . ARG A 1 195 ? 30.757  44.227  3.424   1.00 25.02  ? 221 ARG A N   1 
ATOM   1554  C CA  . ARG A 1 195 ? 31.364  43.236  4.294   1.00 25.59  ? 221 ARG A CA  1 
ATOM   1555  C C   . ARG A 1 195 ? 32.332  42.366  3.512   1.00 27.18  ? 221 ARG A C   1 
ATOM   1556  O O   . ARG A 1 195 ? 33.484  42.175  3.909   1.00 26.22  ? 221 ARG A O   1 
ATOM   1557  C CB  . ARG A 1 195 ? 30.301  42.324  4.902   1.00 28.02  ? 221 ARG A CB  1 
ATOM   1558  C CG  . ARG A 1 195 ? 30.875  41.278  5.869   1.00 29.82  ? 221 ARG A CG  1 
ATOM   1559  C CD  . ARG A 1 195 ? 29.859  40.204  6.217   1.00 28.46  ? 221 ARG A CD  1 
ATOM   1560  N NE  . ARG A 1 195 ? 29.583  39.369  5.055   1.00 35.47  ? 221 ARG A NE  1 
ATOM   1561  C CZ  . ARG A 1 195 ? 28.677  38.397  5.020   1.00 37.96  ? 221 ARG A CZ  1 
ATOM   1562  N NH1 . ARG A 1 195 ? 27.938  38.125  6.090   1.00 37.20  ? 221 ARG A NH1 1 
ATOM   1563  N NH2 . ARG A 1 195 ? 28.508  37.700  3.906   1.00 38.11  ? 221 ARG A NH2 1 
ATOM   1564  N N   . ASP A 1 196 ? 31.859  41.845  2.387   1.00 27.43  ? 222 ASP A N   1 
ATOM   1565  C CA  . ASP A 1 196 ? 32.670  40.954  1.576   1.00 28.77  ? 222 ASP A CA  1 
ATOM   1566  C C   . ASP A 1 196 ? 33.747  41.574  0.689   1.00 27.59  ? 222 ASP A C   1 
ATOM   1567  O O   . ASP A 1 196 ? 34.877  41.095  0.680   1.00 28.40  ? 222 ASP A O   1 
ATOM   1568  C CB  . ASP A 1 196 ? 31.740  40.069  0.742   1.00 29.65  ? 222 ASP A CB  1 
ATOM   1569  C CG  . ASP A 1 196 ? 30.865  39.169  1.610   1.00 32.60  ? 222 ASP A CG  1 
ATOM   1570  O OD1 . ASP A 1 196 ? 29.819  38.702  1.107   1.00 34.24  ? 222 ASP A OD1 1 
ATOM   1571  O OD2 . ASP A 1 196 ? 31.221  38.925  2.789   1.00 27.82  ? 222 ASP A OD2 1 
ATOM   1572  N N   . ASN A 1 197 ? 33.416  42.636  -0.036  1.00 29.18  ? 223 ASN A N   1 
ATOM   1573  C CA  . ASN A 1 197 ? 34.373  43.273  -0.939  1.00 29.71  ? 223 ASN A CA  1 
ATOM   1574  C C   . ASN A 1 197 ? 35.394  44.185  -0.283  1.00 31.28  ? 223 ASN A C   1 
ATOM   1575  O O   . ASN A 1 197 ? 36.554  44.221  -0.694  1.00 34.25  ? 223 ASN A O   1 
ATOM   1576  C CB  . ASN A 1 197 ? 33.610  43.991  -2.036  1.00 31.66  ? 223 ASN A CB  1 
ATOM   1577  C CG  . ASN A 1 197 ? 32.741  43.039  -2.819  1.00 33.18  ? 223 ASN A CG  1 
ATOM   1578  O OD1 . ASN A 1 197 ? 33.202  41.974  -3.216  1.00 34.71  ? 223 ASN A OD1 1 
ATOM   1579  N ND2 . ASN A 1 197 ? 31.483  43.404  -3.039  1.00 34.82  ? 223 ASN A ND2 1 
ATOM   1580  N N   . GLU A 1 198 ? 34.960  44.942  0.715   1.00 32.90  ? 224 GLU A N   1 
ATOM   1581  C CA  . GLU A 1 198 ? 35.859  45.797  1.496   1.00 34.12  ? 224 GLU A CA  1 
ATOM   1582  C C   . GLU A 1 198 ? 35.847  44.961  2.782   1.00 37.34  ? 224 GLU A C   1 
ATOM   1583  O O   . GLU A 1 198 ? 34.959  44.123  2.945   1.00 42.55  ? 224 GLU A O   1 
ATOM   1584  C CB  . GLU A 1 198 ? 35.225  47.176  1.741   1.00 30.77  ? 224 GLU A CB  1 
ATOM   1585  C CG  . GLU A 1 198 ? 34.854  47.938  0.472   1.00 27.85  ? 224 GLU A CG  1 
ATOM   1586  C CD  . GLU A 1 198 ? 34.253  49.321  0.739   1.00 30.80  ? 224 GLU A CD  1 
ATOM   1587  O OE1 . GLU A 1 198 ? 33.007  49.474  0.692   1.00 25.68  ? 224 GLU A OE1 1 
ATOM   1588  O OE2 . GLU A 1 198 ? 35.038  50.262  0.999   1.00 34.49  ? 224 GLU A OE2 1 
ATOM   1589  N N   . ARG A 1 199 ? 36.797  45.131  3.685   1.00 35.31  ? 225 ARG A N   1 
ATOM   1590  C CA  . ARG A 1 199 ? 36.768  44.328  4.918   1.00 35.31  ? 225 ARG A CA  1 
ATOM   1591  C C   . ARG A 1 199 ? 37.015  42.826  4.682   1.00 36.29  ? 225 ARG A C   1 
ATOM   1592  O O   . ARG A 1 199 ? 37.433  42.110  5.590   1.00 38.15  ? 225 ARG A O   1 
ATOM   1593  C CB  . ARG A 1 199 ? 35.423  44.509  5.652   1.00 30.05  ? 225 ARG A CB  1 
ATOM   1594  C CG  . ARG A 1 199 ? 34.846  45.922  5.581   1.00 28.44  ? 225 ARG A CG  1 
ATOM   1595  C CD  . ARG A 1 199 ? 35.842  46.982  6.069   1.00 28.86  ? 225 ARG A CD  1 
ATOM   1596  N NE  . ARG A 1 199 ? 35.608  48.293  5.458   1.00 27.39  ? 225 ARG A NE  1 
ATOM   1597  C CZ  . ARG A 1 199 ? 34.573  49.086  5.730   1.00 29.39  ? 225 ARG A CZ  1 
ATOM   1598  N NH1 . ARG A 1 199 ? 33.652  48.715  6.621   1.00 26.68  ? 225 ARG A NH1 1 
ATOM   1599  N NH2 . ARG A 1 199 ? 34.448  50.248  5.096   1.00 27.26  ? 225 ARG A NH2 1 
ATOM   1600  N N   . SER A 1 200 ? 36.739  42.342  3.476   1.00 37.73  ? 226 SER A N   1 
ATOM   1601  C CA  . SER A 1 200 ? 36.966  40.933  3.152   1.00 39.50  ? 226 SER A CA  1 
ATOM   1602  C C   . SER A 1 200 ? 36.291  39.902  4.068   1.00 39.01  ? 226 SER A C   1 
ATOM   1603  O O   . SER A 1 200 ? 36.942  38.988  4.573   1.00 39.83  ? 226 SER A O   1 
ATOM   1604  C CB  . SER A 1 200 ? 38.468  40.655  3.116   1.00 40.75  ? 226 SER A CB  1 
ATOM   1605  O OG  . SER A 1 200 ? 39.097  41.471  2.142   1.00 47.94  ? 226 SER A OG  1 
ATOM   1606  N N   . GLY A 1 201 ? 34.987  40.042  4.266   1.00 38.10  ? 227 GLY A N   1 
ATOM   1607  C CA  . GLY A 1 201 ? 34.258  39.100  5.093   1.00 37.59  ? 227 GLY A CA  1 
ATOM   1608  C C   . GLY A 1 201 ? 34.446  39.248  6.589   1.00 39.17  ? 227 GLY A C   1 
ATOM   1609  O O   . GLY A 1 201 ? 33.715  38.636  7.366   1.00 37.53  ? 227 GLY A O   1 
ATOM   1610  N N   . ARG A 1 202 ? 35.418  40.058  6.997   1.00 41.49  ? 228 ARG A N   1 
ATOM   1611  C CA  . ARG A 1 202 ? 35.690  40.270  8.414   1.00 42.79  ? 228 ARG A CA  1 
ATOM   1612  C C   . ARG A 1 202 ? 34.985  41.533  8.919   1.00 42.31  ? 228 ARG A C   1 
ATOM   1613  O O   . ARG A 1 202 ? 35.620  42.570  9.104   1.00 45.97  ? 228 ARG A O   1 
ATOM   1614  C CB  . ARG A 1 202 ? 37.198  40.404  8.630   1.00 47.64  ? 228 ARG A CB  1 
ATOM   1615  C CG  . ARG A 1 202 ? 38.025  39.358  7.917   1.00 56.07  ? 228 ARG A CG  1 
ATOM   1616  C CD  . ARG A 1 202 ? 39.499  39.510  8.228   1.00 61.97  ? 228 ARG A CD  1 
ATOM   1617  N NE  . ARG A 1 202 ? 39.790  39.227  9.633   1.00 71.49  ? 228 ARG A NE  1 
ATOM   1618  C CZ  . ARG A 1 202 ? 39.638  40.093  10.635  1.00 75.95  ? 228 ARG A CZ  1 
ATOM   1619  N NH1 . ARG A 1 202 ? 39.194  41.324  10.404  1.00 78.45  ? 228 ARG A NH1 1 
ATOM   1620  N NH2 . ARG A 1 202 ? 39.939  39.728  11.876  1.00 77.93  ? 228 ARG A NH2 1 
ATOM   1621  N N   . ALA A 1 203 ? 33.682  41.442  9.144   1.00 38.86  ? 229 ALA A N   1 
ATOM   1622  C CA  . ALA A 1 203 ? 32.906  42.572  9.612   1.00 36.29  ? 229 ALA A CA  1 
ATOM   1623  C C   . ALA A 1 203 ? 31.520  42.072  9.981   1.00 36.30  ? 229 ALA A C   1 
ATOM   1624  O O   . ALA A 1 203 ? 30.987  41.158  9.355   1.00 36.37  ? 229 ALA A O   1 
ATOM   1625  C CB  . ALA A 1 203 ? 32.825  43.631  8.536   1.00 34.89  ? 229 ALA A CB  1 
ATOM   1626  N N   . GLN A 1 204 ? 30.954  42.654  11.026  1.00 35.85  ? 230 GLN A N   1 
ATOM   1627  C CA  . GLN A 1 204 ? 29.652  42.279  11.509  1.00 34.06  ? 230 GLN A CA  1 
ATOM   1628  C C   . GLN A 1 204 ? 28.573  43.178  10.912  1.00 31.15  ? 230 GLN A C   1 
ATOM   1629  O O   . GLN A 1 204 ? 28.696  44.403  10.888  1.00 28.71  ? 230 GLN A O   1 
ATOM   1630  C CB  . GLN A 1 204 ? 29.662  42.430  13.016  1.00 39.24  ? 230 GLN A CB  1 
ATOM   1631  C CG  . GLN A 1 204 ? 28.381  42.002  13.652  1.00 51.18  ? 230 GLN A CG  1 
ATOM   1632  C CD  . GLN A 1 204 ? 28.253  40.505  13.655  1.00 59.01  ? 230 GLN A CD  1 
ATOM   1633  O OE1 . GLN A 1 204 ? 29.175  39.786  13.267  1.00 64.15  ? 230 GLN A OE1 1 
ATOM   1634  N NE2 . GLN A 1 204 ? 27.108  39.995  14.105  1.00 60.93  ? 230 GLN A NE2 1 
ATOM   1635  N N   . VAL A 1 205 ? 27.521  42.550  10.403  1.00 28.62  ? 231 VAL A N   1 
ATOM   1636  C CA  . VAL A 1 205 ? 26.431  43.294  9.825   1.00 26.59  ? 231 VAL A CA  1 
ATOM   1637  C C   . VAL A 1 205 ? 25.197  42.976  10.632  1.00 27.25  ? 231 VAL A C   1 
ATOM   1638  O O   . VAL A 1 205 ? 24.835  41.808  10.811  1.00 27.18  ? 231 VAL A O   1 
ATOM   1639  C CB  . VAL A 1 205 ? 26.168  42.902  8.364   1.00 24.70  ? 231 VAL A CB  1 
ATOM   1640  C CG1 . VAL A 1 205 ? 24.970  43.661  7.829   1.00 24.33  ? 231 VAL A CG1 1 
ATOM   1641  C CG2 . VAL A 1 205 ? 27.379  43.201  7.502   1.00 26.26  ? 231 VAL A CG2 1 
ATOM   1642  N N   . SER A 1 206 ? 24.562  44.023  11.137  1.00 28.00  ? 232 SER A N   1 
ATOM   1643  C CA  . SER A 1 206 ? 23.348  43.855  11.891  1.00 30.54  ? 232 SER A CA  1 
ATOM   1644  C C   . SER A 1 206 ? 22.324  44.794  11.276  1.00 31.63  ? 232 SER A C   1 
ATOM   1645  O O   . SER A 1 206 ? 22.619  45.953  11.007  1.00 34.15  ? 232 SER A O   1 
ATOM   1646  C CB  . SER A 1 206 ? 23.584  44.186  13.362  1.00 30.92  ? 232 SER A CB  1 
ATOM   1647  O OG  . SER A 1 206 ? 24.153  45.471  13.508  1.00 39.34  ? 232 SER A OG  1 
ATOM   1648  N N   . VAL A 1 207 ? 21.130  44.282  11.022  1.00 32.24  ? 233 VAL A N   1 
ATOM   1649  C CA  . VAL A 1 207 ? 20.078  45.092  10.436  1.00 35.62  ? 233 VAL A CA  1 
ATOM   1650  C C   . VAL A 1 207 ? 19.068  45.516  11.508  1.00 35.00  ? 233 VAL A C   1 
ATOM   1651  O O   . VAL A 1 207 ? 18.733  44.742  12.397  1.00 36.56  ? 233 VAL A O   1 
ATOM   1652  C CB  . VAL A 1 207 ? 19.366  44.317  9.306   1.00 34.84  ? 233 VAL A CB  1 
ATOM   1653  C CG1 . VAL A 1 207 ? 18.740  43.064  9.865   1.00 39.95  ? 233 VAL A CG1 1 
ATOM   1654  C CG2 . VAL A 1 207 ? 18.318  45.199  8.645   1.00 34.04  ? 233 VAL A CG2 1 
ATOM   1655  N N   . PHE A 1 208 ? 18.595  46.754  11.418  1.00 36.65  ? 234 PHE A N   1 
ATOM   1656  C CA  . PHE A 1 208 ? 17.636  47.307  12.378  1.00 36.76  ? 234 PHE A CA  1 
ATOM   1657  C C   . PHE A 1 208 ? 16.543  48.084  11.667  1.00 35.59  ? 234 PHE A C   1 
ATOM   1658  O O   . PHE A 1 208 ? 16.758  48.618  10.584  1.00 36.06  ? 234 PHE A O   1 
ATOM   1659  C CB  . PHE A 1 208 ? 18.326  48.296  13.323  1.00 38.08  ? 234 PHE A CB  1 
ATOM   1660  C CG  . PHE A 1 208 ? 19.385  47.688  14.187  1.00 43.24  ? 234 PHE A CG  1 
ATOM   1661  C CD1 . PHE A 1 208 ? 19.049  47.042  15.376  1.00 43.87  ? 234 PHE A CD1 1 
ATOM   1662  C CD2 . PHE A 1 208 ? 20.727  47.783  13.829  1.00 43.26  ? 234 PHE A CD2 1 
ATOM   1663  C CE1 . PHE A 1 208 ? 20.038  46.502  16.200  1.00 44.50  ? 234 PHE A CE1 1 
ATOM   1664  C CE2 . PHE A 1 208 ? 21.724  47.244  14.646  1.00 42.79  ? 234 PHE A CE2 1 
ATOM   1665  C CZ  . PHE A 1 208 ? 21.381  46.606  15.832  1.00 43.26  ? 234 PHE A CZ  1 
ATOM   1666  N N   . GLU A 1 209 ? 15.377  48.169  12.290  1.00 36.18  ? 235 GLU A N   1 
ATOM   1667  C CA  . GLU A 1 209 ? 14.285  48.944  11.727  1.00 37.60  ? 235 GLU A CA  1 
ATOM   1668  C C   . GLU A 1 209 ? 14.132  50.191  12.596  1.00 36.63  ? 235 GLU A C   1 
ATOM   1669  O O   . GLU A 1 209 ? 14.545  50.200  13.757  1.00 35.13  ? 235 GLU A O   1 
ATOM   1670  C CB  . GLU A 1 209 ? 12.996  48.124  11.711  1.00 43.20  ? 235 GLU A CB  1 
ATOM   1671  C CG  . GLU A 1 209 ? 13.009  47.023  10.667  1.00 52.64  ? 235 GLU A CG  1 
ATOM   1672  C CD  . GLU A 1 209 ? 11.732  46.206  10.653  1.00 58.72  ? 235 GLU A CD  1 
ATOM   1673  O OE1 . GLU A 1 209 ? 10.641  46.803  10.512  1.00 63.75  ? 235 GLU A OE1 1 
ATOM   1674  O OE2 . GLU A 1 209 ? 11.819  44.965  10.776  1.00 62.41  ? 235 GLU A OE2 1 
ATOM   1675  N N   . GLU A 1 210 ? 13.566  51.250  12.030  1.00 36.35  ? 236 GLU A N   1 
ATOM   1676  C CA  . GLU A 1 210 ? 13.374  52.496  12.765  1.00 37.98  ? 236 GLU A CA  1 
ATOM   1677  C C   . GLU A 1 210 ? 12.693  52.245  14.111  1.00 39.17  ? 236 GLU A C   1 
ATOM   1678  O O   . GLU A 1 210 ? 11.677  51.545  14.186  1.00 40.52  ? 236 GLU A O   1 
ATOM   1679  C CB  . GLU A 1 210 ? 12.544  53.475  11.923  1.00 37.80  ? 236 GLU A CB  1 
ATOM   1680  C CG  . GLU A 1 210 ? 12.009  54.680  12.684  1.00 36.72  ? 236 GLU A CG  1 
ATOM   1681  C CD  . GLU A 1 210 ? 11.332  55.686  11.772  1.00 38.29  ? 236 GLU A CD  1 
ATOM   1682  O OE1 . GLU A 1 210 ? 10.864  55.286  10.684  1.00 37.45  ? 236 GLU A OE1 1 
ATOM   1683  O OE2 . GLU A 1 210 ? 11.259  56.877  12.147  1.00 40.73  ? 236 GLU A OE2 1 
ATOM   1684  N N   . GLY A 1 211 ? 13.259  52.817  15.170  1.00 39.58  ? 237 GLY A N   1 
ATOM   1685  C CA  . GLY A 1 211 ? 12.697  52.637  16.496  1.00 39.05  ? 237 GLY A CA  1 
ATOM   1686  C C   . GLY A 1 211 ? 13.487  51.645  17.333  1.00 39.15  ? 237 GLY A C   1 
ATOM   1687  O O   . GLY A 1 211 ? 13.223  51.470  18.521  1.00 40.30  ? 237 GLY A O   1 
ATOM   1688  N N   . ALA A 1 212 ? 14.464  50.991  16.719  1.00 38.02  ? 238 ALA A N   1 
ATOM   1689  C CA  . ALA A 1 212 ? 15.281  50.025  17.442  1.00 37.54  ? 238 ALA A CA  1 
ATOM   1690  C C   . ALA A 1 212 ? 16.769  50.299  17.236  1.00 36.04  ? 238 ALA A C   1 
ATOM   1691  O O   . ALA A 1 212 ? 17.575  49.370  17.187  1.00 35.86  ? 238 ALA A O   1 
ATOM   1692  C CB  . ALA A 1 212 ? 14.940  48.610  16.985  1.00 35.51  ? 238 ALA A CB  1 
ATOM   1693  N N   . GLU A 1 213 ? 17.136  51.573  17.126  1.00 34.65  ? 239 GLU A N   1 
ATOM   1694  C CA  . GLU A 1 213 ? 18.534  51.922  16.906  1.00 33.60  ? 239 GLU A CA  1 
ATOM   1695  C C   . GLU A 1 213 ? 19.411  51.564  18.097  1.00 31.45  ? 239 GLU A C   1 
ATOM   1696  O O   . GLU A 1 213 ? 19.112  51.925  19.233  1.00 33.45  ? 239 GLU A O   1 
ATOM   1697  C CB  . GLU A 1 213 ? 18.668  53.404  16.556  1.00 34.82  ? 239 GLU A CB  1 
ATOM   1698  C CG  . GLU A 1 213 ? 17.607  54.301  17.153  1.00 40.45  ? 239 GLU A CG  1 
ATOM   1699  C CD  . GLU A 1 213 ? 16.238  54.092  16.529  1.00 44.57  ? 239 GLU A CD  1 
ATOM   1700  O OE1 . GLU A 1 213 ? 16.086  54.295  15.301  1.00 42.01  ? 239 GLU A OE1 1 
ATOM   1701  O OE2 . GLU A 1 213 ? 15.310  53.722  17.277  1.00 49.68  ? 239 GLU A OE2 1 
ATOM   1702  N N   . PRO A 1 214 ? 20.512  50.834  17.845  1.00 28.97  ? 240 PRO A N   1 
ATOM   1703  C CA  . PRO A 1 214 ? 21.475  50.388  18.858  1.00 27.60  ? 240 PRO A CA  1 
ATOM   1704  C C   . PRO A 1 214 ? 22.267  51.528  19.496  1.00 26.05  ? 240 PRO A C   1 
ATOM   1705  O O   . PRO A 1 214 ? 22.178  52.673  19.060  1.00 25.20  ? 240 PRO A O   1 
ATOM   1706  C CB  . PRO A 1 214 ? 22.359  49.427  18.076  1.00 28.60  ? 240 PRO A CB  1 
ATOM   1707  C CG  . PRO A 1 214 ? 22.415  50.074  16.743  1.00 27.49  ? 240 PRO A CG  1 
ATOM   1708  C CD  . PRO A 1 214 ? 20.964  50.440  16.501  1.00 28.29  ? 240 PRO A CD  1 
ATOM   1709  N N   . GLU A 1 215 ? 23.036  51.209  20.531  1.00 26.21  ? 241 GLU A N   1 
ATOM   1710  C CA  . GLU A 1 215 ? 23.821  52.216  21.240  1.00 25.54  ? 241 GLU A CA  1 
ATOM   1711  C C   . GLU A 1 215 ? 24.903  52.843  20.363  1.00 24.04  ? 241 GLU A C   1 
ATOM   1712  O O   . GLU A 1 215 ? 25.107  54.057  20.399  1.00 22.30  ? 241 GLU A O   1 
ATOM   1713  C CB  . GLU A 1 215 ? 24.461  51.600  22.490  1.00 28.01  ? 241 GLU A CB  1 
ATOM   1714  C CG  . GLU A 1 215 ? 25.175  52.610  23.383  1.00 34.60  ? 241 GLU A CG  1 
ATOM   1715  C CD  . GLU A 1 215 ? 25.909  51.969  24.560  1.00 39.45  ? 241 GLU A CD  1 
ATOM   1716  O OE1 . GLU A 1 215 ? 26.401  52.722  25.427  1.00 43.20  ? 241 GLU A OE1 1 
ATOM   1717  O OE2 . GLU A 1 215 ? 26.004  50.723  24.620  1.00 39.86  ? 241 GLU A OE2 1 
ATOM   1718  N N   . ALA A 1 216 ? 25.589  52.009  19.582  1.00 23.18  ? 242 ALA A N   1 
ATOM   1719  C CA  . ALA A 1 216 ? 26.659  52.470  18.702  1.00 25.98  ? 242 ALA A CA  1 
ATOM   1720  C C   . ALA A 1 216 ? 26.163  53.579  17.799  1.00 27.65  ? 242 ALA A C   1 
ATOM   1721  O O   . ALA A 1 216 ? 26.778  54.642  17.701  1.00 30.13  ? 242 ALA A O   1 
ATOM   1722  C CB  . ALA A 1 216 ? 27.187  51.316  17.856  1.00 20.05  ? 242 ALA A CB  1 
ATOM   1723  N N   . MET A 1 217 ? 25.042  53.314  17.142  1.00 29.16  ? 243 MET A N   1 
ATOM   1724  C CA  . MET A 1 217 ? 24.432  54.262  16.230  1.00 31.27  ? 243 MET A CA  1 
ATOM   1725  C C   . MET A 1 217 ? 24.070  55.545  16.959  1.00 31.61  ? 243 MET A C   1 
ATOM   1726  O O   . MET A 1 217 ? 24.421  56.638  16.520  1.00 35.28  ? 243 MET A O   1 
ATOM   1727  C CB  . MET A 1 217 ? 23.187  53.634  15.601  1.00 33.41  ? 243 MET A CB  1 
ATOM   1728  C CG  . MET A 1 217 ? 22.422  54.555  14.680  1.00 37.54  ? 243 MET A CG  1 
ATOM   1729  S SD  . MET A 1 217 ? 21.369  53.642  13.555  1.00 37.99  ? 243 MET A SD  1 
ATOM   1730  C CE  . MET A 1 217 ? 21.048  54.904  12.342  1.00 37.07  ? 243 MET A CE  1 
ATOM   1731  N N   . LEU A 1 218 ? 23.375  55.395  18.080  1.00 29.34  ? 244 LEU A N   1 
ATOM   1732  C CA  . LEU A 1 218 ? 22.948  56.516  18.903  1.00 28.52  ? 244 LEU A CA  1 
ATOM   1733  C C   . LEU A 1 218 ? 24.144  57.319  19.414  1.00 28.92  ? 244 LEU A C   1 
ATOM   1734  O O   . LEU A 1 218 ? 24.053  58.532  19.612  1.00 28.04  ? 244 LEU A O   1 
ATOM   1735  C CB  . LEU A 1 218 ? 22.135  55.993  20.089  1.00 27.01  ? 244 LEU A CB  1 
ATOM   1736  C CG  . LEU A 1 218 ? 20.635  56.293  20.183  1.00 29.54  ? 244 LEU A CG  1 
ATOM   1737  C CD1 . LEU A 1 218 ? 20.015  56.468  18.804  1.00 28.21  ? 244 LEU A CD1 1 
ATOM   1738  C CD2 . LEU A 1 218 ? 19.957  55.155  20.943  1.00 28.63  ? 244 LEU A CD2 1 
ATOM   1739  N N   . GLN A 1 219 ? 25.268  56.645  19.623  1.00 26.47  ? 245 GLN A N   1 
ATOM   1740  C CA  . GLN A 1 219 ? 26.447  57.326  20.121  1.00 24.48  ? 245 GLN A CA  1 
ATOM   1741  C C   . GLN A 1 219 ? 27.025  58.322  19.125  1.00 23.87  ? 245 GLN A C   1 
ATOM   1742  O O   . GLN A 1 219 ? 27.319  59.452  19.495  1.00 23.91  ? 245 GLN A O   1 
ATOM   1743  C CB  . GLN A 1 219 ? 27.519  56.312  20.525  1.00 25.64  ? 245 GLN A CB  1 
ATOM   1744  C CG  . GLN A 1 219 ? 28.682  56.932  21.271  1.00 24.09  ? 245 GLN A CG  1 
ATOM   1745  C CD  . GLN A 1 219 ? 29.547  55.900  21.972  1.00 27.21  ? 245 GLN A CD  1 
ATOM   1746  O OE1 . GLN A 1 219 ? 30.299  55.160  21.335  1.00 29.71  ? 245 GLN A OE1 1 
ATOM   1747  N NE2 . GLN A 1 219 ? 29.438  55.841  23.295  1.00 25.86  ? 245 GLN A NE2 1 
ATOM   1748  N N   . VAL A 1 220 ? 27.179  57.928  17.865  1.00 23.70  ? 246 VAL A N   1 
ATOM   1749  C CA  . VAL A 1 220 ? 27.752  58.855  16.891  1.00 24.80  ? 246 VAL A CA  1 
ATOM   1750  C C   . VAL A 1 220 ? 26.749  59.821  16.268  1.00 23.54  ? 246 VAL A C   1 
ATOM   1751  O O   . VAL A 1 220 ? 27.131  60.893  15.827  1.00 21.84  ? 246 VAL A O   1 
ATOM   1752  C CB  . VAL A 1 220 ? 28.538  58.103  15.745  1.00 24.76  ? 246 VAL A CB  1 
ATOM   1753  C CG1 . VAL A 1 220 ? 28.872  56.697  16.177  1.00 25.01  ? 246 VAL A CG1 1 
ATOM   1754  C CG2 . VAL A 1 220 ? 27.769  58.120  14.450  1.00 20.92  ? 246 VAL A CG2 1 
ATOM   1755  N N   . LEU A 1 221 ? 25.473  59.451  16.233  1.00 24.20  ? 247 LEU A N   1 
ATOM   1756  C CA  . LEU A 1 221 ? 24.466  60.332  15.648  1.00 26.00  ? 247 LEU A CA  1 
ATOM   1757  C C   . LEU A 1 221 ? 23.790  61.201  16.694  1.00 27.13  ? 247 LEU A C   1 
ATOM   1758  O O   . LEU A 1 221 ? 23.444  62.342  16.429  1.00 24.69  ? 247 LEU A O   1 
ATOM   1759  C CB  . LEU A 1 221 ? 23.389  59.523  14.916  1.00 25.75  ? 247 LEU A CB  1 
ATOM   1760  C CG  . LEU A 1 221 ? 23.847  58.726  13.693  1.00 28.73  ? 247 LEU A CG  1 
ATOM   1761  C CD1 . LEU A 1 221 ? 22.745  57.776  13.278  1.00 26.87  ? 247 LEU A CD1 1 
ATOM   1762  C CD2 . LEU A 1 221 ? 24.221  59.676  12.556  1.00 23.93  ? 247 LEU A CD2 1 
ATOM   1763  N N   . GLY A 1 222 ? 23.608  60.650  17.886  1.00 29.81  ? 248 GLY A N   1 
ATOM   1764  C CA  . GLY A 1 222 ? 22.935  61.385  18.937  1.00 33.28  ? 248 GLY A CA  1 
ATOM   1765  C C   . GLY A 1 222 ? 21.489  60.919  19.019  1.00 35.79  ? 248 GLY A C   1 
ATOM   1766  O O   . GLY A 1 222 ? 21.090  59.998  18.295  1.00 35.63  ? 248 GLY A O   1 
ATOM   1767  N N   . PRO A 1 223 ? 20.672  61.535  19.886  1.00 37.43  ? 249 PRO A N   1 
ATOM   1768  C CA  . PRO A 1 223 ? 19.267  61.134  20.016  1.00 37.50  ? 249 PRO A CA  1 
ATOM   1769  C C   . PRO A 1 223 ? 18.478  61.342  18.722  1.00 36.98  ? 249 PRO A C   1 
ATOM   1770  O O   . PRO A 1 223 ? 18.607  62.377  18.065  1.00 34.94  ? 249 PRO A O   1 
ATOM   1771  C CB  . PRO A 1 223 ? 18.771  62.006  21.172  1.00 40.43  ? 249 PRO A CB  1 
ATOM   1772  C CG  . PRO A 1 223 ? 19.602  63.268  21.029  1.00 39.46  ? 249 PRO A CG  1 
ATOM   1773  C CD  . PRO A 1 223 ? 20.976  62.705  20.736  1.00 39.30  ? 249 PRO A CD  1 
ATOM   1774  N N   . LYS A 1 224 ? 17.664  60.351  18.365  1.00 38.46  ? 250 LYS A N   1 
ATOM   1775  C CA  . LYS A 1 224 ? 16.858  60.396  17.148  1.00 37.12  ? 250 LYS A CA  1 
ATOM   1776  C C   . LYS A 1 224 ? 15.684  61.360  17.234  1.00 38.58  ? 250 LYS A C   1 
ATOM   1777  O O   . LYS A 1 224 ? 14.852  61.260  18.132  1.00 38.95  ? 250 LYS A O   1 
ATOM   1778  C CB  . LYS A 1 224 ? 16.334  58.996  16.817  1.00 36.68  ? 250 LYS A CB  1 
ATOM   1779  C CG  . LYS A 1 224 ? 15.243  58.969  15.748  1.00 39.43  ? 250 LYS A CG  1 
ATOM   1780  C CD  . LYS A 1 224 ? 14.746  57.548  15.497  1.00 41.27  ? 250 LYS A CD  1 
ATOM   1781  C CE  . LYS A 1 224 ? 13.256  57.519  15.171  1.00 41.48  ? 250 LYS A CE  1 
ATOM   1782  N NZ  . LYS A 1 224 ? 12.920  58.343  13.977  1.00 41.61  ? 250 LYS A NZ  1 
ATOM   1783  N N   . PRO A 1 225 ? 15.611  62.322  16.300  1.00 39.96  ? 251 PRO A N   1 
ATOM   1784  C CA  . PRO A 1 225 ? 14.527  63.306  16.267  1.00 40.91  ? 251 PRO A CA  1 
ATOM   1785  C C   . PRO A 1 225 ? 13.361  62.767  15.433  1.00 42.17  ? 251 PRO A C   1 
ATOM   1786  O O   . PRO A 1 225 ? 13.314  61.575  15.125  1.00 42.51  ? 251 PRO A O   1 
ATOM   1787  C CB  . PRO A 1 225 ? 15.191  64.510  15.617  1.00 40.05  ? 251 PRO A CB  1 
ATOM   1788  C CG  . PRO A 1 225 ? 16.065  63.857  14.596  1.00 37.88  ? 251 PRO A CG  1 
ATOM   1789  C CD  . PRO A 1 225 ? 16.694  62.716  15.378  1.00 40.41  ? 251 PRO A CD  1 
ATOM   1790  N N   . THR A 1 226 ? 12.412  63.633  15.086  1.00 44.02  ? 252 THR A N   1 
ATOM   1791  C CA  . THR A 1 226 ? 11.288  63.202  14.261  1.00 45.00  ? 252 THR A CA  1 
ATOM   1792  C C   . THR A 1 226 ? 11.834  63.216  12.848  1.00 44.46  ? 252 THR A C   1 
ATOM   1793  O O   . THR A 1 226 ? 12.534  64.147  12.456  1.00 43.46  ? 252 THR A O   1 
ATOM   1794  C CB  . THR A 1 226 ? 10.071  64.166  14.362  1.00 46.69  ? 252 THR A CB  1 
ATOM   1795  O OG1 . THR A 1 226 ? 9.463   64.040  15.653  1.00 47.79  ? 252 THR A OG1 1 
ATOM   1796  C CG2 . THR A 1 226 ? 9.034   63.837  13.293  1.00 45.16  ? 252 THR A CG2 1 
ATOM   1797  N N   . LEU A 1 227 ? 11.520  62.178  12.088  1.00 44.46  ? 253 LEU A N   1 
ATOM   1798  C CA  . LEU A 1 227 ? 12.021  62.066  10.730  1.00 43.97  ? 253 LEU A CA  1 
ATOM   1799  C C   . LEU A 1 227 ? 11.043  62.535  9.665   1.00 44.43  ? 253 LEU A C   1 
ATOM   1800  O O   . LEU A 1 227 ? 9.832   62.485  9.853   1.00 46.73  ? 253 LEU A O   1 
ATOM   1801  C CB  . LEU A 1 227 ? 12.427  60.614  10.458  1.00 41.73  ? 253 LEU A CB  1 
ATOM   1802  C CG  . LEU A 1 227 ? 13.448  60.042  11.446  1.00 39.28  ? 253 LEU A CG  1 
ATOM   1803  C CD1 . LEU A 1 227 ? 13.821  58.626  11.041  1.00 37.21  ? 253 LEU A CD1 1 
ATOM   1804  C CD2 . LEU A 1 227 ? 14.687  60.940  11.480  1.00 38.07  ? 253 LEU A CD2 1 
ATOM   1805  N N   . PRO A 1 228 ? 11.570  63.022  8.533   1.00 44.31  ? 254 PRO A N   1 
ATOM   1806  C CA  . PRO A 1 228 ? 10.762  63.504  7.411   1.00 44.75  ? 254 PRO A CA  1 
ATOM   1807  C C   . PRO A 1 228 ? 10.285  62.335  6.559   1.00 46.16  ? 254 PRO A C   1 
ATOM   1808  O O   . PRO A 1 228 ? 10.686  61.191  6.777   1.00 47.08  ? 254 PRO A O   1 
ATOM   1809  C CB  . PRO A 1 228 ? 11.739  64.383  6.627   1.00 43.85  ? 254 PRO A CB  1 
ATOM   1810  C CG  . PRO A 1 228 ? 12.762  64.775  7.640   1.00 44.04  ? 254 PRO A CG  1 
ATOM   1811  C CD  . PRO A 1 228 ? 12.954  63.502  8.407   1.00 44.31  ? 254 PRO A CD  1 
ATOM   1812  N N   . GLU A 1 229 ? 9.426   62.635  5.593   1.00 47.62  ? 255 GLU A N   1 
ATOM   1813  C CA  . GLU A 1 229 ? 8.922   61.632  4.669   1.00 50.56  ? 255 GLU A CA  1 
ATOM   1814  C C   . GLU A 1 229 ? 9.951   61.628  3.543   1.00 53.93  ? 255 GLU A C   1 
ATOM   1815  O O   . GLU A 1 229 ? 10.626  62.631  3.318   1.00 52.93  ? 255 GLU A O   1 
ATOM   1816  C CB  . GLU A 1 229 ? 7.557   62.053  4.113   1.00 51.65  ? 255 GLU A CB  1 
ATOM   1817  C CG  . GLU A 1 229 ? 6.381   61.898  5.065   1.00 53.91  ? 255 GLU A CG  1 
ATOM   1818  C CD  . GLU A 1 229 ? 5.947   60.449  5.227   1.00 58.65  ? 255 GLU A CD  1 
ATOM   1819  O OE1 . GLU A 1 229 ? 5.705   59.777  4.195   1.00 57.45  ? 255 GLU A OE1 1 
ATOM   1820  O OE2 . GLU A 1 229 ? 5.841   59.982  6.385   1.00 59.20  ? 255 GLU A OE2 1 
ATOM   1821  N N   . ALA A 1 230 ? 10.090  60.509  2.843   1.00 58.33  ? 256 ALA A N   1 
ATOM   1822  C CA  . ALA A 1 230 ? 11.045  60.444  1.745   1.00 62.41  ? 256 ALA A CA  1 
ATOM   1823  C C   . ALA A 1 230 ? 10.508  61.264  0.582   1.00 66.77  ? 256 ALA A C   1 
ATOM   1824  O O   . ALA A 1 230 ? 9.299   61.309  0.346   1.00 68.44  ? 256 ALA A O   1 
ATOM   1825  C CB  . ALA A 1 230 ? 11.267  58.999  1.315   1.00 60.78  ? 256 ALA A CB  1 
ATOM   1826  N N   . THR A 1 231 ? 11.407  61.926  -0.133  1.00 71.78  ? 257 THR A N   1 
ATOM   1827  C CA  . THR A 1 231 ? 11.019  62.741  -1.275  1.00 76.42  ? 257 THR A CA  1 
ATOM   1828  C C   . THR A 1 231 ? 10.941  61.851  -2.507  1.00 80.27  ? 257 THR A C   1 
ATOM   1829  O O   . THR A 1 231 ? 11.927  61.686  -3.223  1.00 81.20  ? 257 THR A O   1 
ATOM   1830  C CB  . THR A 1 231 ? 12.043  63.859  -1.527  1.00 75.76  ? 257 THR A CB  1 
ATOM   1831  O OG1 . THR A 1 231 ? 12.085  64.734  -0.392  1.00 75.02  ? 257 THR A OG1 1 
ATOM   1832  C CG2 . THR A 1 231 ? 11.667  64.653  -2.763  1.00 75.74  ? 257 THR A CG2 1 
ATOM   1833  N N   . GLU A 1 232 ? 9.765   61.275  -2.742  1.00 85.06  ? 258 GLU A N   1 
ATOM   1834  C CA  . GLU A 1 232 ? 9.552   60.391  -3.884  1.00 89.95  ? 258 GLU A CA  1 
ATOM   1835  C C   . GLU A 1 232 ? 9.853   61.123  -5.182  1.00 92.33  ? 258 GLU A C   1 
ATOM   1836  O O   . GLU A 1 232 ? 10.167  60.508  -6.204  1.00 92.31  ? 258 GLU A O   1 
ATOM   1837  C CB  . GLU A 1 232 ? 8.106   59.893  -3.906  1.00 91.82  ? 258 GLU A CB  1 
ATOM   1838  C CG  . GLU A 1 232 ? 7.836   58.824  -4.954  1.00 94.52  ? 258 GLU A CG  1 
ATOM   1839  C CD  . GLU A 1 232 ? 8.659   57.568  -4.724  1.00 96.41  ? 258 GLU A CD  1 
ATOM   1840  O OE1 . GLU A 1 232 ? 8.546   56.977  -3.628  1.00 96.54  ? 258 GLU A OE1 1 
ATOM   1841  O OE2 . GLU A 1 232 ? 9.418   57.173  -5.636  1.00 97.14  ? 258 GLU A OE2 1 
ATOM   1842  N N   . ASP A 1 233 ? 9.753   62.446  -5.129  1.00 95.76  ? 259 ASP A N   1 
ATOM   1843  C CA  . ASP A 1 233 ? 10.015  63.284  -6.290  1.00 98.63  ? 259 ASP A CA  1 
ATOM   1844  C C   . ASP A 1 233 ? 11.512  63.546  -6.459  1.00 99.46  ? 259 ASP A C   1 
ATOM   1845  O O   . ASP A 1 233 ? 11.909  64.599  -6.958  1.00 99.37  ? 259 ASP A O   1 
ATOM   1846  C CB  . ASP A 1 233 ? 9.269   64.619  -6.154  1.00 100.08 ? 259 ASP A CB  1 
ATOM   1847  C CG  . ASP A 1 233 ? 7.765   64.440  -6.008  1.00 100.41 ? 259 ASP A CG  1 
ATOM   1848  O OD1 . ASP A 1 233 ? 7.043   65.463  -6.014  1.00 100.20 ? 259 ASP A OD1 1 
ATOM   1849  O OD2 . ASP A 1 233 ? 7.305   63.282  -5.885  1.00 100.35 ? 259 ASP A OD2 1 
ATOM   1850  N N   . THR A 1 234 ? 12.338  62.591  -6.031  1.00 100.29 ? 260 THR A N   1 
ATOM   1851  C CA  . THR A 1 234 ? 13.789  62.723  -6.155  1.00 100.41 ? 260 THR A CA  1 
ATOM   1852  C C   . THR A 1 234 ? 14.099  62.893  -7.637  1.00 100.41 ? 260 THR A C   1 
ATOM   1853  O O   . THR A 1 234 ? 14.849  63.787  -8.035  1.00 100.41 ? 260 THR A O   1 
ATOM   1854  C CB  . THR A 1 234 ? 14.524  61.464  -5.627  1.00 100.41 ? 260 THR A CB  1 
ATOM   1855  O OG1 . THR A 1 234 ? 14.288  61.324  -4.220  1.00 100.31 ? 260 THR A OG1 1 
ATOM   1856  C CG2 . THR A 1 234 ? 16.026  61.574  -5.875  1.00 100.28 ? 260 THR A CG2 1 
ATOM   1857  N N   . VAL A 1 235 ? 13.505  62.014  -8.440  1.00 100.41 ? 261 VAL A N   1 
ATOM   1858  C CA  . VAL A 1 235 ? 13.650  62.014  -9.893  1.00 100.41 ? 261 VAL A CA  1 
ATOM   1859  C C   . VAL A 1 235 ? 12.443  61.237  -10.422 1.00 100.41 ? 261 VAL A C   1 
ATOM   1860  O O   . VAL A 1 235 ? 12.569  60.408  -11.326 1.00 100.41 ? 261 VAL A O   1 
ATOM   1861  C CB  . VAL A 1 235 ? 14.952  61.290  -10.357 1.00 100.41 ? 261 VAL A CB  1 
ATOM   1862  C CG1 . VAL A 1 235 ? 15.129  61.446  -11.865 1.00 99.46  ? 261 VAL A CG1 1 
ATOM   1863  C CG2 . VAL A 1 235 ? 16.167  61.850  -9.629  1.00 100.40 ? 261 VAL A CG2 1 
ATOM   1864  N N   . LYS A 1 236 ? 11.275  61.506  -9.841  1.00 100.41 ? 262 LYS A N   1 
ATOM   1865  C CA  . LYS A 1 236 ? 10.049  60.820  -10.239 1.00 100.41 ? 262 LYS A CA  1 
ATOM   1866  C C   . LYS A 1 236 ? 9.899   60.766  -11.756 1.00 100.41 ? 262 LYS A C   1 
ATOM   1867  O O   . LYS A 1 236 ? 9.935   61.793  -12.438 1.00 100.18 ? 262 LYS A O   1 
ATOM   1868  C CB  . LYS A 1 236 ? 8.817   61.500  -9.623  1.00 100.41 ? 262 LYS A CB  1 
ATOM   1869  C CG  . LYS A 1 236 ? 8.459   62.849  -10.227 1.00 100.41 ? 262 LYS A CG  1 
ATOM   1870  C CD  . LYS A 1 236 ? 7.106   63.330  -9.727  1.00 100.41 ? 262 LYS A CD  1 
ATOM   1871  C CE  . LYS A 1 236 ? 6.730   64.665  -10.350 1.00 100.03 ? 262 LYS A CE  1 
ATOM   1872  N NZ  . LYS A 1 236 ? 5.416   65.153  -9.853  1.00 99.99  ? 262 LYS A NZ  1 
ATOM   1873  N N   . GLU A 1 237 ? 9.740   59.553  -12.277 1.00 100.41 ? 263 GLU A N   1 
ATOM   1874  C CA  . GLU A 1 237 ? 9.576   59.353  -13.711 1.00 100.41 ? 263 GLU A CA  1 
ATOM   1875  C C   . GLU A 1 237 ? 8.098   59.479  -14.069 1.00 100.37 ? 263 GLU A C   1 
ATOM   1876  O O   . GLU A 1 237 ? 7.226   59.089  -13.291 1.00 100.26 ? 263 GLU A O   1 
ATOM   1877  C CB  . GLU A 1 237 ? 10.095  57.967  -14.116 1.00 100.41 ? 263 GLU A CB  1 
ATOM   1878  C CG  . GLU A 1 237 ? 11.552  57.701  -13.741 1.00 100.17 ? 263 GLU A CG  1 
ATOM   1879  C CD  . GLU A 1 237 ? 12.007  56.294  -14.103 1.00 100.41 ? 263 GLU A CD  1 
ATOM   1880  O OE1 . GLU A 1 237 ? 11.387  55.321  -13.621 1.00 100.41 ? 263 GLU A OE1 1 
ATOM   1881  O OE2 . GLU A 1 237 ? 12.988  56.160  -14.867 1.00 100.41 ? 263 GLU A OE2 1 
ATOM   1882  N N   . ASP A 1 238 ? 7.823   60.039  -15.241 1.00 100.41 ? 264 ASP A N   1 
ATOM   1883  C CA  . ASP A 1 238 ? 6.453   60.210  -15.718 1.00 100.41 ? 264 ASP A CA  1 
ATOM   1884  C C   . ASP A 1 238 ? 6.430   60.143  -17.244 1.00 100.40 ? 264 ASP A C   1 
ATOM   1885  O O   . ASP A 1 238 ? 5.526   60.674  -17.892 1.00 99.74  ? 264 ASP A O   1 
ATOM   1886  C CB  . ASP A 1 238 ? 5.882   61.547  -15.232 1.00 100.31 ? 264 ASP A CB  1 
ATOM   1887  C CG  . ASP A 1 238 ? 5.300   61.460  -13.827 1.00 100.41 ? 264 ASP A CG  1 
ATOM   1888  O OD1 . ASP A 1 238 ? 4.203   60.878  -13.672 1.00 99.73  ? 264 ASP A OD1 1 
ATOM   1889  O OD2 . ASP A 1 238 ? 5.939   61.965  -12.878 1.00 100.41 ? 264 ASP A OD2 1 
ATOM   1890  N N   . ALA A 1 239 ? 7.436   59.478  -17.806 1.00 100.23 ? 265 ALA A N   1 
ATOM   1891  C CA  . ALA A 1 239 ? 7.557   59.324  -19.250 1.00 99.52  ? 265 ALA A CA  1 
ATOM   1892  C C   . ALA A 1 239 ? 6.494   58.364  -19.773 1.00 98.52  ? 265 ALA A C   1 
ATOM   1893  O O   . ALA A 1 239 ? 6.799   57.246  -20.189 1.00 98.49  ? 265 ALA A O   1 
ATOM   1894  C CB  . ALA A 1 239 ? 8.954   58.809  -19.604 1.00 99.85  ? 265 ALA A CB  1 
ATOM   1895  N N   . ALA A 1 240 ? 5.242   58.802  -19.754 1.00 97.22  ? 266 ALA A N   1 
ATOM   1896  C CA  . ALA A 1 240 ? 4.155   57.959  -20.227 1.00 95.81  ? 266 ALA A CA  1 
ATOM   1897  C C   . ALA A 1 240 ? 4.401   57.478  -21.653 1.00 94.59  ? 266 ALA A C   1 
ATOM   1898  O O   . ALA A 1 240 ? 4.944   56.394  -21.875 1.00 93.80  ? 266 ALA A O   1 
ATOM   1899  C CB  . ALA A 1 240 ? 2.832   58.717  -20.152 1.00 95.11  ? 266 ALA A CB  1 
ATOM   1900  N N   . ASN A 1 241 ? 4.009   58.308  -22.614 1.00 93.57  ? 267 ASN A N   1 
ATOM   1901  C CA  . ASN A 1 241 ? 4.142   57.975  -24.022 1.00 91.98  ? 267 ASN A CA  1 
ATOM   1902  C C   . ASN A 1 241 ? 5.173   58.833  -24.746 1.00 90.38  ? 267 ASN A C   1 
ATOM   1903  O O   . ASN A 1 241 ? 4.947   60.019  -24.991 1.00 89.77  ? 267 ASN A O   1 
ATOM   1904  C CB  . ASN A 1 241 ? 2.780   58.119  -24.698 1.00 93.87  ? 267 ASN A CB  1 
ATOM   1905  C CG  . ASN A 1 241 ? 1.674   57.410  -23.931 1.00 96.16  ? 267 ASN A CG  1 
ATOM   1906  O OD1 . ASN A 1 241 ? 1.413   57.717  -22.764 1.00 96.91  ? 267 ASN A OD1 1 
ATOM   1907  N ND2 . ASN A 1 241 ? 1.020   56.454  -24.583 1.00 97.79  ? 267 ASN A ND2 1 
ATOM   1908  N N   . ARG A 1 242 ? 6.304   58.216  -25.085 1.00 88.30  ? 268 ARG A N   1 
ATOM   1909  C CA  . ARG A 1 242 ? 7.390   58.887  -25.795 1.00 84.52  ? 268 ARG A CA  1 
ATOM   1910  C C   . ARG A 1 242 ? 7.961   57.933  -26.846 1.00 80.46  ? 268 ARG A C   1 
ATOM   1911  O O   . ARG A 1 242 ? 8.921   57.203  -26.581 1.00 79.04  ? 268 ARG A O   1 
ATOM   1912  C CB  . ARG A 1 242 ? 8.491   59.299  -24.815 1.00 86.52  ? 268 ARG A CB  1 
ATOM   1913  C CG  . ARG A 1 242 ? 7.997   60.145  -23.654 1.00 89.41  ? 268 ARG A CG  1 
ATOM   1914  C CD  . ARG A 1 242 ? 7.304   61.405  -24.138 1.00 92.37  ? 268 ARG A CD  1 
ATOM   1915  N NE  . ARG A 1 242 ? 6.731   62.163  -23.030 1.00 96.32  ? 268 ARG A NE  1 
ATOM   1916  C CZ  . ARG A 1 242 ? 6.028   63.282  -23.172 1.00 98.02  ? 268 ARG A CZ  1 
ATOM   1917  N NH1 . ARG A 1 242 ? 5.808   63.780  -24.383 1.00 99.11  ? 268 ARG A NH1 1 
ATOM   1918  N NH2 . ARG A 1 242 ? 5.546   63.905  -22.103 1.00 97.84  ? 268 ARG A NH2 1 
ATOM   1919  N N   . LYS A 1 243 ? 7.361   57.950  -28.035 1.00 74.62  ? 269 LYS A N   1 
ATOM   1920  C CA  . LYS A 1 243 ? 7.772   57.081  -29.136 1.00 69.34  ? 269 LYS A CA  1 
ATOM   1921  C C   . LYS A 1 243 ? 8.263   57.848  -30.363 1.00 66.10  ? 269 LYS A C   1 
ATOM   1922  O O   . LYS A 1 243 ? 8.616   57.246  -31.379 1.00 64.55  ? 269 LYS A O   1 
ATOM   1923  C CB  . LYS A 1 243 ? 6.599   56.184  -29.548 1.00 67.79  ? 269 LYS A CB  1 
ATOM   1924  C CG  . LYS A 1 243 ? 5.352   56.951  -29.975 1.00 64.56  ? 269 LYS A CG  1 
ATOM   1925  C CD  . LYS A 1 243 ? 4.174   56.033  -30.267 1.00 61.63  ? 269 LYS A CD  1 
ATOM   1926  C CE  . LYS A 1 243 ? 4.415   55.180  -31.496 1.00 60.64  ? 269 LYS A CE  1 
ATOM   1927  N NZ  . LYS A 1 243 ? 3.243   54.313  -31.796 1.00 61.29  ? 269 LYS A NZ  1 
ATOM   1928  N N   . LEU A 1 244 ? 8.286   59.172  -30.269 1.00 63.20  ? 270 LEU A N   1 
ATOM   1929  C CA  . LEU A 1 244 ? 8.711   59.998  -31.390 1.00 60.01  ? 270 LEU A CA  1 
ATOM   1930  C C   . LEU A 1 244 ? 10.183  60.403  -31.326 1.00 57.99  ? 270 LEU A C   1 
ATOM   1931  O O   . LEU A 1 244 ? 10.736  60.598  -30.247 1.00 58.63  ? 270 LEU A O   1 
ATOM   1932  C CB  . LEU A 1 244 ? 7.808   61.230  -31.477 1.00 58.69  ? 270 LEU A CB  1 
ATOM   1933  C CG  . LEU A 1 244 ? 6.346   60.869  -31.761 1.00 56.50  ? 270 LEU A CG  1 
ATOM   1934  C CD1 . LEU A 1 244 ? 5.482   62.115  -31.739 1.00 56.40  ? 270 LEU A CD1 1 
ATOM   1935  C CD2 . LEU A 1 244 ? 6.252   60.171  -33.109 1.00 55.37  ? 270 LEU A CD2 1 
ATOM   1936  N N   . ALA A 1 245 ? 10.811  60.510  -32.494 1.00 54.58  ? 271 ALA A N   1 
ATOM   1937  C CA  . ALA A 1 245 ? 12.218  60.876  -32.591 1.00 52.10  ? 271 ALA A CA  1 
ATOM   1938  C C   . ALA A 1 245 ? 12.500  61.528  -33.937 1.00 50.96  ? 271 ALA A C   1 
ATOM   1939  O O   . ALA A 1 245 ? 11.726  61.384  -34.880 1.00 49.83  ? 271 ALA A O   1 
ATOM   1940  C CB  . ALA A 1 245 ? 13.092  59.641  -32.423 1.00 50.02  ? 271 ALA A CB  1 
ATOM   1941  N N   . LYS A 1 246 ? 13.619  62.236  -34.024 1.00 49.38  ? 272 LYS A N   1 
ATOM   1942  C CA  . LYS A 1 246 ? 13.991  62.905  -35.258 1.00 47.93  ? 272 LYS A CA  1 
ATOM   1943  C C   . LYS A 1 246 ? 15.409  62.531  -35.679 1.00 46.10  ? 272 LYS A C   1 
ATOM   1944  O O   . LYS A 1 246 ? 16.243  62.179  -34.846 1.00 43.97  ? 272 LYS A O   1 
ATOM   1945  C CB  . LYS A 1 246 ? 13.872  64.421  -35.080 1.00 50.96  ? 272 LYS A CB  1 
ATOM   1946  C CG  . LYS A 1 246 ? 12.463  64.889  -34.762 1.00 52.66  ? 272 LYS A CG  1 
ATOM   1947  C CD  . LYS A 1 246 ? 12.400  66.386  -34.520 1.00 55.17  ? 272 LYS A CD  1 
ATOM   1948  C CE  . LYS A 1 246 ? 10.978  66.808  -34.187 1.00 57.91  ? 272 LYS A CE  1 
ATOM   1949  N NZ  . LYS A 1 246 ? 10.887  68.245  -33.817 1.00 60.81  ? 272 LYS A NZ  1 
ATOM   1950  N N   . LEU A 1 247 ? 15.672  62.618  -36.978 1.00 44.87  ? 273 LEU A N   1 
ATOM   1951  C CA  . LEU A 1 247 ? 16.977  62.278  -37.527 1.00 44.12  ? 273 LEU A CA  1 
ATOM   1952  C C   . LEU A 1 247 ? 17.651  63.491  -38.181 1.00 44.99  ? 273 LEU A C   1 
ATOM   1953  O O   . LEU A 1 247 ? 17.107  64.090  -39.111 1.00 45.75  ? 273 LEU A O   1 
ATOM   1954  C CB  . LEU A 1 247 ? 16.807  61.148  -38.541 1.00 42.45  ? 273 LEU A CB  1 
ATOM   1955  C CG  . LEU A 1 247 ? 18.061  60.553  -39.170 1.00 42.37  ? 273 LEU A CG  1 
ATOM   1956  C CD1 . LEU A 1 247 ? 18.989  60.036  -38.089 1.00 39.04  ? 273 LEU A CD1 1 
ATOM   1957  C CD2 . LEU A 1 247 ? 17.652  59.431  -40.114 1.00 42.21  ? 273 LEU A CD2 1 
ATOM   1958  N N   . TYR A 1 248 ? 18.841  63.840  -37.696 1.00 45.63  ? 274 TYR A N   1 
ATOM   1959  C CA  . TYR A 1 248 ? 19.595  64.986  -38.207 1.00 46.52  ? 274 TYR A CA  1 
ATOM   1960  C C   . TYR A 1 248 ? 20.894  64.594  -38.905 1.00 48.19  ? 274 TYR A C   1 
ATOM   1961  O O   . TYR A 1 248 ? 21.467  63.537  -38.651 1.00 47.08  ? 274 TYR A O   1 
ATOM   1962  C CB  . TYR A 1 248 ? 19.940  65.949  -37.059 1.00 46.49  ? 274 TYR A CB  1 
ATOM   1963  C CG  . TYR A 1 248 ? 18.748  66.591  -36.377 1.00 46.33  ? 274 TYR A CG  1 
ATOM   1964  C CD1 . TYR A 1 248 ? 18.223  67.796  -36.838 1.00 43.85  ? 274 TYR A CD1 1 
ATOM   1965  C CD2 . TYR A 1 248 ? 18.132  65.980  -35.281 1.00 44.29  ? 274 TYR A CD2 1 
ATOM   1966  C CE1 . TYR A 1 248 ? 17.116  68.379  -36.228 1.00 44.39  ? 274 TYR A CE1 1 
ATOM   1967  C CE2 . TYR A 1 248 ? 17.023  66.551  -34.670 1.00 44.50  ? 274 TYR A CE2 1 
ATOM   1968  C CZ  . TYR A 1 248 ? 16.518  67.751  -35.149 1.00 45.62  ? 274 TYR A CZ  1 
ATOM   1969  O OH  . TYR A 1 248 ? 15.411  68.319  -34.556 1.00 44.35  ? 274 TYR A OH  1 
ATOM   1970  N N   . LYS A 1 249 ? 21.357  65.479  -39.780 1.00 51.11  ? 275 LYS A N   1 
ATOM   1971  C CA  . LYS A 1 249 ? 22.599  65.294  -40.520 1.00 55.06  ? 275 LYS A CA  1 
ATOM   1972  C C   . LYS A 1 249 ? 23.571  66.355  -39.999 1.00 57.61  ? 275 LYS A C   1 
ATOM   1973  O O   . LYS A 1 249 ? 23.199  67.516  -39.844 1.00 57.19  ? 275 LYS A O   1 
ATOM   1974  C CB  . LYS A 1 249 ? 22.334  65.498  -42.012 1.00 56.37  ? 275 LYS A CB  1 
ATOM   1975  C CG  . LYS A 1 249 ? 23.568  65.600  -42.887 1.00 57.75  ? 275 LYS A CG  1 
ATOM   1976  C CD  . LYS A 1 249 ? 23.177  66.083  -44.279 1.00 61.18  ? 275 LYS A CD  1 
ATOM   1977  C CE  . LYS A 1 249 ? 24.392  66.344  -45.149 1.00 62.42  ? 275 LYS A CE  1 
ATOM   1978  N NZ  . LYS A 1 249 ? 25.212  65.113  -45.305 1.00 64.86  ? 275 LYS A NZ  1 
ATOM   1979  N N   . VAL A 1 250 ? 24.811  65.970  -39.727 1.00 61.89  ? 276 VAL A N   1 
ATOM   1980  C CA  . VAL A 1 250 ? 25.774  66.929  -39.200 1.00 67.71  ? 276 VAL A CA  1 
ATOM   1981  C C   . VAL A 1 250 ? 27.116  66.961  -39.924 1.00 71.72  ? 276 VAL A C   1 
ATOM   1982  O O   . VAL A 1 250 ? 27.585  65.949  -40.444 1.00 73.09  ? 276 VAL A O   1 
ATOM   1983  C CB  . VAL A 1 250 ? 26.033  66.656  -37.709 1.00 67.80  ? 276 VAL A CB  1 
ATOM   1984  C CG1 . VAL A 1 250 ? 26.617  65.265  -37.539 1.00 69.39  ? 276 VAL A CG1 1 
ATOM   1985  C CG2 . VAL A 1 250 ? 26.966  67.707  -37.136 1.00 68.41  ? 276 VAL A CG2 1 
ATOM   1986  N N   . SER A 1 251 ? 27.727  68.142  -39.946 1.00 76.73  ? 277 SER A N   1 
ATOM   1987  C CA  . SER A 1 251 ? 29.025  68.349  -40.582 1.00 82.79  ? 277 SER A CA  1 
ATOM   1988  C C   . SER A 1 251 ? 29.706  69.548  -39.929 1.00 86.08  ? 277 SER A C   1 
ATOM   1989  O O   . SER A 1 251 ? 29.296  70.689  -40.142 1.00 86.75  ? 277 SER A O   1 
ATOM   1990  C CB  . SER A 1 251 ? 28.854  68.607  -42.082 1.00 82.13  ? 277 SER A CB  1 
ATOM   1991  O OG  . SER A 1 251 ? 28.295  67.479  -42.734 1.00 84.44  ? 277 SER A OG  1 
ATOM   1992  N N   . ASN A 1 252 ? 30.740  69.288  -39.133 1.00 90.18  ? 278 ASN A N   1 
ATOM   1993  C CA  . ASN A 1 252 ? 31.456  70.364  -38.448 1.00 94.75  ? 278 ASN A CA  1 
ATOM   1994  C C   . ASN A 1 252 ? 32.837  69.957  -37.938 1.00 96.28  ? 278 ASN A C   1 
ATOM   1995  O O   . ASN A 1 252 ? 33.093  68.780  -37.670 1.00 96.65  ? 278 ASN A O   1 
ATOM   1996  C CB  . ASN A 1 252 ? 30.626  70.877  -37.265 1.00 95.99  ? 278 ASN A CB  1 
ATOM   1997  C CG  . ASN A 1 252 ? 30.461  69.835  -36.168 1.00 96.64  ? 278 ASN A CG  1 
ATOM   1998  O OD1 . ASN A 1 252 ? 29.904  68.762  -36.396 1.00 97.34  ? 278 ASN A OD1 1 
ATOM   1999  N ND2 . ASN A 1 252 ? 30.949  70.151  -34.971 1.00 96.75  ? 278 ASN A ND2 1 
ATOM   2000  N N   . GLY A 1 253 ? 33.721  70.944  -37.803 1.00 97.20  ? 279 GLY A N   1 
ATOM   2001  C CA  . GLY A 1 253 ? 35.056  70.676  -37.303 1.00 98.22  ? 279 GLY A CA  1 
ATOM   2002  C C   . GLY A 1 253 ? 34.981  70.464  -35.803 1.00 98.79  ? 279 GLY A C   1 
ATOM   2003  O O   . GLY A 1 253 ? 35.656  69.596  -35.249 1.00 98.69  ? 279 GLY A O   1 
ATOM   2004  N N   . ALA A 1 254 ? 34.139  71.268  -35.157 1.00 99.41  ? 280 ALA A N   1 
ATOM   2005  C CA  . ALA A 1 254 ? 33.916  71.213  -33.714 1.00 99.92  ? 280 ALA A CA  1 
ATOM   2006  C C   . ALA A 1 254 ? 33.232  72.500  -33.253 1.00 100.38 ? 280 ALA A C   1 
ATOM   2007  O O   . ALA A 1 254 ? 32.615  72.538  -32.186 1.00 100.41 ? 280 ALA A O   1 
ATOM   2008  C CB  . ALA A 1 254 ? 35.236  71.028  -32.971 1.00 99.95  ? 280 ALA A CB  1 
ATOM   2009  N N   . GLY A 1 255 ? 33.349  73.550  -34.066 1.00 100.19 ? 281 GLY A N   1 
ATOM   2010  C CA  . GLY A 1 255 ? 32.740  74.830  -33.740 1.00 99.14  ? 281 GLY A CA  1 
ATOM   2011  C C   . GLY A 1 255 ? 31.607  75.194  -34.684 1.00 98.26  ? 281 GLY A C   1 
ATOM   2012  O O   . GLY A 1 255 ? 30.462  75.347  -34.251 1.00 97.91  ? 281 GLY A O   1 
ATOM   2013  N N   . PRO A 1 256 ? 31.894  75.351  -35.987 1.00 97.30  ? 282 PRO A N   1 
ATOM   2014  C CA  . PRO A 1 256 ? 30.867  75.697  -36.974 1.00 95.65  ? 282 PRO A CA  1 
ATOM   2015  C C   . PRO A 1 256 ? 29.983  74.480  -37.226 1.00 93.46  ? 282 PRO A C   1 
ATOM   2016  O O   . PRO A 1 256 ? 30.035  73.870  -38.296 1.00 93.40  ? 282 PRO A O   1 
ATOM   2017  C CB  . PRO A 1 256 ? 31.690  76.081  -38.197 1.00 96.66  ? 282 PRO A CB  1 
ATOM   2018  C CG  . PRO A 1 256 ? 32.853  75.137  -38.102 1.00 97.70  ? 282 PRO A CG  1 
ATOM   2019  C CD  . PRO A 1 256 ? 33.215  75.221  -36.632 1.00 97.64  ? 282 PRO A CD  1 
ATOM   2020  N N   . MET A 1 257 ? 29.177  74.129  -36.231 1.00 90.62  ? 283 MET A N   1 
ATOM   2021  C CA  . MET A 1 257 ? 28.304  72.970  -36.333 1.00 88.13  ? 283 MET A CA  1 
ATOM   2022  C C   . MET A 1 257 ? 27.040  73.222  -37.141 1.00 85.80  ? 283 MET A C   1 
ATOM   2023  O O   . MET A 1 257 ? 26.150  73.954  -36.710 1.00 85.89  ? 283 MET A O   1 
ATOM   2024  C CB  . MET A 1 257 ? 27.926  72.475  -34.937 1.00 88.17  ? 283 MET A CB  1 
ATOM   2025  C CG  . MET A 1 257 ? 27.057  71.233  -34.945 1.00 87.64  ? 283 MET A CG  1 
ATOM   2026  S SD  . MET A 1 257 ? 26.714  70.639  -33.290 1.00 86.03  ? 283 MET A SD  1 
ATOM   2027  C CE  . MET A 1 257 ? 25.298  71.632  -32.866 1.00 88.21  ? 283 MET A CE  1 
ATOM   2028  N N   . VAL A 1 258 ? 26.971  72.602  -38.314 1.00 82.84  ? 284 VAL A N   1 
ATOM   2029  C CA  . VAL A 1 258 ? 25.816  72.733  -39.192 1.00 79.27  ? 284 VAL A CA  1 
ATOM   2030  C C   . VAL A 1 258 ? 24.914  71.516  -38.996 1.00 75.65  ? 284 VAL A C   1 
ATOM   2031  O O   . VAL A 1 258 ? 25.339  70.380  -39.209 1.00 74.77  ? 284 VAL A O   1 
ATOM   2032  C CB  . VAL A 1 258 ? 26.246  72.798  -40.677 1.00 80.68  ? 284 VAL A CB  1 
ATOM   2033  C CG1 . VAL A 1 258 ? 25.036  73.065  -41.560 1.00 80.97  ? 284 VAL A CG1 1 
ATOM   2034  C CG2 . VAL A 1 258 ? 27.298  73.877  -40.870 1.00 81.49  ? 284 VAL A CG2 1 
ATOM   2035  N N   . VAL A 1 259 ? 23.674  71.753  -38.579 1.00 71.36  ? 285 VAL A N   1 
ATOM   2036  C CA  . VAL A 1 259 ? 22.730  70.666  -38.367 1.00 67.47  ? 285 VAL A CA  1 
ATOM   2037  C C   . VAL A 1 259 ? 21.513  70.862  -39.257 1.00 64.74  ? 285 VAL A C   1 
ATOM   2038  O O   . VAL A 1 259 ? 20.921  71.938  -39.288 1.00 64.42  ? 285 VAL A O   1 
ATOM   2039  C CB  . VAL A 1 259 ? 22.269  70.596  -36.902 1.00 67.16  ? 285 VAL A CB  1 
ATOM   2040  C CG1 . VAL A 1 259 ? 21.410  69.365  -36.690 1.00 66.52  ? 285 VAL A CG1 1 
ATOM   2041  C CG2 . VAL A 1 259 ? 23.472  70.559  -35.983 1.00 68.27  ? 285 VAL A CG2 1 
ATOM   2042  N N   . SER A 1 260 ? 21.143  69.812  -39.979 1.00 62.03  ? 286 SER A N   1 
ATOM   2043  C CA  . SER A 1 260 ? 20.007  69.871  -40.884 1.00 60.64  ? 286 SER A CA  1 
ATOM   2044  C C   . SER A 1 260 ? 19.058  68.692  -40.708 1.00 59.52  ? 286 SER A C   1 
ATOM   2045  O O   . SER A 1 260 ? 19.489  67.544  -40.630 1.00 60.25  ? 286 SER A O   1 
ATOM   2046  C CB  . SER A 1 260 ? 20.512  69.931  -42.328 1.00 61.17  ? 286 SER A CB  1 
ATOM   2047  O OG  . SER A 1 260 ? 21.619  69.066  -42.517 1.00 60.01  ? 286 SER A OG  1 
ATOM   2048  N N   . LEU A 1 261 ? 17.763  68.987  -40.642 1.00 58.15  ? 287 LEU A N   1 
ATOM   2049  C CA  . LEU A 1 261 ? 16.737  67.962  -40.476 1.00 57.80  ? 287 LEU A CA  1 
ATOM   2050  C C   . LEU A 1 261 ? 16.781  67.038  -41.680 1.00 56.72  ? 287 LEU A C   1 
ATOM   2051  O O   . LEU A 1 261 ? 17.091  67.476  -42.783 1.00 59.45  ? 287 LEU A O   1 
ATOM   2052  C CB  . LEU A 1 261 ? 15.356  68.606  -40.389 1.00 58.38  ? 287 LEU A CB  1 
ATOM   2053  C CG  . LEU A 1 261 ? 14.247  67.716  -39.832 1.00 61.55  ? 287 LEU A CG  1 
ATOM   2054  C CD1 . LEU A 1 261 ? 14.432  67.597  -38.325 1.00 61.52  ? 287 LEU A CD1 1 
ATOM   2055  C CD2 . LEU A 1 261 ? 12.876  68.305  -40.150 1.00 61.10  ? 287 LEU A CD2 1 
ATOM   2056  N N   . VAL A 1 262 ? 16.477  65.762  -41.478 1.00 55.02  ? 288 VAL A N   1 
ATOM   2057  C CA  . VAL A 1 262 ? 16.494  64.805  -42.579 1.00 52.27  ? 288 VAL A CA  1 
ATOM   2058  C C   . VAL A 1 262 ? 15.241  63.961  -42.525 1.00 51.55  ? 288 VAL A C   1 
ATOM   2059  O O   . VAL A 1 262 ? 14.745  63.494  -43.543 1.00 52.64  ? 288 VAL A O   1 
ATOM   2060  C CB  . VAL A 1 262 ? 17.705  63.870  -42.499 1.00 51.47  ? 288 VAL A CB  1 
ATOM   2061  C CG1 . VAL A 1 262 ? 17.698  62.920  -43.681 1.00 51.47  ? 288 VAL A CG1 1 
ATOM   2062  C CG2 . VAL A 1 262 ? 18.984  64.680  -42.473 1.00 50.74  ? 288 VAL A CG2 1 
ATOM   2063  N N   . ALA A 1 263 ? 14.746  63.764  -41.315 1.00 50.19  ? 289 ALA A N   1 
ATOM   2064  C CA  . ALA A 1 263 ? 13.543  62.995  -41.088 1.00 52.10  ? 289 ALA A CA  1 
ATOM   2065  C C   . ALA A 1 263 ? 12.927  63.633  -39.866 1.00 55.02  ? 289 ALA A C   1 
ATOM   2066  O O   . ALA A 1 263 ? 13.575  63.766  -38.829 1.00 55.47  ? 289 ALA A O   1 
ATOM   2067  C CB  . ALA A 1 263 ? 13.880  61.549  -40.816 1.00 51.25  ? 289 ALA A CB  1 
ATOM   2068  N N   . ASP A 1 264 ? 11.675  64.046  -39.994 1.00 58.40  ? 290 ASP A N   1 
ATOM   2069  C CA  . ASP A 1 264 ? 10.992  64.699  -38.895 1.00 60.40  ? 290 ASP A CA  1 
ATOM   2070  C C   . ASP A 1 264 ? 10.286  63.683  -38.019 1.00 59.33  ? 290 ASP A C   1 
ATOM   2071  O O   . ASP A 1 264 ? 9.871   63.999  -36.906 1.00 58.78  ? 290 ASP A O   1 
ATOM   2072  C CB  . ASP A 1 264 ? 9.970   65.701  -39.437 1.00 64.51  ? 290 ASP A CB  1 
ATOM   2073  C CG  . ASP A 1 264 ? 9.427   66.620  -38.357 1.00 69.31  ? 290 ASP A CG  1 
ATOM   2074  O OD1 . ASP A 1 264 ? 8.371   67.253  -38.583 1.00 71.79  ? 290 ASP A OD1 1 
ATOM   2075  O OD2 . ASP A 1 264 ? 10.064  66.716  -37.284 1.00 71.13  ? 290 ASP A OD2 1 
ATOM   2076  N N   . GLU A 1 265 ? 10.172  62.452  -38.503 1.00 58.57  ? 291 GLU A N   1 
ATOM   2077  C CA  . GLU A 1 265 ? 9.459   61.451  -37.731 1.00 59.19  ? 291 GLU A CA  1 
ATOM   2078  C C   . GLU A 1 265 ? 9.815   60.004  -38.073 1.00 57.22  ? 291 GLU A C   1 
ATOM   2079  O O   . GLU A 1 265 ? 9.837   59.617  -39.244 1.00 57.19  ? 291 GLU A O   1 
ATOM   2080  C CB  . GLU A 1 265 ? 7.963   61.689  -37.933 1.00 62.48  ? 291 GLU A CB  1 
ATOM   2081  C CG  . GLU A 1 265 ? 7.032   60.955  -36.999 1.00 67.72  ? 291 GLU A CG  1 
ATOM   2082  C CD  . GLU A 1 265 ? 5.590   61.390  -37.200 1.00 71.24  ? 291 GLU A CD  1 
ATOM   2083  O OE1 . GLU A 1 265 ? 5.343   62.241  -38.087 1.00 71.28  ? 291 GLU A OE1 1 
ATOM   2084  O OE2 . GLU A 1 265 ? 4.706   60.883  -36.475 1.00 72.87  ? 291 GLU A OE2 1 
ATOM   2085  N N   . ASN A 1 266 ? 10.091  59.218  -37.035 1.00 54.64  ? 292 ASN A N   1 
ATOM   2086  C CA  . ASN A 1 266 ? 10.420  57.801  -37.171 1.00 51.63  ? 292 ASN A CA  1 
ATOM   2087  C C   . ASN A 1 266 ? 9.093   57.071  -37.362 1.00 49.83  ? 292 ASN A C   1 
ATOM   2088  O O   . ASN A 1 266 ? 8.048   57.597  -36.992 1.00 51.00  ? 292 ASN A O   1 
ATOM   2089  C CB  . ASN A 1 266 ? 11.095  57.297  -35.896 1.00 49.80  ? 292 ASN A CB  1 
ATOM   2090  C CG  . ASN A 1 266 ? 10.189  57.405  -34.677 1.00 51.34  ? 292 ASN A CG  1 
ATOM   2091  O OD1 . ASN A 1 266 ? 9.865   56.404  -34.038 1.00 52.29  ? 292 ASN A OD1 1 
ATOM   2092  N ND2 . ASN A 1 266 ? 9.774   58.623  -34.352 1.00 49.82  ? 292 ASN A ND2 1 
ATOM   2093  N N   . PRO A 1 267 ? 9.110   55.847  -37.924 1.00 48.68  ? 293 PRO A N   1 
ATOM   2094  C CA  . PRO A 1 267 ? 10.245  55.053  -38.411 1.00 47.50  ? 293 PRO A CA  1 
ATOM   2095  C C   . PRO A 1 267 ? 11.053  55.742  -39.498 1.00 45.93  ? 293 PRO A C   1 
ATOM   2096  O O   . PRO A 1 267 ? 10.495  56.276  -40.454 1.00 47.77  ? 293 PRO A O   1 
ATOM   2097  C CB  . PRO A 1 267 ? 9.575   53.781  -38.923 1.00 47.89  ? 293 PRO A CB  1 
ATOM   2098  C CG  . PRO A 1 267 ? 8.377   53.657  -38.040 1.00 47.08  ? 293 PRO A CG  1 
ATOM   2099  C CD  . PRO A 1 267 ? 7.866   55.068  -38.023 1.00 47.05  ? 293 PRO A CD  1 
ATOM   2100  N N   . PHE A 1 268 ? 12.370  55.727  -39.346 1.00 43.54  ? 294 PHE A N   1 
ATOM   2101  C CA  . PHE A 1 268 ? 13.245  56.347  -40.324 1.00 41.36  ? 294 PHE A CA  1 
ATOM   2102  C C   . PHE A 1 268 ? 13.579  55.323  -41.408 1.00 41.25  ? 294 PHE A C   1 
ATOM   2103  O O   . PHE A 1 268 ? 13.386  54.120  -41.216 1.00 40.72  ? 294 PHE A O   1 
ATOM   2104  C CB  . PHE A 1 268 ? 14.542  56.814  -39.656 1.00 39.47  ? 294 PHE A CB  1 
ATOM   2105  C CG  . PHE A 1 268 ? 14.336  57.771  -38.512 1.00 38.00  ? 294 PHE A CG  1 
ATOM   2106  C CD1 . PHE A 1 268 ? 13.706  58.992  -38.711 1.00 37.97  ? 294 PHE A CD1 1 
ATOM   2107  C CD2 . PHE A 1 268 ? 14.810  57.465  -37.238 1.00 38.22  ? 294 PHE A CD2 1 
ATOM   2108  C CE1 . PHE A 1 268 ? 13.552  59.897  -37.665 1.00 36.74  ? 294 PHE A CE1 1 
ATOM   2109  C CE2 . PHE A 1 268 ? 14.661  58.363  -36.185 1.00 34.94  ? 294 PHE A CE2 1 
ATOM   2110  C CZ  . PHE A 1 268 ? 14.030  59.582  -36.401 1.00 37.36  ? 294 PHE A CZ  1 
ATOM   2111  N N   . ALA A 1 269 ? 14.069  55.800  -42.549 1.00 38.92  ? 295 ALA A N   1 
ATOM   2112  C CA  . ALA A 1 269 ? 14.454  54.901  -43.629 1.00 39.08  ? 295 ALA A CA  1 
ATOM   2113  C C   . ALA A 1 269 ? 15.939  54.614  -43.456 1.00 38.32  ? 295 ALA A C   1 
ATOM   2114  O O   . ALA A 1 269 ? 16.720  55.509  -43.132 1.00 37.79  ? 295 ALA A O   1 
ATOM   2115  C CB  . ALA A 1 269 ? 14.200  55.550  -44.987 1.00 39.49  ? 295 ALA A CB  1 
ATOM   2116  N N   . GLN A 1 270 ? 16.332  53.365  -43.654 1.00 37.93  ? 296 GLN A N   1 
ATOM   2117  C CA  . GLN A 1 270 ? 17.732  53.011  -43.512 1.00 38.21  ? 296 GLN A CA  1 
ATOM   2118  C C   . GLN A 1 270 ? 18.545  53.776  -44.549 1.00 39.05  ? 296 GLN A C   1 
ATOM   2119  O O   . GLN A 1 270 ? 19.743  54.005  -44.374 1.00 37.62  ? 296 GLN A O   1 
ATOM   2120  C CB  . GLN A 1 270 ? 17.900  51.502  -43.689 1.00 36.96  ? 296 GLN A CB  1 
ATOM   2121  C CG  . GLN A 1 270 ? 19.335  51.019  -43.722 1.00 35.33  ? 296 GLN A CG  1 
ATOM   2122  C CD  . GLN A 1 270 ? 19.435  49.525  -43.485 1.00 35.22  ? 296 GLN A CD  1 
ATOM   2123  O OE1 . GLN A 1 270 ? 18.494  48.775  -43.768 1.00 30.21  ? 296 GLN A OE1 1 
ATOM   2124  N NE2 . GLN A 1 270 ? 20.582  49.079  -42.969 1.00 32.52  ? 296 GLN A NE2 1 
ATOM   2125  N N   . GLY A 1 271 ? 17.869  54.188  -45.617 1.00 41.73  ? 297 GLY A N   1 
ATOM   2126  C CA  . GLY A 1 271 ? 18.517  54.915  -46.694 1.00 43.42  ? 297 GLY A CA  1 
ATOM   2127  C C   . GLY A 1 271 ? 19.040  56.290  -46.333 1.00 45.49  ? 297 GLY A C   1 
ATOM   2128  O O   . GLY A 1 271 ? 20.042  56.740  -46.889 1.00 46.51  ? 297 GLY A O   1 
ATOM   2129  N N   . ALA A 1 272 ? 18.372  56.970  -45.408 1.00 46.25  ? 298 ALA A N   1 
ATOM   2130  C CA  . ALA A 1 272 ? 18.801  58.303  -45.002 1.00 46.73  ? 298 ALA A CA  1 
ATOM   2131  C C   . ALA A 1 272 ? 20.247  58.286  -44.499 1.00 48.27  ? 298 ALA A C   1 
ATOM   2132  O O   . ALA A 1 272 ? 20.901  59.324  -44.432 1.00 49.52  ? 298 ALA A O   1 
ATOM   2133  C CB  . ALA A 1 272 ? 17.874  58.842  -43.923 1.00 42.97  ? 298 ALA A CB  1 
ATOM   2134  N N   . LEU A 1 273 ? 20.746  57.104  -44.159 1.00 47.49  ? 299 LEU A N   1 
ATOM   2135  C CA  . LEU A 1 273 ? 22.107  56.969  -43.659 1.00 48.37  ? 299 LEU A CA  1 
ATOM   2136  C C   . LEU A 1 273 ? 23.151  56.911  -44.768 1.00 51.70  ? 299 LEU A C   1 
ATOM   2137  O O   . LEU A 1 273 ? 23.245  55.920  -45.494 1.00 55.22  ? 299 LEU A O   1 
ATOM   2138  C CB  . LEU A 1 273 ? 22.211  55.719  -42.788 1.00 43.96  ? 299 LEU A CB  1 
ATOM   2139  C CG  . LEU A 1 273 ? 22.121  55.899  -41.274 1.00 40.48  ? 299 LEU A CG  1 
ATOM   2140  C CD1 . LEU A 1 273 ? 21.085  56.950  -40.903 1.00 38.55  ? 299 LEU A CD1 1 
ATOM   2141  C CD2 . LEU A 1 273 ? 21.791  54.552  -40.657 1.00 39.01  ? 299 LEU A CD2 1 
ATOM   2142  N N   . ARG A 1 274 ? 23.948  57.970  -44.876 1.00 54.01  ? 300 ARG A N   1 
ATOM   2143  C CA  . ARG A 1 274 ? 24.997  58.074  -45.891 1.00 53.73  ? 300 ARG A CA  1 
ATOM   2144  C C   . ARG A 1 274 ? 26.388  57.862  -45.274 1.00 51.59  ? 300 ARG A C   1 
ATOM   2145  O O   . ARG A 1 274 ? 26.750  58.524  -44.306 1.00 52.00  ? 300 ARG A O   1 
ATOM   2146  C CB  . ARG A 1 274 ? 24.923  59.457  -46.538 1.00 57.83  ? 300 ARG A CB  1 
ATOM   2147  C CG  . ARG A 1 274 ? 23.520  59.864  -46.964 1.00 62.10  ? 300 ARG A CG  1 
ATOM   2148  C CD  . ARG A 1 274 ? 23.244  59.499  -48.410 1.00 67.10  ? 300 ARG A CD  1 
ATOM   2149  N NE  . ARG A 1 274 ? 24.107  60.249  -49.321 1.00 70.61  ? 300 ARG A NE  1 
ATOM   2150  C CZ  . ARG A 1 274 ? 24.054  60.162  -50.647 1.00 71.68  ? 300 ARG A CZ  1 
ATOM   2151  N NH1 . ARG A 1 274 ? 23.176  59.352  -51.227 1.00 71.52  ? 300 ARG A NH1 1 
ATOM   2152  N NH2 . ARG A 1 274 ? 24.879  60.885  -51.393 1.00 71.48  ? 300 ARG A NH2 1 
ATOM   2153  N N   . SER A 1 275 ? 27.170  56.953  -45.847 1.00 49.88  ? 301 SER A N   1 
ATOM   2154  C CA  . SER A 1 275 ? 28.509  56.648  -45.340 1.00 49.64  ? 301 SER A CA  1 
ATOM   2155  C C   . SER A 1 275 ? 29.519  57.787  -45.322 1.00 49.65  ? 301 SER A C   1 
ATOM   2156  O O   . SER A 1 275 ? 30.556  57.675  -44.669 1.00 49.47  ? 301 SER A O   1 
ATOM   2157  C CB  . SER A 1 275 ? 29.122  55.493  -46.130 1.00 49.97  ? 301 SER A CB  1 
ATOM   2158  O OG  . SER A 1 275 ? 28.449  54.277  -45.874 1.00 54.91  ? 301 SER A OG  1 
ATOM   2159  N N   . GLU A 1 276 ? 29.243  58.868  -46.044 1.00 51.05  ? 302 GLU A N   1 
ATOM   2160  C CA  . GLU A 1 276 ? 30.174  59.992  -46.087 1.00 52.73  ? 302 GLU A CA  1 
ATOM   2161  C C   . GLU A 1 276 ? 29.912  60.982  -44.965 1.00 51.80  ? 302 GLU A C   1 
ATOM   2162  O O   . GLU A 1 276 ? 30.704  61.902  -44.740 1.00 51.46  ? 302 GLU A O   1 
ATOM   2163  C CB  . GLU A 1 276 ? 30.073  60.742  -47.420 1.00 56.75  ? 302 GLU A CB  1 
ATOM   2164  C CG  . GLU A 1 276 ? 30.410  59.931  -48.658 1.00 61.22  ? 302 GLU A CG  1 
ATOM   2165  C CD  . GLU A 1 276 ? 29.384  58.856  -48.949 1.00 64.18  ? 302 GLU A CD  1 
ATOM   2166  O OE1 . GLU A 1 276 ? 28.171  59.168  -48.915 1.00 65.17  ? 302 GLU A OE1 1 
ATOM   2167  O OE2 . GLU A 1 276 ? 29.793  57.704  -49.222 1.00 66.20  ? 302 GLU A OE2 1 
ATOM   2168  N N   . ASP A 1 277 ? 28.804  60.798  -44.257 1.00 50.54  ? 303 ASP A N   1 
ATOM   2169  C CA  . ASP A 1 277 ? 28.461  61.721  -43.183 1.00 49.16  ? 303 ASP A CA  1 
ATOM   2170  C C   . ASP A 1 277 ? 28.225  61.097  -41.813 1.00 45.05  ? 303 ASP A C   1 
ATOM   2171  O O   . ASP A 1 277 ? 28.376  59.889  -41.608 1.00 40.98  ? 303 ASP A O   1 
ATOM   2172  C CB  . ASP A 1 277 ? 27.216  62.525  -43.572 1.00 52.17  ? 303 ASP A CB  1 
ATOM   2173  C CG  . ASP A 1 277 ? 27.308  63.107  -44.970 1.00 54.37  ? 303 ASP A CG  1 
ATOM   2174  O OD1 . ASP A 1 277 ? 28.273  63.852  -45.248 1.00 55.90  ? 303 ASP A OD1 1 
ATOM   2175  O OD2 . ASP A 1 277 ? 26.410  62.819  -45.788 1.00 55.57  ? 303 ASP A OD2 1 
ATOM   2176  N N   . CYS A 1 278 ? 27.867  61.969  -40.879 1.00 41.76  ? 304 CYS A N   1 
ATOM   2177  C CA  . CYS A 1 278 ? 27.560  61.596  -39.510 1.00 41.30  ? 304 CYS A CA  1 
ATOM   2178  C C   . CYS A 1 278 ? 26.142  62.080  -39.244 1.00 39.52  ? 304 CYS A C   1 
ATOM   2179  O O   . CYS A 1 278 ? 25.766  63.175  -39.660 1.00 40.96  ? 304 CYS A O   1 
ATOM   2180  C CB  . CYS A 1 278 ? 28.522  62.271  -38.527 1.00 41.95  ? 304 CYS A CB  1 
ATOM   2181  S SG  . CYS A 1 278 ? 30.198  61.594  -38.517 1.00 42.91  ? 304 CYS A SG  1 
ATOM   2182  N N   . PHE A 1 279 ? 25.357  61.257  -38.561 1.00 36.15  ? 305 PHE A N   1 
ATOM   2183  C CA  . PHE A 1 279 ? 23.985  61.607  -38.243 1.00 33.10  ? 305 PHE A CA  1 
ATOM   2184  C C   . PHE A 1 279 ? 23.752  61.563  -36.749 1.00 33.00  ? 305 PHE A C   1 
ATOM   2185  O O   . PHE A 1 279 ? 24.492  60.919  -36.010 1.00 31.01  ? 305 PHE A O   1 
ATOM   2186  C CB  . PHE A 1 279 ? 23.018  60.642  -38.928 1.00 33.23  ? 305 PHE A CB  1 
ATOM   2187  C CG  . PHE A 1 279 ? 23.047  60.722  -40.420 1.00 33.19  ? 305 PHE A CG  1 
ATOM   2188  C CD1 . PHE A 1 279 ? 24.147  60.260  -41.130 1.00 32.83  ? 305 PHE A CD1 1 
ATOM   2189  C CD2 . PHE A 1 279 ? 21.996  61.303  -41.114 1.00 32.39  ? 305 PHE A CD2 1 
ATOM   2190  C CE1 . PHE A 1 279 ? 24.202  60.376  -42.506 1.00 32.93  ? 305 PHE A CE1 1 
ATOM   2191  C CE2 . PHE A 1 279 ? 22.042  61.423  -42.489 1.00 33.16  ? 305 PHE A CE2 1 
ATOM   2192  C CZ  . PHE A 1 279 ? 23.149  60.960  -43.187 1.00 33.76  ? 305 PHE A CZ  1 
ATOM   2193  N N   . ILE A 1 280 ? 22.712  62.259  -36.314 1.00 33.14  ? 306 ILE A N   1 
ATOM   2194  C CA  . ILE A 1 280 ? 22.346  62.294  -34.915 1.00 31.63  ? 306 ILE A CA  1 
ATOM   2195  C C   . ILE A 1 280 ? 20.897  61.869  -34.810 1.00 33.51  ? 306 ILE A C   1 
ATOM   2196  O O   . ILE A 1 280 ? 20.013  62.517  -35.363 1.00 32.05  ? 306 ILE A O   1 
ATOM   2197  C CB  . ILE A 1 280 ? 22.525  63.712  -34.320 1.00 33.51  ? 306 ILE A CB  1 
ATOM   2198  C CG1 . ILE A 1 280 ? 24.018  64.006  -34.152 1.00 32.92  ? 306 ILE A CG1 1 
ATOM   2199  C CG2 . ILE A 1 280 ? 21.795  63.836  -32.981 1.00 29.91  ? 306 ILE A CG2 1 
ATOM   2200  C CD1 . ILE A 1 280 ? 24.310  65.365  -33.586 1.00 34.32  ? 306 ILE A CD1 1 
ATOM   2201  N N   . LEU A 1 281 ? 20.673  60.747  -34.133 1.00 36.16  ? 307 LEU A N   1 
ATOM   2202  C CA  . LEU A 1 281 ? 19.333  60.228  -33.910 1.00 36.70  ? 307 LEU A CA  1 
ATOM   2203  C C   . LEU A 1 281 ? 18.941  60.979  -32.644 1.00 38.52  ? 307 LEU A C   1 
ATOM   2204  O O   . LEU A 1 281 ? 19.542  60.783  -31.590 1.00 39.32  ? 307 LEU A O   1 
ATOM   2205  C CB  . LEU A 1 281 ? 19.393  58.722  -33.646 1.00 38.09  ? 307 LEU A CB  1 
ATOM   2206  C CG  . LEU A 1 281 ? 18.142  57.824  -33.592 1.00 39.61  ? 307 LEU A CG  1 
ATOM   2207  C CD1 . LEU A 1 281 ? 17.023  58.502  -32.810 1.00 35.72  ? 307 LEU A CD1 1 
ATOM   2208  C CD2 . LEU A 1 281 ? 17.691  57.490  -34.995 1.00 36.38  ? 307 LEU A CD2 1 
ATOM   2209  N N   . ASP A 1 282 ? 17.954  61.859  -32.755 1.00 39.46  ? 308 ASP A N   1 
ATOM   2210  C CA  . ASP A 1 282 ? 17.521  62.653  -31.616 1.00 39.14  ? 308 ASP A CA  1 
ATOM   2211  C C   . ASP A 1 282 ? 16.295  62.091  -30.904 1.00 36.63  ? 308 ASP A C   1 
ATOM   2212  O O   . ASP A 1 282 ? 15.168  62.246  -31.361 1.00 34.91  ? 308 ASP A O   1 
ATOM   2213  C CB  . ASP A 1 282 ? 17.244  64.090  -32.072 1.00 41.78  ? 308 ASP A CB  1 
ATOM   2214  C CG  . ASP A 1 282 ? 16.909  65.022  -30.918 1.00 44.12  ? 308 ASP A CG  1 
ATOM   2215  O OD1 . ASP A 1 282 ? 16.610  66.203  -31.192 1.00 47.08  ? 308 ASP A OD1 1 
ATOM   2216  O OD2 . ASP A 1 282 ? 16.947  64.591  -29.742 1.00 45.84  ? 308 ASP A OD2 1 
ATOM   2217  N N   . HIS A 1 283 ? 16.537  61.444  -29.774 1.00 36.99  ? 309 HIS A N   1 
ATOM   2218  C CA  . HIS A 1 283 ? 15.477  60.871  -28.958 1.00 40.59  ? 309 HIS A CA  1 
ATOM   2219  C C   . HIS A 1 283 ? 15.542  61.596  -27.609 1.00 42.39  ? 309 HIS A C   1 
ATOM   2220  O O   . HIS A 1 283 ? 15.290  61.007  -26.558 1.00 41.47  ? 309 HIS A O   1 
ATOM   2221  C CB  . HIS A 1 283 ? 15.722  59.367  -28.777 1.00 40.70  ? 309 HIS A CB  1 
ATOM   2222  C CG  . HIS A 1 283 ? 14.551  58.607  -28.231 1.00 40.46  ? 309 HIS A CG  1 
ATOM   2223  N ND1 . HIS A 1 283 ? 13.263  58.781  -28.693 1.00 39.99  ? 309 HIS A ND1 1 
ATOM   2224  C CD2 . HIS A 1 283 ? 14.491  57.606  -27.321 1.00 40.75  ? 309 HIS A CD2 1 
ATOM   2225  C CE1 . HIS A 1 283 ? 12.461  57.917  -28.094 1.00 40.76  ? 309 HIS A CE1 1 
ATOM   2226  N NE2 . HIS A 1 283 ? 13.180  57.192  -27.257 1.00 39.63  ? 309 HIS A NE2 1 
ATOM   2227  N N   . GLY A 1 284 ? 15.883  62.883  -27.661 1.00 44.58  ? 310 GLY A N   1 
ATOM   2228  C CA  . GLY A 1 284 ? 16.002  63.688  -26.461 1.00 46.30  ? 310 GLY A CA  1 
ATOM   2229  C C   . GLY A 1 284 ? 14.798  63.687  -25.543 1.00 47.80  ? 310 GLY A C   1 
ATOM   2230  O O   . GLY A 1 284 ? 14.949  63.753  -24.321 1.00 47.18  ? 310 GLY A O   1 
ATOM   2231  N N   . LYS A 1 285 ? 13.600  63.616  -26.116 1.00 50.67  ? 311 LYS A N   1 
ATOM   2232  C CA  . LYS A 1 285 ? 12.375  63.613  -25.315 1.00 54.48  ? 311 LYS A CA  1 
ATOM   2233  C C   . LYS A 1 285 ? 12.355  62.452  -24.326 1.00 53.66  ? 311 LYS A C   1 
ATOM   2234  O O   . LYS A 1 285 ? 11.540  62.425  -23.405 1.00 54.62  ? 311 LYS A O   1 
ATOM   2235  C CB  . LYS A 1 285 ? 11.140  63.545  -26.221 1.00 58.51  ? 311 LYS A CB  1 
ATOM   2236  C CG  . LYS A 1 285 ? 11.028  64.703  -27.208 1.00 63.84  ? 311 LYS A CG  1 
ATOM   2237  C CD  . LYS A 1 285 ? 11.097  66.055  -26.502 1.00 66.50  ? 311 LYS A CD  1 
ATOM   2238  C CE  . LYS A 1 285 ? 11.044  67.200  -27.502 1.00 67.70  ? 311 LYS A CE  1 
ATOM   2239  N NZ  . LYS A 1 285 ? 11.252  68.520  -26.844 1.00 69.48  ? 311 LYS A NZ  1 
ATOM   2240  N N   . ASP A 1 286 ? 13.254  61.492  -24.529 1.00 51.67  ? 312 ASP A N   1 
ATOM   2241  C CA  . ASP A 1 286 ? 13.363  60.340  -23.643 1.00 48.22  ? 312 ASP A CA  1 
ATOM   2242  C C   . ASP A 1 286 ? 14.789  60.292  -23.084 1.00 45.63  ? 312 ASP A C   1 
ATOM   2243  O O   . ASP A 1 286 ? 15.290  59.224  -22.723 1.00 42.95  ? 312 ASP A O   1 
ATOM   2244  C CB  . ASP A 1 286 ? 13.062  59.043  -24.399 1.00 49.10  ? 312 ASP A CB  1 
ATOM   2245  C CG  . ASP A 1 286 ? 12.662  57.904  -23.471 1.00 49.65  ? 312 ASP A CG  1 
ATOM   2246  O OD1 . ASP A 1 286 ? 12.895  56.728  -23.822 1.00 48.64  ? 312 ASP A OD1 1 
ATOM   2247  O OD2 . ASP A 1 286 ? 12.099  58.186  -22.393 1.00 50.71  ? 312 ASP A OD2 1 
ATOM   2248  N N   . GLY A 1 287 ? 15.430  61.461  -23.043 1.00 43.41  ? 313 GLY A N   1 
ATOM   2249  C CA  . GLY A 1 287 ? 16.786  61.596  -22.525 1.00 42.51  ? 313 GLY A CA  1 
ATOM   2250  C C   . GLY A 1 287 ? 17.878  60.753  -23.164 1.00 41.53  ? 313 GLY A C   1 
ATOM   2251  O O   . GLY A 1 287 ? 18.671  60.144  -22.454 1.00 40.45  ? 313 GLY A O   1 
ATOM   2252  N N   . LYS A 1 288 ? 17.953  60.736  -24.493 1.00 42.71  ? 314 LYS A N   1 
ATOM   2253  C CA  . LYS A 1 288 ? 18.961  59.926  -25.173 1.00 43.38  ? 314 LYS A CA  1 
ATOM   2254  C C   . LYS A 1 288 ? 19.179  60.313  -26.642 1.00 41.98  ? 314 LYS A C   1 
ATOM   2255  O O   . LYS A 1 288 ? 18.223  60.420  -27.409 1.00 42.93  ? 314 LYS A O   1 
ATOM   2256  C CB  . LYS A 1 288 ? 18.543  58.450  -25.100 1.00 46.55  ? 314 LYS A CB  1 
ATOM   2257  C CG  . LYS A 1 288 ? 19.613  57.448  -25.525 1.00 51.66  ? 314 LYS A CG  1 
ATOM   2258  C CD  . LYS A 1 288 ? 19.076  56.017  -25.465 1.00 55.73  ? 314 LYS A CD  1 
ATOM   2259  C CE  . LYS A 1 288 ? 20.189  54.974  -25.571 1.00 57.11  ? 314 LYS A CE  1 
ATOM   2260  N NZ  . LYS A 1 288 ? 21.042  54.933  -24.346 1.00 59.77  ? 314 LYS A NZ  1 
ATOM   2261  N N   . ILE A 1 289 ? 20.430  60.524  -27.035 1.00 37.00  ? 315 ILE A N   1 
ATOM   2262  C CA  . ILE A 1 289 ? 20.715  60.848  -28.427 1.00 34.42  ? 315 ILE A CA  1 
ATOM   2263  C C   . ILE A 1 289 ? 21.783  59.912  -28.966 1.00 32.92  ? 315 ILE A C   1 
ATOM   2264  O O   . ILE A 1 289 ? 22.694  59.518  -28.238 1.00 33.19  ? 315 ILE A O   1 
ATOM   2265  C CB  . ILE A 1 289 ? 21.215  62.293  -28.609 1.00 34.47  ? 315 ILE A CB  1 
ATOM   2266  C CG1 . ILE A 1 289 ? 22.608  62.444  -28.006 1.00 32.39  ? 315 ILE A CG1 1 
ATOM   2267  C CG2 . ILE A 1 289 ? 20.232  63.266  -27.983 1.00 33.43  ? 315 ILE A CG2 1 
ATOM   2268  C CD1 . ILE A 1 289 ? 23.274  63.735  -28.374 1.00 31.11  ? 315 ILE A CD1 1 
ATOM   2269  N N   . PHE A 1 290 ? 21.667  59.558  -30.242 1.00 30.68  ? 316 PHE A N   1 
ATOM   2270  C CA  . PHE A 1 290 ? 22.631  58.667  -30.893 1.00 28.02  ? 316 PHE A CA  1 
ATOM   2271  C C   . PHE A 1 290 ? 23.420  59.442  -31.939 1.00 28.33  ? 316 PHE A C   1 
ATOM   2272  O O   . PHE A 1 290 ? 22.848  60.210  -32.709 1.00 28.76  ? 316 PHE A O   1 
ATOM   2273  C CB  . PHE A 1 290 ? 21.920  57.510  -31.613 1.00 23.55  ? 316 PHE A CB  1 
ATOM   2274  C CG  . PHE A 1 290 ? 21.168  56.576  -30.701 1.00 22.76  ? 316 PHE A CG  1 
ATOM   2275  C CD1 . PHE A 1 290 ? 21.756  55.398  -30.247 1.00 17.78  ? 316 PHE A CD1 1 
ATOM   2276  C CD2 . PHE A 1 290 ? 19.872  56.883  -30.286 1.00 24.39  ? 316 PHE A CD2 1 
ATOM   2277  C CE1 . PHE A 1 290 ? 21.068  54.536  -29.389 1.00 17.81  ? 316 PHE A CE1 1 
ATOM   2278  C CE2 . PHE A 1 290 ? 19.165  56.029  -29.420 1.00 22.05  ? 316 PHE A CE2 1 
ATOM   2279  C CZ  . PHE A 1 290 ? 19.769  54.854  -28.973 1.00 22.17  ? 316 PHE A CZ  1 
ATOM   2280  N N   . VAL A 1 291 ? 24.733  59.254  -31.951 1.00 29.01  ? 317 VAL A N   1 
ATOM   2281  C CA  . VAL A 1 291 ? 25.584  59.881  -32.948 1.00 30.39  ? 317 VAL A CA  1 
ATOM   2282  C C   . VAL A 1 291 ? 26.032  58.712  -33.825 1.00 31.20  ? 317 VAL A C   1 
ATOM   2283  O O   . VAL A 1 291 ? 26.587  57.734  -33.329 1.00 28.86  ? 317 VAL A O   1 
ATOM   2284  C CB  . VAL A 1 291 ? 26.818  60.568  -32.322 1.00 33.46  ? 317 VAL A CB  1 
ATOM   2285  C CG1 . VAL A 1 291 ? 27.715  61.114  -33.419 1.00 33.11  ? 317 VAL A CG1 1 
ATOM   2286  C CG2 . VAL A 1 291 ? 26.383  61.702  -31.404 1.00 33.06  ? 317 VAL A CG2 1 
ATOM   2287  N N   . TRP A 1 292 ? 25.765  58.808  -35.124 1.00 33.84  ? 318 TRP A N   1 
ATOM   2288  C CA  . TRP A 1 292 ? 26.112  57.757  -36.078 1.00 33.68  ? 318 TRP A CA  1 
ATOM   2289  C C   . TRP A 1 292 ? 27.275  58.188  -36.976 1.00 34.95  ? 318 TRP A C   1 
ATOM   2290  O O   . TRP A 1 292 ? 27.218  59.233  -37.616 1.00 34.83  ? 318 TRP A O   1 
ATOM   2291  C CB  . TRP A 1 292 ? 24.886  57.450  -36.934 1.00 33.72  ? 318 TRP A CB  1 
ATOM   2292  C CG  . TRP A 1 292 ? 24.993  56.224  -37.767 1.00 36.08  ? 318 TRP A CG  1 
ATOM   2293  C CD1 . TRP A 1 292 ? 24.737  54.943  -37.377 1.00 35.84  ? 318 TRP A CD1 1 
ATOM   2294  C CD2 . TRP A 1 292 ? 25.347  56.160  -39.156 1.00 38.05  ? 318 TRP A CD2 1 
ATOM   2295  N NE1 . TRP A 1 292 ? 24.903  54.082  -38.438 1.00 36.37  ? 318 TRP A NE1 1 
ATOM   2296  C CE2 . TRP A 1 292 ? 25.277  54.800  -39.540 1.00 35.13  ? 318 TRP A CE2 1 
ATOM   2297  C CE3 . TRP A 1 292 ? 25.714  57.116  -40.112 1.00 36.93  ? 318 TRP A CE3 1 
ATOM   2298  C CZ2 . TRP A 1 292 ? 25.560  54.375  -40.839 1.00 33.88  ? 318 TRP A CZ2 1 
ATOM   2299  C CZ3 . TRP A 1 292 ? 25.995  56.690  -41.406 1.00 36.26  ? 318 TRP A CZ3 1 
ATOM   2300  C CH2 . TRP A 1 292 ? 25.916  55.329  -41.754 1.00 33.96  ? 318 TRP A CH2 1 
ATOM   2301  N N   . LYS A 1 293 ? 28.333  57.390  -37.026 1.00 36.02  ? 319 LYS A N   1 
ATOM   2302  C CA  . LYS A 1 293 ? 29.478  57.730  -37.870 1.00 38.26  ? 319 LYS A CA  1 
ATOM   2303  C C   . LYS A 1 293 ? 29.555  56.876  -39.147 1.00 39.67  ? 319 LYS A C   1 
ATOM   2304  O O   . LYS A 1 293 ? 29.682  55.652  -39.075 1.00 37.34  ? 319 LYS A O   1 
ATOM   2305  C CB  . LYS A 1 293 ? 30.772  57.568  -37.076 1.00 38.20  ? 319 LYS A CB  1 
ATOM   2306  C CG  . LYS A 1 293 ? 30.842  58.405  -35.815 1.00 38.39  ? 319 LYS A CG  1 
ATOM   2307  C CD  . LYS A 1 293 ? 32.141  58.141  -35.059 1.00 38.84  ? 319 LYS A CD  1 
ATOM   2308  C CE  . LYS A 1 293 ? 32.238  56.689  -34.598 1.00 38.03  ? 319 LYS A CE  1 
ATOM   2309  N NZ  . LYS A 1 293 ? 33.523  56.404  -33.915 1.00 39.00  ? 319 LYS A NZ  1 
ATOM   2310  N N   . GLY A 1 294 ? 29.478  57.525  -40.311 1.00 41.14  ? 320 GLY A N   1 
ATOM   2311  C CA  . GLY A 1 294 ? 29.561  56.804  -41.572 1.00 42.28  ? 320 GLY A CA  1 
ATOM   2312  C C   . GLY A 1 294 ? 30.982  56.315  -41.765 1.00 44.11  ? 320 GLY A C   1 
ATOM   2313  O O   . GLY A 1 294 ? 31.922  57.041  -41.453 1.00 44.65  ? 320 GLY A O   1 
ATOM   2314  N N   . LYS A 1 295 ? 31.153  55.102  -42.285 1.00 47.26  ? 321 LYS A N   1 
ATOM   2315  C CA  . LYS A 1 295 ? 32.493  54.549  -42.467 1.00 52.09  ? 321 LYS A CA  1 
ATOM   2316  C C   . LYS A 1 295 ? 33.414  55.324  -43.398 1.00 54.26  ? 321 LYS A C   1 
ATOM   2317  O O   . LYS A 1 295 ? 34.615  55.059  -43.439 1.00 55.09  ? 321 LYS A O   1 
ATOM   2318  C CB  . LYS A 1 295 ? 32.425  53.088  -42.922 1.00 53.58  ? 321 LYS A CB  1 
ATOM   2319  C CG  . LYS A 1 295 ? 31.940  52.856  -44.338 1.00 58.91  ? 321 LYS A CG  1 
ATOM   2320  C CD  . LYS A 1 295 ? 31.980  51.360  -44.652 1.00 62.27  ? 321 LYS A CD  1 
ATOM   2321  C CE  . LYS A 1 295 ? 31.505  51.057  -46.065 1.00 65.36  ? 321 LYS A CE  1 
ATOM   2322  N NZ  . LYS A 1 295 ? 31.520  49.590  -46.349 1.00 65.68  ? 321 LYS A NZ  1 
ATOM   2323  N N   . GLN A 1 296 ? 32.871  56.281  -44.141 1.00 57.03  ? 322 GLN A N   1 
ATOM   2324  C CA  . GLN A 1 296 ? 33.703  57.069  -45.046 1.00 61.16  ? 322 GLN A CA  1 
ATOM   2325  C C   . GLN A 1 296 ? 33.752  58.527  -44.629 1.00 61.73  ? 322 GLN A C   1 
ATOM   2326  O O   . GLN A 1 296 ? 34.131  59.396  -45.410 1.00 61.23  ? 322 GLN A O   1 
ATOM   2327  C CB  . GLN A 1 296 ? 33.192  56.951  -46.481 1.00 63.91  ? 322 GLN A CB  1 
ATOM   2328  C CG  . GLN A 1 296 ? 33.395  55.571  -47.080 1.00 68.29  ? 322 GLN A CG  1 
ATOM   2329  C CD  . GLN A 1 296 ? 32.712  55.411  -48.421 1.00 71.85  ? 322 GLN A CD  1 
ATOM   2330  O OE1 . GLN A 1 296 ? 32.774  54.344  -49.036 1.00 75.27  ? 322 GLN A OE1 1 
ATOM   2331  N NE2 . GLN A 1 296 ? 32.051  56.469  -48.884 1.00 72.88  ? 322 GLN A NE2 1 
ATOM   2332  N N   . ALA A 1 297 ? 33.368  58.788  -43.386 1.00 63.57  ? 323 ALA A N   1 
ATOM   2333  C CA  . ALA A 1 297 ? 33.378  60.141  -42.863 1.00 65.41  ? 323 ALA A CA  1 
ATOM   2334  C C   . ALA A 1 297 ? 34.809  60.543  -42.540 1.00 66.56  ? 323 ALA A C   1 
ATOM   2335  O O   . ALA A 1 297 ? 35.655  59.697  -42.244 1.00 66.13  ? 323 ALA A O   1 
ATOM   2336  C CB  . ALA A 1 297 ? 32.515  60.228  -41.619 1.00 66.04  ? 323 ALA A CB  1 
ATOM   2337  N N   . ASN A 1 298 ? 35.066  61.844  -42.604 1.00 67.97  ? 324 ASN A N   1 
ATOM   2338  C CA  . ASN A 1 298 ? 36.386  62.397  -42.339 1.00 69.01  ? 324 ASN A CA  1 
ATOM   2339  C C   . ASN A 1 298 ? 36.879  61.967  -40.955 1.00 68.64  ? 324 ASN A C   1 
ATOM   2340  O O   . ASN A 1 298 ? 36.075  61.748  -40.048 1.00 67.89  ? 324 ASN A O   1 
ATOM   2341  C CB  . ASN A 1 298 ? 36.310  63.927  -42.421 1.00 71.40  ? 324 ASN A CB  1 
ATOM   2342  C CG  . ASN A 1 298 ? 37.674  64.580  -42.511 1.00 73.86  ? 324 ASN A CG  1 
ATOM   2343  O OD1 . ASN A 1 298 ? 37.818  65.777  -42.245 1.00 74.09  ? 324 ASN A OD1 1 
ATOM   2344  N ND2 . ASN A 1 298 ? 38.682  63.804  -42.902 1.00 75.78  ? 324 ASN A ND2 1 
ATOM   2345  N N   . MET A 1 299 ? 38.196  61.835  -40.803 1.00 68.41  ? 325 MET A N   1 
ATOM   2346  C CA  . MET A 1 299 ? 38.793  61.452  -39.523 1.00 68.01  ? 325 MET A CA  1 
ATOM   2347  C C   . MET A 1 299 ? 38.649  62.595  -38.525 1.00 66.91  ? 325 MET A C   1 
ATOM   2348  O O   . MET A 1 299 ? 38.439  62.374  -37.334 1.00 65.14  ? 325 MET A O   1 
ATOM   2349  C CB  . MET A 1 299 ? 40.283  61.132  -39.691 1.00 69.59  ? 325 MET A CB  1 
ATOM   2350  C CG  . MET A 1 299 ? 41.051  61.070  -38.364 1.00 73.80  ? 325 MET A CG  1 
ATOM   2351  S SD  . MET A 1 299 ? 42.867  61.056  -38.500 1.00 76.13  ? 325 MET A SD  1 
ATOM   2352  C CE  . MET A 1 299 ? 43.210  62.808  -38.867 1.00 73.79  ? 325 MET A CE  1 
ATOM   2353  N N   . GLU A 1 300 ? 38.771  63.820  -39.022 1.00 66.52  ? 326 GLU A N   1 
ATOM   2354  C CA  . GLU A 1 300 ? 38.668  64.996  -38.173 1.00 66.83  ? 326 GLU A CA  1 
ATOM   2355  C C   . GLU A 1 300 ? 37.349  65.084  -37.417 1.00 65.79  ? 326 GLU A C   1 
ATOM   2356  O O   . GLU A 1 300 ? 37.344  65.379  -36.222 1.00 65.66  ? 326 GLU A O   1 
ATOM   2357  C CB  . GLU A 1 300 ? 38.881  66.276  -38.991 1.00 69.07  ? 326 GLU A CB  1 
ATOM   2358  C CG  . GLU A 1 300 ? 40.302  66.453  -39.519 1.00 72.37  ? 326 GLU A CG  1 
ATOM   2359  C CD  . GLU A 1 300 ? 40.630  67.904  -39.830 1.00 74.52  ? 326 GLU A CD  1 
ATOM   2360  O OE1 . GLU A 1 300 ? 40.490  68.748  -38.917 1.00 75.10  ? 326 GLU A OE1 1 
ATOM   2361  O OE2 . GLU A 1 300 ? 41.031  68.204  -40.977 1.00 76.24  ? 326 GLU A OE2 1 
ATOM   2362  N N   . GLU A 1 301 ? 36.233  64.835  -38.096 1.00 63.89  ? 327 GLU A N   1 
ATOM   2363  C CA  . GLU A 1 301 ? 34.945  64.912  -37.418 1.00 62.90  ? 327 GLU A CA  1 
ATOM   2364  C C   . GLU A 1 301 ? 34.523  63.595  -36.770 1.00 59.64  ? 327 GLU A C   1 
ATOM   2365  O O   . GLU A 1 301 ? 33.538  63.546  -36.035 1.00 57.94  ? 327 GLU A O   1 
ATOM   2366  C CB  . GLU A 1 301 ? 33.852  65.425  -38.365 1.00 65.50  ? 327 GLU A CB  1 
ATOM   2367  C CG  . GLU A 1 301 ? 33.666  64.646  -39.644 1.00 70.47  ? 327 GLU A CG  1 
ATOM   2368  C CD  . GLU A 1 301 ? 32.484  65.163  -40.441 1.00 73.76  ? 327 GLU A CD  1 
ATOM   2369  O OE1 . GLU A 1 301 ? 32.388  66.399  -40.614 1.00 74.80  ? 327 GLU A OE1 1 
ATOM   2370  O OE2 . GLU A 1 301 ? 31.656  64.341  -40.894 1.00 75.49  ? 327 GLU A OE2 1 
ATOM   2371  N N   . ARG A 1 302 ? 35.270  62.531  -37.044 1.00 56.96  ? 328 ARG A N   1 
ATOM   2372  C CA  . ARG A 1 302 ? 34.990  61.233  -36.447 1.00 53.54  ? 328 ARG A CA  1 
ATOM   2373  C C   . ARG A 1 302 ? 35.482  61.363  -35.015 1.00 49.74  ? 328 ARG A C   1 
ATOM   2374  O O   . ARG A 1 302 ? 34.771  61.048  -34.064 1.00 50.06  ? 328 ARG A O   1 
ATOM   2375  C CB  . ARG A 1 302 ? 35.779  60.127  -37.150 1.00 56.68  ? 328 ARG A CB  1 
ATOM   2376  C CG  . ARG A 1 302 ? 35.400  58.715  -36.717 1.00 61.13  ? 328 ARG A CG  1 
ATOM   2377  C CD  . ARG A 1 302 ? 36.520  57.717  -36.997 1.00 64.17  ? 328 ARG A CD  1 
ATOM   2378  N NE  . ARG A 1 302 ? 37.084  57.878  -38.335 1.00 67.03  ? 328 ARG A NE  1 
ATOM   2379  C CZ  . ARG A 1 302 ? 36.422  57.647  -39.463 1.00 68.57  ? 328 ARG A CZ  1 
ATOM   2380  N NH1 . ARG A 1 302 ? 35.161  57.238  -39.421 1.00 69.84  ? 328 ARG A NH1 1 
ATOM   2381  N NH2 . ARG A 1 302 ? 37.020  57.835  -40.633 1.00 68.65  ? 328 ARG A NH2 1 
ATOM   2382  N N   . LYS A 1 303 ? 36.710  61.848  -34.879 1.00 45.80  ? 329 LYS A N   1 
ATOM   2383  C CA  . LYS A 1 303 ? 37.334  62.050  -33.579 1.00 42.17  ? 329 LYS A CA  1 
ATOM   2384  C C   . LYS A 1 303 ? 36.726  63.208  -32.792 1.00 40.30  ? 329 LYS A C   1 
ATOM   2385  O O   . LYS A 1 303 ? 37.138  63.485  -31.664 1.00 41.87  ? 329 LYS A O   1 
ATOM   2386  C CB  . LYS A 1 303 ? 38.835  62.277  -33.755 1.00 41.33  ? 329 LYS A CB  1 
ATOM   2387  C CG  . LYS A 1 303 ? 39.631  60.994  -33.886 1.00 42.07  ? 329 LYS A CG  1 
ATOM   2388  C CD  . LYS A 1 303 ? 41.068  61.277  -34.244 1.00 45.13  ? 329 LYS A CD  1 
ATOM   2389  C CE  . LYS A 1 303 ? 41.980  60.153  -33.783 1.00 46.48  ? 329 LYS A CE  1 
ATOM   2390  N NZ  . LYS A 1 303 ? 41.481  58.825  -34.216 1.00 51.77  ? 329 LYS A NZ  1 
ATOM   2391  N N   . ALA A 1 304 ? 35.745  63.883  -33.379 1.00 36.90  ? 330 ALA A N   1 
ATOM   2392  C CA  . ALA A 1 304 ? 35.095  65.002  -32.703 1.00 35.13  ? 330 ALA A CA  1 
ATOM   2393  C C   . ALA A 1 304 ? 33.646  64.676  -32.381 1.00 32.46  ? 330 ALA A C   1 
ATOM   2394  O O   . ALA A 1 304 ? 32.893  65.547  -31.946 1.00 32.07  ? 330 ALA A O   1 
ATOM   2395  C CB  . ALA A 1 304 ? 35.158  66.256  -33.581 1.00 38.02  ? 330 ALA A CB  1 
ATOM   2396  N N   . ALA A 1 305 ? 33.270  63.417  -32.588 1.00 31.02  ? 331 ALA A N   1 
ATOM   2397  C CA  . ALA A 1 305 ? 31.900  62.962  -32.370 1.00 30.73  ? 331 ALA A CA  1 
ATOM   2398  C C   . ALA A 1 305 ? 31.352  63.275  -30.983 1.00 29.77  ? 331 ALA A C   1 
ATOM   2399  O O   . ALA A 1 305 ? 30.202  63.692  -30.849 1.00 24.56  ? 331 ALA A O   1 
ATOM   2400  C CB  . ALA A 1 305 ? 31.800  61.467  -32.652 1.00 30.47  ? 331 ALA A CB  1 
ATOM   2401  N N   . LEU A 1 306 ? 32.179  63.072  -29.962 1.00 30.11  ? 332 LEU A N   1 
ATOM   2402  C CA  . LEU A 1 306 ? 31.787  63.331  -28.584 1.00 33.05  ? 332 LEU A CA  1 
ATOM   2403  C C   . LEU A 1 306 ? 31.504  64.817  -28.380 1.00 37.09  ? 332 LEU A C   1 
ATOM   2404  O O   . LEU A 1 306 ? 30.500  65.191  -27.772 1.00 37.84  ? 332 LEU A O   1 
ATOM   2405  C CB  . LEU A 1 306 ? 32.895  62.865  -27.637 1.00 32.53  ? 332 LEU A CB  1 
ATOM   2406  C CG  . LEU A 1 306 ? 32.667  61.599  -26.798 1.00 34.44  ? 332 LEU A CG  1 
ATOM   2407  C CD1 . LEU A 1 306 ? 31.707  60.633  -27.485 1.00 34.01  ? 332 LEU A CD1 1 
ATOM   2408  C CD2 . LEU A 1 306 ? 34.013  60.943  -26.538 1.00 32.53  ? 332 LEU A CD2 1 
ATOM   2409  N N   . LYS A 1 307 ? 32.385  65.666  -28.898 1.00 38.68  ? 333 LYS A N   1 
ATOM   2410  C CA  . LYS A 1 307 ? 32.196  67.105  -28.780 1.00 38.84  ? 333 LYS A CA  1 
ATOM   2411  C C   . LYS A 1 307 ? 30.958  67.507  -29.583 1.00 37.37  ? 333 LYS A C   1 
ATOM   2412  O O   . LYS A 1 307 ? 30.141  68.305  -29.130 1.00 39.12  ? 333 LYS A O   1 
ATOM   2413  C CB  . LYS A 1 307 ? 33.422  67.849  -29.309 1.00 40.36  ? 333 LYS A CB  1 
ATOM   2414  C CG  . LYS A 1 307 ? 33.442  69.322  -28.936 1.00 46.38  ? 333 LYS A CG  1 
ATOM   2415  C CD  . LYS A 1 307 ? 34.708  70.026  -29.410 1.00 49.93  ? 333 LYS A CD  1 
ATOM   2416  C CE  . LYS A 1 307 ? 34.699  71.501  -29.001 1.00 52.96  ? 333 LYS A CE  1 
ATOM   2417  N NZ  . LYS A 1 307 ? 33.493  72.231  -29.515 1.00 52.92  ? 333 LYS A NZ  1 
ATOM   2418  N N   . THR A 1 308 ? 30.818  66.942  -30.775 1.00 33.75  ? 334 THR A N   1 
ATOM   2419  C CA  . THR A 1 308 ? 29.680  67.247  -31.625 1.00 32.23  ? 334 THR A CA  1 
ATOM   2420  C C   . THR A 1 308 ? 28.362  66.979  -30.906 1.00 33.34  ? 334 THR A C   1 
ATOM   2421  O O   . THR A 1 308 ? 27.416  67.757  -31.022 1.00 33.93  ? 334 THR A O   1 
ATOM   2422  C CB  . THR A 1 308 ? 29.723  66.410  -32.913 1.00 30.63  ? 334 THR A CB  1 
ATOM   2423  O OG1 . THR A 1 308 ? 30.955  66.664  -33.594 1.00 29.87  ? 334 THR A OG1 1 
ATOM   2424  C CG2 . THR A 1 308 ? 28.553  66.755  -33.824 1.00 25.99  ? 334 THR A CG2 1 
ATOM   2425  N N   . ALA A 1 309 ? 28.303  65.878  -30.167 1.00 33.35  ? 335 ALA A N   1 
ATOM   2426  C CA  . ALA A 1 309 ? 27.093  65.515  -29.439 1.00 34.37  ? 335 ALA A CA  1 
ATOM   2427  C C   . ALA A 1 309 ? 26.780  66.544  -28.352 1.00 36.71  ? 335 ALA A C   1 
ATOM   2428  O O   . ALA A 1 309 ? 25.612  66.834  -28.069 1.00 35.77  ? 335 ALA A O   1 
ATOM   2429  C CB  . ALA A 1 309 ? 27.258  64.143  -28.822 1.00 32.94  ? 335 ALA A CB  1 
ATOM   2430  N N   . SER A 1 310 ? 27.834  67.091  -27.751 1.00 37.94  ? 336 SER A N   1 
ATOM   2431  C CA  . SER A 1 310 ? 27.694  68.080  -26.693 1.00 40.65  ? 336 SER A CA  1 
ATOM   2432  C C   . SER A 1 310 ? 27.133  69.377  -27.228 1.00 41.21  ? 336 SER A C   1 
ATOM   2433  O O   . SER A 1 310 ? 26.220  69.953  -26.634 1.00 40.18  ? 336 SER A O   1 
ATOM   2434  C CB  . SER A 1 310 ? 29.048  68.358  -26.038 1.00 43.04  ? 336 SER A CB  1 
ATOM   2435  O OG  . SER A 1 310 ? 29.535  67.210  -25.373 1.00 45.43  ? 336 SER A OG  1 
ATOM   2436  N N   . ASP A 1 311 ? 27.695  69.836  -28.345 1.00 42.91  ? 337 ASP A N   1 
ATOM   2437  C CA  . ASP A 1 311 ? 27.262  71.077  -28.975 1.00 44.86  ? 337 ASP A CA  1 
ATOM   2438  C C   . ASP A 1 311 ? 25.818  70.926  -29.393 1.00 45.37  ? 337 ASP A C   1 
ATOM   2439  O O   . ASP A 1 311 ? 25.055  71.888  -29.375 1.00 48.54  ? 337 ASP A O   1 
ATOM   2440  C CB  . ASP A 1 311 ? 28.111  71.394  -30.210 1.00 46.26  ? 337 ASP A CB  1 
ATOM   2441  C CG  . ASP A 1 311 ? 29.580  71.555  -29.885 1.00 46.84  ? 337 ASP A CG  1 
ATOM   2442  O OD1 . ASP A 1 311 ? 29.943  71.465  -28.691 1.00 48.41  ? 337 ASP A OD1 1 
ATOM   2443  O OD2 . ASP A 1 311 ? 30.374  71.773  -30.826 1.00 47.97  ? 337 ASP A OD2 1 
ATOM   2444  N N   . PHE A 1 312 ? 25.450  69.710  -29.779 1.00 45.37  ? 338 PHE A N   1 
ATOM   2445  C CA  . PHE A 1 312 ? 24.086  69.438  -30.191 1.00 44.59  ? 338 PHE A CA  1 
ATOM   2446  C C   . PHE A 1 312 ? 23.165  69.535  -28.978 1.00 46.67  ? 338 PHE A C   1 
ATOM   2447  O O   . PHE A 1 312 ? 22.061  70.069  -29.071 1.00 48.62  ? 338 PHE A O   1 
ATOM   2448  C CB  . PHE A 1 312 ? 23.976  68.041  -30.803 1.00 40.83  ? 338 PHE A CB  1 
ATOM   2449  C CG  . PHE A 1 312 ? 22.589  67.693  -31.248 1.00 37.70  ? 338 PHE A CG  1 
ATOM   2450  C CD1 . PHE A 1 312 ? 22.081  68.197  -32.438 1.00 36.72  ? 338 PHE A CD1 1 
ATOM   2451  C CD2 . PHE A 1 312 ? 21.772  66.899  -30.454 1.00 35.84  ? 338 PHE A CD2 1 
ATOM   2452  C CE1 . PHE A 1 312 ? 20.774  67.919  -32.830 1.00 36.53  ? 338 PHE A CE1 1 
ATOM   2453  C CE2 . PHE A 1 312 ? 20.466  66.614  -30.834 1.00 37.23  ? 338 PHE A CE2 1 
ATOM   2454  C CZ  . PHE A 1 312 ? 19.963  67.125  -32.026 1.00 36.97  ? 338 PHE A CZ  1 
ATOM   2455  N N   . ILE A 1 313 ? 23.617  69.013  -27.841 1.00 46.69  ? 339 ILE A N   1 
ATOM   2456  C CA  . ILE A 1 313 ? 22.811  69.048  -26.628 1.00 47.78  ? 339 ILE A CA  1 
ATOM   2457  C C   . ILE A 1 313 ? 22.648  70.482  -26.146 1.00 49.70  ? 339 ILE A C   1 
ATOM   2458  O O   . ILE A 1 313 ? 21.670  70.814  -25.472 1.00 47.27  ? 339 ILE A O   1 
ATOM   2459  C CB  . ILE A 1 313 ? 23.442  68.187  -25.503 1.00 47.12  ? 339 ILE A CB  1 
ATOM   2460  C CG1 . ILE A 1 313 ? 23.314  66.706  -25.857 1.00 45.90  ? 339 ILE A CG1 1 
ATOM   2461  C CG2 . ILE A 1 313 ? 22.760  68.475  -24.168 1.00 44.52  ? 339 ILE A CG2 1 
ATOM   2462  C CD1 . ILE A 1 313 ? 23.847  65.780  -24.798 1.00 45.63  ? 339 ILE A CD1 1 
ATOM   2463  N N   . SER A 1 314 ? 23.609  71.330  -26.496 1.00 52.17  ? 340 SER A N   1 
ATOM   2464  C CA  . SER A 1 314 ? 23.559  72.733  -26.107 1.00 55.55  ? 340 SER A CA  1 
ATOM   2465  C C   . SER A 1 314 ? 22.596  73.472  -27.020 1.00 57.38  ? 340 SER A C   1 
ATOM   2466  O O   . SER A 1 314 ? 21.605  74.042  -26.566 1.00 57.13  ? 340 SER A O   1 
ATOM   2467  C CB  . SER A 1 314 ? 24.947  73.367  -26.201 1.00 56.01  ? 340 SER A CB  1 
ATOM   2468  O OG  . SER A 1 314 ? 25.816  72.828  -25.220 1.00 59.67  ? 340 SER A OG  1 
ATOM   2469  N N   . LYS A 1 315 ? 22.890  73.447  -28.314 1.00 60.17  ? 341 LYS A N   1 
ATOM   2470  C CA  . LYS A 1 315 ? 22.059  74.114  -29.306 1.00 63.11  ? 341 LYS A CA  1 
ATOM   2471  C C   . LYS A 1 315 ? 20.600  73.662  -29.232 1.00 62.97  ? 341 LYS A C   1 
ATOM   2472  O O   . LYS A 1 315 ? 19.700  74.370  -29.689 1.00 66.20  ? 341 LYS A O   1 
ATOM   2473  C CB  . LYS A 1 315 ? 22.614  73.855  -30.711 1.00 65.84  ? 341 LYS A CB  1 
ATOM   2474  C CG  . LYS A 1 315 ? 21.895  74.607  -31.823 1.00 70.96  ? 341 LYS A CG  1 
ATOM   2475  C CD  . LYS A 1 315 ? 22.528  74.333  -33.184 1.00 74.50  ? 341 LYS A CD  1 
ATOM   2476  C CE  . LYS A 1 315 ? 23.989  74.783  -33.229 1.00 76.78  ? 341 LYS A CE  1 
ATOM   2477  N NZ  . LYS A 1 315 ? 24.647  74.468  -34.535 1.00 77.55  ? 341 LYS A NZ  1 
ATOM   2478  N N   . MET A 1 316 ? 20.364  72.488  -28.658 1.00 60.35  ? 342 MET A N   1 
ATOM   2479  C CA  . MET A 1 316 ? 19.010  71.965  -28.542 1.00 58.53  ? 342 MET A CA  1 
ATOM   2480  C C   . MET A 1 316 ? 18.449  72.213  -27.151 1.00 58.53  ? 342 MET A C   1 
ATOM   2481  O O   . MET A 1 316 ? 17.302  71.872  -26.854 1.00 57.59  ? 342 MET A O   1 
ATOM   2482  C CB  . MET A 1 316 ? 18.999  70.473  -28.857 1.00 58.38  ? 342 MET A CB  1 
ATOM   2483  C CG  . MET A 1 316 ? 19.275  70.159  -30.315 1.00 57.93  ? 342 MET A CG  1 
ATOM   2484  S SD  . MET A 1 316 ? 18.103  70.979  -31.408 1.00 57.47  ? 342 MET A SD  1 
ATOM   2485  C CE  . MET A 1 316 ? 16.653  69.955  -31.178 1.00 58.12  ? 342 MET A CE  1 
ATOM   2486  N N   . ASP A 1 317 ? 19.274  72.811  -26.302 1.00 58.38  ? 343 ASP A N   1 
ATOM   2487  C CA  . ASP A 1 317 ? 18.877  73.136  -24.941 1.00 59.37  ? 343 ASP A CA  1 
ATOM   2488  C C   . ASP A 1 317 ? 18.326  71.919  -24.194 1.00 57.14  ? 343 ASP A C   1 
ATOM   2489  O O   . ASP A 1 317 ? 17.186  71.921  -23.724 1.00 57.17  ? 343 ASP A O   1 
ATOM   2490  C CB  . ASP A 1 317 ? 17.843  74.272  -24.974 1.00 63.34  ? 343 ASP A CB  1 
ATOM   2491  C CG  . ASP A 1 317 ? 17.544  74.836  -23.599 1.00 66.84  ? 343 ASP A CG  1 
ATOM   2492  O OD1 . ASP A 1 317 ? 18.503  75.105  -22.841 1.00 67.10  ? 343 ASP A OD1 1 
ATOM   2493  O OD2 . ASP A 1 317 ? 16.346  75.019  -23.286 1.00 68.69  ? 343 ASP A OD2 1 
ATOM   2494  N N   . TYR A 1 318 ? 19.148  70.878  -24.100 1.00 53.05  ? 344 TYR A N   1 
ATOM   2495  C CA  . TYR A 1 318 ? 18.775  69.658  -23.400 1.00 47.32  ? 344 TYR A CA  1 
ATOM   2496  C C   . TYR A 1 318 ? 19.511  69.589  -22.072 1.00 46.57  ? 344 TYR A C   1 
ATOM   2497  O O   . TYR A 1 318 ? 20.523  70.268  -21.869 1.00 45.69  ? 344 TYR A O   1 
ATOM   2498  C CB  . TYR A 1 318 ? 19.150  68.413  -24.208 1.00 45.11  ? 344 TYR A CB  1 
ATOM   2499  C CG  . TYR A 1 318 ? 18.308  68.140  -25.428 1.00 41.73  ? 344 TYR A CG  1 
ATOM   2500  C CD1 . TYR A 1 318 ? 16.965  68.502  -25.476 1.00 41.22  ? 344 TYR A CD1 1 
ATOM   2501  C CD2 . TYR A 1 318 ? 18.847  67.461  -26.520 1.00 41.74  ? 344 TYR A CD2 1 
ATOM   2502  C CE1 . TYR A 1 318 ? 16.180  68.196  -26.585 1.00 42.10  ? 344 TYR A CE1 1 
ATOM   2503  C CE2 . TYR A 1 318 ? 18.072  67.146  -27.628 1.00 41.20  ? 344 TYR A CE2 1 
ATOM   2504  C CZ  . TYR A 1 318 ? 16.743  67.515  -27.653 1.00 41.52  ? 344 TYR A CZ  1 
ATOM   2505  O OH  . TYR A 1 318 ? 15.982  67.201  -28.747 1.00 44.83  ? 344 TYR A OH  1 
ATOM   2506  N N   . PRO A 1 319 ? 19.014  68.756  -21.145 1.00 45.18  ? 345 PRO A N   1 
ATOM   2507  C CA  . PRO A 1 319 ? 19.651  68.610  -19.837 1.00 44.19  ? 345 PRO A CA  1 
ATOM   2508  C C   . PRO A 1 319 ? 21.062  68.065  -20.032 1.00 45.49  ? 345 PRO A C   1 
ATOM   2509  O O   . PRO A 1 319 ? 21.296  67.243  -20.918 1.00 44.73  ? 345 PRO A O   1 
ATOM   2510  C CB  . PRO A 1 319 ? 18.746  67.613  -19.128 1.00 44.26  ? 345 PRO A CB  1 
ATOM   2511  C CG  . PRO A 1 319 ? 17.406  67.859  -19.762 1.00 42.32  ? 345 PRO A CG  1 
ATOM   2512  C CD  . PRO A 1 319 ? 17.764  67.980  -21.209 1.00 42.78  ? 345 PRO A CD  1 
ATOM   2513  N N   . LYS A 1 320 ? 21.999  68.522  -19.211 1.00 46.80  ? 346 LYS A N   1 
ATOM   2514  C CA  . LYS A 1 320 ? 23.378  68.063  -19.327 1.00 47.68  ? 346 LYS A CA  1 
ATOM   2515  C C   . LYS A 1 320 ? 23.495  66.539  -19.181 1.00 44.35  ? 346 LYS A C   1 
ATOM   2516  O O   . LYS A 1 320 ? 24.324  65.902  -19.830 1.00 43.47  ? 346 LYS A O   1 
ATOM   2517  C CB  . LYS A 1 320 ? 24.247  68.752  -18.268 1.00 52.20  ? 346 LYS A CB  1 
ATOM   2518  C CG  . LYS A 1 320 ? 24.212  70.281  -18.310 1.00 59.13  ? 346 LYS A CG  1 
ATOM   2519  C CD  . LYS A 1 320 ? 25.247  70.901  -17.356 1.00 64.17  ? 346 LYS A CD  1 
ATOM   2520  C CE  . LYS A 1 320 ? 25.047  70.440  -15.905 1.00 67.25  ? 346 LYS A CE  1 
ATOM   2521  N NZ  . LYS A 1 320 ? 26.140  70.895  -14.985 1.00 67.44  ? 346 LYS A NZ  1 
ATOM   2522  N N   . GLN A 1 321 ? 22.650  65.965  -18.329 1.00 41.04  ? 347 GLN A N   1 
ATOM   2523  C CA  . GLN A 1 321 ? 22.649  64.530  -18.068 1.00 39.28  ? 347 GLN A CA  1 
ATOM   2524  C C   . GLN A 1 321 ? 22.125  63.640  -19.192 1.00 35.15  ? 347 GLN A C   1 
ATOM   2525  O O   . GLN A 1 321 ? 21.988  62.435  -19.010 1.00 35.09  ? 347 GLN A O   1 
ATOM   2526  C CB  . GLN A 1 321 ? 21.861  64.229  -16.789 1.00 41.07  ? 347 GLN A CB  1 
ATOM   2527  C CG  . GLN A 1 321 ? 20.590  65.045  -16.604 1.00 44.06  ? 347 GLN A CG  1 
ATOM   2528  C CD  . GLN A 1 321 ? 20.884  66.466  -16.155 1.00 46.91  ? 347 GLN A CD  1 
ATOM   2529  O OE1 . GLN A 1 321 ? 20.805  67.417  -16.940 1.00 45.41  ? 347 GLN A OE1 1 
ATOM   2530  N NE2 . GLN A 1 321 ? 21.247  66.614  -14.886 1.00 48.21  ? 347 GLN A NE2 1 
ATOM   2531  N N   . THR A 1 322 ? 21.837  64.223  -20.347 1.00 31.16  ? 348 THR A N   1 
ATOM   2532  C CA  . THR A 1 322 ? 21.336  63.452  -21.478 1.00 30.16  ? 348 THR A CA  1 
ATOM   2533  C C   . THR A 1 322 ? 22.313  62.328  -21.861 1.00 30.69  ? 348 THR A C   1 
ATOM   2534  O O   . THR A 1 322 ? 23.526  62.536  -21.916 1.00 31.73  ? 348 THR A O   1 
ATOM   2535  C CB  . THR A 1 322 ? 21.097  64.369  -22.695 1.00 30.43  ? 348 THR A CB  1 
ATOM   2536  O OG1 . THR A 1 322 ? 20.155  65.393  -22.344 1.00 27.76  ? 348 THR A OG1 1 
ATOM   2537  C CG2 . THR A 1 322 ? 20.556  63.570  -23.874 1.00 27.90  ? 348 THR A CG2 1 
ATOM   2538  N N   . GLN A 1 323 ? 21.772  61.137  -22.111 1.00 28.85  ? 349 GLN A N   1 
ATOM   2539  C CA  . GLN A 1 323 ? 22.566  59.965  -22.477 1.00 28.85  ? 349 GLN A CA  1 
ATOM   2540  C C   . GLN A 1 323 ? 23.083  60.023  -23.907 1.00 29.04  ? 349 GLN A C   1 
ATOM   2541  O O   . GLN A 1 323 ? 22.325  60.307  -24.834 1.00 32.27  ? 349 GLN A O   1 
ATOM   2542  C CB  . GLN A 1 323 ? 21.730  58.700  -22.299 1.00 32.04  ? 349 GLN A CB  1 
ATOM   2543  C CG  . GLN A 1 323 ? 21.653  58.202  -20.877 1.00 30.48  ? 349 GLN A CG  1 
ATOM   2544  C CD  . GLN A 1 323 ? 20.587  57.147  -20.694 1.00 34.38  ? 349 GLN A CD  1 
ATOM   2545  O OE1 . GLN A 1 323 ? 20.291  56.369  -21.610 1.00 33.24  ? 349 GLN A OE1 1 
ATOM   2546  N NE2 . GLN A 1 323 ? 20.008  57.103  -19.497 1.00 34.59  ? 349 GLN A NE2 1 
ATOM   2547  N N   . VAL A 1 324 ? 24.372  59.742  -24.087 1.00 27.02  ? 350 VAL A N   1 
ATOM   2548  C CA  . VAL A 1 324 ? 24.985  59.778  -25.414 1.00 25.89  ? 350 VAL A CA  1 
ATOM   2549  C C   . VAL A 1 324 ? 25.670  58.480  -25.830 1.00 26.58  ? 350 VAL A C   1 
ATOM   2550  O O   . VAL A 1 324 ? 26.431  57.891  -25.068 1.00 25.88  ? 350 VAL A O   1 
ATOM   2551  C CB  . VAL A 1 324 ? 26.042  60.887  -25.513 1.00 25.58  ? 350 VAL A CB  1 
ATOM   2552  C CG1 . VAL A 1 324 ? 26.628  60.908  -26.912 1.00 23.63  ? 350 VAL A CG1 1 
ATOM   2553  C CG2 . VAL A 1 324 ? 25.425  62.233  -25.173 1.00 27.22  ? 350 VAL A CG2 1 
ATOM   2554  N N   . SER A 1 325 ? 25.400  58.047  -27.055 1.00 26.84  ? 351 SER A N   1 
ATOM   2555  C CA  . SER A 1 325 ? 26.009  56.839  -27.601 1.00 26.58  ? 351 SER A CA  1 
ATOM   2556  C C   . SER A 1 325 ? 26.468  57.146  -29.015 1.00 24.82  ? 351 SER A C   1 
ATOM   2557  O O   . SER A 1 325 ? 25.712  57.718  -29.790 1.00 25.24  ? 351 SER A O   1 
ATOM   2558  C CB  . SER A 1 325 ? 24.995  55.690  -27.650 1.00 25.74  ? 351 SER A CB  1 
ATOM   2559  O OG  . SER A 1 325 ? 24.654  55.257  -26.351 1.00 32.27  ? 351 SER A OG  1 
ATOM   2560  N N   . VAL A 1 326 ? 27.703  56.799  -29.351 1.00 23.33  ? 352 VAL A N   1 
ATOM   2561  C CA  . VAL A 1 326 ? 28.155  57.036  -30.710 1.00 27.19  ? 352 VAL A CA  1 
ATOM   2562  C C   . VAL A 1 326 ? 28.451  55.670  -31.316 1.00 27.19  ? 352 VAL A C   1 
ATOM   2563  O O   . VAL A 1 326 ? 29.199  54.870  -30.755 1.00 25.98  ? 352 VAL A O   1 
ATOM   2564  C CB  . VAL A 1 326 ? 29.411  57.960  -30.778 1.00 29.04  ? 352 VAL A CB  1 
ATOM   2565  C CG1 . VAL A 1 326 ? 29.313  59.068  -29.725 1.00 27.03  ? 352 VAL A CG1 1 
ATOM   2566  C CG2 . VAL A 1 326 ? 30.672  57.154  -30.618 1.00 34.71  ? 352 VAL A CG2 1 
ATOM   2567  N N   . LEU A 1 327 ? 27.832  55.388  -32.453 1.00 28.13  ? 353 LEU A N   1 
ATOM   2568  C CA  . LEU A 1 327 ? 28.039  54.102  -33.087 1.00 28.38  ? 353 LEU A CA  1 
ATOM   2569  C C   . LEU A 1 327 ? 28.697  54.229  -34.438 1.00 28.31  ? 353 LEU A C   1 
ATOM   2570  O O   . LEU A 1 327 ? 28.529  55.230  -35.137 1.00 29.30  ? 353 LEU A O   1 
ATOM   2571  C CB  . LEU A 1 327 ? 26.709  53.370  -33.271 1.00 26.22  ? 353 LEU A CB  1 
ATOM   2572  C CG  . LEU A 1 327 ? 25.495  53.770  -32.439 1.00 26.89  ? 353 LEU A CG  1 
ATOM   2573  C CD1 . LEU A 1 327 ? 24.393  52.771  -32.729 1.00 26.19  ? 353 LEU A CD1 1 
ATOM   2574  C CD2 . LEU A 1 327 ? 25.823  53.784  -30.947 1.00 29.44  ? 353 LEU A CD2 1 
ATOM   2575  N N   . PRO A 1 328 ? 29.488  53.222  -34.815 1.00 27.25  ? 354 PRO A N   1 
ATOM   2576  C CA  . PRO A 1 328 ? 30.160  53.240  -36.119 1.00 28.27  ? 354 PRO A CA  1 
ATOM   2577  C C   . PRO A 1 328 ? 29.303  52.441  -37.119 1.00 29.08  ? 354 PRO A C   1 
ATOM   2578  O O   . PRO A 1 328 ? 28.633  51.479  -36.744 1.00 28.86  ? 354 PRO A O   1 
ATOM   2579  C CB  . PRO A 1 328 ? 31.494  52.566  -35.822 1.00 24.94  ? 354 PRO A CB  1 
ATOM   2580  C CG  . PRO A 1 328 ? 31.091  51.515  -34.834 1.00 26.07  ? 354 PRO A CG  1 
ATOM   2581  C CD  . PRO A 1 328 ? 30.120  52.247  -33.908 1.00 23.75  ? 354 PRO A CD  1 
ATOM   2582  N N   . GLU A 1 329 ? 29.307  52.847  -38.382 1.00 32.26  ? 355 GLU A N   1 
ATOM   2583  C CA  . GLU A 1 329 ? 28.540  52.135  -39.396 1.00 33.08  ? 355 GLU A CA  1 
ATOM   2584  C C   . GLU A 1 329 ? 28.936  50.665  -39.354 1.00 31.82  ? 355 GLU A C   1 
ATOM   2585  O O   . GLU A 1 329 ? 30.121  50.335  -39.288 1.00 31.72  ? 355 GLU A O   1 
ATOM   2586  C CB  . GLU A 1 329 ? 28.836  52.700  -40.786 1.00 33.67  ? 355 GLU A CB  1 
ATOM   2587  C CG  . GLU A 1 329 ? 28.210  51.910  -41.917 1.00 37.60  ? 355 GLU A CG  1 
ATOM   2588  C CD  . GLU A 1 329 ? 28.367  52.579  -43.278 1.00 41.82  ? 355 GLU A CD  1 
ATOM   2589  O OE1 . GLU A 1 329 ? 27.710  52.117  -44.232 1.00 45.48  ? 355 GLU A OE1 1 
ATOM   2590  O OE2 . GLU A 1 329 ? 29.137  53.555  -43.404 1.00 41.44  ? 355 GLU A OE2 1 
ATOM   2591  N N   . GLY A 1 330 ? 27.943  49.787  -39.383 1.00 30.13  ? 356 GLY A N   1 
ATOM   2592  C CA  . GLY A 1 330 ? 28.229  48.370  -39.358 1.00 28.24  ? 356 GLY A CA  1 
ATOM   2593  C C   . GLY A 1 330 ? 28.219  47.793  -37.963 1.00 28.70  ? 356 GLY A C   1 
ATOM   2594  O O   . GLY A 1 330 ? 28.170  46.579  -37.806 1.00 31.57  ? 356 GLY A O   1 
ATOM   2595  N N   . GLY A 1 331 ? 28.259  48.652  -36.948 1.00 27.60  ? 357 GLY A N   1 
ATOM   2596  C CA  . GLY A 1 331 ? 28.257  48.167  -35.581 1.00 24.69  ? 357 GLY A CA  1 
ATOM   2597  C C   . GLY A 1 331 ? 27.085  48.693  -34.776 1.00 26.52  ? 357 GLY A C   1 
ATOM   2598  O O   . GLY A 1 331 ? 27.174  48.812  -33.559 1.00 25.64  ? 357 GLY A O   1 
ATOM   2599  N N   . GLU A 1 332 ? 25.976  48.983  -35.450 1.00 27.98  ? 358 GLU A N   1 
ATOM   2600  C CA  . GLU A 1 332 ? 24.784  49.527  -34.799 1.00 28.97  ? 358 GLU A CA  1 
ATOM   2601  C C   . GLU A 1 332 ? 24.137  48.599  -33.769 1.00 28.45  ? 358 GLU A C   1 
ATOM   2602  O O   . GLU A 1 332 ? 24.086  47.390  -33.945 1.00 30.28  ? 358 GLU A O   1 
ATOM   2603  C CB  . GLU A 1 332 ? 23.748  49.916  -35.856 1.00 30.44  ? 358 GLU A CB  1 
ATOM   2604  C CG  . GLU A 1 332 ? 24.254  50.914  -36.908 1.00 32.18  ? 358 GLU A CG  1 
ATOM   2605  C CD  . GLU A 1 332 ? 25.038  50.256  -38.043 1.00 33.37  ? 358 GLU A CD  1 
ATOM   2606  O OE1 . GLU A 1 332 ? 25.453  50.978  -38.973 1.00 34.05  ? 358 GLU A OE1 1 
ATOM   2607  O OE2 . GLU A 1 332 ? 25.238  49.022  -38.010 1.00 33.68  ? 358 GLU A OE2 1 
ATOM   2608  N N   . THR A 1 333 ? 23.630  49.179  -32.691 1.00 27.19  ? 359 THR A N   1 
ATOM   2609  C CA  . THR A 1 333 ? 22.995  48.402  -31.637 1.00 27.62  ? 359 THR A CA  1 
ATOM   2610  C C   . THR A 1 333 ? 21.500  48.229  -31.893 1.00 26.81  ? 359 THR A C   1 
ATOM   2611  O O   . THR A 1 333 ? 20.917  48.943  -32.707 1.00 23.52  ? 359 THR A O   1 
ATOM   2612  C CB  . THR A 1 333 ? 23.173  49.097  -30.279 1.00 28.17  ? 359 THR A CB  1 
ATOM   2613  O OG1 . THR A 1 333 ? 22.578  50.401  -30.333 1.00 27.44  ? 359 THR A OG1 1 
ATOM   2614  C CG2 . THR A 1 333 ? 24.647  49.239  -29.946 1.00 30.40  ? 359 THR A CG2 1 
ATOM   2615  N N   . PRO A 1 334 ? 20.862  47.271  -31.199 1.00 27.69  ? 360 PRO A N   1 
ATOM   2616  C CA  . PRO A 1 334 ? 19.430  47.005  -31.345 1.00 28.18  ? 360 PRO A CA  1 
ATOM   2617  C C   . PRO A 1 334 ? 18.606  48.254  -31.043 1.00 28.27  ? 360 PRO A C   1 
ATOM   2618  O O   . PRO A 1 334 ? 17.641  48.559  -31.743 1.00 27.35  ? 360 PRO A O   1 
ATOM   2619  C CB  . PRO A 1 334 ? 19.179  45.904  -30.315 1.00 28.15  ? 360 PRO A CB  1 
ATOM   2620  C CG  . PRO A 1 334 ? 20.451  45.165  -30.295 1.00 27.94  ? 360 PRO A CG  1 
ATOM   2621  C CD  . PRO A 1 334 ? 21.477  46.275  -30.301 1.00 29.39  ? 360 PRO A CD  1 
ATOM   2622  N N   . LEU A 1 335 ? 18.995  48.970  -29.995 1.00 28.98  ? 361 LEU A N   1 
ATOM   2623  C CA  . LEU A 1 335 ? 18.283  50.171  -29.598 1.00 32.16  ? 361 LEU A CA  1 
ATOM   2624  C C   . LEU A 1 335 ? 18.282  51.235  -30.691 1.00 32.56  ? 361 LEU A C   1 
ATOM   2625  O O   . LEU A 1 335 ? 17.338  52.014  -30.805 1.00 35.03  ? 361 LEU A O   1 
ATOM   2626  C CB  . LEU A 1 335 ? 18.878  50.740  -28.308 1.00 35.32  ? 361 LEU A CB  1 
ATOM   2627  C CG  . LEU A 1 335 ? 18.507  50.007  -27.012 1.00 38.12  ? 361 LEU A CG  1 
ATOM   2628  C CD1 . LEU A 1 335 ? 19.208  50.665  -25.819 1.00 38.06  ? 361 LEU A CD1 1 
ATOM   2629  C CD2 . LEU A 1 335 ? 16.989  50.028  -26.829 1.00 37.13  ? 361 LEU A CD2 1 
ATOM   2630  N N   . PHE A 1 336 ? 19.339  51.265  -31.492 1.00 30.42  ? 362 PHE A N   1 
ATOM   2631  C CA  . PHE A 1 336 ? 19.444  52.225  -32.579 1.00 30.41  ? 362 PHE A CA  1 
ATOM   2632  C C   . PHE A 1 336 ? 18.615  51.726  -33.771 1.00 32.82  ? 362 PHE A C   1 
ATOM   2633  O O   . PHE A 1 336 ? 17.804  52.463  -34.339 1.00 31.75  ? 362 PHE A O   1 
ATOM   2634  C CB  . PHE A 1 336 ? 20.913  52.376  -32.985 1.00 28.53  ? 362 PHE A CB  1 
ATOM   2635  C CG  . PHE A 1 336 ? 21.135  53.323  -34.115 1.00 25.97  ? 362 PHE A CG  1 
ATOM   2636  C CD1 . PHE A 1 336 ? 21.114  54.697  -33.903 1.00 26.68  ? 362 PHE A CD1 1 
ATOM   2637  C CD2 . PHE A 1 336 ? 21.339  52.847  -35.401 1.00 25.49  ? 362 PHE A CD2 1 
ATOM   2638  C CE1 . PHE A 1 336 ? 21.292  55.588  -34.964 1.00 26.66  ? 362 PHE A CE1 1 
ATOM   2639  C CE2 . PHE A 1 336 ? 21.518  53.728  -36.470 1.00 27.65  ? 362 PHE A CE2 1 
ATOM   2640  C CZ  . PHE A 1 336 ? 21.494  55.101  -36.249 1.00 27.81  ? 362 PHE A CZ  1 
ATOM   2641  N N   . ARG A 1 337 ? 18.824  50.461  -34.130 1.00 33.68  ? 363 ARG A N   1 
ATOM   2642  C CA  . ARG A 1 337 ? 18.135  49.830  -35.247 1.00 35.13  ? 363 ARG A CA  1 
ATOM   2643  C C   . ARG A 1 337 ? 16.611  49.917  -35.153 1.00 36.61  ? 363 ARG A C   1 
ATOM   2644  O O   . ARG A 1 337 ? 15.938  50.170  -36.153 1.00 36.22  ? 363 ARG A O   1 
ATOM   2645  C CB  . ARG A 1 337 ? 18.562  48.357  -35.356 1.00 36.47  ? 363 ARG A CB  1 
ATOM   2646  C CG  . ARG A 1 337 ? 19.977  48.126  -35.881 1.00 39.52  ? 363 ARG A CG  1 
ATOM   2647  C CD  . ARG A 1 337 ? 20.552  46.792  -35.377 1.00 45.52  ? 363 ARG A CD  1 
ATOM   2648  N NE  . ARG A 1 337 ? 19.686  45.653  -35.677 1.00 50.64  ? 363 ARG A NE  1 
ATOM   2649  C CZ  . ARG A 1 337 ? 19.867  44.815  -36.695 1.00 52.88  ? 363 ARG A CZ  1 
ATOM   2650  N NH1 . ARG A 1 337 ? 19.017  43.814  -36.888 1.00 52.29  ? 363 ARG A NH1 1 
ATOM   2651  N NH2 . ARG A 1 337 ? 20.907  44.966  -37.509 1.00 52.57  ? 363 ARG A NH2 1 
ATOM   2652  N N   . GLN A 1 338 ? 16.071  49.720  -33.955 1.00 36.89  ? 364 GLN A N   1 
ATOM   2653  C CA  . GLN A 1 338 ? 14.626  49.751  -33.754 1.00 37.97  ? 364 GLN A CA  1 
ATOM   2654  C C   . GLN A 1 338 ? 13.918  50.984  -34.327 1.00 38.52  ? 364 GLN A C   1 
ATOM   2655  O O   . GLN A 1 338 ? 12.700  50.967  -34.487 1.00 37.69  ? 364 GLN A O   1 
ATOM   2656  C CB  . GLN A 1 338 ? 14.301  49.645  -32.264 1.00 38.66  ? 364 GLN A CB  1 
ATOM   2657  C CG  . GLN A 1 338 ? 14.618  50.920  -31.496 1.00 43.89  ? 364 GLN A CG  1 
ATOM   2658  C CD  . GLN A 1 338 ? 14.168  50.885  -30.049 1.00 44.71  ? 364 GLN A CD  1 
ATOM   2659  O OE1 . GLN A 1 338 ? 13.017  50.564  -29.747 1.00 46.83  ? 364 GLN A OE1 1 
ATOM   2660  N NE2 . GLN A 1 338 ? 15.074  51.231  -29.143 1.00 45.90  ? 364 GLN A NE2 1 
ATOM   2661  N N   . PHE A 1 339 ? 14.660  52.049  -34.635 1.00 39.28  ? 365 PHE A N   1 
ATOM   2662  C CA  . PHE A 1 339 ? 14.034  53.265  -35.172 1.00 42.19  ? 365 PHE A CA  1 
ATOM   2663  C C   . PHE A 1 339 ? 13.831  53.288  -36.686 1.00 44.56  ? 365 PHE A C   1 
ATOM   2664  O O   . PHE A 1 339 ? 13.288  54.255  -37.223 1.00 45.82  ? 365 PHE A O   1 
ATOM   2665  C CB  . PHE A 1 339 ? 14.828  54.523  -34.781 1.00 38.38  ? 365 PHE A CB  1 
ATOM   2666  C CG  . PHE A 1 339 ? 14.684  54.912  -33.342 1.00 36.93  ? 365 PHE A CG  1 
ATOM   2667  C CD1 . PHE A 1 339 ? 15.724  54.692  -32.441 1.00 39.16  ? 365 PHE A CD1 1 
ATOM   2668  C CD2 . PHE A 1 339 ? 13.510  55.488  -32.881 1.00 35.07  ? 365 PHE A CD2 1 
ATOM   2669  C CE1 . PHE A 1 339 ? 15.595  55.039  -31.090 1.00 38.63  ? 365 PHE A CE1 1 
ATOM   2670  C CE2 . PHE A 1 339 ? 13.366  55.839  -31.535 1.00 38.62  ? 365 PHE A CE2 1 
ATOM   2671  C CZ  . PHE A 1 339 ? 14.412  55.616  -30.638 1.00 38.90  ? 365 PHE A CZ  1 
ATOM   2672  N N   . PHE A 1 340 ? 14.251  52.235  -37.377 1.00 45.84  ? 366 PHE A N   1 
ATOM   2673  C CA  . PHE A 1 340 ? 14.106  52.207  -38.824 1.00 47.20  ? 366 PHE A CA  1 
ATOM   2674  C C   . PHE A 1 340 ? 13.097  51.192  -39.346 1.00 50.20  ? 366 PHE A C   1 
ATOM   2675  O O   . PHE A 1 340 ? 12.941  50.109  -38.784 1.00 47.43  ? 366 PHE A O   1 
ATOM   2676  C CB  . PHE A 1 340 ? 15.466  51.962  -39.469 1.00 44.68  ? 366 PHE A CB  1 
ATOM   2677  C CG  . PHE A 1 340 ? 16.489  53.002  -39.127 1.00 44.03  ? 366 PHE A CG  1 
ATOM   2678  C CD1 . PHE A 1 340 ? 17.016  53.084  -37.844 1.00 42.44  ? 366 PHE A CD1 1 
ATOM   2679  C CD2 . PHE A 1 340 ? 16.912  53.920  -40.086 1.00 43.38  ? 366 PHE A CD2 1 
ATOM   2680  C CE1 . PHE A 1 340 ? 17.954  54.065  -37.521 1.00 43.14  ? 366 PHE A CE1 1 
ATOM   2681  C CE2 . PHE A 1 340 ? 17.849  54.905  -39.775 1.00 42.14  ? 366 PHE A CE2 1 
ATOM   2682  C CZ  . PHE A 1 340 ? 18.370  54.979  -38.490 1.00 41.69  ? 366 PHE A CZ  1 
ATOM   2683  N N   . LYS A 1 341 ? 12.418  51.571  -40.429 1.00 55.96  ? 367 LYS A N   1 
ATOM   2684  C CA  . LYS A 1 341 ? 11.414  50.739  -41.092 1.00 59.57  ? 367 LYS A CA  1 
ATOM   2685  C C   . LYS A 1 341 ? 11.770  49.268  -41.004 1.00 60.83  ? 367 LYS A C   1 
ATOM   2686  O O   . LYS A 1 341 ? 11.300  48.553  -40.120 1.00 62.14  ? 367 LYS A O   1 
ATOM   2687  C CB  . LYS A 1 341 ? 11.295  51.125  -42.571 1.00 62.89  ? 367 LYS A CB  1 
ATOM   2688  C CG  . LYS A 1 341 ? 10.553  52.424  -42.846 1.00 67.51  ? 367 LYS A CG  1 
ATOM   2689  C CD  . LYS A 1 341 ? 9.068   52.280  -42.548 1.00 71.63  ? 367 LYS A CD  1 
ATOM   2690  C CE  . LYS A 1 341 ? 8.303   53.539  -42.929 1.00 74.50  ? 367 LYS A CE  1 
ATOM   2691  N NZ  . LYS A 1 341 ? 6.840   53.415  -42.661 1.00 74.94  ? 367 LYS A NZ  1 
ATOM   2692  N N   . ASN A 1 342 ? 12.598  48.823  -41.939 1.00 61.68  ? 368 ASN A N   1 
ATOM   2693  C CA  . ASN A 1 342 ? 13.030  47.434  -41.979 1.00 63.22  ? 368 ASN A CA  1 
ATOM   2694  C C   . ASN A 1 342 ? 14.538  47.387  -42.192 1.00 62.25  ? 368 ASN A C   1 
ATOM   2695  O O   . ASN A 1 342 ? 15.027  47.403  -43.325 1.00 62.65  ? 368 ASN A O   1 
ATOM   2696  C CB  . ASN A 1 342 ? 12.296  46.690  -43.101 1.00 67.12  ? 368 ASN A CB  1 
ATOM   2697  C CG  . ASN A 1 342 ? 10.800  46.558  -42.833 1.00 70.38  ? 368 ASN A CG  1 
ATOM   2698  O OD1 . ASN A 1 342 ? 10.089  47.558  -42.691 1.00 72.25  ? 368 ASN A OD1 1 
ATOM   2699  N ND2 . ASN A 1 342 ? 10.317  45.319  -42.759 1.00 71.08  ? 368 ASN A ND2 1 
ATOM   2700  N N   . TRP A 1 343 ? 15.270  47.337  -41.084 1.00 59.27  ? 369 TRP A N   1 
ATOM   2701  C CA  . TRP A 1 343 ? 16.721  47.309  -41.126 1.00 56.64  ? 369 TRP A CA  1 
ATOM   2702  C C   . TRP A 1 343 ? 17.226  45.966  -41.613 1.00 59.29  ? 369 TRP A C   1 
ATOM   2703  O O   . TRP A 1 343 ? 16.995  44.934  -40.981 1.00 58.71  ? 369 TRP A O   1 
ATOM   2704  C CB  . TRP A 1 343 ? 17.294  47.620  -39.739 1.00 49.08  ? 369 TRP A CB  1 
ATOM   2705  C CG  . TRP A 1 343 ? 18.769  47.853  -39.744 1.00 39.98  ? 369 TRP A CG  1 
ATOM   2706  C CD1 . TRP A 1 343 ? 19.745  46.912  -39.879 1.00 37.16  ? 369 TRP A CD1 1 
ATOM   2707  C CD2 . TRP A 1 343 ? 19.437  49.114  -39.663 1.00 37.54  ? 369 TRP A CD2 1 
ATOM   2708  N NE1 . TRP A 1 343 ? 20.981  47.506  -39.887 1.00 33.86  ? 369 TRP A NE1 1 
ATOM   2709  C CE2 . TRP A 1 343 ? 20.823  48.860  -39.752 1.00 36.15  ? 369 TRP A CE2 1 
ATOM   2710  C CE3 . TRP A 1 343 ? 19.001  50.438  -39.515 1.00 37.95  ? 369 TRP A CE3 1 
ATOM   2711  C CZ2 . TRP A 1 343 ? 21.776  49.877  -39.711 1.00 33.86  ? 369 TRP A CZ2 1 
ATOM   2712  C CZ3 . TRP A 1 343 ? 19.951  51.453  -39.473 1.00 35.14  ? 369 TRP A CZ3 1 
ATOM   2713  C CH2 . TRP A 1 343 ? 21.321  51.163  -39.568 1.00 36.75  ? 369 TRP A CH2 1 
ATOM   2714  N N   . ARG A 1 344 ? 17.918  45.993  -42.746 1.00 63.58  ? 370 ARG A N   1 
ATOM   2715  C CA  . ARG A 1 344 ? 18.472  44.789  -43.349 1.00 69.76  ? 370 ARG A CA  1 
ATOM   2716  C C   . ARG A 1 344 ? 19.974  44.961  -43.567 1.00 71.70  ? 370 ARG A C   1 
ATOM   2717  O O   . ARG A 1 344 ? 20.403  45.831  -44.321 1.00 71.16  ? 370 ARG A O   1 
ATOM   2718  C CB  . ARG A 1 344 ? 17.785  44.526  -44.689 1.00 72.52  ? 370 ARG A CB  1 
ATOM   2719  C CG  . ARG A 1 344 ? 16.271  44.488  -44.605 1.00 77.86  ? 370 ARG A CG  1 
ATOM   2720  C CD  . ARG A 1 344 ? 15.655  44.704  -45.974 1.00 83.53  ? 370 ARG A CD  1 
ATOM   2721  N NE  . ARG A 1 344 ? 15.987  46.025  -46.509 1.00 87.73  ? 370 ARG A NE  1 
ATOM   2722  C CZ  . ARG A 1 344 ? 15.765  46.406  -47.766 1.00 89.07  ? 370 ARG A CZ  1 
ATOM   2723  N NH1 . ARG A 1 344 ? 15.208  45.567  -48.630 1.00 89.61  ? 370 ARG A NH1 1 
ATOM   2724  N NH2 . ARG A 1 344 ? 16.104  47.627  -48.161 1.00 89.29  ? 370 ARG A NH2 1 
ATOM   2725  N N   . ASP A 1 345 ? 20.773  44.136  -42.902 1.00 75.45  ? 371 ASP A N   1 
ATOM   2726  C CA  . ASP A 1 345 ? 22.218  44.226  -43.052 1.00 80.61  ? 371 ASP A CA  1 
ATOM   2727  C C   . ASP A 1 345 ? 22.686  43.488  -44.296 1.00 84.42  ? 371 ASP A C   1 
ATOM   2728  O O   . ASP A 1 345 ? 22.491  42.279  -44.427 1.00 84.55  ? 371 ASP A O   1 
ATOM   2729  C CB  . ASP A 1 345 ? 22.923  43.665  -41.823 1.00 80.56  ? 371 ASP A CB  1 
ATOM   2730  C CG  . ASP A 1 345 ? 22.718  44.522  -40.596 1.00 80.50  ? 371 ASP A CG  1 
ATOM   2731  O OD1 . ASP A 1 345 ? 22.907  45.753  -40.698 1.00 79.92  ? 371 ASP A OD1 1 
ATOM   2732  O OD2 . ASP A 1 345 ? 22.376  43.965  -39.532 1.00 80.48  ? 371 ASP A OD2 1 
ATOM   2733  N N   . PRO A 1 346 ? 23.318  44.217  -45.228 1.00 88.28  ? 372 PRO A N   1 
ATOM   2734  C CA  . PRO A 1 346 ? 23.832  43.670  -46.488 1.00 90.07  ? 372 PRO A CA  1 
ATOM   2735  C C   . PRO A 1 346 ? 25.055  42.783  -46.297 1.00 91.35  ? 372 PRO A C   1 
ATOM   2736  O O   . PRO A 1 346 ? 26.053  42.928  -47.005 1.00 93.28  ? 372 PRO A O   1 
ATOM   2737  C CB  . PRO A 1 346 ? 24.154  44.925  -47.290 1.00 90.05  ? 372 PRO A CB  1 
ATOM   2738  C CG  . PRO A 1 346 ? 24.654  45.855  -46.224 1.00 89.84  ? 372 PRO A CG  1 
ATOM   2739  C CD  . PRO A 1 346 ? 23.632  45.655  -45.118 1.00 89.14  ? 372 PRO A CD  1 
ATOM   2740  N N   . ASP A 1 347 ? 24.975  41.866  -45.339 1.00 91.10  ? 373 ASP A N   1 
ATOM   2741  C CA  . ASP A 1 347 ? 26.079  40.959  -45.061 1.00 91.05  ? 373 ASP A CA  1 
ATOM   2742  C C   . ASP A 1 347 ? 25.713  40.128  -43.842 1.00 89.84  ? 373 ASP A C   1 
ATOM   2743  O O   . ASP A 1 347 ? 26.581  39.693  -43.087 1.00 89.49  ? 373 ASP A O   1 
ATOM   2744  C CB  . ASP A 1 347 ? 27.359  41.756  -44.786 1.00 93.13  ? 373 ASP A CB  1 
ATOM   2745  C CG  . ASP A 1 347 ? 28.613  40.900  -44.870 1.00 95.62  ? 373 ASP A CG  1 
ATOM   2746  O OD1 . ASP A 1 347 ? 28.768  39.968  -44.048 1.00 96.70  ? 373 ASP A OD1 1 
ATOM   2747  O OD2 . ASP A 1 347 ? 29.448  41.162  -45.764 1.00 95.75  ? 373 ASP A OD2 1 
ATOM   2748  N N   . GLN A 1 348 ? 24.417  39.907  -43.657 1.00 88.39  ? 374 GLN A N   1 
ATOM   2749  C CA  . GLN A 1 348 ? 23.947  39.142  -42.513 1.00 86.55  ? 374 GLN A CA  1 
ATOM   2750  C C   . GLN A 1 348 ? 22.920  38.073  -42.859 1.00 84.46  ? 374 GLN A C   1 
ATOM   2751  O O   . GLN A 1 348 ? 22.198  37.591  -41.987 1.00 84.57  ? 374 GLN A O   1 
ATOM   2752  C CB  . GLN A 1 348 ? 23.384  40.094  -41.456 1.00 86.63  ? 374 GLN A CB  1 
ATOM   2753  C CG  . GLN A 1 348 ? 24.426  41.060  -40.908 1.00 87.08  ? 374 GLN A CG  1 
ATOM   2754  C CD  . GLN A 1 348 ? 25.534  40.364  -40.137 1.00 87.46  ? 374 GLN A CD  1 
ATOM   2755  O OE1 . GLN A 1 348 ? 26.557  40.971  -39.817 1.00 86.65  ? 374 GLN A OE1 1 
ATOM   2756  N NE2 . GLN A 1 348 ? 25.332  39.087  -39.827 1.00 88.05  ? 374 GLN A NE2 1 
ATOM   2757  N N   . THR A 1 349 ? 22.853  37.704  -44.133 1.00 81.47  ? 375 THR A N   1 
ATOM   2758  C CA  . THR A 1 349 ? 21.929  36.663  -44.560 1.00 78.48  ? 375 THR A CA  1 
ATOM   2759  C C   . THR A 1 349 ? 22.552  35.343  -44.110 1.00 75.86  ? 375 THR A C   1 
ATOM   2760  O O   . THR A 1 349 ? 21.857  34.349  -43.887 1.00 75.81  ? 375 THR A O   1 
ATOM   2761  C CB  . THR A 1 349 ? 21.769  36.658  -46.084 1.00 79.59  ? 375 THR A CB  1 
ATOM   2762  O OG1 . THR A 1 349 ? 21.378  37.965  -46.524 1.00 80.09  ? 375 THR A OG1 1 
ATOM   2763  C CG2 . THR A 1 349 ? 20.711  35.644  -46.502 1.00 80.60  ? 375 THR A CG2 1 
ATOM   2764  N N   . GLU A 1 350 ? 23.877  35.361  -43.980 1.00 71.35  ? 376 GLU A N   1 
ATOM   2765  C CA  . GLU A 1 350 ? 24.663  34.211  -43.541 1.00 65.68  ? 376 GLU A CA  1 
ATOM   2766  C C   . GLU A 1 350 ? 25.342  34.608  -42.233 1.00 61.37  ? 376 GLU A C   1 
ATOM   2767  O O   . GLU A 1 350 ? 24.929  35.563  -41.582 1.00 61.08  ? 376 GLU A O   1 
ATOM   2768  C CB  . GLU A 1 350 ? 25.726  33.863  -44.591 1.00 64.67  ? 376 GLU A CB  1 
ATOM   2769  C CG  . GLU A 1 350 ? 25.172  33.368  -45.920 1.00 63.63  ? 376 GLU A CG  1 
ATOM   2770  C CD  . GLU A 1 350 ? 24.700  31.921  -45.872 1.00 64.58  ? 376 GLU A CD  1 
ATOM   2771  O OE1 . GLU A 1 350 ? 24.100  31.462  -46.867 1.00 64.50  ? 376 GLU A OE1 1 
ATOM   2772  O OE2 . GLU A 1 350 ? 24.933  31.239  -44.849 1.00 63.77  ? 376 GLU A OE2 1 
ATOM   2773  N N   . GLY A 1 351 ? 26.382  33.878  -41.850 1.00 57.48  ? 377 GLY A N   1 
ATOM   2774  C CA  . GLY A 1 351 ? 27.094  34.197  -40.626 1.00 53.32  ? 377 GLY A CA  1 
ATOM   2775  C C   . GLY A 1 351 ? 26.399  33.803  -39.334 1.00 50.20  ? 377 GLY A C   1 
ATOM   2776  O O   . GLY A 1 351 ? 25.251  33.350  -39.332 1.00 50.13  ? 377 GLY A O   1 
ATOM   2777  N N   . LEU A 1 352 ? 27.115  33.973  -38.227 1.00 47.54  ? 378 LEU A N   1 
ATOM   2778  C CA  . LEU A 1 352 ? 26.597  33.651  -36.899 1.00 45.16  ? 378 LEU A CA  1 
ATOM   2779  C C   . LEU A 1 352 ? 26.250  34.927  -36.140 1.00 42.06  ? 378 LEU A C   1 
ATOM   2780  O O   . LEU A 1 352 ? 27.104  35.786  -35.941 1.00 42.74  ? 378 LEU A O   1 
ATOM   2781  C CB  . LEU A 1 352 ? 27.636  32.854  -36.105 1.00 44.39  ? 378 LEU A CB  1 
ATOM   2782  C CG  . LEU A 1 352 ? 27.815  31.374  -36.437 1.00 43.96  ? 378 LEU A CG  1 
ATOM   2783  C CD1 . LEU A 1 352 ? 29.050  30.848  -35.740 1.00 47.77  ? 378 LEU A CD1 1 
ATOM   2784  C CD2 . LEU A 1 352 ? 26.599  30.598  -35.986 1.00 45.44  ? 378 LEU A CD2 1 
ATOM   2785  N N   . GLY A 1 353 ? 24.997  35.050  -35.719 1.00 38.51  ? 379 GLY A N   1 
ATOM   2786  C CA  . GLY A 1 353 ? 24.587  36.236  -34.992 1.00 35.62  ? 379 GLY A CA  1 
ATOM   2787  C C   . GLY A 1 353 ? 24.845  37.510  -35.775 1.00 34.07  ? 379 GLY A C   1 
ATOM   2788  O O   . GLY A 1 353 ? 25.052  37.475  -36.990 1.00 34.08  ? 379 GLY A O   1 
ATOM   2789  N N   . LEU A 1 354 ? 24.844  38.641  -35.078 1.00 32.86  ? 380 LEU A N   1 
ATOM   2790  C CA  . LEU A 1 354 ? 25.071  39.932  -35.721 1.00 31.22  ? 380 LEU A CA  1 
ATOM   2791  C C   . LEU A 1 354 ? 26.397  40.551  -35.297 1.00 30.38  ? 380 LEU A C   1 
ATOM   2792  O O   . LEU A 1 354 ? 27.213  39.910  -34.627 1.00 33.28  ? 380 LEU A O   1 
ATOM   2793  C CB  . LEU A 1 354 ? 23.920  40.890  -35.393 1.00 31.15  ? 380 LEU A CB  1 
ATOM   2794  C CG  . LEU A 1 354 ? 22.511  40.475  -35.843 1.00 30.90  ? 380 LEU A CG  1 
ATOM   2795  C CD1 . LEU A 1 354 ? 21.501  41.493  -35.362 1.00 30.29  ? 380 LEU A CD1 1 
ATOM   2796  C CD2 . LEU A 1 354 ? 22.456  40.356  -37.361 1.00 30.10  ? 380 LEU A CD2 1 
ATOM   2797  N N   . ALA A 1 355 ? 26.610  41.797  -35.693 1.00 28.53  ? 381 ALA A N   1 
ATOM   2798  C CA  . ALA A 1 355 ? 27.838  42.508  -35.359 1.00 27.70  ? 381 ALA A CA  1 
ATOM   2799  C C   . ALA A 1 355 ? 27.833  42.997  -33.905 1.00 28.09  ? 381 ALA A C   1 
ATOM   2800  O O   . ALA A 1 355 ? 28.868  43.413  -33.379 1.00 28.75  ? 381 ALA A O   1 
ATOM   2801  C CB  . ALA A 1 355 ? 28.021  43.684  -36.310 1.00 25.28  ? 381 ALA A CB  1 
ATOM   2802  N N   . TYR A 1 356 ? 26.668  42.936  -33.262 1.00 26.82  ? 382 TYR A N   1 
ATOM   2803  C CA  . TYR A 1 356 ? 26.519  43.373  -31.874 1.00 24.87  ? 382 TYR A CA  1 
ATOM   2804  C C   . TYR A 1 356 ? 25.672  42.381  -31.067 1.00 24.72  ? 382 TYR A C   1 
ATOM   2805  O O   . TYR A 1 356 ? 24.736  41.776  -31.590 1.00 22.68  ? 382 TYR A O   1 
ATOM   2806  C CB  . TYR A 1 356 ? 25.858  44.755  -31.832 1.00 24.23  ? 382 TYR A CB  1 
ATOM   2807  C CG  . TYR A 1 356 ? 25.934  45.450  -30.488 1.00 25.11  ? 382 TYR A CG  1 
ATOM   2808  C CD1 . TYR A 1 356 ? 26.991  46.316  -30.196 1.00 24.57  ? 382 TYR A CD1 1 
ATOM   2809  C CD2 . TYR A 1 356 ? 24.951  45.256  -29.512 1.00 24.45  ? 382 TYR A CD2 1 
ATOM   2810  C CE1 . TYR A 1 356 ? 27.075  46.975  -28.970 1.00 23.14  ? 382 TYR A CE1 1 
ATOM   2811  C CE2 . TYR A 1 356 ? 25.027  45.917  -28.270 1.00 24.69  ? 382 TYR A CE2 1 
ATOM   2812  C CZ  . TYR A 1 356 ? 26.097  46.778  -28.015 1.00 24.17  ? 382 TYR A CZ  1 
ATOM   2813  O OH  . TYR A 1 356 ? 26.203  47.455  -26.822 1.00 19.75  ? 382 TYR A OH  1 
ATOM   2814  N N   . LEU A 1 357 ? 25.995  42.238  -29.787 1.00 23.28  ? 383 LEU A N   1 
ATOM   2815  C CA  . LEU A 1 357 ? 25.289  41.325  -28.899 1.00 24.16  ? 383 LEU A CA  1 
ATOM   2816  C C   . LEU A 1 357 ? 25.103  41.991  -27.533 1.00 24.91  ? 383 LEU A C   1 
ATOM   2817  O O   . LEU A 1 357 ? 26.076  42.246  -26.822 1.00 26.65  ? 383 LEU A O   1 
ATOM   2818  C CB  . LEU A 1 357 ? 26.097  40.025  -28.746 1.00 25.08  ? 383 LEU A CB  1 
ATOM   2819  C CG  . LEU A 1 357 ? 25.530  38.910  -27.850 1.00 25.36  ? 383 LEU A CG  1 
ATOM   2820  C CD1 . LEU A 1 357 ? 24.239  38.393  -28.433 1.00 21.75  ? 383 LEU A CD1 1 
ATOM   2821  C CD2 . LEU A 1 357 ? 26.535  37.774  -27.731 1.00 23.78  ? 383 LEU A CD2 1 
ATOM   2822  N N   . SER A 1 358 ? 23.855  42.271  -27.171 1.00 24.43  ? 384 SER A N   1 
ATOM   2823  C CA  . SER A 1 358 ? 23.542  42.910  -25.897 1.00 23.86  ? 384 SER A CA  1 
ATOM   2824  C C   . SER A 1 358 ? 24.164  42.154  -24.736 1.00 22.92  ? 384 SER A C   1 
ATOM   2825  O O   . SER A 1 358 ? 23.980  40.947  -24.602 1.00 24.95  ? 384 SER A O   1 
ATOM   2826  C CB  . SER A 1 358 ? 22.024  42.986  -25.696 1.00 26.66  ? 384 SER A CB  1 
ATOM   2827  O OG  . SER A 1 358 ? 21.405  43.740  -26.722 1.00 29.19  ? 384 SER A OG  1 
ATOM   2828  N N   . SER A 1 359 ? 24.882  42.874  -23.882 1.00 23.68  ? 385 SER A N   1 
ATOM   2829  C CA  . SER A 1 359 ? 25.548  42.268  -22.733 1.00 23.08  ? 385 SER A CA  1 
ATOM   2830  C C   . SER A 1 359 ? 24.679  41.391  -21.850 1.00 22.13  ? 385 SER A C   1 
ATOM   2831  O O   . SER A 1 359 ? 25.138  40.363  -21.356 1.00 21.09  ? 385 SER A O   1 
ATOM   2832  C CB  . SER A 1 359 ? 26.185  43.347  -21.858 1.00 24.35  ? 385 SER A CB  1 
ATOM   2833  O OG  . SER A 1 359 ? 27.564  43.481  -22.134 1.00 30.92  ? 385 SER A OG  1 
ATOM   2834  N N   . HIS A 1 360 ? 23.428  41.793  -21.652 1.00 21.07  ? 386 HIS A N   1 
ATOM   2835  C CA  . HIS A 1 360 ? 22.535  41.042  -20.786 1.00 22.14  ? 386 HIS A CA  1 
ATOM   2836  C C   . HIS A 1 360 ? 22.056  39.694  -21.319 1.00 22.81  ? 386 HIS A C   1 
ATOM   2837  O O   . HIS A 1 360 ? 21.241  39.037  -20.676 1.00 25.50  ? 386 HIS A O   1 
ATOM   2838  C CB  . HIS A 1 360 ? 21.332  41.900  -20.415 1.00 20.20  ? 386 HIS A CB  1 
ATOM   2839  C CG  . HIS A 1 360 ? 20.449  42.234  -21.574 1.00 19.91  ? 386 HIS A CG  1 
ATOM   2840  N ND1 . HIS A 1 360 ? 19.160  41.762  -21.686 1.00 17.13  ? 386 HIS A ND1 1 
ATOM   2841  C CD2 . HIS A 1 360 ? 20.658  43.017  -22.661 1.00 21.71  ? 386 HIS A CD2 1 
ATOM   2842  C CE1 . HIS A 1 360 ? 18.609  42.242  -22.786 1.00 20.33  ? 386 HIS A CE1 1 
ATOM   2843  N NE2 . HIS A 1 360 ? 19.499  43.007  -23.396 1.00 23.73  ? 386 HIS A NE2 1 
ATOM   2844  N N   . ILE A 1 361 ? 22.540  39.276  -22.484 1.00 22.70  ? 387 ILE A N   1 
ATOM   2845  C CA  . ILE A 1 361 ? 22.141  37.981  -23.021 1.00 24.20  ? 387 ILE A CA  1 
ATOM   2846  C C   . ILE A 1 361 ? 23.301  37.270  -23.679 1.00 25.98  ? 387 ILE A C   1 
ATOM   2847  O O   . ILE A 1 361 ? 23.123  36.199  -24.259 1.00 28.41  ? 387 ILE A O   1 
ATOM   2848  C CB  . ILE A 1 361 ? 21.036  38.098  -24.081 1.00 23.44  ? 387 ILE A CB  1 
ATOM   2849  C CG1 . ILE A 1 361 ? 21.452  39.111  -25.139 1.00 22.16  ? 387 ILE A CG1 1 
ATOM   2850  C CG2 . ILE A 1 361 ? 19.716  38.452  -23.432 1.00 22.96  ? 387 ILE A CG2 1 
ATOM   2851  C CD1 . ILE A 1 361 ? 20.634  39.028  -26.391 1.00 24.04  ? 387 ILE A CD1 1 
ATOM   2852  N N   . ALA A 1 362 ? 24.484  37.868  -23.594 1.00 28.34  ? 388 ALA A N   1 
ATOM   2853  C CA  . ALA A 1 362 ? 25.682  37.307  -24.217 1.00 33.22  ? 388 ALA A CA  1 
ATOM   2854  C C   . ALA A 1 362 ? 26.026  35.920  -23.691 1.00 35.53  ? 388 ALA A C   1 
ATOM   2855  O O   . ALA A 1 362 ? 26.703  35.133  -24.361 1.00 35.23  ? 388 ALA A O   1 
ATOM   2856  C CB  . ALA A 1 362 ? 26.860  38.252  -24.001 1.00 31.63  ? 388 ALA A CB  1 
ATOM   2857  N N   . HIS A 1 363 ? 25.534  35.637  -22.490 1.00 38.44  ? 389 HIS A N   1 
ATOM   2858  C CA  . HIS A 1 363 ? 25.767  34.383  -21.785 1.00 40.64  ? 389 HIS A CA  1 
ATOM   2859  C C   . HIS A 1 363 ? 24.694  33.327  -22.052 1.00 39.67  ? 389 HIS A C   1 
ATOM   2860  O O   . HIS A 1 363 ? 24.703  32.253  -21.441 1.00 39.64  ? 389 HIS A O   1 
ATOM   2861  C CB  . HIS A 1 363 ? 25.799  34.683  -20.291 1.00 45.84  ? 389 HIS A CB  1 
ATOM   2862  C CG  . HIS A 1 363 ? 24.546  35.342  -19.797 1.00 51.52  ? 389 HIS A CG  1 
ATOM   2863  N ND1 . HIS A 1 363 ? 23.401  34.633  -19.497 1.00 56.18  ? 389 HIS A ND1 1 
ATOM   2864  C CD2 . HIS A 1 363 ? 24.234  36.648  -19.621 1.00 53.61  ? 389 HIS A CD2 1 
ATOM   2865  C CE1 . HIS A 1 363 ? 22.438  35.474  -19.159 1.00 55.89  ? 389 HIS A CE1 1 
ATOM   2866  N NE2 . HIS A 1 363 ? 22.918  36.702  -19.227 1.00 55.93  ? 389 HIS A NE2 1 
ATOM   2867  N N   . VAL A 1 364 ? 23.765  33.628  -22.949 1.00 36.69  ? 390 VAL A N   1 
ATOM   2868  C CA  . VAL A 1 364 ? 22.685  32.691  -23.241 1.00 33.81  ? 390 VAL A CA  1 
ATOM   2869  C C   . VAL A 1 364 ? 22.970  31.799  -24.435 1.00 34.45  ? 390 VAL A C   1 
ATOM   2870  O O   . VAL A 1 364 ? 23.248  32.278  -25.536 1.00 32.10  ? 390 VAL A O   1 
ATOM   2871  C CB  . VAL A 1 364 ? 21.351  33.440  -23.486 1.00 32.48  ? 390 VAL A CB  1 
ATOM   2872  C CG1 . VAL A 1 364 ? 20.260  32.459  -23.881 1.00 23.57  ? 390 VAL A CG1 1 
ATOM   2873  C CG2 . VAL A 1 364 ? 20.953  34.205  -22.235 1.00 26.68  ? 390 VAL A CG2 1 
ATOM   2874  N N   . GLU A 1 365 ? 22.892  30.493  -24.201 1.00 37.01  ? 391 GLU A N   1 
ATOM   2875  C CA  . GLU A 1 365 ? 23.116  29.507  -25.246 1.00 39.30  ? 391 GLU A CA  1 
ATOM   2876  C C   . GLU A 1 365 ? 21.912  29.451  -26.166 1.00 38.80  ? 391 GLU A C   1 
ATOM   2877  O O   . GLU A 1 365 ? 20.766  29.446  -25.709 1.00 39.04  ? 391 GLU A O   1 
ATOM   2878  C CB  . GLU A 1 365 ? 23.326  28.123  -24.646 1.00 43.21  ? 391 GLU A CB  1 
ATOM   2879  C CG  . GLU A 1 365 ? 24.573  27.975  -23.812 1.00 52.43  ? 391 GLU A CG  1 
ATOM   2880  C CD  . GLU A 1 365 ? 24.685  26.585  -23.215 1.00 59.50  ? 391 GLU A CD  1 
ATOM   2881  O OE1 . GLU A 1 365 ? 24.659  25.604  -23.999 1.00 63.53  ? 391 GLU A OE1 1 
ATOM   2882  O OE2 . GLU A 1 365 ? 24.793  26.476  -21.970 1.00 59.95  ? 391 GLU A OE2 1 
ATOM   2883  N N   . ARG A 1 366 ? 22.182  29.401  -27.463 1.00 37.50  ? 392 ARG A N   1 
ATOM   2884  C CA  . ARG A 1 366 ? 21.135  29.332  -28.463 1.00 38.07  ? 392 ARG A CA  1 
ATOM   2885  C C   . ARG A 1 366 ? 20.783  27.872  -28.745 1.00 37.96  ? 392 ARG A C   1 
ATOM   2886  O O   . ARG A 1 366 ? 21.448  27.213  -29.531 1.00 40.10  ? 392 ARG A O   1 
ATOM   2887  C CB  . ARG A 1 366 ? 21.605  30.015  -29.747 1.00 36.56  ? 392 ARG A CB  1 
ATOM   2888  C CG  . ARG A 1 366 ? 22.023  31.469  -29.562 1.00 39.37  ? 392 ARG A CG  1 
ATOM   2889  C CD  . ARG A 1 366 ? 20.836  32.355  -29.208 1.00 41.87  ? 392 ARG A CD  1 
ATOM   2890  N NE  . ARG A 1 366 ? 20.947  33.696  -29.790 1.00 43.53  ? 392 ARG A NE  1 
ATOM   2891  C CZ  . ARG A 1 366 ? 21.680  34.686  -29.286 1.00 45.83  ? 392 ARG A CZ  1 
ATOM   2892  N NH1 . ARG A 1 366 ? 22.388  34.515  -28.170 1.00 47.96  ? 392 ARG A NH1 1 
ATOM   2893  N NH2 . ARG A 1 366 ? 21.702  35.858  -29.899 1.00 45.10  ? 392 ARG A NH2 1 
ATOM   2894  N N   . VAL A 1 367 ? 19.737  27.370  -28.096 1.00 39.42  ? 393 VAL A N   1 
ATOM   2895  C CA  . VAL A 1 367 ? 19.304  25.989  -28.288 1.00 40.81  ? 393 VAL A CA  1 
ATOM   2896  C C   . VAL A 1 367 ? 18.260  25.856  -29.400 1.00 41.25  ? 393 VAL A C   1 
ATOM   2897  O O   . VAL A 1 367 ? 17.162  26.413  -29.310 1.00 41.05  ? 393 VAL A O   1 
ATOM   2898  C CB  . VAL A 1 367 ? 18.724  25.390  -26.977 1.00 40.06  ? 393 VAL A CB  1 
ATOM   2899  C CG1 . VAL A 1 367 ? 17.746  26.360  -26.341 1.00 42.00  ? 393 VAL A CG1 1 
ATOM   2900  C CG2 . VAL A 1 367 ? 18.021  24.073  -27.273 1.00 38.85  ? 393 VAL A CG2 1 
ATOM   2901  N N   . PRO A 1 368 ? 18.604  25.130  -30.478 1.00 42.29  ? 394 PRO A N   1 
ATOM   2902  C CA  . PRO A 1 368 ? 17.692  24.925  -31.607 1.00 43.60  ? 394 PRO A CA  1 
ATOM   2903  C C   . PRO A 1 368 ? 16.491  24.065  -31.211 1.00 44.29  ? 394 PRO A C   1 
ATOM   2904  O O   . PRO A 1 368 ? 16.547  23.316  -30.231 1.00 43.16  ? 394 PRO A O   1 
ATOM   2905  C CB  . PRO A 1 368 ? 18.588  24.263  -32.656 1.00 44.18  ? 394 PRO A CB  1 
ATOM   2906  C CG  . PRO A 1 368 ? 19.610  23.558  -31.833 1.00 43.09  ? 394 PRO A CG  1 
ATOM   2907  C CD  . PRO A 1 368 ? 19.933  24.570  -30.777 1.00 41.27  ? 394 PRO A CD  1 
ATOM   2908  N N   . PHE A 1 369 ? 15.402  24.176  -31.966 1.00 45.28  ? 395 PHE A N   1 
ATOM   2909  C CA  . PHE A 1 369 ? 14.209  23.413  -31.639 1.00 47.93  ? 395 PHE A CA  1 
ATOM   2910  C C   . PHE A 1 369 ? 14.301  21.931  -31.979 1.00 49.15  ? 395 PHE A C   1 
ATOM   2911  O O   . PHE A 1 369 ? 14.728  21.541  -33.067 1.00 48.98  ? 395 PHE A O   1 
ATOM   2912  C CB  . PHE A 1 369 ? 12.962  24.014  -32.299 1.00 48.14  ? 395 PHE A CB  1 
ATOM   2913  C CG  . PHE A 1 369 ? 11.681  23.431  -31.777 1.00 48.37  ? 395 PHE A CG  1 
ATOM   2914  C CD1 . PHE A 1 369 ? 11.127  22.296  -32.359 1.00 49.66  ? 395 PHE A CD1 1 
ATOM   2915  C CD2 . PHE A 1 369 ? 11.076  23.965  -30.646 1.00 47.23  ? 395 PHE A CD2 1 
ATOM   2916  C CE1 . PHE A 1 369 ? 9.996   21.699  -31.815 1.00 50.02  ? 395 PHE A CE1 1 
ATOM   2917  C CE2 . PHE A 1 369 ? 9.946   23.376  -30.095 1.00 49.40  ? 395 PHE A CE2 1 
ATOM   2918  C CZ  . PHE A 1 369 ? 9.404   22.240  -30.679 1.00 49.25  ? 395 PHE A CZ  1 
ATOM   2919  N N   . ASP A 1 370 ? 13.887  21.115  -31.017 1.00 50.78  ? 396 ASP A N   1 
ATOM   2920  C CA  . ASP A 1 370 ? 13.904  19.671  -31.151 1.00 51.71  ? 396 ASP A CA  1 
ATOM   2921  C C   . ASP A 1 370 ? 12.706  19.127  -30.388 1.00 50.82  ? 396 ASP A C   1 
ATOM   2922  O O   . ASP A 1 370 ? 12.768  18.932  -29.171 1.00 49.78  ? 396 ASP A O   1 
ATOM   2923  C CB  . ASP A 1 370 ? 15.210  19.109  -30.577 1.00 54.36  ? 396 ASP A CB  1 
ATOM   2924  C CG  . ASP A 1 370 ? 15.441  17.668  -30.963 1.00 55.77  ? 396 ASP A CG  1 
ATOM   2925  O OD1 . ASP A 1 370 ? 14.826  16.770  -30.352 1.00 57.32  ? 396 ASP A OD1 1 
ATOM   2926  O OD2 . ASP A 1 370 ? 16.235  17.435  -31.897 1.00 60.53  ? 396 ASP A OD2 1 
ATOM   2927  N N   . ALA A 1 371 ? 11.616  18.897  -31.114 1.00 50.40  ? 397 ALA A N   1 
ATOM   2928  C CA  . ALA A 1 371 ? 10.381  18.385  -30.529 1.00 51.44  ? 397 ALA A CA  1 
ATOM   2929  C C   . ALA A 1 371 ? 10.602  17.228  -29.553 1.00 51.79  ? 397 ALA A C   1 
ATOM   2930  O O   . ALA A 1 371 ? 9.911   17.124  -28.537 1.00 52.15  ? 397 ALA A O   1 
ATOM   2931  C CB  . ALA A 1 371 ? 9.422   17.953  -31.638 1.00 49.98  ? 397 ALA A CB  1 
ATOM   2932  N N   . ALA A 1 372 ? 11.572  16.371  -29.854 1.00 51.57  ? 398 ALA A N   1 
ATOM   2933  C CA  . ALA A 1 372 ? 11.854  15.217  -29.010 1.00 51.74  ? 398 ALA A CA  1 
ATOM   2934  C C   . ALA A 1 372 ? 12.496  15.543  -27.661 1.00 51.86  ? 398 ALA A C   1 
ATOM   2935  O O   . ALA A 1 372 ? 12.329  14.797  -26.696 1.00 53.07  ? 398 ALA A O   1 
ATOM   2936  C CB  . ALA A 1 372 ? 12.721  14.228  -29.772 1.00 52.21  ? 398 ALA A CB  1 
ATOM   2937  N N   . THR A 1 373 ? 13.230  16.648  -27.583 1.00 51.12  ? 399 THR A N   1 
ATOM   2938  C CA  . THR A 1 373 ? 13.881  17.027  -26.329 1.00 48.76  ? 399 THR A CA  1 
ATOM   2939  C C   . THR A 1 373 ? 13.258  18.255  -25.665 1.00 46.96  ? 399 THR A C   1 
ATOM   2940  O O   . THR A 1 373 ? 13.634  18.623  -24.554 1.00 45.58  ? 399 THR A O   1 
ATOM   2941  C CB  . THR A 1 373 ? 15.393  17.294  -26.543 1.00 49.67  ? 399 THR A CB  1 
ATOM   2942  O OG1 . THR A 1 373 ? 15.600  17.950  -27.805 1.00 49.01  ? 399 THR A OG1 1 
ATOM   2943  C CG2 . THR A 1 373 ? 16.171  15.992  -26.504 1.00 50.93  ? 399 THR A CG2 1 
ATOM   2944  N N   . LEU A 1 374 ? 12.307  18.882  -26.350 1.00 44.47  ? 400 LEU A N   1 
ATOM   2945  C CA  . LEU A 1 374 ? 11.636  20.069  -25.836 1.00 44.11  ? 400 LEU A CA  1 
ATOM   2946  C C   . LEU A 1 374 ? 11.161  19.976  -24.384 1.00 45.87  ? 400 LEU A C   1 
ATOM   2947  O O   . LEU A 1 374 ? 11.432  20.861  -23.578 1.00 44.35  ? 400 LEU A O   1 
ATOM   2948  C CB  . LEU A 1 374 ? 10.441  20.408  -26.722 1.00 43.25  ? 400 LEU A CB  1 
ATOM   2949  C CG  . LEU A 1 374 ? 9.542   21.520  -26.182 1.00 42.94  ? 400 LEU A CG  1 
ATOM   2950  C CD1 . LEU A 1 374 ? 10.330  22.819  -26.110 1.00 41.06  ? 400 LEU A CD1 1 
ATOM   2951  C CD2 . LEU A 1 374 ? 8.322   21.672  -27.075 1.00 42.10  ? 400 LEU A CD2 1 
ATOM   2952  N N   . HIS A 1 375 ? 10.446  18.909  -24.052 1.00 49.09  ? 401 HIS A N   1 
ATOM   2953  C CA  . HIS A 1 375 ? 9.918   18.740  -22.703 1.00 52.53  ? 401 HIS A CA  1 
ATOM   2954  C C   . HIS A 1 375 ? 10.984  18.672  -21.624 1.00 51.17  ? 401 HIS A C   1 
ATOM   2955  O O   . HIS A 1 375 ? 10.668  18.607  -20.437 1.00 51.43  ? 401 HIS A O   1 
ATOM   2956  C CB  . HIS A 1 375 ? 9.044   17.484  -22.630 1.00 59.28  ? 401 HIS A CB  1 
ATOM   2957  C CG  . HIS A 1 375 ? 9.800   16.206  -22.838 1.00 64.71  ? 401 HIS A CG  1 
ATOM   2958  N ND1 . HIS A 1 375 ? 10.656  15.684  -21.891 1.00 67.03  ? 401 HIS A ND1 1 
ATOM   2959  C CD2 . HIS A 1 375 ? 9.829   15.347  -23.884 1.00 67.51  ? 401 HIS A CD2 1 
ATOM   2960  C CE1 . HIS A 1 375 ? 11.178  14.559  -22.344 1.00 67.48  ? 401 HIS A CE1 1 
ATOM   2961  N NE2 . HIS A 1 375 ? 10.693  14.331  -23.551 1.00 69.25  ? 401 HIS A NE2 1 
ATOM   2962  N N   . THR A 1 376 ? 12.246  18.689  -22.021 1.00 50.15  ? 402 THR A N   1 
ATOM   2963  C CA  . THR A 1 376 ? 13.309  18.607  -21.034 1.00 51.19  ? 402 THR A CA  1 
ATOM   2964  C C   . THR A 1 376 ? 14.155  19.874  -20.989 1.00 49.48  ? 402 THR A C   1 
ATOM   2965  O O   . THR A 1 376 ? 15.180  19.910  -20.309 1.00 50.12  ? 402 THR A O   1 
ATOM   2966  C CB  . THR A 1 376 ? 14.234  17.396  -21.314 1.00 53.16  ? 402 THR A CB  1 
ATOM   2967  O OG1 . THR A 1 376 ? 15.043  17.135  -20.161 1.00 58.49  ? 402 THR A OG1 1 
ATOM   2968  C CG2 . THR A 1 376 ? 15.148  17.680  -22.499 1.00 53.62  ? 402 THR A CG2 1 
ATOM   2969  N N   . SER A 1 377 ? 13.717  20.912  -21.703 1.00 47.08  ? 403 SER A N   1 
ATOM   2970  C CA  . SER A 1 377 ? 14.457  22.170  -21.754 1.00 43.38  ? 403 SER A CA  1 
ATOM   2971  C C   . SER A 1 377 ? 13.576  23.420  -21.748 1.00 42.02  ? 403 SER A C   1 
ATOM   2972  O O   . SER A 1 377 ? 12.918  23.737  -22.742 1.00 40.22  ? 403 SER A O   1 
ATOM   2973  C CB  . SER A 1 377 ? 15.353  22.188  -22.999 1.00 42.78  ? 403 SER A CB  1 
ATOM   2974  O OG  . SER A 1 377 ? 16.111  23.385  -23.093 1.00 42.44  ? 403 SER A OG  1 
ATOM   2975  N N   . THR A 1 378 ? 13.573  24.136  -20.627 1.00 39.36  ? 404 THR A N   1 
ATOM   2976  C CA  . THR A 1 378 ? 12.792  25.361  -20.537 1.00 36.91  ? 404 THR A CA  1 
ATOM   2977  C C   . THR A 1 378 ? 13.439  26.425  -21.433 1.00 36.48  ? 404 THR A C   1 
ATOM   2978  O O   . THR A 1 378 ? 12.758  27.310  -21.959 1.00 34.65  ? 404 THR A O   1 
ATOM   2979  C CB  . THR A 1 378 ? 12.710  25.881  -19.084 1.00 34.28  ? 404 THR A CB  1 
ATOM   2980  O OG1 . THR A 1 378 ? 14.026  26.013  -18.546 1.00 39.27  ? 404 THR A OG1 1 
ATOM   2981  C CG2 . THR A 1 378 ? 11.922  24.929  -18.222 1.00 32.21  ? 404 THR A CG2 1 
ATOM   2982  N N   . ALA A 1 379 ? 14.753  26.321  -21.617 1.00 35.22  ? 405 ALA A N   1 
ATOM   2983  C CA  . ALA A 1 379 ? 15.480  27.261  -22.455 1.00 34.78  ? 405 ALA A CA  1 
ATOM   2984  C C   . ALA A 1 379 ? 14.939  27.175  -23.875 1.00 34.88  ? 405 ALA A C   1 
ATOM   2985  O O   . ALA A 1 379 ? 14.726  28.192  -24.540 1.00 34.26  ? 405 ALA A O   1 
ATOM   2986  C CB  . ALA A 1 379 ? 16.959  26.939  -22.436 1.00 34.50  ? 405 ALA A CB  1 
ATOM   2987  N N   . MET A 1 380 ? 14.717  25.953  -24.342 1.00 34.87  ? 406 MET A N   1 
ATOM   2988  C CA  . MET A 1 380 ? 14.182  25.750  -25.682 1.00 33.77  ? 406 MET A CA  1 
ATOM   2989  C C   . MET A 1 380 ? 12.760  26.325  -25.739 1.00 30.87  ? 406 MET A C   1 
ATOM   2990  O O   . MET A 1 380 ? 12.390  27.010  -26.689 1.00 29.10  ? 406 MET A O   1 
ATOM   2991  C CB  . MET A 1 380 ? 14.157  24.260  -26.012 1.00 34.35  ? 406 MET A CB  1 
ATOM   2992  C CG  . MET A 1 380 ? 13.805  23.965  -27.458 1.00 36.80  ? 406 MET A CG  1 
ATOM   2993  S SD  . MET A 1 380 ? 13.460  22.219  -27.703 1.00 41.28  ? 406 MET A SD  1 
ATOM   2994  C CE  . MET A 1 380 ? 15.128  21.504  -27.543 1.00 37.62  ? 406 MET A CE  1 
ATOM   2995  N N   . ALA A 1 381 ? 11.968  26.034  -24.710 1.00 29.74  ? 407 ALA A N   1 
ATOM   2996  C CA  . ALA A 1 381 ? 10.599  26.538  -24.621 1.00 29.94  ? 407 ALA A CA  1 
ATOM   2997  C C   . ALA A 1 381 ? 10.564  28.058  -24.852 1.00 30.14  ? 407 ALA A C   1 
ATOM   2998  O O   . ALA A 1 381 ? 9.831   28.559  -25.713 1.00 28.28  ? 407 ALA A O   1 
ATOM   2999  C CB  . ALA A 1 381 ? 10.020  26.207  -23.248 1.00 26.98  ? 407 ALA A CB  1 
ATOM   3000  N N   . ALA A 1 382 ? 11.380  28.775  -24.079 1.00 28.26  ? 408 ALA A N   1 
ATOM   3001  C CA  . ALA A 1 382 ? 11.477  30.225  -24.146 1.00 26.02  ? 408 ALA A CA  1 
ATOM   3002  C C   . ALA A 1 382 ? 11.988  30.760  -25.475 1.00 27.13  ? 408 ALA A C   1 
ATOM   3003  O O   . ALA A 1 382 ? 11.425  31.703  -26.025 1.00 27.92  ? 408 ALA A O   1 
ATOM   3004  C CB  . ALA A 1 382 ? 12.365  30.721  -23.031 1.00 27.06  ? 408 ALA A CB  1 
ATOM   3005  N N   . GLN A 1 383 ? 13.059  30.169  -25.987 1.00 28.75  ? 409 GLN A N   1 
ATOM   3006  C CA  . GLN A 1 383 ? 13.632  30.626  -27.243 1.00 26.31  ? 409 GLN A CA  1 
ATOM   3007  C C   . GLN A 1 383 ? 12.751  30.381  -28.449 1.00 28.07  ? 409 GLN A C   1 
ATOM   3008  O O   . GLN A 1 383 ? 12.880  31.065  -29.463 1.00 31.07  ? 409 GLN A O   1 
ATOM   3009  C CB  . GLN A 1 383 ? 15.001  29.990  -27.453 1.00 26.35  ? 409 GLN A CB  1 
ATOM   3010  C CG  . GLN A 1 383 ? 16.081  30.616  -26.583 1.00 28.75  ? 409 GLN A CG  1 
ATOM   3011  C CD  . GLN A 1 383 ? 17.419  29.915  -26.702 1.00 28.45  ? 409 GLN A CD  1 
ATOM   3012  O OE1 . GLN A 1 383 ? 17.897  29.651  -27.805 1.00 28.39  ? 409 GLN A OE1 1 
ATOM   3013  N NE2 . GLN A 1 383 ? 18.036  29.621  -25.564 1.00 26.41  ? 409 GLN A NE2 1 
ATOM   3014  N N   . HIS A 1 384 ? 11.833  29.430  -28.344 1.00 30.17  ? 410 HIS A N   1 
ATOM   3015  C CA  . HIS A 1 384 ? 10.951  29.128  -29.470 1.00 32.30  ? 410 HIS A CA  1 
ATOM   3016  C C   . HIS A 1 384 ? 9.460   29.323  -29.168 1.00 33.54  ? 410 HIS A C   1 
ATOM   3017  O O   . HIS A 1 384 ? 8.601   28.999  -29.993 1.00 34.26  ? 410 HIS A O   1 
ATOM   3018  C CB  . HIS A 1 384 ? 11.235  27.698  -29.964 1.00 33.13  ? 410 HIS A CB  1 
ATOM   3019  C CG  . HIS A 1 384 ? 12.627  27.518  -30.495 1.00 31.64  ? 410 HIS A CG  1 
ATOM   3020  N ND1 . HIS A 1 384 ? 13.040  28.052  -31.697 1.00 29.69  ? 410 HIS A ND1 1 
ATOM   3021  C CD2 . HIS A 1 384 ? 13.729  26.960  -29.936 1.00 30.57  ? 410 HIS A CD2 1 
ATOM   3022  C CE1 . HIS A 1 384 ? 14.332  27.839  -31.854 1.00 28.40  ? 410 HIS A CE1 1 
ATOM   3023  N NE2 . HIS A 1 384 ? 14.776  27.179  -30.799 1.00 28.61  ? 410 HIS A NE2 1 
ATOM   3024  N N   . GLY A 1 385 ? 9.165   29.864  -27.988 1.00 33.16  ? 411 GLY A N   1 
ATOM   3025  C CA  . GLY A 1 385 ? 7.788   30.102  -27.597 1.00 32.82  ? 411 GLY A CA  1 
ATOM   3026  C C   . GLY A 1 385 ? 6.894   28.876  -27.615 1.00 33.73  ? 411 GLY A C   1 
ATOM   3027  O O   . GLY A 1 385 ? 5.754   28.948  -28.066 1.00 33.35  ? 411 GLY A O   1 
ATOM   3028  N N   . MET A 1 386 ? 7.397   27.753  -27.113 1.00 33.04  ? 412 MET A N   1 
ATOM   3029  C CA  . MET A 1 386 ? 6.625   26.517  -27.079 1.00 33.31  ? 412 MET A CA  1 
ATOM   3030  C C   . MET A 1 386 ? 6.591   25.896  -25.680 1.00 33.53  ? 412 MET A C   1 
ATOM   3031  O O   . MET A 1 386 ? 7.532   25.222  -25.269 1.00 30.86  ? 412 MET A O   1 
ATOM   3032  C CB  . MET A 1 386 ? 7.217   25.508  -28.069 1.00 34.90  ? 412 MET A CB  1 
ATOM   3033  C CG  . MET A 1 386 ? 7.246   25.971  -29.530 1.00 35.70  ? 412 MET A CG  1 
ATOM   3034  S SD  . MET A 1 386 ? 5.648   25.854  -30.395 1.00 36.57  ? 412 MET A SD  1 
ATOM   3035  C CE  . MET A 1 386 ? 5.417   24.082  -30.339 1.00 35.65  ? 412 MET A CE  1 
ATOM   3036  N N   . ASP A 1 387 ? 5.502   26.123  -24.953 1.00 35.26  ? 413 ASP A N   1 
ATOM   3037  C CA  . ASP A 1 387 ? 5.356   25.566  -23.607 1.00 37.33  ? 413 ASP A CA  1 
ATOM   3038  C C   . ASP A 1 387 ? 5.356   24.026  -23.614 1.00 37.46  ? 413 ASP A C   1 
ATOM   3039  O O   . ASP A 1 387 ? 5.626   23.392  -22.598 1.00 38.31  ? 413 ASP A O   1 
ATOM   3040  C CB  . ASP A 1 387 ? 4.081   26.112  -22.947 1.00 36.14  ? 413 ASP A CB  1 
ATOM   3041  C CG  . ASP A 1 387 ? 4.210   27.582  -22.542 1.00 36.27  ? 413 ASP A CG  1 
ATOM   3042  O OD1 . ASP A 1 387 ? 3.292   28.374  -22.856 1.00 36.35  ? 413 ASP A OD1 1 
ATOM   3043  O OD2 . ASP A 1 387 ? 5.220   27.946  -21.899 1.00 34.05  ? 413 ASP A OD2 1 
ATOM   3044  N N   . ASP A 1 388 ? 5.038   23.436  -24.762 1.00 38.53  ? 414 ASP A N   1 
ATOM   3045  C CA  . ASP A 1 388 ? 5.057   21.984  -24.938 1.00 39.73  ? 414 ASP A CA  1 
ATOM   3046  C C   . ASP A 1 388 ? 4.813   21.695  -26.417 1.00 41.04  ? 414 ASP A C   1 
ATOM   3047  O O   . ASP A 1 388 ? 4.619   22.627  -27.193 1.00 41.05  ? 414 ASP A O   1 
ATOM   3048  C CB  . ASP A 1 388 ? 4.032   21.281  -24.034 1.00 38.98  ? 414 ASP A CB  1 
ATOM   3049  C CG  . ASP A 1 388 ? 2.597   21.435  -24.510 1.00 41.95  ? 414 ASP A CG  1 
ATOM   3050  O OD1 . ASP A 1 388 ? 1.709   20.852  -23.848 1.00 39.59  ? 414 ASP A OD1 1 
ATOM   3051  O OD2 . ASP A 1 388 ? 2.350   22.123  -25.526 1.00 40.00  ? 414 ASP A OD2 1 
ATOM   3052  N N   . ASP A 1 389 ? 4.835   20.429  -26.821 1.00 44.92  ? 415 ASP A N   1 
ATOM   3053  C CA  . ASP A 1 389 ? 4.650   20.102  -28.238 1.00 47.75  ? 415 ASP A CA  1 
ATOM   3054  C C   . ASP A 1 389 ? 3.287   20.448  -28.818 1.00 47.64  ? 415 ASP A C   1 
ATOM   3055  O O   . ASP A 1 389 ? 3.122   20.470  -30.033 1.00 49.21  ? 415 ASP A O   1 
ATOM   3056  C CB  . ASP A 1 389 ? 4.960   18.626  -28.494 1.00 50.56  ? 415 ASP A CB  1 
ATOM   3057  C CG  . ASP A 1 389 ? 4.348   17.718  -27.460 1.00 53.71  ? 415 ASP A CG  1 
ATOM   3058  O OD1 . ASP A 1 389 ? 3.117   17.779  -27.279 1.00 56.09  ? 415 ASP A OD1 1 
ATOM   3059  O OD2 . ASP A 1 389 ? 5.100   16.946  -26.828 1.00 55.50  ? 415 ASP A OD2 1 
ATOM   3060  N N   . GLY A 1 390 ? 2.315   20.718  -27.954 1.00 47.67  ? 416 GLY A N   1 
ATOM   3061  C CA  . GLY A 1 390 ? 0.989   21.079  -28.427 1.00 46.17  ? 416 GLY A CA  1 
ATOM   3062  C C   . GLY A 1 390 ? 0.063   19.918  -28.727 1.00 44.99  ? 416 GLY A C   1 
ATOM   3063  O O   . GLY A 1 390 ? -0.853  20.050  -29.536 1.00 44.25  ? 416 GLY A O   1 
ATOM   3064  N N   . THR A 1 391 ? 0.290   18.780  -28.080 1.00 44.73  ? 417 THR A N   1 
ATOM   3065  C CA  . THR A 1 391 ? -0.551  17.612  -28.305 1.00 46.41  ? 417 THR A CA  1 
ATOM   3066  C C   . THR A 1 391 ? -1.391  17.292  -27.070 1.00 47.25  ? 417 THR A C   1 
ATOM   3067  O O   . THR A 1 391 ? -1.912  16.184  -26.931 1.00 48.08  ? 417 THR A O   1 
ATOM   3068  C CB  . THR A 1 391 ? 0.287   16.362  -28.682 1.00 44.78  ? 417 THR A CB  1 
ATOM   3069  O OG1 . THR A 1 391 ? 1.132   15.995  -27.584 1.00 44.53  ? 417 THR A OG1 1 
ATOM   3070  C CG2 . THR A 1 391 ? 1.140   16.644  -29.906 1.00 41.87  ? 417 THR A CG2 1 
ATOM   3071  N N   . GLY A 1 392 ? -1.524  18.273  -26.181 1.00 46.81  ? 418 GLY A N   1 
ATOM   3072  C CA  . GLY A 1 392 ? -2.315  18.081  -24.978 1.00 44.69  ? 418 GLY A CA  1 
ATOM   3073  C C   . GLY A 1 392 ? -3.805  18.263  -25.227 1.00 44.64  ? 418 GLY A C   1 
ATOM   3074  O O   . GLY A 1 392 ? -4.217  18.701  -26.307 1.00 42.67  ? 418 GLY A O   1 
ATOM   3075  N N   . GLN A 1 393 ? -4.609  17.923  -24.221 1.00 45.12  ? 419 GLN A N   1 
ATOM   3076  C CA  . GLN A 1 393 ? -6.064  18.037  -24.296 1.00 45.64  ? 419 GLN A CA  1 
ATOM   3077  C C   . GLN A 1 393 ? -6.485  19.497  -24.461 1.00 44.73  ? 419 GLN A C   1 
ATOM   3078  O O   . GLN A 1 393 ? -5.982  20.380  -23.764 1.00 43.64  ? 419 GLN A O   1 
ATOM   3079  C CB  . GLN A 1 393 ? -6.699  17.478  -23.019 1.00 50.26  ? 419 GLN A CB  1 
ATOM   3080  C CG  . GLN A 1 393 ? -6.279  16.056  -22.662 1.00 57.94  ? 419 GLN A CG  1 
ATOM   3081  C CD  . GLN A 1 393 ? -7.319  15.017  -23.047 1.00 63.40  ? 419 GLN A CD  1 
ATOM   3082  O OE1 . GLN A 1 393 ? -7.730  14.927  -24.210 1.00 65.69  ? 419 GLN A OE1 1 
ATOM   3083  N NE2 . GLN A 1 393 ? -7.749  14.219  -22.067 1.00 63.97  ? 419 GLN A NE2 1 
ATOM   3084  N N   . LYS A 1 394 ? -7.418  19.747  -25.371 1.00 43.30  ? 420 LYS A N   1 
ATOM   3085  C CA  . LYS A 1 394 ? -7.894  21.103  -25.606 1.00 43.13  ? 420 LYS A CA  1 
ATOM   3086  C C   . LYS A 1 394 ? -9.388  21.169  -25.924 1.00 43.62  ? 420 LYS A C   1 
ATOM   3087  O O   . LYS A 1 394 ? -9.976  20.211  -26.437 1.00 44.41  ? 420 LYS A O   1 
ATOM   3088  C CB  . LYS A 1 394 ? -7.114  21.744  -26.757 1.00 40.67  ? 420 LYS A CB  1 
ATOM   3089  C CG  . LYS A 1 394 ? -7.396  21.126  -28.111 1.00 38.28  ? 420 LYS A CG  1 
ATOM   3090  C CD  . LYS A 1 394 ? -6.699  21.895  -29.212 1.00 40.54  ? 420 LYS A CD  1 
ATOM   3091  C CE  . LYS A 1 394 ? -6.945  21.277  -30.578 1.00 41.53  ? 420 LYS A CE  1 
ATOM   3092  N NZ  . LYS A 1 394 ? -6.348  19.917  -30.701 1.00 40.53  ? 420 LYS A NZ  1 
ATOM   3093  N N   . GLN A 1 395 ? -9.989  22.313  -25.610 1.00 41.93  ? 421 GLN A N   1 
ATOM   3094  C CA  . GLN A 1 395 ? -11.397 22.559  -25.877 1.00 41.88  ? 421 GLN A CA  1 
ATOM   3095  C C   . GLN A 1 395 ? -11.488 23.868  -26.638 1.00 39.03  ? 421 GLN A C   1 
ATOM   3096  O O   . GLN A 1 395 ? -10.779 24.819  -26.321 1.00 39.29  ? 421 GLN A O   1 
ATOM   3097  C CB  . GLN A 1 395 ? -12.179 22.670  -24.573 1.00 46.52  ? 421 GLN A CB  1 
ATOM   3098  C CG  . GLN A 1 395 ? -12.240 21.377  -23.786 1.00 56.20  ? 421 GLN A CG  1 
ATOM   3099  C CD  . GLN A 1 395 ? -13.086 21.504  -22.537 1.00 60.90  ? 421 GLN A CD  1 
ATOM   3100  O OE1 . GLN A 1 395 ? -14.240 21.938  -22.601 1.00 63.17  ? 421 GLN A OE1 1 
ATOM   3101  N NE2 . GLN A 1 395 ? -12.521 21.123  -21.392 1.00 61.92  ? 421 GLN A NE2 1 
ATOM   3102  N N   . ILE A 1 396 ? -12.352 23.918  -27.646 1.00 36.12  ? 422 ILE A N   1 
ATOM   3103  C CA  . ILE A 1 396 ? -12.512 25.134  -28.432 1.00 34.21  ? 422 ILE A CA  1 
ATOM   3104  C C   . ILE A 1 396 ? -13.953 25.630  -28.459 1.00 34.47  ? 422 ILE A C   1 
ATOM   3105  O O   . ILE A 1 396 ? -14.870 24.879  -28.780 1.00 36.12  ? 422 ILE A O   1 
ATOM   3106  C CB  . ILE A 1 396 ? -12.032 24.928  -29.877 1.00 31.07  ? 422 ILE A CB  1 
ATOM   3107  C CG1 . ILE A 1 396 ? -10.554 24.547  -29.866 1.00 30.46  ? 422 ILE A CG1 1 
ATOM   3108  C CG2 . ILE A 1 396 ? -12.253 26.199  -30.692 1.00 27.91  ? 422 ILE A CG2 1 
ATOM   3109  C CD1 . ILE A 1 396 ? -9.938  24.422  -31.244 1.00 34.96  ? 422 ILE A CD1 1 
ATOM   3110  N N   . TRP A 1 397 ? -14.131 26.901  -28.110 1.00 33.81  ? 423 TRP A N   1 
ATOM   3111  C CA  . TRP A 1 397 ? -15.442 27.545  -28.086 1.00 33.52  ? 423 TRP A CA  1 
ATOM   3112  C C   . TRP A 1 397 ? -15.521 28.755  -29.016 1.00 35.15  ? 423 TRP A C   1 
ATOM   3113  O O   . TRP A 1 397 ? -14.535 29.461  -29.247 1.00 37.11  ? 423 TRP A O   1 
ATOM   3114  C CB  . TRP A 1 397 ? -15.775 28.044  -26.683 1.00 30.52  ? 423 TRP A CB  1 
ATOM   3115  C CG  . TRP A 1 397 ? -16.032 26.999  -25.671 1.00 29.34  ? 423 TRP A CG  1 
ATOM   3116  C CD1 . TRP A 1 397 ? -17.190 26.307  -25.480 1.00 29.93  ? 423 TRP A CD1 1 
ATOM   3117  C CD2 . TRP A 1 397 ? -15.133 26.571  -24.646 1.00 28.94  ? 423 TRP A CD2 1 
ATOM   3118  N NE1 . TRP A 1 397 ? -17.074 25.480  -24.388 1.00 29.52  ? 423 TRP A NE1 1 
ATOM   3119  C CE2 . TRP A 1 397 ? -15.820 25.624  -23.855 1.00 29.11  ? 423 TRP A CE2 1 
ATOM   3120  C CE3 . TRP A 1 397 ? -13.817 26.902  -24.310 1.00 27.90  ? 423 TRP A CE3 1 
ATOM   3121  C CZ2 . TRP A 1 397 ? -15.234 24.999  -22.753 1.00 30.39  ? 423 TRP A CZ2 1 
ATOM   3122  C CZ3 . TRP A 1 397 ? -13.231 26.279  -23.209 1.00 30.72  ? 423 TRP A CZ3 1 
ATOM   3123  C CH2 . TRP A 1 397 ? -13.942 25.341  -22.443 1.00 28.01  ? 423 TRP A CH2 1 
ATOM   3124  N N   . ARG A 1 398 ? -16.713 28.991  -29.542 1.00 35.40  ? 424 ARG A N   1 
ATOM   3125  C CA  . ARG A 1 398 ? -16.955 30.137  -30.392 1.00 34.88  ? 424 ARG A CA  1 
ATOM   3126  C C   . ARG A 1 398 ? -17.842 31.031  -29.532 1.00 34.24  ? 424 ARG A C   1 
ATOM   3127  O O   . ARG A 1 398 ? -18.630 30.542  -28.715 1.00 30.48  ? 424 ARG A O   1 
ATOM   3128  C CB  . ARG A 1 398 ? -17.691 29.723  -31.669 1.00 35.26  ? 424 ARG A CB  1 
ATOM   3129  C CG  . ARG A 1 398 ? -17.954 30.879  -32.620 1.00 39.28  ? 424 ARG A CG  1 
ATOM   3130  C CD  . ARG A 1 398 ? -18.702 30.431  -33.875 1.00 41.76  ? 424 ARG A CD  1 
ATOM   3131  N NE  . ARG A 1 398 ? -19.877 29.632  -33.538 1.00 42.79  ? 424 ARG A NE  1 
ATOM   3132  C CZ  . ARG A 1 398 ? -19.956 28.313  -33.688 1.00 44.19  ? 424 ARG A CZ  1 
ATOM   3133  N NH1 . ARG A 1 398 ? -18.927 27.631  -34.181 1.00 45.37  ? 424 ARG A NH1 1 
ATOM   3134  N NH2 . ARG A 1 398 ? -21.057 27.671  -33.320 1.00 45.60  ? 424 ARG A NH2 1 
ATOM   3135  N N   . VAL A 1 399 ? -17.701 32.340  -29.676 1.00 34.33  ? 425 VAL A N   1 
ATOM   3136  C CA  . VAL A 1 399 ? -18.526 33.227  -28.885 1.00 34.84  ? 425 VAL A CA  1 
ATOM   3137  C C   . VAL A 1 399 ? -19.716 33.666  -29.712 1.00 36.44  ? 425 VAL A C   1 
ATOM   3138  O O   . VAL A 1 399 ? -19.559 34.259  -30.782 1.00 37.64  ? 425 VAL A O   1 
ATOM   3139  C CB  . VAL A 1 399 ? -17.736 34.455  -28.406 1.00 34.51  ? 425 VAL A CB  1 
ATOM   3140  C CG1 . VAL A 1 399 ? -18.663 35.423  -27.678 1.00 34.54  ? 425 VAL A CG1 1 
ATOM   3141  C CG2 . VAL A 1 399 ? -16.617 34.010  -27.483 1.00 32.61  ? 425 VAL A CG2 1 
ATOM   3142  N N   . GLU A 1 400 ? -20.904 33.333  -29.222 1.00 38.80  ? 426 GLU A N   1 
ATOM   3143  C CA  . GLU A 1 400 ? -22.152 33.695  -29.885 1.00 40.00  ? 426 GLU A CA  1 
ATOM   3144  C C   . GLU A 1 400 ? -22.952 34.565  -28.926 1.00 39.09  ? 426 GLU A C   1 
ATOM   3145  O O   . GLU A 1 400 ? -23.487 34.084  -27.923 1.00 39.31  ? 426 GLU A O   1 
ATOM   3146  C CB  . GLU A 1 400 ? -22.952 32.444  -30.267 1.00 39.03  ? 426 GLU A CB  1 
ATOM   3147  C CG  . GLU A 1 400 ? -22.307 31.631  -31.382 1.00 46.29  ? 426 GLU A CG  1 
ATOM   3148  C CD  . GLU A 1 400 ? -23.184 30.494  -31.884 1.00 50.74  ? 426 GLU A CD  1 
ATOM   3149  O OE1 . GLU A 1 400 ? -22.688 29.691  -32.700 1.00 52.69  ? 426 GLU A OE1 1 
ATOM   3150  O OE2 . GLU A 1 400 ? -24.364 30.402  -31.473 1.00 51.97  ? 426 GLU A OE2 1 
ATOM   3151  N N   . GLY A 1 401 ? -23.021 35.853  -29.236 1.00 37.62  ? 427 GLY A N   1 
ATOM   3152  C CA  . GLY A 1 401 ? -23.738 36.763  -28.372 1.00 36.62  ? 427 GLY A CA  1 
ATOM   3153  C C   . GLY A 1 401 ? -22.966 36.939  -27.081 1.00 37.13  ? 427 GLY A C   1 
ATOM   3154  O O   . GLY A 1 401 ? -21.973 37.665  -27.034 1.00 36.56  ? 427 GLY A O   1 
ATOM   3155  N N   . SER A 1 402 ? -23.405 36.248  -26.037 1.00 38.03  ? 428 SER A N   1 
ATOM   3156  C CA  . SER A 1 402 ? -22.763 36.349  -24.739 1.00 37.90  ? 428 SER A CA  1 
ATOM   3157  C C   . SER A 1 402 ? -22.483 34.990  -24.114 1.00 38.31  ? 428 SER A C   1 
ATOM   3158  O O   . SER A 1 402 ? -22.271 34.891  -22.906 1.00 38.63  ? 428 SER A O   1 
ATOM   3159  C CB  . SER A 1 402 ? -23.641 37.180  -23.801 1.00 38.11  ? 428 SER A CB  1 
ATOM   3160  O OG  . SER A 1 402 ? -24.937 36.612  -23.685 1.00 37.49  ? 428 SER A OG  1 
ATOM   3161  N N   . ASN A 1 403 ? -22.469 33.941  -24.930 1.00 40.10  ? 429 ASN A N   1 
ATOM   3162  C CA  . ASN A 1 403 ? -22.206 32.606  -24.400 1.00 42.72  ? 429 ASN A CA  1 
ATOM   3163  C C   . ASN A 1 403 ? -21.108 31.864  -25.159 1.00 40.88  ? 429 ASN A C   1 
ATOM   3164  O O   . ASN A 1 403 ? -20.775 32.217  -26.293 1.00 41.23  ? 429 ASN A O   1 
ATOM   3165  C CB  . ASN A 1 403 ? -23.489 31.766  -24.424 1.00 46.95  ? 429 ASN A CB  1 
ATOM   3166  C CG  . ASN A 1 403 ? -24.732 32.598  -24.200 1.00 50.48  ? 429 ASN A CG  1 
ATOM   3167  O OD1 . ASN A 1 403 ? -25.268 33.199  -25.136 1.00 54.36  ? 429 ASN A OD1 1 
ATOM   3168  N ND2 . ASN A 1 403 ? -25.190 32.656  -22.951 1.00 51.62  ? 429 ASN A ND2 1 
ATOM   3169  N N   . LYS A 1 404 ? -20.547 30.843  -24.515 1.00 38.43  ? 430 LYS A N   1 
ATOM   3170  C CA  . LYS A 1 404 ? -19.509 30.016  -25.118 1.00 37.28  ? 430 LYS A CA  1 
ATOM   3171  C C   . LYS A 1 404 ? -20.178 28.831  -25.795 1.00 37.79  ? 430 LYS A C   1 
ATOM   3172  O O   . LYS A 1 404 ? -20.835 28.036  -25.133 1.00 41.65  ? 430 LYS A O   1 
ATOM   3173  C CB  . LYS A 1 404 ? -18.553 29.458  -24.062 1.00 33.37  ? 430 LYS A CB  1 
ATOM   3174  C CG  . LYS A 1 404 ? -17.730 30.462  -23.317 1.00 31.33  ? 430 LYS A CG  1 
ATOM   3175  C CD  . LYS A 1 404 ? -16.520 29.777  -22.680 1.00 33.05  ? 430 LYS A CD  1 
ATOM   3176  C CE  . LYS A 1 404 ? -16.908 28.705  -21.663 1.00 33.47  ? 430 LYS A CE  1 
ATOM   3177  N NZ  . LYS A 1 404 ? -17.524 29.291  -20.442 1.00 32.50  ? 430 LYS A NZ  1 
ATOM   3178  N N   . VAL A 1 405 ? -20.008 28.694  -27.102 1.00 38.17  ? 431 VAL A N   1 
ATOM   3179  C CA  . VAL A 1 405 ? -20.610 27.571  -27.802 1.00 37.61  ? 431 VAL A CA  1 
ATOM   3180  C C   . VAL A 1 405 ? -19.527 26.643  -28.349 1.00 37.51  ? 431 VAL A C   1 
ATOM   3181  O O   . VAL A 1 405 ? -18.678 27.064  -29.136 1.00 34.10  ? 431 VAL A O   1 
ATOM   3182  C CB  . VAL A 1 405 ? -21.496 28.049  -28.964 1.00 39.58  ? 431 VAL A CB  1 
ATOM   3183  C CG1 . VAL A 1 405 ? -22.218 26.860  -29.590 1.00 38.73  ? 431 VAL A CG1 1 
ATOM   3184  C CG2 . VAL A 1 405 ? -22.489 29.085  -28.462 1.00 38.80  ? 431 VAL A CG2 1 
ATOM   3185  N N   . PRO A 1 406 ? -19.550 25.361  -27.937 1.00 38.32  ? 432 PRO A N   1 
ATOM   3186  C CA  . PRO A 1 406 ? -18.569 24.368  -28.385 1.00 37.63  ? 432 PRO A CA  1 
ATOM   3187  C C   . PRO A 1 406 ? -18.445 24.363  -29.893 1.00 37.45  ? 432 PRO A C   1 
ATOM   3188  O O   . PRO A 1 406 ? -19.441 24.458  -30.598 1.00 38.13  ? 432 PRO A O   1 
ATOM   3189  C CB  . PRO A 1 406 ? -19.141 23.054  -27.865 1.00 37.83  ? 432 PRO A CB  1 
ATOM   3190  C CG  . PRO A 1 406 ? -19.879 23.469  -26.629 1.00 36.77  ? 432 PRO A CG  1 
ATOM   3191  C CD  . PRO A 1 406 ? -20.570 24.730  -27.077 1.00 38.34  ? 432 PRO A CD  1 
ATOM   3192  N N   . VAL A 1 407 ? -17.220 24.269  -30.386 1.00 39.71  ? 433 VAL A N   1 
ATOM   3193  C CA  . VAL A 1 407 ? -16.995 24.229  -31.822 1.00 43.44  ? 433 VAL A CA  1 
ATOM   3194  C C   . VAL A 1 407 ? -16.979 22.759  -32.209 1.00 44.86  ? 433 VAL A C   1 
ATOM   3195  O O   . VAL A 1 407 ? -16.467 21.928  -31.465 1.00 43.76  ? 433 VAL A O   1 
ATOM   3196  C CB  . VAL A 1 407 ? -15.642 24.881  -32.204 1.00 45.15  ? 433 VAL A CB  1 
ATOM   3197  C CG1 . VAL A 1 407 ? -15.390 24.743  -33.692 1.00 45.35  ? 433 VAL A CG1 1 
ATOM   3198  C CG2 . VAL A 1 407 ? -15.649 26.347  -31.823 1.00 47.36  ? 433 VAL A CG2 1 
ATOM   3199  N N   . ASP A 1 408 ? -17.558 22.430  -33.358 1.00 49.23  ? 434 ASP A N   1 
ATOM   3200  C CA  . ASP A 1 408 ? -17.586 21.044  -33.808 1.00 53.02  ? 434 ASP A CA  1 
ATOM   3201  C C   . ASP A 1 408 ? -16.147 20.521  -33.862 1.00 54.20  ? 434 ASP A C   1 
ATOM   3202  O O   . ASP A 1 408 ? -15.327 21.019  -34.637 1.00 52.94  ? 434 ASP A O   1 
ATOM   3203  C CB  . ASP A 1 408 ? -18.230 20.955  -35.192 1.00 56.58  ? 434 ASP A CB  1 
ATOM   3204  C CG  . ASP A 1 408 ? -18.503 19.526  -35.616 1.00 58.74  ? 434 ASP A CG  1 
ATOM   3205  O OD1 . ASP A 1 408 ? -17.590 18.684  -35.495 1.00 60.47  ? 434 ASP A OD1 1 
ATOM   3206  O OD2 . ASP A 1 408 ? -19.629 19.247  -36.077 1.00 61.66  ? 434 ASP A OD2 1 
ATOM   3207  N N   . PRO A 1 409 ? -15.825 19.511  -33.036 1.00 55.21  ? 435 PRO A N   1 
ATOM   3208  C CA  . PRO A 1 409 ? -14.487 18.915  -32.978 1.00 57.24  ? 435 PRO A CA  1 
ATOM   3209  C C   . PRO A 1 409 ? -13.841 18.648  -34.334 1.00 58.68  ? 435 PRO A C   1 
ATOM   3210  O O   . PRO A 1 409 ? -12.625 18.765  -34.488 1.00 60.84  ? 435 PRO A O   1 
ATOM   3211  C CB  . PRO A 1 409 ? -14.718 17.642  -32.176 1.00 57.31  ? 435 PRO A CB  1 
ATOM   3212  C CG  . PRO A 1 409 ? -15.763 18.078  -31.194 1.00 56.38  ? 435 PRO A CG  1 
ATOM   3213  C CD  . PRO A 1 409 ? -16.731 18.835  -32.088 1.00 56.46  ? 435 PRO A CD  1 
ATOM   3214  N N   . ALA A 1 410 ? -14.656 18.294  -35.319 1.00 59.05  ? 436 ALA A N   1 
ATOM   3215  C CA  . ALA A 1 410 ? -14.143 18.015  -36.652 1.00 59.39  ? 436 ALA A CA  1 
ATOM   3216  C C   . ALA A 1 410 ? -13.638 19.289  -37.319 1.00 58.82  ? 436 ALA A C   1 
ATOM   3217  O O   . ALA A 1 410 ? -12.848 19.236  -38.263 1.00 59.81  ? 436 ALA A O   1 
ATOM   3218  C CB  . ALA A 1 410 ? -15.233 17.376  -37.501 1.00 59.74  ? 436 ALA A CB  1 
ATOM   3219  N N   . THR A 1 411 ? -14.094 20.432  -36.816 1.00 57.86  ? 437 THR A N   1 
ATOM   3220  C CA  . THR A 1 411 ? -13.716 21.732  -37.364 1.00 55.19  ? 437 THR A CA  1 
ATOM   3221  C C   . THR A 1 411 ? -12.435 22.299  -36.751 1.00 50.58  ? 437 THR A C   1 
ATOM   3222  O O   . THR A 1 411 ? -11.899 23.288  -37.248 1.00 49.44  ? 437 THR A O   1 
ATOM   3223  C CB  . THR A 1 411 ? -14.831 22.767  -37.139 1.00 57.24  ? 437 THR A CB  1 
ATOM   3224  O OG1 . THR A 1 411 ? -16.105 22.135  -37.294 1.00 60.92  ? 437 THR A OG1 1 
ATOM   3225  C CG2 . THR A 1 411 ? -14.715 23.906  -38.147 1.00 58.33  ? 437 THR A CG2 1 
ATOM   3226  N N   . TYR A 1 412 ? -11.955 21.683  -35.673 1.00 45.05  ? 438 TYR A N   1 
ATOM   3227  C CA  . TYR A 1 412 ? -10.741 22.151  -35.004 1.00 42.71  ? 438 TYR A CA  1 
ATOM   3228  C C   . TYR A 1 412 ? -9.607  22.481  -35.972 1.00 42.32  ? 438 TYR A C   1 
ATOM   3229  O O   . TYR A 1 412 ? -9.354  21.745  -36.925 1.00 43.04  ? 438 TYR A O   1 
ATOM   3230  C CB  . TYR A 1 412 ? -10.272 21.113  -33.990 1.00 37.11  ? 438 TYR A CB  1 
ATOM   3231  C CG  . TYR A 1 412 ? -11.050 21.132  -32.696 1.00 32.86  ? 438 TYR A CG  1 
ATOM   3232  C CD1 . TYR A 1 412 ? -12.306 21.741  -32.616 1.00 30.88  ? 438 TYR A CD1 1 
ATOM   3233  C CD2 . TYR A 1 412 ? -10.543 20.519  -31.554 1.00 32.22  ? 438 TYR A CD2 1 
ATOM   3234  C CE1 . TYR A 1 412 ? -13.036 21.739  -31.425 1.00 29.04  ? 438 TYR A CE1 1 
ATOM   3235  C CE2 . TYR A 1 412 ? -11.267 20.506  -30.358 1.00 32.62  ? 438 TYR A CE2 1 
ATOM   3236  C CZ  . TYR A 1 412 ? -12.510 21.117  -30.301 1.00 29.32  ? 438 TYR A CZ  1 
ATOM   3237  O OH  . TYR A 1 412 ? -13.208 21.106  -29.120 1.00 23.80  ? 438 TYR A OH  1 
ATOM   3238  N N   . GLY A 1 413 ? -8.931  23.596  -35.727 1.00 41.25  ? 439 GLY A N   1 
ATOM   3239  C CA  . GLY A 1 413 ? -7.845  23.997  -36.602 1.00 42.17  ? 439 GLY A CA  1 
ATOM   3240  C C   . GLY A 1 413 ? -8.328  24.995  -37.631 1.00 43.24  ? 439 GLY A C   1 
ATOM   3241  O O   . GLY A 1 413 ? -7.540  25.695  -38.271 1.00 43.62  ? 439 GLY A O   1 
ATOM   3242  N N   . GLN A 1 414 ? -9.642  25.050  -37.803 1.00 45.82  ? 440 GLN A N   1 
ATOM   3243  C CA  . GLN A 1 414 ? -10.250 25.978  -38.743 1.00 47.50  ? 440 GLN A CA  1 
ATOM   3244  C C   . GLN A 1 414 ? -10.864 27.139  -37.968 1.00 47.96  ? 440 GLN A C   1 
ATOM   3245  O O   . GLN A 1 414 ? -11.563 26.937  -36.971 1.00 47.34  ? 440 GLN A O   1 
ATOM   3246  C CB  . GLN A 1 414 ? -11.315 25.262  -39.571 1.00 49.36  ? 440 GLN A CB  1 
ATOM   3247  C CG  . GLN A 1 414 ? -10.745 24.445  -40.722 1.00 54.41  ? 440 GLN A CG  1 
ATOM   3248  C CD  . GLN A 1 414 ? -11.800 23.614  -41.431 1.00 56.27  ? 440 GLN A CD  1 
ATOM   3249  O OE1 . GLN A 1 414 ? -12.145 22.514  -40.986 1.00 56.09  ? 440 GLN A OE1 1 
ATOM   3250  N NE2 . GLN A 1 414 ? -12.330 24.145  -42.531 1.00 55.42  ? 440 GLN A NE2 1 
ATOM   3251  N N   . PHE A 1 415 ? -10.584 28.353  -38.425 1.00 47.50  ? 441 PHE A N   1 
ATOM   3252  C CA  . PHE A 1 415 ? -11.082 29.555  -37.771 1.00 47.95  ? 441 PHE A CA  1 
ATOM   3253  C C   . PHE A 1 415 ? -11.616 30.536  -38.799 1.00 48.91  ? 441 PHE A C   1 
ATOM   3254  O O   . PHE A 1 415 ? -11.066 30.676  -39.893 1.00 50.83  ? 441 PHE A O   1 
ATOM   3255  C CB  . PHE A 1 415 ? -9.960  30.227  -36.972 1.00 47.64  ? 441 PHE A CB  1 
ATOM   3256  C CG  . PHE A 1 415 ? -9.446  29.397  -35.833 1.00 47.25  ? 441 PHE A CG  1 
ATOM   3257  C CD1 . PHE A 1 415 ? -10.158 29.314  -34.643 1.00 48.93  ? 441 PHE A CD1 1 
ATOM   3258  C CD2 . PHE A 1 415 ? -8.263  28.681  -35.960 1.00 46.62  ? 441 PHE A CD2 1 
ATOM   3259  C CE1 . PHE A 1 415 ? -9.701  28.526  -33.591 1.00 48.85  ? 441 PHE A CE1 1 
ATOM   3260  C CE2 . PHE A 1 415 ? -7.794  27.891  -34.922 1.00 48.39  ? 441 PHE A CE2 1 
ATOM   3261  C CZ  . PHE A 1 415 ? -8.514  27.813  -33.730 1.00 50.67  ? 441 PHE A CZ  1 
ATOM   3262  N N   . TYR A 1 416 ? -12.685 31.227  -38.432 1.00 47.60  ? 442 TYR A N   1 
ATOM   3263  C CA  . TYR A 1 416 ? -13.291 32.199  -39.320 1.00 47.16  ? 442 TYR A CA  1 
ATOM   3264  C C   . TYR A 1 416 ? -13.153 33.610  -38.749 1.00 45.88  ? 442 TYR A C   1 
ATOM   3265  O O   . TYR A 1 416 ? -13.549 33.878  -37.620 1.00 47.02  ? 442 TYR A O   1 
ATOM   3266  C CB  . TYR A 1 416 ? -14.751 31.813  -39.544 1.00 47.58  ? 442 TYR A CB  1 
ATOM   3267  C CG  . TYR A 1 416 ? -14.888 30.523  -40.324 1.00 45.51  ? 442 TYR A CG  1 
ATOM   3268  C CD1 . TYR A 1 416 ? -15.108 30.538  -41.702 1.00 46.33  ? 442 TYR A CD1 1 
ATOM   3269  C CD2 . TYR A 1 416 ? -14.756 29.287  -39.691 1.00 44.86  ? 442 TYR A CD2 1 
ATOM   3270  C CE1 . TYR A 1 416 ? -15.192 29.351  -42.430 1.00 47.86  ? 442 TYR A CE1 1 
ATOM   3271  C CE2 . TYR A 1 416 ? -14.839 28.095  -40.406 1.00 45.96  ? 442 TYR A CE2 1 
ATOM   3272  C CZ  . TYR A 1 416 ? -15.055 28.134  -41.773 1.00 48.03  ? 442 TYR A CZ  1 
ATOM   3273  O OH  . TYR A 1 416 ? -15.117 26.961  -42.488 1.00 49.26  ? 442 TYR A OH  1 
ATOM   3274  N N   . GLY A 1 417 ? -12.571 34.500  -39.543 1.00 43.88  ? 443 GLY A N   1 
ATOM   3275  C CA  . GLY A 1 417 ? -12.353 35.868  -39.111 1.00 44.19  ? 443 GLY A CA  1 
ATOM   3276  C C   . GLY A 1 417 ? -13.567 36.669  -38.683 1.00 43.18  ? 443 GLY A C   1 
ATOM   3277  O O   . GLY A 1 417 ? -13.431 37.832  -38.291 1.00 43.35  ? 443 GLY A O   1 
ATOM   3278  N N   . GLY A 1 418 ? -14.748 36.064  -38.758 1.00 41.67  ? 444 GLY A N   1 
ATOM   3279  C CA  . GLY A 1 418 ? -15.964 36.755  -38.360 1.00 38.91  ? 444 GLY A CA  1 
ATOM   3280  C C   . GLY A 1 418 ? -16.365 36.484  -36.919 1.00 36.95  ? 444 GLY A C   1 
ATOM   3281  O O   . GLY A 1 418 ? -17.314 37.072  -36.419 1.00 36.26  ? 444 GLY A O   1 
ATOM   3282  N N   . ASP A 1 419 ? -15.654 35.579  -36.257 1.00 35.85  ? 445 ASP A N   1 
ATOM   3283  C CA  . ASP A 1 419 ? -15.943 35.256  -34.867 1.00 37.07  ? 445 ASP A CA  1 
ATOM   3284  C C   . ASP A 1 419 ? -14.706 35.504  -34.005 1.00 35.51  ? 445 ASP A C   1 
ATOM   3285  O O   . ASP A 1 419 ? -13.679 35.990  -34.476 1.00 35.87  ? 445 ASP A O   1 
ATOM   3286  C CB  . ASP A 1 419 ? -16.332 33.775  -34.687 1.00 41.81  ? 445 ASP A CB  1 
ATOM   3287  C CG  . ASP A 1 419 ? -17.164 33.226  -35.831 1.00 42.89  ? 445 ASP A CG  1 
ATOM   3288  O OD1 . ASP A 1 419 ? -18.145 33.882  -36.237 1.00 46.55  ? 445 ASP A OD1 1 
ATOM   3289  O OD2 . ASP A 1 419 ? -16.836 32.120  -36.310 1.00 40.80  ? 445 ASP A OD2 1 
ATOM   3290  N N   . SER A 1 420 ? -14.839 35.143  -32.736 1.00 31.65  ? 446 SER A N   1 
ATOM   3291  C CA  . SER A 1 420 ? -13.793 35.248  -31.736 1.00 28.47  ? 446 SER A CA  1 
ATOM   3292  C C   . SER A 1 420 ? -13.926 33.919  -31.019 1.00 28.21  ? 446 SER A C   1 
ATOM   3293  O O   . SER A 1 420 ? -15.037 33.480  -30.733 1.00 28.59  ? 446 SER A O   1 
ATOM   3294  C CB  . SER A 1 420 ? -14.074 36.386  -30.755 1.00 27.32  ? 446 SER A CB  1 
ATOM   3295  O OG  . SER A 1 420 ? -13.979 37.653  -31.375 1.00 22.10  ? 446 SER A OG  1 
ATOM   3296  N N   . TYR A 1 421 ? -12.807 33.261  -30.752 1.00 27.75  ? 447 TYR A N   1 
ATOM   3297  C CA  . TYR A 1 421 ? -12.860 31.972  -30.093 1.00 25.83  ? 447 TYR A CA  1 
ATOM   3298  C C   . TYR A 1 421 ? -12.045 32.026  -28.832 1.00 27.55  ? 447 TYR A C   1 
ATOM   3299  O O   . TYR A 1 421 ? -11.242 32.939  -28.633 1.00 27.28  ? 447 TYR A O   1 
ATOM   3300  C CB  . TYR A 1 421 ? -12.288 30.866  -30.990 1.00 27.14  ? 447 TYR A CB  1 
ATOM   3301  C CG  . TYR A 1 421 ? -12.838 30.821  -32.399 1.00 25.86  ? 447 TYR A CG  1 
ATOM   3302  C CD1 . TYR A 1 421 ? -12.356 31.681  -33.382 1.00 27.31  ? 447 TYR A CD1 1 
ATOM   3303  C CD2 . TYR A 1 421 ? -13.850 29.922  -32.747 1.00 27.00  ? 447 TYR A CD2 1 
ATOM   3304  C CE1 . TYR A 1 421 ? -12.870 31.650  -34.682 1.00 30.90  ? 447 TYR A CE1 1 
ATOM   3305  C CE2 . TYR A 1 421 ? -14.373 29.879  -34.042 1.00 25.40  ? 447 TYR A CE2 1 
ATOM   3306  C CZ  . TYR A 1 421 ? -13.881 30.746  -35.002 1.00 28.83  ? 447 TYR A CZ  1 
ATOM   3307  O OH  . TYR A 1 421 ? -14.399 30.731  -36.274 1.00 29.57  ? 447 TYR A OH  1 
ATOM   3308  N N   . ILE A 1 422 ? -12.276 31.044  -27.977 1.00 28.41  ? 448 ILE A N   1 
ATOM   3309  C CA  . ILE A 1 422 ? -11.539 30.916  -26.739 1.00 32.06  ? 448 ILE A CA  1 
ATOM   3310  C C   . ILE A 1 422 ? -11.125 29.457  -26.669 1.00 30.40  ? 448 ILE A C   1 
ATOM   3311  O O   . ILE A 1 422 ? -11.935 28.559  -26.908 1.00 30.27  ? 448 ILE A O   1 
ATOM   3312  C CB  . ILE A 1 422 ? -12.382 31.312  -25.495 1.00 34.81  ? 448 ILE A CB  1 
ATOM   3313  C CG1 . ILE A 1 422 ? -11.779 30.665  -24.251 1.00 36.93  ? 448 ILE A CG1 1 
ATOM   3314  C CG2 . ILE A 1 422 ? -13.823 30.919  -25.673 1.00 38.97  ? 448 ILE A CG2 1 
ATOM   3315  C CD1 . ILE A 1 422 ? -12.454 31.081  -22.976 1.00 43.40  ? 448 ILE A CD1 1 
ATOM   3316  N N   . ILE A 1 423 ? -9.854  29.233  -26.360 1.00 27.53  ? 449 ILE A N   1 
ATOM   3317  C CA  . ILE A 1 423 ? -9.309  27.891  -26.302 1.00 25.89  ? 449 ILE A CA  1 
ATOM   3318  C C   . ILE A 1 423 ? -8.659  27.560  -24.970 1.00 25.96  ? 449 ILE A C   1 
ATOM   3319  O O   . ILE A 1 423 ? -7.814  28.310  -24.478 1.00 27.59  ? 449 ILE A O   1 
ATOM   3320  C CB  . ILE A 1 423 ? -8.261  27.703  -27.421 1.00 24.75  ? 449 ILE A CB  1 
ATOM   3321  C CG1 . ILE A 1 423 ? -8.911  27.969  -28.783 1.00 24.69  ? 449 ILE A CG1 1 
ATOM   3322  C CG2 . ILE A 1 423 ? -7.684  26.299  -27.368 1.00 25.60  ? 449 ILE A CG2 1 
ATOM   3323  C CD1 . ILE A 1 423 ? -7.929  28.362  -29.869 1.00 23.64  ? 449 ILE A CD1 1 
ATOM   3324  N N   . LEU A 1 424 ? -9.061  26.438  -24.383 1.00 25.40  ? 450 LEU A N   1 
ATOM   3325  C CA  . LEU A 1 424 ? -8.467  25.992  -23.131 1.00 30.09  ? 450 LEU A CA  1 
ATOM   3326  C C   . LEU A 1 424 ? -7.533  24.834  -23.473 1.00 33.71  ? 450 LEU A C   1 
ATOM   3327  O O   . LEU A 1 424 ? -7.955  23.839  -24.061 1.00 34.28  ? 450 LEU A O   1 
ATOM   3328  C CB  . LEU A 1 424 ? -9.535  25.518  -22.138 1.00 27.98  ? 450 LEU A CB  1 
ATOM   3329  C CG  . LEU A 1 424 ? -9.003  25.069  -20.768 1.00 31.33  ? 450 LEU A CG  1 
ATOM   3330  C CD1 . LEU A 1 424 ? -8.203  26.195  -20.124 1.00 29.71  ? 450 LEU A CD1 1 
ATOM   3331  C CD2 . LEU A 1 424 ? -10.165 24.668  -19.860 1.00 32.09  ? 450 LEU A CD2 1 
ATOM   3332  N N   . TYR A 1 425 ? -6.259  24.976  -23.127 1.00 36.38  ? 451 TYR A N   1 
ATOM   3333  C CA  . TYR A 1 425 ? -5.275  23.939  -23.406 1.00 38.56  ? 451 TYR A CA  1 
ATOM   3334  C C   . TYR A 1 425 ? -4.504  23.523  -22.153 1.00 39.66  ? 451 TYR A C   1 
ATOM   3335  O O   . TYR A 1 425 ? -4.066  24.360  -21.364 1.00 41.89  ? 451 TYR A O   1 
ATOM   3336  C CB  . TYR A 1 425 ? -4.292  24.429  -24.468 1.00 41.94  ? 451 TYR A CB  1 
ATOM   3337  C CG  . TYR A 1 425 ? -3.196  23.439  -24.794 1.00 46.91  ? 451 TYR A CG  1 
ATOM   3338  C CD1 . TYR A 1 425 ? -3.462  22.298  -25.553 1.00 47.54  ? 451 TYR A CD1 1 
ATOM   3339  C CD2 . TYR A 1 425 ? -1.893  23.632  -24.325 1.00 49.51  ? 451 TYR A CD2 1 
ATOM   3340  C CE1 . TYR A 1 425 ? -2.455  21.373  -25.839 1.00 50.23  ? 451 TYR A CE1 1 
ATOM   3341  C CE2 . TYR A 1 425 ? -0.879  22.712  -24.603 1.00 49.88  ? 451 TYR A CE2 1 
ATOM   3342  C CZ  . TYR A 1 425 ? -1.167  21.586  -25.360 1.00 51.25  ? 451 TYR A CZ  1 
ATOM   3343  O OH  . TYR A 1 425 ? -0.174  20.675  -25.641 1.00 51.95  ? 451 TYR A OH  1 
ATOM   3344  N N   . ASN A 1 426 ? -4.345  22.221  -21.971 1.00 40.78  ? 452 ASN A N   1 
ATOM   3345  C CA  . ASN A 1 426 ? -3.609  21.700  -20.830 1.00 42.15  ? 452 ASN A CA  1 
ATOM   3346  C C   . ASN A 1 426 ? -2.232  21.265  -21.329 1.00 42.19  ? 452 ASN A C   1 
ATOM   3347  O O   . ASN A 1 426 ? -2.114  20.320  -22.109 1.00 43.01  ? 452 ASN A O   1 
ATOM   3348  C CB  . ASN A 1 426 ? -4.370  20.527  -20.232 1.00 43.74  ? 452 ASN A CB  1 
ATOM   3349  C CG  . ASN A 1 426 ? -5.757  20.919  -19.785 1.00 47.40  ? 452 ASN A CG  1 
ATOM   3350  O OD1 . ASN A 1 426 ? -5.926  21.625  -18.788 1.00 48.20  ? 452 ASN A OD1 1 
ATOM   3351  N ND2 . ASN A 1 426 ? -6.763  20.483  -20.534 1.00 50.08  ? 452 ASN A ND2 1 
ATOM   3352  N N   . TYR A 1 427 ? -1.195  21.970  -20.885 1.00 41.16  ? 453 TYR A N   1 
ATOM   3353  C CA  . TYR A 1 427 ? 0.166   21.674  -21.316 1.00 40.48  ? 453 TYR A CA  1 
ATOM   3354  C C   . TYR A 1 427 ? 0.970   20.838  -20.317 1.00 42.02  ? 453 TYR A C   1 
ATOM   3355  O O   . TYR A 1 427 ? 0.799   20.954  -19.097 1.00 41.19  ? 453 TYR A O   1 
ATOM   3356  C CB  . TYR A 1 427 ? 0.908   22.989  -21.615 1.00 37.15  ? 453 TYR A CB  1 
ATOM   3357  C CG  . TYR A 1 427 ? 1.354   23.760  -20.381 1.00 32.52  ? 453 TYR A CG  1 
ATOM   3358  C CD1 . TYR A 1 427 ? 2.469   23.350  -19.648 1.00 29.73  ? 453 TYR A CD1 1 
ATOM   3359  C CD2 . TYR A 1 427 ? 0.657   24.886  -19.941 1.00 27.23  ? 453 TYR A CD2 1 
ATOM   3360  C CE1 . TYR A 1 427 ? 2.879   24.034  -18.515 1.00 28.99  ? 453 TYR A CE1 1 
ATOM   3361  C CE2 . TYR A 1 427 ? 1.061   25.582  -18.798 1.00 25.76  ? 453 TYR A CE2 1 
ATOM   3362  C CZ  . TYR A 1 427 ? 2.176   25.148  -18.091 1.00 27.67  ? 453 TYR A CZ  1 
ATOM   3363  O OH  . TYR A 1 427 ? 2.604   25.816  -16.966 1.00 22.62  ? 453 TYR A OH  1 
ATOM   3364  N N   . ARG A 1 428 ? 1.843   19.988  -20.853 1.00 44.16  ? 454 ARG A N   1 
ATOM   3365  C CA  . ARG A 1 428 ? 2.710   19.139  -20.041 1.00 47.50  ? 454 ARG A CA  1 
ATOM   3366  C C   . ARG A 1 428 ? 4.152   19.330  -20.489 1.00 47.19  ? 454 ARG A C   1 
ATOM   3367  O O   . ARG A 1 428 ? 4.486   19.079  -21.647 1.00 47.15  ? 454 ARG A O   1 
ATOM   3368  C CB  . ARG A 1 428 ? 2.336   17.662  -20.181 1.00 52.04  ? 454 ARG A CB  1 
ATOM   3369  C CG  . ARG A 1 428 ? 1.127   17.235  -19.371 1.00 60.93  ? 454 ARG A CG  1 
ATOM   3370  C CD  . ARG A 1 428 ? -0.194  17.539  -20.080 1.00 67.83  ? 454 ARG A CD  1 
ATOM   3371  N NE  . ARG A 1 428 ? -0.397  16.696  -21.258 1.00 72.99  ? 454 ARG A NE  1 
ATOM   3372  C CZ  . ARG A 1 428 ? -1.559  16.564  -21.896 1.00 76.09  ? 454 ARG A CZ  1 
ATOM   3373  N NH1 . ARG A 1 428 ? -2.635  17.220  -21.476 1.00 75.84  ? 454 ARG A NH1 1 
ATOM   3374  N NH2 . ARG A 1 428 ? -1.648  15.765  -22.952 1.00 77.23  ? 454 ARG A NH2 1 
ATOM   3375  N N   . HIS A 1 429 ? 5.002   19.777  -19.570 1.00 46.13  ? 455 HIS A N   1 
ATOM   3376  C CA  . HIS A 1 429 ? 6.406   20.000  -19.878 1.00 46.95  ? 455 HIS A CA  1 
ATOM   3377  C C   . HIS A 1 429 ? 7.299   19.630  -18.698 1.00 50.52  ? 455 HIS A C   1 
ATOM   3378  O O   . HIS A 1 429 ? 7.790   20.503  -17.988 1.00 51.79  ? 455 HIS A O   1 
ATOM   3379  C CB  . HIS A 1 429 ? 6.631   21.467  -20.270 1.00 41.47  ? 455 HIS A CB  1 
ATOM   3380  C CG  . HIS A 1 429 ? 8.061   21.802  -20.567 1.00 37.59  ? 455 HIS A CG  1 
ATOM   3381  N ND1 . HIS A 1 429 ? 9.016   21.936  -19.582 1.00 33.90  ? 455 HIS A ND1 1 
ATOM   3382  C CD2 . HIS A 1 429 ? 8.703   21.999  -21.744 1.00 35.68  ? 455 HIS A CD2 1 
ATOM   3383  C CE1 . HIS A 1 429 ? 10.184  22.199  -20.138 1.00 33.69  ? 455 HIS A CE1 1 
ATOM   3384  N NE2 . HIS A 1 429 ? 10.023  22.243  -21.449 1.00 32.39  ? 455 HIS A NE2 1 
ATOM   3385  N N   . GLY A 1 430 ? 7.501   18.328  -18.504 1.00 54.32  ? 456 GLY A N   1 
ATOM   3386  C CA  . GLY A 1 430 ? 8.334   17.825  -17.422 1.00 58.27  ? 456 GLY A CA  1 
ATOM   3387  C C   . GLY A 1 430 ? 8.383   18.675  -16.164 1.00 62.87  ? 456 GLY A C   1 
ATOM   3388  O O   . GLY A 1 430 ? 7.799   18.321  -15.133 1.00 63.29  ? 456 GLY A O   1 
ATOM   3389  N N   . SER A 1 431 ? 9.097   19.795  -16.254 1.00 65.23  ? 457 SER A N   1 
ATOM   3390  C CA  . SER A 1 431 ? 9.256   20.732  -15.146 1.00 66.95  ? 457 SER A CA  1 
ATOM   3391  C C   . SER A 1 431 ? 7.933   21.302  -14.621 1.00 67.46  ? 457 SER A C   1 
ATOM   3392  O O   . SER A 1 431 ? 7.794   21.556  -13.421 1.00 67.97  ? 457 SER A O   1 
ATOM   3393  C CB  . SER A 1 431 ? 10.171  21.884  -15.577 1.00 67.00  ? 457 SER A CB  1 
ATOM   3394  O OG  . SER A 1 431 ? 9.652   22.549  -16.715 1.00 67.46  ? 457 SER A OG  1 
ATOM   3395  N N   . ARG A 1 432 ? 6.966   21.502  -15.514 1.00 67.55  ? 458 ARG A N   1 
ATOM   3396  C CA  . ARG A 1 432 ? 5.678   22.054  -15.111 1.00 67.00  ? 458 ARG A CA  1 
ATOM   3397  C C   . ARG A 1 432 ? 4.498   21.579  -15.947 1.00 64.28  ? 458 ARG A C   1 
ATOM   3398  O O   . ARG A 1 432 ? 4.654   21.097  -17.068 1.00 63.16  ? 458 ARG A O   1 
ATOM   3399  C CB  . ARG A 1 432 ? 5.717   23.586  -15.163 1.00 69.97  ? 458 ARG A CB  1 
ATOM   3400  C CG  . ARG A 1 432 ? 6.686   24.233  -14.193 1.00 73.73  ? 458 ARG A CG  1 
ATOM   3401  C CD  . ARG A 1 432 ? 6.685   25.749  -14.341 1.00 75.56  ? 458 ARG A CD  1 
ATOM   3402  N NE  . ARG A 1 432 ? 7.607   26.388  -13.406 1.00 77.76  ? 458 ARG A NE  1 
ATOM   3403  C CZ  . ARG A 1 432 ? 8.912   26.136  -13.351 1.00 79.18  ? 458 ARG A CZ  1 
ATOM   3404  N NH1 . ARG A 1 432 ? 9.455   25.252  -14.179 1.00 80.05  ? 458 ARG A NH1 1 
ATOM   3405  N NH2 . ARG A 1 432 ? 9.676   26.767  -12.468 1.00 80.16  ? 458 ARG A NH2 1 
ATOM   3406  N N   . GLN A 1 433 ? 3.313   21.734  -15.368 1.00 62.24  ? 459 GLN A N   1 
ATOM   3407  C CA  . GLN A 1 433 ? 2.051   21.382  -16.007 1.00 60.15  ? 459 GLN A CA  1 
ATOM   3408  C C   . GLN A 1 433 ? 1.087   22.520  -15.684 1.00 55.33  ? 459 GLN A C   1 
ATOM   3409  O O   . GLN A 1 433 ? 1.108   23.068  -14.583 1.00 55.12  ? 459 GLN A O   1 
ATOM   3410  C CB  . GLN A 1 433 ? 1.489   20.075  -15.439 1.00 63.15  ? 459 GLN A CB  1 
ATOM   3411  C CG  . GLN A 1 433 ? 2.334   18.840  -15.690 1.00 68.66  ? 459 GLN A CG  1 
ATOM   3412  C CD  . GLN A 1 433 ? 1.694   17.580  -15.124 1.00 72.31  ? 459 GLN A CD  1 
ATOM   3413  O OE1 . GLN A 1 433 ? 2.221   16.476  -15.282 1.00 74.83  ? 459 GLN A OE1 1 
ATOM   3414  N NE2 . GLN A 1 433 ? 0.551   17.740  -14.460 1.00 72.66  ? 459 GLN A NE2 1 
ATOM   3415  N N   . GLY A 1 434 ? 0.246   22.882  -16.640 1.00 50.87  ? 460 GLY A N   1 
ATOM   3416  C CA  . GLY A 1 434 ? -0.697  23.951  -16.390 1.00 46.02  ? 460 GLY A CA  1 
ATOM   3417  C C   . GLY A 1 434 ? -1.688  24.088  -17.517 1.00 42.01  ? 460 GLY A C   1 
ATOM   3418  O O   . GLY A 1 434 ? -1.822  23.196  -18.348 1.00 40.80  ? 460 GLY A O   1 
ATOM   3419  N N   . GLN A 1 435 ? -2.384  25.214  -17.546 1.00 39.53  ? 461 GLN A N   1 
ATOM   3420  C CA  . GLN A 1 435 ? -3.368  25.459  -18.586 1.00 39.43  ? 461 GLN A CA  1 
ATOM   3421  C C   . GLN A 1 435 ? -3.111  26.799  -19.228 1.00 36.34  ? 461 GLN A C   1 
ATOM   3422  O O   . GLN A 1 435 ? -2.555  27.697  -18.609 1.00 35.94  ? 461 GLN A O   1 
ATOM   3423  C CB  . GLN A 1 435 ? -4.774  25.453  -18.002 1.00 39.31  ? 461 GLN A CB  1 
ATOM   3424  C CG  . GLN A 1 435 ? -5.109  24.187  -17.284 1.00 45.22  ? 461 GLN A CG  1 
ATOM   3425  C CD  . GLN A 1 435 ? -6.479  24.227  -16.670 1.00 49.59  ? 461 GLN A CD  1 
ATOM   3426  O OE1 . GLN A 1 435 ? -6.728  24.975  -15.722 1.00 52.11  ? 461 GLN A OE1 1 
ATOM   3427  N NE2 . GLN A 1 435 ? -7.390  23.424  -17.212 1.00 51.08  ? 461 GLN A NE2 1 
ATOM   3428  N N   . ILE A 1 436 ? -3.523  26.921  -20.479 1.00 35.06  ? 462 ILE A N   1 
ATOM   3429  C CA  . ILE A 1 436 ? -3.363  28.157  -21.212 1.00 34.67  ? 462 ILE A CA  1 
ATOM   3430  C C   . ILE A 1 436 ? -4.696  28.453  -21.871 1.00 35.58  ? 462 ILE A C   1 
ATOM   3431  O O   . ILE A 1 436 ? -5.286  27.586  -22.521 1.00 35.10  ? 462 ILE A O   1 
ATOM   3432  C CB  . ILE A 1 436 ? -2.304  28.029  -22.321 1.00 34.95  ? 462 ILE A CB  1 
ATOM   3433  C CG1 . ILE A 1 436 ? -0.960  27.620  -21.718 1.00 36.15  ? 462 ILE A CG1 1 
ATOM   3434  C CG2 . ILE A 1 436 ? -2.173  29.354  -23.072 1.00 34.10  ? 462 ILE A CG2 1 
ATOM   3435  C CD1 . ILE A 1 436 ? 0.098   27.315  -22.763 1.00 33.21  ? 462 ILE A CD1 1 
ATOM   3436  N N   . ILE A 1 437 ? -5.184  29.672  -21.690 1.00 34.46  ? 463 ILE A N   1 
ATOM   3437  C CA  . ILE A 1 437 ? -6.433  30.051  -22.315 1.00 32.15  ? 463 ILE A CA  1 
ATOM   3438  C C   . ILE A 1 437 ? -6.095  31.014  -23.442 1.00 31.28  ? 463 ILE A C   1 
ATOM   3439  O O   . ILE A 1 437 ? -5.502  32.071  -23.217 1.00 32.34  ? 463 ILE A O   1 
ATOM   3440  C CB  . ILE A 1 437 ? -7.386  30.760  -21.326 1.00 31.18  ? 463 ILE A CB  1 
ATOM   3441  C CG1 . ILE A 1 437 ? -7.606  29.900  -20.080 1.00 27.99  ? 463 ILE A CG1 1 
ATOM   3442  C CG2 . ILE A 1 437 ? -8.717  31.037  -22.013 1.00 31.55  ? 463 ILE A CG2 1 
ATOM   3443  C CD1 . ILE A 1 437 ? -8.533  30.537  -19.068 1.00 23.97  ? 463 ILE A CD1 1 
ATOM   3444  N N   . TYR A 1 438 ? -6.446  30.640  -24.662 1.00 29.82  ? 464 TYR A N   1 
ATOM   3445  C CA  . TYR A 1 438 ? -6.190  31.514  -25.802 1.00 30.10  ? 464 TYR A CA  1 
ATOM   3446  C C   . TYR A 1 438 ? -7.477  32.212  -26.220 1.00 29.61  ? 464 TYR A C   1 
ATOM   3447  O O   . TYR A 1 438 ? -8.518  31.580  -26.383 1.00 30.91  ? 464 TYR A O   1 
ATOM   3448  C CB  . TYR A 1 438 ? -5.655  30.721  -26.995 1.00 27.79  ? 464 TYR A CB  1 
ATOM   3449  C CG  . TYR A 1 438 ? -4.204  30.338  -26.903 1.00 27.72  ? 464 TYR A CG  1 
ATOM   3450  C CD1 . TYR A 1 438 ? -3.199  31.300  -27.047 1.00 27.16  ? 464 TYR A CD1 1 
ATOM   3451  C CD2 . TYR A 1 438 ? -3.826  29.001  -26.725 1.00 26.91  ? 464 TYR A CD2 1 
ATOM   3452  C CE1 . TYR A 1 438 ? -1.859  30.941  -27.025 1.00 26.78  ? 464 TYR A CE1 1 
ATOM   3453  C CE2 . TYR A 1 438 ? -2.487  28.632  -26.695 1.00 26.79  ? 464 TYR A CE2 1 
ATOM   3454  C CZ  . TYR A 1 438 ? -1.510  29.607  -26.851 1.00 28.56  ? 464 TYR A CZ  1 
ATOM   3455  O OH  . TYR A 1 438 ? -0.187  29.249  -26.848 1.00 28.79  ? 464 TYR A OH  1 
ATOM   3456  N N   . ASN A 1 439 ? -7.396  33.522  -26.389 1.00 29.70  ? 465 ASN A N   1 
ATOM   3457  C CA  . ASN A 1 439 ? -8.538  34.312  -26.815 1.00 27.95  ? 465 ASN A CA  1 
ATOM   3458  C C   . ASN A 1 439 ? -8.145  34.831  -28.193 1.00 27.91  ? 465 ASN A C   1 
ATOM   3459  O O   . ASN A 1 439 ? -7.337  35.757  -28.315 1.00 28.16  ? 465 ASN A O   1 
ATOM   3460  C CB  . ASN A 1 439 ? -8.781  35.471  -25.835 1.00 24.29  ? 465 ASN A CB  1 
ATOM   3461  C CG  . ASN A 1 439 ? -9.973  36.325  -26.212 1.00 23.88  ? 465 ASN A CG  1 
ATOM   3462  O OD1 . ASN A 1 439 ? -10.146 37.420  -25.689 1.00 26.16  ? 465 ASN A OD1 1 
ATOM   3463  N ND2 . ASN A 1 439 ? -10.807 35.827  -27.116 1.00 25.37  ? 465 ASN A ND2 1 
ATOM   3464  N N   . TRP A 1 440 ? -8.699  34.203  -29.227 1.00 27.30  ? 466 TRP A N   1 
ATOM   3465  C CA  . TRP A 1 440 ? -8.420  34.575  -30.607 1.00 27.87  ? 466 TRP A CA  1 
ATOM   3466  C C   . TRP A 1 440 ? -9.454  35.590  -31.084 1.00 29.61  ? 466 TRP A C   1 
ATOM   3467  O O   . TRP A 1 440 ? -10.661 35.342  -31.001 1.00 32.65  ? 466 TRP A O   1 
ATOM   3468  C CB  . TRP A 1 440 ? -8.484  33.335  -31.497 1.00 28.26  ? 466 TRP A CB  1 
ATOM   3469  C CG  . TRP A 1 440 ? -8.001  33.567  -32.886 1.00 29.43  ? 466 TRP A CG  1 
ATOM   3470  C CD1 . TRP A 1 440 ? -6.704  33.563  -33.313 1.00 29.79  ? 466 TRP A CD1 1 
ATOM   3471  C CD2 . TRP A 1 440 ? -8.802  33.862  -34.033 1.00 31.21  ? 466 TRP A CD2 1 
ATOM   3472  N NE1 . TRP A 1 440 ? -6.645  33.837  -34.655 1.00 31.58  ? 466 TRP A NE1 1 
ATOM   3473  C CE2 . TRP A 1 440 ? -7.921  34.025  -35.127 1.00 32.92  ? 466 TRP A CE2 1 
ATOM   3474  C CE3 . TRP A 1 440 ? -10.181 34.009  -34.246 1.00 31.19  ? 466 TRP A CE3 1 
ATOM   3475  C CZ2 . TRP A 1 440 ? -8.370  34.326  -36.419 1.00 31.17  ? 466 TRP A CZ2 1 
ATOM   3476  C CZ3 . TRP A 1 440 ? -10.633 34.309  -35.528 1.00 30.06  ? 466 TRP A CZ3 1 
ATOM   3477  C CH2 . TRP A 1 440 ? -9.726  34.464  -36.599 1.00 33.84  ? 466 TRP A CH2 1 
ATOM   3478  N N   . GLN A 1 441 ? -8.993  36.726  -31.598 1.00 28.60  ? 467 GLN A N   1 
ATOM   3479  C CA  . GLN A 1 441 ? -9.916  37.749  -32.070 1.00 27.39  ? 467 GLN A CA  1 
ATOM   3480  C C   . GLN A 1 441 ? -9.854  37.997  -33.573 1.00 29.06  ? 467 GLN A C   1 
ATOM   3481  O O   . GLN A 1 441 ? -8.906  38.594  -34.087 1.00 28.39  ? 467 GLN A O   1 
ATOM   3482  C CB  . GLN A 1 441 ? -9.683  39.045  -31.292 1.00 25.07  ? 467 GLN A CB  1 
ATOM   3483  C CG  . GLN A 1 441 ? -10.233 38.970  -29.877 1.00 24.70  ? 467 GLN A CG  1 
ATOM   3484  C CD  . GLN A 1 441 ? -9.698  40.048  -28.950 1.00 22.87  ? 467 GLN A CD  1 
ATOM   3485  O OE1 . GLN A 1 441 ? -9.434  41.175  -29.366 1.00 20.96  ? 467 GLN A OE1 1 
ATOM   3486  N NE2 . GLN A 1 441 ? -9.562  39.705  -27.674 1.00 22.55  ? 467 GLN A NE2 1 
ATOM   3487  N N   . GLY A 1 442 ? -10.885 37.528  -34.274 1.00 29.87  ? 468 GLY A N   1 
ATOM   3488  C CA  . GLY A 1 442 ? -10.955 37.696  -35.713 1.00 28.67  ? 468 GLY A CA  1 
ATOM   3489  C C   . GLY A 1 442 ? -11.090 39.151  -36.112 1.00 29.77  ? 468 GLY A C   1 
ATOM   3490  O O   . GLY A 1 442 ? -11.880 39.889  -35.518 1.00 28.54  ? 468 GLY A O   1 
ATOM   3491  N N   . ALA A 1 443 ? -10.327 39.554  -37.123 1.00 28.10  ? 469 ALA A N   1 
ATOM   3492  C CA  . ALA A 1 443 ? -10.330 40.930  -37.613 1.00 29.31  ? 469 ALA A CA  1 
ATOM   3493  C C   . ALA A 1 443 ? -11.710 41.445  -38.016 1.00 31.82  ? 469 ALA A C   1 
ATOM   3494  O O   . ALA A 1 443 ? -11.915 42.654  -38.150 1.00 32.40  ? 469 ALA A O   1 
ATOM   3495  C CB  . ALA A 1 443 ? -9.367  41.062  -38.792 1.00 22.59  ? 469 ALA A CB  1 
ATOM   3496  N N   . GLN A 1 444 ? -12.657 40.535  -38.211 1.00 33.66  ? 470 GLN A N   1 
ATOM   3497  C CA  . GLN A 1 444 ? -13.992 40.944  -38.612 1.00 36.40  ? 470 GLN A CA  1 
ATOM   3498  C C   . GLN A 1 444 ? -15.058 40.620  -37.588 1.00 34.56  ? 470 GLN A C   1 
ATOM   3499  O O   . GLN A 1 444 ? -16.246 40.700  -37.878 1.00 36.69  ? 470 GLN A O   1 
ATOM   3500  C CB  . GLN A 1 444 ? -14.351 40.308  -39.947 1.00 39.85  ? 470 GLN A CB  1 
ATOM   3501  C CG  . GLN A 1 444 ? -14.111 41.223  -41.118 1.00 46.98  ? 470 GLN A CG  1 
ATOM   3502  C CD  . GLN A 1 444 ? -13.431 40.514  -42.252 1.00 52.59  ? 470 GLN A CD  1 
ATOM   3503  O OE1 . GLN A 1 444 ? -12.263 40.121  -42.142 1.00 56.43  ? 470 GLN A OE1 1 
ATOM   3504  N NE2 . GLN A 1 444 ? -14.153 40.329  -43.355 1.00 52.38  ? 470 GLN A NE2 1 
ATOM   3505  N N   . SER A 1 445 ? -14.628 40.249  -36.392 1.00 31.42  ? 471 SER A N   1 
ATOM   3506  C CA  . SER A 1 445 ? -15.555 39.925  -35.329 1.00 29.48  ? 471 SER A CA  1 
ATOM   3507  C C   . SER A 1 445 ? -16.144 41.259  -34.868 1.00 31.47  ? 471 SER A C   1 
ATOM   3508  O O   . SER A 1 445 ? -15.422 42.249  -34.734 1.00 31.20  ? 471 SER A O   1 
ATOM   3509  C CB  . SER A 1 445 ? -14.798 39.226  -34.192 1.00 28.08  ? 471 SER A CB  1 
ATOM   3510  O OG  . SER A 1 445 ? -15.666 38.707  -33.198 1.00 25.16  ? 471 SER A OG  1 
ATOM   3511  N N   . THR A 1 446 ? -17.452 41.304  -34.644 1.00 31.63  ? 472 THR A N   1 
ATOM   3512  C CA  . THR A 1 446 ? -18.077 42.548  -34.215 1.00 31.85  ? 472 THR A CA  1 
ATOM   3513  C C   . THR A 1 446 ? -17.641 42.927  -32.794 1.00 33.24  ? 472 THR A C   1 
ATOM   3514  O O   . THR A 1 446 ? -17.411 42.057  -31.950 1.00 30.21  ? 472 THR A O   1 
ATOM   3515  C CB  . THR A 1 446 ? -19.607 42.444  -34.295 1.00 30.79  ? 472 THR A CB  1 
ATOM   3516  O OG1 . THR A 1 446 ? -20.049 41.341  -33.504 1.00 32.44  ? 472 THR A OG1 1 
ATOM   3517  C CG2 . THR A 1 446 ? -20.046 42.229  -35.731 1.00 31.33  ? 472 THR A CG2 1 
ATOM   3518  N N   . GLN A 1 447 ? -17.524 44.230  -32.541 1.00 34.43  ? 473 GLN A N   1 
ATOM   3519  C CA  . GLN A 1 447 ? -17.093 44.733  -31.239 1.00 37.35  ? 473 GLN A CA  1 
ATOM   3520  C C   . GLN A 1 447 ? -17.724 44.078  -30.018 1.00 35.45  ? 473 GLN A C   1 
ATOM   3521  O O   . GLN A 1 447 ? -17.026 43.718  -29.079 1.00 36.09  ? 473 GLN A O   1 
ATOM   3522  C CB  . GLN A 1 447 ? -17.295 46.248  -31.164 1.00 42.39  ? 473 GLN A CB  1 
ATOM   3523  C CG  . GLN A 1 447 ? -16.211 47.035  -31.871 1.00 52.44  ? 473 GLN A CG  1 
ATOM   3524  C CD  . GLN A 1 447 ? -14.807 46.633  -31.420 1.00 55.62  ? 473 GLN A CD  1 
ATOM   3525  O OE1 . GLN A 1 447 ? -14.520 46.580  -30.221 1.00 57.67  ? 473 GLN A OE1 1 
ATOM   3526  N NE2 . GLN A 1 447 ? -13.928 46.356  -32.383 1.00 53.91  ? 473 GLN A NE2 1 
ATOM   3527  N N   . ASP A 1 448 ? -19.040 43.928  -30.023 1.00 34.06  ? 474 ASP A N   1 
ATOM   3528  C CA  . ASP A 1 448 ? -19.719 43.321  -28.892 1.00 33.07  ? 474 ASP A CA  1 
ATOM   3529  C C   . ASP A 1 448 ? -19.208 41.902  -28.616 1.00 32.46  ? 474 ASP A C   1 
ATOM   3530  O O   . ASP A 1 448 ? -18.966 41.538  -27.465 1.00 32.71  ? 474 ASP A O   1 
ATOM   3531  C CB  . ASP A 1 448 ? -21.230 43.301  -29.135 1.00 32.99  ? 474 ASP A CB  1 
ATOM   3532  C CG  . ASP A 1 448 ? -21.620 42.459  -30.336 1.00 31.53  ? 474 ASP A CG  1 
ATOM   3533  O OD1 . ASP A 1 448 ? -21.181 42.768  -31.465 1.00 29.31  ? 474 ASP A OD1 1 
ATOM   3534  O OD2 . ASP A 1 448 ? -22.372 41.486  -30.139 1.00 30.20  ? 474 ASP A OD2 1 
ATOM   3535  N N   . GLU A 1 449 ? -19.040 41.106  -29.666 1.00 31.36  ? 475 GLU A N   1 
ATOM   3536  C CA  . GLU A 1 449 ? -18.552 39.742  -29.492 1.00 31.73  ? 475 GLU A CA  1 
ATOM   3537  C C   . GLU A 1 449 ? -17.064 39.685  -29.143 1.00 29.52  ? 475 GLU A C   1 
ATOM   3538  O O   . GLU A 1 449 ? -16.617 38.786  -28.428 1.00 28.99  ? 475 GLU A O   1 
ATOM   3539  C CB  . GLU A 1 449 ? -18.863 38.904  -30.735 1.00 32.05  ? 475 GLU A CB  1 
ATOM   3540  C CG  . GLU A 1 449 ? -20.325 38.502  -30.798 1.00 35.64  ? 475 GLU A CG  1 
ATOM   3541  C CD  . GLU A 1 449 ? -20.617 37.459  -31.858 1.00 38.71  ? 475 GLU A CD  1 
ATOM   3542  O OE1 . GLU A 1 449 ? -21.708 36.845  -31.796 1.00 36.39  ? 475 GLU A OE1 1 
ATOM   3543  O OE2 . GLU A 1 449 ? -19.762 37.254  -32.749 1.00 39.33  ? 475 GLU A OE2 1 
ATOM   3544  N N   . VAL A 1 450 ? -16.292 40.644  -29.640 1.00 26.85  ? 476 VAL A N   1 
ATOM   3545  C CA  . VAL A 1 450 ? -14.885 40.681  -29.293 1.00 26.97  ? 476 VAL A CA  1 
ATOM   3546  C C   . VAL A 1 450 ? -14.835 41.008  -27.793 1.00 27.40  ? 476 VAL A C   1 
ATOM   3547  O O   . VAL A 1 450 ? -14.176 40.315  -27.020 1.00 27.09  ? 476 VAL A O   1 
ATOM   3548  C CB  . VAL A 1 450 ? -14.121 41.776  -30.089 1.00 26.48  ? 476 VAL A CB  1 
ATOM   3549  C CG1 . VAL A 1 450 ? -12.707 41.929  -29.541 1.00 22.82  ? 476 VAL A CG1 1 
ATOM   3550  C CG2 . VAL A 1 450 ? -14.066 41.404  -31.559 1.00 24.64  ? 476 VAL A CG2 1 
ATOM   3551  N N   . ALA A 1 451 ? -15.557 42.053  -27.391 1.00 25.59  ? 477 ALA A N   1 
ATOM   3552  C CA  . ALA A 1 451 ? -15.601 42.468  -25.993 1.00 23.86  ? 477 ALA A CA  1 
ATOM   3553  C C   . ALA A 1 451 ? -16.130 41.343  -25.121 1.00 23.73  ? 477 ALA A C   1 
ATOM   3554  O O   . ALA A 1 451 ? -15.638 41.131  -24.014 1.00 26.91  ? 477 ALA A O   1 
ATOM   3555  C CB  . ALA A 1 451 ? -16.467 43.698  -25.842 1.00 24.01  ? 477 ALA A CB  1 
ATOM   3556  N N   . ALA A 1 452 ? -17.121 40.614  -25.624 1.00 21.59  ? 478 ALA A N   1 
ATOM   3557  C CA  . ALA A 1 452 ? -17.703 39.494  -24.891 1.00 17.86  ? 478 ALA A CA  1 
ATOM   3558  C C   . ALA A 1 452 ? -16.706 38.343  -24.712 1.00 20.60  ? 478 ALA A C   1 
ATOM   3559  O O   . ALA A 1 452 ? -16.683 37.688  -23.664 1.00 20.06  ? 478 ALA A O   1 
ATOM   3560  C CB  . ALA A 1 452 ? -18.941 38.991  -25.609 1.00 16.23  ? 478 ALA A CB  1 
ATOM   3561  N N   . SER A 1 453 ? -15.884 38.090  -25.729 1.00 20.86  ? 479 SER A N   1 
ATOM   3562  C CA  . SER A 1 453 ? -14.911 37.011  -25.642 1.00 22.27  ? 479 SER A CA  1 
ATOM   3563  C C   . SER A 1 453 ? -13.851 37.284  -24.564 1.00 24.83  ? 479 SER A C   1 
ATOM   3564  O O   . SER A 1 453 ? -13.442 36.372  -23.840 1.00 24.30  ? 479 SER A O   1 
ATOM   3565  C CB  . SER A 1 453 ? -14.236 36.781  -27.007 1.00 24.41  ? 479 SER A CB  1 
ATOM   3566  O OG  . SER A 1 453 ? -13.443 37.888  -27.422 1.00 21.62  ? 479 SER A OG  1 
ATOM   3567  N N   . ALA A 1 454 ? -13.412 38.539  -24.460 1.00 24.12  ? 480 ALA A N   1 
ATOM   3568  C CA  . ALA A 1 454 ? -12.406 38.926  -23.475 1.00 23.26  ? 480 ALA A CA  1 
ATOM   3569  C C   . ALA A 1 454 ? -12.953 38.693  -22.074 1.00 23.89  ? 480 ALA A C   1 
ATOM   3570  O O   . ALA A 1 454 ? -12.283 38.125  -21.207 1.00 26.02  ? 480 ALA A O   1 
ATOM   3571  C CB  . ALA A 1 454 ? -12.038 40.391  -23.655 1.00 18.16  ? 480 ALA A CB  1 
ATOM   3572  N N   . ILE A 1 455 ? -14.186 39.127  -21.856 1.00 24.58  ? 481 ILE A N   1 
ATOM   3573  C CA  . ILE A 1 455 ? -14.805 38.953  -20.559 1.00 24.25  ? 481 ILE A CA  1 
ATOM   3574  C C   . ILE A 1 455 ? -14.955 37.481  -20.229 1.00 24.27  ? 481 ILE A C   1 
ATOM   3575  O O   . ILE A 1 455 ? -14.623 37.057  -19.119 1.00 26.22  ? 481 ILE A O   1 
ATOM   3576  C CB  . ILE A 1 455 ? -16.188 39.639  -20.500 1.00 24.79  ? 481 ILE A CB  1 
ATOM   3577  C CG1 . ILE A 1 455 ? -16.007 41.159  -20.587 1.00 21.53  ? 481 ILE A CG1 1 
ATOM   3578  C CG2 . ILE A 1 455 ? -16.911 39.253  -19.208 1.00 24.32  ? 481 ILE A CG2 1 
ATOM   3579  C CD1 . ILE A 1 455 ? -17.284 41.924  -20.776 1.00 21.36  ? 481 ILE A CD1 1 
ATOM   3580  N N   . LEU A 1 456 ? -15.451 36.702  -21.189 1.00 24.60  ? 482 LEU A N   1 
ATOM   3581  C CA  . LEU A 1 456 ? -15.651 35.266  -20.977 1.00 22.74  ? 482 LEU A CA  1 
ATOM   3582  C C   . LEU A 1 456 ? -14.324 34.573  -20.694 1.00 23.49  ? 482 LEU A C   1 
ATOM   3583  O O   . LEU A 1 456 ? -14.273 33.574  -19.965 1.00 21.83  ? 482 LEU A O   1 
ATOM   3584  C CB  . LEU A 1 456 ? -16.350 34.638  -22.191 1.00 22.08  ? 482 LEU A CB  1 
ATOM   3585  C CG  . LEU A 1 456 ? -17.838 35.009  -22.340 1.00 20.30  ? 482 LEU A CG  1 
ATOM   3586  C CD1 . LEU A 1 456 ? -18.366 34.518  -23.657 1.00 16.74  ? 482 LEU A CD1 1 
ATOM   3587  C CD2 . LEU A 1 456 ? -18.644 34.405  -21.209 1.00 17.32  ? 482 LEU A CD2 1 
ATOM   3588  N N   . THR A 1 457 ? -13.256 35.115  -21.274 1.00 24.16  ? 483 THR A N   1 
ATOM   3589  C CA  . THR A 1 457 ? -11.910 34.595  -21.063 1.00 25.90  ? 483 THR A CA  1 
ATOM   3590  C C   . THR A 1 457 ? -11.536 34.852  -19.600 1.00 27.94  ? 483 THR A C   1 
ATOM   3591  O O   . THR A 1 457 ? -11.079 33.957  -18.896 1.00 28.33  ? 483 THR A O   1 
ATOM   3592  C CB  . THR A 1 457 ? -10.882 35.315  -21.954 1.00 24.93  ? 483 THR A CB  1 
ATOM   3593  O OG1 . THR A 1 457 ? -11.118 34.995  -23.328 1.00 24.79  ? 483 THR A OG1 1 
ATOM   3594  C CG2 . THR A 1 457 ? -9.479  34.900  -21.580 1.00 24.60  ? 483 THR A CG2 1 
ATOM   3595  N N   . ALA A 1 458 ? -11.726 36.087  -19.148 1.00 29.93  ? 484 ALA A N   1 
ATOM   3596  C CA  . ALA A 1 458 ? -11.417 36.439  -17.766 1.00 31.79  ? 484 ALA A CA  1 
ATOM   3597  C C   . ALA A 1 458 ? -12.242 35.595  -16.794 1.00 31.92  ? 484 ALA A C   1 
ATOM   3598  O O   . ALA A 1 458 ? -11.749 35.173  -15.750 1.00 31.28  ? 484 ALA A O   1 
ATOM   3599  C CB  . ALA A 1 458 ? -11.685 37.929  -17.527 1.00 29.50  ? 484 ALA A CB  1 
ATOM   3600  N N   . GLN A 1 459 ? -13.500 35.346  -17.142 1.00 33.81  ? 485 GLN A N   1 
ATOM   3601  C CA  . GLN A 1 459 ? -14.369 34.553  -16.283 1.00 35.28  ? 485 GLN A CA  1 
ATOM   3602  C C   . GLN A 1 459 ? -13.971 33.082  -16.224 1.00 34.84  ? 485 GLN A C   1 
ATOM   3603  O O   . GLN A 1 459 ? -14.104 32.444  -15.185 1.00 34.69  ? 485 GLN A O   1 
ATOM   3604  C CB  . GLN A 1 459 ? -15.816 34.680  -16.742 1.00 37.30  ? 485 GLN A CB  1 
ATOM   3605  C CG  . GLN A 1 459 ? -16.646 35.636  -15.907 1.00 39.33  ? 485 GLN A CG  1 
ATOM   3606  C CD  . GLN A 1 459 ? -18.045 35.795  -16.453 1.00 41.99  ? 485 GLN A CD  1 
ATOM   3607  O OE1 . GLN A 1 459 ? -18.678 34.817  -16.861 1.00 43.79  ? 485 GLN A OE1 1 
ATOM   3608  N NE2 . GLN A 1 459 ? -18.542 37.030  -16.460 1.00 40.26  ? 485 GLN A NE2 1 
ATOM   3609  N N   . LEU A 1 460 ? -13.491 32.539  -17.337 1.00 37.08  ? 486 LEU A N   1 
ATOM   3610  C CA  . LEU A 1 460 ? -13.067 31.145  -17.358 1.00 39.42  ? 486 LEU A CA  1 
ATOM   3611  C C   . LEU A 1 460 ? -11.830 31.011  -16.488 1.00 41.63  ? 486 LEU A C   1 
ATOM   3612  O O   . LEU A 1 460 ? -11.679 30.049  -15.737 1.00 42.36  ? 486 LEU A O   1 
ATOM   3613  C CB  . LEU A 1 460 ? -12.737 30.700  -18.781 1.00 38.17  ? 486 LEU A CB  1 
ATOM   3614  C CG  . LEU A 1 460 ? -12.141 29.295  -18.924 1.00 38.28  ? 486 LEU A CG  1 
ATOM   3615  C CD1 . LEU A 1 460 ? -13.060 28.264  -18.294 1.00 36.18  ? 486 LEU A CD1 1 
ATOM   3616  C CD2 . LEU A 1 460 ? -11.924 28.992  -20.390 1.00 36.39  ? 486 LEU A CD2 1 
ATOM   3617  N N   . ASP A 1 461 ? -10.941 31.988  -16.599 1.00 44.98  ? 487 ASP A N   1 
ATOM   3618  C CA  . ASP A 1 461 ? -9.718  31.987  -15.818 1.00 46.93  ? 487 ASP A CA  1 
ATOM   3619  C C   . ASP A 1 461 ? -10.078 31.967  -14.338 1.00 48.58  ? 487 ASP A C   1 
ATOM   3620  O O   . ASP A 1 461 ? -9.519  31.192  -13.562 1.00 48.35  ? 487 ASP A O   1 
ATOM   3621  C CB  . ASP A 1 461 ? -8.875  33.229  -16.153 1.00 46.81  ? 487 ASP A CB  1 
ATOM   3622  C CG  . ASP A 1 461 ? -7.694  33.409  -15.211 1.00 47.12  ? 487 ASP A CG  1 
ATOM   3623  O OD1 . ASP A 1 461 ? -7.861  34.052  -14.152 1.00 48.99  ? 487 ASP A OD1 1 
ATOM   3624  O OD2 . ASP A 1 461 ? -6.599  32.896  -15.521 1.00 48.08  ? 487 ASP A OD2 1 
ATOM   3625  N N   . GLU A 1 462 ? -11.034 32.811  -13.962 1.00 50.36  ? 488 GLU A N   1 
ATOM   3626  C CA  . GLU A 1 462 ? -11.469 32.908  -12.578 1.00 52.17  ? 488 GLU A CA  1 
ATOM   3627  C C   . GLU A 1 462 ? -12.160 31.650  -12.050 1.00 51.71  ? 488 GLU A C   1 
ATOM   3628  O O   . GLU A 1 462 ? -11.895 31.235  -10.921 1.00 50.95  ? 488 GLU A O   1 
ATOM   3629  C CB  . GLU A 1 462 ? -12.379 34.126  -12.399 1.00 54.20  ? 488 GLU A CB  1 
ATOM   3630  C CG  . GLU A 1 462 ? -12.984 34.247  -11.014 1.00 60.26  ? 488 GLU A CG  1 
ATOM   3631  C CD  . GLU A 1 462 ? -13.404 35.669  -10.678 1.00 65.44  ? 488 GLU A CD  1 
ATOM   3632  O OE1 . GLU A 1 462 ? -12.508 36.531  -10.513 1.00 67.02  ? 488 GLU A OE1 1 
ATOM   3633  O OE2 . GLU A 1 462 ? -14.625 35.924  -10.578 1.00 66.87  ? 488 GLU A OE2 1 
ATOM   3634  N N   . GLU A 1 463 ? -13.032 31.035  -12.842 1.00 52.16  ? 489 GLU A N   1 
ATOM   3635  C CA  . GLU A 1 463 ? -13.709 29.830  -12.364 1.00 55.31  ? 489 GLU A CA  1 
ATOM   3636  C C   . GLU A 1 463 ? -12.777 28.629  -12.457 1.00 55.24  ? 489 GLU A C   1 
ATOM   3637  O O   . GLU A 1 463 ? -13.172 27.493  -12.190 1.00 56.22  ? 489 GLU A O   1 
ATOM   3638  C CB  . GLU A 1 463 ? -15.008 29.567  -13.145 1.00 58.03  ? 489 GLU A CB  1 
ATOM   3639  C CG  . GLU A 1 463 ? -14.858 28.849  -14.481 1.00 63.53  ? 489 GLU A CG  1 
ATOM   3640  C CD  . GLU A 1 463 ? -16.196 28.686  -15.210 1.00 67.16  ? 489 GLU A CD  1 
ATOM   3641  O OE1 . GLU A 1 463 ? -17.228 29.176  -14.698 1.00 68.32  ? 489 GLU A OE1 1 
ATOM   3642  O OE2 . GLU A 1 463 ? -16.217 28.070  -16.299 1.00 68.55  ? 489 GLU A OE2 1 
ATOM   3643  N N   . LEU A 1 464 ? -11.528 28.899  -12.829 1.00 54.48  ? 490 LEU A N   1 
ATOM   3644  C CA  . LEU A 1 464 ? -10.514 27.862  -12.949 1.00 51.87  ? 490 LEU A CA  1 
ATOM   3645  C C   . LEU A 1 464 ? -9.444  28.063  -11.876 1.00 50.90  ? 490 LEU A C   1 
ATOM   3646  O O   . LEU A 1 464 ? -8.513  27.270  -11.759 1.00 51.67  ? 490 LEU A O   1 
ATOM   3647  C CB  . LEU A 1 464 ? -9.886  27.901  -14.344 1.00 52.13  ? 490 LEU A CB  1 
ATOM   3648  C CG  . LEU A 1 464 ? -9.808  26.559  -15.078 1.00 50.65  ? 490 LEU A CG  1 
ATOM   3649  C CD1 . LEU A 1 464 ? -11.160 25.860  -15.019 1.00 48.99  ? 490 LEU A CD1 1 
ATOM   3650  C CD2 . LEU A 1 464 ? -9.386  26.785  -16.521 1.00 48.92  ? 490 LEU A CD2 1 
ATOM   3651  N N   . GLY A 1 465 ? -9.584  29.135  -11.100 1.00 48.75  ? 491 GLY A N   1 
ATOM   3652  C CA  . GLY A 1 465 ? -8.640  29.405  -10.034 1.00 47.34  ? 491 GLY A CA  1 
ATOM   3653  C C   . GLY A 1 465 ? -7.668  30.552  -10.236 1.00 48.35  ? 491 GLY A C   1 
ATOM   3654  O O   . GLY A 1 465 ? -6.886  30.853  -9.336  1.00 49.84  ? 491 GLY A O   1 
ATOM   3655  N N   . GLY A 1 466 ? -7.703  31.203  -11.392 1.00 47.72  ? 492 GLY A N   1 
ATOM   3656  C CA  . GLY A 1 466 ? -6.777  32.299  -11.634 1.00 45.72  ? 492 GLY A CA  1 
ATOM   3657  C C   . GLY A 1 466 ? -5.378  31.751  -11.847 1.00 44.89  ? 492 GLY A C   1 
ATOM   3658  O O   . GLY A 1 466 ? -4.389  32.477  -11.832 1.00 46.03  ? 492 GLY A O   1 
ATOM   3659  N N   . THR A 1 467 ? -5.323  30.445  -12.066 1.00 43.61  ? 493 THR A N   1 
ATOM   3660  C CA  . THR A 1 467 ? -4.090  29.707  -12.281 1.00 42.15  ? 493 THR A CA  1 
ATOM   3661  C C   . THR A 1 467 ? -3.616  29.649  -13.733 1.00 40.50  ? 493 THR A C   1 
ATOM   3662  O O   . THR A 1 467 ? -2.415  29.595  -13.998 1.00 41.80  ? 493 THR A O   1 
ATOM   3663  C CB  . THR A 1 467 ? -4.257  28.253  -11.784 1.00 43.91  ? 493 THR A CB  1 
ATOM   3664  O OG1 . THR A 1 467 ? -4.300  28.238  -10.352 1.00 47.20  ? 493 THR A OG1 1 
ATOM   3665  C CG2 . THR A 1 467 ? -3.119  27.381  -12.264 1.00 46.27  ? 493 THR A CG2 1 
ATOM   3666  N N   . PRO A 1 468 ? -4.547  29.657  -14.698 1.00 37.86  ? 494 PRO A N   1 
ATOM   3667  C CA  . PRO A 1 468 ? -4.118  29.585  -16.099 1.00 34.17  ? 494 PRO A CA  1 
ATOM   3668  C C   . PRO A 1 468 ? -3.307  30.754  -16.624 1.00 30.83  ? 494 PRO A C   1 
ATOM   3669  O O   . PRO A 1 468 ? -3.226  31.812  -16.003 1.00 32.78  ? 494 PRO A O   1 
ATOM   3670  C CB  . PRO A 1 468 ? -5.436  29.438  -16.861 1.00 33.64  ? 494 PRO A CB  1 
ATOM   3671  C CG  . PRO A 1 468 ? -6.361  28.832  -15.851 1.00 36.51  ? 494 PRO A CG  1 
ATOM   3672  C CD  . PRO A 1 468 ? -6.016  29.593  -14.604 1.00 35.07  ? 494 PRO A CD  1 
ATOM   3673  N N   . VAL A 1 469 ? -2.683  30.524  -17.771 1.00 28.15  ? 495 VAL A N   1 
ATOM   3674  C CA  . VAL A 1 469 ? -1.925  31.539  -18.476 1.00 26.84  ? 495 VAL A CA  1 
ATOM   3675  C C   . VAL A 1 469 ? -2.985  32.080  -19.422 1.00 27.47  ? 495 VAL A C   1 
ATOM   3676  O O   . VAL A 1 469 ? -3.728  31.310  -20.036 1.00 28.47  ? 495 VAL A O   1 
ATOM   3677  C CB  . VAL A 1 469 ? -0.768  30.930  -19.299 1.00 25.27  ? 495 VAL A CB  1 
ATOM   3678  C CG1 . VAL A 1 469 ? -0.241  31.942  -20.292 1.00 23.13  ? 495 VAL A CG1 1 
ATOM   3679  C CG2 . VAL A 1 469 ? 0.349   30.508  -18.373 1.00 28.15  ? 495 VAL A CG2 1 
ATOM   3680  N N   . GLN A 1 470 ? -3.074  33.396  -19.533 1.00 27.96  ? 496 GLN A N   1 
ATOM   3681  C CA  . GLN A 1 470 ? -4.080  34.001  -20.392 1.00 29.26  ? 496 GLN A CA  1 
ATOM   3682  C C   . GLN A 1 470 ? -3.402  34.751  -21.513 1.00 27.26  ? 496 GLN A C   1 
ATOM   3683  O O   . GLN A 1 470 ? -2.584  35.625  -21.273 1.00 27.65  ? 496 GLN A O   1 
ATOM   3684  C CB  . GLN A 1 470 ? -4.935  34.947  -19.566 1.00 32.23  ? 496 GLN A CB  1 
ATOM   3685  C CG  . GLN A 1 470 ? -6.232  35.345  -20.197 1.00 34.55  ? 496 GLN A CG  1 
ATOM   3686  C CD  . GLN A 1 470 ? -7.023  36.233  -19.274 1.00 35.68  ? 496 GLN A CD  1 
ATOM   3687  O OE1 . GLN A 1 470 ? -7.310  35.856  -18.134 1.00 35.23  ? 496 GLN A OE1 1 
ATOM   3688  N NE2 . GLN A 1 470 ? -7.374  37.423  -19.750 1.00 37.52  ? 496 GLN A NE2 1 
ATOM   3689  N N   . SER A 1 471 ? -3.758  34.419  -22.745 1.00 28.12  ? 497 SER A N   1 
ATOM   3690  C CA  . SER A 1 471 ? -3.130  35.057  -23.886 1.00 28.60  ? 497 SER A CA  1 
ATOM   3691  C C   . SER A 1 471 ? -4.127  35.648  -24.897 1.00 29.00  ? 497 SER A C   1 
ATOM   3692  O O   . SER A 1 471 ? -5.071  34.979  -25.318 1.00 26.15  ? 497 SER A O   1 
ATOM   3693  C CB  . SER A 1 471 ? -2.223  34.026  -24.573 1.00 27.53  ? 497 SER A CB  1 
ATOM   3694  O OG  . SER A 1 471 ? -1.416  34.627  -25.564 1.00 31.79  ? 497 SER A OG  1 
ATOM   3695  N N   . ARG A 1 472 ? -3.916  36.909  -25.273 1.00 28.22  ? 498 ARG A N   1 
ATOM   3696  C CA  . ARG A 1 472 ? -4.776  37.555  -26.254 1.00 28.25  ? 498 ARG A CA  1 
ATOM   3697  C C   . ARG A 1 472 ? -4.099  37.554  -27.610 1.00 28.90  ? 498 ARG A C   1 
ATOM   3698  O O   . ARG A 1 472 ? -3.066  38.186  -27.798 1.00 26.30  ? 498 ARG A O   1 
ATOM   3699  C CB  . ARG A 1 472 ? -5.074  39.003  -25.885 1.00 27.63  ? 498 ARG A CB  1 
ATOM   3700  C CG  . ARG A 1 472 ? -5.809  39.763  -27.000 1.00 27.62  ? 498 ARG A CG  1 
ATOM   3701  C CD  . ARG A 1 472 ? -5.767  41.247  -26.739 1.00 32.62  ? 498 ARG A CD  1 
ATOM   3702  N NE  . ARG A 1 472 ? -5.063  42.025  -27.760 1.00 35.38  ? 498 ARG A NE  1 
ATOM   3703  C CZ  . ARG A 1 472 ? -3.882  41.711  -28.289 1.00 34.69  ? 498 ARG A CZ  1 
ATOM   3704  N NH1 . ARG A 1 472 ? -3.240  40.615  -27.919 1.00 37.36  ? 498 ARG A NH1 1 
ATOM   3705  N NH2 . ARG A 1 472 ? -3.328  42.519  -29.178 1.00 35.74  ? 498 ARG A NH2 1 
ATOM   3706  N N   . VAL A 1 473 ? -4.690  36.847  -28.561 1.00 31.27  ? 499 VAL A N   1 
ATOM   3707  C CA  . VAL A 1 473 ? -4.132  36.797  -29.896 1.00 32.06  ? 499 VAL A CA  1 
ATOM   3708  C C   . VAL A 1 473 ? -5.147  37.379  -30.886 1.00 33.03  ? 499 VAL A C   1 
ATOM   3709  O O   . VAL A 1 473 ? -6.354  37.163  -30.766 1.00 31.05  ? 499 VAL A O   1 
ATOM   3710  C CB  . VAL A 1 473 ? -3.748  35.338  -30.275 1.00 31.65  ? 499 VAL A CB  1 
ATOM   3711  C CG1 . VAL A 1 473 ? -4.907  34.415  -30.008 1.00 33.67  ? 499 VAL A CG1 1 
ATOM   3712  C CG2 . VAL A 1 473 ? -3.338  35.256  -31.745 1.00 34.15  ? 499 VAL A CG2 1 
ATOM   3713  N N   . VAL A 1 474 ? -4.640  38.151  -31.841 1.00 34.34  ? 500 VAL A N   1 
ATOM   3714  C CA  . VAL A 1 474 ? -5.461  38.777  -32.865 1.00 36.31  ? 500 VAL A CA  1 
ATOM   3715  C C   . VAL A 1 474 ? -5.197  38.057  -34.185 1.00 39.26  ? 500 VAL A C   1 
ATOM   3716  O O   . VAL A 1 474 ? -4.086  37.579  -34.429 1.00 39.20  ? 500 VAL A O   1 
ATOM   3717  C CB  . VAL A 1 474 ? -5.096  40.278  -33.037 1.00 36.87  ? 500 VAL A CB  1 
ATOM   3718  C CG1 . VAL A 1 474 ? -5.996  40.922  -34.083 1.00 35.66  ? 500 VAL A CG1 1 
ATOM   3719  C CG2 . VAL A 1 474 ? -5.216  41.004  -31.707 1.00 36.81  ? 500 VAL A CG2 1 
ATOM   3720  N N   . GLN A 1 475 ? -6.221  37.977  -35.030 1.00 40.98  ? 501 GLN A N   1 
ATOM   3721  C CA  . GLN A 1 475 ? -6.103  37.327  -36.331 1.00 42.15  ? 501 GLN A CA  1 
ATOM   3722  C C   . GLN A 1 475 ? -4.982  37.961  -37.148 1.00 41.82  ? 501 GLN A C   1 
ATOM   3723  O O   . GLN A 1 475 ? -5.002  39.161  -37.419 1.00 41.68  ? 501 GLN A O   1 
ATOM   3724  C CB  . GLN A 1 475 ? -7.429  37.447  -37.084 1.00 44.21  ? 501 GLN A CB  1 
ATOM   3725  C CG  . GLN A 1 475 ? -7.400  36.974  -38.525 1.00 46.15  ? 501 GLN A CG  1 
ATOM   3726  C CD  . GLN A 1 475 ? -8.771  37.027  -39.168 1.00 48.20  ? 501 GLN A CD  1 
ATOM   3727  O OE1 . GLN A 1 475 ? -9.482  38.024  -39.062 1.00 49.84  ? 501 GLN A OE1 1 
ATOM   3728  N NE2 . GLN A 1 475 ? -9.147  35.952  -39.845 1.00 51.71  ? 501 GLN A NE2 1 
ATOM   3729  N N   . GLY A 1 476 ? -4.003  37.155  -37.541 1.00 42.14  ? 502 GLY A N   1 
ATOM   3730  C CA  . GLY A 1 476 ? -2.896  37.683  -38.319 1.00 43.36  ? 502 GLY A CA  1 
ATOM   3731  C C   . GLY A 1 476 ? -1.557  37.536  -37.620 1.00 42.71  ? 502 GLY A C   1 
ATOM   3732  O O   . GLY A 1 476 ? -0.530  37.383  -38.277 1.00 44.14  ? 502 GLY A O   1 
ATOM   3733  N N   . LYS A 1 477 ? -1.565  37.593  -36.290 1.00 40.71  ? 503 LYS A N   1 
ATOM   3734  C CA  . LYS A 1 477 ? -0.346  37.452  -35.501 1.00 40.43  ? 503 LYS A CA  1 
ATOM   3735  C C   . LYS A 1 477 ? -0.461  36.306  -34.506 1.00 38.27  ? 503 LYS A C   1 
ATOM   3736  O O   . LYS A 1 477 ? -0.192  36.468  -33.311 1.00 36.74  ? 503 LYS A O   1 
ATOM   3737  C CB  . LYS A 1 477 ? -0.021  38.752  -34.745 1.00 43.19  ? 503 LYS A CB  1 
ATOM   3738  C CG  . LYS A 1 477 ? 0.909   39.699  -35.492 1.00 47.44  ? 503 LYS A CG  1 
ATOM   3739  C CD  . LYS A 1 477 ? 2.257   39.044  -35.786 1.00 53.69  ? 503 LYS A CD  1 
ATOM   3740  C CE  . LYS A 1 477 ? 3.120   39.922  -36.693 1.00 57.10  ? 503 LYS A CE  1 
ATOM   3741  N NZ  . LYS A 1 477 ? 4.385   39.249  -37.124 1.00 58.73  ? 503 LYS A NZ  1 
ATOM   3742  N N   . GLU A 1 478 ? -0.869  35.146  -35.001 1.00 35.59  ? 504 GLU A N   1 
ATOM   3743  C CA  . GLU A 1 478 ? -1.001  33.973  -34.152 1.00 34.32  ? 504 GLU A CA  1 
ATOM   3744  C C   . GLU A 1 478 ? 0.389   33.563  -33.657 1.00 34.00  ? 504 GLU A C   1 
ATOM   3745  O O   . GLU A 1 478 ? 1.355   33.581  -34.418 1.00 35.90  ? 504 GLU A O   1 
ATOM   3746  C CB  . GLU A 1 478 ? -1.621  32.814  -34.941 1.00 32.01  ? 504 GLU A CB  1 
ATOM   3747  C CG  . GLU A 1 478 ? -3.037  33.049  -35.474 1.00 29.93  ? 504 GLU A CG  1 
ATOM   3748  C CD  . GLU A 1 478 ? -3.145  34.172  -36.502 1.00 33.14  ? 504 GLU A CD  1 
ATOM   3749  O OE1 . GLU A 1 478 ? -2.179  34.400  -37.268 1.00 30.20  ? 504 GLU A OE1 1 
ATOM   3750  O OE2 . GLU A 1 478 ? -4.217  34.817  -36.559 1.00 33.53  ? 504 GLU A OE2 1 
ATOM   3751  N N   . PRO A 1 479 ? 0.515   33.211  -32.374 1.00 32.89  ? 505 PRO A N   1 
ATOM   3752  C CA  . PRO A 1 479 ? 1.811   32.797  -31.822 1.00 33.91  ? 505 PRO A CA  1 
ATOM   3753  C C   . PRO A 1 479 ? 2.151   31.337  -32.162 1.00 34.03  ? 505 PRO A C   1 
ATOM   3754  O O   . PRO A 1 479 ? 1.260   30.509  -32.344 1.00 33.86  ? 505 PRO A O   1 
ATOM   3755  C CB  . PRO A 1 479 ? 1.625   33.008  -30.325 1.00 34.24  ? 505 PRO A CB  1 
ATOM   3756  C CG  . PRO A 1 479 ? 0.186   32.654  -30.136 1.00 32.93  ? 505 PRO A CG  1 
ATOM   3757  C CD  . PRO A 1 479 ? -0.477  33.376  -31.299 1.00 30.30  ? 505 PRO A CD  1 
ATOM   3758  N N   . ALA A 1 480 ? 3.442   31.032  -32.232 1.00 34.93  ? 506 ALA A N   1 
ATOM   3759  C CA  . ALA A 1 480 ? 3.925   29.692  -32.556 1.00 35.78  ? 506 ALA A CA  1 
ATOM   3760  C C   . ALA A 1 480 ? 3.208   28.526  -31.859 1.00 36.69  ? 506 ALA A C   1 
ATOM   3761  O O   . ALA A 1 480 ? 2.781   27.564  -32.504 1.00 36.15  ? 506 ALA A O   1 
ATOM   3762  C CB  . ALA A 1 480 ? 5.407   29.616  -32.267 1.00 35.66  ? 506 ALA A CB  1 
ATOM   3763  N N   . HIS A 1 481 ? 3.080   28.607  -30.542 1.00 34.92  ? 507 HIS A N   1 
ATOM   3764  C CA  . HIS A 1 481 ? 2.443   27.539  -29.793 1.00 33.88  ? 507 HIS A CA  1 
ATOM   3765  C C   . HIS A 1 481 ? 0.983   27.317  -30.168 1.00 37.19  ? 507 HIS A C   1 
ATOM   3766  O O   . HIS A 1 481 ? 0.506   26.182  -30.201 1.00 37.95  ? 507 HIS A O   1 
ATOM   3767  C CB  . HIS A 1 481 ? 2.533   27.822  -28.309 1.00 29.95  ? 507 HIS A CB  1 
ATOM   3768  C CG  . HIS A 1 481 ? 2.024   26.704  -27.463 1.00 26.50  ? 507 HIS A CG  1 
ATOM   3769  N ND1 . HIS A 1 481 ? 2.681   25.500  -27.356 1.00 28.55  ? 507 HIS A ND1 1 
ATOM   3770  C CD2 . HIS A 1 481 ? 0.919   26.603  -26.688 1.00 23.40  ? 507 HIS A CD2 1 
ATOM   3771  C CE1 . HIS A 1 481 ? 2.004   24.704  -26.548 1.00 27.77  ? 507 HIS A CE1 1 
ATOM   3772  N NE2 . HIS A 1 481 ? 0.930   25.351  -26.130 1.00 24.45  ? 507 HIS A NE2 1 
ATOM   3773  N N   . LEU A 1 482 ? 0.265   28.402  -30.428 1.00 38.00  ? 508 LEU A N   1 
ATOM   3774  C CA  . LEU A 1 482 ? -1.132  28.283  -30.802 1.00 38.65  ? 508 LEU A CA  1 
ATOM   3775  C C   . LEU A 1 482 ? -1.226  27.531  -32.127 1.00 39.29  ? 508 LEU A C   1 
ATOM   3776  O O   . LEU A 1 482 ? -2.156  26.765  -32.344 1.00 39.60  ? 508 LEU A O   1 
ATOM   3777  C CB  . LEU A 1 482 ? -1.774  29.675  -30.923 1.00 38.04  ? 508 LEU A CB  1 
ATOM   3778  C CG  . LEU A 1 482 ? -3.216  29.736  -31.445 1.00 35.68  ? 508 LEU A CG  1 
ATOM   3779  C CD1 . LEU A 1 482 ? -4.108  28.797  -30.645 1.00 32.58  ? 508 LEU A CD1 1 
ATOM   3780  C CD2 . LEU A 1 482 ? -3.724  31.164  -31.369 1.00 33.50  ? 508 LEU A CD2 1 
ATOM   3781  N N   . MET A 1 483 ? -0.243  27.743  -32.998 1.00 40.76  ? 509 MET A N   1 
ATOM   3782  C CA  . MET A 1 483 ? -0.200  27.095  -34.308 1.00 43.19  ? 509 MET A CA  1 
ATOM   3783  C C   . MET A 1 483 ? -0.019  25.576  -34.258 1.00 43.70  ? 509 MET A C   1 
ATOM   3784  O O   . MET A 1 483 ? -0.530  24.870  -35.122 1.00 45.06  ? 509 MET A O   1 
ATOM   3785  C CB  . MET A 1 483 ? 0.939   27.674  -35.155 1.00 42.87  ? 509 MET A CB  1 
ATOM   3786  C CG  . MET A 1 483 ? 0.770   29.111  -35.600 1.00 45.15  ? 509 MET A CG  1 
ATOM   3787  S SD  . MET A 1 483 ? 2.199   29.676  -36.577 1.00 48.39  ? 509 MET A SD  1 
ATOM   3788  C CE  . MET A 1 483 ? 2.934   30.882  -35.479 1.00 50.27  ? 509 MET A CE  1 
ATOM   3789  N N   . SER A 1 484 ? 0.702   25.080  -33.255 1.00 43.72  ? 510 SER A N   1 
ATOM   3790  C CA  . SER A 1 484 ? 0.984   23.652  -33.141 1.00 45.45  ? 510 SER A CA  1 
ATOM   3791  C C   . SER A 1 484 ? -0.019  22.801  -32.360 1.00 48.93  ? 510 SER A C   1 
ATOM   3792  O O   . SER A 1 484 ? 0.279   21.655  -32.004 1.00 49.37  ? 510 SER A O   1 
ATOM   3793  C CB  . SER A 1 484 ? 2.378   23.446  -32.533 1.00 45.28  ? 510 SER A CB  1 
ATOM   3794  O OG  . SER A 1 484 ? 2.376   23.669  -31.133 1.00 41.15  ? 510 SER A OG  1 
ATOM   3795  N N   . LEU A 1 485 ? -1.203  23.344  -32.102 1.00 50.69  ? 511 LEU A N   1 
ATOM   3796  C CA  . LEU A 1 485 ? -2.220  22.609  -31.355 1.00 50.89  ? 511 LEU A CA  1 
ATOM   3797  C C   . LEU A 1 485 ? -3.072  21.691  -32.230 1.00 52.22  ? 511 LEU A C   1 
ATOM   3798  O O   . LEU A 1 485 ? -3.950  20.991  -31.720 1.00 53.00  ? 511 LEU A O   1 
ATOM   3799  C CB  . LEU A 1 485 ? -3.148  23.587  -30.628 1.00 49.53  ? 511 LEU A CB  1 
ATOM   3800  C CG  . LEU A 1 485 ? -2.575  24.448  -29.505 1.00 48.66  ? 511 LEU A CG  1 
ATOM   3801  C CD1 . LEU A 1 485 ? -3.643  25.399  -29.002 1.00 50.29  ? 511 LEU A CD1 1 
ATOM   3802  C CD2 . LEU A 1 485 ? -2.091  23.564  -28.376 1.00 50.52  ? 511 LEU A CD2 1 
ATOM   3803  N N   . PHE A 1 486 ? -2.811  21.671  -33.534 1.00 51.54  ? 512 PHE A N   1 
ATOM   3804  C CA  . PHE A 1 486 ? -3.625  20.858  -34.431 1.00 53.33  ? 512 PHE A CA  1 
ATOM   3805  C C   . PHE A 1 486 ? -2.900  19.731  -35.171 1.00 56.07  ? 512 PHE A C   1 
ATOM   3806  O O   . PHE A 1 486 ? -2.970  19.627  -36.402 1.00 55.81  ? 512 PHE A O   1 
ATOM   3807  C CB  . PHE A 1 486 ? -4.333  21.797  -35.414 1.00 48.68  ? 512 PHE A CB  1 
ATOM   3808  C CG  . PHE A 1 486 ? -4.891  23.024  -34.752 1.00 44.92  ? 512 PHE A CG  1 
ATOM   3809  C CD1 . PHE A 1 486 ? -4.304  24.270  -34.952 1.00 41.84  ? 512 PHE A CD1 1 
ATOM   3810  C CD2 . PHE A 1 486 ? -5.952  22.919  -33.851 1.00 42.35  ? 512 PHE A CD2 1 
ATOM   3811  C CE1 . PHE A 1 486 ? -4.761  25.391  -34.261 1.00 37.69  ? 512 PHE A CE1 1 
ATOM   3812  C CE2 . PHE A 1 486 ? -6.412  24.031  -33.159 1.00 40.25  ? 512 PHE A CE2 1 
ATOM   3813  C CZ  . PHE A 1 486 ? -5.814  25.268  -33.364 1.00 37.84  ? 512 PHE A CZ  1 
ATOM   3814  N N   . GLY A 1 487 ? -2.235  18.870  -34.402 1.00 58.07  ? 513 GLY A N   1 
ATOM   3815  C CA  . GLY A 1 487 ? -1.501  17.764  -34.987 1.00 60.62  ? 513 GLY A CA  1 
ATOM   3816  C C   . GLY A 1 487 ? -0.393  18.297  -35.872 1.00 62.21  ? 513 GLY A C   1 
ATOM   3817  O O   . GLY A 1 487 ? 0.553   18.930  -35.394 1.00 64.79  ? 513 GLY A O   1 
ATOM   3818  N N   . GLY A 1 488 ? -0.513  18.048  -37.169 1.00 61.45  ? 514 GLY A N   1 
ATOM   3819  C CA  . GLY A 1 488 ? 0.481   18.527  -38.107 1.00 60.45  ? 514 GLY A CA  1 
ATOM   3820  C C   . GLY A 1 488 ? -0.176  19.400  -39.154 1.00 60.79  ? 514 GLY A C   1 
ATOM   3821  O O   . GLY A 1 488 ? 0.478   19.872  -40.086 1.00 61.45  ? 514 GLY A O   1 
ATOM   3822  N N   . LYS A 1 489 ? -1.480  19.613  -39.007 1.00 60.76  ? 515 LYS A N   1 
ATOM   3823  C CA  . LYS A 1 489 ? -2.215  20.439  -39.956 1.00 60.73  ? 515 LYS A CA  1 
ATOM   3824  C C   . LYS A 1 489 ? -1.997  21.916  -39.665 1.00 59.07  ? 515 LYS A C   1 
ATOM   3825  O O   . LYS A 1 489 ? -1.939  22.333  -38.508 1.00 58.48  ? 515 LYS A O   1 
ATOM   3826  C CB  . LYS A 1 489 ? -3.711  20.125  -39.902 1.00 63.28  ? 515 LYS A CB  1 
ATOM   3827  C CG  . LYS A 1 489 ? -4.104  18.785  -40.509 1.00 65.88  ? 515 LYS A CG  1 
ATOM   3828  C CD  . LYS A 1 489 ? -3.583  17.601  -39.704 1.00 66.77  ? 515 LYS A CD  1 
ATOM   3829  C CE  . LYS A 1 489 ? -4.027  16.282  -40.336 1.00 68.34  ? 515 LYS A CE  1 
ATOM   3830  N NZ  . LYS A 1 489 ? -3.553  15.084  -39.581 1.00 69.39  ? 515 LYS A NZ  1 
ATOM   3831  N N   . PRO A 1 490 ? -1.861  22.730  -40.718 1.00 58.12  ? 516 PRO A N   1 
ATOM   3832  C CA  . PRO A 1 490 ? -1.650  24.160  -40.505 1.00 57.68  ? 516 PRO A CA  1 
ATOM   3833  C C   . PRO A 1 490 ? -2.922  24.788  -39.964 1.00 57.66  ? 516 PRO A C   1 
ATOM   3834  O O   . PRO A 1 490 ? -4.026  24.367  -40.312 1.00 59.73  ? 516 PRO A O   1 
ATOM   3835  C CB  . PRO A 1 490 ? -1.306  24.664  -41.900 1.00 56.44  ? 516 PRO A CB  1 
ATOM   3836  C CG  . PRO A 1 490 ? -2.151  23.791  -42.765 1.00 56.56  ? 516 PRO A CG  1 
ATOM   3837  C CD  . PRO A 1 490 ? -1.954  22.419  -42.155 1.00 56.57  ? 516 PRO A CD  1 
ATOM   3838  N N   . MET A 1 491 ? -2.774  25.778  -39.097 1.00 56.46  ? 517 MET A N   1 
ATOM   3839  C CA  . MET A 1 491 ? -3.936  26.451  -38.546 1.00 54.71  ? 517 MET A CA  1 
ATOM   3840  C C   . MET A 1 491 ? -4.535  27.200  -39.734 1.00 53.93  ? 517 MET A C   1 
ATOM   3841  O O   . MET A 1 491 ? -3.852  28.000  -40.372 1.00 53.13  ? 517 MET A O   1 
ATOM   3842  C CB  . MET A 1 491 ? -3.505  27.431  -37.451 1.00 54.38  ? 517 MET A CB  1 
ATOM   3843  C CG  . MET A 1 491 ? -4.626  27.880  -36.527 1.00 53.63  ? 517 MET A CG  1 
ATOM   3844  S SD  . MET A 1 491 ? -4.109  29.134  -35.329 1.00 50.58  ? 517 MET A SD  1 
ATOM   3845  C CE  . MET A 1 491 ? -4.935  30.560  -35.983 1.00 52.32  ? 517 MET A CE  1 
ATOM   3846  N N   . ILE A 1 492 ? -5.796  26.930  -40.055 1.00 53.20  ? 518 ILE A N   1 
ATOM   3847  C CA  . ILE A 1 492 ? -6.419  27.608  -41.186 1.00 53.53  ? 518 ILE A CA  1 
ATOM   3848  C C   . ILE A 1 492 ? -7.214  28.808  -40.683 1.00 53.93  ? 518 ILE A C   1 
ATOM   3849  O O   . ILE A 1 492 ? -7.990  28.690  -39.734 1.00 53.12  ? 518 ILE A O   1 
ATOM   3850  C CB  . ILE A 1 492 ? -7.401  26.683  -41.974 1.00 52.67  ? 518 ILE A CB  1 
ATOM   3851  C CG1 . ILE A 1 492 ? -6.904  25.230  -41.997 1.00 52.82  ? 518 ILE A CG1 1 
ATOM   3852  C CG2 . ILE A 1 492 ? -7.553  27.203  -43.392 1.00 48.05  ? 518 ILE A CG2 1 
ATOM   3853  C CD1 . ILE A 1 492 ? -5.674  24.995  -42.824 1.00 54.58  ? 518 ILE A CD1 1 
ATOM   3854  N N   . VAL A 1 493 ? -7.018  29.958  -41.325 1.00 53.99  ? 519 VAL A N   1 
ATOM   3855  C CA  . VAL A 1 493 ? -7.728  31.178  -40.957 1.00 54.03  ? 519 VAL A CA  1 
ATOM   3856  C C   . VAL A 1 493 ? -8.348  31.834  -42.184 1.00 54.26  ? 519 VAL A C   1 
ATOM   3857  O O   . VAL A 1 493 ? -7.645  32.410  -43.011 1.00 53.52  ? 519 VAL A O   1 
ATOM   3858  C CB  . VAL A 1 493 ? -6.788  32.204  -40.290 1.00 54.47  ? 519 VAL A CB  1 
ATOM   3859  C CG1 . VAL A 1 493 ? -7.524  33.518  -40.075 1.00 54.85  ? 519 VAL A CG1 1 
ATOM   3860  C CG2 . VAL A 1 493 ? -6.281  31.663  -38.963 1.00 54.10  ? 519 VAL A CG2 1 
ATOM   3861  N N   . TYR A 1 494 ? -9.668  31.747  -42.298 1.00 55.83  ? 520 TYR A N   1 
ATOM   3862  C CA  . TYR A 1 494 ? -10.364 32.350  -43.428 1.00 57.30  ? 520 TYR A CA  1 
ATOM   3863  C C   . TYR A 1 494 ? -10.725 33.788  -43.079 1.00 58.85  ? 520 TYR A C   1 
ATOM   3864  O O   . TYR A 1 494 ? -11.309 34.040  -42.030 1.00 60.25  ? 520 TYR A O   1 
ATOM   3865  C CB  . TYR A 1 494 ? -11.655 31.583  -43.751 1.00 55.70  ? 520 TYR A CB  1 
ATOM   3866  C CG  . TYR A 1 494 ? -11.517 30.077  -43.831 1.00 51.80  ? 520 TYR A CG  1 
ATOM   3867  C CD1 . TYR A 1 494 ? -11.704 29.284  -42.702 1.00 50.67  ? 520 TYR A CD1 1 
ATOM   3868  C CD2 . TYR A 1 494 ? -11.215 29.444  -45.040 1.00 50.61  ? 520 TYR A CD2 1 
ATOM   3869  C CE1 . TYR A 1 494 ? -11.602 27.894  -42.768 1.00 50.54  ? 520 TYR A CE1 1 
ATOM   3870  C CE2 . TYR A 1 494 ? -11.108 28.052  -45.119 1.00 49.05  ? 520 TYR A CE2 1 
ATOM   3871  C CZ  . TYR A 1 494 ? -11.307 27.284  -43.977 1.00 49.77  ? 520 TYR A CZ  1 
ATOM   3872  O OH  . TYR A 1 494 ? -11.243 25.912  -44.037 1.00 47.30  ? 520 TYR A OH  1 
ATOM   3873  N N   . LYS A 1 495 ? -10.381 34.734  -43.945 1.00 61.37  ? 521 LYS A N   1 
ATOM   3874  C CA  . LYS A 1 495 ? -10.720 36.127  -43.676 1.00 64.01  ? 521 LYS A CA  1 
ATOM   3875  C C   . LYS A 1 495 ? -12.223 36.289  -43.885 1.00 66.33  ? 521 LYS A C   1 
ATOM   3876  O O   . LYS A 1 495 ? -12.763 37.390  -43.787 1.00 67.81  ? 521 LYS A O   1 
ATOM   3877  C CB  . LYS A 1 495 ? -9.966  37.065  -44.620 1.00 62.95  ? 521 LYS A CB  1 
ATOM   3878  C CG  . LYS A 1 495 ? -10.340 36.901  -46.079 1.00 65.92  ? 521 LYS A CG  1 
ATOM   3879  C CD  . LYS A 1 495 ? -9.606  37.894  -46.983 1.00 67.01  ? 521 LYS A CD  1 
ATOM   3880  C CE  . LYS A 1 495 ? -10.186 39.299  -46.882 1.00 66.96  ? 521 LYS A CE  1 
ATOM   3881  N NZ  . LYS A 1 495 ? -10.054 39.880  -45.521 1.00 68.26  ? 521 LYS A NZ  1 
ATOM   3882  N N   . GLY A 1 496 ? -12.894 35.174  -44.163 1.00 67.57  ? 522 GLY A N   1 
ATOM   3883  C CA  . GLY A 1 496 ? -14.325 35.198  -44.398 1.00 67.05  ? 522 GLY A CA  1 
ATOM   3884  C C   . GLY A 1 496 ? -15.193 35.582  -43.212 1.00 66.72  ? 522 GLY A C   1 
ATOM   3885  O O   . GLY A 1 496 ? -14.764 36.285  -42.293 1.00 66.38  ? 522 GLY A O   1 
ATOM   3886  N N   . GLY A 1 497 ? -16.434 35.109  -43.248 1.00 66.59  ? 523 GLY A N   1 
ATOM   3887  C CA  . GLY A 1 497 ? -17.384 35.404  -42.196 1.00 65.14  ? 523 GLY A CA  1 
ATOM   3888  C C   . GLY A 1 497 ? -17.424 34.360  -41.103 1.00 64.14  ? 523 GLY A C   1 
ATOM   3889  O O   . GLY A 1 497 ? -16.443 33.667  -40.860 1.00 65.14  ? 523 GLY A O   1 
ATOM   3890  N N   . THR A 1 498 ? -18.578 34.246  -40.457 1.00 63.46  ? 524 THR A N   1 
ATOM   3891  C CA  . THR A 1 498 ? -18.786 33.315  -39.353 1.00 63.83  ? 524 THR A CA  1 
ATOM   3892  C C   . THR A 1 498 ? -18.781 31.838  -39.736 1.00 63.16  ? 524 THR A C   1 
ATOM   3893  O O   . THR A 1 498 ? -18.526 31.484  -40.878 1.00 63.45  ? 524 THR A O   1 
ATOM   3894  C CB  . THR A 1 498 ? -20.118 33.618  -38.642 1.00 63.62  ? 524 THR A CB  1 
ATOM   3895  O OG1 . THR A 1 498 ? -20.249 32.780  -37.487 1.00 63.33  ? 524 THR A OG1 1 
ATOM   3896  C CG2 . THR A 1 498 ? -21.285 33.361  -39.580 1.00 63.28  ? 524 THR A CG2 1 
ATOM   3897  N N   . SER A 1 499 ? -19.068 30.988  -38.754 1.00 63.39  ? 525 SER A N   1 
ATOM   3898  C CA  . SER A 1 499 ? -19.117 29.543  -38.937 1.00 64.46  ? 525 SER A CA  1 
ATOM   3899  C C   . SER A 1 499 ? -20.157 28.952  -37.989 1.00 66.34  ? 525 SER A C   1 
ATOM   3900  O O   . SER A 1 499 ? -20.228 27.739  -37.807 1.00 65.45  ? 525 SER A O   1 
ATOM   3901  C CB  . SER A 1 499 ? -17.756 28.918  -38.625 1.00 63.82  ? 525 SER A CB  1 
ATOM   3902  O OG  . SER A 1 499 ? -17.467 28.975  -37.237 1.00 60.30  ? 525 SER A OG  1 
ATOM   3903  N N   . ARG A 1 500 ? -20.955 29.823  -37.381 1.00 69.47  ? 526 ARG A N   1 
ATOM   3904  C CA  . ARG A 1 500 ? -21.987 29.406  -36.438 1.00 72.74  ? 526 ARG A CA  1 
ATOM   3905  C C   . ARG A 1 500 ? -23.187 28.791  -37.161 1.00 76.77  ? 526 ARG A C   1 
ATOM   3906  O O   . ARG A 1 500 ? -23.028 28.158  -38.205 1.00 77.61  ? 526 ARG A O   1 
ATOM   3907  C CB  . ARG A 1 500 ? -22.432 30.613  -35.604 1.00 69.73  ? 526 ARG A CB  1 
ATOM   3908  C CG  . ARG A 1 500 ? -23.107 31.715  -36.407 1.00 66.26  ? 526 ARG A CG  1 
ATOM   3909  C CD  . ARG A 1 500 ? -23.123 33.015  -35.636 1.00 65.27  ? 526 ARG A CD  1 
ATOM   3910  N NE  . ARG A 1 500 ? -21.778 33.571  -35.505 1.00 65.50  ? 526 ARG A NE  1 
ATOM   3911  C CZ  . ARG A 1 500 ? -21.465 34.607  -34.736 1.00 64.38  ? 526 ARG A CZ  1 
ATOM   3912  N NH1 . ARG A 1 500 ? -22.401 35.209  -34.014 1.00 65.35  ? 526 ARG A NH1 1 
ATOM   3913  N NH2 . ARG A 1 500 ? -20.214 35.046  -34.693 1.00 62.52  ? 526 ARG A NH2 1 
ATOM   3914  N N   . GLU A 1 501 ? -24.377 28.980  -36.594 1.00 81.45  ? 527 GLU A N   1 
ATOM   3915  C CA  . GLU A 1 501 ? -25.621 28.460  -37.162 1.00 86.48  ? 527 GLU A CA  1 
ATOM   3916  C C   . GLU A 1 501 ? -25.532 28.256  -38.674 1.00 89.33  ? 527 GLU A C   1 
ATOM   3917  O O   . GLU A 1 501 ? -25.791 27.162  -39.180 1.00 89.81  ? 527 GLU A O   1 
ATOM   3918  C CB  . GLU A 1 501 ? -26.782 29.411  -36.839 1.00 88.68  ? 527 GLU A CB  1 
ATOM   3919  C CG  . GLU A 1 501 ? -26.561 30.854  -37.297 1.00 92.16  ? 527 GLU A CG  1 
ATOM   3920  C CD  . GLU A 1 501 ? -27.781 31.744  -37.093 1.00 94.06  ? 527 GLU A CD  1 
ATOM   3921  O OE1 . GLU A 1 501 ? -28.249 31.869  -35.940 1.00 94.31  ? 527 GLU A OE1 1 
ATOM   3922  O OE2 . GLU A 1 501 ? -28.267 32.323  -38.090 1.00 94.35  ? 527 GLU A OE2 1 
ATOM   3923  N N   . GLY A 1 502 ? -25.159 29.315  -39.387 1.00 92.00  ? 528 GLY A N   1 
ATOM   3924  C CA  . GLY A 1 502 ? -25.041 29.236  -40.832 1.00 94.56  ? 528 GLY A CA  1 
ATOM   3925  C C   . GLY A 1 502 ? -24.397 30.472  -41.435 1.00 96.42  ? 528 GLY A C   1 
ATOM   3926  O O   . GLY A 1 502 ? -24.972 31.563  -41.398 1.00 96.34  ? 528 GLY A O   1 
ATOM   3927  N N   . GLY A 1 503 ? -23.198 30.301  -41.988 1.00 97.62  ? 529 GLY A N   1 
ATOM   3928  C CA  . GLY A 1 503 ? -22.495 31.413  -42.603 1.00 98.78  ? 529 GLY A CA  1 
ATOM   3929  C C   . GLY A 1 503 ? -22.746 31.439  -44.097 1.00 99.55  ? 529 GLY A C   1 
ATOM   3930  O O   . GLY A 1 503 ? -23.102 32.473  -44.662 1.00 99.96  ? 529 GLY A O   1 
ATOM   3931  N N   . GLN A 1 504 ? -22.561 30.286  -44.733 1.00 100.41 ? 530 GLN A N   1 
ATOM   3932  C CA  . GLN A 1 504 ? -22.773 30.136  -46.170 1.00 100.41 ? 530 GLN A CA  1 
ATOM   3933  C C   . GLN A 1 504 ? -21.839 31.011  -47.002 1.00 100.41 ? 530 GLN A C   1 
ATOM   3934  O O   . GLN A 1 504 ? -21.731 30.839  -48.219 1.00 100.41 ? 530 GLN A O   1 
ATOM   3935  C CB  . GLN A 1 504 ? -24.239 30.436  -46.515 1.00 100.18 ? 530 GLN A CB  1 
ATOM   3936  C CG  . GLN A 1 504 ? -25.220 29.451  -45.880 1.00 100.41 ? 530 GLN A CG  1 
ATOM   3937  C CD  . GLN A 1 504 ? -26.666 29.705  -46.274 1.00 100.41 ? 530 GLN A CD  1 
ATOM   3938  O OE1 . GLN A 1 504 ? -27.010 29.712  -47.457 1.00 99.96  ? 530 GLN A OE1 1 
ATOM   3939  N NE2 . GLN A 1 504 ? -27.524 29.908  -45.277 1.00 100.41 ? 530 GLN A NE2 1 
ATOM   3940  N N   . THR A 1 505 ? -21.160 31.942  -46.337 1.00 100.41 ? 531 THR A N   1 
ATOM   3941  C CA  . THR A 1 505 ? -20.224 32.838  -47.006 1.00 100.41 ? 531 THR A CA  1 
ATOM   3942  C C   . THR A 1 505 ? -18.801 32.354  -46.758 1.00 100.41 ? 531 THR A C   1 
ATOM   3943  O O   . THR A 1 505 ? -18.373 32.221  -45.608 1.00 99.81  ? 531 THR A O   1 
ATOM   3944  C CB  . THR A 1 505 ? -20.350 34.290  -46.483 1.00 100.41 ? 531 THR A CB  1 
ATOM   3945  O OG1 . THR A 1 505 ? -21.682 34.771  -46.712 1.00 100.41 ? 531 THR A OG1 1 
ATOM   3946  C CG2 . THR A 1 505 ? -19.355 35.205  -47.194 1.00 100.18 ? 531 THR A CG2 1 
ATOM   3947  N N   . ALA A 1 506 ? -18.080 32.080  -47.842 1.00 100.41 ? 532 ALA A N   1 
ATOM   3948  C CA  . ALA A 1 506 ? -16.699 31.616  -47.752 1.00 100.41 ? 532 ALA A CA  1 
ATOM   3949  C C   . ALA A 1 506 ? -16.081 31.344  -49.129 1.00 100.41 ? 532 ALA A C   1 
ATOM   3950  O O   . ALA A 1 506 ? -15.119 32.005  -49.523 1.00 100.41 ? 532 ALA A O   1 
ATOM   3951  C CB  . ALA A 1 506 ? -16.615 30.357  -46.870 1.00 99.94  ? 532 ALA A CB  1 
ATOM   3952  N N   . PRO A 1 507 ? -16.634 30.378  -49.884 1.00 100.41 ? 533 PRO A N   1 
ATOM   3953  C CA  . PRO A 1 507 ? -16.091 30.061  -51.210 1.00 100.29 ? 533 PRO A CA  1 
ATOM   3954  C C   . PRO A 1 507 ? -16.233 31.171  -52.254 1.00 99.88  ? 533 PRO A C   1 
ATOM   3955  O O   . PRO A 1 507 ? -16.990 31.031  -53.216 1.00 100.41 ? 533 PRO A O   1 
ATOM   3956  C CB  . PRO A 1 507 ? -16.858 28.800  -51.596 1.00 100.41 ? 533 PRO A CB  1 
ATOM   3957  C CG  . PRO A 1 507 ? -18.196 29.038  -50.976 1.00 100.41 ? 533 PRO A CG  1 
ATOM   3958  C CD  . PRO A 1 507 ? -17.825 29.553  -49.602 1.00 100.41 ? 533 PRO A CD  1 
ATOM   3959  N N   . ALA A 1 508 ? -15.496 32.264  -52.069 1.00 98.86  ? 534 ALA A N   1 
ATOM   3960  C CA  . ALA A 1 508 ? -15.543 33.383  -53.005 1.00 97.49  ? 534 ALA A CA  1 
ATOM   3961  C C   . ALA A 1 508 ? -14.993 32.954  -54.365 1.00 96.70  ? 534 ALA A C   1 
ATOM   3962  O O   . ALA A 1 508 ? -14.995 31.767  -54.700 1.00 96.47  ? 534 ALA A O   1 
ATOM   3963  C CB  . ALA A 1 508 ? -14.740 34.561  -52.459 1.00 96.60  ? 534 ALA A CB  1 
ATOM   3964  N N   . SER A 1 509 ? -14.520 33.922  -55.144 1.00 95.30  ? 535 SER A N   1 
ATOM   3965  C CA  . SER A 1 509 ? -13.975 33.639  -56.469 1.00 92.70  ? 535 SER A CA  1 
ATOM   3966  C C   . SER A 1 509 ? -12.459 33.446  -56.447 1.00 90.43  ? 535 SER A C   1 
ATOM   3967  O O   . SER A 1 509 ? -11.958 32.366  -56.769 1.00 89.12  ? 535 SER A O   1 
ATOM   3968  C CB  . SER A 1 509 ? -14.339 34.770  -57.435 1.00 93.38  ? 535 SER A CB  1 
ATOM   3969  O OG  . SER A 1 509 ? -13.875 36.021  -56.956 1.00 94.51  ? 535 SER A OG  1 
ATOM   3970  N N   . THR A 1 510 ? -11.736 34.497  -56.063 1.00 88.23  ? 536 THR A N   1 
ATOM   3971  C CA  . THR A 1 510 ? -10.278 34.456  -56.004 1.00 85.24  ? 536 THR A CA  1 
ATOM   3972  C C   . THR A 1 510 ? -9.769  34.709  -54.587 1.00 83.27  ? 536 THR A C   1 
ATOM   3973  O O   . THR A 1 510 ? -9.808  35.835  -54.095 1.00 83.22  ? 536 THR A O   1 
ATOM   3974  C CB  . THR A 1 510 ? -9.663  35.512  -56.932 1.00 85.21  ? 536 THR A CB  1 
ATOM   3975  O OG1 . THR A 1 510 ? -10.312 35.460  -58.208 1.00 85.14  ? 536 THR A OG1 1 
ATOM   3976  C CG2 . THR A 1 510 ? -8.177  35.249  -57.120 1.00 85.36  ? 536 THR A CG2 1 
ATOM   3977  N N   . ARG A 1 511 ? -9.282  33.655  -53.942 1.00 81.37  ? 537 ARG A N   1 
ATOM   3978  C CA  . ARG A 1 511 ? -8.774  33.751  -52.577 1.00 78.89  ? 537 ARG A CA  1 
ATOM   3979  C C   . ARG A 1 511 ? -7.290  33.388  -52.522 1.00 76.63  ? 537 ARG A C   1 
ATOM   3980  O O   . ARG A 1 511 ? -6.850  32.443  -53.179 1.00 76.08  ? 537 ARG A O   1 
ATOM   3981  C CB  . ARG A 1 511 ? -9.553  32.798  -51.667 1.00 79.02  ? 537 ARG A CB  1 
ATOM   3982  C CG  . ARG A 1 511 ? -11.053 32.797  -51.905 1.00 79.36  ? 537 ARG A CG  1 
ATOM   3983  C CD  . ARG A 1 511 ? -11.726 31.634  -51.188 1.00 79.45  ? 537 ARG A CD  1 
ATOM   3984  N NE  . ARG A 1 511 ? -11.675 31.773  -49.735 1.00 79.18  ? 537 ARG A NE  1 
ATOM   3985  C CZ  . ARG A 1 511 ? -12.137 30.866  -48.879 1.00 79.32  ? 537 ARG A CZ  1 
ATOM   3986  N NH1 . ARG A 1 511 ? -12.686 29.745  -49.326 1.00 79.05  ? 537 ARG A NH1 1 
ATOM   3987  N NH2 . ARG A 1 511 ? -12.053 31.080  -47.573 1.00 79.12  ? 537 ARG A NH2 1 
ATOM   3988  N N   . LEU A 1 512 ? -6.519  34.134  -51.736 1.00 73.40  ? 538 LEU A N   1 
ATOM   3989  C CA  . LEU A 1 512 ? -5.098  33.846  -51.605 1.00 70.39  ? 538 LEU A CA  1 
ATOM   3990  C C   . LEU A 1 512 ? -4.778  33.435  -50.168 1.00 68.69  ? 538 LEU A C   1 
ATOM   3991  O O   . LEU A 1 512 ? -5.244  34.063  -49.215 1.00 66.77  ? 538 LEU A O   1 
ATOM   3992  C CB  . LEU A 1 512 ? -4.254  35.067  -51.983 1.00 69.42  ? 538 LEU A CB  1 
ATOM   3993  C CG  . LEU A 1 512 ? -2.962  34.808  -52.777 1.00 68.71  ? 538 LEU A CG  1 
ATOM   3994  C CD1 . LEU A 1 512 ? -2.016  35.972  -52.552 1.00 68.27  ? 538 LEU A CD1 1 
ATOM   3995  C CD2 . LEU A 1 512 ? -2.290  33.511  -52.347 1.00 66.37  ? 538 LEU A CD2 1 
ATOM   3996  N N   . PHE A 1 513 ? -3.987  32.371  -50.030 1.00 67.12  ? 539 PHE A N   1 
ATOM   3997  C CA  . PHE A 1 513 ? -3.574  31.863  -48.726 1.00 65.36  ? 539 PHE A CA  1 
ATOM   3998  C C   . PHE A 1 513 ? -2.061  31.889  -48.540 1.00 63.28  ? 539 PHE A C   1 
ATOM   3999  O O   . PHE A 1 513 ? -1.314  31.309  -49.330 1.00 62.58  ? 539 PHE A O   1 
ATOM   4000  C CB  . PHE A 1 513 ? -4.074  30.432  -48.515 1.00 65.96  ? 539 PHE A CB  1 
ATOM   4001  C CG  . PHE A 1 513 ? -5.527  30.348  -48.170 1.00 68.36  ? 539 PHE A CG  1 
ATOM   4002  C CD1 . PHE A 1 513 ? -6.500  30.532  -49.144 1.00 68.78  ? 539 PHE A CD1 1 
ATOM   4003  C CD2 . PHE A 1 513 ? -5.926  30.110  -46.859 1.00 68.81  ? 539 PHE A CD2 1 
ATOM   4004  C CE1 . PHE A 1 513 ? -7.853  30.481  -48.818 1.00 69.70  ? 539 PHE A CE1 1 
ATOM   4005  C CE2 . PHE A 1 513 ? -7.276  30.058  -46.522 1.00 69.85  ? 539 PHE A CE2 1 
ATOM   4006  C CZ  . PHE A 1 513 ? -8.243  30.244  -47.505 1.00 68.90  ? 539 PHE A CZ  1 
ATOM   4007  N N   . GLN A 1 514 ? -1.622  32.569  -47.485 1.00 61.14  ? 540 GLN A N   1 
ATOM   4008  C CA  . GLN A 1 514 ? -0.206  32.670  -47.156 1.00 57.96  ? 540 GLN A CA  1 
ATOM   4009  C C   . GLN A 1 514 ? 0.111   31.636  -46.079 1.00 56.37  ? 540 GLN A C   1 
ATOM   4010  O O   . GLN A 1 514 ? -0.512  31.618  -45.019 1.00 54.75  ? 540 GLN A O   1 
ATOM   4011  C CB  . GLN A 1 514 ? 0.117   34.069  -46.641 1.00 57.08  ? 540 GLN A CB  1 
ATOM   4012  C CG  . GLN A 1 514 ? 1.585   34.282  -46.353 1.00 58.18  ? 540 GLN A CG  1 
ATOM   4013  C CD  . GLN A 1 514 ? 1.876   35.647  -45.764 1.00 57.91  ? 540 GLN A CD  1 
ATOM   4014  O OE1 . GLN A 1 514 ? 1.539   36.680  -46.348 1.00 58.91  ? 540 GLN A OE1 1 
ATOM   4015  N NE2 . GLN A 1 514 ? 2.511   35.658  -44.602 1.00 57.59  ? 540 GLN A NE2 1 
ATOM   4016  N N   . VAL A 1 515 ? 1.074   30.767  -46.359 1.00 55.53  ? 541 VAL A N   1 
ATOM   4017  C CA  . VAL A 1 515 ? 1.450   29.732  -45.411 1.00 54.33  ? 541 VAL A CA  1 
ATOM   4018  C C   . VAL A 1 515 ? 2.815   30.050  -44.815 1.00 56.13  ? 541 VAL A C   1 
ATOM   4019  O O   . VAL A 1 515 ? 3.840   29.938  -45.482 1.00 56.73  ? 541 VAL A O   1 
ATOM   4020  C CB  . VAL A 1 515 ? 1.493   28.357  -46.093 1.00 50.66  ? 541 VAL A CB  1 
ATOM   4021  C CG1 . VAL A 1 515 ? 1.570   27.259  -45.053 1.00 48.34  ? 541 VAL A CG1 1 
ATOM   4022  C CG2 . VAL A 1 515 ? 0.266   28.181  -46.958 1.00 49.48  ? 541 VAL A CG2 1 
ATOM   4023  N N   . ARG A 1 516 ? 2.811   30.452  -43.549 1.00 57.66  ? 542 ARG A N   1 
ATOM   4024  C CA  . ARG A 1 516 ? 4.029   30.809  -42.834 1.00 58.33  ? 542 ARG A CA  1 
ATOM   4025  C C   . ARG A 1 516 ? 4.349   29.716  -41.814 1.00 56.29  ? 542 ARG A C   1 
ATOM   4026  O O   . ARG A 1 516 ? 3.442   29.165  -41.186 1.00 55.96  ? 542 ARG A O   1 
ATOM   4027  C CB  . ARG A 1 516 ? 3.818   32.166  -42.142 1.00 62.26  ? 542 ARG A CB  1 
ATOM   4028  C CG  . ARG A 1 516 ? 5.040   32.774  -41.465 1.00 67.84  ? 542 ARG A CG  1 
ATOM   4029  C CD  . ARG A 1 516 ? 4.779   34.237  -41.113 1.00 70.87  ? 542 ARG A CD  1 
ATOM   4030  N NE  . ARG A 1 516 ? 5.817   34.809  -40.258 1.00 75.55  ? 542 ARG A NE  1 
ATOM   4031  C CZ  . ARG A 1 516 ? 5.936   36.109  -39.993 1.00 78.78  ? 542 ARG A CZ  1 
ATOM   4032  N NH1 . ARG A 1 516 ? 5.081   36.975  -40.523 1.00 78.88  ? 542 ARG A NH1 1 
ATOM   4033  N NH2 . ARG A 1 516 ? 6.908   36.545  -39.197 1.00 79.79  ? 542 ARG A NH2 1 
ATOM   4034  N N   . ALA A 1 517 ? 5.632   29.393  -41.665 1.00 53.39  ? 543 ALA A N   1 
ATOM   4035  C CA  . ALA A 1 517 ? 6.054   28.364  -40.719 1.00 50.82  ? 543 ALA A CA  1 
ATOM   4036  C C   . ALA A 1 517 ? 6.809   28.977  -39.550 1.00 50.17  ? 543 ALA A C   1 
ATOM   4037  O O   . ALA A 1 517 ? 7.331   30.081  -39.650 1.00 49.10  ? 543 ALA A O   1 
ATOM   4038  C CB  . ALA A 1 517 ? 6.924   27.334  -41.417 1.00 49.05  ? 543 ALA A CB  1 
ATOM   4039  N N   . SER A 1 518 ? 6.865   28.253  -38.438 1.00 51.19  ? 544 SER A N   1 
ATOM   4040  C CA  . SER A 1 518 ? 7.554   28.740  -37.249 1.00 52.37  ? 544 SER A CA  1 
ATOM   4041  C C   . SER A 1 518 ? 8.758   27.874  -36.900 1.00 53.63  ? 544 SER A C   1 
ATOM   4042  O O   . SER A 1 518 ? 8.927   26.775  -37.436 1.00 52.66  ? 544 SER A O   1 
ATOM   4043  C CB  . SER A 1 518 ? 6.597   28.764  -36.056 1.00 52.36  ? 544 SER A CB  1 
ATOM   4044  O OG  . SER A 1 518 ? 6.219   27.449  -35.685 1.00 50.44  ? 544 SER A OG  1 
ATOM   4045  N N   . SER A 1 519 ? 9.579   28.380  -35.983 1.00 54.62  ? 545 SER A N   1 
ATOM   4046  C CA  . SER A 1 519 ? 10.780  27.688  -35.531 1.00 54.14  ? 545 SER A CA  1 
ATOM   4047  C C   . SER A 1 519 ? 10.498  26.249  -35.131 1.00 54.57  ? 545 SER A C   1 
ATOM   4048  O O   . SER A 1 519 ? 11.361  25.388  -35.274 1.00 55.87  ? 545 SER A O   1 
ATOM   4049  C CB  . SER A 1 519 ? 11.392  28.418  -34.337 1.00 54.46  ? 545 SER A CB  1 
ATOM   4050  O OG  . SER A 1 519 ? 11.640  29.779  -34.635 1.00 56.50  ? 545 SER A OG  1 
ATOM   4051  N N   . SER A 1 520 ? 9.295   25.987  -34.626 1.00 54.09  ? 546 SER A N   1 
ATOM   4052  C CA  . SER A 1 520 ? 8.938   24.638  -34.198 1.00 54.25  ? 546 SER A CA  1 
ATOM   4053  C C   . SER A 1 520 ? 8.307   23.790  -35.298 1.00 53.48  ? 546 SER A C   1 
ATOM   4054  O O   . SER A 1 520 ? 7.731   22.737  -35.028 1.00 53.99  ? 546 SER A O   1 
ATOM   4055  C CB  . SER A 1 520 ? 8.005   24.699  -32.981 1.00 54.16  ? 546 SER A CB  1 
ATOM   4056  O OG  . SER A 1 520 ? 6.901   25.554  -33.213 1.00 55.31  ? 546 SER A OG  1 
ATOM   4057  N N   . GLY A 1 521 ? 8.422   24.246  -36.539 1.00 53.31  ? 547 GLY A N   1 
ATOM   4058  C CA  . GLY A 1 521 ? 7.858   23.499  -37.646 1.00 53.63  ? 547 GLY A CA  1 
ATOM   4059  C C   . GLY A 1 521 ? 6.361   23.682  -37.798 1.00 54.49  ? 547 GLY A C   1 
ATOM   4060  O O   . GLY A 1 521 ? 5.756   23.155  -38.733 1.00 55.68  ? 547 GLY A O   1 
ATOM   4061  N N   . ALA A 1 522 ? 5.756   24.428  -36.880 1.00 54.00  ? 548 ALA A N   1 
ATOM   4062  C CA  . ALA A 1 522 ? 4.320   24.675  -36.934 1.00 53.80  ? 548 ALA A CA  1 
ATOM   4063  C C   . ALA A 1 522 ? 3.999   25.573  -38.123 1.00 52.69  ? 548 ALA A C   1 
ATOM   4064  O O   . ALA A 1 522 ? 4.827   26.384  -38.539 1.00 53.09  ? 548 ALA A O   1 
ATOM   4065  C CB  . ALA A 1 522 ? 3.852   25.329  -35.639 1.00 54.84  ? 548 ALA A CB  1 
ATOM   4066  N N   . THR A 1 523 ? 2.801   25.425  -38.675 1.00 51.47  ? 549 THR A N   1 
ATOM   4067  C CA  . THR A 1 523 ? 2.406   26.246  -39.813 1.00 52.27  ? 549 THR A CA  1 
ATOM   4068  C C   . THR A 1 523 ? 0.988   26.768  -39.678 1.00 50.33  ? 549 THR A C   1 
ATOM   4069  O O   . THR A 1 523 ? 0.184   26.226  -38.920 1.00 47.57  ? 549 THR A O   1 
ATOM   4070  C CB  . THR A 1 523 ? 2.495   25.462  -41.148 1.00 54.95  ? 549 THR A CB  1 
ATOM   4071  O OG1 . THR A 1 523 ? 1.642   24.309  -41.092 1.00 55.55  ? 549 THR A OG1 1 
ATOM   4072  C CG2 . THR A 1 523 ? 3.931   25.023  -41.415 1.00 58.20  ? 549 THR A CG2 1 
ATOM   4073  N N   . ARG A 1 524 ? 0.693   27.832  -40.413 1.00 49.68  ? 550 ARG A N   1 
ATOM   4074  C CA  . ARG A 1 524 ? -0.639  28.411  -40.408 1.00 51.25  ? 550 ARG A CA  1 
ATOM   4075  C C   . ARG A 1 524 ? -0.952  28.998  -41.778 1.00 50.91  ? 550 ARG A C   1 
ATOM   4076  O O   . ARG A 1 524 ? -0.129  29.693  -42.372 1.00 50.02  ? 550 ARG A O   1 
ATOM   4077  C CB  . ARG A 1 524 ? -0.767  29.487  -39.319 1.00 53.33  ? 550 ARG A CB  1 
ATOM   4078  C CG  . ARG A 1 524 ? 0.103   30.736  -39.488 1.00 58.11  ? 550 ARG A CG  1 
ATOM   4079  C CD  . ARG A 1 524 ? 0.075   31.560  -38.196 1.00 63.35  ? 550 ARG A CD  1 
ATOM   4080  N NE  . ARG A 1 524 ? 0.967   32.721  -38.186 1.00 64.76  ? 550 ARG A NE  1 
ATOM   4081  C CZ  . ARG A 1 524 ? 0.826   33.779  -38.978 1.00 67.00  ? 550 ARG A CZ  1 
ATOM   4082  N NH1 . ARG A 1 524 ? -0.170  33.824  -39.853 1.00 68.16  ? 550 ARG A NH1 1 
ATOM   4083  N NH2 . ARG A 1 524 ? 1.667   34.801  -38.879 1.00 67.20  ? 550 ARG A NH2 1 
ATOM   4084  N N   . ALA A 1 525 ? -2.138  28.686  -42.288 1.00 50.91  ? 551 ALA A N   1 
ATOM   4085  C CA  . ALA A 1 525 ? -2.571  29.191  -43.581 1.00 51.21  ? 551 ALA A CA  1 
ATOM   4086  C C   . ALA A 1 525 ? -3.529  30.346  -43.330 1.00 51.73  ? 551 ALA A C   1 
ATOM   4087  O O   . ALA A 1 525 ? -4.614  30.157  -42.774 1.00 50.77  ? 551 ALA A O   1 
ATOM   4088  C CB  . ALA A 1 525 ? -3.263  28.091  -44.367 1.00 51.36  ? 551 ALA A CB  1 
ATOM   4089  N N   . VAL A 1 526 ? -3.118  31.543  -43.736 1.00 52.48  ? 552 VAL A N   1 
ATOM   4090  C CA  . VAL A 1 526 ? -3.927  32.736  -43.544 1.00 54.43  ? 552 VAL A CA  1 
ATOM   4091  C C   . VAL A 1 526 ? -4.366  33.328  -44.877 1.00 56.66  ? 552 VAL A C   1 
ATOM   4092  O O   . VAL A 1 526 ? -3.574  33.433  -45.812 1.00 57.05  ? 552 VAL A O   1 
ATOM   4093  C CB  . VAL A 1 526 ? -3.145  33.817  -42.754 1.00 53.74  ? 552 VAL A CB  1 
ATOM   4094  C CG1 . VAL A 1 526 ? -4.075  34.968  -42.379 1.00 51.55  ? 552 VAL A CG1 1 
ATOM   4095  C CG2 . VAL A 1 526 ? -2.526  33.206  -41.512 1.00 52.44  ? 552 VAL A CG2 1 
ATOM   4096  N N   . GLU A 1 527 ? -5.632  33.722  -44.954 1.00 58.87  ? 553 GLU A N   1 
ATOM   4097  C CA  . GLU A 1 527 ? -6.174  34.305  -46.169 1.00 62.72  ? 553 GLU A CA  1 
ATOM   4098  C C   . GLU A 1 527 ? -6.015  35.825  -46.158 1.00 65.50  ? 553 GLU A C   1 
ATOM   4099  O O   . GLU A 1 527 ? -6.292  36.479  -45.152 1.00 66.49  ? 553 GLU A O   1 
ATOM   4100  C CB  . GLU A 1 527 ? -7.650  33.931  -46.303 1.00 62.57  ? 553 GLU A CB  1 
ATOM   4101  C CG  . GLU A 1 527 ? -8.285  34.397  -47.600 1.00 64.29  ? 553 GLU A CG  1 
ATOM   4102  C CD  . GLU A 1 527 ? -9.737  33.990  -47.719 1.00 63.80  ? 553 GLU A CD  1 
ATOM   4103  O OE1 . GLU A 1 527 ? -10.361 34.320  -48.751 1.00 63.12  ? 553 GLU A OE1 1 
ATOM   4104  O OE2 . GLU A 1 527 ? -10.253 33.341  -46.784 1.00 64.55  ? 553 GLU A OE2 1 
ATOM   4105  N N   . ILE A 1 528 ? -5.571  36.382  -47.280 1.00 68.50  ? 554 ILE A N   1 
ATOM   4106  C CA  . ILE A 1 528 ? -5.375  37.825  -47.396 1.00 71.80  ? 554 ILE A CA  1 
ATOM   4107  C C   . ILE A 1 528 ? -6.028  38.358  -48.666 1.00 73.78  ? 554 ILE A C   1 
ATOM   4108  O O   . ILE A 1 528 ? -6.826  37.658  -49.294 1.00 74.09  ? 554 ILE A O   1 
ATOM   4109  C CB  . ILE A 1 528 ? -3.876  38.171  -47.418 1.00 72.00  ? 554 ILE A CB  1 
ATOM   4110  C CG1 . ILE A 1 528 ? -3.179  37.379  -48.530 1.00 72.53  ? 554 ILE A CG1 1 
ATOM   4111  C CG2 . ILE A 1 528 ? -3.259  37.858  -46.064 1.00 72.36  ? 554 ILE A CG2 1 
ATOM   4112  C CD1 . ILE A 1 528 ? -1.679  37.587  -48.610 1.00 73.45  ? 554 ILE A CD1 1 
ATOM   4113  N N   . ILE A 1 529 ? -5.694  39.592  -49.041 1.00 75.66  ? 555 ILE A N   1 
ATOM   4114  C CA  . ILE A 1 529 ? -6.257  40.203  -50.245 1.00 77.12  ? 555 ILE A CA  1 
ATOM   4115  C C   . ILE A 1 529 ? -5.408  39.853  -51.468 1.00 78.19  ? 555 ILE A C   1 
ATOM   4116  O O   . ILE A 1 529 ? -4.235  40.224  -51.549 1.00 77.87  ? 555 ILE A O   1 
ATOM   4117  C CB  . ILE A 1 529 ? -6.337  41.743  -50.120 1.00 78.26  ? 555 ILE A CB  1 
ATOM   4118  C CG1 . ILE A 1 529 ? -7.166  42.131  -48.890 1.00 77.31  ? 555 ILE A CG1 1 
ATOM   4119  C CG2 . ILE A 1 529 ? -6.948  42.338  -51.391 1.00 77.30  ? 555 ILE A CG2 1 
ATOM   4120  C CD1 . ILE A 1 529 ? -8.605  41.670  -48.941 1.00 78.53  ? 555 ILE A CD1 1 
ATOM   4121  N N   . PRO A 1 530 ? -6.001  39.140  -52.440 1.00 79.10  ? 556 PRO A N   1 
ATOM   4122  C CA  . PRO A 1 530 ? -5.338  38.712  -53.675 1.00 79.62  ? 556 PRO A CA  1 
ATOM   4123  C C   . PRO A 1 530 ? -4.613  39.825  -54.424 1.00 80.67  ? 556 PRO A C   1 
ATOM   4124  O O   . PRO A 1 530 ? -5.233  40.600  -55.152 1.00 80.83  ? 556 PRO A O   1 
ATOM   4125  C CB  . PRO A 1 530 ? -6.483  38.127  -54.494 1.00 79.55  ? 556 PRO A CB  1 
ATOM   4126  C CG  . PRO A 1 530 ? -7.400  37.592  -53.446 1.00 79.60  ? 556 PRO A CG  1 
ATOM   4127  C CD  . PRO A 1 530 ? -7.410  38.710  -52.437 1.00 79.47  ? 556 PRO A CD  1 
ATOM   4128  N N   . LYS A 1 531 ? -3.298  39.894  -54.237 1.00 81.55  ? 557 LYS A N   1 
ATOM   4129  C CA  . LYS A 1 531 ? -2.469  40.892  -54.901 1.00 81.95  ? 557 LYS A CA  1 
ATOM   4130  C C   . LYS A 1 531 ? -1.017  40.438  -54.987 1.00 81.78  ? 557 LYS A C   1 
ATOM   4131  O O   . LYS A 1 531 ? -0.459  39.924  -54.018 1.00 82.00  ? 557 LYS A O   1 
ATOM   4132  C CB  . LYS A 1 531 ? -2.524  42.235  -54.165 1.00 83.25  ? 557 LYS A CB  1 
ATOM   4133  C CG  . LYS A 1 531 ? -3.822  43.004  -54.334 1.00 85.08  ? 557 LYS A CG  1 
ATOM   4134  C CD  . LYS A 1 531 ? -3.633  44.483  -54.003 1.00 86.98  ? 557 LYS A CD  1 
ATOM   4135  C CE  . LYS A 1 531 ? -3.127  44.696  -52.581 1.00 86.82  ? 557 LYS A CE  1 
ATOM   4136  N NZ  . LYS A 1 531 ? -2.938  46.145  -52.279 1.00 87.09  ? 557 LYS A NZ  1 
ATOM   4137  N N   . ALA A 1 532 ? -0.410  40.634  -56.154 1.00 81.40  ? 558 ALA A N   1 
ATOM   4138  C CA  . ALA A 1 532 ? 0.979   40.257  -56.367 1.00 80.19  ? 558 ALA A CA  1 
ATOM   4139  C C   . ALA A 1 532 ? 1.848   40.876  -55.281 1.00 79.61  ? 558 ALA A C   1 
ATOM   4140  O O   . ALA A 1 532 ? 2.590   40.173  -54.594 1.00 79.58  ? 558 ALA A O   1 
ATOM   4141  C CB  . ALA A 1 532 ? 1.441   40.728  -57.737 1.00 80.22  ? 558 ALA A CB  1 
ATOM   4142  N N   . GLY A 1 533 ? 1.743   42.193  -55.129 1.00 79.40  ? 559 GLY A N   1 
ATOM   4143  C CA  . GLY A 1 533 ? 2.525   42.900  -54.130 1.00 78.73  ? 559 GLY A CA  1 
ATOM   4144  C C   . GLY A 1 533 ? 2.164   42.540  -52.703 1.00 78.65  ? 559 GLY A C   1 
ATOM   4145  O O   . GLY A 1 533 ? 2.075   43.409  -51.838 1.00 78.95  ? 559 GLY A O   1 
ATOM   4146  N N   . ALA A 1 534 ? 1.959   41.252  -52.454 1.00 78.70  ? 560 ALA A N   1 
ATOM   4147  C CA  . ALA A 1 534 ? 1.607   40.767  -51.126 1.00 78.21  ? 560 ALA A CA  1 
ATOM   4148  C C   . ALA A 1 534 ? 2.220   39.392  -50.908 1.00 77.66  ? 560 ALA A C   1 
ATOM   4149  O O   . ALA A 1 534 ? 1.955   38.732  -49.904 1.00 77.62  ? 560 ALA A O   1 
ATOM   4150  C CB  . ALA A 1 534 ? 0.095   40.691  -50.980 1.00 78.56  ? 560 ALA A CB  1 
ATOM   4151  N N   . LEU A 1 535 ? 3.038   38.965  -51.862 1.00 76.59  ? 561 LEU A N   1 
ATOM   4152  C CA  . LEU A 1 535 ? 3.691   37.671  -51.772 1.00 76.08  ? 561 LEU A CA  1 
ATOM   4153  C C   . LEU A 1 535 ? 4.971   37.823  -50.958 1.00 76.15  ? 561 LEU A C   1 
ATOM   4154  O O   . LEU A 1 535 ? 5.491   38.931  -50.805 1.00 75.40  ? 561 LEU A O   1 
ATOM   4155  C CB  . LEU A 1 535 ? 4.015   37.148  -53.175 1.00 76.13  ? 561 LEU A CB  1 
ATOM   4156  C CG  . LEU A 1 535 ? 2.834   37.021  -54.141 1.00 75.39  ? 561 LEU A CG  1 
ATOM   4157  C CD1 . LEU A 1 535 ? 3.338   36.622  -55.514 1.00 75.44  ? 561 LEU A CD1 1 
ATOM   4158  C CD2 . LEU A 1 535 ? 1.843   35.995  -53.614 1.00 75.01  ? 561 LEU A CD2 1 
ATOM   4159  N N   . ASN A 1 536 ? 5.467   36.710  -50.425 1.00 75.86  ? 562 ASN A N   1 
ATOM   4160  C CA  . ASN A 1 536 ? 6.691   36.725  -49.633 1.00 75.86  ? 562 ASN A CA  1 
ATOM   4161  C C   . ASN A 1 536 ? 7.614   35.591  -50.070 1.00 75.58  ? 562 ASN A C   1 
ATOM   4162  O O   . ASN A 1 536 ? 7.268   34.412  -49.956 1.00 74.93  ? 562 ASN A O   1 
ATOM   4163  C CB  . ASN A 1 536 ? 6.366   36.594  -48.142 1.00 75.86  ? 562 ASN A CB  1 
ATOM   4164  C CG  . ASN A 1 536 ? 7.589   36.786  -47.261 1.00 74.60  ? 562 ASN A CG  1 
ATOM   4165  O OD1 . ASN A 1 536 ? 8.548   36.018  -47.331 1.00 73.71  ? 562 ASN A OD1 1 
ATOM   4166  N ND2 . ASN A 1 536 ? 7.559   37.818  -46.428 1.00 74.00  ? 562 ASN A ND2 1 
ATOM   4167  N N   . SER A 1 537 ? 8.790   35.963  -50.566 1.00 75.20  ? 563 SER A N   1 
ATOM   4168  C CA  . SER A 1 537 ? 9.776   35.002  -51.045 1.00 75.09  ? 563 SER A CA  1 
ATOM   4169  C C   . SER A 1 537 ? 10.039  33.871  -50.051 1.00 75.06  ? 563 SER A C   1 
ATOM   4170  O O   . SER A 1 537 ? 10.396  32.763  -50.452 1.00 75.48  ? 563 SER A O   1 
ATOM   4171  C CB  . SER A 1 537 ? 11.087  35.723  -51.376 1.00 75.58  ? 563 SER A CB  1 
ATOM   4172  O OG  . SER A 1 537 ? 11.942  34.903  -52.153 1.00 75.59  ? 563 SER A OG  1 
ATOM   4173  N N   . ASN A 1 538 ? 9.860   34.148  -48.759 1.00 74.72  ? 564 ASN A N   1 
ATOM   4174  C CA  . ASN A 1 538 ? 10.083  33.137  -47.726 1.00 73.65  ? 564 ASN A CA  1 
ATOM   4175  C C   . ASN A 1 538 ? 8.969   32.096  -47.727 1.00 73.94  ? 564 ASN A C   1 
ATOM   4176  O O   . ASN A 1 538 ? 9.093   31.044  -48.350 1.00 75.45  ? 564 ASN A O   1 
ATOM   4177  C CB  . ASN A 1 538 ? 10.180  33.780  -46.335 1.00 71.62  ? 564 ASN A CB  1 
ATOM   4178  C CG  . ASN A 1 538 ? 11.441  34.617  -46.158 1.00 70.29  ? 564 ASN A CG  1 
ATOM   4179  O OD1 . ASN A 1 538 ? 11.543  35.734  -46.668 1.00 68.95  ? 564 ASN A OD1 1 
ATOM   4180  N ND2 . ASN A 1 538 ? 12.412  34.073  -45.434 1.00 68.40  ? 564 ASN A ND2 1 
ATOM   4181  N N   . ASP A 1 539 ? 7.877   32.390  -47.034 1.00 73.82  ? 565 ASP A N   1 
ATOM   4182  C CA  . ASP A 1 539 ? 6.755   31.459  -46.964 1.00 73.17  ? 565 ASP A CA  1 
ATOM   4183  C C   . ASP A 1 539 ? 6.137   31.136  -48.332 1.00 71.98  ? 565 ASP A C   1 
ATOM   4184  O O   . ASP A 1 539 ? 6.453   31.780  -49.335 1.00 71.70  ? 565 ASP A O   1 
ATOM   4185  C CB  . ASP A 1 539 ? 5.691   32.003  -45.999 1.00 73.09  ? 565 ASP A CB  1 
ATOM   4186  C CG  . ASP A 1 539 ? 5.547   33.513  -46.071 1.00 72.81  ? 565 ASP A CG  1 
ATOM   4187  O OD1 . ASP A 1 539 ? 5.179   34.028  -47.146 1.00 73.23  ? 565 ASP A OD1 1 
ATOM   4188  O OD2 . ASP A 1 539 ? 5.803   34.185  -45.049 1.00 70.95  ? 565 ASP A OD2 1 
ATOM   4189  N N   . ALA A 1 540 ? 5.264   30.128  -48.360 1.00 70.87  ? 566 ALA A N   1 
ATOM   4190  C CA  . ALA A 1 540 ? 4.592   29.684  -49.585 1.00 68.66  ? 566 ALA A CA  1 
ATOM   4191  C C   . ALA A 1 540 ? 3.088   29.967  -49.572 1.00 67.64  ? 566 ALA A C   1 
ATOM   4192  O O   . ALA A 1 540 ? 2.429   29.806  -48.547 1.00 67.56  ? 566 ALA A O   1 
ATOM   4193  C CB  . ALA A 1 540 ? 4.833   28.190  -49.788 1.00 68.35  ? 566 ALA A CB  1 
ATOM   4194  N N   . PHE A 1 541 ? 2.545   30.368  -50.718 1.00 66.23  ? 567 PHE A N   1 
ATOM   4195  C CA  . PHE A 1 541 ? 1.119   30.676  -50.823 1.00 65.47  ? 567 PHE A CA  1 
ATOM   4196  C C   . PHE A 1 541 ? 0.328   29.658  -51.645 1.00 66.51  ? 567 PHE A C   1 
ATOM   4197  O O   . PHE A 1 541 ? 0.899   28.774  -52.280 1.00 66.45  ? 567 PHE A O   1 
ATOM   4198  C CB  . PHE A 1 541 ? 0.919   32.052  -51.451 1.00 63.18  ? 567 PHE A CB  1 
ATOM   4199  C CG  . PHE A 1 541 ? 1.636   33.160  -50.739 1.00 61.85  ? 567 PHE A CG  1 
ATOM   4200  C CD1 . PHE A 1 541 ? 3.019   33.121  -50.568 1.00 60.28  ? 567 PHE A CD1 1 
ATOM   4201  C CD2 . PHE A 1 541 ? 0.932   34.264  -50.268 1.00 60.09  ? 567 PHE A CD2 1 
ATOM   4202  C CE1 . PHE A 1 541 ? 3.690   34.168  -49.939 1.00 60.81  ? 567 PHE A CE1 1 
ATOM   4203  C CE2 . PHE A 1 541 ? 1.593   35.317  -49.638 1.00 60.73  ? 567 PHE A CE2 1 
ATOM   4204  C CZ  . PHE A 1 541 ? 2.976   35.270  -49.473 1.00 59.69  ? 567 PHE A CZ  1 
ATOM   4205  N N   . VAL A 1 542 ? -0.995  29.803  -51.626 1.00 67.08  ? 568 VAL A N   1 
ATOM   4206  C CA  . VAL A 1 542 ? -1.908  28.933  -52.371 1.00 66.47  ? 568 VAL A CA  1 
ATOM   4207  C C   . VAL A 1 542 ? -3.024  29.805  -52.936 1.00 67.75  ? 568 VAL A C   1 
ATOM   4208  O O   . VAL A 1 542 ? -3.819  30.363  -52.187 1.00 67.26  ? 568 VAL A O   1 
ATOM   4209  C CB  . VAL A 1 542 ? -2.538  27.854  -51.465 1.00 64.67  ? 568 VAL A CB  1 
ATOM   4210  C CG1 . VAL A 1 542 ? -3.571  27.066  -52.242 1.00 62.72  ? 568 VAL A CG1 1 
ATOM   4211  C CG2 . VAL A 1 542 ? -1.463  26.929  -50.934 1.00 63.18  ? 568 VAL A CG2 1 
ATOM   4212  N N   . LEU A 1 543 ? -3.080  29.920  -54.259 1.00 70.13  ? 569 LEU A N   1 
ATOM   4213  C CA  . LEU A 1 543 ? -4.089  30.754  -54.909 1.00 72.23  ? 569 LEU A CA  1 
ATOM   4214  C C   . LEU A 1 543 ? -5.258  29.955  -55.467 1.00 74.72  ? 569 LEU A C   1 
ATOM   4215  O O   . LEU A 1 543 ? -5.121  29.250  -56.468 1.00 75.94  ? 569 LEU A O   1 
ATOM   4216  C CB  . LEU A 1 543 ? -3.440  31.583  -56.027 1.00 68.49  ? 569 LEU A CB  1 
ATOM   4217  C CG  . LEU A 1 543 ? -4.296  32.558  -56.841 1.00 65.35  ? 569 LEU A CG  1 
ATOM   4218  C CD1 . LEU A 1 543 ? -5.098  33.464  -55.930 1.00 64.46  ? 569 LEU A CD1 1 
ATOM   4219  C CD2 . LEU A 1 543 ? -3.379  33.382  -57.729 1.00 65.89  ? 569 LEU A CD2 1 
ATOM   4220  N N   . LYS A 1 544 ? -6.405  30.076  -54.803 1.00 77.54  ? 570 LYS A N   1 
ATOM   4221  C CA  . LYS A 1 544 ? -7.633  29.392  -55.200 1.00 80.01  ? 570 LYS A CA  1 
ATOM   4222  C C   . LYS A 1 544 ? -8.286  30.140  -56.349 1.00 82.04  ? 570 LYS A C   1 
ATOM   4223  O O   . LYS A 1 544 ? -8.217  31.365  -56.419 1.00 81.86  ? 570 LYS A O   1 
ATOM   4224  C CB  . LYS A 1 544 ? -8.595  29.324  -54.011 1.00 80.08  ? 570 LYS A CB  1 
ATOM   4225  C CG  . LYS A 1 544 ? -10.059 29.121  -54.371 1.00 79.32  ? 570 LYS A CG  1 
ATOM   4226  C CD  . LYS A 1 544 ? -10.320 27.771  -55.008 1.00 78.64  ? 570 LYS A CD  1 
ATOM   4227  C CE  . LYS A 1 544 ? -11.797 27.625  -55.333 1.00 78.00  ? 570 LYS A CE  1 
ATOM   4228  N NZ  . LYS A 1 544 ? -12.280 28.755  -56.177 1.00 76.67  ? 570 LYS A NZ  1 
ATOM   4229  N N   . THR A 1 545 ? -8.924  29.398  -57.248 1.00 85.63  ? 571 THR A N   1 
ATOM   4230  C CA  . THR A 1 545 ? -9.582  30.000  -58.402 1.00 88.88  ? 571 THR A CA  1 
ATOM   4231  C C   . THR A 1 545 ? -10.512 28.967  -59.046 1.00 91.04  ? 571 THR A C   1 
ATOM   4232  O O   . THR A 1 545 ? -10.356 27.762  -58.831 1.00 90.30  ? 571 THR A O   1 
ATOM   4233  C CB  . THR A 1 545 ? -8.525  30.481  -59.443 1.00 88.49  ? 571 THR A CB  1 
ATOM   4234  O OG1 . THR A 1 545 ? -9.102  31.469  -60.305 1.00 88.04  ? 571 THR A OG1 1 
ATOM   4235  C CG2 . THR A 1 545 ? -8.029  29.314  -60.289 1.00 88.10  ? 571 THR A CG2 1 
ATOM   4236  N N   . PRO A 1 546 ? -11.501 29.427  -59.831 1.00 93.40  ? 572 PRO A N   1 
ATOM   4237  C CA  . PRO A 1 546 ? -12.439 28.515  -60.495 1.00 95.08  ? 572 PRO A CA  1 
ATOM   4238  C C   . PRO A 1 546 ? -11.747 27.632  -61.537 1.00 96.66  ? 572 PRO A C   1 
ATOM   4239  O O   . PRO A 1 546 ? -12.329 26.668  -62.035 1.00 96.59  ? 572 PRO A O   1 
ATOM   4240  C CB  . PRO A 1 546 ? -13.461 29.465  -61.116 1.00 94.70  ? 572 PRO A CB  1 
ATOM   4241  C CG  . PRO A 1 546 ? -12.645 30.692  -61.399 1.00 94.30  ? 572 PRO A CG  1 
ATOM   4242  C CD  . PRO A 1 546 ? -11.843 30.830  -60.131 1.00 93.49  ? 572 PRO A CD  1 
ATOM   4243  N N   . SER A 1 547 ? -10.502 27.973  -61.860 1.00 98.43  ? 573 SER A N   1 
ATOM   4244  C CA  . SER A 1 547 ? -9.716  27.214  -62.829 1.00 99.58  ? 573 SER A CA  1 
ATOM   4245  C C   . SER A 1 547 ? -9.041  26.034  -62.129 1.00 100.02 ? 573 SER A C   1 
ATOM   4246  O O   . SER A 1 547 ? -9.521  24.899  -62.197 1.00 100.41 ? 573 SER A O   1 
ATOM   4247  C CB  . SER A 1 547 ? -8.651  28.112  -63.466 1.00 99.95  ? 573 SER A CB  1 
ATOM   4248  O OG  . SER A 1 547 ? -9.241  29.245  -64.078 1.00 100.41 ? 573 SER A OG  1 
ATOM   4249  N N   . ALA A 1 548 ? -7.928  26.313  -61.454 1.00 99.49  ? 574 ALA A N   1 
ATOM   4250  C CA  . ALA A 1 548 ? -7.185  25.286  -60.729 1.00 98.16  ? 574 ALA A CA  1 
ATOM   4251  C C   . ALA A 1 548 ? -6.448  25.901  -59.545 1.00 96.91  ? 574 ALA A C   1 
ATOM   4252  O O   . ALA A 1 548 ? -6.502  27.113  -59.328 1.00 95.74  ? 574 ALA A O   1 
ATOM   4253  C CB  . ALA A 1 548 ? -6.193  24.596  -61.660 1.00 98.53  ? 574 ALA A CB  1 
ATOM   4254  N N   . ALA A 1 549 ? -5.753  25.062  -58.785 1.00 95.67  ? 575 ALA A N   1 
ATOM   4255  C CA  . ALA A 1 549 ? -5.014  25.532  -57.621 1.00 94.38  ? 575 ALA A CA  1 
ATOM   4256  C C   . ALA A 1 549 ? -3.542  25.807  -57.931 1.00 93.17  ? 575 ALA A C   1 
ATOM   4257  O O   . ALA A 1 549 ? -2.856  24.981  -58.532 1.00 92.95  ? 575 ALA A O   1 
ATOM   4258  C CB  . ALA A 1 549 ? -5.134  24.515  -56.489 1.00 94.82  ? 575 ALA A CB  1 
ATOM   4259  N N   . TYR A 1 550 ? -3.070  26.980  -57.519 1.00 92.13  ? 576 TYR A N   1 
ATOM   4260  C CA  . TYR A 1 550 ? -1.682  27.381  -57.723 1.00 90.34  ? 576 TYR A CA  1 
ATOM   4261  C C   . TYR A 1 550 ? -0.929  27.262  -56.401 1.00 89.05  ? 576 TYR A C   1 
ATOM   4262  O O   . TYR A 1 550 ? -1.103  28.095  -55.512 1.00 88.97  ? 576 TYR A O   1 
ATOM   4263  C CB  . TYR A 1 550 ? -1.607  28.832  -58.203 1.00 91.02  ? 576 TYR A CB  1 
ATOM   4264  C CG  . TYR A 1 550 ? -2.129  29.075  -59.601 1.00 91.85  ? 576 TYR A CG  1 
ATOM   4265  C CD1 . TYR A 1 550 ? -3.462  28.830  -59.929 1.00 92.88  ? 576 TYR A CD1 1 
ATOM   4266  C CD2 . TYR A 1 550 ? -1.288  29.564  -60.596 1.00 92.74  ? 576 TYR A CD2 1 
ATOM   4267  C CE1 . TYR A 1 550 ? -3.941  29.071  -61.219 1.00 93.27  ? 576 TYR A CE1 1 
ATOM   4268  C CE2 . TYR A 1 550 ? -1.755  29.807  -61.884 1.00 92.51  ? 576 TYR A CE2 1 
ATOM   4269  C CZ  . TYR A 1 550 ? -3.077  29.561  -62.189 1.00 92.70  ? 576 TYR A CZ  1 
ATOM   4270  O OH  . TYR A 1 550 ? -3.527  29.813  -63.463 1.00 92.80  ? 576 TYR A OH  1 
ATOM   4271  N N   . LEU A 1 551 ? -0.101  26.231  -56.267 1.00 87.36  ? 577 LEU A N   1 
ATOM   4272  C CA  . LEU A 1 551 ? 0.665   26.036  -55.040 1.00 86.10  ? 577 LEU A CA  1 
ATOM   4273  C C   . LEU A 1 551 ? 1.984   26.798  -55.112 1.00 85.36  ? 577 LEU A C   1 
ATOM   4274  O O   . LEU A 1 551 ? 3.056   26.199  -55.055 1.00 85.88  ? 577 LEU A O   1 
ATOM   4275  C CB  . LEU A 1 551 ? 0.948   24.547  -54.810 1.00 86.58  ? 577 LEU A CB  1 
ATOM   4276  C CG  . LEU A 1 551 ? 1.602   24.165  -53.475 1.00 86.81  ? 577 LEU A CG  1 
ATOM   4277  C CD1 . LEU A 1 551 ? 0.599   24.339  -52.348 1.00 88.19  ? 577 LEU A CD1 1 
ATOM   4278  C CD2 . LEU A 1 551 ? 2.079   22.725  -53.522 1.00 87.33  ? 577 LEU A CD2 1 
ATOM   4279  N N   . TRP A 1 552 ? 1.896   28.120  -55.236 1.00 84.17  ? 578 TRP A N   1 
ATOM   4280  C CA  . TRP A 1 552 ? 3.077   28.978  -55.318 1.00 82.85  ? 578 TRP A CA  1 
ATOM   4281  C C   . TRP A 1 552 ? 4.030   28.718  -54.150 1.00 83.01  ? 578 TRP A C   1 
ATOM   4282  O O   . TRP A 1 552 ? 3.656   28.871  -52.989 1.00 83.51  ? 578 TRP A O   1 
ATOM   4283  C CB  . TRP A 1 552 ? 2.653   30.448  -55.303 1.00 81.50  ? 578 TRP A CB  1 
ATOM   4284  C CG  . TRP A 1 552 ? 3.705   31.394  -55.796 1.00 80.92  ? 578 TRP A CG  1 
ATOM   4285  C CD1 . TRP A 1 552 ? 4.083   31.595  -57.092 1.00 80.80  ? 578 TRP A CD1 1 
ATOM   4286  C CD2 . TRP A 1 552 ? 4.505   32.278  -55.005 1.00 80.25  ? 578 TRP A CD2 1 
ATOM   4287  N NE1 . TRP A 1 552 ? 5.064   32.553  -57.158 1.00 79.72  ? 578 TRP A NE1 1 
ATOM   4288  C CE2 . TRP A 1 552 ? 5.344   32.989  -55.890 1.00 79.81  ? 578 TRP A CE2 1 
ATOM   4289  C CE3 . TRP A 1 552 ? 4.595   32.540  -53.631 1.00 80.37  ? 578 TRP A CE3 1 
ATOM   4290  C CZ2 . TRP A 1 552 ? 6.262   33.945  -55.449 1.00 80.61  ? 578 TRP A CZ2 1 
ATOM   4291  C CZ3 . TRP A 1 552 ? 5.510   33.493  -53.191 1.00 80.73  ? 578 TRP A CZ3 1 
ATOM   4292  C CH2 . TRP A 1 552 ? 6.332   34.183  -54.099 1.00 80.21  ? 578 TRP A CH2 1 
ATOM   4293  N N   . VAL A 1 553 ? 5.261   28.323  -54.460 1.00 82.85  ? 579 VAL A N   1 
ATOM   4294  C CA  . VAL A 1 553 ? 6.260   28.054  -53.429 1.00 83.04  ? 579 VAL A CA  1 
ATOM   4295  C C   . VAL A 1 553 ? 7.455   29.004  -53.563 1.00 83.84  ? 579 VAL A C   1 
ATOM   4296  O O   . VAL A 1 553 ? 8.269   28.872  -54.476 1.00 83.98  ? 579 VAL A O   1 
ATOM   4297  C CB  . VAL A 1 553 ? 6.744   26.579  -53.493 1.00 81.67  ? 579 VAL A CB  1 
ATOM   4298  C CG1 . VAL A 1 553 ? 7.070   26.197  -54.920 1.00 83.22  ? 579 VAL A CG1 1 
ATOM   4299  C CG2 . VAL A 1 553 ? 7.962   26.390  -52.610 1.00 80.78  ? 579 VAL A CG2 1 
ATOM   4300  N N   . GLY A 1 554 ? 7.543   29.965  -52.645 1.00 84.61  ? 580 GLY A N   1 
ATOM   4301  C CA  . GLY A 1 554 ? 8.623   30.935  -52.668 1.00 84.55  ? 580 GLY A CA  1 
ATOM   4302  C C   . GLY A 1 554 ? 9.990   30.309  -52.478 1.00 85.11  ? 580 GLY A C   1 
ATOM   4303  O O   . GLY A 1 554 ? 10.137  29.338  -51.738 1.00 85.06  ? 580 GLY A O   1 
ATOM   4304  N N   . ALA A 1 555 ? 10.994  30.871  -53.147 1.00 85.42  ? 581 ALA A N   1 
ATOM   4305  C CA  . ALA A 1 555 ? 12.362  30.369  -53.066 1.00 85.22  ? 581 ALA A CA  1 
ATOM   4306  C C   . ALA A 1 555 ? 12.823  30.191  -51.621 1.00 84.87  ? 581 ALA A C   1 
ATOM   4307  O O   . ALA A 1 555 ? 13.532  29.234  -51.298 1.00 84.25  ? 581 ALA A O   1 
ATOM   4308  C CB  . ALA A 1 555 ? 13.306  31.317  -53.802 1.00 85.46  ? 581 ALA A CB  1 
ATOM   4309  N N   . GLY A 1 556 ? 12.414  31.117  -50.759 1.00 84.18  ? 582 GLY A N   1 
ATOM   4310  C CA  . GLY A 1 556 ? 12.793  31.048  -49.360 1.00 83.77  ? 582 GLY A CA  1 
ATOM   4311  C C   . GLY A 1 556 ? 11.992  30.038  -48.561 1.00 83.44  ? 582 GLY A C   1 
ATOM   4312  O O   . GLY A 1 556 ? 12.235  29.848  -47.370 1.00 83.43  ? 582 GLY A O   1 
ATOM   4313  N N   . ALA A 1 557 ? 11.035  29.385  -49.210 1.00 83.72  ? 583 ALA A N   1 
ATOM   4314  C CA  . ALA A 1 557 ? 10.205  28.393  -48.536 1.00 84.08  ? 583 ALA A CA  1 
ATOM   4315  C C   . ALA A 1 557 ? 11.019  27.163  -48.153 1.00 84.09  ? 583 ALA A C   1 
ATOM   4316  O O   . ALA A 1 557 ? 12.224  27.105  -48.397 1.00 84.53  ? 583 ALA A O   1 
ATOM   4317  C CB  . ALA A 1 557 ? 9.042   27.992  -49.431 1.00 84.54  ? 583 ALA A CB  1 
ATOM   4318  N N   . SER A 1 558 ? 10.349  26.184  -47.553 1.00 83.52  ? 584 SER A N   1 
ATOM   4319  C CA  . SER A 1 558 ? 10.993  24.946  -47.126 1.00 82.49  ? 584 SER A CA  1 
ATOM   4320  C C   . SER A 1 558 ? 9.971   23.828  -46.962 1.00 82.09  ? 584 SER A C   1 
ATOM   4321  O O   . SER A 1 558 ? 8.827   23.943  -47.401 1.00 81.39  ? 584 SER A O   1 
ATOM   4322  C CB  . SER A 1 558 ? 11.721  25.156  -45.797 1.00 82.58  ? 584 SER A CB  1 
ATOM   4323  O OG  . SER A 1 558 ? 12.732  26.141  -45.912 1.00 84.35  ? 584 SER A OG  1 
ATOM   4324  N N   . GLU A 1 559 ? 10.405  22.746  -46.326 1.00 82.17  ? 585 GLU A N   1 
ATOM   4325  C CA  . GLU A 1 559 ? 9.564   21.584  -46.068 1.00 82.18  ? 585 GLU A CA  1 
ATOM   4326  C C   . GLU A 1 559 ? 8.236   21.982  -45.425 1.00 80.48  ? 585 GLU A C   1 
ATOM   4327  O O   . GLU A 1 559 ? 7.174   21.847  -46.036 1.00 80.00  ? 585 GLU A O   1 
ATOM   4328  C CB  . GLU A 1 559 ? 10.326  20.609  -45.158 1.00 85.57  ? 585 GLU A CB  1 
ATOM   4329  C CG  . GLU A 1 559 ? 9.470   19.634  -44.350 1.00 89.24  ? 585 GLU A CG  1 
ATOM   4330  C CD  . GLU A 1 559 ? 8.683   18.669  -45.212 1.00 90.87  ? 585 GLU A CD  1 
ATOM   4331  O OE1 . GLU A 1 559 ? 7.795   19.127  -45.962 1.00 92.38  ? 585 GLU A OE1 1 
ATOM   4332  O OE2 . GLU A 1 559 ? 8.954   17.451  -45.134 1.00 91.53  ? 585 GLU A OE2 1 
ATOM   4333  N N   . ALA A 1 560 ? 8.312   22.484  -44.196 1.00 78.05  ? 586 ALA A N   1 
ATOM   4334  C CA  . ALA A 1 560 ? 7.139   22.899  -43.432 1.00 75.18  ? 586 ALA A CA  1 
ATOM   4335  C C   . ALA A 1 560 ? 6.117   23.736  -44.201 1.00 73.57  ? 586 ALA A C   1 
ATOM   4336  O O   . ALA A 1 560 ? 4.916   23.471  -44.118 1.00 73.35  ? 586 ALA A O   1 
ATOM   4337  C CB  . ALA A 1 560 ? 7.581   23.649  -42.181 1.00 74.75  ? 586 ALA A CB  1 
ATOM   4338  N N   . GLU A 1 561 ? 6.579   24.744  -44.937 1.00 71.37  ? 587 GLU A N   1 
ATOM   4339  C CA  . GLU A 1 561 ? 5.667   25.602  -45.691 1.00 70.19  ? 587 GLU A CA  1 
ATOM   4340  C C   . GLU A 1 561 ? 4.892   24.823  -46.750 1.00 71.11  ? 587 GLU A C   1 
ATOM   4341  O O   . GLU A 1 561 ? 3.663   24.864  -46.787 1.00 70.78  ? 587 GLU A O   1 
ATOM   4342  C CB  . GLU A 1 561 ? 6.422   26.748  -46.372 1.00 67.86  ? 587 GLU A CB  1 
ATOM   4343  C CG  . GLU A 1 561 ? 7.892   26.856  -46.015 1.00 67.04  ? 587 GLU A CG  1 
ATOM   4344  C CD  . GLU A 1 561 ? 8.133   27.407  -44.630 1.00 64.75  ? 587 GLU A CD  1 
ATOM   4345  O OE1 . GLU A 1 561 ? 7.732   28.561  -44.365 1.00 63.35  ? 587 GLU A OE1 1 
ATOM   4346  O OE2 . GLU A 1 561 ? 8.732   26.683  -43.808 1.00 65.20  ? 587 GLU A OE2 1 
ATOM   4347  N N   . LYS A 1 562 ? 5.615   24.116  -47.614 1.00 72.36  ? 588 LYS A N   1 
ATOM   4348  C CA  . LYS A 1 562 ? 4.988   23.338  -48.677 1.00 72.05  ? 588 LYS A CA  1 
ATOM   4349  C C   . LYS A 1 562 ? 4.013   22.310  -48.113 1.00 71.30  ? 588 LYS A C   1 
ATOM   4350  O O   . LYS A 1 562 ? 2.819   22.343  -48.413 1.00 71.25  ? 588 LYS A O   1 
ATOM   4351  C CB  . LYS A 1 562 ? 6.053   22.625  -49.522 1.00 73.39  ? 588 LYS A CB  1 
ATOM   4352  C CG  . LYS A 1 562 ? 7.002   23.553  -50.272 1.00 73.80  ? 588 LYS A CG  1 
ATOM   4353  C CD  . LYS A 1 562 ? 7.752   22.801  -51.369 1.00 76.02  ? 588 LYS A CD  1 
ATOM   4354  C CE  . LYS A 1 562 ? 8.696   21.735  -50.812 1.00 76.77  ? 588 LYS A CE  1 
ATOM   4355  N NZ  . LYS A 1 562 ? 9.929   22.316  -50.206 1.00 76.85  ? 588 LYS A NZ  1 
ATOM   4356  N N   . THR A 1 563 ? 4.530   21.398  -47.297 1.00 70.21  ? 589 THR A N   1 
ATOM   4357  C CA  . THR A 1 563 ? 3.704   20.361  -46.699 1.00 69.48  ? 589 THR A CA  1 
ATOM   4358  C C   . THR A 1 563 ? 2.409   20.943  -46.141 1.00 69.48  ? 589 THR A C   1 
ATOM   4359  O O   . THR A 1 563 ? 1.325   20.411  -46.381 1.00 69.42  ? 589 THR A O   1 
ATOM   4360  C CB  . THR A 1 563 ? 4.465   19.621  -45.572 1.00 68.83  ? 589 THR A CB  1 
ATOM   4361  O OG1 . THR A 1 563 ? 3.579   18.713  -44.912 1.00 69.23  ? 589 THR A OG1 1 
ATOM   4362  C CG2 . THR A 1 563 ? 5.013   20.599  -44.557 1.00 69.47  ? 589 THR A CG2 1 
ATOM   4363  N N   . GLY A 1 564 ? 2.526   22.046  -45.409 1.00 69.65  ? 590 GLY A N   1 
ATOM   4364  C CA  . GLY A 1 564 ? 1.353   22.675  -44.830 1.00 69.38  ? 590 GLY A CA  1 
ATOM   4365  C C   . GLY A 1 564 ? 0.511   23.386  -45.867 1.00 69.03  ? 590 GLY A C   1 
ATOM   4366  O O   . GLY A 1 564 ? -0.706  23.477  -45.733 1.00 67.37  ? 590 GLY A O   1 
ATOM   4367  N N   . ALA A 1 565 ? 1.168   23.889  -46.906 1.00 70.27  ? 591 ALA A N   1 
ATOM   4368  C CA  . ALA A 1 565 ? 0.490   24.602  -47.977 1.00 71.57  ? 591 ALA A CA  1 
ATOM   4369  C C   . ALA A 1 565 ? -0.499  23.701  -48.698 1.00 73.58  ? 591 ALA A C   1 
ATOM   4370  O O   . ALA A 1 565 ? -1.620  24.105  -48.995 1.00 73.24  ? 591 ALA A O   1 
ATOM   4371  C CB  . ALA A 1 565 ? 1.512   25.142  -48.966 1.00 71.17  ? 591 ALA A CB  1 
ATOM   4372  N N   . GLN A 1 566 ? -0.080  22.474  -48.977 1.00 75.86  ? 592 GLN A N   1 
ATOM   4373  C CA  . GLN A 1 566 ? -0.935  21.530  -49.677 1.00 78.01  ? 592 GLN A CA  1 
ATOM   4374  C C   . GLN A 1 566 ? -2.008  20.920  -48.785 1.00 77.33  ? 592 GLN A C   1 
ATOM   4375  O O   . GLN A 1 566 ? -3.116  20.652  -49.249 1.00 77.07  ? 592 GLN A O   1 
ATOM   4376  C CB  . GLN A 1 566 ? -0.087  20.427  -50.303 1.00 80.88  ? 592 GLN A CB  1 
ATOM   4377  C CG  . GLN A 1 566 ? 0.775   19.679  -49.316 1.00 84.59  ? 592 GLN A CG  1 
ATOM   4378  C CD  . GLN A 1 566 ? 1.679   18.688  -50.005 1.00 87.52  ? 592 GLN A CD  1 
ATOM   4379  O OE1 . GLN A 1 566 ? 2.512   19.065  -50.833 1.00 88.96  ? 592 GLN A OE1 1 
ATOM   4380  N NE2 . GLN A 1 566 ? 1.519   17.409  -49.677 1.00 88.56  ? 592 GLN A NE2 1 
ATOM   4381  N N   . GLU A 1 567 ? -1.687  20.697  -47.513 1.00 77.10  ? 593 GLU A N   1 
ATOM   4382  C CA  . GLU A 1 567 ? -2.663  20.128  -46.587 1.00 77.30  ? 593 GLU A CA  1 
ATOM   4383  C C   . GLU A 1 567 ? -3.900  21.025  -46.540 1.00 76.68  ? 593 GLU A C   1 
ATOM   4384  O O   . GLU A 1 567 ? -4.971  20.616  -46.085 1.00 76.40  ? 593 GLU A O   1 
ATOM   4385  C CB  . GLU A 1 567 ? -2.069  20.000  -45.188 1.00 78.98  ? 593 GLU A CB  1 
ATOM   4386  C CG  . GLU A 1 567 ? -3.012  19.341  -44.194 1.00 83.01  ? 593 GLU A CG  1 
ATOM   4387  C CD  . GLU A 1 567 ? -3.280  17.884  -44.521 1.00 84.63  ? 593 GLU A CD  1 
ATOM   4388  O OE1 . GLU A 1 567 ? -4.175  17.285  -43.887 1.00 85.18  ? 593 GLU A OE1 1 
ATOM   4389  O OE2 . GLU A 1 567 ? -2.590  17.334  -45.406 1.00 85.62  ? 593 GLU A OE2 1 
ATOM   4390  N N   . LEU A 1 568 ? -3.730  22.256  -47.008 1.00 75.45  ? 594 LEU A N   1 
ATOM   4391  C CA  . LEU A 1 568 ? -4.811  23.228  -47.067 1.00 74.17  ? 594 LEU A CA  1 
ATOM   4392  C C   . LEU A 1 568 ? -5.617  22.941  -48.329 1.00 75.72  ? 594 LEU A C   1 
ATOM   4393  O O   . LEU A 1 568 ? -6.845  23.021  -48.324 1.00 76.73  ? 594 LEU A O   1 
ATOM   4394  C CB  . LEU A 1 568 ? -4.242  24.644  -47.137 1.00 70.38  ? 594 LEU A CB  1 
ATOM   4395  C CG  . LEU A 1 568 ? -5.245  25.752  -47.451 1.00 68.09  ? 594 LEU A CG  1 
ATOM   4396  C CD1 . LEU A 1 568 ? -6.255  25.858  -46.321 1.00 67.49  ? 594 LEU A CD1 1 
ATOM   4397  C CD2 . LEU A 1 568 ? -4.512  27.067  -47.652 1.00 66.94  ? 594 LEU A CD2 1 
ATOM   4398  N N   . LEU A 1 569 ? -4.912  22.613  -49.412 1.00 76.95  ? 595 LEU A N   1 
ATOM   4399  C CA  . LEU A 1 569 ? -5.551  22.300  -50.685 1.00 77.28  ? 595 LEU A CA  1 
ATOM   4400  C C   . LEU A 1 569 ? -6.517  21.134  -50.523 1.00 77.86  ? 595 LEU A C   1 
ATOM   4401  O O   . LEU A 1 569 ? -7.597  21.131  -51.114 1.00 77.09  ? 595 LEU A O   1 
ATOM   4402  C CB  . LEU A 1 569 ? -4.506  21.949  -51.751 1.00 77.24  ? 595 LEU A CB  1 
ATOM   4403  C CG  . LEU A 1 569 ? -3.775  23.085  -52.474 1.00 77.30  ? 595 LEU A CG  1 
ATOM   4404  C CD1 . LEU A 1 569 ? -4.795  24.041  -53.076 1.00 76.89  ? 595 LEU A CD1 1 
ATOM   4405  C CD2 . LEU A 1 569 ? -2.864  23.816  -51.515 1.00 79.28  ? 595 LEU A CD2 1 
ATOM   4406  N N   . ARG A 1 570 ? -6.127  20.141  -49.728 1.00 78.58  ? 596 ARG A N   1 
ATOM   4407  C CA  . ARG A 1 570 ? -6.989  18.990  -49.497 1.00 80.21  ? 596 ARG A CA  1 
ATOM   4408  C C   . ARG A 1 570 ? -8.295  19.481  -48.883 1.00 80.70  ? 596 ARG A C   1 
ATOM   4409  O O   . ARG A 1 570 ? -9.380  19.046  -49.269 1.00 81.48  ? 596 ARG A O   1 
ATOM   4410  C CB  . ARG A 1 570 ? -6.326  17.988  -48.550 1.00 81.55  ? 596 ARG A CB  1 
ATOM   4411  C CG  . ARG A 1 570 ? -7.225  16.800  -48.220 1.00 84.85  ? 596 ARG A CG  1 
ATOM   4412  C CD  . ARG A 1 570 ? -6.678  15.947  -47.086 1.00 87.83  ? 596 ARG A CD  1 
ATOM   4413  N NE  . ARG A 1 570 ? -5.499  15.178  -47.472 1.00 90.33  ? 596 ARG A NE  1 
ATOM   4414  C CZ  . ARG A 1 570 ? -4.863  14.335  -46.663 1.00 92.13  ? 596 ARG A CZ  1 
ATOM   4415  N NH1 . ARG A 1 570 ? -5.295  14.153  -45.421 1.00 93.03  ? 596 ARG A NH1 1 
ATOM   4416  N NH2 . ARG A 1 570 ? -3.800  13.670  -47.096 1.00 93.06  ? 596 ARG A NH2 1 
ATOM   4417  N N   . VAL A 1 571 ? -8.181  20.391  -47.922 1.00 80.78  ? 597 VAL A N   1 
ATOM   4418  C CA  . VAL A 1 571 ? -9.352  20.950  -47.261 1.00 81.46  ? 597 VAL A CA  1 
ATOM   4419  C C   . VAL A 1 571 ? -10.188 21.725  -48.276 1.00 82.14  ? 597 VAL A C   1 
ATOM   4420  O O   . VAL A 1 571 ? -11.401 21.532  -48.372 1.00 81.72  ? 597 VAL A O   1 
ATOM   4421  C CB  . VAL A 1 571 ? -8.937  21.896  -46.103 1.00 81.74  ? 597 VAL A CB  1 
ATOM   4422  C CG1 . VAL A 1 571 ? -10.166 22.520  -45.462 1.00 80.56  ? 597 VAL A CG1 1 
ATOM   4423  C CG2 . VAL A 1 571 ? -8.142  21.120  -45.063 1.00 81.42  ? 597 VAL A CG2 1 
ATOM   4424  N N   . LEU A 1 572 ? -9.526  22.593  -49.036 1.00 83.10  ? 598 LEU A N   1 
ATOM   4425  C CA  . LEU A 1 572 ? -10.189 23.406  -50.050 1.00 84.66  ? 598 LEU A CA  1 
ATOM   4426  C C   . LEU A 1 572 ? -10.801 22.560  -51.162 1.00 86.90  ? 598 LEU A C   1 
ATOM   4427  O O   . LEU A 1 572 ? -11.566 23.069  -51.984 1.00 86.43  ? 598 LEU A O   1 
ATOM   4428  C CB  . LEU A 1 572 ? -9.196  24.399  -50.658 1.00 83.38  ? 598 LEU A CB  1 
ATOM   4429  C CG  . LEU A 1 572 ? -8.673  25.519  -49.757 1.00 82.38  ? 598 LEU A CG  1 
ATOM   4430  C CD1 . LEU A 1 572 ? -7.570  26.274  -50.473 1.00 81.71  ? 598 LEU A CD1 1 
ATOM   4431  C CD2 . LEU A 1 572 ? -9.813  26.460  -49.391 1.00 82.24  ? 598 LEU A CD2 1 
ATOM   4432  N N   . ARG A 1 573 ? -10.460 21.273  -51.188 1.00 90.16  ? 599 ARG A N   1 
ATOM   4433  C CA  . ARG A 1 573 ? -10.980 20.358  -52.204 1.00 93.34  ? 599 ARG A CA  1 
ATOM   4434  C C   . ARG A 1 573 ? -10.518 20.756  -53.604 1.00 94.47  ? 599 ARG A C   1 
ATOM   4435  O O   . ARG A 1 573 ? -11.345 21.051  -54.468 1.00 95.34  ? 599 ARG A O   1 
ATOM   4436  C CB  . ARG A 1 573 ? -12.514 20.344  -52.165 1.00 94.97  ? 599 ARG A CB  1 
ATOM   4437  C CG  . ARG A 1 573 ? -13.123 19.492  -51.061 1.00 96.86  ? 599 ARG A CG  1 
ATOM   4438  C CD  . ARG A 1 573 ? -13.208 18.039  -51.495 1.00 98.77  ? 599 ARG A CD  1 
ATOM   4439  N NE  . ARG A 1 573 ? -13.806 17.183  -50.475 1.00 99.40  ? 599 ARG A NE  1 
ATOM   4440  C CZ  . ARG A 1 573 ? -14.120 15.905  -50.666 1.00 99.68  ? 599 ARG A CZ  1 
ATOM   4441  N NH1 . ARG A 1 573 ? -13.897 15.331  -51.842 1.00 98.64  ? 599 ARG A NH1 1 
ATOM   4442  N NH2 . ARG A 1 573 ? -14.652 15.197  -49.678 1.00 99.47  ? 599 ARG A NH2 1 
ATOM   4443  N N   . ALA A 1 574 ? -9.205  20.760  -53.830 1.00 95.29  ? 600 ALA A N   1 
ATOM   4444  C CA  . ALA A 1 574 ? -8.667  21.135  -55.138 1.00 96.36  ? 600 ALA A CA  1 
ATOM   4445  C C   . ALA A 1 574 ? -7.323  20.485  -55.468 1.00 96.93  ? 600 ALA A C   1 
ATOM   4446  O O   . ALA A 1 574 ? -6.654  19.924  -54.596 1.00 96.67  ? 600 ALA A O   1 
ATOM   4447  C CB  . ALA A 1 574 ? -8.540  22.656  -55.230 1.00 95.93  ? 600 ALA A CB  1 
ATOM   4448  N N   . GLN A 1 575 ? -6.941  20.567  -56.741 1.00 97.49  ? 601 GLN A N   1 
ATOM   4449  C CA  . GLN A 1 575 ? -5.680  20.008  -57.214 1.00 97.60  ? 601 GLN A CA  1 
ATOM   4450  C C   . GLN A 1 575 ? -4.752  21.153  -57.621 1.00 97.16  ? 601 GLN A C   1 
ATOM   4451  O O   . GLN A 1 575 ? -5.034  21.891  -58.569 1.00 96.96  ? 601 GLN A O   1 
ATOM   4452  C CB  . GLN A 1 575 ? -5.921  19.072  -58.405 1.00 98.57  ? 601 GLN A CB  1 
ATOM   4453  C CG  . GLN A 1 575 ? -4.681  18.305  -58.851 1.00 99.64  ? 601 GLN A CG  1 
ATOM   4454  C CD  . GLN A 1 575 ? -4.126  17.392  -57.766 1.00 100.41 ? 601 GLN A CD  1 
ATOM   4455  O OE1 . GLN A 1 575 ? -3.071  16.777  -57.936 1.00 100.41 ? 601 GLN A OE1 1 
ATOM   4456  N NE2 . GLN A 1 575 ? -4.837  17.297  -56.646 1.00 100.41 ? 601 GLN A NE2 1 
ATOM   4457  N N   . PRO A 1 576 ? -3.628  21.308  -56.903 1.00 96.58  ? 602 PRO A N   1 
ATOM   4458  C CA  . PRO A 1 576 ? -2.620  22.348  -57.130 1.00 95.53  ? 602 PRO A CA  1 
ATOM   4459  C C   . PRO A 1 576 ? -1.791  22.253  -58.411 1.00 94.51  ? 602 PRO A C   1 
ATOM   4460  O O   . PRO A 1 576 ? -1.914  21.311  -59.195 1.00 93.93  ? 602 PRO A O   1 
ATOM   4461  C CB  . PRO A 1 576 ? -1.752  22.257  -55.879 1.00 95.82  ? 602 PRO A CB  1 
ATOM   4462  C CG  . PRO A 1 576 ? -1.768  20.795  -55.588 1.00 96.27  ? 602 PRO A CG  1 
ATOM   4463  C CD  . PRO A 1 576 ? -3.234  20.447  -55.770 1.00 96.71  ? 602 PRO A CD  1 
ATOM   4464  N N   . VAL A 1 577 ? -0.943  23.261  -58.596 1.00 93.70  ? 603 VAL A N   1 
ATOM   4465  C CA  . VAL A 1 577 ? -0.054  23.371  -59.744 1.00 92.48  ? 603 VAL A CA  1 
ATOM   4466  C C   . VAL A 1 577 ? 1.275   23.930  -59.234 1.00 92.28  ? 603 VAL A C   1 
ATOM   4467  O O   . VAL A 1 577 ? 1.561   25.117  -59.407 1.00 92.03  ? 603 VAL A O   1 
ATOM   4468  C CB  . VAL A 1 577 ? -0.628  24.344  -60.800 1.00 92.00  ? 603 VAL A CB  1 
ATOM   4469  C CG1 . VAL A 1 577 ? 0.272   24.376  -62.024 1.00 91.72  ? 603 VAL A CG1 1 
ATOM   4470  C CG2 . VAL A 1 577 ? -2.039  23.928  -61.182 1.00 91.70  ? 603 VAL A CG2 1 
ATOM   4471  N N   . GLN A 1 578 ? 2.074   23.077  -58.595 1.00 92.00  ? 604 GLN A N   1 
ATOM   4472  C CA  . GLN A 1 578 ? 3.363   23.497  -58.050 1.00 92.04  ? 604 GLN A CA  1 
ATOM   4473  C C   . GLN A 1 578 ? 4.057   24.503  -58.956 1.00 91.82  ? 604 GLN A C   1 
ATOM   4474  O O   . GLN A 1 578 ? 4.489   24.169  -60.059 1.00 92.38  ? 604 GLN A O   1 
ATOM   4475  C CB  . GLN A 1 578 ? 4.287   22.292  -57.827 1.00 92.31  ? 604 GLN A CB  1 
ATOM   4476  C CG  . GLN A 1 578 ? 4.021   21.494  -56.553 1.00 92.39  ? 604 GLN A CG  1 
ATOM   4477  C CD  . GLN A 1 578 ? 2.745   20.672  -56.618 1.00 93.30  ? 604 GLN A CD  1 
ATOM   4478  O OE1 . GLN A 1 578 ? 1.647   21.213  -56.759 1.00 92.87  ? 604 GLN A OE1 1 
ATOM   4479  N NE2 . GLN A 1 578 ? 2.886   19.353  -56.515 1.00 93.46  ? 604 GLN A NE2 1 
ATOM   4480  N N   . VAL A 1 579 ? 4.153   25.738  -58.483 1.00 91.26  ? 605 VAL A N   1 
ATOM   4481  C CA  . VAL A 1 579 ? 4.795   26.800  -59.240 1.00 91.24  ? 605 VAL A CA  1 
ATOM   4482  C C   . VAL A 1 579 ? 5.894   27.472  -58.415 1.00 91.97  ? 605 VAL A C   1 
ATOM   4483  O O   . VAL A 1 579 ? 5.632   28.017  -57.343 1.00 91.59  ? 605 VAL A O   1 
ATOM   4484  C CB  . VAL A 1 579 ? 3.762   27.857  -59.688 1.00 90.05  ? 605 VAL A CB  1 
ATOM   4485  C CG1 . VAL A 1 579 ? 2.854   28.216  -58.532 1.00 90.41  ? 605 VAL A CG1 1 
ATOM   4486  C CG2 . VAL A 1 579 ? 4.472   29.096  -60.204 1.00 88.83  ? 605 VAL A CG2 1 
ATOM   4487  N N   . ALA A 1 580 ? 7.124   27.420  -58.926 1.00 92.58  ? 606 ALA A N   1 
ATOM   4488  C CA  . ALA A 1 580 ? 8.274   28.016  -58.253 1.00 92.15  ? 606 ALA A CA  1 
ATOM   4489  C C   . ALA A 1 580 ? 8.387   29.509  -58.557 1.00 92.08  ? 606 ALA A C   1 
ATOM   4490  O O   . ALA A 1 580 ? 8.119   29.948  -59.675 1.00 91.88  ? 606 ALA A O   1 
ATOM   4491  C CB  . ALA A 1 580 ? 9.550   27.299  -58.672 1.00 91.55  ? 606 ALA A CB  1 
ATOM   4492  N N   . GLU A 1 581 ? 8.785   30.279  -57.548 1.00 92.60  ? 607 GLU A N   1 
ATOM   4493  C CA  . GLU A 1 581 ? 8.936   31.726  -57.673 1.00 92.82  ? 607 GLU A CA  1 
ATOM   4494  C C   . GLU A 1 581 ? 9.820   32.121  -58.850 1.00 94.06  ? 607 GLU A C   1 
ATOM   4495  O O   . GLU A 1 581 ? 10.790  31.433  -59.172 1.00 94.82  ? 607 GLU A O   1 
ATOM   4496  C CB  . GLU A 1 581 ? 9.508   32.300  -56.373 1.00 91.26  ? 607 GLU A CB  1 
ATOM   4497  C CG  . GLU A 1 581 ? 9.944   33.753  -56.460 1.00 88.73  ? 607 GLU A CG  1 
ATOM   4498  C CD  . GLU A 1 581 ? 10.346  34.318  -55.113 1.00 87.03  ? 607 GLU A CD  1 
ATOM   4499  O OE1 . GLU A 1 581 ? 11.049  33.615  -54.356 1.00 84.94  ? 607 GLU A OE1 1 
ATOM   4500  O OE2 . GLU A 1 581 ? 9.966   35.470  -54.814 1.00 86.14  ? 607 GLU A OE2 1 
ATOM   4501  N N   . GLY A 1 582 ? 9.477   33.238  -59.485 1.00 94.69  ? 608 GLY A N   1 
ATOM   4502  C CA  . GLY A 1 582 ? 10.242  33.708  -60.625 1.00 95.85  ? 608 GLY A CA  1 
ATOM   4503  C C   . GLY A 1 582 ? 9.697   33.168  -61.934 1.00 96.61  ? 608 GLY A C   1 
ATOM   4504  O O   . GLY A 1 582 ? 9.399   33.929  -62.856 1.00 96.67  ? 608 GLY A O   1 
ATOM   4505  N N   . SER A 1 583 ? 9.563   31.848  -62.013 1.00 97.00  ? 609 SER A N   1 
ATOM   4506  C CA  . SER A 1 583 ? 9.052   31.195  -63.210 1.00 97.33  ? 609 SER A CA  1 
ATOM   4507  C C   . SER A 1 583 ? 7.612   30.717  -63.014 1.00 98.25  ? 609 SER A C   1 
ATOM   4508  O O   . SER A 1 583 ? 7.363   29.532  -62.781 1.00 97.94  ? 609 SER A O   1 
ATOM   4509  C CB  . SER A 1 583 ? 9.958   30.017  -63.579 1.00 96.94  ? 609 SER A CB  1 
ATOM   4510  O OG  . SER A 1 583 ? 10.177  29.174  -62.461 1.00 95.54  ? 609 SER A OG  1 
ATOM   4511  N N   . GLU A 1 584 ? 6.666   31.649  -63.112 1.00 99.61  ? 610 GLU A N   1 
ATOM   4512  C CA  . GLU A 1 584 ? 5.247   31.336  -62.947 1.00 99.99  ? 610 GLU A CA  1 
ATOM   4513  C C   . GLU A 1 584 ? 4.452   31.818  -64.161 1.00 99.93  ? 610 GLU A C   1 
ATOM   4514  O O   . GLU A 1 584 ? 4.657   32.934  -64.640 1.00 99.82  ? 610 GLU A O   1 
ATOM   4515  C CB  . GLU A 1 584 ? 4.692   32.007  -61.684 1.00 100.18 ? 610 GLU A CB  1 
ATOM   4516  C CG  . GLU A 1 584 ? 5.729   32.313  -60.614 1.00 100.14 ? 610 GLU A CG  1 
ATOM   4517  C CD  . GLU A 1 584 ? 6.366   33.681  -60.798 1.00 100.41 ? 610 GLU A CD  1 
ATOM   4518  O OE1 . GLU A 1 584 ? 6.871   33.964  -61.907 1.00 100.41 ? 610 GLU A OE1 1 
ATOM   4519  O OE2 . GLU A 1 584 ? 6.363   34.476  -59.832 1.00 100.41 ? 610 GLU A OE2 1 
ATOM   4520  N N   . PRO A 1 585 ? 3.524   30.987  -64.665 1.00 99.85  ? 611 PRO A N   1 
ATOM   4521  C CA  . PRO A 1 585 ? 2.713   31.362  -65.827 1.00 99.54  ? 611 PRO A CA  1 
ATOM   4522  C C   . PRO A 1 585 ? 1.943   32.655  -65.601 1.00 99.30  ? 611 PRO A C   1 
ATOM   4523  O O   . PRO A 1 585 ? 1.532   32.951  -64.481 1.00 99.64  ? 611 PRO A O   1 
ATOM   4524  C CB  . PRO A 1 585 ? 1.792   30.157  -66.009 1.00 99.84  ? 611 PRO A CB  1 
ATOM   4525  C CG  . PRO A 1 585 ? 1.636   29.642  -64.610 1.00 99.80  ? 611 PRO A CG  1 
ATOM   4526  C CD  . PRO A 1 585 ? 3.050   29.715  -64.089 1.00 99.91  ? 611 PRO A CD  1 
ATOM   4527  N N   . ASP A 1 586 ? 1.751   33.422  -66.668 1.00 99.44  ? 612 ASP A N   1 
ATOM   4528  C CA  . ASP A 1 586 ? 1.027   34.683  -66.578 1.00 100.00 ? 612 ASP A CA  1 
ATOM   4529  C C   . ASP A 1 586 ? -0.433  34.472  -66.174 1.00 100.41 ? 612 ASP A C   1 
ATOM   4530  O O   . ASP A 1 586 ? -1.171  35.436  -65.954 1.00 100.41 ? 612 ASP A O   1 
ATOM   4531  C CB  . ASP A 1 586 ? 1.104   35.431  -67.913 1.00 99.95  ? 612 ASP A CB  1 
ATOM   4532  C CG  . ASP A 1 586 ? 0.657   34.582  -69.082 1.00 100.07 ? 612 ASP A CG  1 
ATOM   4533  O OD1 . ASP A 1 586 ? 1.315   33.557  -69.362 1.00 100.08 ? 612 ASP A OD1 1 
ATOM   4534  O OD2 . ASP A 1 586 ? -0.354  34.940  -69.721 1.00 100.41 ? 612 ASP A OD2 1 
ATOM   4535  N N   . SER A 1 587 ? -0.847  33.210  -66.085 1.00 100.41 ? 613 SER A N   1 
ATOM   4536  C CA  . SER A 1 587 ? -2.210  32.872  -65.682 1.00 100.18 ? 613 SER A CA  1 
ATOM   4537  C C   . SER A 1 587 ? -2.301  33.182  -64.193 1.00 100.41 ? 613 SER A C   1 
ATOM   4538  O O   . SER A 1 587 ? -3.316  33.677  -63.698 1.00 100.41 ? 613 SER A O   1 
ATOM   4539  C CB  . SER A 1 587 ? -2.481  31.384  -65.914 1.00 99.48  ? 613 SER A CB  1 
ATOM   4540  O OG  . SER A 1 587 ? -2.211  31.018  -67.254 1.00 99.67  ? 613 SER A OG  1 
ATOM   4541  N N   . PHE A 1 588 ? -1.210  32.876  -63.496 1.00 100.41 ? 614 PHE A N   1 
ATOM   4542  C CA  . PHE A 1 588 ? -1.075  33.105  -62.064 1.00 100.25 ? 614 PHE A CA  1 
ATOM   4543  C C   . PHE A 1 588 ? -1.057  34.603  -61.790 1.00 100.05 ? 614 PHE A C   1 
ATOM   4544  O O   . PHE A 1 588 ? -1.767  35.096  -60.913 1.00 100.34 ? 614 PHE A O   1 
ATOM   4545  C CB  . PHE A 1 588 ? 0.224   32.453  -61.568 1.00 100.21 ? 614 PHE A CB  1 
ATOM   4546  C CG  . PHE A 1 588 ? 0.660   32.903  -60.201 1.00 100.41 ? 614 PHE A CG  1 
ATOM   4547  C CD1 . PHE A 1 588 ? 1.303   34.127  -60.026 1.00 100.07 ? 614 PHE A CD1 1 
ATOM   4548  C CD2 . PHE A 1 588 ? 0.434   32.101  -59.088 1.00 100.23 ? 614 PHE A CD2 1 
ATOM   4549  C CE1 . PHE A 1 588 ? 1.712   34.544  -58.766 1.00 99.95  ? 614 PHE A CE1 1 
ATOM   4550  C CE2 . PHE A 1 588 ? 0.839   32.508  -57.822 1.00 100.27 ? 614 PHE A CE2 1 
ATOM   4551  C CZ  . PHE A 1 588 ? 1.481   33.734  -57.661 1.00 100.41 ? 614 PHE A CZ  1 
ATOM   4552  N N   . TRP A 1 589 ? -0.237  35.319  -62.552 1.00 99.22  ? 615 TRP A N   1 
ATOM   4553  C CA  . TRP A 1 589 ? -0.111  36.760  -62.405 1.00 99.02  ? 615 TRP A CA  1 
ATOM   4554  C C   . TRP A 1 589 ? -1.437  37.496  -62.553 1.00 98.82  ? 615 TRP A C   1 
ATOM   4555  O O   . TRP A 1 589 ? -1.672  38.497  -61.876 1.00 98.49  ? 615 TRP A O   1 
ATOM   4556  C CB  . TRP A 1 589 ? 0.902   37.294  -63.419 1.00 99.67  ? 615 TRP A CB  1 
ATOM   4557  C CG  . TRP A 1 589 ? 2.334   37.077  -63.013 1.00 100.41 ? 615 TRP A CG  1 
ATOM   4558  C CD1 . TRP A 1 589 ? 3.375   36.732  -63.830 1.00 100.41 ? 615 TRP A CD1 1 
ATOM   4559  C CD2 . TRP A 1 589 ? 2.894   37.238  -61.701 1.00 100.41 ? 615 TRP A CD2 1 
ATOM   4560  N NE1 . TRP A 1 589 ? 4.544   36.670  -63.110 1.00 100.41 ? 615 TRP A NE1 1 
ATOM   4561  C CE2 . TRP A 1 589 ? 4.279   36.977  -61.802 1.00 100.41 ? 615 TRP A CE2 1 
ATOM   4562  C CE3 . TRP A 1 589 ? 2.358   37.583  -60.450 1.00 100.41 ? 615 TRP A CE3 1 
ATOM   4563  C CZ2 . TRP A 1 589 ? 5.138   37.047  -60.698 1.00 100.41 ? 615 TRP A CZ2 1 
ATOM   4564  C CZ3 . TRP A 1 589 ? 3.214   37.652  -59.353 1.00 100.39 ? 615 TRP A CZ3 1 
ATOM   4565  C CH2 . TRP A 1 589 ? 4.589   37.386  -59.487 1.00 100.41 ? 615 TRP A CH2 1 
ATOM   4566  N N   . GLU A 1 590 ? -2.305  37.008  -63.433 1.00 98.76  ? 616 GLU A N   1 
ATOM   4567  C CA  . GLU A 1 590 ? -3.596  37.655  -63.628 1.00 99.21  ? 616 GLU A CA  1 
ATOM   4568  C C   . GLU A 1 590 ? -4.504  37.494  -62.420 1.00 99.29  ? 616 GLU A C   1 
ATOM   4569  O O   . GLU A 1 590 ? -5.252  38.409  -62.079 1.00 99.43  ? 616 GLU A O   1 
ATOM   4570  C CB  . GLU A 1 590 ? -4.303  37.111  -64.872 1.00 99.80  ? 616 GLU A CB  1 
ATOM   4571  C CG  . GLU A 1 590 ? -3.873  37.783  -66.165 1.00 100.41 ? 616 GLU A CG  1 
ATOM   4572  C CD  . GLU A 1 590 ? -4.841  37.529  -67.303 1.00 100.41 ? 616 GLU A CD  1 
ATOM   4573  O OE1 . GLU A 1 590 ? -6.020  37.934  -67.189 1.00 100.14 ? 616 GLU A OE1 1 
ATOM   4574  O OE2 . GLU A 1 590 ? -4.423  36.925  -68.312 1.00 100.41 ? 616 GLU A OE2 1 
ATOM   4575  N N   . ALA A 1 591 ? -4.434  36.335  -61.773 1.00 99.00  ? 617 ALA A N   1 
ATOM   4576  C CA  . ALA A 1 591 ? -5.260  36.070  -60.601 1.00 99.00  ? 617 ALA A CA  1 
ATOM   4577  C C   . ALA A 1 591 ? -4.765  36.846  -59.375 1.00 99.31  ? 617 ALA A C   1 
ATOM   4578  O O   . ALA A 1 591 ? -4.813  36.344  -58.250 1.00 100.41 ? 617 ALA A O   1 
ATOM   4579  C CB  . ALA A 1 591 ? -5.279  34.572  -60.306 1.00 98.26  ? 617 ALA A CB  1 
ATOM   4580  N N   . LEU A 1 592 ? -4.293  38.071  -59.603 1.00 98.51  ? 618 LEU A N   1 
ATOM   4581  C CA  . LEU A 1 592 ? -3.791  38.933  -58.532 1.00 97.75  ? 618 LEU A CA  1 
ATOM   4582  C C   . LEU A 1 592 ? -3.983  40.412  -58.876 1.00 97.57  ? 618 LEU A C   1 
ATOM   4583  O O   . LEU A 1 592 ? -3.987  41.272  -57.994 1.00 96.64  ? 618 LEU A O   1 
ATOM   4584  C CB  . LEU A 1 592 ? -2.303  38.663  -58.277 1.00 97.17  ? 618 LEU A CB  1 
ATOM   4585  C CG  . LEU A 1 592 ? -1.888  37.270  -57.799 1.00 96.51  ? 618 LEU A CG  1 
ATOM   4586  C CD1 . LEU A 1 592 ? -0.377  37.217  -57.665 1.00 96.06  ? 618 LEU A CD1 1 
ATOM   4587  C CD2 . LEU A 1 592 ? -2.554  36.950  -56.470 1.00 96.79  ? 618 LEU A CD2 1 
ATOM   4588  N N   . GLY A 1 593 ? -4.137  40.700  -60.164 1.00 98.17  ? 619 GLY A N   1 
ATOM   4589  C CA  . GLY A 1 593 ? -4.323  42.072  -60.598 1.00 97.95  ? 619 GLY A CA  1 
ATOM   4590  C C   . GLY A 1 593 ? -3.077  42.648  -61.243 1.00 98.40  ? 619 GLY A C   1 
ATOM   4591  O O   . GLY A 1 593 ? -2.855  43.860  -61.209 1.00 97.99  ? 619 GLY A O   1 
ATOM   4592  N N   . GLY A 1 594 ? -2.256  41.779  -61.827 1.00 98.55  ? 620 GLY A N   1 
ATOM   4593  C CA  . GLY A 1 594 ? -1.040  42.236  -62.474 1.00 99.39  ? 620 GLY A CA  1 
ATOM   4594  C C   . GLY A 1 594 ? 0.207   41.452  -62.104 1.00 100.15 ? 620 GLY A C   1 
ATOM   4595  O O   . GLY A 1 594 ? 0.251   40.229  -62.242 1.00 99.88  ? 620 GLY A O   1 
ATOM   4596  N N   . LYS A 1 595 ? 1.224   42.169  -61.631 1.00 100.41 ? 621 LYS A N   1 
ATOM   4597  C CA  . LYS A 1 595 ? 2.498   41.570  -61.240 1.00 100.41 ? 621 LYS A CA  1 
ATOM   4598  C C   . LYS A 1 595 ? 3.392   42.670  -60.668 1.00 100.41 ? 621 LYS A C   1 
ATOM   4599  O O   . LYS A 1 595 ? 4.331   43.121  -61.323 1.00 100.31 ? 621 LYS A O   1 
ATOM   4600  C CB  . LYS A 1 595 ? 3.167   40.933  -62.462 1.00 100.16 ? 621 LYS A CB  1 
ATOM   4601  C CG  . LYS A 1 595 ? 4.533   40.326  -62.201 1.00 100.41 ? 621 LYS A CG  1 
ATOM   4602  C CD  . LYS A 1 595 ? 5.124   39.765  -63.486 1.00 100.41 ? 621 LYS A CD  1 
ATOM   4603  C CE  . LYS A 1 595 ? 6.486   39.126  -63.249 1.00 100.41 ? 621 LYS A CE  1 
ATOM   4604  N NZ  . LYS A 1 595 ? 7.501   40.113  -62.792 1.00 99.54  ? 621 LYS A NZ  1 
ATOM   4605  N N   . ALA A 1 596 ? 3.090   43.096  -59.444 1.00 100.41 ? 622 ALA A N   1 
ATOM   4606  C CA  . ALA A 1 596 ? 3.842   44.160  -58.778 1.00 100.41 ? 622 ALA A CA  1 
ATOM   4607  C C   . ALA A 1 596 ? 5.202   43.716  -58.241 1.00 100.41 ? 622 ALA A C   1 
ATOM   4608  O O   . ALA A 1 596 ? 5.819   42.786  -58.767 1.00 100.20 ? 622 ALA A O   1 
ATOM   4609  C CB  . ALA A 1 596 ? 3.007   44.750  -57.643 1.00 100.41 ? 622 ALA A CB  1 
ATOM   4610  N N   . THR A 1 597 ? 5.662   44.397  -57.193 1.00 100.34 ? 623 THR A N   1 
ATOM   4611  C CA  . THR A 1 597 ? 6.946   44.091  -56.571 1.00 100.41 ? 623 THR A CA  1 
ATOM   4612  C C   . THR A 1 597 ? 6.791   43.081  -55.435 1.00 100.27 ? 623 THR A C   1 
ATOM   4613  O O   . THR A 1 597 ? 5.900   43.206  -54.594 1.00 99.74  ? 623 THR A O   1 
ATOM   4614  C CB  . THR A 1 597 ? 7.621   45.368  -56.007 1.00 100.41 ? 623 THR A CB  1 
ATOM   4615  O OG1 . THR A 1 597 ? 7.803   46.325  -57.059 1.00 100.30 ? 623 THR A OG1 1 
ATOM   4616  C CG2 . THR A 1 597 ? 8.979   45.030  -55.403 1.00 99.78  ? 623 THR A CG2 1 
ATOM   4617  N N   . TYR A 1 598 ? 7.666   42.081  -55.428 1.00 100.27 ? 624 TYR A N   1 
ATOM   4618  C CA  . TYR A 1 598 ? 7.665   41.038  -54.409 1.00 99.99  ? 624 TYR A CA  1 
ATOM   4619  C C   . TYR A 1 598 ? 7.824   41.619  -53.013 1.00 99.71  ? 624 TYR A C   1 
ATOM   4620  O O   . TYR A 1 598 ? 7.327   42.694  -52.685 1.00 98.67  ? 624 TYR A O   1 
ATOM   4621  C CB  . TYR A 1 598 ? 8.839   40.078  -54.613 1.00 100.41 ? 624 TYR A CB  1 
ATOM   4622  C CG  . TYR A 1 598 ? 8.687   39.021  -55.674 1.00 100.24 ? 624 TYR A CG  1 
ATOM   4623  C CD1 . TYR A 1 598 ? 9.362   39.126  -56.890 1.00 99.99  ? 624 TYR A CD1 1 
ATOM   4624  C CD2 . TYR A 1 598 ? 7.941   37.871  -55.430 1.00 99.76  ? 624 TYR A CD2 1 
ATOM   4625  C CE1 . TYR A 1 598 ? 9.307   38.105  -57.833 1.00 100.41 ? 624 TYR A CE1 1 
ATOM   4626  C CE2 . TYR A 1 598 ? 7.877   36.844  -56.365 1.00 100.41 ? 624 TYR A CE2 1 
ATOM   4627  C CZ  . TYR A 1 598 ? 8.565   36.965  -57.564 1.00 100.41 ? 624 TYR A CZ  1 
ATOM   4628  O OH  . TYR A 1 598 ? 8.533   35.940  -58.482 1.00 100.41 ? 624 TYR A OH  1 
ATOM   4629  N N   . ARG A 1 599 ? 8.552   40.857  -52.207 1.00 100.13 ? 625 ARG A N   1 
ATOM   4630  C CA  . ARG A 1 599 ? 8.886   41.187  -50.835 1.00 100.39 ? 625 ARG A CA  1 
ATOM   4631  C C   . ARG A 1 599 ? 9.933   40.128  -50.520 1.00 100.23 ? 625 ARG A C   1 
ATOM   4632  O O   . ARG A 1 599 ? 9.597   38.995  -50.174 1.00 99.84  ? 625 ARG A O   1 
ATOM   4633  C CB  . ARG A 1 599 ? 7.672   41.026  -49.916 1.00 100.25 ? 625 ARG A CB  1 
ATOM   4634  C CG  . ARG A 1 599 ? 7.719   41.919  -48.680 1.00 100.08 ? 625 ARG A CG  1 
ATOM   4635  C CD  . ARG A 1 599 ? 9.039   41.780  -47.931 1.00 100.41 ? 625 ARG A CD  1 
ATOM   4636  N NE  . ARG A 1 599 ? 9.156   42.739  -46.835 1.00 100.41 ? 625 ARG A NE  1 
ATOM   4637  C CZ  . ARG A 1 599 ? 8.374   42.749  -45.759 1.00 100.41 ? 625 ARG A CZ  1 
ATOM   4638  N NH1 . ARG A 1 599 ? 7.408   41.849  -45.627 1.00 100.41 ? 625 ARG A NH1 1 
ATOM   4639  N NH2 . ARG A 1 599 ? 8.556   43.663  -44.815 1.00 100.41 ? 625 ARG A NH2 1 
ATOM   4640  N N   . THR A 1 600 ? 11.202  40.493  -50.669 1.00 100.10 ? 626 THR A N   1 
ATOM   4641  C CA  . THR A 1 600 ? 12.291  39.555  -50.437 1.00 99.97  ? 626 THR A CA  1 
ATOM   4642  C C   . THR A 1 600 ? 13.113  39.841  -49.182 1.00 100.08 ? 626 THR A C   1 
ATOM   4643  O O   . THR A 1 600 ? 14.328  39.649  -49.167 1.00 99.79  ? 626 THR A O   1 
ATOM   4644  C CB  . THR A 1 600 ? 13.228  39.513  -51.656 1.00 99.60  ? 626 THR A CB  1 
ATOM   4645  O OG1 . THR A 1 600 ? 12.446  39.352  -52.847 1.00 98.92  ? 626 THR A OG1 1 
ATOM   4646  C CG2 . THR A 1 600 ? 14.198  38.346  -51.543 1.00 99.54  ? 626 THR A CG2 1 
ATOM   4647  N N   . SER A 1 601 ? 12.445  40.301  -48.128 1.00 100.41 ? 627 SER A N   1 
ATOM   4648  C CA  . SER A 1 601 ? 13.118  40.583  -46.862 1.00 99.94  ? 627 SER A CA  1 
ATOM   4649  C C   . SER A 1 601 ? 13.304  39.256  -46.126 1.00 99.46  ? 627 SER A C   1 
ATOM   4650  O O   . SER A 1 601 ? 12.331  38.625  -45.710 1.00 100.33 ? 627 SER A O   1 
ATOM   4651  C CB  . SER A 1 601 ? 12.275  41.534  -46.000 1.00 100.02 ? 627 SER A CB  1 
ATOM   4652  O OG  . SER A 1 601 ? 12.096  42.793  -46.625 1.00 100.41 ? 627 SER A OG  1 
ATOM   4653  N N   . PRO A 1 602 ? 14.560  38.810  -45.962 1.00 98.15  ? 628 PRO A N   1 
ATOM   4654  C CA  . PRO A 1 602 ? 14.857  37.549  -45.273 1.00 96.71  ? 628 PRO A CA  1 
ATOM   4655  C C   . PRO A 1 602 ? 14.514  37.581  -43.781 1.00 95.08  ? 628 PRO A C   1 
ATOM   4656  O O   . PRO A 1 602 ? 15.083  38.362  -43.017 1.00 94.65  ? 628 PRO A O   1 
ATOM   4657  C CB  . PRO A 1 602 ? 16.351  37.369  -45.527 1.00 97.16  ? 628 PRO A CB  1 
ATOM   4658  C CG  . PRO A 1 602 ? 16.847  38.781  -45.548 1.00 97.99  ? 628 PRO A CG  1 
ATOM   4659  C CD  . PRO A 1 602 ? 15.802  39.479  -46.390 1.00 98.10  ? 628 PRO A CD  1 
ATOM   4660  N N   . ARG A 1 603 ? 13.579  36.724  -43.379 1.00 93.15  ? 629 ARG A N   1 
ATOM   4661  C CA  . ARG A 1 603 ? 13.144  36.640  -41.988 1.00 90.84  ? 629 ARG A CA  1 
ATOM   4662  C C   . ARG A 1 603 ? 14.315  36.385  -41.052 1.00 89.34  ? 629 ARG A C   1 
ATOM   4663  O O   . ARG A 1 603 ? 15.090  35.450  -41.255 1.00 88.68  ? 629 ARG A O   1 
ATOM   4664  C CB  . ARG A 1 603 ? 12.121  35.513  -41.818 1.00 90.44  ? 629 ARG A CB  1 
ATOM   4665  C CG  . ARG A 1 603 ? 10.820  35.721  -42.570 1.00 89.53  ? 629 ARG A CG  1 
ATOM   4666  C CD  . ARG A 1 603 ? 9.897   36.691  -41.852 1.00 89.32  ? 629 ARG A CD  1 
ATOM   4667  N NE  . ARG A 1 603 ? 8.711   37.015  -42.644 1.00 89.72  ? 629 ARG A NE  1 
ATOM   4668  C CZ  . ARG A 1 603 ? 7.886   36.115  -43.173 1.00 89.14  ? 629 ARG A CZ  1 
ATOM   4669  N NH1 . ARG A 1 603 ? 8.107   34.818  -43.002 1.00 89.68  ? 629 ARG A NH1 1 
ATOM   4670  N NH2 . ARG A 1 603 ? 6.834   36.515  -43.875 1.00 88.28  ? 629 ARG A NH2 1 
ATOM   4671  N N   . LEU A 1 604 ? 14.437  37.222  -40.027 1.00 87.84  ? 630 LEU A N   1 
ATOM   4672  C CA  . LEU A 1 604 ? 15.501  37.081  -39.041 1.00 86.21  ? 630 LEU A CA  1 
ATOM   4673  C C   . LEU A 1 604 ? 15.164  35.872  -38.178 1.00 85.35  ? 630 LEU A C   1 
ATOM   4674  O O   . LEU A 1 604 ? 14.654  36.026  -37.069 1.00 87.30  ? 630 LEU A O   1 
ATOM   4675  C CB  . LEU A 1 604 ? 15.572  38.326  -38.155 1.00 85.61  ? 630 LEU A CB  1 
ATOM   4676  C CG  . LEU A 1 604 ? 15.799  39.679  -38.829 1.00 85.65  ? 630 LEU A CG  1 
ATOM   4677  C CD1 . LEU A 1 604 ? 15.613  40.791  -37.810 1.00 86.00  ? 630 LEU A CD1 1 
ATOM   4678  C CD2 . LEU A 1 604 ? 17.190  39.726  -39.432 1.00 86.40  ? 630 LEU A CD2 1 
ATOM   4679  N N   . LYS A 1 605 ? 15.439  34.673  -38.681 1.00 82.81  ? 631 LYS A N   1 
ATOM   4680  C CA  . LYS A 1 605 ? 15.132  33.464  -37.926 1.00 79.98  ? 631 LYS A CA  1 
ATOM   4681  C C   . LYS A 1 605 ? 15.961  33.351  -36.655 1.00 76.00  ? 631 LYS A C   1 
ATOM   4682  O O   . LYS A 1 605 ? 15.496  33.675  -35.564 1.00 74.46  ? 631 LYS A O   1 
ATOM   4683  C CB  . LYS A 1 605 ? 15.350  32.218  -38.787 1.00 83.25  ? 631 LYS A CB  1 
ATOM   4684  C CG  . LYS A 1 605 ? 15.030  30.918  -38.050 1.00 87.04  ? 631 LYS A CG  1 
ATOM   4685  C CD  . LYS A 1 605 ? 15.167  29.692  -38.943 1.00 89.98  ? 631 LYS A CD  1 
ATOM   4686  C CE  . LYS A 1 605 ? 14.747  28.425  -38.200 1.00 91.50  ? 631 LYS A CE  1 
ATOM   4687  N NZ  . LYS A 1 605 ? 14.822  27.208  -39.058 1.00 92.55  ? 631 LYS A NZ  1 
ATOM   4688  N N   . ASP A 1 606 ? 17.191  32.880  -36.807 1.00 73.25  ? 632 ASP A N   1 
ATOM   4689  C CA  . ASP A 1 606 ? 18.100  32.709  -35.682 1.00 69.49  ? 632 ASP A CA  1 
ATOM   4690  C C   . ASP A 1 606 ? 18.529  34.068  -35.132 1.00 64.63  ? 632 ASP A C   1 
ATOM   4691  O O   . ASP A 1 606 ? 18.571  34.275  -33.919 1.00 63.25  ? 632 ASP A O   1 
ATOM   4692  C CB  . ASP A 1 606 ? 19.332  31.928  -36.137 1.00 73.95  ? 632 ASP A CB  1 
ATOM   4693  C CG  . ASP A 1 606 ? 20.177  31.444  -34.980 1.00 78.01  ? 632 ASP A CG  1 
ATOM   4694  O OD1 . ASP A 1 606 ? 20.116  32.056  -33.891 1.00 80.14  ? 632 ASP A OD1 1 
ATOM   4695  O OD2 . ASP A 1 606 ? 20.915  30.452  -35.169 1.00 80.12  ? 632 ASP A OD2 1 
ATOM   4696  N N   . LYS A 1 607 ? 18.843  34.991  -36.035 1.00 58.40  ? 633 LYS A N   1 
ATOM   4697  C CA  . LYS A 1 607 ? 19.275  36.329  -35.657 1.00 54.50  ? 633 LYS A CA  1 
ATOM   4698  C C   . LYS A 1 607 ? 18.225  37.114  -34.866 1.00 53.82  ? 633 LYS A C   1 
ATOM   4699  O O   . LYS A 1 607 ? 18.509  38.188  -34.336 1.00 53.46  ? 633 LYS A O   1 
ATOM   4700  C CB  . LYS A 1 607 ? 19.660  37.123  -36.906 1.00 51.75  ? 633 LYS A CB  1 
ATOM   4701  C CG  . LYS A 1 607 ? 21.031  36.801  -37.470 1.00 48.90  ? 633 LYS A CG  1 
ATOM   4702  C CD  . LYS A 1 607 ? 21.094  35.432  -38.117 1.00 47.67  ? 633 LYS A CD  1 
ATOM   4703  C CE  . LYS A 1 607 ? 22.502  35.139  -38.610 1.00 45.45  ? 633 LYS A CE  1 
ATOM   4704  N NZ  . LYS A 1 607 ? 23.045  36.249  -39.446 1.00 41.17  ? 633 LYS A NZ  1 
ATOM   4705  N N   . LYS A 1 608 ? 17.017  36.571  -34.784 1.00 53.46  ? 634 LYS A N   1 
ATOM   4706  C CA  . LYS A 1 608 ? 15.917  37.222  -34.077 1.00 52.00  ? 634 LYS A CA  1 
ATOM   4707  C C   . LYS A 1 608 ? 16.281  37.713  -32.675 1.00 48.97  ? 634 LYS A C   1 
ATOM   4708  O O   . LYS A 1 608 ? 16.047  38.873  -32.327 1.00 47.19  ? 634 LYS A O   1 
ATOM   4709  C CB  . LYS A 1 608 ? 14.732  36.261  -33.999 1.00 55.70  ? 634 LYS A CB  1 
ATOM   4710  C CG  . LYS A 1 608 ? 13.567  36.741  -33.150 1.00 61.28  ? 634 LYS A CG  1 
ATOM   4711  C CD  . LYS A 1 608 ? 12.420  35.743  -33.221 1.00 66.38  ? 634 LYS A CD  1 
ATOM   4712  C CE  . LYS A 1 608 ? 12.879  34.334  -32.838 1.00 70.06  ? 634 LYS A CE  1 
ATOM   4713  N NZ  . LYS A 1 608 ? 11.812  33.304  -33.027 1.00 70.49  ? 634 LYS A NZ  1 
ATOM   4714  N N   . MET A 1 609 ? 16.857  36.822  -31.879 1.00 45.63  ? 635 MET A N   1 
ATOM   4715  C CA  . MET A 1 609 ? 17.247  37.136  -30.512 1.00 41.26  ? 635 MET A CA  1 
ATOM   4716  C C   . MET A 1 609 ? 18.332  38.205  -30.448 1.00 37.35  ? 635 MET A C   1 
ATOM   4717  O O   . MET A 1 609 ? 18.464  38.910  -29.454 1.00 35.03  ? 635 MET A O   1 
ATOM   4718  C CB  . MET A 1 609 ? 17.737  35.866  -29.829 1.00 42.68  ? 635 MET A CB  1 
ATOM   4719  C CG  . MET A 1 609 ? 17.861  35.976  -28.337 1.00 46.50  ? 635 MET A CG  1 
ATOM   4720  S SD  . MET A 1 609 ? 18.136  34.363  -27.601 1.00 47.18  ? 635 MET A SD  1 
ATOM   4721  C CE  . MET A 1 609 ? 19.652  34.691  -26.668 1.00 50.64  ? 635 MET A CE  1 
ATOM   4722  N N   . ASP A 1 610 ? 19.101  38.317  -31.523 1.00 34.39  ? 636 ASP A N   1 
ATOM   4723  C CA  . ASP A 1 610 ? 20.187  39.282  -31.608 1.00 31.31  ? 636 ASP A CA  1 
ATOM   4724  C C   . ASP A 1 610 ? 19.709  40.671  -32.011 1.00 30.04  ? 636 ASP A C   1 
ATOM   4725  O O   . ASP A 1 610 ? 20.183  41.676  -31.484 1.00 28.31  ? 636 ASP A O   1 
ATOM   4726  C CB  . ASP A 1 610 ? 21.221  38.799  -32.626 1.00 32.66  ? 636 ASP A CB  1 
ATOM   4727  C CG  . ASP A 1 610 ? 21.873  37.504  -32.219 1.00 34.25  ? 636 ASP A CG  1 
ATOM   4728  O OD1 . ASP A 1 610 ? 22.768  37.539  -31.349 1.00 35.07  ? 636 ASP A OD1 1 
ATOM   4729  O OD2 . ASP A 1 610 ? 21.487  36.448  -32.760 1.00 36.28  ? 636 ASP A OD2 1 
ATOM   4730  N N   . ALA A 1 611 ? 18.786  40.719  -32.967 1.00 28.30  ? 637 ALA A N   1 
ATOM   4731  C CA  . ALA A 1 611 ? 18.248  41.978  -33.466 1.00 26.95  ? 637 ALA A CA  1 
ATOM   4732  C C   . ALA A 1 611 ? 17.249  42.590  -32.495 1.00 27.17  ? 637 ALA A C   1 
ATOM   4733  O O   . ALA A 1 611 ? 17.151  43.803  -32.380 1.00 28.01  ? 637 ALA A O   1 
ATOM   4734  C CB  . ALA A 1 611 ? 17.586  41.755  -34.810 1.00 26.75  ? 637 ALA A CB  1 
ATOM   4735  N N   . HIS A 1 612 ? 16.501  41.744  -31.801 1.00 27.91  ? 638 HIS A N   1 
ATOM   4736  C CA  . HIS A 1 612 ? 15.513  42.228  -30.855 1.00 29.61  ? 638 HIS A CA  1 
ATOM   4737  C C   . HIS A 1 612 ? 15.627  41.465  -29.546 1.00 28.47  ? 638 HIS A C   1 
ATOM   4738  O O   . HIS A 1 612 ? 14.759  40.668  -29.204 1.00 30.77  ? 638 HIS A O   1 
ATOM   4739  C CB  . HIS A 1 612 ? 14.101  42.078  -31.438 1.00 31.51  ? 638 HIS A CB  1 
ATOM   4740  C CG  . HIS A 1 612 ? 13.864  42.893  -32.676 1.00 33.97  ? 638 HIS A CG  1 
ATOM   4741  N ND1 . HIS A 1 612 ? 13.773  42.333  -33.932 1.00 33.35  ? 638 HIS A ND1 1 
ATOM   4742  C CD2 . HIS A 1 612 ? 13.705  44.228  -32.850 1.00 33.93  ? 638 HIS A CD2 1 
ATOM   4743  C CE1 . HIS A 1 612 ? 13.571  43.288  -34.824 1.00 33.84  ? 638 HIS A CE1 1 
ATOM   4744  N NE2 . HIS A 1 612 ? 13.526  44.447  -34.193 1.00 32.25  ? 638 HIS A NE2 1 
ATOM   4745  N N   . PRO A 1 613 ? 16.704  41.706  -28.785 1.00 28.33  ? 639 PRO A N   1 
ATOM   4746  C CA  . PRO A 1 613 ? 16.848  40.988  -27.520 1.00 27.54  ? 639 PRO A CA  1 
ATOM   4747  C C   . PRO A 1 613 ? 15.709  41.308  -26.559 1.00 26.71  ? 639 PRO A C   1 
ATOM   4748  O O   . PRO A 1 613 ? 15.152  42.405  -26.593 1.00 22.99  ? 639 PRO A O   1 
ATOM   4749  C CB  . PRO A 1 613 ? 18.203  41.472  -27.005 1.00 27.37  ? 639 PRO A CB  1 
ATOM   4750  C CG  . PRO A 1 613 ? 18.258  42.883  -27.509 1.00 28.12  ? 639 PRO A CG  1 
ATOM   4751  C CD  . PRO A 1 613 ? 17.745  42.743  -28.927 1.00 27.24  ? 639 PRO A CD  1 
ATOM   4752  N N   . PRO A 1 614 ? 15.344  40.341  -25.698 1.00 26.32  ? 640 PRO A N   1 
ATOM   4753  C CA  . PRO A 1 614 ? 14.270  40.504  -24.711 1.00 24.73  ? 640 PRO A CA  1 
ATOM   4754  C C   . PRO A 1 614 ? 14.658  41.598  -23.707 1.00 24.52  ? 640 PRO A C   1 
ATOM   4755  O O   . PRO A 1 614 ? 15.843  41.843  -23.474 1.00 22.99  ? 640 PRO A O   1 
ATOM   4756  C CB  . PRO A 1 614 ? 14.191  39.128  -24.043 1.00 25.02  ? 640 PRO A CB  1 
ATOM   4757  C CG  . PRO A 1 614 ? 14.748  38.200  -25.080 1.00 28.65  ? 640 PRO A CG  1 
ATOM   4758  C CD  . PRO A 1 614 ? 15.907  38.982  -25.639 1.00 25.78  ? 640 PRO A CD  1 
ATOM   4759  N N   . ARG A 1 615 ? 13.659  42.252  -23.127 1.00 24.01  ? 641 ARG A N   1 
ATOM   4760  C CA  . ARG A 1 615 ? 13.888  43.309  -22.152 1.00 25.49  ? 641 ARG A CA  1 
ATOM   4761  C C   . ARG A 1 615 ? 12.881  43.128  -21.025 1.00 26.18  ? 641 ARG A C   1 
ATOM   4762  O O   . ARG A 1 615 ? 11.757  42.666  -21.243 1.00 23.97  ? 641 ARG A O   1 
ATOM   4763  C CB  . ARG A 1 615 ? 13.718  44.690  -22.800 1.00 28.68  ? 641 ARG A CB  1 
ATOM   4764  C CG  . ARG A 1 615 ? 14.643  44.940  -23.994 1.00 34.35  ? 641 ARG A CG  1 
ATOM   4765  C CD  . ARG A 1 615 ? 14.300  46.230  -24.756 1.00 40.44  ? 641 ARG A CD  1 
ATOM   4766  N NE  . ARG A 1 615 ? 14.543  47.433  -23.958 1.00 47.76  ? 641 ARG A NE  1 
ATOM   4767  C CZ  . ARG A 1 615 ? 14.400  48.684  -24.399 1.00 48.43  ? 641 ARG A CZ  1 
ATOM   4768  N NH1 . ARG A 1 615 ? 14.010  48.920  -25.645 1.00 48.23  ? 641 ARG A NH1 1 
ATOM   4769  N NH2 . ARG A 1 615 ? 14.645  49.704  -23.584 1.00 46.82  ? 641 ARG A NH2 1 
ATOM   4770  N N   . LEU A 1 616 ? 13.293  43.472  -19.811 1.00 26.11  ? 642 LEU A N   1 
ATOM   4771  C CA  . LEU A 1 616 ? 12.415  43.332  -18.663 1.00 24.88  ? 642 LEU A CA  1 
ATOM   4772  C C   . LEU A 1 616 ? 12.098  44.711  -18.083 1.00 24.23  ? 642 LEU A C   1 
ATOM   4773  O O   . LEU A 1 616 ? 12.996  45.516  -17.853 1.00 21.11  ? 642 LEU A O   1 
ATOM   4774  C CB  . LEU A 1 616 ? 13.075  42.422  -17.624 1.00 25.73  ? 642 LEU A CB  1 
ATOM   4775  C CG  . LEU A 1 616 ? 12.249  42.017  -16.397 1.00 29.41  ? 642 LEU A CG  1 
ATOM   4776  C CD1 . LEU A 1 616 ? 10.941  41.338  -16.819 1.00 27.61  ? 642 LEU A CD1 1 
ATOM   4777  C CD2 . LEU A 1 616 ? 13.087  41.090  -15.533 1.00 29.47  ? 642 LEU A CD2 1 
ATOM   4778  N N   . PHE A 1 617 ? 10.814  44.989  -17.874 1.00 26.05  ? 643 PHE A N   1 
ATOM   4779  C CA  . PHE A 1 617 ? 10.400  46.286  -17.340 1.00 29.03  ? 643 PHE A CA  1 
ATOM   4780  C C   . PHE A 1 617 ? 9.455   46.124  -16.168 1.00 30.62  ? 643 PHE A C   1 
ATOM   4781  O O   . PHE A 1 617 ? 8.915   45.043  -15.940 1.00 33.90  ? 643 PHE A O   1 
ATOM   4782  C CB  . PHE A 1 617 ? 9.669   47.131  -18.402 1.00 27.04  ? 643 PHE A CB  1 
ATOM   4783  C CG  . PHE A 1 617 ? 10.452  47.369  -19.668 1.00 27.93  ? 643 PHE A CG  1 
ATOM   4784  C CD1 . PHE A 1 617 ? 10.486  46.406  -20.679 1.00 25.81  ? 643 PHE A CD1 1 
ATOM   4785  C CD2 . PHE A 1 617 ? 11.116  48.585  -19.877 1.00 27.73  ? 643 PHE A CD2 1 
ATOM   4786  C CE1 . PHE A 1 617 ? 11.169  46.653  -21.883 1.00 25.52  ? 643 PHE A CE1 1 
ATOM   4787  C CE2 . PHE A 1 617 ? 11.803  48.839  -21.078 1.00 24.93  ? 643 PHE A CE2 1 
ATOM   4788  C CZ  . PHE A 1 617 ? 11.826  47.873  -22.081 1.00 24.89  ? 643 PHE A CZ  1 
ATOM   4789  N N   . ALA A 1 618 ? 9.257   47.219  -15.439 1.00 33.05  ? 644 ALA A N   1 
ATOM   4790  C CA  . ALA A 1 618 ? 8.343   47.267  -14.302 1.00 34.09  ? 644 ALA A CA  1 
ATOM   4791  C C   . ALA A 1 618 ? 7.212   48.200  -14.717 1.00 37.14  ? 644 ALA A C   1 
ATOM   4792  O O   . ALA A 1 618 ? 7.458   49.215  -15.378 1.00 34.12  ? 644 ALA A O   1 
ATOM   4793  C CB  . ALA A 1 618 ? 9.048   47.819  -13.089 1.00 34.28  ? 644 ALA A CB  1 
ATOM   4794  N N   . CYS A 1 619 ? 5.984   47.855  -14.329 1.00 43.37  ? 645 CYS A N   1 
ATOM   4795  C CA  . CYS A 1 619 ? 4.786   48.636  -14.663 1.00 48.70  ? 645 CYS A CA  1 
ATOM   4796  C C   . CYS A 1 619 ? 4.166   49.423  -13.518 1.00 52.24  ? 645 CYS A C   1 
ATOM   4797  O O   . CYS A 1 619 ? 4.044   48.920  -12.401 1.00 51.25  ? 645 CYS A O   1 
ATOM   4798  C CB  . CYS A 1 619 ? 3.699   47.721  -15.215 1.00 50.44  ? 645 CYS A CB  1 
ATOM   4799  S SG  . CYS A 1 619 ? 3.816   47.403  -16.946 1.00 52.09  ? 645 CYS A SG  1 
ATOM   4800  N N   . SER A 1 620 ? 3.739   50.645  -13.823 1.00 57.87  ? 646 SER A N   1 
ATOM   4801  C CA  . SER A 1 620 ? 3.099   51.518  -12.842 1.00 64.69  ? 646 SER A CA  1 
ATOM   4802  C C   . SER A 1 620 ? 2.036   52.386  -13.510 1.00 68.85  ? 646 SER A C   1 
ATOM   4803  O O   . SER A 1 620 ? 2.332   53.137  -14.442 1.00 67.11  ? 646 SER A O   1 
ATOM   4804  C CB  . SER A 1 620 ? 4.131   52.426  -12.170 1.00 64.41  ? 646 SER A CB  1 
ATOM   4805  O OG  . SER A 1 620 ? 5.127   51.669  -11.508 1.00 66.69  ? 646 SER A OG  1 
ATOM   4806  N N   . ASN A 1 621 ? 0.799   52.266  -13.033 1.00 75.46  ? 647 ASN A N   1 
ATOM   4807  C CA  . ASN A 1 621 ? -0.328  53.045  -13.549 1.00 81.03  ? 647 ASN A CA  1 
ATOM   4808  C C   . ASN A 1 621 ? -0.742  54.041  -12.476 1.00 84.17  ? 647 ASN A C   1 
ATOM   4809  O O   . ASN A 1 621 ? -1.604  54.889  -12.700 1.00 84.76  ? 647 ASN A O   1 
ATOM   4810  C CB  . ASN A 1 621 ? -1.526  52.140  -13.870 1.00 82.56  ? 647 ASN A CB  1 
ATOM   4811  C CG  . ASN A 1 621 ? -1.349  51.363  -15.162 1.00 84.75  ? 647 ASN A CG  1 
ATOM   4812  O OD1 . ASN A 1 621 ? -2.255  50.649  -15.600 1.00 84.97  ? 647 ASN A OD1 1 
ATOM   4813  N ND2 . ASN A 1 621 ? -0.182  51.499  -15.780 1.00 86.57  ? 647 ASN A ND2 1 
ATOM   4814  N N   . LYS A 1 622 ? -0.115  53.916  -11.310 1.00 88.10  ? 648 LYS A N   1 
ATOM   4815  C CA  . LYS A 1 622 ? -0.385  54.768  -10.156 1.00 91.95  ? 648 LYS A CA  1 
ATOM   4816  C C   . LYS A 1 622 ? -0.812  56.191  -10.509 1.00 93.52  ? 648 LYS A C   1 
ATOM   4817  O O   . LYS A 1 622 ? -0.100  56.918  -11.208 1.00 93.41  ? 648 LYS A O   1 
ATOM   4818  C CB  . LYS A 1 622 ? 0.847   54.811  -9.245  1.00 93.55  ? 648 LYS A CB  1 
ATOM   4819  C CG  . LYS A 1 622 ? 1.291   53.442  -8.745  1.00 95.16  ? 648 LYS A CG  1 
ATOM   4820  C CD  . LYS A 1 622 ? 2.563   53.533  -7.917  1.00 96.71  ? 648 LYS A CD  1 
ATOM   4821  C CE  . LYS A 1 622 ? 3.048   52.150  -7.503  1.00 97.20  ? 648 LYS A CE  1 
ATOM   4822  N NZ  . LYS A 1 622 ? 4.324   52.213  -6.734  1.00 98.45  ? 648 LYS A NZ  1 
ATOM   4823  N N   . ILE A 1 623 ? -1.988  56.570  -10.016 1.00 94.69  ? 649 ILE A N   1 
ATOM   4824  C CA  . ILE A 1 623 ? -2.548  57.899  -10.239 1.00 96.01  ? 649 ILE A CA  1 
ATOM   4825  C C   . ILE A 1 623 ? -2.715  58.241  -11.722 1.00 95.61  ? 649 ILE A C   1 
ATOM   4826  O O   . ILE A 1 623 ? -2.073  59.161  -12.234 1.00 95.74  ? 649 ILE A O   1 
ATOM   4827  C CB  . ILE A 1 623 ? -1.671  58.984  -9.574  1.00 97.15  ? 649 ILE A CB  1 
ATOM   4828  C CG1 . ILE A 1 623 ? -1.278  58.549  -8.156  1.00 97.66  ? 649 ILE A CG1 1 
ATOM   4829  C CG2 . ILE A 1 623 ? -2.426  60.309  -9.538  1.00 98.09  ? 649 ILE A CG2 1 
ATOM   4830  C CD1 . ILE A 1 623 ? -2.448  58.298  -7.225  1.00 97.97  ? 649 ILE A CD1 1 
ATOM   4831  N N   . GLY A 1 624 ? -3.581  57.492  -12.401 1.00 94.77  ? 650 GLY A N   1 
ATOM   4832  C CA  . GLY A 1 624 ? -3.848  57.723  -13.812 1.00 93.61  ? 650 GLY A CA  1 
ATOM   4833  C C   . GLY A 1 624 ? -2.649  57.992  -14.707 1.00 92.56  ? 650 GLY A C   1 
ATOM   4834  O O   . GLY A 1 624 ? -2.805  58.483  -15.830 1.00 93.17  ? 650 GLY A O   1 
ATOM   4835  N N   . ARG A 1 625 ? -1.453  57.675  -14.222 1.00 90.56  ? 651 ARG A N   1 
ATOM   4836  C CA  . ARG A 1 625 ? -0.230  57.884  -14.997 1.00 86.95  ? 651 ARG A CA  1 
ATOM   4837  C C   . ARG A 1 625 ? 0.469   56.552  -15.278 1.00 81.86  ? 651 ARG A C   1 
ATOM   4838  O O   . ARG A 1 625 ? 0.763   55.789  -14.357 1.00 81.59  ? 651 ARG A O   1 
ATOM   4839  C CB  . ARG A 1 625 ? 0.719   58.822  -14.242 1.00 89.99  ? 651 ARG A CB  1 
ATOM   4840  C CG  . ARG A 1 625 ? 2.106   58.922  -14.857 1.00 92.62  ? 651 ARG A CG  1 
ATOM   4841  C CD  . ARG A 1 625 ? 2.075   59.545  -16.243 1.00 95.05  ? 651 ARG A CD  1 
ATOM   4842  N NE  . ARG A 1 625 ? 1.936   60.998  -16.197 1.00 97.60  ? 651 ARG A NE  1 
ATOM   4843  C CZ  . ARG A 1 625 ? 2.000   61.787  -17.265 1.00 98.91  ? 651 ARG A CZ  1 
ATOM   4844  N NH1 . ARG A 1 625 ? 2.199   61.266  -18.470 1.00 99.18  ? 651 ARG A NH1 1 
ATOM   4845  N NH2 . ARG A 1 625 ? 1.873   63.101  -17.129 1.00 100.11 ? 651 ARG A NH2 1 
ATOM   4846  N N   . PHE A 1 626 ? 0.725   56.279  -16.555 1.00 74.95  ? 652 PHE A N   1 
ATOM   4847  C CA  . PHE A 1 626 ? 1.389   55.045  -16.959 1.00 67.95  ? 652 PHE A CA  1 
ATOM   4848  C C   . PHE A 1 626 ? 2.886   55.283  -17.110 1.00 64.51  ? 652 PHE A C   1 
ATOM   4849  O O   . PHE A 1 626 ? 3.311   56.078  -17.946 1.00 64.36  ? 652 PHE A O   1 
ATOM   4850  C CB  . PHE A 1 626 ? 0.823   54.542  -18.292 1.00 65.44  ? 652 PHE A CB  1 
ATOM   4851  C CG  . PHE A 1 626 ? 1.473   53.277  -18.787 1.00 62.58  ? 652 PHE A CG  1 
ATOM   4852  C CD1 . PHE A 1 626 ? 1.208   52.057  -18.176 1.00 60.76  ? 652 PHE A CD1 1 
ATOM   4853  C CD2 . PHE A 1 626 ? 2.376   53.310  -19.847 1.00 60.97  ? 652 PHE A CD2 1 
ATOM   4854  C CE1 . PHE A 1 626 ? 1.832   50.888  -18.607 1.00 59.50  ? 652 PHE A CE1 1 
ATOM   4855  C CE2 . PHE A 1 626 ? 3.006   52.147  -20.286 1.00 58.82  ? 652 PHE A CE2 1 
ATOM   4856  C CZ  . PHE A 1 626 ? 2.732   50.934  -19.663 1.00 57.69  ? 652 PHE A CZ  1 
ATOM   4857  N N   . VAL A 1 627 ? 3.683   54.592  -16.303 1.00 60.25  ? 653 VAL A N   1 
ATOM   4858  C CA  . VAL A 1 627 ? 5.128   54.747  -16.373 1.00 56.09  ? 653 VAL A CA  1 
ATOM   4859  C C   . VAL A 1 627 ? 5.827   53.387  -16.348 1.00 52.53  ? 653 VAL A C   1 
ATOM   4860  O O   . VAL A 1 627 ? 5.381   52.460  -15.670 1.00 49.91  ? 653 VAL A O   1 
ATOM   4861  C CB  . VAL A 1 627 ? 5.645   55.624  -15.207 1.00 57.35  ? 653 VAL A CB  1 
ATOM   4862  C CG1 . VAL A 1 627 ? 5.650   54.830  -13.910 1.00 57.63  ? 653 VAL A CG1 1 
ATOM   4863  C CG2 . VAL A 1 627 ? 7.031   56.162  -15.534 1.00 59.54  ? 653 VAL A CG2 1 
ATOM   4864  N N   . ILE A 1 628 ? 6.916   53.269  -17.101 1.00 49.48  ? 654 ILE A N   1 
ATOM   4865  C CA  . ILE A 1 628 ? 7.663   52.020  -17.160 1.00 47.72  ? 654 ILE A CA  1 
ATOM   4866  C C   . ILE A 1 628 ? 9.141   52.225  -16.871 1.00 47.02  ? 654 ILE A C   1 
ATOM   4867  O O   . ILE A 1 628 ? 9.763   53.157  -17.385 1.00 46.93  ? 654 ILE A O   1 
ATOM   4868  C CB  . ILE A 1 628 ? 7.558   51.355  -18.552 1.00 48.53  ? 654 ILE A CB  1 
ATOM   4869  C CG1 . ILE A 1 628 ? 8.207   52.257  -19.608 1.00 47.30  ? 654 ILE A CG1 1 
ATOM   4870  C CG2 . ILE A 1 628 ? 6.103   51.085  -18.897 1.00 46.12  ? 654 ILE A CG2 1 
ATOM   4871  C CD1 . ILE A 1 628 ? 8.408   51.593  -20.957 1.00 46.57  ? 654 ILE A CD1 1 
ATOM   4872  N N   . GLU A 1 629 ? 9.706   51.352  -16.049 1.00 46.28  ? 655 GLU A N   1 
ATOM   4873  C CA  . GLU A 1 629 ? 11.123  51.440  -15.735 1.00 45.03  ? 655 GLU A CA  1 
ATOM   4874  C C   . GLU A 1 629 ? 11.771  50.098  -16.045 1.00 40.92  ? 655 GLU A C   1 
ATOM   4875  O O   . GLU A 1 629 ? 11.336  49.052  -15.556 1.00 39.42  ? 655 GLU A O   1 
ATOM   4876  C CB  . GLU A 1 629 ? 11.348  51.787  -14.262 1.00 51.57  ? 655 GLU A CB  1 
ATOM   4877  C CG  . GLU A 1 629 ? 12.704  52.450  -14.016 1.00 61.55  ? 655 GLU A CG  1 
ATOM   4878  C CD  . GLU A 1 629 ? 13.148  52.396  -12.563 1.00 66.38  ? 655 GLU A CD  1 
ATOM   4879  O OE1 . GLU A 1 629 ? 12.340  52.731  -11.668 1.00 70.12  ? 655 GLU A OE1 1 
ATOM   4880  O OE2 . GLU A 1 629 ? 14.316  52.022  -12.323 1.00 68.54  ? 655 GLU A OE2 1 
ATOM   4881  N N   . GLU A 1 630 ? 12.812  50.137  -16.867 1.00 36.05  ? 656 GLU A N   1 
ATOM   4882  C CA  . GLU A 1 630 ? 13.533  48.936  -17.262 1.00 31.40  ? 656 GLU A CA  1 
ATOM   4883  C C   . GLU A 1 630 ? 14.459  48.408  -16.164 1.00 28.27  ? 656 GLU A C   1 
ATOM   4884  O O   . GLU A 1 630 ? 15.080  49.180  -15.437 1.00 28.48  ? 656 GLU A O   1 
ATOM   4885  C CB  . GLU A 1 630 ? 14.334  49.233  -18.533 1.00 31.26  ? 656 GLU A CB  1 
ATOM   4886  C CG  . GLU A 1 630 ? 15.373  48.191  -18.894 1.00 33.22  ? 656 GLU A CG  1 
ATOM   4887  C CD  . GLU A 1 630 ? 15.831  48.288  -20.343 1.00 34.10  ? 656 GLU A CD  1 
ATOM   4888  O OE1 . GLU A 1 630 ? 15.945  49.422  -20.873 1.00 36.66  ? 656 GLU A OE1 1 
ATOM   4889  O OE2 . GLU A 1 630 ? 16.089  47.225  -20.945 1.00 30.40  ? 656 GLU A OE2 1 
ATOM   4890  N N   . VAL A 1 631 ? 14.523  47.092  -16.016 1.00 23.00  ? 657 VAL A N   1 
ATOM   4891  C CA  . VAL A 1 631 ? 15.411  46.518  -15.024 1.00 23.15  ? 657 VAL A CA  1 
ATOM   4892  C C   . VAL A 1 631 ? 16.609  45.953  -15.801 1.00 24.82  ? 657 VAL A C   1 
ATOM   4893  O O   . VAL A 1 631 ? 16.480  45.019  -16.595 1.00 25.15  ? 657 VAL A O   1 
ATOM   4894  C CB  . VAL A 1 631 ? 14.683  45.450  -14.135 1.00 21.59  ? 657 VAL A CB  1 
ATOM   4895  C CG1 . VAL A 1 631 ? 13.466  44.925  -14.837 1.00 23.85  ? 657 VAL A CG1 1 
ATOM   4896  C CG2 . VAL A 1 631 ? 15.629  44.332  -13.756 1.00 14.23  ? 657 VAL A CG2 1 
ATOM   4897  N N   . PRO A 1 632 ? 17.795  46.550  -15.594 1.00 25.03  ? 658 PRO A N   1 
ATOM   4898  C CA  . PRO A 1 632 ? 19.041  46.156  -16.259 1.00 24.09  ? 658 PRO A CA  1 
ATOM   4899  C C   . PRO A 1 632 ? 19.719  44.873  -15.788 1.00 23.03  ? 658 PRO A C   1 
ATOM   4900  O O   . PRO A 1 632 ? 19.435  44.355  -14.708 1.00 23.39  ? 658 PRO A O   1 
ATOM   4901  C CB  . PRO A 1 632 ? 19.919  47.386  -16.064 1.00 24.79  ? 658 PRO A CB  1 
ATOM   4902  C CG  . PRO A 1 632 ? 19.504  47.849  -14.697 1.00 26.96  ? 658 PRO A CG  1 
ATOM   4903  C CD  . PRO A 1 632 ? 18.007  47.727  -14.729 1.00 24.01  ? 658 PRO A CD  1 
ATOM   4904  N N   . GLY A 1 633 ? 20.618  44.364  -16.628 1.00 23.03  ? 659 GLY A N   1 
ATOM   4905  C CA  . GLY A 1 633 ? 21.353  43.155  -16.309 1.00 21.45  ? 659 GLY A CA  1 
ATOM   4906  C C   . GLY A 1 633 ? 20.702  41.867  -16.767 1.00 23.85  ? 659 GLY A C   1 
ATOM   4907  O O   . GLY A 1 633 ? 19.659  41.873  -17.427 1.00 22.19  ? 659 GLY A O   1 
ATOM   4908  N N   . GLU A 1 634 ? 21.338  40.754  -16.415 1.00 27.43  ? 660 GLU A N   1 
ATOM   4909  C CA  . GLU A 1 634 ? 20.845  39.425  -16.751 1.00 30.02  ? 660 GLU A CA  1 
ATOM   4910  C C   . GLU A 1 634 ? 19.534  39.247  -16.004 1.00 29.09  ? 660 GLU A C   1 
ATOM   4911  O O   . GLU A 1 634 ? 19.413  39.671  -14.854 1.00 23.71  ? 660 GLU A O   1 
ATOM   4912  C CB  . GLU A 1 634 ? 21.833  38.366  -16.275 1.00 34.44  ? 660 GLU A CB  1 
ATOM   4913  C CG  . GLU A 1 634 ? 23.271  38.674  -16.621 1.00 47.54  ? 660 GLU A CG  1 
ATOM   4914  C CD  . GLU A 1 634 ? 24.256  37.936  -15.724 1.00 56.20  ? 660 GLU A CD  1 
ATOM   4915  O OE1 . GLU A 1 634 ? 24.212  38.142  -14.486 1.00 60.01  ? 660 GLU A OE1 1 
ATOM   4916  O OE2 . GLU A 1 634 ? 25.074  37.152  -16.258 1.00 61.26  ? 660 GLU A OE2 1 
ATOM   4917  N N   . PHE A 1 635 ? 18.556  38.623  -16.653 1.00 29.28  ? 661 PHE A N   1 
ATOM   4918  C CA  . PHE A 1 635 ? 17.257  38.396  -16.023 1.00 29.11  ? 661 PHE A CA  1 
ATOM   4919  C C   . PHE A 1 635 ? 17.366  37.500  -14.784 1.00 28.31  ? 661 PHE A C   1 
ATOM   4920  O O   . PHE A 1 635 ? 17.854  36.368  -14.852 1.00 25.18  ? 661 PHE A O   1 
ATOM   4921  C CB  . PHE A 1 635 ? 16.281  37.787  -17.036 1.00 27.77  ? 661 PHE A CB  1 
ATOM   4922  C CG  . PHE A 1 635 ? 16.067  38.642  -18.256 1.00 28.37  ? 661 PHE A CG  1 
ATOM   4923  C CD1 . PHE A 1 635 ? 15.932  40.022  -18.138 1.00 27.79  ? 661 PHE A CD1 1 
ATOM   4924  C CD2 . PHE A 1 635 ? 15.995  38.072  -19.522 1.00 28.24  ? 661 PHE A CD2 1 
ATOM   4925  C CE1 . PHE A 1 635 ? 15.732  40.824  -19.264 1.00 23.91  ? 661 PHE A CE1 1 
ATOM   4926  C CE2 . PHE A 1 635 ? 15.794  38.868  -20.651 1.00 28.06  ? 661 PHE A CE2 1 
ATOM   4927  C CZ  . PHE A 1 635 ? 15.662  40.248  -20.517 1.00 24.37  ? 661 PHE A CZ  1 
ATOM   4928  N N   . MET A 1 636 ? 16.911  38.021  -13.649 1.00 29.77  ? 662 MET A N   1 
ATOM   4929  C CA  . MET A 1 636 ? 16.962  37.283  -12.394 1.00 32.67  ? 662 MET A CA  1 
ATOM   4930  C C   . MET A 1 636 ? 15.619  37.230  -11.687 1.00 32.95  ? 662 MET A C   1 
ATOM   4931  O O   . MET A 1 636 ? 14.885  38.216  -11.640 1.00 33.29  ? 662 MET A O   1 
ATOM   4932  C CB  . MET A 1 636 ? 17.993  37.909  -11.467 1.00 35.42  ? 662 MET A CB  1 
ATOM   4933  C CG  . MET A 1 636 ? 19.380  37.957  -12.059 1.00 42.79  ? 662 MET A CG  1 
ATOM   4934  S SD  . MET A 1 636 ? 20.578  38.427  -10.826 1.00 50.36  ? 662 MET A SD  1 
ATOM   4935  C CE  . MET A 1 636 ? 20.874  36.811  -10.051 1.00 50.56  ? 662 MET A CE  1 
ATOM   4936  N N   . GLN A 1 637 ? 15.314  36.067  -11.130 1.00 33.91  ? 663 GLN A N   1 
ATOM   4937  C CA  . GLN A 1 637 ? 14.065  35.843  -10.428 1.00 34.51  ? 663 GLN A CA  1 
ATOM   4938  C C   . GLN A 1 637 ? 13.932  36.750  -9.224  1.00 34.85  ? 663 GLN A C   1 
ATOM   4939  O O   . GLN A 1 637 ? 12.828  37.076  -8.803  1.00 34.16  ? 663 GLN A O   1 
ATOM   4940  C CB  . GLN A 1 637 ? 13.988  34.385  -9.995  1.00 36.29  ? 663 GLN A CB  1 
ATOM   4941  C CG  . GLN A 1 637 ? 12.757  34.010  -9.202  1.00 38.20  ? 663 GLN A CG  1 
ATOM   4942  C CD  . GLN A 1 637 ? 12.689  32.517  -8.979  1.00 37.65  ? 663 GLN A CD  1 
ATOM   4943  O OE1 . GLN A 1 637 ? 13.720  31.858  -8.860  1.00 38.35  ? 663 GLN A OE1 1 
ATOM   4944  N NE2 . GLN A 1 637 ? 11.478  31.975  -8.913  1.00 38.14  ? 663 GLN A NE2 1 
ATOM   4945  N N   . GLU A 1 638 ? 15.069  37.161  -8.680  1.00 36.52  ? 664 GLU A N   1 
ATOM   4946  C CA  . GLU A 1 638 ? 15.109  38.032  -7.515  1.00 37.59  ? 664 GLU A CA  1 
ATOM   4947  C C   . GLU A 1 638 ? 14.536  39.400  -7.851  1.00 36.34  ? 664 GLU A C   1 
ATOM   4948  O O   . GLU A 1 638 ? 14.072  40.119  -6.974  1.00 39.40  ? 664 GLU A O   1 
ATOM   4949  C CB  . GLU A 1 638 ? 16.554  38.185  -7.027  1.00 41.88  ? 664 GLU A CB  1 
ATOM   4950  C CG  . GLU A 1 638 ? 17.256  36.863  -6.693  1.00 49.99  ? 664 GLU A CG  1 
ATOM   4951  C CD  . GLU A 1 638 ? 17.453  35.958  -7.907  1.00 52.83  ? 664 GLU A CD  1 
ATOM   4952  O OE1 . GLU A 1 638 ? 18.144  36.376  -8.860  1.00 55.41  ? 664 GLU A OE1 1 
ATOM   4953  O OE2 . GLU A 1 638 ? 16.918  34.827  -7.911  1.00 53.74  ? 664 GLU A OE2 1 
ATOM   4954  N N   . ASP A 1 639 ? 14.567  39.753  -9.129  1.00 34.51  ? 665 ASP A N   1 
ATOM   4955  C CA  . ASP A 1 639 ? 14.059  41.041  -9.586  1.00 34.27  ? 665 ASP A CA  1 
ATOM   4956  C C   . ASP A 1 639 ? 12.535  41.124  -9.680  1.00 33.40  ? 665 ASP A C   1 
ATOM   4957  O O   . ASP A 1 639 ? 11.981  42.208  -9.859  1.00 31.56  ? 665 ASP A O   1 
ATOM   4958  C CB  . ASP A 1 639 ? 14.667  41.388  -10.952 1.00 33.20  ? 665 ASP A CB  1 
ATOM   4959  C CG  . ASP A 1 639 ? 16.134  41.747  -10.858 1.00 32.67  ? 665 ASP A CG  1 
ATOM   4960  O OD1 . ASP A 1 639 ? 16.497  42.459  -9.893  1.00 29.96  ? 665 ASP A OD1 1 
ATOM   4961  O OD2 . ASP A 1 639 ? 16.917  41.334  -11.747 1.00 32.71  ? 665 ASP A OD2 1 
ATOM   4962  N N   . LEU A 1 640 ? 11.864  39.982  -9.573  1.00 32.01  ? 666 LEU A N   1 
ATOM   4963  C CA  . LEU A 1 640 ? 10.408  39.941  -9.658  1.00 33.61  ? 666 LEU A CA  1 
ATOM   4964  C C   . LEU A 1 640 ? 9.744   40.288  -8.317  1.00 34.19  ? 666 LEU A C   1 
ATOM   4965  O O   . LEU A 1 640 ? 9.507   39.411  -7.485  1.00 36.46  ? 666 LEU A O   1 
ATOM   4966  C CB  . LEU A 1 640 ? 9.966   38.553  -10.149 1.00 29.86  ? 666 LEU A CB  1 
ATOM   4967  C CG  . LEU A 1 640 ? 9.796   38.325  -11.665 1.00 31.61  ? 666 LEU A CG  1 
ATOM   4968  C CD1 . LEU A 1 640 ? 10.644  39.286  -12.475 1.00 29.18  ? 666 LEU A CD1 1 
ATOM   4969  C CD2 . LEU A 1 640 ? 10.151  36.879  -12.002 1.00 27.33  ? 666 LEU A CD2 1 
ATOM   4970  N N   . ALA A 1 641 ? 9.456   41.574  -8.115  1.00 32.98  ? 667 ALA A N   1 
ATOM   4971  C CA  . ALA A 1 641 ? 8.825   42.053  -6.882  1.00 31.97  ? 667 ALA A CA  1 
ATOM   4972  C C   . ALA A 1 641 ? 7.379   41.572  -6.804  1.00 31.11  ? 667 ALA A C   1 
ATOM   4973  O O   . ALA A 1 641 ? 6.548   41.970  -7.618  1.00 27.85  ? 667 ALA A O   1 
ATOM   4974  C CB  . ALA A 1 641 ? 8.875   43.574  -6.829  1.00 32.05  ? 667 ALA A CB  1 
ATOM   4975  N N   . THR A 1 642 ? 7.081   40.732  -5.816  1.00 31.17  ? 668 THR A N   1 
ATOM   4976  C CA  . THR A 1 642 ? 5.741   40.175  -5.660  1.00 33.41  ? 668 THR A CA  1 
ATOM   4977  C C   . THR A 1 642 ? 4.626   41.210  -5.565  1.00 32.17  ? 668 THR A C   1 
ATOM   4978  O O   . THR A 1 642 ? 3.454   40.862  -5.634  1.00 32.49  ? 668 THR A O   1 
ATOM   4979  C CB  . THR A 1 642 ? 5.639   39.261  -4.423  1.00 35.03  ? 668 THR A CB  1 
ATOM   4980  O OG1 . THR A 1 642 ? 5.690   40.058  -3.239  1.00 36.82  ? 668 THR A OG1 1 
ATOM   4981  C CG2 . THR A 1 642 ? 6.780   38.261  -4.401  1.00 36.11  ? 668 THR A CG2 1 
ATOM   4982  N N   . ASP A 1 643 ? 4.984   42.475  -5.413  1.00 32.34  ? 669 ASP A N   1 
ATOM   4983  C CA  . ASP A 1 643 ? 3.984   43.526  -5.320  1.00 33.22  ? 669 ASP A CA  1 
ATOM   4984  C C   . ASP A 1 643 ? 4.037   44.409  -6.566  1.00 33.50  ? 669 ASP A C   1 
ATOM   4985  O O   . ASP A 1 643 ? 3.491   45.513  -6.586  1.00 34.29  ? 669 ASP A O   1 
ATOM   4986  C CB  . ASP A 1 643 ? 4.222   44.353  -4.061  1.00 33.12  ? 669 ASP A CB  1 
ATOM   4987  C CG  . ASP A 1 643 ? 5.527   45.107  -4.105  1.00 37.25  ? 669 ASP A CG  1 
ATOM   4988  O OD1 . ASP A 1 643 ? 6.503   44.582  -4.694  1.00 37.87  ? 669 ASP A OD1 1 
ATOM   4989  O OD2 . ASP A 1 643 ? 5.578   46.223  -3.544  1.00 38.68  ? 669 ASP A OD2 1 
ATOM   4990  N N   . ASP A 1 644 ? 4.695   43.901  -7.604  1.00 32.94  ? 670 ASP A N   1 
ATOM   4991  C CA  . ASP A 1 644 ? 4.824   44.601  -8.878  1.00 32.41  ? 670 ASP A CA  1 
ATOM   4992  C C   . ASP A 1 644 ? 4.201   43.833  -10.041 1.00 29.78  ? 670 ASP A C   1 
ATOM   4993  O O   . ASP A 1 644 ? 3.878   42.651  -9.929  1.00 26.93  ? 670 ASP A O   1 
ATOM   4994  C CB  . ASP A 1 644 ? 6.299   44.832  -9.225  1.00 34.93  ? 670 ASP A CB  1 
ATOM   4995  C CG  . ASP A 1 644 ? 6.840   46.101  -8.636  1.00 38.81  ? 670 ASP A CG  1 
ATOM   4996  O OD1 . ASP A 1 644 ? 6.219   47.164  -8.848  1.00 41.64  ? 670 ASP A OD1 1 
ATOM   4997  O OD2 . ASP A 1 644 ? 7.890   46.039  -7.968  1.00 39.38  ? 670 ASP A OD2 1 
ATOM   4998  N N   . VAL A 1 645 ? 4.042   44.534  -11.160 1.00 28.54  ? 671 VAL A N   1 
ATOM   4999  C CA  . VAL A 1 645 ? 3.531   43.946  -12.388 1.00 28.51  ? 671 VAL A CA  1 
ATOM   5000  C C   . VAL A 1 645 ? 4.649   44.164  -13.393 1.00 27.39  ? 671 VAL A C   1 
ATOM   5001  O O   . VAL A 1 645 ? 4.928   45.295  -13.785 1.00 27.99  ? 671 VAL A O   1 
ATOM   5002  C CB  . VAL A 1 645 ? 2.247   44.639  -12.894 1.00 30.99  ? 671 VAL A CB  1 
ATOM   5003  C CG1 . VAL A 1 645 ? 1.908   44.132  -14.294 1.00 29.17  ? 671 VAL A CG1 1 
ATOM   5004  C CG2 . VAL A 1 645 ? 1.084   44.339  -11.951 1.00 30.67  ? 671 VAL A CG2 1 
ATOM   5005  N N   . MET A 1 646 ? 5.289   43.073  -13.796 1.00 26.10  ? 672 MET A N   1 
ATOM   5006  C CA  . MET A 1 646 ? 6.413   43.115  -14.725 1.00 27.44  ? 672 MET A CA  1 
ATOM   5007  C C   . MET A 1 646 ? 6.037   42.797  -16.167 1.00 27.87  ? 672 MET A C   1 
ATOM   5008  O O   . MET A 1 646 ? 5.054   42.106  -16.430 1.00 29.69  ? 672 MET A O   1 
ATOM   5009  C CB  . MET A 1 646 ? 7.479   42.111  -14.275 1.00 27.09  ? 672 MET A CB  1 
ATOM   5010  C CG  . MET A 1 646 ? 7.863   42.203  -12.807 1.00 32.27  ? 672 MET A CG  1 
ATOM   5011  S SD  . MET A 1 646 ? 8.628   43.778  -12.392 1.00 37.28  ? 672 MET A SD  1 
ATOM   5012  C CE  . MET A 1 646 ? 10.302  43.482  -12.925 1.00 34.32  ? 672 MET A CE  1 
ATOM   5013  N N   . LEU A 1 647 ? 6.842   43.292  -17.099 1.00 28.47  ? 673 LEU A N   1 
ATOM   5014  C CA  . LEU A 1 647 ? 6.630   43.029  -18.517 1.00 28.37  ? 673 LEU A CA  1 
ATOM   5015  C C   . LEU A 1 647 ? 7.898   42.433  -19.133 1.00 27.16  ? 673 LEU A C   1 
ATOM   5016  O O   . LEU A 1 647 ? 8.939   43.090  -19.181 1.00 26.78  ? 673 LEU A O   1 
ATOM   5017  C CB  . LEU A 1 647 ? 6.279   44.316  -19.276 1.00 31.31  ? 673 LEU A CB  1 
ATOM   5018  C CG  . LEU A 1 647 ? 4.936   45.004  -19.053 1.00 34.09  ? 673 LEU A CG  1 
ATOM   5019  C CD1 . LEU A 1 647 ? 4.792   46.129  -20.070 1.00 34.76  ? 673 LEU A CD1 1 
ATOM   5020  C CD2 . LEU A 1 647 ? 3.795   44.011  -19.211 1.00 36.65  ? 673 LEU A CD2 1 
ATOM   5021  N N   . LEU A 1 648 ? 7.816   41.186  -19.586 1.00 25.48  ? 674 LEU A N   1 
ATOM   5022  C CA  . LEU A 1 648 ? 8.957   40.546  -20.225 1.00 22.31  ? 674 LEU A CA  1 
ATOM   5023  C C   . LEU A 1 648 ? 8.659   40.725  -21.693 1.00 22.68  ? 674 LEU A C   1 
ATOM   5024  O O   . LEU A 1 648 ? 7.838   40.002  -22.262 1.00 22.77  ? 674 LEU A O   1 
ATOM   5025  C CB  . LEU A 1 648 ? 9.024   39.048  -19.911 1.00 22.96  ? 674 LEU A CB  1 
ATOM   5026  C CG  . LEU A 1 648 ? 10.378  38.315  -19.901 1.00 24.54  ? 674 LEU A CG  1 
ATOM   5027  C CD1 . LEU A 1 648 ? 10.137  36.860  -20.234 1.00 26.62  ? 674 LEU A CD1 1 
ATOM   5028  C CD2 . LEU A 1 648 ? 11.354  38.890  -20.907 1.00 22.37  ? 674 LEU A CD2 1 
ATOM   5029  N N   . ASP A 1 649 ? 9.307   41.704  -22.305 1.00 24.16  ? 675 ASP A N   1 
ATOM   5030  C CA  . ASP A 1 649 ? 9.091   41.960  -23.714 1.00 25.51  ? 675 ASP A CA  1 
ATOM   5031  C C   . ASP A 1 649 ? 9.961   41.100  -24.614 1.00 26.92  ? 675 ASP A C   1 
ATOM   5032  O O   . ASP A 1 649 ? 11.119  41.414  -24.867 1.00 28.16  ? 675 ASP A O   1 
ATOM   5033  C CB  . ASP A 1 649 ? 9.319   43.447  -24.036 1.00 23.23  ? 675 ASP A CB  1 
ATOM   5034  C CG  . ASP A 1 649 ? 9.170   43.769  -25.534 1.00 24.12  ? 675 ASP A CG  1 
ATOM   5035  O OD1 . ASP A 1 649 ? 8.727   42.899  -26.301 1.00 19.29  ? 675 ASP A OD1 1 
ATOM   5036  O OD2 . ASP A 1 649 ? 9.490   44.908  -25.951 1.00 23.47  ? 675 ASP A OD2 1 
ATOM   5037  N N   . THR A 1 650 ? 9.403   39.983  -25.061 1.00 28.73  ? 676 THR A N   1 
ATOM   5038  C CA  . THR A 1 650 ? 10.089  39.133  -26.024 1.00 31.60  ? 676 THR A CA  1 
ATOM   5039  C C   . THR A 1 650 ? 9.800   39.994  -27.238 1.00 33.99  ? 676 THR A C   1 
ATOM   5040  O O   . THR A 1 650 ? 9.052   40.962  -27.120 1.00 38.54  ? 676 THR A O   1 
ATOM   5041  C CB  . THR A 1 650 ? 9.370   37.785  -26.194 1.00 28.36  ? 676 THR A CB  1 
ATOM   5042  O OG1 . THR A 1 650 ? 9.734   36.912  -25.120 1.00 25.19  ? 676 THR A OG1 1 
ATOM   5043  C CG2 . THR A 1 650 ? 9.729   37.155  -27.524 1.00 33.11  ? 676 THR A CG2 1 
ATOM   5044  N N   . TRP A 1 651 ? 10.352  39.712  -28.402 1.00 34.79  ? 677 TRP A N   1 
ATOM   5045  C CA  . TRP A 1 651 ? 9.979   40.596  -29.500 1.00 34.59  ? 677 TRP A CA  1 
ATOM   5046  C C   . TRP A 1 651 ? 8.660   40.113  -30.086 1.00 36.05  ? 677 TRP A C   1 
ATOM   5047  O O   . TRP A 1 651 ? 7.762   40.903  -30.388 1.00 35.42  ? 677 TRP A O   1 
ATOM   5048  C CB  . TRP A 1 651 ? 11.050  40.616  -30.583 1.00 33.36  ? 677 TRP A CB  1 
ATOM   5049  C CG  . TRP A 1 651 ? 10.711  41.545  -31.699 1.00 32.44  ? 677 TRP A CG  1 
ATOM   5050  C CD1 . TRP A 1 651 ? 10.334  41.204  -32.963 1.00 32.45  ? 677 TRP A CD1 1 
ATOM   5051  C CD2 . TRP A 1 651 ? 10.739  42.976  -31.659 1.00 33.79  ? 677 TRP A CD2 1 
ATOM   5052  N NE1 . TRP A 1 651 ? 10.131  42.333  -33.718 1.00 30.57  ? 677 TRP A NE1 1 
ATOM   5053  C CE2 . TRP A 1 651 ? 10.373  43.435  -32.946 1.00 32.73  ? 677 TRP A CE2 1 
ATOM   5054  C CE3 . TRP A 1 651 ? 11.047  43.917  -30.663 1.00 34.62  ? 677 TRP A CE3 1 
ATOM   5055  C CZ2 . TRP A 1 651 ? 10.305  44.797  -33.266 1.00 32.92  ? 677 TRP A CZ2 1 
ATOM   5056  C CZ3 . TRP A 1 651 ? 10.980  45.277  -30.982 1.00 34.60  ? 677 TRP A CZ3 1 
ATOM   5057  C CH2 . TRP A 1 651 ? 10.611  45.700  -32.277 1.00 34.53  ? 677 TRP A CH2 1 
ATOM   5058  N N   . ASP A 1 652 ? 8.563   38.795  -30.226 1.00 37.82  ? 678 ASP A N   1 
ATOM   5059  C CA  . ASP A 1 652 ? 7.402   38.122  -30.785 1.00 38.07  ? 678 ASP A CA  1 
ATOM   5060  C C   . ASP A 1 652 ? 6.206   38.094  -29.862 1.00 37.67  ? 678 ASP A C   1 
ATOM   5061  O O   . ASP A 1 652 ? 5.108   37.720  -30.268 1.00 38.94  ? 678 ASP A O   1 
ATOM   5062  C CB  . ASP A 1 652 ? 7.777   36.685  -31.133 1.00 41.72  ? 678 ASP A CB  1 
ATOM   5063  C CG  . ASP A 1 652 ? 8.497   36.584  -32.447 1.00 47.86  ? 678 ASP A CG  1 
ATOM   5064  O OD1 . ASP A 1 652 ? 9.231   35.592  -32.639 1.00 50.74  ? 678 ASP A OD1 1 
ATOM   5065  O OD2 . ASP A 1 652 ? 8.317   37.494  -33.291 1.00 50.96  ? 678 ASP A OD2 1 
ATOM   5066  N N   . GLN A 1 653 ? 6.405   38.499  -28.621 1.00 35.04  ? 679 GLN A N   1 
ATOM   5067  C CA  . GLN A 1 653 ? 5.317   38.449  -27.674 1.00 32.66  ? 679 GLN A CA  1 
ATOM   5068  C C   . GLN A 1 653 ? 5.657   39.260  -26.434 1.00 31.07  ? 679 GLN A C   1 
ATOM   5069  O O   . GLN A 1 653 ? 6.826   39.493  -26.138 1.00 30.92  ? 679 GLN A O   1 
ATOM   5070  C CB  . GLN A 1 653 ? 5.069   36.976  -27.342 1.00 31.72  ? 679 GLN A CB  1 
ATOM   5071  C CG  . GLN A 1 653 ? 4.287   36.663  -26.097 1.00 33.71  ? 679 GLN A CG  1 
ATOM   5072  C CD  . GLN A 1 653 ? 4.253   35.167  -25.845 1.00 36.23  ? 679 GLN A CD  1 
ATOM   5073  O OE1 . GLN A 1 653 ? 5.283   34.494  -25.938 1.00 35.40  ? 679 GLN A OE1 1 
ATOM   5074  N NE2 . GLN A 1 653 ? 3.073   34.637  -25.529 1.00 34.21  ? 679 GLN A NE2 1 
ATOM   5075  N N   . VAL A 1 654 ? 4.626   39.710  -25.728 1.00 28.61  ? 680 VAL A N   1 
ATOM   5076  C CA  . VAL A 1 654 ? 4.823   40.482  -24.518 1.00 25.07  ? 680 VAL A CA  1 
ATOM   5077  C C   . VAL A 1 654 ? 4.205   39.744  -23.335 1.00 25.89  ? 680 VAL A C   1 
ATOM   5078  O O   . VAL A 1 654 ? 3.000   39.503  -23.290 1.00 26.92  ? 680 VAL A O   1 
ATOM   5079  C CB  . VAL A 1 654 ? 4.198   41.892  -24.642 1.00 21.60  ? 680 VAL A CB  1 
ATOM   5080  C CG1 . VAL A 1 654 ? 4.404   42.672  -23.373 1.00 20.30  ? 680 VAL A CG1 1 
ATOM   5081  C CG2 . VAL A 1 654 ? 4.831   42.633  -25.785 1.00 18.99  ? 680 VAL A CG2 1 
ATOM   5082  N N   . PHE A 1 655 ? 5.055   39.362  -22.391 1.00 25.53  ? 681 PHE A N   1 
ATOM   5083  C CA  . PHE A 1 655 ? 4.607   38.679  -21.194 1.00 24.41  ? 681 PHE A CA  1 
ATOM   5084  C C   . PHE A 1 655 ? 4.365   39.733  -20.133 1.00 25.03  ? 681 PHE A C   1 
ATOM   5085  O O   . PHE A 1 655 ? 5.140   40.685  -20.004 1.00 23.21  ? 681 PHE A O   1 
ATOM   5086  C CB  . PHE A 1 655 ? 5.689   37.737  -20.668 1.00 25.11  ? 681 PHE A CB  1 
ATOM   5087  C CG  . PHE A 1 655 ? 5.752   36.415  -21.367 1.00 25.95  ? 681 PHE A CG  1 
ATOM   5088  C CD1 . PHE A 1 655 ? 4.953   35.362  -20.953 1.00 25.25  ? 681 PHE A CD1 1 
ATOM   5089  C CD2 . PHE A 1 655 ? 6.658   36.203  -22.403 1.00 25.44  ? 681 PHE A CD2 1 
ATOM   5090  C CE1 . PHE A 1 655 ? 5.057   34.112  -21.552 1.00 24.82  ? 681 PHE A CE1 1 
ATOM   5091  C CE2 . PHE A 1 655 ? 6.768   34.960  -23.009 1.00 25.00  ? 681 PHE A CE2 1 
ATOM   5092  C CZ  . PHE A 1 655 ? 5.966   33.909  -22.578 1.00 24.74  ? 681 PHE A CZ  1 
ATOM   5093  N N   . VAL A 1 656 ? 3.281   39.570  -19.388 1.00 24.46  ? 682 VAL A N   1 
ATOM   5094  C CA  . VAL A 1 656 ? 2.979   40.463  -18.289 1.00 25.98  ? 682 VAL A CA  1 
ATOM   5095  C C   . VAL A 1 656 ? 2.876   39.549  -17.068 1.00 25.84  ? 682 VAL A C   1 
ATOM   5096  O O   . VAL A 1 656 ? 2.003   38.677  -16.994 1.00 24.16  ? 682 VAL A O   1 
ATOM   5097  C CB  . VAL A 1 656 ? 1.668   41.252  -18.519 1.00 29.43  ? 682 VAL A CB  1 
ATOM   5098  C CG1 . VAL A 1 656 ? 0.581   40.333  -19.030 1.00 34.65  ? 682 VAL A CG1 1 
ATOM   5099  C CG2 . VAL A 1 656 ? 1.230   41.917  -17.216 1.00 28.93  ? 682 VAL A CG2 1 
ATOM   5100  N N   . TRP A 1 657 ? 3.810   39.735  -16.138 1.00 24.69  ? 683 TRP A N   1 
ATOM   5101  C CA  . TRP A 1 657 ? 3.902   38.945  -14.911 1.00 24.11  ? 683 TRP A CA  1 
ATOM   5102  C C   . TRP A 1 657 ? 3.271   39.736  -13.774 1.00 27.03  ? 683 TRP A C   1 
ATOM   5103  O O   . TRP A 1 657 ? 3.660   40.877  -13.526 1.00 28.38  ? 683 TRP A O   1 
ATOM   5104  C CB  . TRP A 1 657 ? 5.375   38.688  -14.599 1.00 21.53  ? 683 TRP A CB  1 
ATOM   5105  C CG  . TRP A 1 657 ? 5.633   37.785  -13.446 1.00 20.46  ? 683 TRP A CG  1 
ATOM   5106  C CD1 . TRP A 1 657 ? 5.719   36.418  -13.469 1.00 19.16  ? 683 TRP A CD1 1 
ATOM   5107  C CD2 . TRP A 1 657 ? 5.834   38.178  -12.084 1.00 21.05  ? 683 TRP A CD2 1 
ATOM   5108  N NE1 . TRP A 1 657 ? 5.962   35.937  -12.203 1.00 18.91  ? 683 TRP A NE1 1 
ATOM   5109  C CE2 . TRP A 1 657 ? 6.036   36.995  -11.334 1.00 19.59  ? 683 TRP A CE2 1 
ATOM   5110  C CE3 . TRP A 1 657 ? 5.865   39.417  -11.426 1.00 19.80  ? 683 TRP A CE3 1 
ATOM   5111  C CZ2 . TRP A 1 657 ? 6.264   37.015  -9.952  1.00 19.97  ? 683 TRP A CZ2 1 
ATOM   5112  C CZ3 . TRP A 1 657 ? 6.091   39.438  -10.053 1.00 20.13  ? 683 TRP A CZ3 1 
ATOM   5113  C CH2 . TRP A 1 657 ? 6.290   38.240  -9.332  1.00 20.74  ? 683 TRP A CH2 1 
ATOM   5114  N N   . VAL A 1 658 ? 2.299   39.151  -13.080 1.00 27.02  ? 684 VAL A N   1 
ATOM   5115  C CA  . VAL A 1 658 ? 1.660   39.875  -11.988 1.00 29.30  ? 684 VAL A CA  1 
ATOM   5116  C C   . VAL A 1 658 ? 1.990   39.274  -10.634 1.00 28.42  ? 684 VAL A C   1 
ATOM   5117  O O   . VAL A 1 658 ? 1.711   38.104  -10.375 1.00 28.08  ? 684 VAL A O   1 
ATOM   5118  C CB  . VAL A 1 658 ? 0.119   39.947  -12.172 1.00 29.68  ? 684 VAL A CB  1 
ATOM   5119  C CG1 . VAL A 1 658 ? -0.203  40.592  -13.506 1.00 33.56  ? 684 VAL A CG1 1 
ATOM   5120  C CG2 . VAL A 1 658 ? -0.486  38.573  -12.117 1.00 33.49  ? 684 VAL A CG2 1 
ATOM   5121  N N   . GLY A 1 659 ? 2.602   40.088  -9.779  1.00 28.60  ? 685 GLY A N   1 
ATOM   5122  C CA  . GLY A 1 659 ? 2.970   39.634  -8.452  1.00 32.25  ? 685 GLY A CA  1 
ATOM   5123  C C   . GLY A 1 659 ? 1.762   39.301  -7.598  1.00 34.11  ? 685 GLY A C   1 
ATOM   5124  O O   . GLY A 1 659 ? 0.717   39.945  -7.702  1.00 32.70  ? 685 GLY A O   1 
ATOM   5125  N N   . LYS A 1 660 ? 1.908   38.295  -6.743  1.00 36.95  ? 686 LYS A N   1 
ATOM   5126  C CA  . LYS A 1 660 ? 0.823   37.872  -5.870  1.00 40.85  ? 686 LYS A CA  1 
ATOM   5127  C C   . LYS A 1 660 ? 0.241   39.050  -5.091  1.00 40.95  ? 686 LYS A C   1 
ATOM   5128  O O   . LYS A 1 660 ? -0.977  39.199  -5.018  1.00 40.85  ? 686 LYS A O   1 
ATOM   5129  C CB  . LYS A 1 660 ? 1.314   36.807  -4.875  1.00 43.65  ? 686 LYS A CB  1 
ATOM   5130  C CG  . LYS A 1 660 ? 0.189   35.984  -4.249  1.00 48.62  ? 686 LYS A CG  1 
ATOM   5131  C CD  . LYS A 1 660 ? 0.459   35.612  -2.790  1.00 53.78  ? 686 LYS A CD  1 
ATOM   5132  C CE  . LYS A 1 660 ? 1.644   34.673  -2.622  1.00 55.79  ? 686 LYS A CE  1 
ATOM   5133  N NZ  . LYS A 1 660 ? 1.884   34.354  -1.177  1.00 57.95  ? 686 LYS A NZ  1 
ATOM   5134  N N   . ASP A 1 661 ? 1.118   39.888  -4.537  1.00 41.17  ? 687 ASP A N   1 
ATOM   5135  C CA  . ASP A 1 661 ? 0.718   41.040  -3.719  1.00 42.49  ? 687 ASP A CA  1 
ATOM   5136  C C   . ASP A 1 661 ? 0.589   42.399  -4.408  1.00 41.99  ? 687 ASP A C   1 
ATOM   5137  O O   . ASP A 1 661 ? 0.701   43.436  -3.752  1.00 43.24  ? 687 ASP A O   1 
ATOM   5138  C CB  . ASP A 1 661 ? 1.682   41.198  -2.539  1.00 44.68  ? 687 ASP A CB  1 
ATOM   5139  C CG  . ASP A 1 661 ? 2.023   39.877  -1.889  1.00 50.48  ? 687 ASP A CG  1 
ATOM   5140  O OD1 . ASP A 1 661 ? 1.088   39.093  -1.597  1.00 51.84  ? 687 ASP A OD1 1 
ATOM   5141  O OD2 . ASP A 1 661 ? 3.229   39.625  -1.668  1.00 52.08  ? 687 ASP A OD2 1 
ATOM   5142  N N   . SER A 1 662 ? 0.370   42.414  -5.715  1.00 40.88  ? 688 SER A N   1 
ATOM   5143  C CA  . SER A 1 662 ? 0.213   43.683  -6.403  1.00 41.65  ? 688 SER A CA  1 
ATOM   5144  C C   . SER A 1 662 ? -1.223  44.135  -6.155  1.00 44.89  ? 688 SER A C   1 
ATOM   5145  O O   . SER A 1 662 ? -2.032  43.375  -5.619  1.00 44.74  ? 688 SER A O   1 
ATOM   5146  C CB  . SER A 1 662 ? 0.486   43.521  -7.901  1.00 38.15  ? 688 SER A CB  1 
ATOM   5147  O OG  . SER A 1 662 ? -0.271  42.457  -8.446  1.00 36.16  ? 688 SER A OG  1 
ATOM   5148  N N   . GLN A 1 663 ? -1.547  45.364  -6.535  1.00 48.82  ? 689 GLN A N   1 
ATOM   5149  C CA  . GLN A 1 663 ? -2.896  45.869  -6.319  1.00 53.95  ? 689 GLN A CA  1 
ATOM   5150  C C   . GLN A 1 663 ? -3.902  45.309  -7.316  1.00 55.70  ? 689 GLN A C   1 
ATOM   5151  O O   . GLN A 1 663 ? -3.581  45.085  -8.486  1.00 56.61  ? 689 GLN A O   1 
ATOM   5152  C CB  . GLN A 1 663 ? -2.905  47.395  -6.377  1.00 56.85  ? 689 GLN A CB  1 
ATOM   5153  C CG  . GLN A 1 663 ? -4.218  48.019  -5.935  1.00 62.18  ? 689 GLN A CG  1 
ATOM   5154  C CD  . GLN A 1 663 ? -4.081  49.494  -5.616  1.00 65.28  ? 689 GLN A CD  1 
ATOM   5155  O OE1 . GLN A 1 663 ? -5.049  50.152  -5.232  1.00 67.62  ? 689 GLN A OE1 1 
ATOM   5156  N NE2 . GLN A 1 663 ? -2.870  50.024  -5.771  1.00 65.84  ? 689 GLN A NE2 1 
ATOM   5157  N N   . ASP A 1 664 ? -5.120  45.080  -6.837  1.00 57.10  ? 690 ASP A N   1 
ATOM   5158  C CA  . ASP A 1 664 ? -6.191  44.550  -7.667  1.00 59.74  ? 690 ASP A CA  1 
ATOM   5159  C C   . ASP A 1 664 ? -6.394  45.353  -8.940  1.00 60.87  ? 690 ASP A C   1 
ATOM   5160  O O   . ASP A 1 664 ? -6.476  44.784  -10.028 1.00 60.38  ? 690 ASP A O   1 
ATOM   5161  C CB  . ASP A 1 664 ? -7.502  44.519  -6.879  1.00 61.61  ? 690 ASP A CB  1 
ATOM   5162  C CG  . ASP A 1 664 ? -7.700  43.217  -6.131  1.00 64.27  ? 690 ASP A CG  1 
ATOM   5163  O OD1 . ASP A 1 664 ? -6.714  42.697  -5.565  1.00 66.22  ? 690 ASP A OD1 1 
ATOM   5164  O OD2 . ASP A 1 664 ? -8.845  42.716  -6.102  1.00 66.01  ? 690 ASP A OD2 1 
ATOM   5165  N N   . GLU A 1 665 ? -6.467  46.675  -8.807  1.00 62.84  ? 691 GLU A N   1 
ATOM   5166  C CA  . GLU A 1 665 ? -6.691  47.527  -9.968  1.00 65.66  ? 691 GLU A CA  1 
ATOM   5167  C C   . GLU A 1 665 ? -5.531  47.547  -10.949 1.00 64.76  ? 691 GLU A C   1 
ATOM   5168  O O   . GLU A 1 665 ? -5.623  48.163  -12.010 1.00 65.10  ? 691 GLU A O   1 
ATOM   5169  C CB  . GLU A 1 665 ? -7.046  48.960  -9.540  1.00 68.24  ? 691 GLU A CB  1 
ATOM   5170  C CG  . GLU A 1 665 ? -5.991  49.679  -8.725  1.00 75.01  ? 691 GLU A CG  1 
ATOM   5171  C CD  . GLU A 1 665 ? -6.406  51.098  -8.364  1.00 78.77  ? 691 GLU A CD  1 
ATOM   5172  O OE1 . GLU A 1 665 ? -7.403  51.265  -7.629  1.00 81.45  ? 691 GLU A OE1 1 
ATOM   5173  O OE2 . GLU A 1 665 ? -5.739  52.052  -8.818  1.00 81.32  ? 691 GLU A OE2 1 
ATOM   5174  N N   . GLU A 1 666 ? -4.437  46.879  -10.607 1.00 63.38  ? 692 GLU A N   1 
ATOM   5175  C CA  . GLU A 1 666 ? -3.308  46.839  -11.519 1.00 62.01  ? 692 GLU A CA  1 
ATOM   5176  C C   . GLU A 1 666 ? -3.226  45.492  -12.220 1.00 59.33  ? 692 GLU A C   1 
ATOM   5177  O O   . GLU A 1 666 ? -2.818  45.416  -13.377 1.00 58.79  ? 692 GLU A O   1 
ATOM   5178  C CB  . GLU A 1 666 ? -1.997  47.151  -10.793 1.00 64.25  ? 692 GLU A CB  1 
ATOM   5179  C CG  . GLU A 1 666 ? -1.889  48.607  -10.363 1.00 67.79  ? 692 GLU A CG  1 
ATOM   5180  C CD  . GLU A 1 666 ? -0.452  49.095  -10.256 1.00 70.19  ? 692 GLU A CD  1 
ATOM   5181  O OE1 . GLU A 1 666 ? 0.351   48.458  -9.534  1.00 72.61  ? 692 GLU A OE1 1 
ATOM   5182  O OE2 . GLU A 1 666 ? -0.129  50.124  -10.890 1.00 68.75  ? 692 GLU A OE2 1 
ATOM   5183  N N   . LYS A 1 667 ? -3.626  44.426  -11.535 1.00 55.56  ? 693 LYS A N   1 
ATOM   5184  C CA  . LYS A 1 667 ? -3.585  43.119  -12.164 1.00 53.64  ? 693 LYS A CA  1 
ATOM   5185  C C   . LYS A 1 667 ? -4.780  42.969  -13.105 1.00 52.49  ? 693 LYS A C   1 
ATOM   5186  O O   . LYS A 1 667 ? -4.789  42.111  -13.991 1.00 52.82  ? 693 LYS A O   1 
ATOM   5187  C CB  . LYS A 1 667 ? -3.560  42.008  -11.109 1.00 54.13  ? 693 LYS A CB  1 
ATOM   5188  C CG  . LYS A 1 667 ? -4.712  42.009  -10.138 1.00 54.06  ? 693 LYS A CG  1 
ATOM   5189  C CD  . LYS A 1 667 ? -4.604  40.838  -9.164  1.00 52.03  ? 693 LYS A CD  1 
ATOM   5190  C CE  . LYS A 1 667 ? -3.449  41.013  -8.191  1.00 52.14  ? 693 LYS A CE  1 
ATOM   5191  N NZ  . LYS A 1 667 ? -3.395  39.916  -7.178  1.00 50.86  ? 693 LYS A NZ  1 
ATOM   5192  N N   . THR A 1 668 ? -5.784  43.818  -12.912 1.00 50.67  ? 694 THR A N   1 
ATOM   5193  C CA  . THR A 1 668 ? -6.972  43.809  -13.762 1.00 47.60  ? 694 THR A CA  1 
ATOM   5194  C C   . THR A 1 668 ? -6.611  44.563  -15.032 1.00 46.18  ? 694 THR A C   1 
ATOM   5195  O O   . THR A 1 668 ? -7.120  44.274  -16.114 1.00 46.50  ? 694 THR A O   1 
ATOM   5196  C CB  . THR A 1 668 ? -8.166  44.537  -13.099 1.00 46.39  ? 694 THR A CB  1 
ATOM   5197  O OG1 . THR A 1 668 ? -8.681  43.750  -12.021 1.00 43.21  ? 694 THR A OG1 1 
ATOM   5198  C CG2 . THR A 1 668 ? -9.268  44.774  -14.116 1.00 46.42  ? 694 THR A CG2 1 
ATOM   5199  N N   . GLU A 1 669 ? -5.727  45.542  -14.883 1.00 43.84  ? 695 GLU A N   1 
ATOM   5200  C CA  . GLU A 1 669 ? -5.288  46.347  -16.009 1.00 43.66  ? 695 GLU A CA  1 
ATOM   5201  C C   . GLU A 1 669 ? -4.065  45.739  -16.703 1.00 40.32  ? 695 GLU A C   1 
ATOM   5202  O O   . GLU A 1 669 ? -3.478  46.365  -17.587 1.00 37.71  ? 695 GLU A O   1 
ATOM   5203  C CB  . GLU A 1 669 ? -4.974  47.774  -15.543 1.00 48.33  ? 695 GLU A CB  1 
ATOM   5204  C CG  . GLU A 1 669 ? -6.166  48.505  -14.925 1.00 53.24  ? 695 GLU A CG  1 
ATOM   5205  C CD  . GLU A 1 669 ? -7.355  48.597  -15.870 1.00 57.14  ? 695 GLU A CD  1 
ATOM   5206  O OE1 . GLU A 1 669 ? -7.219  49.236  -16.937 1.00 59.10  ? 695 GLU A OE1 1 
ATOM   5207  O OE2 . GLU A 1 669 ? -8.422  48.026  -15.548 1.00 58.44  ? 695 GLU A OE2 1 
ATOM   5208  N N   . ALA A 1 670 ? -3.701  44.517  -16.309 1.00 37.13  ? 696 ALA A N   1 
ATOM   5209  C CA  . ALA A 1 670 ? -2.553  43.817  -16.895 1.00 35.62  ? 696 ALA A CA  1 
ATOM   5210  C C   . ALA A 1 670 ? -2.532  43.913  -18.418 1.00 33.93  ? 696 ALA A C   1 
ATOM   5211  O O   . ALA A 1 670 ? -1.606  44.474  -18.996 1.00 35.26  ? 696 ALA A O   1 
ATOM   5212  C CB  . ALA A 1 670 ? -2.554  42.353  -16.469 1.00 34.62  ? 696 ALA A CB  1 
ATOM   5213  N N   . LEU A 1 671 ? -3.550  43.363  -19.071 1.00 32.24  ? 697 LEU A N   1 
ATOM   5214  C CA  . LEU A 1 671 ? -3.622  43.417  -20.528 1.00 30.51  ? 697 LEU A CA  1 
ATOM   5215  C C   . LEU A 1 671 ? -3.527  44.853  -21.058 1.00 29.77  ? 697 LEU A C   1 
ATOM   5216  O O   . LEU A 1 671 ? -2.812  45.126  -22.030 1.00 26.94  ? 697 LEU A O   1 
ATOM   5217  C CB  . LEU A 1 671 ? -4.922  42.775  -21.012 1.00 32.18  ? 697 LEU A CB  1 
ATOM   5218  C CG  . LEU A 1 671 ? -4.982  41.252  -21.151 1.00 32.63  ? 697 LEU A CG  1 
ATOM   5219  C CD1 . LEU A 1 671 ? -6.433  40.814  -21.323 1.00 35.38  ? 697 LEU A CD1 1 
ATOM   5220  C CD2 . LEU A 1 671 ? -4.156  40.815  -22.343 1.00 32.46  ? 697 LEU A CD2 1 
ATOM   5221  N N   . THR A 1 672 ? -4.246  45.765  -20.415 1.00 29.05  ? 698 THR A N   1 
ATOM   5222  C CA  . THR A 1 672 ? -4.255  47.171  -20.813 1.00 31.38  ? 698 THR A CA  1 
ATOM   5223  C C   . THR A 1 672 ? -2.857  47.782  -20.727 1.00 29.62  ? 698 THR A C   1 
ATOM   5224  O O   . THR A 1 672 ? -2.462  48.600  -21.570 1.00 26.57  ? 698 THR A O   1 
ATOM   5225  C CB  . THR A 1 672 ? -5.201  47.977  -19.906 1.00 34.59  ? 698 THR A CB  1 
ATOM   5226  O OG1 . THR A 1 672 ? -6.509  47.394  -19.951 1.00 38.04  ? 698 THR A OG1 1 
ATOM   5227  C CG2 . THR A 1 672 ? -5.267  49.429  -20.349 1.00 34.49  ? 698 THR A CG2 1 
ATOM   5228  N N   . SER A 1 673 ? -2.121  47.389  -19.693 1.00 27.66  ? 699 SER A N   1 
ATOM   5229  C CA  . SER A 1 673 ? -0.766  47.886  -19.491 1.00 29.14  ? 699 SER A CA  1 
ATOM   5230  C C   . SER A 1 673 ? 0.092   47.436  -20.675 1.00 29.83  ? 699 SER A C   1 
ATOM   5231  O O   . SER A 1 673 ? 0.839   48.228  -21.261 1.00 30.35  ? 699 SER A O   1 
ATOM   5232  C CB  . SER A 1 673 ? -0.179  47.326  -18.192 1.00 29.66  ? 699 SER A CB  1 
ATOM   5233  O OG  . SER A 1 673 ? -0.992  47.628  -17.071 1.00 29.71  ? 699 SER A OG  1 
ATOM   5234  N N   . ALA A 1 674 ? -0.022  46.159  -21.022 1.00 28.38  ? 700 ALA A N   1 
ATOM   5235  C CA  . ALA A 1 674 ? 0.729   45.616  -22.137 1.00 30.14  ? 700 ALA A CA  1 
ATOM   5236  C C   . ALA A 1 674 ? 0.431   46.424  -23.401 1.00 30.66  ? 700 ALA A C   1 
ATOM   5237  O O   . ALA A 1 674 ? 1.351   46.859  -24.087 1.00 31.00  ? 700 ALA A O   1 
ATOM   5238  C CB  . ALA A 1 674 ? 0.371   44.158  -22.339 1.00 30.33  ? 700 ALA A CB  1 
ATOM   5239  N N   . LYS A 1 675 ? -0.849  46.635  -23.703 1.00 32.59  ? 701 LYS A N   1 
ATOM   5240  C CA  . LYS A 1 675 ? -1.226  47.412  -24.883 1.00 35.48  ? 701 LYS A CA  1 
ATOM   5241  C C   . LYS A 1 675 ? -0.600  48.803  -24.824 1.00 36.81  ? 701 LYS A C   1 
ATOM   5242  O O   . LYS A 1 675 ? -0.004  49.267  -25.802 1.00 35.05  ? 701 LYS A O   1 
ATOM   5243  C CB  . LYS A 1 675 ? -2.750  47.524  -24.994 1.00 37.69  ? 701 LYS A CB  1 
ATOM   5244  C CG  . LYS A 1 675 ? -3.429  46.201  -25.321 1.00 44.17  ? 701 LYS A CG  1 
ATOM   5245  C CD  . LYS A 1 675 ? -4.961  46.236  -25.197 1.00 47.05  ? 701 LYS A CD  1 
ATOM   5246  C CE  . LYS A 1 675 ? -5.531  44.819  -25.396 1.00 52.92  ? 701 LYS A CE  1 
ATOM   5247  N NZ  . LYS A 1 675 ? -7.009  44.679  -25.224 1.00 52.37  ? 701 LYS A NZ  1 
ATOM   5248  N N   . ARG A 1 676 ? -0.733  49.472  -23.679 1.00 38.23  ? 702 ARG A N   1 
ATOM   5249  C CA  . ARG A 1 676 ? -0.146  50.796  -23.531 1.00 37.49  ? 702 ARG A CA  1 
ATOM   5250  C C   . ARG A 1 676 ? 1.336   50.674  -23.854 1.00 35.85  ? 702 ARG A C   1 
ATOM   5251  O O   . ARG A 1 676 ? 1.887   51.473  -24.616 1.00 35.96  ? 702 ARG A O   1 
ATOM   5252  C CB  . ARG A 1 676 ? -0.302  51.322  -22.104 1.00 43.20  ? 702 ARG A CB  1 
ATOM   5253  C CG  . ARG A 1 676 ? -1.714  51.709  -21.689 1.00 50.09  ? 702 ARG A CG  1 
ATOM   5254  C CD  . ARG A 1 676 ? -1.653  52.767  -20.583 1.00 56.36  ? 702 ARG A CD  1 
ATOM   5255  N NE  . ARG A 1 676 ? -2.952  53.062  -19.978 1.00 61.87  ? 702 ARG A NE  1 
ATOM   5256  C CZ  . ARG A 1 676 ? -3.504  52.361  -18.989 1.00 64.58  ? 702 ARG A CZ  1 
ATOM   5257  N NH1 . ARG A 1 676 ? -2.876  51.307  -18.471 1.00 64.36  ? 702 ARG A NH1 1 
ATOM   5258  N NH2 . ARG A 1 676 ? -4.692  52.720  -18.512 1.00 64.55  ? 702 ARG A NH2 1 
ATOM   5259  N N   . TYR A 1 677 ? 1.981   49.663  -23.282 1.00 31.57  ? 703 TYR A N   1 
ATOM   5260  C CA  . TYR A 1 677 ? 3.399   49.463  -23.533 1.00 32.97  ? 703 TYR A CA  1 
ATOM   5261  C C   . TYR A 1 677 ? 3.710   49.329  -25.015 1.00 35.05  ? 703 TYR A C   1 
ATOM   5262  O O   . TYR A 1 677 ? 4.642   49.960  -25.516 1.00 33.98  ? 703 TYR A O   1 
ATOM   5263  C CB  . TYR A 1 677 ? 3.914   48.226  -22.801 1.00 31.67  ? 703 TYR A CB  1 
ATOM   5264  C CG  . TYR A 1 677 ? 5.319   47.843  -23.212 1.00 28.49  ? 703 TYR A CG  1 
ATOM   5265  C CD1 . TYR A 1 677 ? 5.536   46.886  -24.201 1.00 26.88  ? 703 TYR A CD1 1 
ATOM   5266  C CD2 . TYR A 1 677 ? 6.431   48.462  -22.635 1.00 26.77  ? 703 TYR A CD2 1 
ATOM   5267  C CE1 . TYR A 1 677 ? 6.823   46.553  -24.606 1.00 27.48  ? 703 TYR A CE1 1 
ATOM   5268  C CE2 . TYR A 1 677 ? 7.724   48.139  -23.035 1.00 24.72  ? 703 TYR A CE2 1 
ATOM   5269  C CZ  . TYR A 1 677 ? 7.910   47.184  -24.022 1.00 26.65  ? 703 TYR A CZ  1 
ATOM   5270  O OH  . TYR A 1 677 ? 9.175   46.864  -24.441 1.00 26.65  ? 703 TYR A OH  1 
ATOM   5271  N N   . ILE A 1 678 ? 2.928   48.506  -25.708 1.00 36.69  ? 704 ILE A N   1 
ATOM   5272  C CA  . ILE A 1 678 ? 3.126   48.277  -27.132 1.00 40.87  ? 704 ILE A CA  1 
ATOM   5273  C C   . ILE A 1 678 ? 2.772   49.469  -28.019 1.00 41.71  ? 704 ILE A C   1 
ATOM   5274  O O   . ILE A 1 678 ? 3.453   49.718  -29.011 1.00 39.47  ? 704 ILE A O   1 
ATOM   5275  C CB  . ILE A 1 678 ? 2.333   47.045  -27.614 1.00 42.47  ? 704 ILE A CB  1 
ATOM   5276  C CG1 . ILE A 1 678 ? 2.872   45.789  -26.928 1.00 43.09  ? 704 ILE A CG1 1 
ATOM   5277  C CG2 . ILE A 1 678 ? 2.457   46.899  -29.122 1.00 42.31  ? 704 ILE A CG2 1 
ATOM   5278  C CD1 . ILE A 1 678 ? 2.114   44.535  -27.277 1.00 45.16  ? 704 ILE A CD1 1 
ATOM   5279  N N   . ASP A 1 679 ? 1.716   50.202  -27.678 1.00 44.20  ? 705 ASP A N   1 
ATOM   5280  C CA  . ASP A 1 679 ? 1.339   51.362  -28.483 1.00 47.87  ? 705 ASP A CA  1 
ATOM   5281  C C   . ASP A 1 679 ? 2.344   52.502  -28.280 1.00 47.83  ? 705 ASP A C   1 
ATOM   5282  O O   . ASP A 1 679 ? 2.397   53.450  -29.063 1.00 49.15  ? 705 ASP A O   1 
ATOM   5283  C CB  . ASP A 1 679 ? -0.075  51.853  -28.124 1.00 51.78  ? 705 ASP A CB  1 
ATOM   5284  C CG  . ASP A 1 679 ? -1.174  50.888  -28.572 1.00 56.97  ? 705 ASP A CG  1 
ATOM   5285  O OD1 . ASP A 1 679 ? -1.094  50.366  -29.706 1.00 58.72  ? 705 ASP A OD1 1 
ATOM   5286  O OD2 . ASP A 1 679 ? -2.130  50.663  -27.795 1.00 60.07  ? 705 ASP A OD2 1 
ATOM   5287  N N   . THR A 1 680 ? 3.151   52.398  -27.231 1.00 47.34  ? 706 THR A N   1 
ATOM   5288  C CA  . THR A 1 680 ? 4.141   53.421  -26.920 1.00 47.51  ? 706 THR A CA  1 
ATOM   5289  C C   . THR A 1 680 ? 5.529   53.139  -27.495 1.00 48.49  ? 706 THR A C   1 
ATOM   5290  O O   . THR A 1 680 ? 6.335   54.055  -27.645 1.00 48.52  ? 706 THR A O   1 
ATOM   5291  C CB  . THR A 1 680 ? 4.269   53.595  -25.390 1.00 46.06  ? 706 THR A CB  1 
ATOM   5292  O OG1 . THR A 1 680 ? 3.091   54.231  -24.889 1.00 49.29  ? 706 THR A OG1 1 
ATOM   5293  C CG2 . THR A 1 680 ? 5.475   54.441  -25.032 1.00 47.53  ? 706 THR A CG2 1 
ATOM   5294  N N   . ASP A 1 681 ? 5.809   51.882  -27.821 1.00 49.28  ? 707 ASP A N   1 
ATOM   5295  C CA  . ASP A 1 681 ? 7.121   51.518  -28.343 1.00 50.93  ? 707 ASP A CA  1 
ATOM   5296  C C   . ASP A 1 681 ? 7.523   52.382  -29.524 1.00 51.37  ? 707 ASP A C   1 
ATOM   5297  O O   . ASP A 1 681 ? 6.775   52.523  -30.489 1.00 51.09  ? 707 ASP A O   1 
ATOM   5298  C CB  . ASP A 1 681 ? 7.152   50.050  -28.761 1.00 53.55  ? 707 ASP A CB  1 
ATOM   5299  C CG  . ASP A 1 681 ? 8.564   49.525  -28.923 1.00 55.17  ? 707 ASP A CG  1 
ATOM   5300  O OD1 . ASP A 1 681 ? 9.355   50.152  -29.657 1.00 56.06  ? 707 ASP A OD1 1 
ATOM   5301  O OD2 . ASP A 1 681 ? 8.883   48.482  -28.315 1.00 57.29  ? 707 ASP A OD2 1 
ATOM   5302  N N   . PRO A 1 682 ? 8.726   52.970  -29.460 1.00 51.39  ? 708 PRO A N   1 
ATOM   5303  C CA  . PRO A 1 682 ? 9.263   53.834  -30.515 1.00 51.70  ? 708 PRO A CA  1 
ATOM   5304  C C   . PRO A 1 682 ? 9.405   53.086  -31.838 1.00 52.46  ? 708 PRO A C   1 
ATOM   5305  O O   . PRO A 1 682 ? 9.436   53.693  -32.908 1.00 52.53  ? 708 PRO A O   1 
ATOM   5306  C CB  . PRO A 1 682 ? 10.628  54.254  -29.962 1.00 53.52  ? 708 PRO A CB  1 
ATOM   5307  C CG  . PRO A 1 682 ? 10.475  54.100  -28.473 1.00 53.56  ? 708 PRO A CG  1 
ATOM   5308  C CD  . PRO A 1 682 ? 9.686   52.833  -28.354 1.00 50.84  ? 708 PRO A CD  1 
ATOM   5309  N N   . ALA A 1 683 ? 9.497   51.762  -31.750 1.00 53.07  ? 709 ALA A N   1 
ATOM   5310  C CA  . ALA A 1 683 ? 9.665   50.905  -32.919 1.00 53.98  ? 709 ALA A CA  1 
ATOM   5311  C C   . ALA A 1 683 ? 8.424   50.808  -33.794 1.00 55.68  ? 709 ALA A C   1 
ATOM   5312  O O   . ALA A 1 683 ? 8.489   50.281  -34.908 1.00 56.60  ? 709 ALA A O   1 
ATOM   5313  C CB  . ALA A 1 683 ? 10.095  49.508  -32.476 1.00 53.43  ? 709 ALA A CB  1 
ATOM   5314  N N   . HIS A 1 684 ? 7.299   51.314  -33.292 1.00 56.83  ? 710 HIS A N   1 
ATOM   5315  C CA  . HIS A 1 684 ? 6.036   51.274  -34.030 1.00 57.46  ? 710 HIS A CA  1 
ATOM   5316  C C   . HIS A 1 684 ? 5.712   49.853  -34.455 1.00 57.26  ? 710 HIS A C   1 
ATOM   5317  O O   . HIS A 1 684 ? 5.475   49.579  -35.630 1.00 58.02  ? 710 HIS A O   1 
ATOM   5318  C CB  . HIS A 1 684 ? 6.100   52.177  -35.267 1.00 56.85  ? 710 HIS A CB  1 
ATOM   5319  C CG  . HIS A 1 684 ? 6.201   53.633  -34.944 1.00 58.42  ? 710 HIS A CG  1 
ATOM   5320  N ND1 . HIS A 1 684 ? 5.840   54.619  -35.834 1.00 59.21  ? 710 HIS A ND1 1 
ATOM   5321  C CD2 . HIS A 1 684 ? 6.605   54.271  -33.819 1.00 58.26  ? 710 HIS A CD2 1 
ATOM   5322  C CE1 . HIS A 1 684 ? 6.013   55.802  -35.271 1.00 59.45  ? 710 HIS A CE1 1 
ATOM   5323  N NE2 . HIS A 1 684 ? 6.477   55.619  -34.048 1.00 57.15  ? 710 HIS A NE2 1 
ATOM   5324  N N   . ARG A 1 685 ? 5.695   48.949  -33.486 1.00 57.32  ? 711 ARG A N   1 
ATOM   5325  C CA  . ARG A 1 685 ? 5.413   47.549  -33.761 1.00 56.19  ? 711 ARG A CA  1 
ATOM   5326  C C   . ARG A 1 685 ? 3.929   47.231  -33.942 1.00 55.02  ? 711 ARG A C   1 
ATOM   5327  O O   . ARG A 1 685 ? 3.053   47.987  -33.522 1.00 52.92  ? 711 ARG A O   1 
ATOM   5328  C CB  . ARG A 1 685 ? 6.028   46.681  -32.655 1.00 55.11  ? 711 ARG A CB  1 
ATOM   5329  C CG  . ARG A 1 685 ? 6.306   47.440  -31.370 1.00 51.22  ? 711 ARG A CG  1 
ATOM   5330  C CD  . ARG A 1 685 ? 7.473   46.836  -30.604 1.00 50.19  ? 711 ARG A CD  1 
ATOM   5331  N NE  . ARG A 1 685 ? 7.246   45.442  -30.225 1.00 47.48  ? 711 ARG A NE  1 
ATOM   5332  C CZ  . ARG A 1 685 ? 7.739   44.886  -29.123 1.00 43.80  ? 711 ARG A CZ  1 
ATOM   5333  N NH1 . ARG A 1 685 ? 8.487   45.607  -28.296 1.00 42.45  ? 711 ARG A NH1 1 
ATOM   5334  N NH2 . ARG A 1 685 ? 7.483   43.616  -28.842 1.00 39.18  ? 711 ARG A NH2 1 
ATOM   5335  N N   . ASP A 1 686 ? 3.668   46.105  -34.597 1.00 55.98  ? 712 ASP A N   1 
ATOM   5336  C CA  . ASP A 1 686 ? 2.315   45.648  -34.866 1.00 56.60  ? 712 ASP A CA  1 
ATOM   5337  C C   . ASP A 1 686 ? 1.514   45.586  -33.576 1.00 55.55  ? 712 ASP A C   1 
ATOM   5338  O O   . ASP A 1 686 ? 1.876   44.871  -32.645 1.00 54.41  ? 712 ASP A O   1 
ATOM   5339  C CB  . ASP A 1 686 ? 2.367   44.267  -35.529 1.00 58.76  ? 712 ASP A CB  1 
ATOM   5340  C CG  . ASP A 1 686 ? 0.997   43.761  -35.939 1.00 60.79  ? 712 ASP A CG  1 
ATOM   5341  O OD1 . ASP A 1 686 ? 0.258   44.496  -36.632 1.00 61.65  ? 712 ASP A OD1 1 
ATOM   5342  O OD2 . ASP A 1 686 ? 0.665   42.617  -35.573 1.00 62.67  ? 712 ASP A OD2 1 
ATOM   5343  N N   . ARG A 1 687 ? 0.425   46.345  -33.529 1.00 56.16  ? 713 ARG A N   1 
ATOM   5344  C CA  . ARG A 1 687 ? -0.433  46.394  -32.351 1.00 56.01  ? 713 ARG A CA  1 
ATOM   5345  C C   . ARG A 1 687 ? -1.139  45.075  -32.081 1.00 52.70  ? 713 ARG A C   1 
ATOM   5346  O O   . ARG A 1 687 ? -1.796  44.921  -31.053 1.00 54.21  ? 713 ARG A O   1 
ATOM   5347  C CB  . ARG A 1 687 ? -1.477  47.505  -32.502 1.00 62.58  ? 713 ARG A CB  1 
ATOM   5348  C CG  . ARG A 1 687 ? -0.917  48.920  -32.387 1.00 70.10  ? 713 ARG A CG  1 
ATOM   5349  C CD  . ARG A 1 687 ? -2.004  49.964  -32.624 1.00 75.93  ? 713 ARG A CD  1 
ATOM   5350  N NE  . ARG A 1 687 ? -3.190  49.718  -31.804 1.00 81.20  ? 713 ARG A NE  1 
ATOM   5351  C CZ  . ARG A 1 687 ? -4.243  50.527  -31.747 1.00 83.65  ? 713 ARG A CZ  1 
ATOM   5352  N NH1 . ARG A 1 687 ? -5.277  50.218  -30.975 1.00 84.66  ? 713 ARG A NH1 1 
ATOM   5353  N NH2 . ARG A 1 687 ? -4.262  51.648  -32.457 1.00 85.22  ? 713 ARG A NH2 1 
ATOM   5354  N N   . ARG A 1 688 ? -1.005  44.128  -33.006 1.00 48.04  ? 714 ARG A N   1 
ATOM   5355  C CA  . ARG A 1 688 ? -1.637  42.823  -32.865 1.00 42.21  ? 714 ARG A CA  1 
ATOM   5356  C C   . ARG A 1 688 ? -0.757  41.897  -32.045 1.00 37.60  ? 714 ARG A C   1 
ATOM   5357  O O   . ARG A 1 688 ? -1.170  40.793  -31.690 1.00 36.44  ? 714 ARG A O   1 
ATOM   5358  C CB  . ARG A 1 688 ? -1.875  42.191  -34.237 1.00 45.09  ? 714 ARG A CB  1 
ATOM   5359  C CG  . ARG A 1 688 ? -2.762  42.994  -35.184 1.00 50.14  ? 714 ARG A CG  1 
ATOM   5360  C CD  . ARG A 1 688 ? -2.786  42.336  -36.560 1.00 53.18  ? 714 ARG A CD  1 
ATOM   5361  N NE  . ARG A 1 688 ? -1.423  42.125  -37.038 1.00 57.20  ? 714 ARG A NE  1 
ATOM   5362  C CZ  . ARG A 1 688 ? -1.090  41.401  -38.101 1.00 58.06  ? 714 ARG A CZ  1 
ATOM   5363  N NH1 . ARG A 1 688 ? -2.028  40.803  -38.824 1.00 59.27  ? 714 ARG A NH1 1 
ATOM   5364  N NH2 . ARG A 1 688 ? 0.189   41.266  -38.430 1.00 58.20  ? 714 ARG A NH2 1 
ATOM   5365  N N   . THR A 1 689 ? 0.459   42.347  -31.757 1.00 33.66  ? 715 THR A N   1 
ATOM   5366  C CA  . THR A 1 689 ? 1.406   41.548  -30.989 1.00 30.45  ? 715 THR A CA  1 
ATOM   5367  C C   . THR A 1 689 ? 0.702   40.810  -29.855 1.00 28.66  ? 715 THR A C   1 
ATOM   5368  O O   . THR A 1 689 ? 0.070   41.421  -28.993 1.00 27.37  ? 715 THR A O   1 
ATOM   5369  C CB  . THR A 1 689 ? 2.540   42.425  -30.399 1.00 29.87  ? 715 THR A CB  1 
ATOM   5370  O OG1 . THR A 1 689 ? 3.277   43.028  -31.468 1.00 32.71  ? 715 THR A OG1 1 
ATOM   5371  C CG2 . THR A 1 689 ? 3.494   41.583  -29.561 1.00 25.78  ? 715 THR A CG2 1 
ATOM   5372  N N   . PRO A 1 690 ? 0.801   39.477  -29.848 1.00 25.43  ? 716 PRO A N   1 
ATOM   5373  C CA  . PRO A 1 690 ? 0.155   38.695  -28.796 1.00 25.02  ? 716 PRO A CA  1 
ATOM   5374  C C   . PRO A 1 690 ? 0.568   39.132  -27.385 1.00 25.17  ? 716 PRO A C   1 
ATOM   5375  O O   . PRO A 1 690 ? 1.726   39.493  -27.143 1.00 23.25  ? 716 PRO A O   1 
ATOM   5376  C CB  . PRO A 1 690 ? 0.565   37.254  -29.131 1.00 23.27  ? 716 PRO A CB  1 
ATOM   5377  C CG  . PRO A 1 690 ? 1.850   37.418  -29.893 1.00 23.64  ? 716 PRO A CG  1 
ATOM   5378  C CD  . PRO A 1 690 ? 1.574   38.612  -30.756 1.00 22.28  ? 716 PRO A CD  1 
ATOM   5379  N N   . ILE A 1 691 ? -0.398  39.109  -26.467 1.00 24.99  ? 717 ILE A N   1 
ATOM   5380  C CA  . ILE A 1 691 ? -0.160  39.485  -25.079 1.00 23.96  ? 717 ILE A CA  1 
ATOM   5381  C C   . ILE A 1 691 ? -0.494  38.305  -24.171 1.00 24.42  ? 717 ILE A C   1 
ATOM   5382  O O   . ILE A 1 691 ? -1.573  37.730  -24.261 1.00 26.23  ? 717 ILE A O   1 
ATOM   5383  C CB  . ILE A 1 691 ? -0.989  40.732  -24.705 1.00 22.43  ? 717 ILE A CB  1 
ATOM   5384  C CG1 . ILE A 1 691 ? -0.501  41.915  -25.538 1.00 23.19  ? 717 ILE A CG1 1 
ATOM   5385  C CG2 . ILE A 1 691 ? -0.858  41.035  -23.226 1.00 17.14  ? 717 ILE A CG2 1 
ATOM   5386  C CD1 . ILE A 1 691 ? -1.111  43.237  -25.182 1.00 26.87  ? 717 ILE A CD1 1 
ATOM   5387  N N   . THR A 1 692 ? 0.444   37.953  -23.298 1.00 23.37  ? 718 THR A N   1 
ATOM   5388  C CA  . THR A 1 692 ? 0.280   36.812  -22.408 1.00 22.46  ? 718 THR A CA  1 
ATOM   5389  C C   . THR A 1 692 ? 0.435   37.145  -20.925 1.00 22.93  ? 718 THR A C   1 
ATOM   5390  O O   . THR A 1 692 ? 1.501   37.573  -20.485 1.00 23.15  ? 718 THR A O   1 
ATOM   5391  C CB  . THR A 1 692 ? 1.298   35.738  -22.785 1.00 22.59  ? 718 THR A CB  1 
ATOM   5392  O OG1 . THR A 1 692 ? 1.199   35.485  -24.189 1.00 27.10  ? 718 THR A OG1 1 
ATOM   5393  C CG2 . THR A 1 692 ? 1.049   34.454  -22.021 1.00 21.78  ? 718 THR A CG2 1 
ATOM   5394  N N   . VAL A 1 693 ? -0.629  36.922  -20.157 1.00 23.74  ? 719 VAL A N   1 
ATOM   5395  C CA  . VAL A 1 693 ? -0.629  37.199  -18.725 1.00 25.59  ? 719 VAL A CA  1 
ATOM   5396  C C   . VAL A 1 693 ? -0.271  35.959  -17.906 1.00 26.90  ? 719 VAL A C   1 
ATOM   5397  O O   . VAL A 1 693 ? -0.915  34.924  -18.017 1.00 28.82  ? 719 VAL A O   1 
ATOM   5398  C CB  . VAL A 1 693 ? -2.008  37.724  -18.269 1.00 25.71  ? 719 VAL A CB  1 
ATOM   5399  C CG1 . VAL A 1 693 ? -1.992  37.989  -16.786 1.00 22.39  ? 719 VAL A CG1 1 
ATOM   5400  C CG2 . VAL A 1 693 ? -2.372  38.993  -19.052 1.00 25.07  ? 719 VAL A CG2 1 
ATOM   5401  N N   . VAL A 1 694 ? 0.760   36.090  -17.077 1.00 27.58  ? 720 VAL A N   1 
ATOM   5402  C CA  . VAL A 1 694 ? 1.259   35.007  -16.233 1.00 29.10  ? 720 VAL A CA  1 
ATOM   5403  C C   . VAL A 1 694 ? 1.103   35.369  -14.747 1.00 30.72  ? 720 VAL A C   1 
ATOM   5404  O O   . VAL A 1 694 ? 1.196   36.537  -14.369 1.00 33.48  ? 720 VAL A O   1 
ATOM   5405  C CB  . VAL A 1 694 ? 2.751   34.732  -16.581 1.00 28.56  ? 720 VAL A CB  1 
ATOM   5406  C CG1 . VAL A 1 694 ? 3.426   33.909  -15.506 1.00 31.09  ? 720 VAL A CG1 1 
ATOM   5407  C CG2 . VAL A 1 694 ? 2.829   34.019  -17.918 1.00 28.24  ? 720 VAL A CG2 1 
ATOM   5408  N N   . LYS A 1 695 ? 0.854   34.375  -13.904 1.00 30.09  ? 721 LYS A N   1 
ATOM   5409  C CA  . LYS A 1 695 ? 0.683   34.645  -12.488 1.00 30.62  ? 721 LYS A CA  1 
ATOM   5410  C C   . LYS A 1 695 ? 1.804   34.035  -11.670 1.00 31.09  ? 721 LYS A C   1 
ATOM   5411  O O   . LYS A 1 695 ? 2.237   32.909  -11.923 1.00 30.97  ? 721 LYS A O   1 
ATOM   5412  C CB  . LYS A 1 695 ? -0.665  34.110  -11.992 1.00 32.76  ? 721 LYS A CB  1 
ATOM   5413  C CG  . LYS A 1 695 ? -1.901  34.783  -12.602 1.00 35.34  ? 721 LYS A CG  1 
ATOM   5414  C CD  . LYS A 1 695 ? -2.074  34.446  -14.085 1.00 39.87  ? 721 LYS A CD  1 
ATOM   5415  C CE  . LYS A 1 695 ? -3.437  34.895  -14.627 1.00 41.26  ? 721 LYS A CE  1 
ATOM   5416  N NZ  . LYS A 1 695 ? -4.576  34.169  -13.986 1.00 38.74  ? 721 LYS A NZ  1 
ATOM   5417  N N   . GLN A 1 696 ? 2.262   34.794  -10.683 1.00 30.55  ? 722 GLN A N   1 
ATOM   5418  C CA  . GLN A 1 696 ? 3.333   34.369  -9.790  1.00 30.65  ? 722 GLN A CA  1 
ATOM   5419  C C   . GLN A 1 696 ? 3.100   32.966  -9.270  1.00 29.80  ? 722 GLN A C   1 
ATOM   5420  O O   . GLN A 1 696 ? 2.080   32.697  -8.645  1.00 31.36  ? 722 GLN A O   1 
ATOM   5421  C CB  . GLN A 1 696 ? 3.416   35.329  -8.603  1.00 32.34  ? 722 GLN A CB  1 
ATOM   5422  C CG  . GLN A 1 696 ? 4.513   35.012  -7.606  1.00 35.37  ? 722 GLN A CG  1 
ATOM   5423  C CD  . GLN A 1 696 ? 4.402   35.843  -6.336  1.00 36.35  ? 722 GLN A CD  1 
ATOM   5424  O OE1 . GLN A 1 696 ? 4.315   37.074  -6.383  1.00 36.85  ? 722 GLN A OE1 1 
ATOM   5425  N NE2 . GLN A 1 696 ? 4.411   35.173  -5.194  1.00 36.95  ? 722 GLN A NE2 1 
ATOM   5426  N N   . GLY A 1 697 ? 4.044   32.070  -9.530  1.00 29.54  ? 723 GLY A N   1 
ATOM   5427  C CA  . GLY A 1 697 ? 3.913   30.711  -9.042  1.00 30.16  ? 723 GLY A CA  1 
ATOM   5428  C C   . GLY A 1 697 ? 3.367   29.751  -10.069 1.00 32.49  ? 723 GLY A C   1 
ATOM   5429  O O   . GLY A 1 697 ? 3.383   28.533  -9.873  1.00 33.70  ? 723 GLY A O   1 
ATOM   5430  N N   . PHE A 1 698 ? 2.872   30.297  -11.171 1.00 33.57  ? 724 PHE A N   1 
ATOM   5431  C CA  . PHE A 1 698 ? 2.332   29.467  -12.236 1.00 30.77  ? 724 PHE A CA  1 
ATOM   5432  C C   . PHE A 1 698 ? 2.908   29.913  -13.544 1.00 28.08  ? 724 PHE A C   1 
ATOM   5433  O O   . PHE A 1 698 ? 2.255   29.805  -14.573 1.00 30.57  ? 724 PHE A O   1 
ATOM   5434  C CB  . PHE A 1 698 ? 0.811   29.570  -12.292 1.00 31.83  ? 724 PHE A CB  1 
ATOM   5435  C CG  . PHE A 1 698 ? 0.157   29.272  -10.994 1.00 34.31  ? 724 PHE A CG  1 
ATOM   5436  C CD1 . PHE A 1 698 ? -0.111  30.293  -10.089 1.00 35.63  ? 724 PHE A CD1 1 
ATOM   5437  C CD2 . PHE A 1 698 ? -0.135  27.958  -10.639 1.00 35.29  ? 724 PHE A CD2 1 
ATOM   5438  C CE1 . PHE A 1 698 ? -0.659  30.009  -8.838  1.00 36.21  ? 724 PHE A CE1 1 
ATOM   5439  C CE2 . PHE A 1 698 ? -0.679  27.663  -9.396  1.00 35.77  ? 724 PHE A CE2 1 
ATOM   5440  C CZ  . PHE A 1 698 ? -0.943  28.692  -8.492  1.00 36.47  ? 724 PHE A CZ  1 
ATOM   5441  N N   . GLU A 1 699 ? 4.130   30.431  -13.500 1.00 28.75  ? 725 GLU A N   1 
ATOM   5442  C CA  . GLU A 1 699 ? 4.797   30.890  -14.710 1.00 27.64  ? 725 GLU A CA  1 
ATOM   5443  C C   . GLU A 1 699 ? 5.031   29.710  -15.642 1.00 25.96  ? 725 GLU A C   1 
ATOM   5444  O O   . GLU A 1 699 ? 5.466   28.646  -15.216 1.00 26.56  ? 725 GLU A O   1 
ATOM   5445  C CB  . GLU A 1 699 ? 6.130   31.561  -14.374 1.00 27.44  ? 725 GLU A CB  1 
ATOM   5446  C CG  . GLU A 1 699 ? 6.009   32.796  -13.491 1.00 27.28  ? 725 GLU A CG  1 
ATOM   5447  C CD  . GLU A 1 699 ? 6.074   32.471  -12.013 1.00 29.30  ? 725 GLU A CD  1 
ATOM   5448  O OE1 . GLU A 1 699 ? 6.214   33.414  -11.199 1.00 32.21  ? 725 GLU A OE1 1 
ATOM   5449  O OE2 . GLU A 1 699 ? 5.987   31.276  -11.662 1.00 27.81  ? 725 GLU A OE2 1 
ATOM   5450  N N   . PRO A 1 700 ? 4.730   29.883  -16.933 1.00 25.57  ? 726 PRO A N   1 
ATOM   5451  C CA  . PRO A 1 700 ? 4.924   28.804  -17.903 1.00 27.59  ? 726 PRO A CA  1 
ATOM   5452  C C   . PRO A 1 700 ? 6.387   28.604  -18.313 1.00 28.19  ? 726 PRO A C   1 
ATOM   5453  O O   . PRO A 1 700 ? 7.234   29.470  -18.088 1.00 27.25  ? 726 PRO A O   1 
ATOM   5454  C CB  . PRO A 1 700 ? 4.045   29.241  -19.075 1.00 26.29  ? 726 PRO A CB  1 
ATOM   5455  C CG  . PRO A 1 700 ? 4.196   30.734  -19.050 1.00 26.32  ? 726 PRO A CG  1 
ATOM   5456  C CD  . PRO A 1 700 ? 4.075   31.046  -17.560 1.00 27.31  ? 726 PRO A CD  1 
ATOM   5457  N N   . PRO A 1 701 ? 6.694   27.447  -18.921 1.00 29.67  ? 727 PRO A N   1 
ATOM   5458  C CA  . PRO A 1 701 ? 8.047   27.108  -19.376 1.00 28.87  ? 727 PRO A CA  1 
ATOM   5459  C C   . PRO A 1 701 ? 8.682   28.141  -20.311 1.00 27.97  ? 727 PRO A C   1 
ATOM   5460  O O   . PRO A 1 701 ? 9.864   28.453  -20.177 1.00 24.65  ? 727 PRO A O   1 
ATOM   5461  C CB  . PRO A 1 701 ? 7.848   25.750  -20.044 1.00 28.33  ? 727 PRO A CB  1 
ATOM   5462  C CG  . PRO A 1 701 ? 6.780   25.140  -19.186 1.00 29.33  ? 727 PRO A CG  1 
ATOM   5463  C CD  . PRO A 1 701 ? 5.799   26.281  -19.046 1.00 28.12  ? 727 PRO A CD  1 
ATOM   5464  N N   . SER A 1 702 ? 7.905   28.673  -21.251 1.00 27.90  ? 728 SER A N   1 
ATOM   5465  C CA  . SER A 1 702 ? 8.440   29.668  -22.176 1.00 29.23  ? 728 SER A CA  1 
ATOM   5466  C C   . SER A 1 702 ? 8.695   31.010  -21.479 1.00 30.39  ? 728 SER A C   1 
ATOM   5467  O O   . SER A 1 702 ? 9.159   31.966  -22.105 1.00 31.01  ? 728 SER A O   1 
ATOM   5468  C CB  . SER A 1 702 ? 7.492   29.871  -23.356 1.00 28.69  ? 728 SER A CB  1 
ATOM   5469  O OG  . SER A 1 702 ? 6.235   30.336  -22.909 1.00 33.73  ? 728 SER A OG  1 
ATOM   5470  N N   . PHE A 1 703 ? 8.385   31.088  -20.188 1.00 28.09  ? 729 PHE A N   1 
ATOM   5471  C CA  . PHE A 1 703 ? 8.633   32.315  -19.441 1.00 26.54  ? 729 PHE A CA  1 
ATOM   5472  C C   . PHE A 1 703 ? 9.887   32.117  -18.593 1.00 25.49  ? 729 PHE A C   1 
ATOM   5473  O O   . PHE A 1 703 ? 10.861  32.848  -18.735 1.00 25.40  ? 729 PHE A O   1 
ATOM   5474  C CB  . PHE A 1 703 ? 7.452   32.666  -18.525 1.00 25.06  ? 729 PHE A CB  1 
ATOM   5475  C CG  . PHE A 1 703 ? 7.663   33.925  -17.719 1.00 21.88  ? 729 PHE A CG  1 
ATOM   5476  C CD1 . PHE A 1 703 ? 7.402   35.173  -18.271 1.00 23.84  ? 729 PHE A CD1 1 
ATOM   5477  C CD2 . PHE A 1 703 ? 8.144   33.861  -16.414 1.00 19.47  ? 729 PHE A CD2 1 
ATOM   5478  C CE1 . PHE A 1 703 ? 7.617   36.343  -17.530 1.00 23.24  ? 729 PHE A CE1 1 
ATOM   5479  C CE2 . PHE A 1 703 ? 8.361   35.014  -15.669 1.00 19.51  ? 729 PHE A CE2 1 
ATOM   5480  C CZ  . PHE A 1 703 ? 8.097   36.262  -16.227 1.00 20.18  ? 729 PHE A CZ  1 
ATOM   5481  N N   . VAL A 1 704 ? 9.858   31.115  -17.723 1.00 25.46  ? 730 VAL A N   1 
ATOM   5482  C CA  . VAL A 1 704 ? 10.985  30.837  -16.841 1.00 28.56  ? 730 VAL A CA  1 
ATOM   5483  C C   . VAL A 1 704 ? 12.278  30.558  -17.613 1.00 29.60  ? 730 VAL A C   1 
ATOM   5484  O O   . VAL A 1 704 ? 13.373  30.897  -17.156 1.00 26.04  ? 730 VAL A O   1 
ATOM   5485  C CB  . VAL A 1 704 ? 10.674  29.639  -15.917 1.00 27.69  ? 730 VAL A CB  1 
ATOM   5486  C CG1 . VAL A 1 704 ? 9.308   29.836  -15.273 1.00 32.87  ? 730 VAL A CG1 1 
ATOM   5487  C CG2 . VAL A 1 704 ? 10.698  28.350  -16.699 1.00 30.12  ? 730 VAL A CG2 1 
ATOM   5488  N N   . GLY A 1 705 ? 12.140  29.947  -18.785 1.00 29.78  ? 731 GLY A N   1 
ATOM   5489  C CA  . GLY A 1 705 ? 13.296  29.629  -19.598 1.00 29.53  ? 731 GLY A CA  1 
ATOM   5490  C C   . GLY A 1 705 ? 14.234  30.803  -19.792 1.00 31.12  ? 731 GLY A C   1 
ATOM   5491  O O   . GLY A 1 705 ? 15.403  30.605  -20.092 1.00 33.21  ? 731 GLY A O   1 
ATOM   5492  N N   . TRP A 1 706 ? 13.741  32.024  -19.618 1.00 30.52  ? 732 TRP A N   1 
ATOM   5493  C CA  . TRP A 1 706 ? 14.584  33.199  -19.796 1.00 30.98  ? 732 TRP A CA  1 
ATOM   5494  C C   . TRP A 1 706 ? 15.398  33.542  -18.534 1.00 33.25  ? 732 TRP A C   1 
ATOM   5495  O O   . TRP A 1 706 ? 16.258  34.422  -18.559 1.00 35.46  ? 732 TRP A O   1 
ATOM   5496  C CB  . TRP A 1 706 ? 13.733  34.402  -20.216 1.00 27.64  ? 732 TRP A CB  1 
ATOM   5497  C CG  . TRP A 1 706 ? 13.264  34.394  -21.654 1.00 26.12  ? 732 TRP A CG  1 
ATOM   5498  C CD1 . TRP A 1 706 ? 11.969  34.375  -22.097 1.00 25.80  ? 732 TRP A CD1 1 
ATOM   5499  C CD2 . TRP A 1 706 ? 14.085  34.477  -22.832 1.00 25.50  ? 732 TRP A CD2 1 
ATOM   5500  N NE1 . TRP A 1 706 ? 11.930  34.450  -23.472 1.00 21.57  ? 732 TRP A NE1 1 
ATOM   5501  C CE2 . TRP A 1 706 ? 13.216  34.510  -23.950 1.00 23.30  ? 732 TRP A CE2 1 
ATOM   5502  C CE3 . TRP A 1 706 ? 15.468  34.524  -23.055 1.00 22.54  ? 732 TRP A CE3 1 
ATOM   5503  C CZ2 . TRP A 1 706 ? 13.683  34.595  -25.271 1.00 23.79  ? 732 TRP A CZ2 1 
ATOM   5504  C CZ3 . TRP A 1 706 ? 15.938  34.602  -24.373 1.00 24.33  ? 732 TRP A CZ3 1 
ATOM   5505  C CH2 . TRP A 1 706 ? 15.045  34.635  -25.463 1.00 20.03  ? 732 TRP A CH2 1 
ATOM   5506  N N   . PHE A 1 707 ? 15.127  32.844  -17.436 1.00 35.38  ? 733 PHE A N   1 
ATOM   5507  C CA  . PHE A 1 707 ? 15.836  33.066  -16.173 1.00 36.68  ? 733 PHE A CA  1 
ATOM   5508  C C   . PHE A 1 707 ? 16.650  31.826  -15.843 1.00 40.48  ? 733 PHE A C   1 
ATOM   5509  O O   . PHE A 1 707 ? 16.078  30.772  -15.563 1.00 43.47  ? 733 PHE A O   1 
ATOM   5510  C CB  . PHE A 1 707 ? 14.855  33.301  -15.021 1.00 30.96  ? 733 PHE A CB  1 
ATOM   5511  C CG  . PHE A 1 707 ? 14.037  34.544  -15.160 1.00 31.94  ? 733 PHE A CG  1 
ATOM   5512  C CD1 . PHE A 1 707 ? 12.998  34.616  -16.088 1.00 31.26  ? 733 PHE A CD1 1 
ATOM   5513  C CD2 . PHE A 1 707 ? 14.298  35.650  -14.355 1.00 29.36  ? 733 PHE A CD2 1 
ATOM   5514  C CE1 . PHE A 1 707 ? 12.230  35.768  -16.207 1.00 28.23  ? 733 PHE A CE1 1 
ATOM   5515  C CE2 . PHE A 1 707 ? 13.538  36.809  -14.467 1.00 28.00  ? 733 PHE A CE2 1 
ATOM   5516  C CZ  . PHE A 1 707 ? 12.501  36.868  -15.396 1.00 29.33  ? 733 PHE A CZ  1 
ATOM   5517  N N   . LEU A 1 708 ? 17.973  31.939  -15.855 1.00 43.01  ? 734 LEU A N   1 
ATOM   5518  C CA  . LEU A 1 708 ? 18.802  30.779  -15.548 1.00 45.18  ? 734 LEU A CA  1 
ATOM   5519  C C   . LEU A 1 708 ? 18.713  30.369  -14.088 1.00 45.17  ? 734 LEU A C   1 
ATOM   5520  O O   . LEU A 1 708 ? 18.728  29.180  -13.766 1.00 46.11  ? 734 LEU A O   1 
ATOM   5521  C CB  . LEU A 1 708 ? 20.260  31.037  -15.919 1.00 47.09  ? 734 LEU A CB  1 
ATOM   5522  C CG  . LEU A 1 708 ? 20.583  30.883  -17.405 1.00 49.65  ? 734 LEU A CG  1 
ATOM   5523  C CD1 . LEU A 1 708 ? 19.885  31.979  -18.212 1.00 49.68  ? 734 LEU A CD1 1 
ATOM   5524  C CD2 . LEU A 1 708 ? 22.092  30.949  -17.592 1.00 51.98  ? 734 LEU A CD2 1 
ATOM   5525  N N   . GLY A 1 709 ? 18.610  31.343  -13.198 1.00 44.42  ? 735 GLY A N   1 
ATOM   5526  C CA  . GLY A 1 709 ? 18.528  30.999  -11.792 1.00 47.86  ? 735 GLY A CA  1 
ATOM   5527  C C   . GLY A 1 709 ? 17.112  30.817  -11.277 1.00 47.07  ? 735 GLY A C   1 
ATOM   5528  O O   . GLY A 1 709 ? 16.780  31.345  -10.209 1.00 49.61  ? 735 GLY A O   1 
ATOM   5529  N N   . TRP A 1 710 ? 16.280  30.066  -12.000 1.00 43.76  ? 736 TRP A N   1 
ATOM   5530  C CA  . TRP A 1 710 ? 14.901  29.888  -11.557 1.00 42.82  ? 736 TRP A CA  1 
ATOM   5531  C C   . TRP A 1 710 ? 14.658  28.715  -10.619 1.00 43.39  ? 736 TRP A C   1 
ATOM   5532  O O   . TRP A 1 710 ? 15.034  27.581  -10.910 1.00 44.33  ? 736 TRP A O   1 
ATOM   5533  C CB  . TRP A 1 710 ? 13.950  29.781  -12.756 1.00 39.46  ? 736 TRP A CB  1 
ATOM   5534  C CG  . TRP A 1 710 ? 12.511  29.941  -12.341 1.00 34.58  ? 736 TRP A CG  1 
ATOM   5535  C CD1 . TRP A 1 710 ? 11.719  29.004  -11.739 1.00 33.36  ? 736 TRP A CD1 1 
ATOM   5536  C CD2 . TRP A 1 710 ? 11.745  31.153  -12.364 1.00 33.32  ? 736 TRP A CD2 1 
ATOM   5537  N NE1 . TRP A 1 710 ? 10.518  29.559  -11.373 1.00 30.94  ? 736 TRP A NE1 1 
ATOM   5538  C CE2 . TRP A 1 710 ? 10.505  30.876  -11.747 1.00 32.66  ? 736 TRP A CE2 1 
ATOM   5539  C CE3 . TRP A 1 710 ? 11.989  32.448  -12.842 1.00 30.20  ? 736 TRP A CE3 1 
ATOM   5540  C CZ2 . TRP A 1 710 ? 9.508   31.851  -11.593 1.00 30.06  ? 736 TRP A CZ2 1 
ATOM   5541  C CZ3 . TRP A 1 710 ? 10.998  33.414  -12.687 1.00 28.70  ? 736 TRP A CZ3 1 
ATOM   5542  C CH2 . TRP A 1 710 ? 9.774   33.107  -12.068 1.00 27.55  ? 736 TRP A CH2 1 
ATOM   5543  N N   . ASP A 1 711 ? 14.011  29.010  -9.494  1.00 44.86  ? 737 ASP A N   1 
ATOM   5544  C CA  . ASP A 1 711 ? 13.677  28.015  -8.477  1.00 48.33  ? 737 ASP A CA  1 
ATOM   5545  C C   . ASP A 1 711 ? 12.236  28.226  -8.009  1.00 48.29  ? 737 ASP A C   1 
ATOM   5546  O O   . ASP A 1 711 ? 11.896  29.280  -7.470  1.00 47.77  ? 737 ASP A O   1 
ATOM   5547  C CB  . ASP A 1 711 ? 14.640  28.141  -7.289  1.00 51.56  ? 737 ASP A CB  1 
ATOM   5548  C CG  . ASP A 1 711 ? 14.295  27.194  -6.148  1.00 54.83  ? 737 ASP A CG  1 
ATOM   5549  O OD1 . ASP A 1 711 ? 14.172  25.974  -6.395  1.00 57.40  ? 737 ASP A OD1 1 
ATOM   5550  O OD2 . ASP A 1 711 ? 14.154  27.669  -5.002  1.00 55.85  ? 737 ASP A OD2 1 
ATOM   5551  N N   . ASP A 1 712 ? 11.392  27.220  -8.213  1.00 50.22  ? 738 ASP A N   1 
ATOM   5552  C CA  . ASP A 1 712 ? 9.984   27.304  -7.823  1.00 51.82  ? 738 ASP A CA  1 
ATOM   5553  C C   . ASP A 1 712 ? 9.762   27.584  -6.339  1.00 52.28  ? 738 ASP A C   1 
ATOM   5554  O O   . ASP A 1 712 ? 8.842   28.315  -5.972  1.00 52.79  ? 738 ASP A O   1 
ATOM   5555  C CB  . ASP A 1 712 ? 9.251   26.016  -8.190  1.00 52.26  ? 738 ASP A CB  1 
ATOM   5556  C CG  . ASP A 1 712 ? 9.476   25.611  -9.622  1.00 53.61  ? 738 ASP A CG  1 
ATOM   5557  O OD1 . ASP A 1 712 ? 10.566  25.078  -9.916  1.00 56.66  ? 738 ASP A OD1 1 
ATOM   5558  O OD2 . ASP A 1 712 ? 8.571   25.833  -10.454 1.00 52.81  ? 738 ASP A OD2 1 
ATOM   5559  N N   . SER A 1 713 ? 10.598  27.001  -5.489  1.00 51.65  ? 739 SER A N   1 
ATOM   5560  C CA  . SER A 1 713 ? 10.464  27.201  -4.054  1.00 52.80  ? 739 SER A CA  1 
ATOM   5561  C C   . SER A 1 713 ? 10.964  28.570  -3.615  1.00 51.97  ? 739 SER A C   1 
ATOM   5562  O O   . SER A 1 713 ? 10.948  28.886  -2.426  1.00 53.11  ? 739 SER A O   1 
ATOM   5563  C CB  . SER A 1 713 ? 11.233  26.118  -3.297  1.00 53.94  ? 739 SER A CB  1 
ATOM   5564  O OG  . SER A 1 713 ? 10.752  24.829  -3.630  1.00 57.62  ? 739 SER A OG  1 
ATOM   5565  N N   . TYR A 1 714 ? 11.394  29.390  -4.567  1.00 50.08  ? 740 TYR A N   1 
ATOM   5566  C CA  . TYR A 1 714 ? 11.916  30.704  -4.223  1.00 48.95  ? 740 TYR A CA  1 
ATOM   5567  C C   . TYR A 1 714 ? 10.979  31.533  -3.347  1.00 49.36  ? 740 TYR A C   1 
ATOM   5568  O O   . TYR A 1 714 ? 11.428  32.248  -2.453  1.00 49.06  ? 740 TYR A O   1 
ATOM   5569  C CB  . TYR A 1 714 ? 12.278  31.492  -5.489  1.00 47.27  ? 740 TYR A CB  1 
ATOM   5570  C CG  . TYR A 1 714 ? 12.907  32.836  -5.189  1.00 43.17  ? 740 TYR A CG  1 
ATOM   5571  C CD1 . TYR A 1 714 ? 12.165  34.012  -5.274  1.00 40.84  ? 740 TYR A CD1 1 
ATOM   5572  C CD2 . TYR A 1 714 ? 14.228  32.924  -4.752  1.00 42.27  ? 740 TYR A CD2 1 
ATOM   5573  C CE1 . TYR A 1 714 ? 12.723  35.240  -4.925  1.00 40.79  ? 740 TYR A CE1 1 
ATOM   5574  C CE2 . TYR A 1 714 ? 14.793  34.146  -4.400  1.00 41.13  ? 740 TYR A CE2 1 
ATOM   5575  C CZ  . TYR A 1 714 ? 14.036  35.297  -4.486  1.00 40.47  ? 740 TYR A CZ  1 
ATOM   5576  O OH  . TYR A 1 714 ? 14.587  36.500  -4.111  1.00 42.61  ? 740 TYR A OH  1 
ATOM   5577  N N   . TRP A 1 715 ? 9.678   31.431  -3.583  1.00 49.04  ? 741 TRP A N   1 
ATOM   5578  C CA  . TRP A 1 715 ? 8.736   32.208  -2.794  1.00 49.08  ? 741 TRP A CA  1 
ATOM   5579  C C   . TRP A 1 715 ? 8.127   31.470  -1.605  1.00 50.45  ? 741 TRP A C   1 
ATOM   5580  O O   . TRP A 1 715 ? 7.299   32.026  -0.892  1.00 51.15  ? 741 TRP A O   1 
ATOM   5581  C CB  . TRP A 1 715 ? 7.633   32.745  -3.698  1.00 46.58  ? 741 TRP A CB  1 
ATOM   5582  C CG  . TRP A 1 715 ? 8.140   33.732  -4.691  1.00 44.86  ? 741 TRP A CG  1 
ATOM   5583  C CD1 . TRP A 1 715 ? 8.720   34.942  -4.425  1.00 44.47  ? 741 TRP A CD1 1 
ATOM   5584  C CD2 . TRP A 1 715 ? 8.123   33.601  -6.119  1.00 42.49  ? 741 TRP A CD2 1 
ATOM   5585  N NE1 . TRP A 1 715 ? 9.061   35.573  -5.599  1.00 42.41  ? 741 TRP A NE1 1 
ATOM   5586  C CE2 . TRP A 1 715 ? 8.707   34.773  -6.650  1.00 42.77  ? 741 TRP A CE2 1 
ATOM   5587  C CE3 . TRP A 1 715 ? 7.669   32.607  -6.995  1.00 41.56  ? 741 TRP A CE3 1 
ATOM   5588  C CZ2 . TRP A 1 715 ? 8.848   34.978  -8.031  1.00 41.87  ? 741 TRP A CZ2 1 
ATOM   5589  C CZ3 . TRP A 1 715 ? 7.810   32.810  -8.367  1.00 41.05  ? 741 TRP A CZ3 1 
ATOM   5590  C CH2 . TRP A 1 715 ? 8.397   33.988  -8.870  1.00 42.08  ? 741 TRP A CH2 1 
ATOM   5591  N N   . SER A 1 716 ? 8.537   30.227  -1.379  1.00 52.45  ? 742 SER A N   1 
ATOM   5592  C CA  . SER A 1 716 ? 8.003   29.464  -0.255  1.00 54.43  ? 742 SER A CA  1 
ATOM   5593  C C   . SER A 1 716 ? 8.407   30.156  1.043   1.00 54.46  ? 742 SER A C   1 
ATOM   5594  O O   . SER A 1 716 ? 7.714   30.068  2.056   1.00 55.72  ? 742 SER A O   1 
ATOM   5595  C CB  . SER A 1 716 ? 8.549   28.039  -0.272  1.00 55.59  ? 742 SER A CB  1 
ATOM   5596  O OG  . SER A 1 716 ? 9.957   28.039  -0.109  1.00 59.83  ? 742 SER A OG  1 
ATOM   5597  N N   . VAL A 1 717 ? 9.541   30.845  0.992   1.00 54.77  ? 743 VAL A N   1 
ATOM   5598  C CA  . VAL A 1 717 ? 10.075  31.586  2.132   1.00 53.43  ? 743 VAL A CA  1 
ATOM   5599  C C   . VAL A 1 717 ? 10.284  33.038  1.713   1.00 50.88  ? 743 VAL A C   1 
ATOM   5600  O O   . VAL A 1 717 ? 10.792  33.298  0.625   1.00 49.34  ? 743 VAL A O   1 
ATOM   5601  C CB  . VAL A 1 717 ? 11.430  30.992  2.586   1.00 55.02  ? 743 VAL A CB  1 
ATOM   5602  C CG1 . VAL A 1 717 ? 12.310  30.741  1.374   1.00 56.20  ? 743 VAL A CG1 1 
ATOM   5603  C CG2 . VAL A 1 717 ? 12.130  31.941  3.554   1.00 53.86  ? 743 VAL A CG2 1 
ATOM   5604  N N   . ASP A 1 718 ? 9.882   33.976  2.571   1.00 50.53  ? 744 ASP A N   1 
ATOM   5605  C CA  . ASP A 1 718 ? 10.037  35.403  2.288   1.00 49.55  ? 744 ASP A CA  1 
ATOM   5606  C C   . ASP A 1 718 ? 11.508  35.661  1.965   1.00 49.03  ? 744 ASP A C   1 
ATOM   5607  O O   . ASP A 1 718 ? 12.391  35.405  2.788   1.00 48.30  ? 744 ASP A O   1 
ATOM   5608  C CB  . ASP A 1 718 ? 9.606   36.236  3.503   1.00 50.69  ? 744 ASP A CB  1 
ATOM   5609  C CG  . ASP A 1 718 ? 9.654   37.738  3.238   1.00 53.97  ? 744 ASP A CG  1 
ATOM   5610  O OD1 . ASP A 1 718 ? 9.013   38.208  2.274   1.00 55.13  ? 744 ASP A OD1 1 
ATOM   5611  O OD2 . ASP A 1 718 ? 10.326  38.458  4.002   1.00 56.17  ? 744 ASP A OD2 1 
ATOM   5612  N N   . PRO A 1 719 ? 11.791  36.163  0.751   1.00 48.73  ? 745 PRO A N   1 
ATOM   5613  C CA  . PRO A 1 719 ? 13.176  36.435  0.354   1.00 47.02  ? 745 PRO A CA  1 
ATOM   5614  C C   . PRO A 1 719 ? 13.954  37.310  1.334   1.00 44.74  ? 745 PRO A C   1 
ATOM   5615  O O   . PRO A 1 719 ? 15.125  37.046  1.600   1.00 44.26  ? 745 PRO A O   1 
ATOM   5616  C CB  . PRO A 1 719 ? 13.025  37.066  -1.033  1.00 47.31  ? 745 PRO A CB  1 
ATOM   5617  C CG  . PRO A 1 719 ? 11.659  37.669  -0.998  1.00 47.59  ? 745 PRO A CG  1 
ATOM   5618  C CD  . PRO A 1 719 ? 10.849  36.622  -0.285  1.00 48.46  ? 745 PRO A CD  1 
ATOM   5619  N N   . LEU A 1 720 ? 13.308  38.337  1.876   1.00 41.65  ? 746 LEU A N   1 
ATOM   5620  C CA  . LEU A 1 720 ? 13.973  39.213  2.825   1.00 39.28  ? 746 LEU A CA  1 
ATOM   5621  C C   . LEU A 1 720 ? 14.395  38.423  4.063   1.00 40.58  ? 746 LEU A C   1 
ATOM   5622  O O   . LEU A 1 720 ? 15.482  38.637  4.588   1.00 39.93  ? 746 LEU A O   1 
ATOM   5623  C CB  . LEU A 1 720 ? 13.064  40.387  3.203   1.00 36.73  ? 746 LEU A CB  1 
ATOM   5624  C CG  . LEU A 1 720 ? 13.544  41.348  4.304   1.00 38.59  ? 746 LEU A CG  1 
ATOM   5625  C CD1 . LEU A 1 720 ? 14.961  41.843  4.043   1.00 36.00  ? 746 LEU A CD1 1 
ATOM   5626  C CD2 . LEU A 1 720 ? 12.579  42.520  4.381   1.00 39.49  ? 746 LEU A CD2 1 
ATOM   5627  N N   . ASP A 1 721 ? 13.554  37.503  4.534   1.00 43.91  ? 747 ASP A N   1 
ATOM   5628  C CA  . ASP A 1 721 ? 13.936  36.702  5.697   1.00 47.46  ? 747 ASP A CA  1 
ATOM   5629  C C   . ASP A 1 721 ? 15.105  35.819  5.292   1.00 48.36  ? 747 ASP A C   1 
ATOM   5630  O O   . ASP A 1 721 ? 16.014  35.573  6.080   1.00 47.75  ? 747 ASP A O   1 
ATOM   5631  C CB  . ASP A 1 721 ? 12.782  35.823  6.191   1.00 49.53  ? 747 ASP A CB  1 
ATOM   5632  C CG  . ASP A 1 721 ? 11.657  36.631  6.803   1.00 53.23  ? 747 ASP A CG  1 
ATOM   5633  O OD1 . ASP A 1 721 ? 11.945  37.680  7.422   1.00 53.56  ? 747 ASP A OD1 1 
ATOM   5634  O OD2 . ASP A 1 721 ? 10.487  36.211  6.677   1.00 55.85  ? 747 ASP A OD2 1 
ATOM   5635  N N   . ARG A 1 722 ? 15.077  35.346  4.052   1.00 49.78  ? 748 ARG A N   1 
ATOM   5636  C CA  . ARG A 1 722 ? 16.151  34.505  3.547   1.00 53.09  ? 748 ARG A CA  1 
ATOM   5637  C C   . ARG A 1 722 ? 17.458  35.295  3.610   1.00 53.43  ? 748 ARG A C   1 
ATOM   5638  O O   . ARG A 1 722 ? 18.452  34.823  4.162   1.00 53.69  ? 748 ARG A O   1 
ATOM   5639  C CB  . ARG A 1 722 ? 15.876  34.099  2.098   1.00 55.49  ? 748 ARG A CB  1 
ATOM   5640  C CG  . ARG A 1 722 ? 16.715  32.925  1.606   1.00 58.31  ? 748 ARG A CG  1 
ATOM   5641  C CD  . ARG A 1 722 ? 16.939  33.009  0.105   1.00 63.05  ? 748 ARG A CD  1 
ATOM   5642  N NE  . ARG A 1 722 ? 15.711  33.338  -0.614  1.00 67.72  ? 748 ARG A NE  1 
ATOM   5643  C CZ  . ARG A 1 722 ? 14.646  32.546  -0.688  1.00 69.44  ? 748 ARG A CZ  1 
ATOM   5644  N NH1 . ARG A 1 722 ? 14.646  31.362  -0.088  1.00 68.72  ? 748 ARG A NH1 1 
ATOM   5645  N NH2 . ARG A 1 722 ? 13.574  32.945  -1.355  1.00 70.86  ? 748 ARG A NH2 1 
ATOM   5646  N N   . ALA A 1 723 ? 17.443  36.499  3.039   1.00 53.35  ? 749 ALA A N   1 
ATOM   5647  C CA  . ALA A 1 723 ? 18.615  37.367  3.014   1.00 53.13  ? 749 ALA A CA  1 
ATOM   5648  C C   . ALA A 1 723 ? 19.125  37.634  4.420   1.00 54.02  ? 749 ALA A C   1 
ATOM   5649  O O   . ALA A 1 723 ? 20.318  37.511  4.692   1.00 55.03  ? 749 ALA A O   1 
ATOM   5650  C CB  . ALA A 1 723 ? 18.279  38.676  2.332   1.00 50.71  ? 749 ALA A CB  1 
ATOM   5651  N N   . LEU A 1 724 ? 18.209  38.000  5.306   1.00 55.49  ? 750 LEU A N   1 
ATOM   5652  C CA  . LEU A 1 724 ? 18.540  38.284  6.692   1.00 58.40  ? 750 LEU A CA  1 
ATOM   5653  C C   . LEU A 1 724 ? 19.193  37.085  7.377   1.00 62.50  ? 750 LEU A C   1 
ATOM   5654  O O   . LEU A 1 724 ? 20.034  37.246  8.260   1.00 62.81  ? 750 LEU A O   1 
ATOM   5655  C CB  . LEU A 1 724 ? 17.272  38.680  7.446   1.00 55.57  ? 750 LEU A CB  1 
ATOM   5656  C CG  . LEU A 1 724 ? 17.153  40.123  7.938   1.00 55.36  ? 750 LEU A CG  1 
ATOM   5657  C CD1 . LEU A 1 724 ? 17.437  41.103  6.813   1.00 53.86  ? 750 LEU A CD1 1 
ATOM   5658  C CD2 . LEU A 1 724 ? 15.754  40.330  8.502   1.00 55.12  ? 750 LEU A CD2 1 
ATOM   5659  N N   . ALA A 1 725 ? 18.806  35.883  6.965   1.00 68.16  ? 751 ALA A N   1 
ATOM   5660  C CA  . ALA A 1 725 ? 19.349  34.657  7.545   1.00 73.93  ? 751 ALA A CA  1 
ATOM   5661  C C   . ALA A 1 725 ? 20.806  34.394  7.152   1.00 78.16  ? 751 ALA A C   1 
ATOM   5662  O O   . ALA A 1 725 ? 21.423  33.454  7.650   1.00 78.98  ? 751 ALA A O   1 
ATOM   5663  C CB  . ALA A 1 725 ? 18.479  33.468  7.147   1.00 72.83  ? 751 ALA A CB  1 
ATOM   5664  N N   . GLU A 1 726 ? 21.355  35.216  6.263   1.00 83.23  ? 752 GLU A N   1 
ATOM   5665  C CA  . GLU A 1 726 ? 22.742  35.046  5.836   1.00 88.12  ? 752 GLU A CA  1 
ATOM   5666  C C   . GLU A 1 726 ? 23.701  35.986  6.562   1.00 90.13  ? 752 GLU A C   1 
ATOM   5667  O O   . GLU A 1 726 ? 24.726  35.551  7.092   1.00 90.69  ? 752 GLU A O   1 
ATOM   5668  C CB  . GLU A 1 726 ? 22.874  35.259  4.328   1.00 90.84  ? 752 GLU A CB  1 
ATOM   5669  C CG  . GLU A 1 726 ? 22.279  34.146  3.490   1.00 94.31  ? 752 GLU A CG  1 
ATOM   5670  C CD  . GLU A 1 726 ? 23.077  33.890  2.225   1.00 95.98  ? 752 GLU A CD  1 
ATOM   5671  O OE1 . GLU A 1 726 ? 22.691  32.987  1.453   1.00 97.27  ? 752 GLU A OE1 1 
ATOM   5672  O OE2 . GLU A 1 726 ? 24.093  34.589  2.008   1.00 95.46  ? 752 GLU A OE2 1 
ATOM   5673  N N   . LEU A 1 727 ? 23.373  37.275  6.573   1.00 91.59  ? 753 LEU A N   1 
ATOM   5674  C CA  . LEU A 1 727 ? 24.205  38.266  7.244   1.00 92.90  ? 753 LEU A CA  1 
ATOM   5675  C C   . LEU A 1 727 ? 24.414  37.850  8.694   1.00 94.76  ? 753 LEU A C   1 
ATOM   5676  O O   . LEU A 1 727 ? 25.528  37.521  9.101   1.00 95.39  ? 753 LEU A O   1 
ATOM   5677  C CB  . LEU A 1 727 ? 23.543  39.645  7.191   1.00 91.71  ? 753 LEU A CB  1 
ATOM   5678  C CG  . LEU A 1 727 ? 23.429  40.297  5.813   1.00 91.58  ? 753 LEU A CG  1 
ATOM   5679  C CD1 . LEU A 1 727 ? 24.811  40.456  5.204   1.00 91.63  ? 753 LEU A CD1 1 
ATOM   5680  C CD2 . LEU A 1 727 ? 22.556  39.448  4.915   1.00 92.97  ? 753 LEU A CD2 1 
ATOM   5681  N N   . ALA A 1 728 ? 23.333  37.861  9.467   1.00 96.58  ? 754 ALA A N   1 
ATOM   5682  C CA  . ALA A 1 728 ? 23.395  37.476  10.871  1.00 98.30  ? 754 ALA A CA  1 
ATOM   5683  C C   . ALA A 1 728 ? 23.365  35.953  10.995  1.00 99.38  ? 754 ALA A C   1 
ATOM   5684  O O   . ALA A 1 728 ? 22.328  35.366  11.309  1.00 99.88  ? 754 ALA A O   1 
ATOM   5685  C CB  . ALA A 1 728 ? 22.227  38.091  11.630  1.00 98.39  ? 754 ALA A CB  1 
ATOM   5686  N N   . ALA A 1 729 ? 24.507  35.321  10.740  1.00 100.41 ? 755 ALA A N   1 
ATOM   5687  C CA  . ALA A 1 729 ? 24.624  33.865  10.821  1.00 100.41 ? 755 ALA A CA  1 
ATOM   5688  C C   . ALA A 1 729 ? 26.042  33.458  11.223  1.00 100.41 ? 755 ALA A C   1 
ATOM   5689  O O   . ALA A 1 729 ? 26.181  32.750  12.246  1.00 100.41 ? 755 ALA A O   1 
ATOM   5690  C CB  . ALA A 1 729 ? 24.256  33.231  9.478   1.00 100.24 ? 755 ALA A CB  1 
ATOM   5691  O OXT . ALA A 1 729 ? 26.994  33.850  10.511  1.00 100.41 ? 755 ALA A OXT 1 
ATOM   5692  N N   . VAL B 1 1   ? 48.296  46.145  44.719  1.00 86.51  ? 27  VAL B N   1 
ATOM   5693  C CA  . VAL B 1 1   ? 48.171  46.669  43.329  1.00 85.19  ? 27  VAL B CA  1 
ATOM   5694  C C   . VAL B 1 1   ? 46.879  47.462  43.162  1.00 83.65  ? 27  VAL B C   1 
ATOM   5695  O O   . VAL B 1 1   ? 46.906  48.690  43.078  1.00 83.17  ? 27  VAL B O   1 
ATOM   5696  C CB  . VAL B 1 1   ? 48.180  45.516  42.290  1.00 86.17  ? 27  VAL B CB  1 
ATOM   5697  C CG1 . VAL B 1 1   ? 48.093  46.080  40.874  1.00 85.29  ? 27  VAL B CG1 1 
ATOM   5698  C CG2 . VAL B 1 1   ? 49.440  44.676  42.456  1.00 85.72  ? 27  VAL B CG2 1 
ATOM   5699  N N   . GLU B 1 2   ? 45.756  46.744  43.131  1.00 81.60  ? 28  GLU B N   1 
ATOM   5700  C CA  . GLU B 1 2   ? 44.425  47.332  42.956  1.00 78.06  ? 28  GLU B CA  1 
ATOM   5701  C C   . GLU B 1 2   ? 44.215  47.633  41.474  1.00 73.04  ? 28  GLU B C   1 
ATOM   5702  O O   . GLU B 1 2   ? 43.088  47.606  40.973  1.00 74.36  ? 28  GLU B O   1 
ATOM   5703  C CB  . GLU B 1 2   ? 44.275  48.617  43.783  1.00 80.95  ? 28  GLU B CB  1 
ATOM   5704  C CG  . GLU B 1 2   ? 44.387  48.413  45.290  1.00 84.71  ? 28  GLU B CG  1 
ATOM   5705  C CD  . GLU B 1 2   ? 43.313  47.491  45.840  1.00 86.70  ? 28  GLU B CD  1 
ATOM   5706  O OE1 . GLU B 1 2   ? 42.115  47.817  45.693  1.00 87.02  ? 28  GLU B OE1 1 
ATOM   5707  O OE2 . GLU B 1 2   ? 43.666  46.441  46.420  1.00 87.99  ? 28  GLU B OE2 1 
ATOM   5708  N N   . HIS B 1 3   ? 45.317  47.920  40.787  1.00 64.29  ? 29  HIS B N   1 
ATOM   5709  C CA  . HIS B 1 3   ? 45.306  48.204  39.359  1.00 56.41  ? 29  HIS B CA  1 
ATOM   5710  C C   . HIS B 1 3   ? 46.710  48.554  38.886  1.00 52.72  ? 29  HIS B C   1 
ATOM   5711  O O   . HIS B 1 3   ? 47.369  49.435  39.437  1.00 52.42  ? 29  HIS B O   1 
ATOM   5712  C CB  . HIS B 1 3   ? 44.359  49.354  39.018  1.00 50.51  ? 29  HIS B CB  1 
ATOM   5713  C CG  . HIS B 1 3   ? 44.041  49.440  37.555  1.00 47.91  ? 29  HIS B CG  1 
ATOM   5714  N ND1 . HIS B 1 3   ? 42.787  49.174  37.047  1.00 42.91  ? 29  HIS B ND1 1 
ATOM   5715  C CD2 . HIS B 1 3   ? 44.830  49.708  36.487  1.00 44.97  ? 29  HIS B CD2 1 
ATOM   5716  C CE1 . HIS B 1 3   ? 42.819  49.274  35.730  1.00 40.93  ? 29  HIS B CE1 1 
ATOM   5717  N NE2 . HIS B 1 3   ? 44.045  49.596  35.364  1.00 39.97  ? 29  HIS B NE2 1 
ATOM   5718  N N   . PRO B 1 4   ? 47.193  47.861  37.851  1.00 48.77  ? 30  PRO B N   1 
ATOM   5719  C CA  . PRO B 1 4   ? 48.538  48.145  37.349  1.00 45.91  ? 30  PRO B CA  1 
ATOM   5720  C C   . PRO B 1 4   ? 48.779  49.575  36.852  1.00 42.88  ? 30  PRO B C   1 
ATOM   5721  O O   . PRO B 1 4   ? 49.917  50.036  36.862  1.00 42.86  ? 30  PRO B O   1 
ATOM   5722  C CB  . PRO B 1 4   ? 48.733  47.085  36.262  1.00 45.19  ? 30  PRO B CB  1 
ATOM   5723  C CG  . PRO B 1 4   ? 47.328  46.762  35.827  1.00 44.39  ? 30  PRO B CG  1 
ATOM   5724  C CD  . PRO B 1 4   ? 46.570  46.747  37.117  1.00 44.79  ? 30  PRO B CD  1 
ATOM   5725  N N   . GLU B 1 5   ? 47.735  50.277  36.414  1.00 38.42  ? 31  GLU B N   1 
ATOM   5726  C CA  . GLU B 1 5   ? 47.926  51.653  35.953  1.00 37.83  ? 31  GLU B CA  1 
ATOM   5727  C C   . GLU B 1 5   ? 48.128  52.596  37.143  1.00 37.45  ? 31  GLU B C   1 
ATOM   5728  O O   . GLU B 1 5   ? 48.688  53.685  36.996  1.00 35.60  ? 31  GLU B O   1 
ATOM   5729  C CB  . GLU B 1 5   ? 46.737  52.143  35.115  1.00 38.33  ? 31  GLU B CB  1 
ATOM   5730  C CG  . GLU B 1 5   ? 46.654  51.577  33.699  1.00 35.12  ? 31  GLU B CG  1 
ATOM   5731  C CD  . GLU B 1 5   ? 47.915  51.806  32.876  1.00 36.73  ? 31  GLU B CD  1 
ATOM   5732  O OE1 . GLU B 1 5   ? 48.411  52.956  32.788  1.00 35.12  ? 31  GLU B OE1 1 
ATOM   5733  O OE2 . GLU B 1 5   ? 48.409  50.817  32.302  1.00 38.67  ? 31  GLU B OE2 1 
ATOM   5734  N N   . PHE B 1 6   ? 47.671  52.170  38.320  1.00 35.13  ? 32  PHE B N   1 
ATOM   5735  C CA  . PHE B 1 6   ? 47.817  52.960  39.538  1.00 34.53  ? 32  PHE B CA  1 
ATOM   5736  C C   . PHE B 1 6   ? 49.285  53.031  39.935  1.00 36.06  ? 32  PHE B C   1 
ATOM   5737  O O   . PHE B 1 6   ? 49.709  53.979  40.592  1.00 39.20  ? 32  PHE B O   1 
ATOM   5738  C CB  . PHE B 1 6   ? 47.037  52.324  40.693  1.00 34.31  ? 32  PHE B CB  1 
ATOM   5739  C CG  . PHE B 1 6   ? 45.558  52.596  40.675  1.00 31.93  ? 32  PHE B CG  1 
ATOM   5740  C CD1 . PHE B 1 6   ? 44.920  53.043  39.529  1.00 31.64  ? 32  PHE B CD1 1 
ATOM   5741  C CD2 . PHE B 1 6   ? 44.797  52.367  41.816  1.00 31.64  ? 32  PHE B CD2 1 
ATOM   5742  C CE1 . PHE B 1 6   ? 43.541  53.256  39.516  1.00 32.68  ? 32  PHE B CE1 1 
ATOM   5743  C CE2 . PHE B 1 6   ? 43.423  52.576  41.812  1.00 33.13  ? 32  PHE B CE2 1 
ATOM   5744  C CZ  . PHE B 1 6   ? 42.793  53.022  40.658  1.00 30.85  ? 32  PHE B CZ  1 
ATOM   5745  N N   . LEU B 1 7   ? 50.059  52.024  39.545  1.00 37.38  ? 33  LEU B N   1 
ATOM   5746  C CA  . LEU B 1 7   ? 51.484  51.981  39.879  1.00 39.59  ? 33  LEU B CA  1 
ATOM   5747  C C   . LEU B 1 7   ? 52.279  53.011  39.097  1.00 38.61  ? 33  LEU B C   1 
ATOM   5748  O O   . LEU B 1 7   ? 53.381  53.376  39.485  1.00 36.73  ? 33  LEU B O   1 
ATOM   5749  C CB  . LEU B 1 7   ? 52.068  50.598  39.587  1.00 39.77  ? 33  LEU B CB  1 
ATOM   5750  C CG  . LEU B 1 7   ? 51.349  49.404  40.212  1.00 42.31  ? 33  LEU B CG  1 
ATOM   5751  C CD1 . LEU B 1 7   ? 52.064  48.122  39.803  1.00 42.26  ? 33  LEU B CD1 1 
ATOM   5752  C CD2 . LEU B 1 7   ? 51.306  49.558  41.729  1.00 43.73  ? 33  LEU B CD2 1 
ATOM   5753  N N   . LYS B 1 8   ? 51.713  53.475  37.991  1.00 40.17  ? 34  LYS B N   1 
ATOM   5754  C CA  . LYS B 1 8   ? 52.388  54.448  37.140  1.00 41.46  ? 34  LYS B CA  1 
ATOM   5755  C C   . LYS B 1 8   ? 51.882  55.857  37.416  1.00 40.43  ? 34  LYS B C   1 
ATOM   5756  O O   . LYS B 1 8   ? 52.444  56.835  36.927  1.00 41.73  ? 34  LYS B O   1 
ATOM   5757  C CB  . LYS B 1 8   ? 52.134  54.084  35.675  1.00 43.79  ? 34  LYS B CB  1 
ATOM   5758  C CG  . LYS B 1 8   ? 52.443  52.621  35.358  1.00 48.54  ? 34  LYS B CG  1 
ATOM   5759  C CD  . LYS B 1 8   ? 51.600  52.088  34.209  1.00 51.80  ? 34  LYS B CD  1 
ATOM   5760  C CE  . LYS B 1 8   ? 51.934  52.764  32.886  1.00 54.63  ? 34  LYS B CE  1 
ATOM   5761  N NZ  . LYS B 1 8   ? 51.002  52.338  31.796  1.00 56.15  ? 34  LYS B NZ  1 
ATOM   5762  N N   . ALA B 1 9   ? 50.834  55.949  38.227  1.00 38.19  ? 35  ALA B N   1 
ATOM   5763  C CA  . ALA B 1 9   ? 50.197  57.223  38.537  1.00 36.44  ? 35  ALA B CA  1 
ATOM   5764  C C   . ALA B 1 9   ? 50.901  58.154  39.517  1.00 34.47  ? 35  ALA B C   1 
ATOM   5765  O O   . ALA B 1 9   ? 51.386  57.730  40.559  1.00 33.67  ? 35  ALA B O   1 
ATOM   5766  C CB  . ALA B 1 9   ? 48.770  56.965  39.013  1.00 33.71  ? 35  ALA B CB  1 
ATOM   5767  N N   . GLY B 1 10  ? 50.929  59.435  39.158  1.00 34.85  ? 36  GLY B N   1 
ATOM   5768  C CA  . GLY B 1 10  ? 51.520  60.472  39.988  1.00 33.10  ? 36  GLY B CA  1 
ATOM   5769  C C   . GLY B 1 10  ? 52.851  60.190  40.643  1.00 32.91  ? 36  GLY B C   1 
ATOM   5770  O O   . GLY B 1 10  ? 53.016  60.447  41.828  1.00 32.19  ? 36  GLY B O   1 
ATOM   5771  N N   . LYS B 1 11  ? 53.805  59.667  39.880  1.00 36.42  ? 37  LYS B N   1 
ATOM   5772  C CA  . LYS B 1 11  ? 55.139  59.365  40.407  1.00 37.37  ? 37  LYS B CA  1 
ATOM   5773  C C   . LYS B 1 11  ? 56.080  60.549  40.199  1.00 36.81  ? 37  LYS B C   1 
ATOM   5774  O O   . LYS B 1 11  ? 57.134  60.631  40.818  1.00 37.05  ? 37  LYS B O   1 
ATOM   5775  C CB  . LYS B 1 11  ? 55.724  58.136  39.711  1.00 37.27  ? 37  LYS B CB  1 
ATOM   5776  C CG  . LYS B 1 11  ? 55.029  56.828  40.032  1.00 39.89  ? 37  LYS B CG  1 
ATOM   5777  C CD  . LYS B 1 11  ? 55.238  56.437  41.483  1.00 44.32  ? 37  LYS B CD  1 
ATOM   5778  C CE  . LYS B 1 11  ? 55.241  54.917  41.647  1.00 49.14  ? 37  LYS B CE  1 
ATOM   5779  N NZ  . LYS B 1 11  ? 56.308  54.265  40.810  1.00 49.82  ? 37  LYS B NZ  1 
ATOM   5780  N N   . GLU B 1 12  ? 55.692  61.463  39.318  1.00 37.76  ? 38  GLU B N   1 
ATOM   5781  C CA  . GLU B 1 12  ? 56.500  62.639  39.031  1.00 38.77  ? 38  GLU B CA  1 
ATOM   5782  C C   . GLU B 1 12  ? 55.644  63.734  38.407  1.00 36.72  ? 38  GLU B C   1 
ATOM   5783  O O   . GLU B 1 12  ? 54.595  63.457  37.836  1.00 36.52  ? 38  GLU B O   1 
ATOM   5784  C CB  . GLU B 1 12  ? 57.637  62.263  38.092  1.00 41.87  ? 38  GLU B CB  1 
ATOM   5785  C CG  . GLU B 1 12  ? 57.172  61.627  36.805  1.00 49.51  ? 38  GLU B CG  1 
ATOM   5786  C CD  . GLU B 1 12  ? 58.320  61.040  36.014  1.00 54.13  ? 38  GLU B CD  1 
ATOM   5787  O OE1 . GLU B 1 12  ? 59.217  61.808  35.599  1.00 54.63  ? 38  GLU B OE1 1 
ATOM   5788  O OE2 . GLU B 1 12  ? 58.325  59.806  35.816  1.00 59.18  ? 38  GLU B OE2 1 
ATOM   5789  N N   . PRO B 1 13  ? 56.082  64.996  38.516  1.00 35.43  ? 39  PRO B N   1 
ATOM   5790  C CA  . PRO B 1 13  ? 55.360  66.149  37.968  1.00 33.46  ? 39  PRO B CA  1 
ATOM   5791  C C   . PRO B 1 13  ? 54.952  65.952  36.520  1.00 32.62  ? 39  PRO B C   1 
ATOM   5792  O O   . PRO B 1 13  ? 55.755  65.506  35.699  1.00 34.76  ? 39  PRO B O   1 
ATOM   5793  C CB  . PRO B 1 13  ? 56.360  67.284  38.134  1.00 33.28  ? 39  PRO B CB  1 
ATOM   5794  C CG  . PRO B 1 13  ? 57.051  66.916  39.404  1.00 35.18  ? 39  PRO B CG  1 
ATOM   5795  C CD  . PRO B 1 13  ? 57.312  65.434  39.199  1.00 35.45  ? 39  PRO B CD  1 
ATOM   5796  N N   . GLY B 1 14  ? 53.700  66.284  36.211  1.00 30.57  ? 40  GLY B N   1 
ATOM   5797  C CA  . GLY B 1 14  ? 53.211  66.127  34.855  1.00 24.64  ? 40  GLY B CA  1 
ATOM   5798  C C   . GLY B 1 14  ? 51.725  65.839  34.742  1.00 22.75  ? 40  GLY B C   1 
ATOM   5799  O O   . GLY B 1 14  ? 50.977  65.890  35.721  1.00 23.50  ? 40  GLY B O   1 
ATOM   5800  N N   . LEU B 1 15  ? 51.301  65.520  33.527  1.00 20.17  ? 41  LEU B N   1 
ATOM   5801  C CA  . LEU B 1 15  ? 49.908  65.243  33.241  1.00 18.12  ? 41  LEU B CA  1 
ATOM   5802  C C   . LEU B 1 15  ? 49.728  63.828  32.681  1.00 17.45  ? 41  LEU B C   1 
ATOM   5803  O O   . LEU B 1 15  ? 50.444  63.428  31.777  1.00 15.95  ? 41  LEU B O   1 
ATOM   5804  C CB  . LEU B 1 15  ? 49.405  66.275  32.234  1.00 13.89  ? 41  LEU B CB  1 
ATOM   5805  C CG  . LEU B 1 15  ? 47.936  66.197  31.822  1.00 18.19  ? 41  LEU B CG  1 
ATOM   5806  C CD1 . LEU B 1 15  ? 47.047  66.638  32.987  1.00 13.32  ? 41  LEU B CD1 1 
ATOM   5807  C CD2 . LEU B 1 15  ? 47.716  67.080  30.592  1.00 14.71  ? 41  LEU B CD2 1 
ATOM   5808  N N   . GLN B 1 16  ? 48.774  63.080  33.228  1.00 17.89  ? 42  GLN B N   1 
ATOM   5809  C CA  . GLN B 1 16  ? 48.487  61.715  32.775  1.00 18.26  ? 42  GLN B CA  1 
ATOM   5810  C C   . GLN B 1 16  ? 46.992  61.617  32.464  1.00 18.71  ? 42  GLN B C   1 
ATOM   5811  O O   . GLN B 1 16  ? 46.162  62.108  33.230  1.00 20.23  ? 42  GLN B O   1 
ATOM   5812  C CB  . GLN B 1 16  ? 48.859  60.688  33.858  1.00 17.02  ? 42  GLN B CB  1 
ATOM   5813  C CG  . GLN B 1 16  ? 50.343  60.560  34.102  1.00 18.91  ? 42  GLN B CG  1 
ATOM   5814  C CD  . GLN B 1 16  ? 50.678  59.739  35.340  1.00 26.55  ? 42  GLN B CD  1 
ATOM   5815  O OE1 . GLN B 1 16  ? 50.278  60.076  36.465  1.00 25.84  ? 42  GLN B OE1 1 
ATOM   5816  N NE2 . GLN B 1 16  ? 51.428  58.657  35.143  1.00 27.63  ? 42  GLN B NE2 1 
ATOM   5817  N N   . ILE B 1 17  ? 46.652  60.990  31.342  1.00 17.49  ? 43  ILE B N   1 
ATOM   5818  C CA  . ILE B 1 17  ? 45.257  60.852  30.948  1.00 17.49  ? 43  ILE B CA  1 
ATOM   5819  C C   . ILE B 1 17  ? 44.916  59.426  30.530  1.00 19.04  ? 43  ILE B C   1 
ATOM   5820  O O   . ILE B 1 17  ? 45.615  58.816  29.720  1.00 20.48  ? 43  ILE B O   1 
ATOM   5821  C CB  . ILE B 1 17  ? 44.906  61.812  29.773  1.00 19.07  ? 43  ILE B CB  1 
ATOM   5822  C CG1 . ILE B 1 17  ? 45.190  63.263  30.186  1.00 17.38  ? 43  ILE B CG1 1 
ATOM   5823  C CG2 . ILE B 1 17  ? 43.430  61.645  29.374  1.00 9.00   ? 43  ILE B CG2 1 
ATOM   5824  C CD1 . ILE B 1 17  ? 44.961  64.279  29.098  1.00 15.72  ? 43  ILE B CD1 1 
ATOM   5825  N N   . TRP B 1 18  ? 43.833  58.902  31.094  1.00 19.50  ? 44  TRP B N   1 
ATOM   5826  C CA  . TRP B 1 18  ? 43.367  57.556  30.787  1.00 17.95  ? 44  TRP B CA  1 
ATOM   5827  C C   . TRP B 1 18  ? 41.939  57.601  30.285  1.00 17.65  ? 44  TRP B C   1 
ATOM   5828  O O   . TRP B 1 18  ? 41.120  58.363  30.788  1.00 18.88  ? 44  TRP B O   1 
ATOM   5829  C CB  . TRP B 1 18  ? 43.374  56.679  32.033  1.00 19.20  ? 44  TRP B CB  1 
ATOM   5830  C CG  . TRP B 1 18  ? 44.717  56.337  32.567  1.00 18.42  ? 44  TRP B CG  1 
ATOM   5831  C CD1 . TRP B 1 18  ? 45.537  55.326  32.149  1.00 15.92  ? 44  TRP B CD1 1 
ATOM   5832  C CD2 . TRP B 1 18  ? 45.389  56.986  33.651  1.00 18.76  ? 44  TRP B CD2 1 
ATOM   5833  N NE1 . TRP B 1 18  ? 46.681  55.305  32.915  1.00 20.74  ? 44  TRP B NE1 1 
ATOM   5834  C CE2 . TRP B 1 18  ? 46.616  56.313  33.846  1.00 18.99  ? 44  TRP B CE2 1 
ATOM   5835  C CE3 . TRP B 1 18  ? 45.075  58.074  34.482  1.00 17.46  ? 44  TRP B CE3 1 
ATOM   5836  C CZ2 . TRP B 1 18  ? 47.528  56.686  34.840  1.00 17.34  ? 44  TRP B CZ2 1 
ATOM   5837  C CZ3 . TRP B 1 18  ? 45.981  58.448  35.469  1.00 15.74  ? 44  TRP B CZ3 1 
ATOM   5838  C CH2 . TRP B 1 18  ? 47.195  57.752  35.638  1.00 17.13  ? 44  TRP B CH2 1 
ATOM   5839  N N   . ARG B 1 19  ? 41.642  56.780  29.293  1.00 17.02  ? 45  ARG B N   1 
ATOM   5840  C CA  . ARG B 1 19  ? 40.294  56.694  28.770  1.00 18.15  ? 45  ARG B CA  1 
ATOM   5841  C C   . ARG B 1 19  ? 39.693  55.472  29.461  1.00 18.17  ? 45  ARG B C   1 
ATOM   5842  O O   . ARG B 1 19  ? 40.376  54.463  29.632  1.00 16.85  ? 45  ARG B O   1 
ATOM   5843  C CB  . ARG B 1 19  ? 40.338  56.472  27.264  1.00 18.96  ? 45  ARG B CB  1 
ATOM   5844  C CG  . ARG B 1 19  ? 38.992  56.488  26.554  1.00 18.47  ? 45  ARG B CG  1 
ATOM   5845  C CD  . ARG B 1 19  ? 39.107  55.547  25.379  1.00 22.96  ? 45  ARG B CD  1 
ATOM   5846  N NE  . ARG B 1 19  ? 38.173  55.799  24.294  1.00 22.72  ? 45  ARG B NE  1 
ATOM   5847  C CZ  . ARG B 1 19  ? 38.171  55.110  23.156  1.00 22.08  ? 45  ARG B CZ  1 
ATOM   5848  N NH1 . ARG B 1 19  ? 39.051  54.130  22.965  1.00 15.90  ? 45  ARG B NH1 1 
ATOM   5849  N NH2 . ARG B 1 19  ? 37.295  55.405  22.206  1.00 21.12  ? 45  ARG B NH2 1 
ATOM   5850  N N   . VAL B 1 20  ? 38.434  55.558  29.881  1.00 20.41  ? 46  VAL B N   1 
ATOM   5851  C CA  . VAL B 1 20  ? 37.800  54.421  30.541  1.00 19.54  ? 46  VAL B CA  1 
ATOM   5852  C C   . VAL B 1 20  ? 37.232  53.521  29.458  1.00 23.02  ? 46  VAL B C   1 
ATOM   5853  O O   . VAL B 1 20  ? 36.336  53.921  28.725  1.00 24.85  ? 46  VAL B O   1 
ATOM   5854  C CB  . VAL B 1 20  ? 36.671  54.871  31.491  1.00 18.94  ? 46  VAL B CB  1 
ATOM   5855  C CG1 . VAL B 1 20  ? 35.950  53.665  32.049  1.00 18.91  ? 46  VAL B CG1 1 
ATOM   5856  C CG2 . VAL B 1 20  ? 37.250  55.693  32.642  1.00 18.36  ? 46  VAL B CG2 1 
ATOM   5857  N N   . GLU B 1 21  ? 37.772  52.310  29.348  1.00 26.04  ? 47  GLU B N   1 
ATOM   5858  C CA  . GLU B 1 21  ? 37.328  51.358  28.339  1.00 26.09  ? 47  GLU B CA  1 
ATOM   5859  C C   . GLU B 1 21  ? 36.905  50.045  28.988  1.00 28.34  ? 47  GLU B C   1 
ATOM   5860  O O   . GLU B 1 21  ? 37.740  49.293  29.488  1.00 28.50  ? 47  GLU B O   1 
ATOM   5861  C CB  . GLU B 1 21  ? 38.452  51.127  27.330  1.00 24.87  ? 47  GLU B CB  1 
ATOM   5862  C CG  . GLU B 1 21  ? 38.767  52.358  26.493  1.00 27.06  ? 47  GLU B CG  1 
ATOM   5863  C CD  . GLU B 1 21  ? 40.026  52.220  25.641  1.00 29.06  ? 47  GLU B CD  1 
ATOM   5864  O OE1 . GLU B 1 21  ? 40.259  51.137  25.063  1.00 28.31  ? 47  GLU B OE1 1 
ATOM   5865  O OE2 . GLU B 1 21  ? 40.780  53.212  25.536  1.00 30.04  ? 47  GLU B OE2 1 
ATOM   5866  N N   . LYS B 1 22  ? 35.599  49.778  28.969  1.00 31.80  ? 48  LYS B N   1 
ATOM   5867  C CA  . LYS B 1 22  ? 35.032  48.571  29.571  1.00 33.25  ? 48  LYS B CA  1 
ATOM   5868  C C   . LYS B 1 22  ? 35.606  48.302  30.951  1.00 31.75  ? 48  LYS B C   1 
ATOM   5869  O O   . LYS B 1 22  ? 36.210  47.265  31.203  1.00 34.22  ? 48  LYS B O   1 
ATOM   5870  C CB  . LYS B 1 22  ? 35.246  47.357  28.670  1.00 35.92  ? 48  LYS B CB  1 
ATOM   5871  C CG  . LYS B 1 22  ? 34.417  47.418  27.410  1.00 41.25  ? 48  LYS B CG  1 
ATOM   5872  C CD  . LYS B 1 22  ? 34.491  46.132  26.622  1.00 48.13  ? 48  LYS B CD  1 
ATOM   5873  C CE  . LYS B 1 22  ? 33.793  46.300  25.284  1.00 51.13  ? 48  LYS B CE  1 
ATOM   5874  N NZ  . LYS B 1 22  ? 32.394  46.790  25.470  1.00 54.77  ? 48  LYS B NZ  1 
ATOM   5875  N N   . PHE B 1 23  ? 35.393  49.268  31.837  1.00 30.32  ? 49  PHE B N   1 
ATOM   5876  C CA  . PHE B 1 23  ? 35.846  49.232  33.215  1.00 27.55  ? 49  PHE B CA  1 
ATOM   5877  C C   . PHE B 1 23  ? 37.336  49.034  33.382  1.00 26.70  ? 49  PHE B C   1 
ATOM   5878  O O   . PHE B 1 23  ? 37.785  48.375  34.313  1.00 29.36  ? 49  PHE B O   1 
ATOM   5879  C CB  . PHE B 1 23  ? 35.098  48.161  34.013  1.00 28.40  ? 49  PHE B CB  1 
ATOM   5880  C CG  . PHE B 1 23  ? 34.977  48.481  35.479  1.00 26.52  ? 49  PHE B CG  1 
ATOM   5881  C CD1 . PHE B 1 23  ? 34.395  47.584  36.354  1.00 26.95  ? 49  PHE B CD1 1 
ATOM   5882  C CD2 . PHE B 1 23  ? 35.407  49.711  35.975  1.00 29.50  ? 49  PHE B CD2 1 
ATOM   5883  C CE1 . PHE B 1 23  ? 34.236  47.897  37.693  1.00 24.73  ? 49  PHE B CE1 1 
ATOM   5884  C CE2 . PHE B 1 23  ? 35.254  50.037  37.317  1.00 26.60  ? 49  PHE B CE2 1 
ATOM   5885  C CZ  . PHE B 1 23  ? 34.663  49.125  38.176  1.00 28.04  ? 49  PHE B CZ  1 
ATOM   5886  N N   . ASP B 1 24  ? 38.110  49.626  32.487  1.00 26.18  ? 50  ASP B N   1 
ATOM   5887  C CA  . ASP B 1 24  ? 39.555  49.528  32.566  1.00 24.28  ? 50  ASP B CA  1 
ATOM   5888  C C   . ASP B 1 24  ? 40.152  50.871  32.186  1.00 24.13  ? 50  ASP B C   1 
ATOM   5889  O O   . ASP B 1 24  ? 39.527  51.647  31.466  1.00 23.27  ? 50  ASP B O   1 
ATOM   5890  C CB  . ASP B 1 24  ? 40.056  48.441  31.628  1.00 24.89  ? 50  ASP B CB  1 
ATOM   5891  C CG  . ASP B 1 24  ? 41.535  48.232  31.737  1.00 26.48  ? 50  ASP B CG  1 
ATOM   5892  O OD1 . ASP B 1 24  ? 42.069  48.368  32.850  1.00 28.17  ? 50  ASP B OD1 1 
ATOM   5893  O OD2 . ASP B 1 24  ? 42.169  47.918  30.714  1.00 36.33  ? 50  ASP B OD2 1 
ATOM   5894  N N   . LEU B 1 25  ? 41.350  51.153  32.691  1.00 24.21  ? 51  LEU B N   1 
ATOM   5895  C CA  . LEU B 1 25  ? 42.030  52.406  32.395  1.00 22.52  ? 51  LEU B CA  1 
ATOM   5896  C C   . LEU B 1 25  ? 43.042  52.166  31.288  1.00 23.11  ? 51  LEU B C   1 
ATOM   5897  O O   . LEU B 1 25  ? 43.980  51.396  31.458  1.00 25.31  ? 51  LEU B O   1 
ATOM   5898  C CB  . LEU B 1 25  ? 42.728  52.941  33.646  1.00 21.31  ? 51  LEU B CB  1 
ATOM   5899  C CG  . LEU B 1 25  ? 41.814  53.408  34.790  1.00 21.06  ? 51  LEU B CG  1 
ATOM   5900  C CD1 . LEU B 1 25  ? 42.654  53.676  36.024  1.00 20.03  ? 51  LEU B CD1 1 
ATOM   5901  C CD2 . LEU B 1 25  ? 41.032  54.658  34.376  1.00 16.65  ? 51  LEU B CD2 1 
ATOM   5902  N N   . VAL B 1 26  ? 42.836  52.823  30.150  1.00 22.66  ? 52  VAL B N   1 
ATOM   5903  C CA  . VAL B 1 26  ? 43.710  52.681  28.998  1.00 19.69  ? 52  VAL B CA  1 
ATOM   5904  C C   . VAL B 1 26  ? 44.376  54.005  28.682  1.00 22.10  ? 52  VAL B C   1 
ATOM   5905  O O   . VAL B 1 26  ? 43.707  54.991  28.407  1.00 21.40  ? 52  VAL B O   1 
ATOM   5906  C CB  . VAL B 1 26  ? 42.924  52.246  27.761  1.00 18.50  ? 52  VAL B CB  1 
ATOM   5907  C CG1 . VAL B 1 26  ? 43.858  52.141  26.565  1.00 15.40  ? 52  VAL B CG1 1 
ATOM   5908  C CG2 . VAL B 1 26  ? 42.227  50.919  28.038  1.00 19.22  ? 52  VAL B CG2 1 
ATOM   5909  N N   . PRO B 1 27  ? 45.714  54.035  28.700  1.00 23.87  ? 53  PRO B N   1 
ATOM   5910  C CA  . PRO B 1 27  ? 46.499  55.241  28.421  1.00 24.56  ? 53  PRO B CA  1 
ATOM   5911  C C   . PRO B 1 27  ? 46.225  55.906  27.075  1.00 24.24  ? 53  PRO B C   1 
ATOM   5912  O O   . PRO B 1 27  ? 46.122  55.239  26.043  1.00 24.79  ? 53  PRO B O   1 
ATOM   5913  C CB  . PRO B 1 27  ? 47.938  54.741  28.519  1.00 25.82  ? 53  PRO B CB  1 
ATOM   5914  C CG  . PRO B 1 27  ? 47.833  53.613  29.512  1.00 27.38  ? 53  PRO B CG  1 
ATOM   5915  C CD  . PRO B 1 27  ? 46.597  52.907  29.041  1.00 23.78  ? 53  PRO B CD  1 
ATOM   5916  N N   . VAL B 1 28  ? 46.111  57.229  27.102  1.00 24.03  ? 54  VAL B N   1 
ATOM   5917  C CA  . VAL B 1 28  ? 45.901  58.015  25.895  1.00 21.36  ? 54  VAL B CA  1 
ATOM   5918  C C   . VAL B 1 28  ? 47.272  58.491  25.435  1.00 20.74  ? 54  VAL B C   1 
ATOM   5919  O O   . VAL B 1 28  ? 48.092  58.912  26.244  1.00 21.28  ? 54  VAL B O   1 
ATOM   5920  C CB  . VAL B 1 28  ? 45.030  59.247  26.171  1.00 20.61  ? 54  VAL B CB  1 
ATOM   5921  C CG1 . VAL B 1 28  ? 44.892  60.090  24.896  1.00 19.17  ? 54  VAL B CG1 1 
ATOM   5922  C CG2 . VAL B 1 28  ? 43.678  58.807  26.665  1.00 19.40  ? 54  VAL B CG2 1 
ATOM   5923  N N   . PRO B 1 29  ? 47.553  58.411  24.132  1.00 23.33  ? 55  PRO B N   1 
ATOM   5924  C CA  . PRO B 1 29  ? 48.861  58.861  23.635  1.00 23.81  ? 55  PRO B CA  1 
ATOM   5925  C C   . PRO B 1 29  ? 49.073  60.334  23.977  1.00 23.71  ? 55  PRO B C   1 
ATOM   5926  O O   . PRO B 1 29  ? 48.245  61.182  23.645  1.00 22.91  ? 55  PRO B O   1 
ATOM   5927  C CB  . PRO B 1 29  ? 48.756  58.619  22.133  1.00 23.13  ? 55  PRO B CB  1 
ATOM   5928  C CG  . PRO B 1 29  ? 47.854  57.429  22.055  1.00 24.54  ? 55  PRO B CG  1 
ATOM   5929  C CD  . PRO B 1 29  ? 46.773  57.768  23.064  1.00 23.73  ? 55  PRO B CD  1 
ATOM   5930  N N   . PRO B 1 30  ? 50.194  60.657  24.633  1.00 25.47  ? 56  PRO B N   1 
ATOM   5931  C CA  . PRO B 1 30  ? 50.508  62.035  25.025  1.00 25.64  ? 56  PRO B CA  1 
ATOM   5932  C C   . PRO B 1 30  ? 50.384  63.066  23.906  1.00 27.18  ? 56  PRO B C   1 
ATOM   5933  O O   . PRO B 1 30  ? 49.970  64.197  24.149  1.00 31.33  ? 56  PRO B O   1 
ATOM   5934  C CB  . PRO B 1 30  ? 51.939  61.931  25.551  1.00 25.90  ? 56  PRO B CB  1 
ATOM   5935  C CG  . PRO B 1 30  ? 52.039  60.513  26.030  1.00 26.02  ? 56  PRO B CG  1 
ATOM   5936  C CD  . PRO B 1 30  ? 51.324  59.761  24.932  1.00 27.16  ? 56  PRO B CD  1 
ATOM   5937  N N   . ASN B 1 31  ? 50.743  62.703  22.683  1.00 28.09  ? 57  ASN B N   1 
ATOM   5938  C CA  . ASN B 1 31  ? 50.642  63.670  21.598  1.00 30.02  ? 57  ASN B CA  1 
ATOM   5939  C C   . ASN B 1 31  ? 49.187  63.933  21.220  1.00 29.02  ? 57  ASN B C   1 
ATOM   5940  O O   . ASN B 1 31  ? 48.903  64.824  20.412  1.00 31.15  ? 57  ASN B O   1 
ATOM   5941  C CB  . ASN B 1 31  ? 51.428  63.198  20.375  1.00 32.07  ? 57  ASN B CB  1 
ATOM   5942  C CG  . ASN B 1 31  ? 50.910  61.894  19.830  1.00 37.26  ? 57  ASN B CG  1 
ATOM   5943  O OD1 . ASN B 1 31  ? 50.911  60.872  20.529  1.00 40.20  ? 57  ASN B OD1 1 
ATOM   5944  N ND2 . ASN B 1 31  ? 50.461  61.912  18.575  1.00 33.44  ? 57  ASN B ND2 1 
ATOM   5945  N N   . LEU B 1 32  ? 48.265  63.166  21.803  1.00 25.44  ? 58  LEU B N   1 
ATOM   5946  C CA  . LEU B 1 32  ? 46.844  63.354  21.526  1.00 20.97  ? 58  LEU B CA  1 
ATOM   5947  C C   . LEU B 1 32  ? 46.070  63.957  22.699  1.00 22.03  ? 58  LEU B C   1 
ATOM   5948  O O   . LEU B 1 32  ? 44.849  64.105  22.621  1.00 24.20  ? 58  LEU B O   1 
ATOM   5949  C CB  . LEU B 1 32  ? 46.183  62.037  21.096  1.00 18.67  ? 58  LEU B CB  1 
ATOM   5950  C CG  . LEU B 1 32  ? 46.636  61.437  19.753  1.00 19.02  ? 58  LEU B CG  1 
ATOM   5951  C CD1 . LEU B 1 32  ? 45.854  60.160  19.512  1.00 14.02  ? 58  LEU B CD1 1 
ATOM   5952  C CD2 . LEU B 1 32  ? 46.437  62.436  18.584  1.00 15.78  ? 58  LEU B CD2 1 
ATOM   5953  N N   . TYR B 1 33  ? 46.764  64.292  23.785  1.00 17.88  ? 59  TYR B N   1 
ATOM   5954  C CA  . TYR B 1 33  ? 46.112  64.911  24.933  1.00 17.75  ? 59  TYR B CA  1 
ATOM   5955  C C   . TYR B 1 33  ? 45.322  66.124  24.428  1.00 18.81  ? 59  TYR B C   1 
ATOM   5956  O O   . TYR B 1 33  ? 45.797  66.876  23.572  1.00 21.54  ? 59  TYR B O   1 
ATOM   5957  C CB  . TYR B 1 33  ? 47.157  65.373  25.954  1.00 20.98  ? 59  TYR B CB  1 
ATOM   5958  C CG  . TYR B 1 33  ? 47.757  64.287  26.830  1.00 18.81  ? 59  TYR B CG  1 
ATOM   5959  C CD1 . TYR B 1 33  ? 47.410  62.941  26.675  1.00 17.68  ? 59  TYR B CD1 1 
ATOM   5960  C CD2 . TYR B 1 33  ? 48.648  64.621  27.842  1.00 17.55  ? 59  TYR B CD2 1 
ATOM   5961  C CE1 . TYR B 1 33  ? 47.939  61.963  27.516  1.00 19.05  ? 59  TYR B CE1 1 
ATOM   5962  C CE2 . TYR B 1 33  ? 49.178  63.662  28.683  1.00 18.04  ? 59  TYR B CE2 1 
ATOM   5963  C CZ  . TYR B 1 33  ? 48.823  62.336  28.523  1.00 21.20  ? 59  TYR B CZ  1 
ATOM   5964  O OH  . TYR B 1 33  ? 49.354  61.405  29.387  1.00 22.15  ? 59  TYR B OH  1 
ATOM   5965  N N   . GLY B 1 34  ? 44.120  66.319  24.956  1.00 18.49  ? 60  GLY B N   1 
ATOM   5966  C CA  . GLY B 1 34  ? 43.291  67.417  24.490  1.00 17.01  ? 60  GLY B CA  1 
ATOM   5967  C C   . GLY B 1 34  ? 42.170  66.873  23.615  1.00 18.58  ? 60  GLY B C   1 
ATOM   5968  O O   . GLY B 1 34  ? 41.142  67.527  23.438  1.00 19.97  ? 60  GLY B O   1 
ATOM   5969  N N   . ASP B 1 35  ? 42.392  65.682  23.052  1.00 16.68  ? 61  ASP B N   1 
ATOM   5970  C CA  . ASP B 1 35  ? 41.410  64.977  22.221  1.00 17.59  ? 61  ASP B CA  1 
ATOM   5971  C C   . ASP B 1 35  ? 40.509  64.153  23.147  1.00 17.09  ? 61  ASP B C   1 
ATOM   5972  O O   . ASP B 1 35  ? 41.001  63.397  23.983  1.00 15.49  ? 61  ASP B O   1 
ATOM   5973  C CB  . ASP B 1 35  ? 42.118  64.026  21.251  1.00 21.22  ? 61  ASP B CB  1 
ATOM   5974  C CG  . ASP B 1 35  ? 42.461  64.680  19.934  1.00 22.65  ? 61  ASP B CG  1 
ATOM   5975  O OD1 . ASP B 1 35  ? 42.688  65.904  19.926  1.00 27.75  ? 61  ASP B OD1 1 
ATOM   5976  O OD2 . ASP B 1 35  ? 42.519  63.972  18.909  1.00 22.56  ? 61  ASP B OD2 1 
ATOM   5977  N N   . PHE B 1 36  ? 39.197  64.299  22.999  1.00 16.95  ? 62  PHE B N   1 
ATOM   5978  C CA  . PHE B 1 36  ? 38.251  63.568  23.840  1.00 17.77  ? 62  PHE B CA  1 
ATOM   5979  C C   . PHE B 1 36  ? 37.052  63.134  23.025  1.00 16.91  ? 62  PHE B C   1 
ATOM   5980  O O   . PHE B 1 36  ? 36.474  63.953  22.303  1.00 16.47  ? 62  PHE B O   1 
ATOM   5981  C CB  . PHE B 1 36  ? 37.749  64.452  24.994  1.00 17.66  ? 62  PHE B CB  1 
ATOM   5982  C CG  . PHE B 1 36  ? 38.778  64.732  26.048  1.00 21.05  ? 62  PHE B CG  1 
ATOM   5983  C CD1 . PHE B 1 36  ? 39.103  63.761  27.003  1.00 21.61  ? 62  PHE B CD1 1 
ATOM   5984  C CD2 . PHE B 1 36  ? 39.424  65.970  26.095  1.00 20.68  ? 62  PHE B CD2 1 
ATOM   5985  C CE1 . PHE B 1 36  ? 40.059  64.018  28.007  1.00 20.40  ? 62  PHE B CE1 1 
ATOM   5986  C CE2 . PHE B 1 36  ? 40.382  66.247  27.090  1.00 22.02  ? 62  PHE B CE2 1 
ATOM   5987  C CZ  . PHE B 1 36  ? 40.701  65.262  28.051  1.00 22.10  ? 62  PHE B CZ  1 
ATOM   5988  N N   . PHE B 1 37  ? 36.682  61.856  23.143  1.00 15.14  ? 63  PHE B N   1 
ATOM   5989  C CA  . PHE B 1 37  ? 35.517  61.324  22.443  1.00 16.46  ? 63  PHE B CA  1 
ATOM   5990  C C   . PHE B 1 37  ? 34.262  61.662  23.248  1.00 17.88  ? 63  PHE B C   1 
ATOM   5991  O O   . PHE B 1 37  ? 34.243  61.549  24.465  1.00 20.22  ? 63  PHE B O   1 
ATOM   5992  C CB  . PHE B 1 37  ? 35.603  59.804  22.280  1.00 16.45  ? 63  PHE B CB  1 
ATOM   5993  C CG  . PHE B 1 37  ? 36.536  59.353  21.192  1.00 17.11  ? 63  PHE B CG  1 
ATOM   5994  C CD1 . PHE B 1 37  ? 37.828  58.914  21.495  1.00 19.46  ? 63  PHE B CD1 1 
ATOM   5995  C CD2 . PHE B 1 37  ? 36.120  59.347  19.860  1.00 17.09  ? 63  PHE B CD2 1 
ATOM   5996  C CE1 . PHE B 1 37  ? 38.695  58.472  20.494  1.00 14.61  ? 63  PHE B CE1 1 
ATOM   5997  C CE2 . PHE B 1 37  ? 36.975  58.908  18.838  1.00 14.51  ? 63  PHE B CE2 1 
ATOM   5998  C CZ  . PHE B 1 37  ? 38.263  58.469  19.156  1.00 17.70  ? 63  PHE B CZ  1 
ATOM   5999  N N   . THR B 1 38  ? 33.210  62.062  22.553  1.00 18.57  ? 64  THR B N   1 
ATOM   6000  C CA  . THR B 1 38  ? 31.949  62.422  23.184  1.00 18.71  ? 64  THR B CA  1 
ATOM   6001  C C   . THR B 1 38  ? 31.182  61.283  23.898  1.00 16.81  ? 64  THR B C   1 
ATOM   6002  O O   . THR B 1 38  ? 30.419  61.534  24.829  1.00 13.90  ? 64  THR B O   1 
ATOM   6003  C CB  . THR B 1 38  ? 31.048  63.092  22.128  1.00 19.39  ? 64  THR B CB  1 
ATOM   6004  O OG1 . THR B 1 38  ? 31.525  64.423  21.898  1.00 26.55  ? 64  THR B OG1 1 
ATOM   6005  C CG2 . THR B 1 38  ? 29.607  63.144  22.576  1.00 24.49  ? 64  THR B CG2 1 
ATOM   6006  N N   . GLY B 1 39  ? 31.374  60.040  23.475  1.00 17.43  ? 65  GLY B N   1 
ATOM   6007  C CA  . GLY B 1 39  ? 30.666  58.949  24.120  1.00 19.35  ? 65  GLY B CA  1 
ATOM   6008  C C   . GLY B 1 39  ? 31.459  58.259  25.226  1.00 22.53  ? 65  GLY B C   1 
ATOM   6009  O O   . GLY B 1 39  ? 31.018  57.245  25.782  1.00 22.95  ? 65  GLY B O   1 
ATOM   6010  N N   . ASP B 1 40  ? 32.619  58.809  25.570  1.00 21.08  ? 66  ASP B N   1 
ATOM   6011  C CA  . ASP B 1 40  ? 33.451  58.192  26.584  1.00 20.82  ? 66  ASP B CA  1 
ATOM   6012  C C   . ASP B 1 40  ? 33.589  58.984  27.882  1.00 22.89  ? 66  ASP B C   1 
ATOM   6013  O O   . ASP B 1 40  ? 33.053  60.090  28.022  1.00 22.09  ? 66  ASP B O   1 
ATOM   6014  C CB  . ASP B 1 40  ? 34.841  57.931  25.994  1.00 21.80  ? 66  ASP B CB  1 
ATOM   6015  C CG  . ASP B 1 40  ? 34.820  56.912  24.855  1.00 20.64  ? 66  ASP B CG  1 
ATOM   6016  O OD1 . ASP B 1 40  ? 35.759  56.919  24.031  1.00 23.05  ? 66  ASP B OD1 1 
ATOM   6017  O OD2 . ASP B 1 40  ? 33.876  56.097  24.790  1.00 18.67  ? 66  ASP B OD2 1 
ATOM   6018  N N   . ALA B 1 41  ? 34.305  58.382  28.832  1.00 21.29  ? 67  ALA B N   1 
ATOM   6019  C CA  . ALA B 1 41  ? 34.606  58.993  30.124  1.00 19.07  ? 67  ALA B CA  1 
ATOM   6020  C C   . ALA B 1 41  ? 36.133  58.888  30.283  1.00 19.42  ? 67  ALA B C   1 
ATOM   6021  O O   . ALA B 1 41  ? 36.754  57.955  29.756  1.00 17.75  ? 67  ALA B O   1 
ATOM   6022  C CB  . ALA B 1 41  ? 33.901  58.243  31.243  1.00 21.52  ? 67  ALA B CB  1 
ATOM   6023  N N   . TYR B 1 42  ? 36.744  59.841  30.984  1.00 18.08  ? 68  TYR B N   1 
ATOM   6024  C CA  . TYR B 1 42  ? 38.195  59.818  31.154  1.00 17.79  ? 68  TYR B CA  1 
ATOM   6025  C C   . TYR B 1 42  ? 38.630  60.195  32.552  1.00 16.78  ? 68  TYR B C   1 
ATOM   6026  O O   . TYR B 1 42  ? 37.911  60.850  33.294  1.00 19.09  ? 68  TYR B O   1 
ATOM   6027  C CB  . TYR B 1 42  ? 38.907  60.784  30.179  1.00 16.43  ? 68  TYR B CB  1 
ATOM   6028  C CG  . TYR B 1 42  ? 38.775  60.496  28.688  1.00 19.95  ? 68  TYR B CG  1 
ATOM   6029  C CD1 . TYR B 1 42  ? 37.532  60.579  28.032  1.00 19.42  ? 68  TYR B CD1 1 
ATOM   6030  C CD2 . TYR B 1 42  ? 39.907  60.224  27.912  1.00 17.48  ? 68  TYR B CD2 1 
ATOM   6031  C CE1 . TYR B 1 42  ? 37.430  60.403  26.636  1.00 17.62  ? 68  TYR B CE1 1 
ATOM   6032  C CE2 . TYR B 1 42  ? 39.814  60.051  26.516  1.00 15.54  ? 68  TYR B CE2 1 
ATOM   6033  C CZ  . TYR B 1 42  ? 38.580  60.142  25.891  1.00 16.46  ? 68  TYR B CZ  1 
ATOM   6034  O OH  . TYR B 1 42  ? 38.503  59.981  24.530  1.00 14.43  ? 68  TYR B OH  1 
ATOM   6035  N N   . VAL B 1 43  ? 39.839  59.786  32.892  1.00 14.48  ? 69  VAL B N   1 
ATOM   6036  C CA  . VAL B 1 43  ? 40.405  60.097  34.176  1.00 12.62  ? 69  VAL B CA  1 
ATOM   6037  C C   . VAL B 1 43  ? 41.703  60.859  33.904  1.00 14.89  ? 69  VAL B C   1 
ATOM   6038  O O   . VAL B 1 43  ? 42.560  60.408  33.139  1.00 10.71  ? 69  VAL B O   1 
ATOM   6039  C CB  . VAL B 1 43  ? 40.669  58.807  34.976  1.00 14.59  ? 69  VAL B CB  1 
ATOM   6040  C CG1 . VAL B 1 43  ? 41.354  59.142  36.289  1.00 15.86  ? 69  VAL B CG1 1 
ATOM   6041  C CG2 . VAL B 1 43  ? 39.341  58.085  35.247  1.00 11.82  ? 69  VAL B CG2 1 
ATOM   6042  N N   . ILE B 1 44  ? 41.827  62.031  34.521  1.00 15.54  ? 70  ILE B N   1 
ATOM   6043  C CA  . ILE B 1 44  ? 42.996  62.881  34.347  1.00 15.73  ? 70  ILE B CA  1 
ATOM   6044  C C   . ILE B 1 44  ? 43.695  63.163  35.671  1.00 17.51  ? 70  ILE B C   1 
ATOM   6045  O O   . ILE B 1 44  ? 43.053  63.509  36.660  1.00 18.01  ? 70  ILE B O   1 
ATOM   6046  C CB  . ILE B 1 44  ? 42.598  64.235  33.712  1.00 18.19  ? 70  ILE B CB  1 
ATOM   6047  C CG1 . ILE B 1 44  ? 42.030  64.003  32.307  1.00 15.68  ? 70  ILE B CG1 1 
ATOM   6048  C CG2 . ILE B 1 44  ? 43.798  65.191  33.696  1.00 17.68  ? 70  ILE B CG2 1 
ATOM   6049  C CD1 . ILE B 1 44  ? 40.598  63.515  32.302  1.00 10.81  ? 70  ILE B CD1 1 
ATOM   6050  N N   . LEU B 1 45  ? 45.013  63.009  35.690  1.00 17.49  ? 71  LEU B N   1 
ATOM   6051  C CA  . LEU B 1 45  ? 45.766  63.265  36.902  1.00 17.82  ? 71  LEU B CA  1 
ATOM   6052  C C   . LEU B 1 45  ? 46.873  64.257  36.611  1.00 19.87  ? 71  LEU B C   1 
ATOM   6053  O O   . LEU B 1 45  ? 47.749  64.016  35.777  1.00 20.87  ? 71  LEU B O   1 
ATOM   6054  C CB  . LEU B 1 45  ? 46.357  61.970  37.465  1.00 18.47  ? 71  LEU B CB  1 
ATOM   6055  C CG  . LEU B 1 45  ? 47.288  62.084  38.691  1.00 21.47  ? 71  LEU B CG  1 
ATOM   6056  C CD1 . LEU B 1 45  ? 46.590  62.757  39.864  1.00 19.18  ? 71  LEU B CD1 1 
ATOM   6057  C CD2 . LEU B 1 45  ? 47.752  60.691  39.093  1.00 21.99  ? 71  LEU B CD2 1 
ATOM   6058  N N   . LYS B 1 46  ? 46.809  65.383  37.306  1.00 20.67  ? 72  LYS B N   1 
ATOM   6059  C CA  . LYS B 1 46  ? 47.788  66.447  37.183  1.00 22.28  ? 72  LYS B CA  1 
ATOM   6060  C C   . LYS B 1 46  ? 48.650  66.384  38.434  1.00 24.98  ? 72  LYS B C   1 
ATOM   6061  O O   . LYS B 1 46  ? 48.139  66.452  39.556  1.00 27.56  ? 72  LYS B O   1 
ATOM   6062  C CB  . LYS B 1 46  ? 47.065  67.794  37.102  1.00 23.60  ? 72  LYS B CB  1 
ATOM   6063  C CG  . LYS B 1 46  ? 47.953  69.020  37.098  1.00 25.52  ? 72  LYS B CG  1 
ATOM   6064  C CD  . LYS B 1 46  ? 48.918  69.043  35.926  1.00 25.31  ? 72  LYS B CD  1 
ATOM   6065  C CE  . LYS B 1 46  ? 49.639  70.387  35.891  1.00 29.89  ? 72  LYS B CE  1 
ATOM   6066  N NZ  . LYS B 1 46  ? 50.765  70.439  34.916  1.00 31.20  ? 72  LYS B NZ  1 
ATOM   6067  N N   . THR B 1 47  ? 49.957  66.245  38.248  1.00 25.83  ? 73  THR B N   1 
ATOM   6068  C CA  . THR B 1 47  ? 50.865  66.168  39.384  1.00 27.62  ? 73  THR B CA  1 
ATOM   6069  C C   . THR B 1 47  ? 51.760  67.395  39.416  1.00 29.05  ? 73  THR B C   1 
ATOM   6070  O O   . THR B 1 47  ? 52.527  67.644  38.488  1.00 29.89  ? 73  THR B O   1 
ATOM   6071  C CB  . THR B 1 47  ? 51.727  64.890  39.311  1.00 27.56  ? 73  THR B CB  1 
ATOM   6072  O OG1 . THR B 1 47  ? 50.863  63.750  39.268  1.00 27.74  ? 73  THR B OG1 1 
ATOM   6073  C CG2 . THR B 1 47  ? 52.650  64.781  40.524  1.00 22.67  ? 73  THR B CG2 1 
ATOM   6074  N N   . VAL B 1 48  ? 51.649  68.165  40.490  1.00 31.45  ? 74  VAL B N   1 
ATOM   6075  C CA  . VAL B 1 48  ? 52.446  69.374  40.639  1.00 33.88  ? 74  VAL B CA  1 
ATOM   6076  C C   . VAL B 1 48  ? 53.388  69.228  41.808  1.00 35.72  ? 74  VAL B C   1 
ATOM   6077  O O   . VAL B 1 48  ? 52.995  68.741  42.865  1.00 37.05  ? 74  VAL B O   1 
ATOM   6078  C CB  . VAL B 1 48  ? 51.555  70.617  40.881  1.00 32.76  ? 74  VAL B CB  1 
ATOM   6079  C CG1 . VAL B 1 48  ? 52.420  71.806  41.300  1.00 30.89  ? 74  VAL B CG1 1 
ATOM   6080  C CG2 . VAL B 1 48  ? 50.774  70.958  39.609  1.00 28.07  ? 74  VAL B CG2 1 
ATOM   6081  N N   . GLN B 1 49  ? 54.633  69.645  41.616  1.00 38.10  ? 75  GLN B N   1 
ATOM   6082  C CA  . GLN B 1 49  ? 55.617  69.565  42.682  1.00 42.21  ? 75  GLN B CA  1 
ATOM   6083  C C   . GLN B 1 49  ? 55.521  70.799  43.571  1.00 41.68  ? 75  GLN B C   1 
ATOM   6084  O O   . GLN B 1 49  ? 55.685  71.922  43.104  1.00 39.48  ? 75  GLN B O   1 
ATOM   6085  C CB  . GLN B 1 49  ? 57.026  69.449  42.098  1.00 46.25  ? 75  GLN B CB  1 
ATOM   6086  C CG  . GLN B 1 49  ? 58.099  69.166  43.144  1.00 53.68  ? 75  GLN B CG  1 
ATOM   6087  C CD  . GLN B 1 49  ? 59.363  68.585  42.535  1.00 58.99  ? 75  GLN B CD  1 
ATOM   6088  O OE1 . GLN B 1 49  ? 60.013  69.213  41.695  1.00 61.34  ? 75  GLN B OE1 1 
ATOM   6089  N NE2 . GLN B 1 49  ? 59.715  67.372  42.954  1.00 61.50  ? 75  GLN B NE2 1 
ATOM   6090  N N   . LEU B 1 50  ? 55.234  70.588  44.850  1.00 43.57  ? 76  LEU B N   1 
ATOM   6091  C CA  . LEU B 1 50  ? 55.131  71.700  45.783  1.00 47.63  ? 76  LEU B CA  1 
ATOM   6092  C C   . LEU B 1 50  ? 56.501  72.322  46.019  1.00 50.66  ? 76  LEU B C   1 
ATOM   6093  O O   . LEU B 1 50  ? 57.520  71.809  45.553  1.00 50.04  ? 76  LEU B O   1 
ATOM   6094  C CB  . LEU B 1 50  ? 54.543  71.239  47.117  1.00 46.65  ? 76  LEU B CB  1 
ATOM   6095  C CG  . LEU B 1 50  ? 53.077  70.806  47.137  1.00 46.06  ? 76  LEU B CG  1 
ATOM   6096  C CD1 . LEU B 1 50  ? 52.651  70.559  48.571  1.00 44.59  ? 76  LEU B CD1 1 
ATOM   6097  C CD2 . LEU B 1 50  ? 52.209  71.889  46.512  1.00 46.12  ? 76  LEU B CD2 1 
ATOM   6098  N N   . ARG B 1 51  ? 56.517  73.431  46.751  1.00 55.07  ? 77  ARG B N   1 
ATOM   6099  C CA  . ARG B 1 51  ? 57.756  74.134  47.049  1.00 59.88  ? 77  ARG B CA  1 
ATOM   6100  C C   . ARG B 1 51  ? 58.689  73.334  47.963  1.00 59.98  ? 77  ARG B C   1 
ATOM   6101  O O   . ARG B 1 51  ? 59.909  73.474  47.881  1.00 60.39  ? 77  ARG B O   1 
ATOM   6102  C CB  . ARG B 1 51  ? 57.436  75.496  47.675  1.00 63.81  ? 77  ARG B CB  1 
ATOM   6103  C CG  . ARG B 1 51  ? 56.559  76.387  46.791  1.00 70.64  ? 77  ARG B CG  1 
ATOM   6104  C CD  . ARG B 1 51  ? 56.394  77.790  47.371  1.00 74.82  ? 77  ARG B CD  1 
ATOM   6105  N NE  . ARG B 1 51  ? 57.658  78.524  47.388  1.00 78.09  ? 77  ARG B NE  1 
ATOM   6106  C CZ  . ARG B 1 51  ? 57.828  79.722  47.941  1.00 78.08  ? 77  ARG B CZ  1 
ATOM   6107  N NH1 . ARG B 1 51  ? 56.811  80.341  48.531  1.00 77.16  ? 77  ARG B NH1 1 
ATOM   6108  N NH2 . ARG B 1 51  ? 59.022  80.299  47.907  1.00 77.53  ? 77  ARG B NH2 1 
ATOM   6109  N N   . ASN B 1 52  ? 58.119  72.485  48.815  1.00 59.77  ? 78  ASN B N   1 
ATOM   6110  C CA  . ASN B 1 52  ? 58.917  71.682  49.739  1.00 59.81  ? 78  ASN B CA  1 
ATOM   6111  C C   . ASN B 1 52  ? 59.349  70.320  49.192  1.00 59.87  ? 78  ASN B C   1 
ATOM   6112  O O   . ASN B 1 52  ? 59.798  69.457  49.953  1.00 60.40  ? 78  ASN B O   1 
ATOM   6113  C CB  . ASN B 1 52  ? 58.156  71.474  51.053  1.00 61.34  ? 78  ASN B CB  1 
ATOM   6114  C CG  . ASN B 1 52  ? 56.846  70.739  50.860  1.00 63.36  ? 78  ASN B CG  1 
ATOM   6115  O OD1 . ASN B 1 52  ? 56.616  70.117  49.823  1.00 65.47  ? 78  ASN B OD1 1 
ATOM   6116  N ND2 . ASN B 1 52  ? 55.983  70.795  51.869  1.00 63.53  ? 78  ASN B ND2 1 
ATOM   6117  N N   . GLY B 1 53  ? 59.212  70.128  47.882  1.00 60.28  ? 79  GLY B N   1 
ATOM   6118  C CA  . GLY B 1 53  ? 59.594  68.863  47.267  1.00 58.16  ? 79  GLY B CA  1 
ATOM   6119  C C   . GLY B 1 53  ? 58.489  67.816  47.216  1.00 55.77  ? 79  GLY B C   1 
ATOM   6120  O O   . GLY B 1 53  ? 58.604  66.818  46.502  1.00 55.34  ? 79  GLY B O   1 
ATOM   6121  N N   . ILE B 1 54  ? 57.421  68.042  47.976  1.00 53.65  ? 80  ILE B N   1 
ATOM   6122  C CA  . ILE B 1 54  ? 56.280  67.127  48.029  1.00 51.39  ? 80  ILE B CA  1 
ATOM   6123  C C   . ILE B 1 54  ? 55.456  67.190  46.732  1.00 46.04  ? 80  ILE B C   1 
ATOM   6124  O O   . ILE B 1 54  ? 55.566  68.144  45.964  1.00 47.20  ? 80  ILE B O   1 
ATOM   6125  C CB  . ILE B 1 54  ? 55.355  67.475  49.232  1.00 53.20  ? 80  ILE B CB  1 
ATOM   6126  C CG1 . ILE B 1 54  ? 56.145  67.404  50.542  1.00 54.85  ? 80  ILE B CG1 1 
ATOM   6127  C CG2 . ILE B 1 54  ? 54.177  66.501  49.298  1.00 56.75  ? 80  ILE B CG2 1 
ATOM   6128  C CD1 . ILE B 1 54  ? 56.639  66.017  50.892  1.00 56.61  ? 80  ILE B CD1 1 
ATOM   6129  N N   . LEU B 1 55  ? 54.642  66.170  46.487  1.00 39.72  ? 81  LEU B N   1 
ATOM   6130  C CA  . LEU B 1 55  ? 53.809  66.140  45.292  1.00 33.81  ? 81  LEU B CA  1 
ATOM   6131  C C   . LEU B 1 55  ? 52.360  66.457  45.637  1.00 31.92  ? 81  LEU B C   1 
ATOM   6132  O O   . LEU B 1 55  ? 51.865  66.075  46.693  1.00 32.93  ? 81  LEU B O   1 
ATOM   6133  C CB  . LEU B 1 55  ? 53.905  64.774  44.619  1.00 30.01  ? 81  LEU B CB  1 
ATOM   6134  C CG  . LEU B 1 55  ? 55.310  64.428  44.113  1.00 28.11  ? 81  LEU B CG  1 
ATOM   6135  C CD1 . LEU B 1 55  ? 55.282  63.084  43.384  1.00 26.04  ? 81  LEU B CD1 1 
ATOM   6136  C CD2 . LEU B 1 55  ? 55.814  65.539  43.181  1.00 21.41  ? 81  LEU B CD2 1 
ATOM   6137  N N   . GLN B 1 56  ? 51.690  67.177  44.746  1.00 30.11  ? 82  GLN B N   1 
ATOM   6138  C CA  . GLN B 1 56  ? 50.291  67.570  44.938  1.00 27.79  ? 82  GLN B CA  1 
ATOM   6139  C C   . GLN B 1 56  ? 49.456  66.953  43.803  1.00 23.07  ? 82  GLN B C   1 
ATOM   6140  O O   . GLN B 1 56  ? 49.905  66.920  42.660  1.00 19.90  ? 82  GLN B O   1 
ATOM   6141  C CB  . GLN B 1 56  ? 50.200  69.101  44.922  1.00 29.47  ? 82  GLN B CB  1 
ATOM   6142  C CG  . GLN B 1 56  ? 48.801  69.678  44.823  1.00 32.20  ? 82  GLN B CG  1 
ATOM   6143  C CD  . GLN B 1 56  ? 48.822  71.157  44.479  1.00 34.49  ? 82  GLN B CD  1 
ATOM   6144  O OE1 . GLN B 1 56  ? 49.202  71.989  45.298  1.00 36.39  ? 82  GLN B OE1 1 
ATOM   6145  N NE2 . GLN B 1 56  ? 48.423  71.488  43.256  1.00 36.38  ? 82  GLN B NE2 1 
ATOM   6146  N N   . TYR B 1 57  ? 48.256  66.468  44.110  1.00 20.26  ? 83  TYR B N   1 
ATOM   6147  C CA  . TYR B 1 57  ? 47.423  65.836  43.084  1.00 22.99  ? 83  TYR B CA  1 
ATOM   6148  C C   . TYR B 1 57  ? 46.070  66.459  42.795  1.00 22.24  ? 83  TYR B C   1 
ATOM   6149  O O   . TYR B 1 57  ? 45.280  66.752  43.699  1.00 23.72  ? 83  TYR B O   1 
ATOM   6150  C CB  . TYR B 1 57  ? 47.173  64.355  43.413  1.00 23.72  ? 83  TYR B CB  1 
ATOM   6151  C CG  . TYR B 1 57  ? 48.427  63.540  43.557  1.00 27.58  ? 83  TYR B CG  1 
ATOM   6152  C CD1 . TYR B 1 57  ? 48.708  62.865  44.746  1.00 27.24  ? 83  TYR B CD1 1 
ATOM   6153  C CD2 . TYR B 1 57  ? 49.368  63.486  42.525  1.00 27.82  ? 83  TYR B CD2 1 
ATOM   6154  C CE1 . TYR B 1 57  ? 49.900  62.165  44.906  1.00 27.86  ? 83  TYR B CE1 1 
ATOM   6155  C CE2 . TYR B 1 57  ? 50.560  62.790  42.677  1.00 28.72  ? 83  TYR B CE2 1 
ATOM   6156  C CZ  . TYR B 1 57  ? 50.819  62.136  43.868  1.00 29.23  ? 83  TYR B CZ  1 
ATOM   6157  O OH  . TYR B 1 57  ? 52.013  61.475  44.025  1.00 34.87  ? 83  TYR B OH  1 
ATOM   6158  N N   . ASP B 1 58  ? 45.808  66.641  41.512  1.00 20.68  ? 84  ASP B N   1 
ATOM   6159  C CA  . ASP B 1 58  ? 44.530  67.148  41.060  1.00 17.70  ? 84  ASP B CA  1 
ATOM   6160  C C   . ASP B 1 58  ? 44.021  66.016  40.185  1.00 17.19  ? 84  ASP B C   1 
ATOM   6161  O O   . ASP B 1 58  ? 44.619  65.684  39.160  1.00 12.52  ? 84  ASP B O   1 
ATOM   6162  C CB  . ASP B 1 58  ? 44.703  68.433  40.255  1.00 21.25  ? 84  ASP B CB  1 
ATOM   6163  C CG  . ASP B 1 58  ? 44.756  69.658  41.137  1.00 20.22  ? 84  ASP B CG  1 
ATOM   6164  O OD1 . ASP B 1 58  ? 43.690  70.074  41.633  1.00 21.77  ? 84  ASP B OD1 1 
ATOM   6165  O OD2 . ASP B 1 58  ? 45.866  70.188  41.347  1.00 24.51  ? 84  ASP B OD2 1 
ATOM   6166  N N   . LEU B 1 59  ? 42.933  65.401  40.632  1.00 18.42  ? 85  LEU B N   1 
ATOM   6167  C CA  . LEU B 1 59  ? 42.329  64.288  39.936  1.00 21.91  ? 85  LEU B CA  1 
ATOM   6168  C C   . LEU B 1 59  ? 40.996  64.709  39.352  1.00 22.89  ? 85  LEU B C   1 
ATOM   6169  O O   . LEU B 1 59  ? 40.121  65.160  40.081  1.00 25.95  ? 85  LEU B O   1 
ATOM   6170  C CB  . LEU B 1 59  ? 42.107  63.147  40.923  1.00 26.33  ? 85  LEU B CB  1 
ATOM   6171  C CG  . LEU B 1 59  ? 42.598  61.740  40.573  1.00 29.85  ? 85  LEU B CG  1 
ATOM   6172  C CD1 . LEU B 1 59  ? 42.417  60.843  41.790  1.00 30.32  ? 85  LEU B CD1 1 
ATOM   6173  C CD2 . LEU B 1 59  ? 41.830  61.188  39.382  1.00 31.37  ? 85  LEU B CD2 1 
ATOM   6174  N N   . HIS B 1 60  ? 40.840  64.588  38.040  1.00 21.76  ? 86  HIS B N   1 
ATOM   6175  C CA  . HIS B 1 60  ? 39.563  64.931  37.420  1.00 22.57  ? 86  HIS B CA  1 
ATOM   6176  C C   . HIS B 1 60  ? 39.094  63.737  36.583  1.00 22.81  ? 86  HIS B C   1 
ATOM   6177  O O   . HIS B 1 60  ? 39.911  62.940  36.108  1.00 23.21  ? 86  HIS B O   1 
ATOM   6178  C CB  . HIS B 1 60  ? 39.651  66.121  36.432  1.00 20.75  ? 86  HIS B CB  1 
ATOM   6179  C CG  . HIS B 1 60  ? 40.488  67.283  36.885  1.00 21.76  ? 86  HIS B CG  1 
ATOM   6180  N ND1 . HIS B 1 60  ? 40.055  68.590  36.774  1.00 14.27  ? 86  HIS B ND1 1 
ATOM   6181  C CD2 . HIS B 1 60  ? 41.773  67.350  37.312  1.00 20.05  ? 86  HIS B CD2 1 
ATOM   6182  C CE1 . HIS B 1 60  ? 41.038  69.406  37.104  1.00 17.14  ? 86  HIS B CE1 1 
ATOM   6183  N NE2 . HIS B 1 60  ? 42.091  68.680  37.434  1.00 16.25  ? 86  HIS B NE2 1 
ATOM   6184  N N   . TYR B 1 61  ? 37.778  63.602  36.436  1.00 21.67  ? 87  TYR B N   1 
ATOM   6185  C CA  . TYR B 1 61  ? 37.218  62.593  35.551  1.00 21.77  ? 87  TYR B CA  1 
ATOM   6186  C C   . TYR B 1 61  ? 36.269  63.445  34.707  1.00 20.66  ? 87  TYR B C   1 
ATOM   6187  O O   . TYR B 1 61  ? 35.543  64.291  35.236  1.00 19.32  ? 87  TYR B O   1 
ATOM   6188  C CB  . TYR B 1 61  ? 36.513  61.442  36.302  1.00 19.16  ? 87  TYR B CB  1 
ATOM   6189  C CG  . TYR B 1 61  ? 35.280  61.774  37.106  1.00 20.82  ? 87  TYR B CG  1 
ATOM   6190  C CD1 . TYR B 1 61  ? 34.016  61.425  36.650  1.00 20.38  ? 87  TYR B CD1 1 
ATOM   6191  C CD2 . TYR B 1 61  ? 35.386  62.346  38.372  1.00 23.20  ? 87  TYR B CD2 1 
ATOM   6192  C CE1 . TYR B 1 61  ? 32.887  61.625  37.438  1.00 22.29  ? 87  TYR B CE1 1 
ATOM   6193  C CE2 . TYR B 1 61  ? 34.269  62.552  39.168  1.00 23.81  ? 87  TYR B CE2 1 
ATOM   6194  C CZ  . TYR B 1 61  ? 33.022  62.186  38.700  1.00 25.05  ? 87  TYR B CZ  1 
ATOM   6195  O OH  . TYR B 1 61  ? 31.918  62.354  39.509  1.00 23.87  ? 87  TYR B OH  1 
ATOM   6196  N N   . TRP B 1 62  ? 36.335  63.254  33.392  1.00 18.24  ? 88  TRP B N   1 
ATOM   6197  C CA  . TRP B 1 62  ? 35.554  64.016  32.417  1.00 18.34  ? 88  TRP B CA  1 
ATOM   6198  C C   . TRP B 1 62  ? 34.483  63.146  31.756  1.00 18.09  ? 88  TRP B C   1 
ATOM   6199  O O   . TRP B 1 62  ? 34.777  62.049  31.293  1.00 18.13  ? 88  TRP B O   1 
ATOM   6200  C CB  . TRP B 1 62  ? 36.529  64.556  31.367  1.00 16.53  ? 88  TRP B CB  1 
ATOM   6201  C CG  . TRP B 1 62  ? 35.941  65.364  30.249  1.00 21.09  ? 88  TRP B CG  1 
ATOM   6202  C CD1 . TRP B 1 62  ? 35.895  66.732  30.157  1.00 19.88  ? 88  TRP B CD1 1 
ATOM   6203  C CD2 . TRP B 1 62  ? 35.444  64.865  29.003  1.00 18.26  ? 88  TRP B CD2 1 
ATOM   6204  N NE1 . TRP B 1 62  ? 35.414  67.106  28.929  1.00 17.14  ? 88  TRP B NE1 1 
ATOM   6205  C CE2 . TRP B 1 62  ? 35.129  65.985  28.200  1.00 17.71  ? 88  TRP B CE2 1 
ATOM   6206  C CE3 . TRP B 1 62  ? 35.239  63.579  28.485  1.00 16.18  ? 88  TRP B CE3 1 
ATOM   6207  C CZ2 . TRP B 1 62  ? 34.623  65.857  26.902  1.00 19.16  ? 88  TRP B CZ2 1 
ATOM   6208  C CZ3 . TRP B 1 62  ? 34.743  63.449  27.200  1.00 16.78  ? 88  TRP B CZ3 1 
ATOM   6209  C CH2 . TRP B 1 62  ? 34.440  64.585  26.419  1.00 20.68  ? 88  TRP B CH2 1 
ATOM   6210  N N   . LEU B 1 63  ? 33.250  63.644  31.702  1.00 16.61  ? 89  LEU B N   1 
ATOM   6211  C CA  . LEU B 1 63  ? 32.136  62.898  31.103  1.00 19.69  ? 89  LEU B CA  1 
ATOM   6212  C C   . LEU B 1 63  ? 31.659  63.506  29.783  1.00 20.73  ? 89  LEU B C   1 
ATOM   6213  O O   . LEU B 1 63  ? 31.271  64.669  29.746  1.00 23.55  ? 89  LEU B O   1 
ATOM   6214  C CB  . LEU B 1 63  ? 30.945  62.855  32.075  1.00 17.41  ? 89  LEU B CB  1 
ATOM   6215  C CG  . LEU B 1 63  ? 31.225  62.341  33.495  1.00 20.99  ? 89  LEU B CG  1 
ATOM   6216  C CD1 . LEU B 1 63  ? 30.031  62.588  34.378  1.00 17.14  ? 89  LEU B CD1 1 
ATOM   6217  C CD2 . LEU B 1 63  ? 31.562  60.861  33.463  1.00 21.42  ? 89  LEU B CD2 1 
ATOM   6218  N N   . GLY B 1 64  ? 31.680  62.722  28.708  1.00 20.78  ? 90  GLY B N   1 
ATOM   6219  C CA  . GLY B 1 64  ? 31.216  63.212  27.423  1.00 24.25  ? 90  GLY B CA  1 
ATOM   6220  C C   . GLY B 1 64  ? 29.696  63.277  27.412  1.00 27.20  ? 90  GLY B C   1 
ATOM   6221  O O   . GLY B 1 64  ? 29.045  62.604  28.199  1.00 28.95  ? 90  GLY B O   1 
ATOM   6222  N N   . ASN B 1 65  ? 29.115  64.067  26.517  1.00 29.84  ? 91  ASN B N   1 
ATOM   6223  C CA  . ASN B 1 65  ? 27.661  64.201  26.474  1.00 32.03  ? 91  ASN B CA  1 
ATOM   6224  C C   . ASN B 1 65  ? 26.872  62.971  26.037  1.00 32.30  ? 91  ASN B C   1 
ATOM   6225  O O   . ASN B 1 65  ? 25.707  62.825  26.400  1.00 30.47  ? 91  ASN B O   1 
ATOM   6226  C CB  . ASN B 1 65  ? 27.263  65.379  25.585  1.00 34.35  ? 91  ASN B CB  1 
ATOM   6227  C CG  . ASN B 1 65  ? 27.490  66.721  26.250  1.00 40.87  ? 91  ASN B CG  1 
ATOM   6228  O OD1 . ASN B 1 65  ? 27.311  67.764  25.624  1.00 47.05  ? 91  ASN B OD1 1 
ATOM   6229  N ND2 . ASN B 1 65  ? 27.875  66.707  27.526  1.00 43.83  ? 91  ASN B ND2 1 
ATOM   6230  N N   . GLU B 1 66  ? 27.482  62.091  25.253  1.00 32.73  ? 92  GLU B N   1 
ATOM   6231  C CA  . GLU B 1 66  ? 26.768  60.907  24.793  1.00 34.17  ? 92  GLU B CA  1 
ATOM   6232  C C   . GLU B 1 66  ? 27.304  59.726  25.569  1.00 35.25  ? 92  GLU B C   1 
ATOM   6233  O O   . GLU B 1 66  ? 27.211  58.581  25.137  1.00 35.20  ? 92  GLU B O   1 
ATOM   6234  C CB  . GLU B 1 66  ? 26.985  60.693  23.286  1.00 34.91  ? 92  GLU B CB  1 
ATOM   6235  C CG  . GLU B 1 66  ? 26.772  61.932  22.421  1.00 34.04  ? 92  GLU B CG  1 
ATOM   6236  C CD  . GLU B 1 66  ? 25.384  62.531  22.548  1.00 38.89  ? 92  GLU B CD  1 
ATOM   6237  O OE1 . GLU B 1 66  ? 25.166  63.643  22.017  1.00 39.24  ? 92  GLU B OE1 1 
ATOM   6238  O OE2 . GLU B 1 66  ? 24.506  61.895  23.168  1.00 41.32  ? 92  GLU B OE2 1 
ATOM   6239  N N   . CYS B 1 67  ? 27.868  60.027  26.730  1.00 39.25  ? 93  CYS B N   1 
ATOM   6240  C CA  . CYS B 1 67  ? 28.454  59.016  27.600  1.00 42.50  ? 93  CYS B CA  1 
ATOM   6241  C C   . CYS B 1 67  ? 27.410  58.273  28.437  1.00 44.61  ? 93  CYS B C   1 
ATOM   6242  O O   . CYS B 1 67  ? 26.480  58.881  28.972  1.00 42.97  ? 93  CYS B O   1 
ATOM   6243  C CB  . CYS B 1 67  ? 29.481  59.682  28.515  1.00 41.36  ? 93  CYS B CB  1 
ATOM   6244  S SG  . CYS B 1 67  ? 30.252  58.580  29.680  1.00 42.97  ? 93  CYS B SG  1 
ATOM   6245  N N   . SER B 1 68  ? 27.581  56.958  28.552  1.00 47.30  ? 94  SER B N   1 
ATOM   6246  C CA  . SER B 1 68  ? 26.661  56.121  29.317  1.00 51.22  ? 94  SER B CA  1 
ATOM   6247  C C   . SER B 1 68  ? 26.855  56.261  30.826  1.00 52.09  ? 94  SER B C   1 
ATOM   6248  O O   . SER B 1 68  ? 27.873  56.781  31.294  1.00 50.30  ? 94  SER B O   1 
ATOM   6249  C CB  . SER B 1 68  ? 26.852  54.656  28.941  1.00 53.38  ? 94  SER B CB  1 
ATOM   6250  O OG  . SER B 1 68  ? 28.087  54.183  29.448  1.00 56.36  ? 94  SER B OG  1 
ATOM   6251  N N   . GLN B 1 69  ? 25.875  55.771  31.579  1.00 54.08  ? 95  GLN B N   1 
ATOM   6252  C CA  . GLN B 1 69  ? 25.914  55.832  33.037  1.00 55.35  ? 95  GLN B CA  1 
ATOM   6253  C C   . GLN B 1 69  ? 26.916  54.838  33.630  1.00 51.76  ? 95  GLN B C   1 
ATOM   6254  O O   . GLN B 1 69  ? 27.493  55.091  34.685  1.00 51.17  ? 95  GLN B O   1 
ATOM   6255  C CB  . GLN B 1 69  ? 24.517  55.576  33.618  1.00 59.92  ? 95  GLN B CB  1 
ATOM   6256  C CG  . GLN B 1 69  ? 23.993  54.158  33.421  1.00 69.76  ? 95  GLN B CG  1 
ATOM   6257  C CD  . GLN B 1 69  ? 23.859  53.769  31.954  1.00 76.05  ? 95  GLN B CD  1 
ATOM   6258  O OE1 . GLN B 1 69  ? 23.135  54.415  31.186  1.00 79.23  ? 95  GLN B OE1 1 
ATOM   6259  N NE2 . GLN B 1 69  ? 24.557  52.705  31.557  1.00 77.90  ? 95  GLN B NE2 1 
ATOM   6260  N N   . ASP B 1 70  ? 27.125  53.710  32.958  1.00 49.17  ? 96  ASP B N   1 
ATOM   6261  C CA  . ASP B 1 70  ? 28.074  52.723  33.453  1.00 47.47  ? 96  ASP B CA  1 
ATOM   6262  C C   . ASP B 1 70  ? 29.500  53.178  33.237  1.00 44.42  ? 96  ASP B C   1 
ATOM   6263  O O   . ASP B 1 70  ? 30.335  53.019  34.119  1.00 41.19  ? 96  ASP B O   1 
ATOM   6264  C CB  . ASP B 1 70  ? 27.868  51.365  32.783  1.00 51.82  ? 96  ASP B CB  1 
ATOM   6265  C CG  . ASP B 1 70  ? 26.741  50.573  33.414  1.00 55.24  ? 96  ASP B CG  1 
ATOM   6266  O OD1 . ASP B 1 70  ? 26.531  50.715  34.641  1.00 55.97  ? 96  ASP B OD1 1 
ATOM   6267  O OD2 . ASP B 1 70  ? 26.079  49.799  32.687  1.00 59.08  ? 96  ASP B OD2 1 
ATOM   6268  N N   . GLU B 1 71  ? 29.773  53.737  32.058  1.00 44.45  ? 97  GLU B N   1 
ATOM   6269  C CA  . GLU B 1 71  ? 31.108  54.240  31.725  1.00 42.54  ? 97  GLU B CA  1 
ATOM   6270  C C   . GLU B 1 71  ? 31.437  55.415  32.640  1.00 38.46  ? 97  GLU B C   1 
ATOM   6271  O O   . GLU B 1 71  ? 32.564  55.554  33.116  1.00 37.85  ? 97  GLU B O   1 
ATOM   6272  C CB  . GLU B 1 71  ? 31.160  54.692  30.261  1.00 47.07  ? 97  GLU B CB  1 
ATOM   6273  C CG  . GLU B 1 71  ? 31.274  53.556  29.245  1.00 54.22  ? 97  GLU B CG  1 
ATOM   6274  C CD  . GLU B 1 71  ? 30.411  53.775  28.003  1.00 57.48  ? 97  GLU B CD  1 
ATOM   6275  O OE1 . GLU B 1 71  ? 30.434  54.886  27.427  1.00 59.10  ? 97  GLU B OE1 1 
ATOM   6276  O OE2 . GLU B 1 71  ? 29.709  52.822  27.603  1.00 59.61  ? 97  GLU B OE2 1 
ATOM   6277  N N   . SER B 1 72  ? 30.441  56.259  32.881  1.00 33.96  ? 98  SER B N   1 
ATOM   6278  C CA  . SER B 1 72  ? 30.623  57.406  33.750  1.00 33.50  ? 98  SER B CA  1 
ATOM   6279  C C   . SER B 1 72  ? 30.745  56.931  35.196  1.00 32.58  ? 98  SER B C   1 
ATOM   6280  O O   . SER B 1 72  ? 31.478  57.525  35.992  1.00 32.44  ? 98  SER B O   1 
ATOM   6281  C CB  . SER B 1 72  ? 29.453  58.395  33.593  1.00 33.31  ? 98  SER B CB  1 
ATOM   6282  O OG  . SER B 1 72  ? 28.193  57.771  33.744  1.00 34.42  ? 98  SER B OG  1 
ATOM   6283  N N   . GLY B 1 73  ? 30.026  55.855  35.526  1.00 30.79  ? 99  GLY B N   1 
ATOM   6284  C CA  . GLY B 1 73  ? 30.079  55.305  36.869  1.00 23.19  ? 99  GLY B CA  1 
ATOM   6285  C C   . GLY B 1 73  ? 31.464  54.740  37.111  1.00 22.40  ? 99  GLY B C   1 
ATOM   6286  O O   . GLY B 1 73  ? 32.058  54.936  38.173  1.00 21.80  ? 99  GLY B O   1 
ATOM   6287  N N   . ALA B 1 74  ? 31.990  54.045  36.107  1.00 20.93  ? 100 ALA B N   1 
ATOM   6288  C CA  . ALA B 1 74  ? 33.312  53.448  36.205  1.00 19.69  ? 100 ALA B CA  1 
ATOM   6289  C C   . ALA B 1 74  ? 34.362  54.511  36.451  1.00 21.68  ? 100 ALA B C   1 
ATOM   6290  O O   . ALA B 1 74  ? 35.263  54.316  37.271  1.00 21.77  ? 100 ALA B O   1 
ATOM   6291  C CB  . ALA B 1 74  ? 33.641  52.703  34.944  1.00 18.79  ? 100 ALA B CB  1 
ATOM   6292  N N   . ALA B 1 75  ? 34.245  55.633  35.742  1.00 19.66  ? 101 ALA B N   1 
ATOM   6293  C CA  . ALA B 1 75  ? 35.196  56.731  35.885  1.00 17.22  ? 101 ALA B CA  1 
ATOM   6294  C C   . ALA B 1 75  ? 35.192  57.290  37.305  1.00 16.92  ? 101 ALA B C   1 
ATOM   6295  O O   . ALA B 1 75  ? 36.253  57.583  37.864  1.00 14.66  ? 101 ALA B O   1 
ATOM   6296  C CB  . ALA B 1 75  ? 34.884  57.845  34.878  1.00 19.55  ? 101 ALA B CB  1 
ATOM   6297  N N   . ALA B 1 76  ? 34.005  57.441  37.884  1.00 16.09  ? 102 ALA B N   1 
ATOM   6298  C CA  . ALA B 1 76  ? 33.890  57.958  39.246  1.00 16.93  ? 102 ALA B CA  1 
ATOM   6299  C C   . ALA B 1 76  ? 34.464  56.939  40.229  1.00 17.97  ? 102 ALA B C   1 
ATOM   6300  O O   . ALA B 1 76  ? 35.093  57.306  41.230  1.00 19.24  ? 102 ALA B O   1 
ATOM   6301  C CB  . ALA B 1 76  ? 32.434  58.260  39.582  1.00 14.82  ? 102 ALA B CB  1 
ATOM   6302  N N   . ILE B 1 77  ? 34.251  55.659  39.946  1.00 17.44  ? 103 ILE B N   1 
ATOM   6303  C CA  . ILE B 1 77  ? 34.780  54.604  40.801  1.00 17.27  ? 103 ILE B CA  1 
ATOM   6304  C C   . ILE B 1 77  ? 36.310  54.689  40.793  1.00 17.65  ? 103 ILE B C   1 
ATOM   6305  O O   . ILE B 1 77  ? 36.957  54.653  41.843  1.00 15.81  ? 103 ILE B O   1 
ATOM   6306  C CB  . ILE B 1 77  ? 34.348  53.203  40.291  1.00 20.28  ? 103 ILE B CB  1 
ATOM   6307  C CG1 . ILE B 1 77  ? 32.829  53.056  40.403  1.00 18.97  ? 103 ILE B CG1 1 
ATOM   6308  C CG2 . ILE B 1 77  ? 35.040  52.098  41.095  1.00 23.11  ? 103 ILE B CG2 1 
ATOM   6309  C CD1 . ILE B 1 77  ? 32.310  51.776  39.822  1.00 18.62  ? 103 ILE B CD1 1 
ATOM   6310  N N   . PHE B 1 78  ? 36.885  54.812  39.600  1.00 18.13  ? 104 PHE B N   1 
ATOM   6311  C CA  . PHE B 1 78  ? 38.332  54.897  39.465  1.00 18.24  ? 104 PHE B CA  1 
ATOM   6312  C C   . PHE B 1 78  ? 38.925  56.125  40.118  1.00 17.55  ? 104 PHE B C   1 
ATOM   6313  O O   . PHE B 1 78  ? 40.033  56.078  40.631  1.00 19.95  ? 104 PHE B O   1 
ATOM   6314  C CB  . PHE B 1 78  ? 38.734  54.841  37.994  1.00 19.22  ? 104 PHE B CB  1 
ATOM   6315  C CG  . PHE B 1 78  ? 38.835  53.446  37.454  1.00 22.87  ? 104 PHE B CG  1 
ATOM   6316  C CD1 . PHE B 1 78  ? 38.309  53.131  36.207  1.00 23.02  ? 104 PHE B CD1 1 
ATOM   6317  C CD2 . PHE B 1 78  ? 39.469  52.446  38.190  1.00 23.26  ? 104 PHE B CD2 1 
ATOM   6318  C CE1 . PHE B 1 78  ? 38.414  51.841  35.693  1.00 23.65  ? 104 PHE B CE1 1 
ATOM   6319  C CE2 . PHE B 1 78  ? 39.581  51.154  37.687  1.00 25.23  ? 104 PHE B CE2 1 
ATOM   6320  C CZ  . PHE B 1 78  ? 39.050  50.849  36.432  1.00 25.26  ? 104 PHE B CZ  1 
ATOM   6321  N N   . THR B 1 79  ? 38.194  57.228  40.104  1.00 20.45  ? 105 THR B N   1 
ATOM   6322  C CA  . THR B 1 79  ? 38.674  58.454  40.730  1.00 22.33  ? 105 THR B CA  1 
ATOM   6323  C C   . THR B 1 79  ? 38.774  58.264  42.249  1.00 22.95  ? 105 THR B C   1 
ATOM   6324  O O   . THR B 1 79  ? 39.780  58.623  42.870  1.00 21.99  ? 105 THR B O   1 
ATOM   6325  C CB  . THR B 1 79  ? 37.729  59.631  40.420  1.00 21.79  ? 105 THR B CB  1 
ATOM   6326  O OG1 . THR B 1 79  ? 37.759  59.900  39.017  1.00 19.90  ? 105 THR B OG1 1 
ATOM   6327  C CG2 . THR B 1 79  ? 38.155  60.873  41.170  1.00 23.78  ? 105 THR B CG2 1 
ATOM   6328  N N   . VAL B 1 80  ? 37.719  57.699  42.832  1.00 24.26  ? 106 VAL B N   1 
ATOM   6329  C CA  . VAL B 1 80  ? 37.653  57.430  44.265  1.00 25.65  ? 106 VAL B CA  1 
ATOM   6330  C C   . VAL B 1 80  ? 38.770  56.483  44.690  1.00 26.60  ? 106 VAL B C   1 
ATOM   6331  O O   . VAL B 1 80  ? 39.485  56.743  45.658  1.00 28.95  ? 106 VAL B O   1 
ATOM   6332  C CB  . VAL B 1 80  ? 36.299  56.782  44.640  1.00 27.53  ? 106 VAL B CB  1 
ATOM   6333  C CG1 . VAL B 1 80  ? 36.322  56.321  46.079  1.00 28.29  ? 106 VAL B CG1 1 
ATOM   6334  C CG2 . VAL B 1 80  ? 35.169  57.775  44.418  1.00 28.28  ? 106 VAL B CG2 1 
ATOM   6335  N N   . GLN B 1 81  ? 38.916  55.381  43.964  1.00 25.65  ? 107 GLN B N   1 
ATOM   6336  C CA  . GLN B 1 81  ? 39.948  54.407  44.277  1.00 25.24  ? 107 GLN B CA  1 
ATOM   6337  C C   . GLN B 1 81  ? 41.361  54.896  43.984  1.00 25.08  ? 107 GLN B C   1 
ATOM   6338  O O   . GLN B 1 81  ? 42.312  54.452  44.611  1.00 24.47  ? 107 GLN B O   1 
ATOM   6339  C CB  . GLN B 1 81  ? 39.670  53.108  43.534  1.00 25.91  ? 107 GLN B CB  1 
ATOM   6340  C CG  . GLN B 1 81  ? 38.592  52.282  44.207  1.00 30.48  ? 107 GLN B CG  1 
ATOM   6341  C CD  . GLN B 1 81  ? 37.995  51.233  43.300  1.00 34.27  ? 107 GLN B CD  1 
ATOM   6342  O OE1 . GLN B 1 81  ? 38.661  50.718  42.398  1.00 35.26  ? 107 GLN B OE1 1 
ATOM   6343  N NE2 . GLN B 1 81  ? 36.733  50.895  43.543  1.00 37.20  ? 107 GLN B NE2 1 
ATOM   6344  N N   . LEU B 1 82  ? 41.514  55.808  43.035  1.00 24.99  ? 108 LEU B N   1 
ATOM   6345  C CA  . LEU B 1 82  ? 42.843  56.310  42.740  1.00 26.29  ? 108 LEU B CA  1 
ATOM   6346  C C   . LEU B 1 82  ? 43.216  57.287  43.851  1.00 27.65  ? 108 LEU B C   1 
ATOM   6347  O O   . LEU B 1 82  ? 44.385  57.410  44.230  1.00 25.35  ? 108 LEU B O   1 
ATOM   6348  C CB  . LEU B 1 82  ? 42.878  57.000  41.371  1.00 26.85  ? 108 LEU B CB  1 
ATOM   6349  C CG  . LEU B 1 82  ? 44.256  57.489  40.911  1.00 28.63  ? 108 LEU B CG  1 
ATOM   6350  C CD1 . LEU B 1 82  ? 45.322  56.449  41.203  1.00 26.11  ? 108 LEU B CD1 1 
ATOM   6351  C CD2 . LEU B 1 82  ? 44.209  57.806  39.430  1.00 31.70  ? 108 LEU B CD2 1 
ATOM   6352  N N   . ASP B 1 83  ? 42.216  57.980  44.382  1.00 28.13  ? 109 ASP B N   1 
ATOM   6353  C CA  . ASP B 1 83  ? 42.482  58.908  45.462  1.00 31.37  ? 109 ASP B CA  1 
ATOM   6354  C C   . ASP B 1 83  ? 42.954  58.063  46.640  1.00 32.05  ? 109 ASP B C   1 
ATOM   6355  O O   . ASP B 1 83  ? 43.959  58.370  47.268  1.00 35.06  ? 109 ASP B O   1 
ATOM   6356  C CB  . ASP B 1 83  ? 41.213  59.687  45.835  1.00 31.60  ? 109 ASP B CB  1 
ATOM   6357  C CG  . ASP B 1 83  ? 41.404  60.559  47.070  1.00 31.58  ? 109 ASP B CG  1 
ATOM   6358  O OD1 . ASP B 1 83  ? 42.339  61.388  47.082  1.00 29.20  ? 109 ASP B OD1 1 
ATOM   6359  O OD2 . ASP B 1 83  ? 40.617  60.413  48.029  1.00 33.60  ? 109 ASP B OD2 1 
ATOM   6360  N N   . ASP B 1 84  ? 42.228  56.983  46.915  1.00 32.28  ? 110 ASP B N   1 
ATOM   6361  C CA  . ASP B 1 84  ? 42.558  56.081  48.007  1.00 31.42  ? 110 ASP B CA  1 
ATOM   6362  C C   . ASP B 1 84  ? 43.998  55.588  47.897  1.00 28.08  ? 110 ASP B C   1 
ATOM   6363  O O   . ASP B 1 84  ? 44.718  55.540  48.888  1.00 28.34  ? 110 ASP B O   1 
ATOM   6364  C CB  . ASP B 1 84  ? 41.605  54.884  48.009  1.00 37.02  ? 110 ASP B CB  1 
ATOM   6365  C CG  . ASP B 1 84  ? 41.642  54.110  49.315  1.00 42.40  ? 110 ASP B CG  1 
ATOM   6366  O OD1 . ASP B 1 84  ? 41.235  52.927  49.329  1.00 47.67  ? 110 ASP B OD1 1 
ATOM   6367  O OD2 . ASP B 1 84  ? 42.067  54.687  50.336  1.00 46.65  ? 110 ASP B OD2 1 
ATOM   6368  N N   . TYR B 1 85  ? 44.410  55.215  46.692  1.00 26.61  ? 111 TYR B N   1 
ATOM   6369  C CA  . TYR B 1 85  ? 45.770  54.739  46.457  1.00 27.16  ? 111 TYR B CA  1 
ATOM   6370  C C   . TYR B 1 85  ? 46.776  55.844  46.770  1.00 29.17  ? 111 TYR B C   1 
ATOM   6371  O O   . TYR B 1 85  ? 47.860  55.581  47.278  1.00 30.91  ? 111 TYR B O   1 
ATOM   6372  C CB  . TYR B 1 85  ? 45.935  54.304  45.002  1.00 26.30  ? 111 TYR B CB  1 
ATOM   6373  C CG  . TYR B 1 85  ? 47.336  53.846  44.633  1.00 29.17  ? 111 TYR B CG  1 
ATOM   6374  C CD1 . TYR B 1 85  ? 47.837  52.625  45.092  1.00 31.99  ? 111 TYR B CD1 1 
ATOM   6375  C CD2 . TYR B 1 85  ? 48.154  54.622  43.814  1.00 28.03  ? 111 TYR B CD2 1 
ATOM   6376  C CE1 . TYR B 1 85  ? 49.112  52.186  44.743  1.00 31.27  ? 111 TYR B CE1 1 
ATOM   6377  C CE2 . TYR B 1 85  ? 49.436  54.195  43.459  1.00 29.24  ? 111 TYR B CE2 1 
ATOM   6378  C CZ  . TYR B 1 85  ? 49.908  52.974  43.928  1.00 32.11  ? 111 TYR B CZ  1 
ATOM   6379  O OH  . TYR B 1 85  ? 51.173  52.534  43.597  1.00 31.58  ? 111 TYR B OH  1 
ATOM   6380  N N   . LEU B 1 86  ? 46.414  57.081  46.450  1.00 31.24  ? 112 LEU B N   1 
ATOM   6381  C CA  . LEU B 1 86  ? 47.276  58.228  46.701  1.00 32.69  ? 112 LEU B CA  1 
ATOM   6382  C C   . LEU B 1 86  ? 47.026  58.746  48.116  1.00 35.87  ? 112 LEU B C   1 
ATOM   6383  O O   . LEU B 1 86  ? 47.095  59.947  48.387  1.00 37.67  ? 112 LEU B O   1 
ATOM   6384  C CB  . LEU B 1 86  ? 47.001  59.332  45.676  1.00 30.89  ? 112 LEU B CB  1 
ATOM   6385  C CG  . LEU B 1 86  ? 47.254  58.965  44.211  1.00 30.23  ? 112 LEU B CG  1 
ATOM   6386  C CD1 . LEU B 1 86  ? 46.754  60.075  43.309  1.00 25.97  ? 112 LEU B CD1 1 
ATOM   6387  C CD2 . LEU B 1 86  ? 48.739  58.716  43.996  1.00 28.80  ? 112 LEU B CD2 1 
ATOM   6388  N N   . ASN B 1 87  ? 46.714  57.815  49.009  1.00 39.12  ? 113 ASN B N   1 
ATOM   6389  C CA  . ASN B 1 87  ? 46.469  58.114  50.415  1.00 41.74  ? 113 ASN B CA  1 
ATOM   6390  C C   . ASN B 1 87  ? 45.499  59.261  50.662  1.00 40.25  ? 113 ASN B C   1 
ATOM   6391  O O   . ASN B 1 87  ? 45.646  59.998  51.631  1.00 40.77  ? 113 ASN B O   1 
ATOM   6392  C CB  . ASN B 1 87  ? 47.800  58.401  51.117  1.00 46.65  ? 113 ASN B CB  1 
ATOM   6393  C CG  . ASN B 1 87  ? 48.855  57.348  50.816  1.00 49.26  ? 113 ASN B CG  1 
ATOM   6394  O OD1 . ASN B 1 87  ? 48.628  56.151  51.007  1.00 50.63  ? 113 ASN B OD1 1 
ATOM   6395  N ND2 . ASN B 1 87  ? 50.017  57.791  50.339  1.00 51.13  ? 113 ASN B ND2 1 
ATOM   6396  N N   . GLY B 1 88  ? 44.518  59.401  49.780  1.00 40.08  ? 114 GLY B N   1 
ATOM   6397  C CA  . GLY B 1 88  ? 43.505  60.435  49.917  1.00 40.96  ? 114 GLY B CA  1 
ATOM   6398  C C   . GLY B 1 88  ? 43.955  61.874  50.065  1.00 42.84  ? 114 GLY B C   1 
ATOM   6399  O O   . GLY B 1 88  ? 43.289  62.665  50.731  1.00 42.41  ? 114 GLY B O   1 
ATOM   6400  N N   . ARG B 1 89  ? 45.072  62.231  49.444  1.00 45.25  ? 115 ARG B N   1 
ATOM   6401  C CA  . ARG B 1 89  ? 45.576  63.600  49.532  1.00 48.27  ? 115 ARG B CA  1 
ATOM   6402  C C   . ARG B 1 89  ? 45.195  64.420  48.296  1.00 45.56  ? 115 ARG B C   1 
ATOM   6403  O O   . ARG B 1 89  ? 45.463  65.619  48.230  1.00 47.12  ? 115 ARG B O   1 
ATOM   6404  C CB  . ARG B 1 89  ? 47.101  63.591  49.668  1.00 54.22  ? 115 ARG B CB  1 
ATOM   6405  C CG  . ARG B 1 89  ? 47.614  62.851  50.887  1.00 63.66  ? 115 ARG B CG  1 
ATOM   6406  C CD  . ARG B 1 89  ? 49.065  62.419  50.698  1.00 71.35  ? 115 ARG B CD  1 
ATOM   6407  N NE  . ARG B 1 89  ? 49.241  61.601  49.496  1.00 77.84  ? 115 ARG B NE  1 
ATOM   6408  C CZ  . ARG B 1 89  ? 50.376  60.991  49.161  1.00 80.54  ? 115 ARG B CZ  1 
ATOM   6409  N NH1 . ARG B 1 89  ? 51.448  61.100  49.939  1.00 82.11  ? 115 ARG B NH1 1 
ATOM   6410  N NH2 . ARG B 1 89  ? 50.446  60.278  48.043  1.00 80.00  ? 115 ARG B NH2 1 
ATOM   6411  N N   . ALA B 1 90  ? 44.567  63.769  47.323  1.00 40.15  ? 116 ALA B N   1 
ATOM   6412  C CA  . ALA B 1 90  ? 44.185  64.426  46.082  1.00 34.47  ? 116 ALA B CA  1 
ATOM   6413  C C   . ALA B 1 90  ? 42.920  65.260  46.152  1.00 31.28  ? 116 ALA B C   1 
ATOM   6414  O O   . ALA B 1 90  ? 42.038  65.018  46.977  1.00 31.30  ? 116 ALA B O   1 
ATOM   6415  C CB  . ALA B 1 90  ? 44.032  63.384  44.972  1.00 32.29  ? 116 ALA B CB  1 
ATOM   6416  N N   . VAL B 1 91  ? 42.849  66.254  45.275  1.00 27.01  ? 117 VAL B N   1 
ATOM   6417  C CA  . VAL B 1 91  ? 41.667  67.089  45.167  1.00 25.39  ? 117 VAL B CA  1 
ATOM   6418  C C   . VAL B 1 91  ? 40.948  66.529  43.929  1.00 25.26  ? 117 VAL B C   1 
ATOM   6419  O O   . VAL B 1 91  ? 41.528  66.448  42.855  1.00 26.83  ? 117 VAL B O   1 
ATOM   6420  C CB  . VAL B 1 91  ? 42.057  68.574  44.971  1.00 26.50  ? 117 VAL B CB  1 
ATOM   6421  C CG1 . VAL B 1 91  ? 40.816  69.431  44.687  1.00 25.93  ? 117 VAL B CG1 1 
ATOM   6422  C CG2 . VAL B 1 91  ? 42.762  69.080  46.226  1.00 21.58  ? 117 VAL B CG2 1 
ATOM   6423  N N   . GLN B 1 92  ? 39.699  66.114  44.091  1.00 24.27  ? 118 GLN B N   1 
ATOM   6424  C CA  . GLN B 1 92  ? 38.934  65.533  42.994  1.00 24.52  ? 118 GLN B CA  1 
ATOM   6425  C C   . GLN B 1 92  ? 38.055  66.555  42.288  1.00 20.99  ? 118 GLN B C   1 
ATOM   6426  O O   . GLN B 1 92  ? 37.631  67.527  42.892  1.00 22.59  ? 118 GLN B O   1 
ATOM   6427  C CB  . GLN B 1 92  ? 38.096  64.366  43.534  1.00 26.91  ? 118 GLN B CB  1 
ATOM   6428  C CG  . GLN B 1 92  ? 38.967  63.323  44.245  1.00 33.64  ? 118 GLN B CG  1 
ATOM   6429  C CD  . GLN B 1 92  ? 38.181  62.219  44.939  1.00 37.06  ? 118 GLN B CD  1 
ATOM   6430  O OE1 . GLN B 1 92  ? 37.318  62.474  45.781  1.00 35.72  ? 118 GLN B OE1 1 
ATOM   6431  N NE2 . GLN B 1 92  ? 38.492  60.978  44.592  1.00 40.15  ? 118 GLN B NE2 1 
ATOM   6432  N N   . HIS B 1 93  ? 37.788  66.330  41.006  1.00 20.00  ? 119 HIS B N   1 
ATOM   6433  C CA  . HIS B 1 93  ? 36.971  67.243  40.197  1.00 18.60  ? 119 HIS B CA  1 
ATOM   6434  C C   . HIS B 1 93  ? 36.069  66.474  39.238  1.00 20.18  ? 119 HIS B C   1 
ATOM   6435  O O   . HIS B 1 93  ? 36.465  65.442  38.692  1.00 21.05  ? 119 HIS B O   1 
ATOM   6436  C CB  . HIS B 1 93  ? 37.857  68.148  39.328  1.00 17.22  ? 119 HIS B CB  1 
ATOM   6437  C CG  . HIS B 1 93  ? 38.899  68.910  40.084  1.00 19.33  ? 119 HIS B CG  1 
ATOM   6438  N ND1 . HIS B 1 93  ? 38.631  70.093  40.740  1.00 20.39  ? 119 HIS B ND1 1 
ATOM   6439  C CD2 . HIS B 1 93  ? 40.212  68.648  40.299  1.00 19.44  ? 119 HIS B CD2 1 
ATOM   6440  C CE1 . HIS B 1 93  ? 39.734  70.526  41.328  1.00 22.58  ? 119 HIS B CE1 1 
ATOM   6441  N NE2 . HIS B 1 93  ? 40.706  69.667  41.076  1.00 22.29  ? 119 HIS B NE2 1 
ATOM   6442  N N   . ARG B 1 94  ? 34.864  66.986  39.018  1.00 19.99  ? 120 ARG B N   1 
ATOM   6443  C CA  . ARG B 1 94  ? 33.950  66.368  38.072  1.00 19.35  ? 120 ARG B CA  1 
ATOM   6444  C C   . ARG B 1 94  ? 33.857  67.341  36.891  1.00 19.90  ? 120 ARG B C   1 
ATOM   6445  O O   . ARG B 1 94  ? 33.421  68.481  37.041  1.00 19.46  ? 120 ARG B O   1 
ATOM   6446  C CB  . ARG B 1 94  ? 32.585  66.147  38.712  1.00 21.55  ? 120 ARG B CB  1 
ATOM   6447  C CG  . ARG B 1 94  ? 31.570  65.477  37.795  1.00 26.40  ? 120 ARG B CG  1 
ATOM   6448  C CD  . ARG B 1 94  ? 30.295  65.079  38.556  1.00 32.46  ? 120 ARG B CD  1 
ATOM   6449  N NE  . ARG B 1 94  ? 29.225  64.705  37.637  1.00 38.90  ? 120 ARG B NE  1 
ATOM   6450  C CZ  . ARG B 1 94  ? 28.326  65.554  37.144  1.00 43.67  ? 120 ARG B CZ  1 
ATOM   6451  N NH1 . ARG B 1 94  ? 28.350  66.835  37.496  1.00 42.19  ? 120 ARG B NH1 1 
ATOM   6452  N NH2 . ARG B 1 94  ? 27.423  65.127  36.266  1.00 45.14  ? 120 ARG B NH2 1 
ATOM   6453  N N   . GLU B 1 95  ? 34.292  66.891  35.719  1.00 19.66  ? 121 GLU B N   1 
ATOM   6454  C CA  . GLU B 1 95  ? 34.283  67.721  34.523  1.00 20.77  ? 121 GLU B CA  1 
ATOM   6455  C C   . GLU B 1 95  ? 33.269  67.228  33.503  1.00 22.23  ? 121 GLU B C   1 
ATOM   6456  O O   . GLU B 1 95  ? 33.277  66.056  33.135  1.00 24.15  ? 121 GLU B O   1 
ATOM   6457  C CB  . GLU B 1 95  ? 35.668  67.712  33.879  1.00 20.29  ? 121 GLU B CB  1 
ATOM   6458  C CG  . GLU B 1 95  ? 36.808  68.019  34.825  1.00 17.52  ? 121 GLU B CG  1 
ATOM   6459  C CD  . GLU B 1 95  ? 36.786  69.452  35.301  1.00 20.70  ? 121 GLU B CD  1 
ATOM   6460  O OE1 . GLU B 1 95  ? 37.677  69.820  36.099  1.00 23.96  ? 121 GLU B OE1 1 
ATOM   6461  O OE2 . GLU B 1 95  ? 35.884  70.208  34.874  1.00 15.71  ? 121 GLU B OE2 1 
ATOM   6462  N N   . VAL B 1 96  ? 32.401  68.123  33.042  1.00 22.00  ? 122 VAL B N   1 
ATOM   6463  C CA  . VAL B 1 96  ? 31.402  67.759  32.043  1.00 21.19  ? 122 VAL B CA  1 
ATOM   6464  C C   . VAL B 1 96  ? 31.691  68.495  30.737  1.00 19.93  ? 122 VAL B C   1 
ATOM   6465  O O   . VAL B 1 96  ? 32.039  69.678  30.736  1.00 18.25  ? 122 VAL B O   1 
ATOM   6466  C CB  . VAL B 1 96  ? 29.968  68.106  32.517  1.00 22.93  ? 122 VAL B CB  1 
ATOM   6467  C CG1 . VAL B 1 96  ? 28.982  67.833  31.404  1.00 23.15  ? 122 VAL B CG1 1 
ATOM   6468  C CG2 . VAL B 1 96  ? 29.599  67.279  33.745  1.00 22.25  ? 122 VAL B CG2 1 
ATOM   6469  N N   . GLN B 1 97  ? 31.562  67.786  29.622  1.00 19.14  ? 123 GLN B N   1 
ATOM   6470  C CA  . GLN B 1 97  ? 31.804  68.384  28.310  1.00 20.11  ? 123 GLN B CA  1 
ATOM   6471  C C   . GLN B 1 97  ? 31.123  69.754  28.163  1.00 18.44  ? 123 GLN B C   1 
ATOM   6472  O O   . GLN B 1 97  ? 29.937  69.904  28.457  1.00 16.90  ? 123 GLN B O   1 
ATOM   6473  C CB  . GLN B 1 97  ? 31.287  67.454  27.217  1.00 17.99  ? 123 GLN B CB  1 
ATOM   6474  C CG  . GLN B 1 97  ? 31.710  67.829  25.822  1.00 17.60  ? 123 GLN B CG  1 
ATOM   6475  C CD  . GLN B 1 97  ? 30.909  67.089  24.767  1.00 20.79  ? 123 GLN B CD  1 
ATOM   6476  O OE1 . GLN B 1 97  ? 30.693  65.873  24.853  1.00 22.66  ? 123 GLN B OE1 1 
ATOM   6477  N NE2 . GLN B 1 97  ? 30.467  67.819  23.758  1.00 19.00  ? 123 GLN B NE2 1 
ATOM   6478  N N   . GLY B 1 98  ? 31.890  70.748  27.724  1.00 18.45  ? 124 GLY B N   1 
ATOM   6479  C CA  . GLY B 1 98  ? 31.349  72.078  27.516  1.00 18.35  ? 124 GLY B CA  1 
ATOM   6480  C C   . GLY B 1 98  ? 31.324  72.967  28.742  1.00 23.86  ? 124 GLY B C   1 
ATOM   6481  O O   . GLY B 1 98  ? 31.112  74.176  28.628  1.00 25.64  ? 124 GLY B O   1 
ATOM   6482  N N   . PHE B 1 99  ? 31.536  72.386  29.918  1.00 23.59  ? 125 PHE B N   1 
ATOM   6483  C CA  . PHE B 1 99  ? 31.510  73.171  31.142  1.00 21.28  ? 125 PHE B CA  1 
ATOM   6484  C C   . PHE B 1 99  ? 32.643  72.807  32.087  1.00 19.32  ? 125 PHE B C   1 
ATOM   6485  O O   . PHE B 1 99  ? 32.451  72.804  33.299  1.00 16.87  ? 125 PHE B O   1 
ATOM   6486  C CB  . PHE B 1 99  ? 30.175  72.976  31.864  1.00 25.34  ? 125 PHE B CB  1 
ATOM   6487  C CG  . PHE B 1 99  ? 28.966  73.301  31.023  1.00 31.22  ? 125 PHE B CG  1 
ATOM   6488  C CD1 . PHE B 1 99  ? 28.464  72.378  30.114  1.00 32.63  ? 125 PHE B CD1 1 
ATOM   6489  C CD2 . PHE B 1 99  ? 28.331  74.537  31.141  1.00 33.97  ? 125 PHE B CD2 1 
ATOM   6490  C CE1 . PHE B 1 99  ? 27.345  72.675  29.333  1.00 35.34  ? 125 PHE B CE1 1 
ATOM   6491  C CE2 . PHE B 1 99  ? 27.211  74.848  30.364  1.00 36.35  ? 125 PHE B CE2 1 
ATOM   6492  C CZ  . PHE B 1 99  ? 26.716  73.916  29.459  1.00 37.40  ? 125 PHE B CZ  1 
ATOM   6493  N N   . GLU B 1 100 ? 33.817  72.497  31.541  1.00 17.03  ? 126 GLU B N   1 
ATOM   6494  C CA  . GLU B 1 100 ? 34.970  72.135  32.368  1.00 19.51  ? 126 GLU B CA  1 
ATOM   6495  C C   . GLU B 1 100 ? 35.439  73.312  33.221  1.00 18.46  ? 126 GLU B C   1 
ATOM   6496  O O   . GLU B 1 100 ? 35.235  74.462  32.855  1.00 22.63  ? 126 GLU B O   1 
ATOM   6497  C CB  . GLU B 1 100 ? 36.135  71.640  31.500  1.00 19.31  ? 126 GLU B CB  1 
ATOM   6498  C CG  . GLU B 1 100 ? 35.793  70.447  30.635  1.00 21.30  ? 126 GLU B CG  1 
ATOM   6499  C CD  . GLU B 1 100 ? 35.060  70.829  29.364  1.00 22.03  ? 126 GLU B CD  1 
ATOM   6500  O OE1 . GLU B 1 100 ? 34.580  71.978  29.244  1.00 22.13  ? 126 GLU B OE1 1 
ATOM   6501  O OE2 . GLU B 1 100 ? 34.961  69.965  28.477  1.00 24.11  ? 126 GLU B OE2 1 
ATOM   6502  N N   . SER B 1 101 ? 36.060  73.016  34.356  1.00 17.18  ? 127 SER B N   1 
ATOM   6503  C CA  . SER B 1 101 ? 36.552  74.057  35.254  1.00 19.22  ? 127 SER B CA  1 
ATOM   6504  C C   . SER B 1 101 ? 37.794  74.730  34.665  1.00 18.23  ? 127 SER B C   1 
ATOM   6505  O O   . SER B 1 101 ? 38.483  74.146  33.832  1.00 20.99  ? 127 SER B O   1 
ATOM   6506  C CB  . SER B 1 101 ? 36.883  73.458  36.633  1.00 21.45  ? 127 SER B CB  1 
ATOM   6507  O OG  . SER B 1 101 ? 38.028  72.615  36.597  1.00 21.37  ? 127 SER B OG  1 
ATOM   6508  N N   . ALA B 1 102 ? 38.073  75.955  35.097  1.00 17.19  ? 128 ALA B N   1 
ATOM   6509  C CA  . ALA B 1 102 ? 39.231  76.703  34.601  1.00 16.96  ? 128 ALA B CA  1 
ATOM   6510  C C   . ALA B 1 102 ? 40.538  75.943  34.822  1.00 18.11  ? 128 ALA B C   1 
ATOM   6511  O O   . ALA B 1 102 ? 41.443  76.006  33.990  1.00 17.94  ? 128 ALA B O   1 
ATOM   6512  C CB  . ALA B 1 102 ? 39.305  78.078  35.277  1.00 16.26  ? 128 ALA B CB  1 
ATOM   6513  N N   . THR B 1 103 ? 40.630  75.234  35.948  1.00 18.75  ? 129 THR B N   1 
ATOM   6514  C CA  . THR B 1 103 ? 41.813  74.440  36.285  1.00 17.77  ? 129 THR B CA  1 
ATOM   6515  C C   . THR B 1 103 ? 42.062  73.375  35.223  1.00 16.19  ? 129 THR B C   1 
ATOM   6516  O O   . THR B 1 103 ? 43.147  73.293  34.667  1.00 19.00  ? 129 THR B O   1 
ATOM   6517  C CB  . THR B 1 103 ? 41.644  73.758  37.660  1.00 19.51  ? 129 THR B CB  1 
ATOM   6518  O OG1 . THR B 1 103 ? 41.563  74.763  38.675  1.00 20.85  ? 129 THR B OG1 1 
ATOM   6519  C CG2 . THR B 1 103 ? 42.825  72.840  37.959  1.00 18.86  ? 129 THR B CG2 1 
ATOM   6520  N N   . PHE B 1 104 ? 41.048  72.566  34.943  1.00 16.12  ? 130 PHE B N   1 
ATOM   6521  C CA  . PHE B 1 104 ? 41.137  71.518  33.930  1.00 14.84  ? 130 PHE B CA  1 
ATOM   6522  C C   . PHE B 1 104 ? 41.556  72.133  32.588  1.00 17.23  ? 130 PHE B C   1 
ATOM   6523  O O   . PHE B 1 104 ? 42.556  71.726  31.986  1.00 18.14  ? 130 PHE B O   1 
ATOM   6524  C CB  . PHE B 1 104 ? 39.763  70.849  33.772  1.00 13.85  ? 130 PHE B CB  1 
ATOM   6525  C CG  . PHE B 1 104 ? 39.729  69.728  32.764  1.00 14.03  ? 130 PHE B CG  1 
ATOM   6526  C CD1 . PHE B 1 104 ? 40.317  68.498  33.045  1.00 13.30  ? 130 PHE B CD1 1 
ATOM   6527  C CD2 . PHE B 1 104 ? 39.077  69.891  31.541  1.00 17.32  ? 130 PHE B CD2 1 
ATOM   6528  C CE1 . PHE B 1 104 ? 40.253  67.442  32.129  1.00 14.04  ? 130 PHE B CE1 1 
ATOM   6529  C CE2 . PHE B 1 104 ? 39.008  68.834  30.614  1.00 16.12  ? 130 PHE B CE2 1 
ATOM   6530  C CZ  . PHE B 1 104 ? 39.596  67.612  30.910  1.00 14.04  ? 130 PHE B CZ  1 
ATOM   6531  N N   . LEU B 1 105 ? 40.783  73.120  32.130  1.00 15.72  ? 131 LEU B N   1 
ATOM   6532  C CA  . LEU B 1 105 ? 41.042  73.777  30.851  1.00 16.72  ? 131 LEU B CA  1 
ATOM   6533  C C   . LEU B 1 105 ? 42.438  74.359  30.741  1.00 18.76  ? 131 LEU B C   1 
ATOM   6534  O O   . LEU B 1 105 ? 42.989  74.452  29.642  1.00 21.71  ? 131 LEU B O   1 
ATOM   6535  C CB  . LEU B 1 105 ? 40.016  74.884  30.604  1.00 20.27  ? 131 LEU B CB  1 
ATOM   6536  C CG  . LEU B 1 105 ? 38.565  74.431  30.460  1.00 20.13  ? 131 LEU B CG  1 
ATOM   6537  C CD1 . LEU B 1 105 ? 37.647  75.635  30.387  1.00 23.02  ? 131 LEU B CD1 1 
ATOM   6538  C CD2 . LEU B 1 105 ? 38.427  73.573  29.224  1.00 17.00  ? 131 LEU B CD2 1 
ATOM   6539  N N   . GLY B 1 106 ? 43.006  74.765  31.873  1.00 18.65  ? 132 GLY B N   1 
ATOM   6540  C CA  . GLY B 1 106 ? 44.339  75.326  31.849  1.00 19.34  ? 132 GLY B CA  1 
ATOM   6541  C C   . GLY B 1 106 ? 45.422  74.332  31.463  1.00 22.76  ? 132 GLY B C   1 
ATOM   6542  O O   . GLY B 1 106 ? 46.554  74.735  31.232  1.00 22.87  ? 132 GLY B O   1 
ATOM   6543  N N   . TYR B 1 107 ? 45.099  73.038  31.404  1.00 26.05  ? 133 TYR B N   1 
ATOM   6544  C CA  . TYR B 1 107 ? 46.098  72.035  31.033  1.00 26.23  ? 133 TYR B CA  1 
ATOM   6545  C C   . TYR B 1 107 ? 46.227  71.953  29.522  1.00 27.77  ? 133 TYR B C   1 
ATOM   6546  O O   . TYR B 1 107 ? 47.215  71.436  29.011  1.00 28.77  ? 133 TYR B O   1 
ATOM   6547  C CB  . TYR B 1 107 ? 45.734  70.628  31.532  1.00 27.97  ? 133 TYR B CB  1 
ATOM   6548  C CG  . TYR B 1 107 ? 45.406  70.471  33.000  1.00 25.62  ? 133 TYR B CG  1 
ATOM   6549  C CD1 . TYR B 1 107 ? 45.931  71.332  33.964  1.00 25.14  ? 133 TYR B CD1 1 
ATOM   6550  C CD2 . TYR B 1 107 ? 44.580  69.435  33.425  1.00 24.09  ? 133 TYR B CD2 1 
ATOM   6551  C CE1 . TYR B 1 107 ? 45.640  71.163  35.318  1.00 23.11  ? 133 TYR B CE1 1 
ATOM   6552  C CE2 . TYR B 1 107 ? 44.283  69.255  34.774  1.00 24.94  ? 133 TYR B CE2 1 
ATOM   6553  C CZ  . TYR B 1 107 ? 44.810  70.121  35.714  1.00 24.07  ? 133 TYR B CZ  1 
ATOM   6554  O OH  . TYR B 1 107 ? 44.479  69.952  37.040  1.00 24.80  ? 133 TYR B OH  1 
ATOM   6555  N N   . PHE B 1 108 ? 45.226  72.456  28.805  1.00 28.84  ? 134 PHE B N   1 
ATOM   6556  C CA  . PHE B 1 108 ? 45.246  72.396  27.348  1.00 30.14  ? 134 PHE B CA  1 
ATOM   6557  C C   . PHE B 1 108 ? 45.182  73.780  26.714  1.00 32.28  ? 134 PHE B C   1 
ATOM   6558  O O   . PHE B 1 108 ? 44.105  74.309  26.453  1.00 32.36  ? 134 PHE B O   1 
ATOM   6559  C CB  . PHE B 1 108 ? 44.076  71.535  26.861  1.00 26.89  ? 134 PHE B CB  1 
ATOM   6560  C CG  . PHE B 1 108 ? 43.844  70.304  27.697  1.00 24.61  ? 134 PHE B CG  1 
ATOM   6561  C CD1 . PHE B 1 108 ? 42.842  70.282  28.670  1.00 24.77  ? 134 PHE B CD1 1 
ATOM   6562  C CD2 . PHE B 1 108 ? 44.650  69.182  27.544  1.00 18.36  ? 134 PHE B CD2 1 
ATOM   6563  C CE1 . PHE B 1 108 ? 42.649  69.158  29.474  1.00 19.70  ? 134 PHE B CE1 1 
ATOM   6564  C CE2 . PHE B 1 108 ? 44.462  68.061  28.343  1.00 18.36  ? 134 PHE B CE2 1 
ATOM   6565  C CZ  . PHE B 1 108 ? 43.463  68.050  29.307  1.00 18.49  ? 134 PHE B CZ  1 
ATOM   6566  N N   . LYS B 1 109 ? 46.342  74.367  26.454  1.00 36.84  ? 135 LYS B N   1 
ATOM   6567  C CA  . LYS B 1 109 ? 46.368  75.698  25.863  1.00 41.08  ? 135 LYS B CA  1 
ATOM   6568  C C   . LYS B 1 109 ? 45.990  75.704  24.395  1.00 39.77  ? 135 LYS B C   1 
ATOM   6569  O O   . LYS B 1 109 ? 45.262  76.588  23.951  1.00 38.81  ? 135 LYS B O   1 
ATOM   6570  C CB  . LYS B 1 109 ? 47.737  76.344  26.065  1.00 45.60  ? 135 LYS B CB  1 
ATOM   6571  C CG  . LYS B 1 109 ? 47.892  77.034  27.434  1.00 49.17  ? 135 LYS B CG  1 
ATOM   6572  C CD  . LYS B 1 109 ? 46.935  78.227  27.591  1.00 49.63  ? 135 LYS B CD  1 
ATOM   6573  C CE  . LYS B 1 109 ? 47.354  79.149  28.745  1.00 51.02  ? 135 LYS B CE  1 
ATOM   6574  N NZ  . LYS B 1 109 ? 46.560  80.427  28.817  1.00 45.79  ? 135 LYS B NZ  1 
ATOM   6575  N N   . SER B 1 110 ? 46.475  74.713  23.653  1.00 38.65  ? 136 SER B N   1 
ATOM   6576  C CA  . SER B 1 110 ? 46.165  74.586  22.233  1.00 38.54  ? 136 SER B CA  1 
ATOM   6577  C C   . SER B 1 110 ? 44.662  74.419  21.990  1.00 36.49  ? 136 SER B C   1 
ATOM   6578  O O   . SER B 1 110 ? 44.185  74.642  20.880  1.00 37.58  ? 136 SER B O   1 
ATOM   6579  C CB  . SER B 1 110 ? 46.892  73.379  21.640  1.00 43.09  ? 136 SER B CB  1 
ATOM   6580  O OG  . SER B 1 110 ? 48.283  73.427  21.908  1.00 50.66  ? 136 SER B OG  1 
ATOM   6581  N N   . GLY B 1 111 ? 43.925  74.010  23.022  1.00 32.75  ? 137 GLY B N   1 
ATOM   6582  C CA  . GLY B 1 111 ? 42.490  73.822  22.890  1.00 30.78  ? 137 GLY B CA  1 
ATOM   6583  C C   . GLY B 1 111 ? 42.018  72.405  23.187  1.00 29.55  ? 137 GLY B C   1 
ATOM   6584  O O   . GLY B 1 111 ? 42.825  71.508  23.416  1.00 29.33  ? 137 GLY B O   1 
ATOM   6585  N N   . LEU B 1 112 ? 40.706  72.208  23.195  1.00 28.30  ? 138 LEU B N   1 
ATOM   6586  C CA  . LEU B 1 112 ? 40.101  70.903  23.447  1.00 27.68  ? 138 LEU B CA  1 
ATOM   6587  C C   . LEU B 1 112 ? 39.471  70.403  22.149  1.00 26.01  ? 138 LEU B C   1 
ATOM   6588  O O   . LEU B 1 112 ? 38.998  71.204  21.352  1.00 25.36  ? 138 LEU B O   1 
ATOM   6589  C CB  . LEU B 1 112 ? 39.026  71.033  24.524  1.00 28.66  ? 138 LEU B CB  1 
ATOM   6590  C CG  . LEU B 1 112 ? 39.301  70.433  25.907  1.00 32.77  ? 138 LEU B CG  1 
ATOM   6591  C CD1 . LEU B 1 112 ? 40.781  70.388  26.196  1.00 33.83  ? 138 LEU B CD1 1 
ATOM   6592  C CD2 . LEU B 1 112 ? 38.575  71.242  26.951  1.00 34.32  ? 138 LEU B CD2 1 
ATOM   6593  N N   . LYS B 1 113 ? 39.474  69.087  21.934  1.00 24.15  ? 139 LYS B N   1 
ATOM   6594  C CA  . LYS B 1 113 ? 38.898  68.507  20.721  1.00 20.63  ? 139 LYS B CA  1 
ATOM   6595  C C   . LYS B 1 113 ? 37.822  67.466  21.076  1.00 21.10  ? 139 LYS B C   1 
ATOM   6596  O O   . LYS B 1 113 ? 38.119  66.439  21.689  1.00 20.25  ? 139 LYS B O   1 
ATOM   6597  C CB  . LYS B 1 113 ? 40.000  67.856  19.880  1.00 20.76  ? 139 LYS B CB  1 
ATOM   6598  C CG  . LYS B 1 113 ? 39.779  67.945  18.369  1.00 26.15  ? 139 LYS B CG  1 
ATOM   6599  C CD  . LYS B 1 113 ? 40.920  67.316  17.544  1.00 23.03  ? 139 LYS B CD  1 
ATOM   6600  C CE  . LYS B 1 113 ? 42.214  68.103  17.632  1.00 23.98  ? 139 LYS B CE  1 
ATOM   6601  N NZ  . LYS B 1 113 ? 43.410  67.216  17.394  1.00 25.29  ? 139 LYS B NZ  1 
ATOM   6602  N N   . TYR B 1 114 ? 36.572  67.744  20.709  1.00 17.53  ? 140 TYR B N   1 
ATOM   6603  C CA  . TYR B 1 114 ? 35.470  66.826  20.987  1.00 18.71  ? 140 TYR B CA  1 
ATOM   6604  C C   . TYR B 1 114 ? 35.186  65.986  19.751  1.00 19.28  ? 140 TYR B C   1 
ATOM   6605  O O   . TYR B 1 114 ? 34.606  66.479  18.782  1.00 20.22  ? 140 TYR B O   1 
ATOM   6606  C CB  . TYR B 1 114 ? 34.202  67.600  21.362  1.00 19.51  ? 140 TYR B CB  1 
ATOM   6607  C CG  . TYR B 1 114 ? 34.327  68.458  22.600  1.00 20.24  ? 140 TYR B CG  1 
ATOM   6608  C CD1 . TYR B 1 114 ? 33.419  69.480  22.845  1.00 24.58  ? 140 TYR B CD1 1 
ATOM   6609  C CD2 . TYR B 1 114 ? 35.355  68.256  23.521  1.00 20.39  ? 140 TYR B CD2 1 
ATOM   6610  C CE1 . TYR B 1 114 ? 33.526  70.289  23.973  1.00 24.31  ? 140 TYR B CE1 1 
ATOM   6611  C CE2 . TYR B 1 114 ? 35.475  69.059  24.654  1.00 24.07  ? 140 TYR B CE2 1 
ATOM   6612  C CZ  . TYR B 1 114 ? 34.557  70.075  24.870  1.00 24.84  ? 140 TYR B CZ  1 
ATOM   6613  O OH  . TYR B 1 114 ? 34.671  70.891  25.966  1.00 25.19  ? 140 TYR B OH  1 
ATOM   6614  N N   . LYS B 1 115 ? 35.576  64.714  19.806  1.00 19.89  ? 141 LYS B N   1 
ATOM   6615  C CA  . LYS B 1 115 ? 35.404  63.779  18.695  1.00 19.25  ? 141 LYS B CA  1 
ATOM   6616  C C   . LYS B 1 115 ? 34.114  62.953  18.747  1.00 18.78  ? 141 LYS B C   1 
ATOM   6617  O O   . LYS B 1 115 ? 33.572  62.709  19.823  1.00 19.94  ? 141 LYS B O   1 
ATOM   6618  C CB  . LYS B 1 115 ? 36.604  62.833  18.656  1.00 18.63  ? 141 LYS B CB  1 
ATOM   6619  C CG  . LYS B 1 115 ? 37.937  63.546  18.561  1.00 19.26  ? 141 LYS B CG  1 
ATOM   6620  C CD  . LYS B 1 115 ? 39.107  62.601  18.772  1.00 22.79  ? 141 LYS B CD  1 
ATOM   6621  C CE  . LYS B 1 115 ? 39.220  61.602  17.634  1.00 25.70  ? 141 LYS B CE  1 
ATOM   6622  N NZ  . LYS B 1 115 ? 39.191  62.293  16.312  1.00 28.05  ? 141 LYS B NZ  1 
ATOM   6623  N N   . LYS B 1 116 ? 33.647  62.521  17.573  1.00 18.97  ? 142 LYS B N   1 
ATOM   6624  C CA  . LYS B 1 116 ? 32.437  61.700  17.430  1.00 21.06  ? 142 LYS B CA  1 
ATOM   6625  C C   . LYS B 1 116 ? 32.720  60.214  17.709  1.00 21.44  ? 142 LYS B C   1 
ATOM   6626  O O   . LYS B 1 116 ? 33.677  59.641  17.191  1.00 19.09  ? 142 LYS B O   1 
ATOM   6627  C CB  . LYS B 1 116 ? 31.885  61.830  16.011  1.00 26.24  ? 142 LYS B CB  1 
ATOM   6628  C CG  . LYS B 1 116 ? 30.959  63.011  15.761  1.00 34.13  ? 142 LYS B CG  1 
ATOM   6629  C CD  . LYS B 1 116 ? 29.496  62.590  15.893  1.00 42.30  ? 142 LYS B CD  1 
ATOM   6630  C CE  . LYS B 1 116 ? 28.523  63.661  15.383  1.00 46.88  ? 142 LYS B CE  1 
ATOM   6631  N NZ  . LYS B 1 116 ? 28.511  64.915  16.204  1.00 50.78  ? 142 LYS B NZ  1 
ATOM   6632  N N   . GLY B 1 117 ? 31.886  59.588  18.526  1.00 22.17  ? 143 GLY B N   1 
ATOM   6633  C CA  . GLY B 1 117 ? 32.101  58.186  18.829  1.00 23.11  ? 143 GLY B CA  1 
ATOM   6634  C C   . GLY B 1 117 ? 32.636  57.934  20.226  1.00 23.35  ? 143 GLY B C   1 
ATOM   6635  O O   . GLY B 1 117 ? 32.692  58.835  21.063  1.00 23.33  ? 143 GLY B O   1 
ATOM   6636  N N   . GLY B 1 118 ? 33.034  56.691  20.462  1.00 23.10  ? 144 GLY B N   1 
ATOM   6637  C CA  . GLY B 1 118 ? 33.555  56.280  21.751  1.00 21.71  ? 144 GLY B CA  1 
ATOM   6638  C C   . GLY B 1 118 ? 33.774  54.782  21.712  1.00 23.16  ? 144 GLY B C   1 
ATOM   6639  O O   . GLY B 1 118 ? 33.700  54.167  20.643  1.00 26.20  ? 144 GLY B O   1 
ATOM   6640  N N   . VAL B 1 119 ? 34.039  54.183  22.864  1.00 21.58  ? 145 VAL B N   1 
ATOM   6641  C CA  . VAL B 1 119 ? 34.280  52.746  22.921  1.00 18.48  ? 145 VAL B CA  1 
ATOM   6642  C C   . VAL B 1 119 ? 33.140  51.920  22.339  1.00 19.85  ? 145 VAL B C   1 
ATOM   6643  O O   . VAL B 1 119 ? 33.382  50.967  21.607  1.00 19.25  ? 145 VAL B O   1 
ATOM   6644  C CB  . VAL B 1 119 ? 34.524  52.296  24.354  1.00 15.47  ? 145 VAL B CB  1 
ATOM   6645  C CG1 . VAL B 1 119 ? 34.776  50.792  24.386  1.00 16.06  ? 145 VAL B CG1 1 
ATOM   6646  C CG2 . VAL B 1 119 ? 35.711  53.057  24.926  1.00 14.72  ? 145 VAL B CG2 1 
ATOM   6647  N N   . ALA B 1 120 ? 31.903  52.287  22.665  1.00 20.77  ? 146 ALA B N   1 
ATOM   6648  C CA  . ALA B 1 120 ? 30.726  51.567  22.171  1.00 22.79  ? 146 ALA B CA  1 
ATOM   6649  C C   . ALA B 1 120 ? 30.636  51.540  20.646  1.00 24.87  ? 146 ALA B C   1 
ATOM   6650  O O   . ALA B 1 120 ? 30.091  50.602  20.076  1.00 26.21  ? 146 ALA B O   1 
ATOM   6651  C CB  . ALA B 1 120 ? 29.441  52.181  22.759  1.00 20.47  ? 146 ALA B CB  1 
ATOM   6652  N N   . SER B 1 121 ? 31.167  52.577  19.995  1.00 27.10  ? 147 SER B N   1 
ATOM   6653  C CA  . SER B 1 121 ? 31.152  52.687  18.539  1.00 22.58  ? 147 SER B CA  1 
ATOM   6654  C C   . SER B 1 121 ? 32.405  52.106  17.920  1.00 21.52  ? 147 SER B C   1 
ATOM   6655  O O   . SER B 1 121 ? 32.560  52.124  16.703  1.00 22.40  ? 147 SER B O   1 
ATOM   6656  C CB  . SER B 1 121 ? 31.052  54.150  18.118  1.00 25.82  ? 147 SER B CB  1 
ATOM   6657  O OG  . SER B 1 121 ? 29.844  54.734  18.555  1.00 31.88  ? 147 SER B OG  1 
ATOM   6658  N N   . GLY B 1 122 ? 33.320  51.628  18.754  1.00 20.97  ? 148 GLY B N   1 
ATOM   6659  C CA  . GLY B 1 122 ? 34.546  51.039  18.242  1.00 18.77  ? 148 GLY B CA  1 
ATOM   6660  C C   . GLY B 1 122 ? 35.687  51.977  17.892  1.00 20.95  ? 148 GLY B C   1 
ATOM   6661  O O   . GLY B 1 122 ? 36.654  51.552  17.272  1.00 23.86  ? 148 GLY B O   1 
ATOM   6662  N N   . PHE B 1 123 ? 35.608  53.243  18.283  1.00 23.43  ? 149 PHE B N   1 
ATOM   6663  C CA  . PHE B 1 123 ? 36.685  54.172  17.967  1.00 24.12  ? 149 PHE B CA  1 
ATOM   6664  C C   . PHE B 1 123 ? 37.844  54.123  18.954  1.00 24.04  ? 149 PHE B C   1 
ATOM   6665  O O   . PHE B 1 123 ? 37.691  53.674  20.090  1.00 20.64  ? 149 PHE B O   1 
ATOM   6666  C CB  . PHE B 1 123 ? 36.143  55.596  17.869  1.00 28.50  ? 149 PHE B CB  1 
ATOM   6667  C CG  . PHE B 1 123 ? 35.247  55.804  16.693  1.00 35.05  ? 149 PHE B CG  1 
ATOM   6668  C CD1 . PHE B 1 123 ? 33.862  55.765  16.836  1.00 38.17  ? 149 PHE B CD1 1 
ATOM   6669  C CD2 . PHE B 1 123 ? 35.789  55.962  15.421  1.00 38.09  ? 149 PHE B CD2 1 
ATOM   6670  C CE1 . PHE B 1 123 ? 33.023  55.875  15.725  1.00 39.55  ? 149 PHE B CE1 1 
ATOM   6671  C CE2 . PHE B 1 123 ? 34.965  56.071  14.305  1.00 42.39  ? 149 PHE B CE2 1 
ATOM   6672  C CZ  . PHE B 1 123 ? 33.575  56.026  14.459  1.00 42.28  ? 149 PHE B CZ  1 
ATOM   6673  N N   . LYS B 1 124 ? 39.006  54.585  18.497  1.00 25.82  ? 150 LYS B N   1 
ATOM   6674  C CA  . LYS B 1 124 ? 40.221  54.610  19.310  1.00 30.52  ? 150 LYS B CA  1 
ATOM   6675  C C   . LYS B 1 124 ? 41.052  55.860  19.048  1.00 30.62  ? 150 LYS B C   1 
ATOM   6676  O O   . LYS B 1 124 ? 40.854  56.562  18.055  1.00 28.49  ? 150 LYS B O   1 
ATOM   6677  C CB  . LYS B 1 124 ? 41.098  53.386  19.011  1.00 31.91  ? 150 LYS B CB  1 
ATOM   6678  C CG  . LYS B 1 124 ? 40.430  52.067  19.290  1.00 40.34  ? 150 LYS B CG  1 
ATOM   6679  C CD  . LYS B 1 124 ? 41.359  50.900  19.001  1.00 47.61  ? 150 LYS B CD  1 
ATOM   6680  C CE  . LYS B 1 124 ? 40.687  49.572  19.343  1.00 50.95  ? 150 LYS B CE  1 
ATOM   6681  N NZ  . LYS B 1 124 ? 41.595  48.412  19.119  1.00 55.99  ? 150 LYS B NZ  1 
ATOM   6682  N N   . HIS B 1 125 ? 41.984  56.129  19.954  1.00 33.34  ? 151 HIS B N   1 
ATOM   6683  C CA  . HIS B 1 125 ? 42.882  57.262  19.813  1.00 36.14  ? 151 HIS B CA  1 
ATOM   6684  C C   . HIS B 1 125 ? 44.042  56.740  18.984  1.00 39.97  ? 151 HIS B C   1 
ATOM   6685  O O   . HIS B 1 125 ? 44.351  57.273  17.925  1.00 38.69  ? 151 HIS B O   1 
ATOM   6686  C CB  . HIS B 1 125 ? 43.372  57.731  21.182  1.00 32.77  ? 151 HIS B CB  1 
ATOM   6687  C CG  . HIS B 1 125 ? 42.349  58.506  21.954  1.00 31.50  ? 151 HIS B CG  1 
ATOM   6688  N ND1 . HIS B 1 125 ? 42.012  59.806  21.643  1.00 28.00  ? 151 HIS B ND1 1 
ATOM   6689  C CD2 . HIS B 1 125 ? 41.573  58.158  23.009  1.00 27.02  ? 151 HIS B CD2 1 
ATOM   6690  C CE1 . HIS B 1 125 ? 41.075  60.224  22.473  1.00 27.33  ? 151 HIS B CE1 1 
ATOM   6691  N NE2 . HIS B 1 125 ? 40.790  59.243  23.310  1.00 27.26  ? 151 HIS B NE2 1 
ATOM   6692  N N   . VAL B 1 126 ? 44.663  55.671  19.468  1.00 49.36  ? 152 VAL B N   1 
ATOM   6693  C CA  . VAL B 1 126 ? 45.780  55.055  18.763  1.00 59.99  ? 152 VAL B CA  1 
ATOM   6694  C C   . VAL B 1 126 ? 45.350  54.728  17.336  1.00 64.55  ? 152 VAL B C   1 
ATOM   6695  O O   . VAL B 1 126 ? 44.648  53.743  17.089  1.00 62.93  ? 152 VAL B O   1 
ATOM   6696  C CB  . VAL B 1 126 ? 46.247  53.748  19.452  1.00 61.11  ? 152 VAL B CB  1 
ATOM   6697  C CG1 . VAL B 1 126 ? 47.517  53.236  18.785  1.00 61.38  ? 152 VAL B CG1 1 
ATOM   6698  C CG2 . VAL B 1 126 ? 46.488  53.996  20.937  1.00 63.99  ? 152 VAL B CG2 1 
ATOM   6699  N N   . VAL B 1 127 ? 45.777  55.578  16.408  1.00 72.16  ? 153 VAL B N   1 
ATOM   6700  C CA  . VAL B 1 127 ? 45.459  55.428  14.995  1.00 79.80  ? 153 VAL B CA  1 
ATOM   6701  C C   . VAL B 1 127 ? 46.726  55.314  14.142  1.00 84.94  ? 153 VAL B C   1 
ATOM   6702  O O   . VAL B 1 127 ? 47.608  56.178  14.200  1.00 85.77  ? 153 VAL B O   1 
ATOM   6703  C CB  . VAL B 1 127 ? 44.629  56.628  14.494  1.00 79.91  ? 153 VAL B CB  1 
ATOM   6704  C CG1 . VAL B 1 127 ? 44.376  56.498  13.002  1.00 80.34  ? 153 VAL B CG1 1 
ATOM   6705  C CG2 . VAL B 1 127 ? 43.314  56.700  15.257  1.00 79.37  ? 153 VAL B CG2 1 
ATOM   6706  N N   . PRO B 1 128 ? 46.826  54.244  13.332  1.00 89.65  ? 154 PRO B N   1 
ATOM   6707  C CA  . PRO B 1 128 ? 47.986  54.011  12.461  1.00 92.77  ? 154 PRO B CA  1 
ATOM   6708  C C   . PRO B 1 128 ? 48.428  55.250  11.661  1.00 94.71  ? 154 PRO B C   1 
ATOM   6709  O O   . PRO B 1 128 ? 47.731  56.267  11.634  1.00 95.30  ? 154 PRO B O   1 
ATOM   6710  C CB  . PRO B 1 128 ? 47.509  52.870  11.563  1.00 92.47  ? 154 PRO B CB  1 
ATOM   6711  C CG  . PRO B 1 128 ? 46.621  52.080  12.488  1.00 91.19  ? 154 PRO B CG  1 
ATOM   6712  C CD  . PRO B 1 128 ? 45.825  53.170  13.169  1.00 90.31  ? 154 PRO B CD  1 
ATOM   6713  N N   . ASN B 1 129 ? 49.591  55.165  11.020  1.00 96.01  ? 155 ASN B N   1 
ATOM   6714  C CA  . ASN B 1 129 ? 50.095  56.280  10.227  1.00 97.16  ? 155 ASN B CA  1 
ATOM   6715  C C   . ASN B 1 129 ? 49.237  56.480  8.986   1.00 96.97  ? 155 ASN B C   1 
ATOM   6716  O O   . ASN B 1 129 ? 48.470  57.439  8.897   1.00 97.04  ? 155 ASN B O   1 
ATOM   6717  C CB  . ASN B 1 129 ? 51.547  56.037  9.809   1.00 98.13  ? 155 ASN B CB  1 
ATOM   6718  C CG  . ASN B 1 129 ? 52.519  56.170  10.963  1.00 99.31  ? 155 ASN B CG  1 
ATOM   6719  O OD1 . ASN B 1 129 ? 53.734  56.166  10.766  1.00 100.41 ? 155 ASN B OD1 1 
ATOM   6720  N ND2 . ASN B 1 129 ? 51.990  56.287  12.177  1.00 99.39  ? 155 ASN B ND2 1 
ATOM   6721  N N   . GLU B 1 130 ? 49.371  55.568  8.029   1.00 96.00  ? 156 GLU B N   1 
ATOM   6722  C CA  . GLU B 1 130 ? 48.605  55.640  6.791   1.00 94.90  ? 156 GLU B CA  1 
ATOM   6723  C C   . GLU B 1 130 ? 47.112  55.477  7.080   1.00 92.27  ? 156 GLU B C   1 
ATOM   6724  O O   . GLU B 1 130 ? 46.603  54.358  7.179   1.00 92.51  ? 156 GLU B O   1 
ATOM   6725  C CB  . GLU B 1 130 ? 49.090  54.557  5.820   1.00 97.02  ? 156 GLU B CB  1 
ATOM   6726  C CG  . GLU B 1 130 ? 50.547  54.737  5.389   1.00 98.97  ? 156 GLU B CG  1 
ATOM   6727  C CD  . GLU B 1 130 ? 51.065  53.597  4.528   1.00 100.40 ? 156 GLU B CD  1 
ATOM   6728  O OE1 . GLU B 1 130 ? 50.434  53.293  3.488   1.00 100.41 ? 156 GLU B OE1 1 
ATOM   6729  O OE2 . GLU B 1 130 ? 52.111  53.010  4.889   1.00 100.23 ? 156 GLU B OE2 1 
ATOM   6730  N N   . VAL B 1 131 ? 46.421  56.607  7.220   1.00 88.39  ? 157 VAL B N   1 
ATOM   6731  C CA  . VAL B 1 131 ? 44.989  56.624  7.509   1.00 83.16  ? 157 VAL B CA  1 
ATOM   6732  C C   . VAL B 1 131 ? 44.248  57.549  6.544   1.00 79.03  ? 157 VAL B C   1 
ATOM   6733  O O   . VAL B 1 131 ? 44.813  58.520  6.039   1.00 79.19  ? 157 VAL B O   1 
ATOM   6734  C CB  . VAL B 1 131 ? 44.722  57.107  8.958   1.00 83.11  ? 157 VAL B CB  1 
ATOM   6735  C CG1 . VAL B 1 131 ? 43.231  57.115  9.250   1.00 83.20  ? 157 VAL B CG1 1 
ATOM   6736  C CG2 . VAL B 1 131 ? 45.436  56.207  9.936   1.00 84.37  ? 157 VAL B CG2 1 
ATOM   6737  N N   . VAL B 1 132 ? 42.981  57.237  6.294   1.00 73.09  ? 158 VAL B N   1 
ATOM   6738  C CA  . VAL B 1 132 ? 42.149  58.036  5.405   1.00 66.40  ? 158 VAL B CA  1 
ATOM   6739  C C   . VAL B 1 132 ? 41.164  58.837  6.249   1.00 62.04  ? 158 VAL B C   1 
ATOM   6740  O O   . VAL B 1 132 ? 40.240  58.267  6.828   1.00 62.45  ? 158 VAL B O   1 
ATOM   6741  C CB  . VAL B 1 132 ? 41.351  57.142  4.453   1.00 65.58  ? 158 VAL B CB  1 
ATOM   6742  C CG1 . VAL B 1 132 ? 40.571  57.999  3.478   1.00 64.37  ? 158 VAL B CG1 1 
ATOM   6743  C CG2 . VAL B 1 132 ? 42.290  56.204  3.727   1.00 65.51  ? 158 VAL B CG2 1 
ATOM   6744  N N   . VAL B 1 133 ? 41.353  60.152  6.319   1.00 55.77  ? 159 VAL B N   1 
ATOM   6745  C CA  . VAL B 1 133 ? 40.462  60.981  7.119   1.00 49.68  ? 159 VAL B CA  1 
ATOM   6746  C C   . VAL B 1 133 ? 39.601  61.931  6.292   1.00 45.08  ? 159 VAL B C   1 
ATOM   6747  O O   . VAL B 1 133 ? 39.975  62.363  5.202   1.00 45.33  ? 159 VAL B O   1 
ATOM   6748  C CB  . VAL B 1 133 ? 41.246  61.806  8.197   1.00 50.32  ? 159 VAL B CB  1 
ATOM   6749  C CG1 . VAL B 1 133 ? 42.515  61.068  8.602   1.00 49.37  ? 159 VAL B CG1 1 
ATOM   6750  C CG2 . VAL B 1 133 ? 41.562  63.197  7.690   1.00 51.82  ? 159 VAL B CG2 1 
ATOM   6751  N N   . GLN B 1 134 ? 38.434  62.243  6.839   1.00 40.26  ? 160 GLN B N   1 
ATOM   6752  C CA  . GLN B 1 134 ? 37.476  63.137  6.219   1.00 35.20  ? 160 GLN B CA  1 
ATOM   6753  C C   . GLN B 1 134 ? 36.579  63.636  7.354   1.00 31.37  ? 160 GLN B C   1 
ATOM   6754  O O   . GLN B 1 134 ? 35.590  62.989  7.699   1.00 31.97  ? 160 GLN B O   1 
ATOM   6755  C CB  . GLN B 1 134 ? 36.634  62.375  5.189   1.00 37.06  ? 160 GLN B CB  1 
ATOM   6756  C CG  . GLN B 1 134 ? 35.721  63.263  4.354   1.00 40.84  ? 160 GLN B CG  1 
ATOM   6757  C CD  . GLN B 1 134 ? 34.639  62.488  3.631   1.00 42.04  ? 160 GLN B CD  1 
ATOM   6758  O OE1 . GLN B 1 134 ? 34.918  61.530  2.908   1.00 47.82  ? 160 GLN B OE1 1 
ATOM   6759  N NE2 . GLN B 1 134 ? 33.392  62.906  3.817   1.00 41.88  ? 160 GLN B NE2 1 
ATOM   6760  N N   . ARG B 1 135 ? 36.927  64.768  7.954   1.00 25.68  ? 161 ARG B N   1 
ATOM   6761  C CA  . ARG B 1 135 ? 36.115  65.292  9.046   1.00 23.79  ? 161 ARG B CA  1 
ATOM   6762  C C   . ARG B 1 135 ? 36.008  66.806  9.017   1.00 21.19  ? 161 ARG B C   1 
ATOM   6763  O O   . ARG B 1 135 ? 36.758  67.476  8.318   1.00 19.95  ? 161 ARG B O   1 
ATOM   6764  C CB  . ARG B 1 135 ? 36.680  64.837  10.394  1.00 20.92  ? 161 ARG B CB  1 
ATOM   6765  C CG  . ARG B 1 135 ? 38.120  65.217  10.609  1.00 19.49  ? 161 ARG B CG  1 
ATOM   6766  C CD  . ARG B 1 135 ? 38.584  64.882  12.004  1.00 18.70  ? 161 ARG B CD  1 
ATOM   6767  N NE  . ARG B 1 135 ? 39.962  65.315  12.193  1.00 18.41  ? 161 ARG B NE  1 
ATOM   6768  C CZ  . ARG B 1 135 ? 40.577  65.365  13.370  1.00 17.12  ? 161 ARG B CZ  1 
ATOM   6769  N NH1 . ARG B 1 135 ? 39.925  65.008  14.471  1.00 19.13  ? 161 ARG B NH1 1 
ATOM   6770  N NH2 . ARG B 1 135 ? 41.840  65.764  13.445  1.00 14.35  ? 161 ARG B NH2 1 
ATOM   6771  N N   . LEU B 1 136 ? 35.061  67.343  9.772   1.00 19.65  ? 162 LEU B N   1 
ATOM   6772  C CA  . LEU B 1 136 ? 34.860  68.785  9.825   1.00 19.73  ? 162 LEU B CA  1 
ATOM   6773  C C   . LEU B 1 136 ? 34.899  69.152  11.294  1.00 20.11  ? 162 LEU B C   1 
ATOM   6774  O O   . LEU B 1 136 ? 34.289  68.479  12.121  1.00 20.98  ? 162 LEU B O   1 
ATOM   6775  C CB  . LEU B 1 136 ? 33.489  69.174  9.243   1.00 18.08  ? 162 LEU B CB  1 
ATOM   6776  C CG  . LEU B 1 136 ? 33.298  70.375  8.293   1.00 14.41  ? 162 LEU B CG  1 
ATOM   6777  C CD1 . LEU B 1 136 ? 31.987  71.054  8.637   1.00 6.20   ? 162 LEU B CD1 1 
ATOM   6778  C CD2 . LEU B 1 136 ? 34.459  71.365  8.358   1.00 7.77   ? 162 LEU B CD2 1 
ATOM   6779  N N   . LEU B 1 137 ? 35.617  70.218  11.620  1.00 20.16  ? 163 LEU B N   1 
ATOM   6780  C CA  . LEU B 1 137 ? 35.726  70.659  13.003  1.00 20.22  ? 163 LEU B CA  1 
ATOM   6781  C C   . LEU B 1 137 ? 35.244  72.088  13.097  1.00 21.01  ? 163 LEU B C   1 
ATOM   6782  O O   . LEU B 1 137 ? 35.656  72.941  12.313  1.00 20.22  ? 163 LEU B O   1 
ATOM   6783  C CB  . LEU B 1 137 ? 37.180  70.573  13.490  1.00 18.68  ? 163 LEU B CB  1 
ATOM   6784  C CG  . LEU B 1 137 ? 37.784  69.171  13.648  1.00 22.10  ? 163 LEU B CG  1 
ATOM   6785  C CD1 . LEU B 1 137 ? 39.296  69.256  13.666  1.00 20.22  ? 163 LEU B CD1 1 
ATOM   6786  C CD2 . LEU B 1 137 ? 37.266  68.523  14.924  1.00 20.92  ? 163 LEU B CD2 1 
ATOM   6787  N N   . GLN B 1 138 ? 34.349  72.332  14.047  1.00 23.24  ? 164 GLN B N   1 
ATOM   6788  C CA  . GLN B 1 138 ? 33.823  73.663  14.279  1.00 23.58  ? 164 GLN B CA  1 
ATOM   6789  C C   . GLN B 1 138 ? 34.572  74.194  15.483  1.00 24.27  ? 164 GLN B C   1 
ATOM   6790  O O   . GLN B 1 138 ? 34.615  73.550  16.531  1.00 21.13  ? 164 GLN B O   1 
ATOM   6791  C CB  . GLN B 1 138 ? 32.327  73.624  14.582  1.00 23.33  ? 164 GLN B CB  1 
ATOM   6792  C CG  . GLN B 1 138 ? 31.741  75.008  14.858  1.00 27.30  ? 164 GLN B CG  1 
ATOM   6793  C CD  . GLN B 1 138 ? 30.230  75.000  15.023  1.00 30.13  ? 164 GLN B CD  1 
ATOM   6794  O OE1 . GLN B 1 138 ? 29.594  76.051  15.010  1.00 31.18  ? 164 GLN B OE1 1 
ATOM   6795  N NE2 . GLN B 1 138 ? 29.651  73.817  15.188  1.00 31.73  ? 164 GLN B NE2 1 
ATOM   6796  N N   . VAL B 1 139 ? 35.204  75.349  15.324  1.00 26.55  ? 165 VAL B N   1 
ATOM   6797  C CA  . VAL B 1 139 ? 35.926  75.935  16.435  1.00 30.01  ? 165 VAL B CA  1 
ATOM   6798  C C   . VAL B 1 139 ? 35.208  77.184  16.941  1.00 30.67  ? 165 VAL B C   1 
ATOM   6799  O O   . VAL B 1 139 ? 34.835  78.077  16.172  1.00 27.98  ? 165 VAL B O   1 
ATOM   6800  C CB  . VAL B 1 139 ? 37.401  76.251  16.053  1.00 30.21  ? 165 VAL B CB  1 
ATOM   6801  C CG1 . VAL B 1 139 ? 37.460  76.933  14.721  1.00 38.76  ? 165 VAL B CG1 1 
ATOM   6802  C CG2 . VAL B 1 139 ? 38.043  77.125  17.112  1.00 29.03  ? 165 VAL B CG2 1 
ATOM   6803  N N   . LYS B 1 140 ? 34.970  77.196  18.247  1.00 32.95  ? 166 LYS B N   1 
ATOM   6804  C CA  . LYS B 1 140 ? 34.326  78.306  18.924  1.00 36.28  ? 166 LYS B CA  1 
ATOM   6805  C C   . LYS B 1 140 ? 35.188  78.606  20.141  1.00 36.67  ? 166 LYS B C   1 
ATOM   6806  O O   . LYS B 1 140 ? 35.943  77.750  20.601  1.00 35.57  ? 166 LYS B O   1 
ATOM   6807  C CB  . LYS B 1 140 ? 32.906  77.923  19.356  1.00 37.52  ? 166 LYS B CB  1 
ATOM   6808  C CG  . LYS B 1 140 ? 31.995  77.573  18.188  1.00 44.72  ? 166 LYS B CG  1 
ATOM   6809  C CD  . LYS B 1 140 ? 30.598  77.164  18.640  1.00 49.12  ? 166 LYS B CD  1 
ATOM   6810  C CE  . LYS B 1 140 ? 29.738  78.364  19.023  1.00 52.38  ? 166 LYS B CE  1 
ATOM   6811  N NZ  . LYS B 1 140 ? 29.373  79.218  17.850  1.00 54.41  ? 166 LYS B NZ  1 
ATOM   6812  N N   . GLY B 1 141 ? 35.097  79.825  20.652  1.00 38.46  ? 167 GLY B N   1 
ATOM   6813  C CA  . GLY B 1 141 ? 35.884  80.166  21.817  1.00 36.79  ? 167 GLY B CA  1 
ATOM   6814  C C   . GLY B 1 141 ? 36.900  81.254  21.579  1.00 36.77  ? 167 GLY B C   1 
ATOM   6815  O O   . GLY B 1 141 ? 37.554  81.320  20.533  1.00 35.14  ? 167 GLY B O   1 
ATOM   6816  N N   . ARG B 1 142 ? 37.038  82.102  22.587  1.00 37.87  ? 168 ARG B N   1 
ATOM   6817  C CA  . ARG B 1 142 ? 37.956  83.223  22.544  1.00 39.72  ? 168 ARG B CA  1 
ATOM   6818  C C   . ARG B 1 142 ? 39.038  83.005  23.598  1.00 40.19  ? 168 ARG B C   1 
ATOM   6819  O O   . ARG B 1 142 ? 40.223  83.143  23.313  1.00 40.96  ? 168 ARG B O   1 
ATOM   6820  C CB  . ARG B 1 142 ? 37.176  84.506  22.823  1.00 39.28  ? 168 ARG B CB  1 
ATOM   6821  C CG  . ARG B 1 142 ? 37.766  85.753  22.239  1.00 39.83  ? 168 ARG B CG  1 
ATOM   6822  C CD  . ARG B 1 142 ? 36.848  86.930  22.503  1.00 41.12  ? 168 ARG B CD  1 
ATOM   6823  N NE  . ARG B 1 142 ? 37.380  88.161  21.931  1.00 44.77  ? 168 ARG B NE  1 
ATOM   6824  C CZ  . ARG B 1 142 ? 37.471  88.396  20.626  1.00 45.80  ? 168 ARG B CZ  1 
ATOM   6825  N NH1 . ARG B 1 142 ? 37.060  87.484  19.757  1.00 46.59  ? 168 ARG B NH1 1 
ATOM   6826  N NH2 . ARG B 1 142 ? 37.972  89.540  20.190  1.00 47.83  ? 168 ARG B NH2 1 
ATOM   6827  N N   . ARG B 1 143 ? 38.627  82.659  24.816  1.00 41.17  ? 169 ARG B N   1 
ATOM   6828  C CA  . ARG B 1 143 ? 39.578  82.413  25.899  1.00 42.33  ? 169 ARG B CA  1 
ATOM   6829  C C   . ARG B 1 143 ? 39.982  80.939  25.850  1.00 43.01  ? 169 ARG B C   1 
ATOM   6830  O O   . ARG B 1 143 ? 41.166  80.593  25.771  1.00 42.26  ? 169 ARG B O   1 
ATOM   6831  C CB  . ARG B 1 143 ? 38.939  82.712  27.259  1.00 41.14  ? 169 ARG B CB  1 
ATOM   6832  C CG  . ARG B 1 143 ? 37.618  83.448  27.190  1.00 39.67  ? 169 ARG B CG  1 
ATOM   6833  C CD  . ARG B 1 143 ? 37.750  84.935  27.512  1.00 37.96  ? 169 ARG B CD  1 
ATOM   6834  N NE  . ARG B 1 143 ? 38.605  85.668  26.585  1.00 35.15  ? 169 ARG B NE  1 
ATOM   6835  C CZ  . ARG B 1 143 ? 38.247  86.784  25.951  1.00 36.41  ? 169 ARG B CZ  1 
ATOM   6836  N NH1 . ARG B 1 143 ? 37.040  87.311  26.126  1.00 31.26  ? 169 ARG B NH1 1 
ATOM   6837  N NH2 . ARG B 1 143 ? 39.112  87.394  25.153  1.00 37.25  ? 169 ARG B NH2 1 
ATOM   6838  N N   . VAL B 1 144 ? 38.970  80.080  25.899  1.00 42.57  ? 170 VAL B N   1 
ATOM   6839  C CA  . VAL B 1 144 ? 39.156  78.638  25.853  1.00 40.94  ? 170 VAL B CA  1 
ATOM   6840  C C   . VAL B 1 144 ? 38.606  78.135  24.522  1.00 37.34  ? 170 VAL B C   1 
ATOM   6841  O O   . VAL B 1 144 ? 37.413  78.268  24.258  1.00 34.86  ? 170 VAL B O   1 
ATOM   6842  C CB  . VAL B 1 144 ? 38.412  77.957  27.038  1.00 45.14  ? 170 VAL B CB  1 
ATOM   6843  C CG1 . VAL B 1 144 ? 37.010  78.537  27.175  1.00 44.21  ? 170 VAL B CG1 1 
ATOM   6844  C CG2 . VAL B 1 144 ? 38.345  76.444  26.827  1.00 45.04  ? 170 VAL B CG2 1 
ATOM   6845  N N   . VAL B 1 145 ? 39.474  77.565  23.686  1.00 33.53  ? 171 VAL B N   1 
ATOM   6846  C CA  . VAL B 1 145 ? 39.045  77.079  22.378  1.00 31.76  ? 171 VAL B CA  1 
ATOM   6847  C C   . VAL B 1 145 ? 38.611  75.614  22.304  1.00 28.81  ? 171 VAL B C   1 
ATOM   6848  O O   . VAL B 1 145 ? 39.363  74.704  22.651  1.00 25.48  ? 171 VAL B O   1 
ATOM   6849  C CB  . VAL B 1 145 ? 40.137  77.297  21.309  1.00 33.35  ? 171 VAL B CB  1 
ATOM   6850  C CG1 . VAL B 1 145 ? 39.654  76.776  19.967  1.00 32.76  ? 171 VAL B CG1 1 
ATOM   6851  C CG2 . VAL B 1 145 ? 40.473  78.771  21.194  1.00 36.46  ? 171 VAL B CG2 1 
ATOM   6852  N N   . ARG B 1 146 ? 37.393  75.410  21.817  1.00 25.59  ? 172 ARG B N   1 
ATOM   6853  C CA  . ARG B 1 146 ? 36.821  74.082  21.658  1.00 26.03  ? 172 ARG B CA  1 
ATOM   6854  C C   . ARG B 1 146 ? 36.498  73.829  20.182  1.00 25.72  ? 172 ARG B C   1 
ATOM   6855  O O   . ARG B 1 146 ? 35.757  74.583  19.557  1.00 26.42  ? 172 ARG B O   1 
ATOM   6856  C CB  . ARG B 1 146 ? 35.533  73.943  22.485  1.00 24.64  ? 172 ARG B CB  1 
ATOM   6857  C CG  . ARG B 1 146 ? 35.703  74.124  23.992  1.00 27.95  ? 172 ARG B CG  1 
ATOM   6858  C CD  . ARG B 1 146 ? 34.360  73.928  24.691  1.00 32.33  ? 172 ARG B CD  1 
ATOM   6859  N NE  . ARG B 1 146 ? 34.453  73.817  26.147  1.00 32.78  ? 172 ARG B NE  1 
ATOM   6860  C CZ  . ARG B 1 146 ? 34.579  74.843  26.979  1.00 31.96  ? 172 ARG B CZ  1 
ATOM   6861  N NH1 . ARG B 1 146 ? 34.634  76.081  26.510  1.00 34.19  ? 172 ARG B NH1 1 
ATOM   6862  N NH2 . ARG B 1 146 ? 34.633  74.629  28.285  1.00 30.87  ? 172 ARG B NH2 1 
ATOM   6863  N N   . ALA B 1 147 ? 37.082  72.776  19.625  1.00 23.37  ? 173 ALA B N   1 
ATOM   6864  C CA  . ALA B 1 147 ? 36.835  72.397  18.241  1.00 22.59  ? 173 ALA B CA  1 
ATOM   6865  C C   . ALA B 1 147 ? 35.997  71.117  18.336  1.00 21.89  ? 173 ALA B C   1 
ATOM   6866  O O   . ALA B 1 147 ? 36.427  70.115  18.927  1.00 20.64  ? 173 ALA B O   1 
ATOM   6867  C CB  . ALA B 1 147 ? 38.159  72.132  17.516  1.00 20.63  ? 173 ALA B CB  1 
ATOM   6868  N N   . THR B 1 148 ? 34.794  71.165  17.774  1.00 19.51  ? 174 THR B N   1 
ATOM   6869  C CA  . THR B 1 148 ? 33.885  70.033  17.815  1.00 15.72  ? 174 THR B CA  1 
ATOM   6870  C C   . THR B 1 148 ? 33.712  69.388  16.459  1.00 15.88  ? 174 THR B C   1 
ATOM   6871  O O   . THR B 1 148 ? 33.480  70.083  15.477  1.00 18.20  ? 174 THR B O   1 
ATOM   6872  C CB  . THR B 1 148 ? 32.492  70.481  18.300  1.00 17.35  ? 174 THR B CB  1 
ATOM   6873  O OG1 . THR B 1 148 ? 32.607  71.008  19.624  1.00 18.70  ? 174 THR B OG1 1 
ATOM   6874  C CG2 . THR B 1 148 ? 31.485  69.301  18.286  1.00 13.18  ? 174 THR B CG2 1 
ATOM   6875  N N   . GLU B 1 149 ? 33.821  68.065  16.397  1.00 16.30  ? 175 GLU B N   1 
ATOM   6876  C CA  . GLU B 1 149 ? 33.612  67.374  15.128  1.00 17.12  ? 175 GLU B CA  1 
ATOM   6877  C C   . GLU B 1 149 ? 32.126  67.463  14.789  1.00 16.39  ? 175 GLU B C   1 
ATOM   6878  O O   . GLU B 1 149 ? 31.267  67.135  15.607  1.00 18.49  ? 175 GLU B O   1 
ATOM   6879  C CB  . GLU B 1 149 ? 34.038  65.898  15.212  1.00 17.72  ? 175 GLU B CB  1 
ATOM   6880  C CG  . GLU B 1 149 ? 35.555  65.690  15.207  1.00 20.55  ? 175 GLU B CG  1 
ATOM   6881  C CD  . GLU B 1 149 ? 35.975  64.223  15.210  1.00 22.32  ? 175 GLU B CD  1 
ATOM   6882  O OE1 . GLU B 1 149 ? 37.194  63.966  15.113  1.00 25.07  ? 175 GLU B OE1 1 
ATOM   6883  O OE2 . GLU B 1 149 ? 35.103  63.329  15.312  1.00 22.62  ? 175 GLU B OE2 1 
ATOM   6884  N N   . VAL B 1 150 ? 31.826  67.911  13.578  1.00 15.28  ? 176 VAL B N   1 
ATOM   6885  C CA  . VAL B 1 150 ? 30.448  68.051  13.131  1.00 12.56  ? 176 VAL B CA  1 
ATOM   6886  C C   . VAL B 1 150 ? 30.290  67.339  11.787  1.00 15.35  ? 176 VAL B C   1 
ATOM   6887  O O   . VAL B 1 150 ? 31.281  66.933  11.167  1.00 16.16  ? 176 VAL B O   1 
ATOM   6888  C CB  . VAL B 1 150 ? 30.069  69.565  13.007  1.00 15.19  ? 176 VAL B CB  1 
ATOM   6889  C CG1 . VAL B 1 150 ? 29.960  70.193  14.409  1.00 8.15   ? 176 VAL B CG1 1 
ATOM   6890  C CG2 . VAL B 1 150 ? 31.132  70.329  12.178  1.00 4.40   ? 176 VAL B CG2 1 
ATOM   6891  N N   . PRO B 1 151 ? 29.049  67.153  11.321  1.00 15.95  ? 177 PRO B N   1 
ATOM   6892  C CA  . PRO B 1 151 ? 28.899  66.469  10.028  1.00 16.94  ? 177 PRO B CA  1 
ATOM   6893  C C   . PRO B 1 151 ? 29.640  67.230  8.932   1.00 17.28  ? 177 PRO B C   1 
ATOM   6894  O O   . PRO B 1 151 ? 29.854  68.438  9.051   1.00 20.69  ? 177 PRO B O   1 
ATOM   6895  C CB  . PRO B 1 151 ? 27.387  66.466  9.812   1.00 15.87  ? 177 PRO B CB  1 
ATOM   6896  C CG  . PRO B 1 151 ? 26.859  66.410  11.205  1.00 13.50  ? 177 PRO B CG  1 
ATOM   6897  C CD  . PRO B 1 151 ? 27.735  67.421  11.924  1.00 13.85  ? 177 PRO B CD  1 
ATOM   6898  N N   . VAL B 1 152 ? 30.048  66.528  7.882   1.00 17.69  ? 178 VAL B N   1 
ATOM   6899  C CA  . VAL B 1 152 ? 30.754  67.167  6.775   1.00 15.70  ? 178 VAL B CA  1 
ATOM   6900  C C   . VAL B 1 152 ? 29.694  67.636  5.795   1.00 18.82  ? 178 VAL B C   1 
ATOM   6901  O O   . VAL B 1 152 ? 29.364  66.928  4.842   1.00 23.12  ? 178 VAL B O   1 
ATOM   6902  C CB  . VAL B 1 152 ? 31.686  66.175  6.075   1.00 14.30  ? 178 VAL B CB  1 
ATOM   6903  C CG1 . VAL B 1 152 ? 32.339  66.825  4.880   1.00 15.56  ? 178 VAL B CG1 1 
ATOM   6904  C CG2 . VAL B 1 152 ? 32.734  65.683  7.047   1.00 12.62  ? 178 VAL B CG2 1 
ATOM   6905  N N   . SER B 1 153 ? 29.167  68.836  6.037   1.00 20.23  ? 179 SER B N   1 
ATOM   6906  C CA  . SER B 1 153 ? 28.099  69.409  5.227   1.00 20.34  ? 179 SER B CA  1 
ATOM   6907  C C   . SER B 1 153 ? 28.028  70.924  5.399   1.00 22.91  ? 179 SER B C   1 
ATOM   6908  O O   . SER B 1 153 ? 28.332  71.438  6.473   1.00 21.00  ? 179 SER B O   1 
ATOM   6909  C CB  . SER B 1 153 ? 26.765  68.792  5.663   1.00 20.85  ? 179 SER B CB  1 
ATOM   6910  O OG  . SER B 1 153 ? 25.657  69.544  5.200   1.00 18.97  ? 179 SER B OG  1 
ATOM   6911  N N   . TRP B 1 154 ? 27.612  71.635  4.350   1.00 22.84  ? 180 TRP B N   1 
ATOM   6912  C CA  . TRP B 1 154 ? 27.492  73.086  4.434   1.00 24.09  ? 180 TRP B CA  1 
ATOM   6913  C C   . TRP B 1 154 ? 26.487  73.433  5.517   1.00 23.90  ? 180 TRP B C   1 
ATOM   6914  O O   . TRP B 1 154 ? 26.524  74.520  6.078   1.00 23.28  ? 180 TRP B O   1 
ATOM   6915  C CB  . TRP B 1 154 ? 27.029  73.689  3.099   1.00 21.88  ? 180 TRP B CB  1 
ATOM   6916  C CG  . TRP B 1 154 ? 28.146  73.924  2.127   1.00 21.11  ? 180 TRP B CG  1 
ATOM   6917  C CD1 . TRP B 1 154 ? 28.307  73.337  0.906   1.00 22.68  ? 180 TRP B CD1 1 
ATOM   6918  C CD2 . TRP B 1 154 ? 29.286  74.768  2.317   1.00 22.46  ? 180 TRP B CD2 1 
ATOM   6919  N NE1 . TRP B 1 154 ? 29.480  73.756  0.322   1.00 22.81  ? 180 TRP B NE1 1 
ATOM   6920  C CE2 . TRP B 1 154 ? 30.103  74.636  1.166   1.00 22.44  ? 180 TRP B CE2 1 
ATOM   6921  C CE3 . TRP B 1 154 ? 29.702  75.624  3.349   1.00 22.86  ? 180 TRP B CE3 1 
ATOM   6922  C CZ2 . TRP B 1 154 ? 31.311  75.323  1.019   1.00 20.66  ? 180 TRP B CZ2 1 
ATOM   6923  C CZ3 . TRP B 1 154 ? 30.905  76.307  3.203   1.00 21.52  ? 180 TRP B CZ3 1 
ATOM   6924  C CH2 . TRP B 1 154 ? 31.697  76.151  2.046   1.00 21.89  ? 180 TRP B CH2 1 
ATOM   6925  N N   . GLU B 1 155 ? 25.592  72.494  5.803   1.00 26.77  ? 181 GLU B N   1 
ATOM   6926  C CA  . GLU B 1 155 ? 24.558  72.684  6.813   1.00 29.27  ? 181 GLU B CA  1 
ATOM   6927  C C   . GLU B 1 155 ? 25.156  72.947  8.185   1.00 30.26  ? 181 GLU B C   1 
ATOM   6928  O O   . GLU B 1 155 ? 24.466  73.426  9.084   1.00 32.76  ? 181 GLU B O   1 
ATOM   6929  C CB  . GLU B 1 155 ? 23.668  71.445  6.899   1.00 34.36  ? 181 GLU B CB  1 
ATOM   6930  C CG  . GLU B 1 155 ? 22.748  71.214  5.710   1.00 44.08  ? 181 GLU B CG  1 
ATOM   6931  C CD  . GLU B 1 155 ? 21.633  72.246  5.628   1.00 51.80  ? 181 GLU B CD  1 
ATOM   6932  O OE1 . GLU B 1 155 ? 21.900  73.385  5.184   1.00 55.51  ? 181 GLU B OE1 1 
ATOM   6933  O OE2 . GLU B 1 155 ? 20.489  71.920  6.019   1.00 54.97  ? 181 GLU B OE2 1 
ATOM   6934  N N   . SER B 1 156 ? 26.437  72.632  8.350   1.00 26.98  ? 182 SER B N   1 
ATOM   6935  C CA  . SER B 1 156 ? 27.104  72.822  9.628   1.00 24.13  ? 182 SER B CA  1 
ATOM   6936  C C   . SER B 1 156 ? 27.752  74.192  9.775   1.00 24.90  ? 182 SER B C   1 
ATOM   6937  O O   . SER B 1 156 ? 28.063  74.620  10.890  1.00 26.70  ? 182 SER B O   1 
ATOM   6938  C CB  . SER B 1 156 ? 28.158  71.735  9.818   1.00 26.11  ? 182 SER B CB  1 
ATOM   6939  O OG  . SER B 1 156 ? 27.567  70.449  9.746   1.00 26.92  ? 182 SER B OG  1 
ATOM   6940  N N   . PHE B 1 157 ? 27.940  74.885  8.656   1.00 23.10  ? 183 PHE B N   1 
ATOM   6941  C CA  . PHE B 1 157 ? 28.569  76.205  8.663   1.00 23.01  ? 183 PHE B CA  1 
ATOM   6942  C C   . PHE B 1 157 ? 27.678  77.387  9.032   1.00 23.79  ? 183 PHE B C   1 
ATOM   6943  O O   . PHE B 1 157 ? 26.456  77.278  9.120   1.00 25.82  ? 183 PHE B O   1 
ATOM   6944  C CB  . PHE B 1 157 ? 29.165  76.519  7.297   1.00 18.86  ? 183 PHE B CB  1 
ATOM   6945  C CG  . PHE B 1 157 ? 30.368  75.712  6.952   1.00 18.77  ? 183 PHE B CG  1 
ATOM   6946  C CD1 . PHE B 1 157 ? 31.608  76.331  6.800   1.00 17.34  ? 183 PHE B CD1 1 
ATOM   6947  C CD2 . PHE B 1 157 ? 30.258  74.349  6.705   1.00 13.91  ? 183 PHE B CD2 1 
ATOM   6948  C CE1 . PHE B 1 157 ? 32.729  75.602  6.397   1.00 18.61  ? 183 PHE B CE1 1 
ATOM   6949  C CE2 . PHE B 1 157 ? 31.368  73.610  6.302   1.00 17.95  ? 183 PHE B CE2 1 
ATOM   6950  C CZ  . PHE B 1 157 ? 32.608  74.236  6.146   1.00 18.66  ? 183 PHE B CZ  1 
ATOM   6951  N N   . ASN B 1 158 ? 28.338  78.520  9.244   1.00 22.69  ? 184 ASN B N   1 
ATOM   6952  C CA  . ASN B 1 158 ? 27.703  79.795  9.538   1.00 23.86  ? 184 ASN B CA  1 
ATOM   6953  C C   . ASN B 1 158 ? 28.778  80.798  9.155   1.00 24.78  ? 184 ASN B C   1 
ATOM   6954  O O   . ASN B 1 158 ? 29.934  80.412  8.972   1.00 24.20  ? 184 ASN B O   1 
ATOM   6955  C CB  . ASN B 1 158 ? 27.290  79.931  11.018  1.00 22.04  ? 184 ASN B CB  1 
ATOM   6956  C CG  . ASN B 1 158 ? 28.458  79.839  11.987  1.00 22.48  ? 184 ASN B CG  1 
ATOM   6957  O OD1 . ASN B 1 158 ? 29.448  80.568  11.878  1.00 24.12  ? 184 ASN B OD1 1 
ATOM   6958  N ND2 . ASN B 1 158 ? 28.329  78.953  12.963  1.00 21.11  ? 184 ASN B ND2 1 
ATOM   6959  N N   . ASN B 1 159 ? 28.417  82.064  9.000   1.00 25.93  ? 185 ASN B N   1 
ATOM   6960  C CA  . ASN B 1 159 ? 29.413  83.048  8.595   1.00 28.18  ? 185 ASN B CA  1 
ATOM   6961  C C   . ASN B 1 159 ? 30.180  83.701  9.731   1.00 28.74  ? 185 ASN B C   1 
ATOM   6962  O O   . ASN B 1 159 ? 30.893  84.681  9.501   1.00 29.95  ? 185 ASN B O   1 
ATOM   6963  C CB  . ASN B 1 159 ? 28.770  84.144  7.732   1.00 30.43  ? 185 ASN B CB  1 
ATOM   6964  C CG  . ASN B 1 159 ? 27.615  84.844  8.428   1.00 32.98  ? 185 ASN B CG  1 
ATOM   6965  O OD1 . ASN B 1 159 ? 27.668  85.122  9.630   1.00 35.24  ? 185 ASN B OD1 1 
ATOM   6966  N ND2 . ASN B 1 159 ? 26.566  85.146  7.670   1.00 30.85  ? 185 ASN B ND2 1 
ATOM   6967  N N   . GLY B 1 160 ? 30.057  83.159  10.944  1.00 28.06  ? 186 GLY B N   1 
ATOM   6968  C CA  . GLY B 1 160 ? 30.743  83.759  12.081  1.00 26.17  ? 186 GLY B CA  1 
ATOM   6969  C C   . GLY B 1 160 ? 31.933  83.018  12.659  1.00 25.93  ? 186 GLY B C   1 
ATOM   6970  O O   . GLY B 1 160 ? 32.898  83.627  13.101  1.00 25.25  ? 186 GLY B O   1 
ATOM   6971  N N   . ASP B 1 161 ? 31.874  81.696  12.646  1.00 27.98  ? 187 ASP B N   1 
ATOM   6972  C CA  . ASP B 1 161 ? 32.944  80.880  13.203  1.00 27.32  ? 187 ASP B CA  1 
ATOM   6973  C C   . ASP B 1 161 ? 33.944  80.426  12.134  1.00 27.70  ? 187 ASP B C   1 
ATOM   6974  O O   . ASP B 1 161 ? 33.830  80.807  10.966  1.00 27.01  ? 187 ASP B O   1 
ATOM   6975  C CB  . ASP B 1 161 ? 32.307  79.672  13.882  1.00 27.65  ? 187 ASP B CB  1 
ATOM   6976  C CG  . ASP B 1 161 ? 31.265  80.075  14.912  1.00 28.94  ? 187 ASP B CG  1 
ATOM   6977  O OD1 . ASP B 1 161 ? 30.435  79.228  15.309  1.00 30.02  ? 187 ASP B OD1 1 
ATOM   6978  O OD2 . ASP B 1 161 ? 31.283  81.248  15.335  1.00 32.00  ? 187 ASP B OD2 1 
ATOM   6979  N N   . CYS B 1 162 ? 34.949  79.656  12.547  1.00 24.55  ? 188 CYS B N   1 
ATOM   6980  C CA  . CYS B 1 162 ? 35.921  79.111  11.605  1.00 23.46  ? 188 CYS B CA  1 
ATOM   6981  C C   . CYS B 1 162 ? 35.710  77.599  11.662  1.00 22.44  ? 188 CYS B C   1 
ATOM   6982  O O   . CYS B 1 162 ? 35.292  77.057  12.691  1.00 16.46  ? 188 CYS B O   1 
ATOM   6983  C CB  . CYS B 1 162 ? 37.378  79.423  11.995  1.00 23.84  ? 188 CYS B CB  1 
ATOM   6984  S SG  . CYS B 1 162 ? 37.951  81.166  11.983  1.00 25.84  ? 188 CYS B SG  1 
ATOM   6985  N N   . PHE B 1 163 ? 35.974  76.926  10.549  1.00 20.55  ? 189 PHE B N   1 
ATOM   6986  C CA  . PHE B 1 163 ? 35.823  75.487  10.486  1.00 21.77  ? 189 PHE B CA  1 
ATOM   6987  C C   . PHE B 1 163 ? 37.050  74.885  9.842   1.00 22.89  ? 189 PHE B C   1 
ATOM   6988  O O   . PHE B 1 163 ? 37.664  75.491  8.971   1.00 25.77  ? 189 PHE B O   1 
ATOM   6989  C CB  . PHE B 1 163 ? 34.585  75.107  9.669   1.00 21.39  ? 189 PHE B CB  1 
ATOM   6990  C CG  . PHE B 1 163 ? 33.289  75.608  10.249  1.00 17.51  ? 189 PHE B CG  1 
ATOM   6991  C CD1 . PHE B 1 163 ? 32.978  76.966  10.223  1.00 13.86  ? 189 PHE B CD1 1 
ATOM   6992  C CD2 . PHE B 1 163 ? 32.370  74.718  10.798  1.00 13.87  ? 189 PHE B CD2 1 
ATOM   6993  C CE1 . PHE B 1 163 ? 31.763  77.430  10.739  1.00 16.33  ? 189 PHE B CE1 1 
ATOM   6994  C CE2 . PHE B 1 163 ? 31.149  75.172  11.318  1.00 13.75  ? 189 PHE B CE2 1 
ATOM   6995  C CZ  . PHE B 1 163 ? 30.847  76.532  11.286  1.00 13.55  ? 189 PHE B CZ  1 
ATOM   6996  N N   . ILE B 1 164 ? 37.417  73.686  10.267  1.00 23.09  ? 190 ILE B N   1 
ATOM   6997  C CA  . ILE B 1 164 ? 38.573  73.039  9.681   1.00 21.98  ? 190 ILE B CA  1 
ATOM   6998  C C   . ILE B 1 164 ? 38.154  71.757  8.969   1.00 22.54  ? 190 ILE B C   1 
ATOM   6999  O O   . ILE B 1 164 ? 37.595  70.840  9.590   1.00 23.21  ? 190 ILE B O   1 
ATOM   7000  C CB  . ILE B 1 164 ? 39.627  72.696  10.752  1.00 23.00  ? 190 ILE B CB  1 
ATOM   7001  C CG1 . ILE B 1 164 ? 40.039  73.960  11.511  1.00 23.09  ? 190 ILE B CG1 1 
ATOM   7002  C CG2 . ILE B 1 164 ? 40.841  72.078  10.096  1.00 19.50  ? 190 ILE B CG2 1 
ATOM   7003  C CD1 . ILE B 1 164 ? 40.911  73.682  12.719  1.00 26.14  ? 190 ILE B CD1 1 
ATOM   7004  N N   . LEU B 1 165 ? 38.401  71.713  7.661   1.00 21.26  ? 191 LEU B N   1 
ATOM   7005  C CA  . LEU B 1 165 ? 38.103  70.537  6.855   1.00 19.23  ? 191 LEU B CA  1 
ATOM   7006  C C   . LEU B 1 165 ? 39.381  69.703  6.849   1.00 19.84  ? 191 LEU B C   1 
ATOM   7007  O O   . LEU B 1 165 ? 40.342  70.035  6.155   1.00 20.28  ? 191 LEU B O   1 
ATOM   7008  C CB  . LEU B 1 165 ? 37.729  70.927  5.428   1.00 17.31  ? 191 LEU B CB  1 
ATOM   7009  C CG  . LEU B 1 165 ? 37.245  69.771  4.543   1.00 19.49  ? 191 LEU B CG  1 
ATOM   7010  C CD1 . LEU B 1 165 ? 36.114  69.021  5.231   1.00 18.38  ? 191 LEU B CD1 1 
ATOM   7011  C CD2 . LEU B 1 165 ? 36.764  70.318  3.202   1.00 18.56  ? 191 LEU B CD2 1 
ATOM   7012  N N   . ASP B 1 166 ? 39.381  68.636  7.646   1.00 19.73  ? 192 ASP B N   1 
ATOM   7013  C CA  . ASP B 1 166 ? 40.523  67.740  7.790   1.00 20.70  ? 192 ASP B CA  1 
ATOM   7014  C C   . ASP B 1 166 ? 40.464  66.614  6.764   1.00 22.28  ? 192 ASP B C   1 
ATOM   7015  O O   . ASP B 1 166 ? 39.707  65.657  6.903   1.00 21.14  ? 192 ASP B O   1 
ATOM   7016  C CB  . ASP B 1 166 ? 40.540  67.156  9.211   1.00 21.47  ? 192 ASP B CB  1 
ATOM   7017  C CG  . ASP B 1 166 ? 41.846  66.452  9.543   1.00 24.95  ? 192 ASP B CG  1 
ATOM   7018  O OD1 . ASP B 1 166 ? 42.784  66.491  8.712   1.00 26.10  ? 192 ASP B OD1 1 
ATOM   7019  O OD2 . ASP B 1 166 ? 41.941  65.870  10.642  1.00 23.48  ? 192 ASP B OD2 1 
ATOM   7020  N N   . LEU B 1 167 ? 41.278  66.727  5.730   1.00 24.71  ? 193 LEU B N   1 
ATOM   7021  C CA  . LEU B 1 167 ? 41.285  65.723  4.683   1.00 27.68  ? 193 LEU B CA  1 
ATOM   7022  C C   . LEU B 1 167 ? 42.544  64.869  4.679   1.00 29.88  ? 193 LEU B C   1 
ATOM   7023  O O   . LEU B 1 167 ? 42.861  64.259  3.675   1.00 32.03  ? 193 LEU B O   1 
ATOM   7024  C CB  . LEU B 1 167 ? 41.102  66.397  3.317   1.00 23.01  ? 193 LEU B CB  1 
ATOM   7025  C CG  . LEU B 1 167 ? 39.726  66.374  2.628   1.00 23.87  ? 193 LEU B CG  1 
ATOM   7026  C CD1 . LEU B 1 167 ? 38.608  66.111  3.613   1.00 19.69  ? 193 LEU B CD1 1 
ATOM   7027  C CD2 . LEU B 1 167 ? 39.517  67.690  1.895   1.00 21.99  ? 193 LEU B CD2 1 
ATOM   7028  N N   . GLY B 1 168 ? 43.260  64.824  5.796   1.00 32.86  ? 194 GLY B N   1 
ATOM   7029  C CA  . GLY B 1 168 ? 44.464  64.010  5.853   1.00 34.24  ? 194 GLY B CA  1 
ATOM   7030  C C   . GLY B 1 168 ? 45.769  64.749  5.619   1.00 36.10  ? 194 GLY B C   1 
ATOM   7031  O O   . GLY B 1 168 ? 46.279  65.409  6.524   1.00 36.92  ? 194 GLY B O   1 
ATOM   7032  N N   . ASN B 1 169 ? 46.311  64.624  4.410   1.00 38.02  ? 195 ASN B N   1 
ATOM   7033  C CA  . ASN B 1 169 ? 47.563  65.277  4.033   1.00 39.87  ? 195 ASN B CA  1 
ATOM   7034  C C   . ASN B 1 169 ? 47.366  66.772  3.879   1.00 38.62  ? 195 ASN B C   1 
ATOM   7035  O O   . ASN B 1 169 ? 48.323  67.544  3.930   1.00 38.27  ? 195 ASN B O   1 
ATOM   7036  C CB  . ASN B 1 169 ? 48.086  64.696  2.717   1.00 45.34  ? 195 ASN B CB  1 
ATOM   7037  C CG  . ASN B 1 169 ? 48.688  63.313  2.891   1.00 53.22  ? 195 ASN B CG  1 
ATOM   7038  O OD1 . ASN B 1 169 ? 48.867  62.570  1.921   1.00 55.81  ? 195 ASN B OD1 1 
ATOM   7039  N ND2 . ASN B 1 169 ? 49.020  62.963  4.137   1.00 56.40  ? 195 ASN B ND2 1 
ATOM   7040  N N   . ASN B 1 170 ? 46.117  67.173  3.675   1.00 36.64  ? 196 ASN B N   1 
ATOM   7041  C CA  . ASN B 1 170 ? 45.784  68.582  3.524   1.00 35.19  ? 196 ASN B CA  1 
ATOM   7042  C C   . ASN B 1 170 ? 44.711  68.979  4.531   1.00 32.94  ? 196 ASN B C   1 
ATOM   7043  O O   . ASN B 1 170 ? 43.717  68.278  4.711   1.00 32.39  ? 196 ASN B O   1 
ATOM   7044  C CB  . ASN B 1 170 ? 45.319  68.867  2.089   1.00 36.94  ? 196 ASN B CB  1 
ATOM   7045  C CG  . ASN B 1 170 ? 46.477  68.865  1.088   1.00 39.69  ? 196 ASN B CG  1 
ATOM   7046  O OD1 . ASN B 1 170 ? 47.245  69.820  1.014   1.00 41.47  ? 196 ASN B OD1 1 
ATOM   7047  N ND2 . ASN B 1 170 ? 46.612  67.781  0.329   1.00 41.61  ? 196 ASN B ND2 1 
ATOM   7048  N N   . ILE B 1 171 ? 44.948  70.095  5.213   1.00 30.72  ? 197 ILE B N   1 
ATOM   7049  C CA  . ILE B 1 171 ? 44.022  70.615  6.206   1.00 28.49  ? 197 ILE B CA  1 
ATOM   7050  C C   . ILE B 1 171 ? 43.597  71.995  5.715   1.00 29.81  ? 197 ILE B C   1 
ATOM   7051  O O   . ILE B 1 171 ? 44.440  72.867  5.495   1.00 31.45  ? 197 ILE B O   1 
ATOM   7052  C CB  . ILE B 1 171 ? 44.711  70.721  7.585   1.00 27.56  ? 197 ILE B CB  1 
ATOM   7053  C CG1 . ILE B 1 171 ? 45.238  69.343  8.004   1.00 23.19  ? 197 ILE B CG1 1 
ATOM   7054  C CG2 . ILE B 1 171 ? 43.732  71.226  8.625   1.00 26.19  ? 197 ILE B CG2 1 
ATOM   7055  C CD1 . ILE B 1 171 ? 46.208  69.376  9.181   1.00 20.75  ? 197 ILE B CD1 1 
ATOM   7056  N N   . TYR B 1 172 ? 42.290  72.180  5.533   1.00 28.79  ? 198 TYR B N   1 
ATOM   7057  C CA  . TYR B 1 172 ? 41.733  73.439  5.042   1.00 26.92  ? 198 TYR B CA  1 
ATOM   7058  C C   . TYR B 1 172 ? 41.013  74.215  6.139   1.00 25.23  ? 198 TYR B C   1 
ATOM   7059  O O   . TYR B 1 172 ? 40.010  73.758  6.672   1.00 24.43  ? 198 TYR B O   1 
ATOM   7060  C CB  . TYR B 1 172 ? 40.765  73.150  3.892   1.00 29.57  ? 198 TYR B CB  1 
ATOM   7061  C CG  . TYR B 1 172 ? 41.426  72.495  2.707   1.00 30.57  ? 198 TYR B CG  1 
ATOM   7062  C CD1 . TYR B 1 172 ? 42.058  73.260  1.725   1.00 33.64  ? 198 TYR B CD1 1 
ATOM   7063  C CD2 . TYR B 1 172 ? 41.485  71.109  2.600   1.00 31.46  ? 198 TYR B CD2 1 
ATOM   7064  C CE1 . TYR B 1 172 ? 42.734  72.660  0.668   1.00 33.70  ? 198 TYR B CE1 1 
ATOM   7065  C CE2 . TYR B 1 172 ? 42.161  70.496  1.548   1.00 32.63  ? 198 TYR B CE2 1 
ATOM   7066  C CZ  . TYR B 1 172 ? 42.789  71.275  0.587   1.00 33.75  ? 198 TYR B CZ  1 
ATOM   7067  O OH  . TYR B 1 172 ? 43.512  70.671  -0.423  1.00 32.90  ? 198 TYR B OH  1 
ATOM   7068  N N   . GLN B 1 173 ? 41.524  75.395  6.470   1.00 24.77  ? 199 GLN B N   1 
ATOM   7069  C CA  . GLN B 1 173 ? 40.913  76.213  7.513   1.00 24.03  ? 199 GLN B CA  1 
ATOM   7070  C C   . GLN B 1 173 ? 40.084  77.343  6.931   1.00 23.03  ? 199 GLN B C   1 
ATOM   7071  O O   . GLN B 1 173 ? 40.616  78.305  6.390   1.00 24.37  ? 199 GLN B O   1 
ATOM   7072  C CB  . GLN B 1 173 ? 41.977  76.803  8.439   1.00 23.40  ? 199 GLN B CB  1 
ATOM   7073  C CG  . GLN B 1 173 ? 41.377  77.636  9.557   1.00 24.61  ? 199 GLN B CG  1 
ATOM   7074  C CD  . GLN B 1 173 ? 42.419  78.228  10.471  1.00 25.93  ? 199 GLN B CD  1 
ATOM   7075  O OE1 . GLN B 1 173 ? 43.336  77.538  10.910  1.00 26.53  ? 199 GLN B OE1 1 
ATOM   7076  N NE2 . GLN B 1 173 ? 42.280  79.515  10.777  1.00 26.57  ? 199 GLN B NE2 1 
ATOM   7077  N N   . TRP B 1 174 ? 38.775  77.233  7.087   1.00 21.93  ? 200 TRP B N   1 
ATOM   7078  C CA  . TRP B 1 174 ? 37.847  78.219  6.571   1.00 22.76  ? 200 TRP B CA  1 
ATOM   7079  C C   . TRP B 1 174 ? 37.268  79.084  7.688   1.00 25.25  ? 200 TRP B C   1 
ATOM   7080  O O   . TRP B 1 174 ? 36.811  78.566  8.701   1.00 24.30  ? 200 TRP B O   1 
ATOM   7081  C CB  . TRP B 1 174 ? 36.725  77.485  5.857   1.00 20.61  ? 200 TRP B CB  1 
ATOM   7082  C CG  . TRP B 1 174 ? 35.725  78.343  5.164   1.00 25.27  ? 200 TRP B CG  1 
ATOM   7083  C CD1 . TRP B 1 174 ? 35.669  78.617  3.824   1.00 21.10  ? 200 TRP B CD1 1 
ATOM   7084  C CD2 . TRP B 1 174 ? 34.543  78.912  5.740   1.00 24.83  ? 200 TRP B CD2 1 
ATOM   7085  N NE1 . TRP B 1 174 ? 34.511  79.300  3.531   1.00 24.21  ? 200 TRP B NE1 1 
ATOM   7086  C CE2 . TRP B 1 174 ? 33.802  79.495  4.685   1.00 24.87  ? 200 TRP B CE2 1 
ATOM   7087  C CE3 . TRP B 1 174 ? 34.031  78.977  7.041   1.00 23.02  ? 200 TRP B CE3 1 
ATOM   7088  C CZ2 . TRP B 1 174 ? 32.576  80.134  4.893   1.00 26.58  ? 200 TRP B CZ2 1 
ATOM   7089  C CZ3 . TRP B 1 174 ? 32.806  79.614  7.249   1.00 22.65  ? 200 TRP B CZ3 1 
ATOM   7090  C CH2 . TRP B 1 174 ? 32.093  80.183  6.178   1.00 24.72  ? 200 TRP B CH2 1 
ATOM   7091  N N   . CYS B 1 175 ? 37.298  80.404  7.504   1.00 26.22  ? 201 CYS B N   1 
ATOM   7092  C CA  . CYS B 1 175 ? 36.742  81.323  8.496   1.00 23.30  ? 201 CYS B CA  1 
ATOM   7093  C C   . CYS B 1 175 ? 35.652  82.195  7.866   1.00 22.30  ? 201 CYS B C   1 
ATOM   7094  O O   . CYS B 1 175 ? 35.853  82.801  6.823   1.00 20.16  ? 201 CYS B O   1 
ATOM   7095  C CB  . CYS B 1 175 ? 37.837  82.213  9.092   1.00 23.88  ? 201 CYS B CB  1 
ATOM   7096  S SG  . CYS B 1 175 ? 39.004  81.428  10.263  1.00 24.90  ? 201 CYS B SG  1 
ATOM   7097  N N   . GLY B 1 176 ? 34.497  82.246  8.514   1.00 24.86  ? 202 GLY B N   1 
ATOM   7098  C CA  . GLY B 1 176 ? 33.385  83.035  8.016   1.00 26.72  ? 202 GLY B CA  1 
ATOM   7099  C C   . GLY B 1 176 ? 33.716  84.498  7.806   1.00 30.99  ? 202 GLY B C   1 
ATOM   7100  O O   . GLY B 1 176 ? 34.706  85.015  8.333   1.00 31.63  ? 202 GLY B O   1 
ATOM   7101  N N   . SER B 1 177 ? 32.878  85.171  7.029   1.00 32.53  ? 203 SER B N   1 
ATOM   7102  C CA  . SER B 1 177 ? 33.076  86.579  6.731   1.00 34.99  ? 203 SER B CA  1 
ATOM   7103  C C   . SER B 1 177 ? 32.945  87.444  7.985   1.00 35.29  ? 203 SER B C   1 
ATOM   7104  O O   . SER B 1 177 ? 33.609  88.476  8.103   1.00 35.50  ? 203 SER B O   1 
ATOM   7105  C CB  . SER B 1 177 ? 32.064  87.032  5.669   1.00 36.65  ? 203 SER B CB  1 
ATOM   7106  O OG  . SER B 1 177 ? 30.728  86.831  6.113   1.00 40.32  ? 203 SER B OG  1 
ATOM   7107  N N   . LYS B 1 178 ? 32.094  87.020  8.920   1.00 35.11  ? 204 LYS B N   1 
ATOM   7108  C CA  . LYS B 1 178 ? 31.879  87.769  10.155  1.00 35.24  ? 204 LYS B CA  1 
ATOM   7109  C C   . LYS B 1 178 ? 32.745  87.299  11.318  1.00 35.98  ? 204 LYS B C   1 
ATOM   7110  O O   . LYS B 1 178 ? 32.393  87.490  12.477  1.00 35.54  ? 204 LYS B O   1 
ATOM   7111  C CB  . LYS B 1 178 ? 30.404  87.709  10.569  1.00 34.40  ? 204 LYS B CB  1 
ATOM   7112  C CG  . LYS B 1 178 ? 29.475  88.547  9.708   1.00 34.99  ? 204 LYS B CG  1 
ATOM   7113  C CD  . LYS B 1 178 ? 28.132  88.766  10.399  1.00 38.74  ? 204 LYS B CD  1 
ATOM   7114  C CE  . LYS B 1 178 ? 27.279  89.789  9.653   1.00 42.31  ? 204 LYS B CE  1 
ATOM   7115  N NZ  . LYS B 1 178 ? 25.952  90.038  10.298  1.00 44.22  ? 204 LYS B NZ  1 
ATOM   7116  N N   . SER B 1 179 ? 33.883  86.692  11.013  1.00 38.46  ? 205 SER B N   1 
ATOM   7117  C CA  . SER B 1 179 ? 34.761  86.217  12.068  1.00 41.55  ? 205 SER B CA  1 
ATOM   7118  C C   . SER B 1 179 ? 35.745  87.310  12.479  1.00 43.03  ? 205 SER B C   1 
ATOM   7119  O O   . SER B 1 179 ? 36.184  88.111  11.653  1.00 42.46  ? 205 SER B O   1 
ATOM   7120  C CB  . SER B 1 179 ? 35.528  84.973  11.608  1.00 40.15  ? 205 SER B CB  1 
ATOM   7121  O OG  . SER B 1 179 ? 36.485  85.309  10.619  1.00 42.33  ? 205 SER B OG  1 
ATOM   7122  N N   . ASN B 1 180 ? 36.083  87.325  13.764  1.00 45.70  ? 206 ASN B N   1 
ATOM   7123  C CA  . ASN B 1 180 ? 37.017  88.288  14.341  1.00 47.66  ? 206 ASN B CA  1 
ATOM   7124  C C   . ASN B 1 180 ? 38.438  87.810  14.040  1.00 44.37  ? 206 ASN B C   1 
ATOM   7125  O O   . ASN B 1 180 ? 38.685  86.606  13.975  1.00 45.70  ? 206 ASN B O   1 
ATOM   7126  C CB  . ASN B 1 180 ? 36.820  88.323  15.858  1.00 55.48  ? 206 ASN B CB  1 
ATOM   7127  C CG  . ASN B 1 180 ? 36.713  89.724  16.417  1.00 61.49  ? 206 ASN B CG  1 
ATOM   7128  O OD1 . ASN B 1 180 ? 37.414  90.645  15.988  1.00 67.38  ? 206 ASN B OD1 1 
ATOM   7129  N ND2 . ASN B 1 180 ? 35.845  89.888  17.411  1.00 63.50  ? 206 ASN B ND2 1 
ATOM   7130  N N   . ARG B 1 181 ? 39.373  88.737  13.869  1.00 41.56  ? 207 ARG B N   1 
ATOM   7131  C CA  . ARG B 1 181 ? 40.765  88.362  13.592  1.00 39.96  ? 207 ARG B CA  1 
ATOM   7132  C C   . ARG B 1 181 ? 41.378  87.547  14.736  1.00 36.42  ? 207 ARG B C   1 
ATOM   7133  O O   . ARG B 1 181 ? 42.285  86.746  14.525  1.00 36.05  ? 207 ARG B O   1 
ATOM   7134  C CB  . ARG B 1 181 ? 41.631  89.607  13.349  1.00 40.97  ? 207 ARG B CB  1 
ATOM   7135  C CG  . ARG B 1 181 ? 41.310  90.370  12.067  1.00 46.70  ? 207 ARG B CG  1 
ATOM   7136  C CD  . ARG B 1 181 ? 42.275  91.538  11.862  1.00 48.58  ? 207 ARG B CD  1 
ATOM   7137  N NE  . ARG B 1 181 ? 43.597  91.093  11.424  1.00 49.34  ? 207 ARG B NE  1 
ATOM   7138  C CZ  . ARG B 1 181 ? 43.880  90.714  10.184  1.00 46.39  ? 207 ARG B CZ  1 
ATOM   7139  N NH1 . ARG B 1 181 ? 42.933  90.731  9.257   1.00 46.70  ? 207 ARG B NH1 1 
ATOM   7140  N NH2 . ARG B 1 181 ? 45.106  90.318  9.871   1.00 48.15  ? 207 ARG B NH2 1 
ATOM   7141  N N   . PHE B 1 182 ? 40.880  87.756  15.947  1.00 33.31  ? 208 PHE B N   1 
ATOM   7142  C CA  . PHE B 1 182 ? 41.390  87.039  17.105  1.00 30.03  ? 208 PHE B CA  1 
ATOM   7143  C C   . PHE B 1 182 ? 40.976  85.564  17.068  1.00 30.36  ? 208 PHE B C   1 
ATOM   7144  O O   . PHE B 1 182 ? 41.771  84.684  17.395  1.00 28.77  ? 208 PHE B O   1 
ATOM   7145  C CB  . PHE B 1 182 ? 40.883  87.696  18.388  1.00 27.77  ? 208 PHE B CB  1 
ATOM   7146  C CG  . PHE B 1 182 ? 41.529  87.166  19.628  1.00 26.08  ? 208 PHE B CG  1 
ATOM   7147  C CD1 . PHE B 1 182 ? 42.910  87.230  19.786  1.00 23.77  ? 208 PHE B CD1 1 
ATOM   7148  C CD2 . PHE B 1 182 ? 40.764  86.579  20.625  1.00 24.78  ? 208 PHE B CD2 1 
ATOM   7149  C CE1 . PHE B 1 182 ? 43.517  86.717  20.914  1.00 24.57  ? 208 PHE B CE1 1 
ATOM   7150  C CE2 . PHE B 1 182 ? 41.363  86.061  21.760  1.00 28.48  ? 208 PHE B CE2 1 
ATOM   7151  C CZ  . PHE B 1 182 ? 42.745  86.129  21.905  1.00 28.54  ? 208 PHE B CZ  1 
ATOM   7152  N N   . GLU B 1 183 ? 39.729  85.304  16.679  1.00 29.68  ? 209 GLU B N   1 
ATOM   7153  C CA  . GLU B 1 183 ? 39.230  83.938  16.570  1.00 29.09  ? 209 GLU B CA  1 
ATOM   7154  C C   . GLU B 1 183 ? 40.014  83.160  15.519  1.00 29.01  ? 209 GLU B C   1 
ATOM   7155  O O   . GLU B 1 183 ? 40.335  81.983  15.718  1.00 25.10  ? 209 GLU B O   1 
ATOM   7156  C CB  . GLU B 1 183 ? 37.756  83.924  16.176  1.00 29.60  ? 209 GLU B CB  1 
ATOM   7157  C CG  . GLU B 1 183 ? 36.785  83.700  17.314  1.00 35.70  ? 209 GLU B CG  1 
ATOM   7158  C CD  . GLU B 1 183 ? 36.545  84.949  18.131  1.00 41.35  ? 209 GLU B CD  1 
ATOM   7159  O OE1 . GLU B 1 183 ? 36.618  86.056  17.556  1.00 43.11  ? 209 GLU B OE1 1 
ATOM   7160  O OE2 . GLU B 1 183 ? 36.264  84.823  19.342  1.00 44.64  ? 209 GLU B OE2 1 
ATOM   7161  N N   . ARG B 1 184 ? 40.299  83.818  14.395  1.00 29.31  ? 210 ARG B N   1 
ATOM   7162  C CA  . ARG B 1 184 ? 41.043  83.190  13.308  1.00 28.83  ? 210 ARG B CA  1 
ATOM   7163  C C   . ARG B 1 184 ? 42.387  82.768  13.840  1.00 26.59  ? 210 ARG B C   1 
ATOM   7164  O O   . ARG B 1 184 ? 42.875  81.684  13.535  1.00 24.91  ? 210 ARG B O   1 
ATOM   7165  C CB  . ARG B 1 184 ? 41.241  84.159  12.141  1.00 32.24  ? 210 ARG B CB  1 
ATOM   7166  C CG  . ARG B 1 184 ? 39.953  84.638  11.494  1.00 33.64  ? 210 ARG B CG  1 
ATOM   7167  C CD  . ARG B 1 184 ? 40.270  85.568  10.345  1.00 36.55  ? 210 ARG B CD  1 
ATOM   7168  N NE  . ARG B 1 184 ? 39.166  86.473  10.058  1.00 38.59  ? 210 ARG B NE  1 
ATOM   7169  C CZ  . ARG B 1 184 ? 39.309  87.632  9.428   1.00 41.59  ? 210 ARG B CZ  1 
ATOM   7170  N NH1 . ARG B 1 184 ? 40.509  88.020  9.016   1.00 39.62  ? 210 ARG B NH1 1 
ATOM   7171  N NH2 . ARG B 1 184 ? 38.255  88.409  9.225   1.00 46.17  ? 210 ARG B NH2 1 
ATOM   7172  N N   . LEU B 1 185 ? 42.978  83.642  14.645  1.00 27.34  ? 211 LEU B N   1 
ATOM   7173  C CA  . LEU B 1 185 ? 44.268  83.376  15.261  1.00 27.59  ? 211 LEU B CA  1 
ATOM   7174  C C   . LEU B 1 185 ? 44.156  82.109  16.114  1.00 28.49  ? 211 LEU B C   1 
ATOM   7175  O O   . LEU B 1 185 ? 45.026  81.237  16.066  1.00 31.00  ? 211 LEU B O   1 
ATOM   7176  C CB  . LEU B 1 185 ? 44.687  84.569  16.127  1.00 26.72  ? 211 LEU B CB  1 
ATOM   7177  C CG  . LEU B 1 185 ? 45.980  84.445  16.936  1.00 26.44  ? 211 LEU B CG  1 
ATOM   7178  C CD1 . LEU B 1 185 ? 47.165  84.201  16.006  1.00 27.43  ? 211 LEU B CD1 1 
ATOM   7179  C CD2 . LEU B 1 185 ? 46.185  85.710  17.731  1.00 27.72  ? 211 LEU B CD2 1 
ATOM   7180  N N   . LYS B 1 186 ? 43.078  82.005  16.886  1.00 28.40  ? 212 LYS B N   1 
ATOM   7181  C CA  . LYS B 1 186 ? 42.860  80.836  17.733  1.00 29.77  ? 212 LYS B CA  1 
ATOM   7182  C C   . LYS B 1 186 ? 42.607  79.555  16.935  1.00 29.43  ? 212 LYS B C   1 
ATOM   7183  O O   . LYS B 1 186 ? 43.080  78.486  17.321  1.00 28.62  ? 212 LYS B O   1 
ATOM   7184  C CB  . LYS B 1 186 ? 41.688  81.079  18.695  1.00 29.89  ? 212 LYS B CB  1 
ATOM   7185  C CG  . LYS B 1 186 ? 41.991  82.101  19.792  1.00 36.18  ? 212 LYS B CG  1 
ATOM   7186  C CD  . LYS B 1 186 ? 43.284  81.747  20.532  1.00 39.81  ? 212 LYS B CD  1 
ATOM   7187  C CE  . LYS B 1 186 ? 43.698  82.830  21.522  1.00 42.51  ? 212 LYS B CE  1 
ATOM   7188  N NZ  . LYS B 1 186 ? 45.111  82.658  21.991  1.00 44.08  ? 212 LYS B NZ  1 
ATOM   7189  N N   . ALA B 1 187 ? 41.867  79.665  15.831  1.00 27.79  ? 213 ALA B N   1 
ATOM   7190  C CA  . ALA B 1 187 ? 41.555  78.511  14.994  1.00 27.17  ? 213 ALA B CA  1 
ATOM   7191  C C   . ALA B 1 187 ? 42.825  77.960  14.371  1.00 29.93  ? 213 ALA B C   1 
ATOM   7192  O O   . ALA B 1 187 ? 42.971  76.748  14.170  1.00 30.78  ? 213 ALA B O   1 
ATOM   7193  C CB  . ALA B 1 187 ? 40.580  78.907  13.907  1.00 26.52  ? 213 ALA B CB  1 
ATOM   7194  N N   . THR B 1 188 ? 43.741  78.875  14.075  1.00 30.80  ? 214 THR B N   1 
ATOM   7195  C CA  . THR B 1 188 ? 45.019  78.555  13.465  1.00 31.38  ? 214 THR B CA  1 
ATOM   7196  C C   . THR B 1 188 ? 45.851  77.657  14.365  1.00 32.01  ? 214 THR B C   1 
ATOM   7197  O O   . THR B 1 188 ? 46.660  76.864  13.884  1.00 30.03  ? 214 THR B O   1 
ATOM   7198  C CB  . THR B 1 188 ? 45.796  79.846  13.178  1.00 33.38  ? 214 THR B CB  1 
ATOM   7199  O OG1 . THR B 1 188 ? 45.038  80.653  12.274  1.00 35.24  ? 214 THR B OG1 1 
ATOM   7200  C CG2 . THR B 1 188 ? 47.144  79.545  12.558  1.00 35.38  ? 214 THR B CG2 1 
ATOM   7201  N N   . GLN B 1 189 ? 45.660  77.796  15.673  1.00 31.63  ? 215 GLN B N   1 
ATOM   7202  C CA  . GLN B 1 189 ? 46.392  76.983  16.631  1.00 32.28  ? 215 GLN B CA  1 
ATOM   7203  C C   . GLN B 1 189 ? 45.911  75.538  16.561  1.00 28.96  ? 215 GLN B C   1 
ATOM   7204  O O   . GLN B 1 189 ? 46.705  74.609  16.677  1.00 27.93  ? 215 GLN B O   1 
ATOM   7205  C CB  . GLN B 1 189 ? 46.208  77.529  18.054  1.00 39.94  ? 215 GLN B CB  1 
ATOM   7206  C CG  . GLN B 1 189 ? 46.841  78.898  18.297  1.00 49.74  ? 215 GLN B CG  1 
ATOM   7207  C CD  . GLN B 1 189 ? 48.357  78.889  18.112  1.00 56.75  ? 215 GLN B CD  1 
ATOM   7208  O OE1 . GLN B 1 189 ? 48.946  77.878  17.711  1.00 58.87  ? 215 GLN B OE1 1 
ATOM   7209  N NE2 . GLN B 1 189 ? 48.993  80.021  18.400  1.00 58.55  ? 215 GLN B NE2 1 
ATOM   7210  N N   . VAL B 1 190 ? 44.608  75.352  16.372  1.00 26.57  ? 216 VAL B N   1 
ATOM   7211  C CA  . VAL B 1 190 ? 44.042  74.011  16.281  1.00 23.44  ? 216 VAL B CA  1 
ATOM   7212  C C   . VAL B 1 190 ? 44.581  73.341  15.013  1.00 24.32  ? 216 VAL B C   1 
ATOM   7213  O O   . VAL B 1 190 ? 45.030  72.194  15.047  1.00 25.80  ? 216 VAL B O   1 
ATOM   7214  C CB  . VAL B 1 190 ? 42.493  74.056  16.243  1.00 20.96  ? 216 VAL B CB  1 
ATOM   7215  C CG1 . VAL B 1 190 ? 41.938  72.659  16.255  1.00 16.59  ? 216 VAL B CG1 1 
ATOM   7216  C CG2 . VAL B 1 190 ? 41.965  74.836  17.434  1.00 14.45  ? 216 VAL B CG2 1 
ATOM   7217  N N   . SER B 1 191 ? 44.551  74.065  13.901  1.00 21.02  ? 217 SER B N   1 
ATOM   7218  C CA  . SER B 1 191 ? 45.060  73.540  12.643  1.00 23.22  ? 217 SER B CA  1 
ATOM   7219  C C   . SER B 1 191 ? 46.506  73.083  12.769  1.00 22.68  ? 217 SER B C   1 
ATOM   7220  O O   . SER B 1 191 ? 46.847  71.961  12.411  1.00 23.89  ? 217 SER B O   1 
ATOM   7221  C CB  . SER B 1 191 ? 44.982  74.604  11.549  1.00 23.09  ? 217 SER B CB  1 
ATOM   7222  O OG  . SER B 1 191 ? 43.641  74.876  11.204  1.00 27.66  ? 217 SER B OG  1 
ATOM   7223  N N   . LYS B 1 192 ? 47.360  73.959  13.269  1.00 25.57  ? 218 LYS B N   1 
ATOM   7224  C CA  . LYS B 1 192 ? 48.763  73.620  13.422  1.00 29.37  ? 218 LYS B CA  1 
ATOM   7225  C C   . LYS B 1 192 ? 48.900  72.461  14.394  1.00 28.72  ? 218 LYS B C   1 
ATOM   7226  O O   . LYS B 1 192 ? 49.809  71.645  14.281  1.00 31.56  ? 218 LYS B O   1 
ATOM   7227  C CB  . LYS B 1 192 ? 49.554  74.825  13.929  1.00 33.74  ? 218 LYS B CB  1 
ATOM   7228  C CG  . LYS B 1 192 ? 51.049  74.568  13.985  1.00 42.98  ? 218 LYS B CG  1 
ATOM   7229  C CD  . LYS B 1 192 ? 51.834  75.772  14.500  1.00 49.24  ? 218 LYS B CD  1 
ATOM   7230  C CE  . LYS B 1 192 ? 53.323  75.435  14.620  1.00 52.22  ? 218 LYS B CE  1 
ATOM   7231  N NZ  . LYS B 1 192 ? 54.114  76.568  15.169  1.00 55.73  ? 218 LYS B NZ  1 
ATOM   7232  N N   . GLY B 1 193 ? 47.984  72.383  15.350  1.00 28.10  ? 219 GLY B N   1 
ATOM   7233  C CA  . GLY B 1 193 ? 48.034  71.306  16.315  1.00 23.74  ? 219 GLY B CA  1 
ATOM   7234  C C   . GLY B 1 193 ? 47.768  69.983  15.636  1.00 25.68  ? 219 GLY B C   1 
ATOM   7235  O O   . GLY B 1 193 ? 48.449  68.989  15.903  1.00 23.75  ? 219 GLY B O   1 
ATOM   7236  N N   . ILE B 1 194 ? 46.776  69.969  14.748  1.00 24.59  ? 220 ILE B N   1 
ATOM   7237  C CA  . ILE B 1 194 ? 46.423  68.751  14.040  1.00 24.67  ? 220 ILE B CA  1 
ATOM   7238  C C   . ILE B 1 194 ? 47.595  68.314  13.179  1.00 27.07  ? 220 ILE B C   1 
ATOM   7239  O O   . ILE B 1 194 ? 47.937  67.135  13.148  1.00 24.24  ? 220 ILE B O   1 
ATOM   7240  C CB  . ILE B 1 194 ? 45.176  68.958  13.151  1.00 23.64  ? 220 ILE B CB  1 
ATOM   7241  C CG1 . ILE B 1 194 ? 43.969  69.322  14.026  1.00 24.77  ? 220 ILE B CG1 1 
ATOM   7242  C CG2 . ILE B 1 194 ? 44.888  67.698  12.360  1.00 19.57  ? 220 ILE B CG2 1 
ATOM   7243  C CD1 . ILE B 1 194 ? 42.683  69.635  13.250  1.00 21.30  ? 220 ILE B CD1 1 
ATOM   7244  N N   . ARG B 1 195 ? 48.214  69.276  12.492  1.00 30.64  ? 221 ARG B N   1 
ATOM   7245  C CA  . ARG B 1 195 ? 49.359  68.997  11.622  1.00 32.24  ? 221 ARG B CA  1 
ATOM   7246  C C   . ARG B 1 195 ? 50.586  68.516  12.385  1.00 32.09  ? 221 ARG B C   1 
ATOM   7247  O O   . ARG B 1 195 ? 51.285  67.616  11.940  1.00 31.90  ? 221 ARG B O   1 
ATOM   7248  C CB  . ARG B 1 195 ? 49.765  70.240  10.835  1.00 33.83  ? 221 ARG B CB  1 
ATOM   7249  C CG  . ARG B 1 195 ? 50.980  70.010  9.934   1.00 35.95  ? 221 ARG B CG  1 
ATOM   7250  C CD  . ARG B 1 195 ? 51.695  71.311  9.618   1.00 36.73  ? 221 ARG B CD  1 
ATOM   7251  N NE  . ARG B 1 195 ? 52.311  71.865  10.817  1.00 41.96  ? 221 ARG B NE  1 
ATOM   7252  C CZ  . ARG B 1 195 ? 52.794  73.100  10.921  1.00 43.37  ? 221 ARG B CZ  1 
ATOM   7253  N NH1 . ARG B 1 195 ? 52.735  73.934  9.891   1.00 43.18  ? 221 ARG B NH1 1 
ATOM   7254  N NH2 . ARG B 1 195 ? 53.333  73.499  12.066  1.00 43.43  ? 221 ARG B NH2 1 
ATOM   7255  N N   . ASP B 1 196 ? 50.848  69.129  13.531  1.00 31.76  ? 222 ASP B N   1 
ATOM   7256  C CA  . ASP B 1 196 ? 52.008  68.779  14.333  1.00 32.67  ? 222 ASP B CA  1 
ATOM   7257  C C   . ASP B 1 196 ? 51.884  67.518  15.202  1.00 33.42  ? 222 ASP B C   1 
ATOM   7258  O O   . ASP B 1 196 ? 52.765  66.661  15.153  1.00 33.65  ? 222 ASP B O   1 
ATOM   7259  C CB  . ASP B 1 196 ? 52.405  69.981  15.202  1.00 34.53  ? 222 ASP B CB  1 
ATOM   7260  C CG  . ASP B 1 196 ? 53.041  71.120  14.389  1.00 35.89  ? 222 ASP B CG  1 
ATOM   7261  O OD1 . ASP B 1 196 ? 53.179  72.234  14.936  1.00 36.43  ? 222 ASP B OD1 1 
ATOM   7262  O OD2 . ASP B 1 196 ? 53.415  70.909  13.215  1.00 34.72  ? 222 ASP B OD2 1 
ATOM   7263  N N   . ASN B 1 197 ? 50.806  67.392  15.980  1.00 33.28  ? 223 ASN B N   1 
ATOM   7264  C CA  . ASN B 1 197 ? 50.625  66.233  16.865  1.00 32.10  ? 223 ASN B CA  1 
ATOM   7265  C C   . ASN B 1 197 ? 50.045  65.002  16.182  1.00 33.46  ? 223 ASN B C   1 
ATOM   7266  O O   . ASN B 1 197 ? 50.304  63.872  16.590  1.00 31.36  ? 223 ASN B O   1 
ATOM   7267  C CB  . ASN B 1 197 ? 49.779  66.629  18.061  1.00 30.22  ? 223 ASN B CB  1 
ATOM   7268  C CG  . ASN B 1 197 ? 50.297  67.873  18.729  1.00 32.38  ? 223 ASN B CG  1 
ATOM   7269  O OD1 . ASN B 1 197 ? 51.504  68.031  18.903  1.00 37.38  ? 223 ASN B OD1 1 
ATOM   7270  N ND2 . ASN B 1 197 ? 49.396  68.770  19.111  1.00 32.79  ? 223 ASN B ND2 1 
ATOM   7271  N N   . GLU B 1 198 ? 49.237  65.233  15.155  1.00 37.44  ? 224 GLU B N   1 
ATOM   7272  C CA  . GLU B 1 198 ? 48.658  64.165  14.342  1.00 39.53  ? 224 GLU B CA  1 
ATOM   7273  C C   . GLU B 1 198 ? 49.400  64.420  13.020  1.00 43.13  ? 224 GLU B C   1 
ATOM   7274  O O   . GLU B 1 198 ? 49.815  65.553  12.764  1.00 46.15  ? 224 GLU B O   1 
ATOM   7275  C CB  . GLU B 1 198 ? 47.145  64.376  14.147  1.00 37.56  ? 224 GLU B CB  1 
ATOM   7276  C CG  . GLU B 1 198 ? 46.265  64.007  15.340  1.00 35.53  ? 224 GLU B CG  1 
ATOM   7277  C CD  . GLU B 1 198 ? 44.778  64.323  15.127  1.00 34.45  ? 224 GLU B CD  1 
ATOM   7278  O OE1 . GLU B 1 198 ? 44.374  65.487  15.350  1.00 28.98  ? 224 GLU B OE1 1 
ATOM   7279  O OE2 . GLU B 1 198 ? 44.014  63.410  14.733  1.00 35.06  ? 224 GLU B OE2 1 
ATOM   7280  N N   . ARG B 1 199 ? 49.594  63.401  12.193  1.00 42.54  ? 225 ARG B N   1 
ATOM   7281  C CA  . ARG B 1 199 ? 50.292  63.594  10.914  1.00 44.87  ? 225 ARG B CA  1 
ATOM   7282  C C   . ARG B 1 199 ? 51.811  63.788  11.039  1.00 45.93  ? 225 ARG B C   1 
ATOM   7283  O O   . ARG B 1 199 ? 52.530  63.731  10.040  1.00 47.03  ? 225 ARG B O   1 
ATOM   7284  C CB  . ARG B 1 199 ? 49.700  64.789  10.146  1.00 41.78  ? 225 ARG B CB  1 
ATOM   7285  C CG  . ARG B 1 199 ? 48.179  64.842  10.150  1.00 43.39  ? 225 ARG B CG  1 
ATOM   7286  C CD  . ARG B 1 199 ? 47.530  63.546  9.652   1.00 40.67  ? 225 ARG B CD  1 
ATOM   7287  N NE  . ARG B 1 199 ? 46.220  63.327  10.271  1.00 40.73  ? 225 ARG B NE  1 
ATOM   7288  C CZ  . ARG B 1 199 ? 45.177  64.148  10.158  1.00 39.68  ? 225 ARG B CZ  1 
ATOM   7289  N NH1 . ARG B 1 199 ? 45.271  65.266  9.435   1.00 34.90  ? 225 ARG B NH1 1 
ATOM   7290  N NH2 . ARG B 1 199 ? 44.038  63.855  10.783  1.00 34.83  ? 225 ARG B NH2 1 
ATOM   7291  N N   . SER B 1 200 ? 52.294  64.025  12.254  1.00 47.21  ? 226 SER B N   1 
ATOM   7292  C CA  . SER B 1 200 ? 53.726  64.204  12.490  1.00 47.94  ? 226 SER B CA  1 
ATOM   7293  C C   . SER B 1 200 ? 54.340  65.294  11.619  1.00 48.01  ? 226 SER B C   1 
ATOM   7294  O O   . SER B 1 200 ? 55.400  65.100  11.033  1.00 47.14  ? 226 SER B O   1 
ATOM   7295  C CB  . SER B 1 200 ? 54.465  62.889  12.229  1.00 49.92  ? 226 SER B CB  1 
ATOM   7296  O OG  . SER B 1 200 ? 53.795  61.794  12.831  1.00 51.15  ? 226 SER B OG  1 
ATOM   7297  N N   . GLY B 1 201 ? 53.670  66.437  11.538  1.00 49.62  ? 227 GLY B N   1 
ATOM   7298  C CA  . GLY B 1 201 ? 54.173  67.542  10.742  1.00 50.56  ? 227 GLY B CA  1 
ATOM   7299  C C   . GLY B 1 201 ? 54.086  67.308  9.247   1.00 52.80  ? 227 GLY B C   1 
ATOM   7300  O O   . GLY B 1 201 ? 54.326  68.219  8.457   1.00 52.67  ? 227 GLY B O   1 
ATOM   7301  N N   . ARG B 1 202 ? 53.734  66.087  8.857   1.00 54.54  ? 228 ARG B N   1 
ATOM   7302  C CA  . ARG B 1 202 ? 53.623  65.730  7.446   1.00 56.53  ? 228 ARG B CA  1 
ATOM   7303  C C   . ARG B 1 202 ? 52.246  66.069  6.876   1.00 54.24  ? 228 ARG B C   1 
ATOM   7304  O O   . ARG B 1 202 ? 51.482  65.174  6.503   1.00 55.94  ? 228 ARG B O   1 
ATOM   7305  C CB  . ARG B 1 202 ? 53.895  64.230  7.265   1.00 63.03  ? 228 ARG B CB  1 
ATOM   7306  C CG  . ARG B 1 202 ? 55.235  63.760  7.826   1.00 71.01  ? 228 ARG B CG  1 
ATOM   7307  C CD  . ARG B 1 202 ? 55.442  62.249  7.676   1.00 77.13  ? 228 ARG B CD  1 
ATOM   7308  N NE  . ARG B 1 202 ? 55.589  61.829  6.282   1.00 83.55  ? 228 ARG B NE  1 
ATOM   7309  C CZ  . ARG B 1 202 ? 54.577  61.626  5.440   1.00 85.65  ? 228 ARG B CZ  1 
ATOM   7310  N NH1 . ARG B 1 202 ? 53.324  61.799  5.843   1.00 86.10  ? 228 ARG B NH1 1 
ATOM   7311  N NH2 . ARG B 1 202 ? 54.819  61.256  4.187   1.00 86.31  ? 228 ARG B NH2 1 
ATOM   7312  N N   . ALA B 1 203 ? 51.926  67.357  6.807   1.00 49.03  ? 229 ALA B N   1 
ATOM   7313  C CA  . ALA B 1 203 ? 50.636  67.776  6.270   1.00 44.94  ? 229 ALA B CA  1 
ATOM   7314  C C   . ALA B 1 203 ? 50.652  69.228  5.837   1.00 42.61  ? 229 ALA B C   1 
ATOM   7315  O O   . ALA B 1 203 ? 51.455  70.022  6.309   1.00 42.25  ? 229 ALA B O   1 
ATOM   7316  C CB  . ALA B 1 203 ? 49.538  67.558  7.301   1.00 42.15  ? 229 ALA B CB  1 
ATOM   7317  N N   . GLN B 1 204 ? 49.750  69.571  4.932   1.00 42.42  ? 230 GLN B N   1 
ATOM   7318  C CA  . GLN B 1 204 ? 49.655  70.929  4.438   1.00 43.13  ? 230 GLN B CA  1 
ATOM   7319  C C   . GLN B 1 204 ? 48.398  71.567  5.005   1.00 41.42  ? 230 GLN B C   1 
ATOM   7320  O O   . GLN B 1 204 ? 47.352  70.926  5.084   1.00 41.24  ? 230 GLN B O   1 
ATOM   7321  C CB  . GLN B 1 204 ? 49.578  70.925  2.910   1.00 48.62  ? 230 GLN B CB  1 
ATOM   7322  C CG  . GLN B 1 204 ? 49.591  72.310  2.276   1.00 55.50  ? 230 GLN B CG  1 
ATOM   7323  C CD  . GLN B 1 204 ? 50.950  72.978  2.395   1.00 61.98  ? 230 GLN B CD  1 
ATOM   7324  O OE1 . GLN B 1 204 ? 51.945  72.481  1.853   1.00 64.64  ? 230 GLN B OE1 1 
ATOM   7325  N NE2 . GLN B 1 204 ? 51.004  74.103  3.112   1.00 61.52  ? 230 GLN B NE2 1 
ATOM   7326  N N   . VAL B 1 205 ? 48.505  72.824  5.417   1.00 38.87  ? 231 VAL B N   1 
ATOM   7327  C CA  . VAL B 1 205 ? 47.355  73.541  5.943   1.00 35.66  ? 231 VAL B CA  1 
ATOM   7328  C C   . VAL B 1 205 ? 47.240  74.865  5.197   1.00 33.39  ? 231 VAL B C   1 
ATOM   7329  O O   . VAL B 1 205 ? 48.197  75.609  5.073   1.00 30.52  ? 231 VAL B O   1 
ATOM   7330  C CB  . VAL B 1 205 ? 47.477  73.755  7.482   1.00 35.87  ? 231 VAL B CB  1 
ATOM   7331  C CG1 . VAL B 1 205 ? 48.911  73.615  7.896   1.00 36.36  ? 231 VAL B CG1 1 
ATOM   7332  C CG2 . VAL B 1 205 ? 46.915  75.121  7.895   1.00 34.08  ? 231 VAL B CG2 1 
ATOM   7333  N N   . SER B 1 206 ? 46.056  75.128  4.670   1.00 34.18  ? 232 SER B N   1 
ATOM   7334  C CA  . SER B 1 206 ? 45.800  76.344  3.924   1.00 33.59  ? 232 SER B CA  1 
ATOM   7335  C C   . SER B 1 206 ? 44.700  77.094  4.632   1.00 32.68  ? 232 SER B C   1 
ATOM   7336  O O   . SER B 1 206 ? 43.783  76.482  5.167   1.00 33.24  ? 232 SER B O   1 
ATOM   7337  C CB  . SER B 1 206 ? 45.338  76.006  2.508   1.00 34.08  ? 232 SER B CB  1 
ATOM   7338  O OG  . SER B 1 206 ? 46.254  75.140  1.868   1.00 36.82  ? 232 SER B OG  1 
ATOM   7339  N N   . VAL B 1 207 ? 44.791  78.416  4.635   1.00 31.84  ? 233 VAL B N   1 
ATOM   7340  C CA  . VAL B 1 207 ? 43.779  79.239  5.277   1.00 32.69  ? 233 VAL B CA  1 
ATOM   7341  C C   . VAL B 1 207 ? 43.027  80.017  4.199   1.00 33.69  ? 233 VAL B C   1 
ATOM   7342  O O   . VAL B 1 207 ? 43.631  80.554  3.272   1.00 36.72  ? 233 VAL B O   1 
ATOM   7343  C CB  . VAL B 1 207 ? 44.418  80.203  6.307   1.00 31.27  ? 233 VAL B CB  1 
ATOM   7344  C CG1 . VAL B 1 207 ? 43.345  80.978  7.029   1.00 28.87  ? 233 VAL B CG1 1 
ATOM   7345  C CG2 . VAL B 1 207 ? 45.238  79.412  7.314   1.00 29.17  ? 233 VAL B CG2 1 
ATOM   7346  N N   . PHE B 1 208 ? 41.704  80.046  4.320   1.00 32.76  ? 234 PHE B N   1 
ATOM   7347  C CA  . PHE B 1 208 ? 40.843  80.723  3.361   1.00 32.82  ? 234 PHE B CA  1 
ATOM   7348  C C   . PHE B 1 208 ? 39.736  81.427  4.112   1.00 33.48  ? 234 PHE B C   1 
ATOM   7349  O O   . PHE B 1 208 ? 39.390  81.052  5.234   1.00 32.09  ? 234 PHE B O   1 
ATOM   7350  C CB  . PHE B 1 208 ? 40.181  79.713  2.427   1.00 33.22  ? 234 PHE B CB  1 
ATOM   7351  C CG  . PHE B 1 208 ? 41.139  78.853  1.681   1.00 37.11  ? 234 PHE B CG  1 
ATOM   7352  C CD1 . PHE B 1 208 ? 41.783  79.329  0.539   1.00 38.06  ? 234 PHE B CD1 1 
ATOM   7353  C CD2 . PHE B 1 208 ? 41.405  77.559  2.113   1.00 36.18  ? 234 PHE B CD2 1 
ATOM   7354  C CE1 . PHE B 1 208 ? 42.680  78.524  -0.169  1.00 36.15  ? 234 PHE B CE1 1 
ATOM   7355  C CE2 . PHE B 1 208 ? 42.301  76.746  1.415   1.00 40.06  ? 234 PHE B CE2 1 
ATOM   7356  C CZ  . PHE B 1 208 ? 42.942  77.233  0.269   1.00 37.36  ? 234 PHE B CZ  1 
ATOM   7357  N N   . GLU B 1 209 ? 39.159  82.436  3.473   1.00 34.78  ? 235 GLU B N   1 
ATOM   7358  C CA  . GLU B 1 209 ? 38.056  83.170  4.063   1.00 37.16  ? 235 GLU B CA  1 
ATOM   7359  C C   . GLU B 1 209 ? 36.838  82.912  3.198   1.00 34.43  ? 235 GLU B C   1 
ATOM   7360  O O   . GLU B 1 209 ? 36.970  82.577  2.026   1.00 32.92  ? 235 GLU B O   1 
ATOM   7361  C CB  . GLU B 1 209 ? 38.373  84.662  4.112   1.00 41.47  ? 235 GLU B CB  1 
ATOM   7362  C CG  . GLU B 1 209 ? 39.556  84.978  4.993   1.00 48.76  ? 235 GLU B CG  1 
ATOM   7363  C CD  . GLU B 1 209 ? 39.812  86.457  5.099   1.00 55.52  ? 235 GLU B CD  1 
ATOM   7364  O OE1 . GLU B 1 209 ? 40.072  87.098  4.052   1.00 57.04  ? 235 GLU B OE1 1 
ATOM   7365  O OE2 . GLU B 1 209 ? 39.749  86.976  6.237   1.00 61.20  ? 235 GLU B OE2 1 
ATOM   7366  N N   . GLU B 1 210 ? 35.653  83.041  3.779   1.00 35.21  ? 236 GLU B N   1 
ATOM   7367  C CA  . GLU B 1 210 ? 34.435  82.808  3.026   1.00 36.71  ? 236 GLU B CA  1 
ATOM   7368  C C   . GLU B 1 210 ? 34.523  83.526  1.687   1.00 38.65  ? 236 GLU B C   1 
ATOM   7369  O O   . GLU B 1 210 ? 34.965  84.673  1.615   1.00 40.47  ? 236 GLU B O   1 
ATOM   7370  C CB  . GLU B 1 210 ? 33.219  83.301  3.810   1.00 34.31  ? 236 GLU B CB  1 
ATOM   7371  C CG  . GLU B 1 210 ? 31.940  83.339  2.999   1.00 30.32  ? 236 GLU B CG  1 
ATOM   7372  C CD  . GLU B 1 210 ? 30.722  83.607  3.854   1.00 35.18  ? 236 GLU B CD  1 
ATOM   7373  O OE1 . GLU B 1 210 ? 30.845  84.347  4.852   1.00 33.51  ? 236 GLU B OE1 1 
ATOM   7374  O OE2 . GLU B 1 210 ? 29.633  83.089  3.524   1.00 39.17  ? 236 GLU B OE2 1 
ATOM   7375  N N   . GLY B 1 211 ? 34.120  82.842  0.623   1.00 39.57  ? 237 GLY B N   1 
ATOM   7376  C CA  . GLY B 1 211 ? 34.167  83.452  -0.690  1.00 37.27  ? 237 GLY B CA  1 
ATOM   7377  C C   . GLY B 1 211 ? 35.287  82.908  -1.547  1.00 36.11  ? 237 GLY B C   1 
ATOM   7378  O O   . GLY B 1 211 ? 35.172  82.881  -2.768  1.00 39.98  ? 237 GLY B O   1 
ATOM   7379  N N   . ALA B 1 212 ? 36.372  82.473  -0.919  1.00 33.33  ? 238 ALA B N   1 
ATOM   7380  C CA  . ALA B 1 212 ? 37.496  81.931  -1.665  1.00 32.77  ? 238 ALA B CA  1 
ATOM   7381  C C   . ALA B 1 212 ? 37.684  80.440  -1.407  1.00 33.16  ? 238 ALA B C   1 
ATOM   7382  O O   . ALA B 1 212 ? 38.812  79.949  -1.379  1.00 31.46  ? 238 ALA B O   1 
ATOM   7383  C CB  . ALA B 1 212 ? 38.762  82.681  -1.294  1.00 35.15  ? 238 ALA B CB  1 
ATOM   7384  N N   . GLU B 1 213 ? 36.588  79.711  -1.213  1.00 33.57  ? 239 GLU B N   1 
ATOM   7385  C CA  . GLU B 1 213 ? 36.720  78.287  -0.949  1.00 35.26  ? 239 GLU B CA  1 
ATOM   7386  C C   . GLU B 1 213 ? 37.391  77.587  -2.127  1.00 33.57  ? 239 GLU B C   1 
ATOM   7387  O O   . GLU B 1 213 ? 37.029  77.803  -3.279  1.00 34.44  ? 239 GLU B O   1 
ATOM   7388  C CB  . GLU B 1 213 ? 35.359  77.657  -0.612  1.00 35.56  ? 239 GLU B CB  1 
ATOM   7389  C CG  . GLU B 1 213 ? 34.146  78.313  -1.239  1.00 40.20  ? 239 GLU B CG  1 
ATOM   7390  C CD  . GLU B 1 213 ? 33.827  79.683  -0.653  1.00 41.30  ? 239 GLU B CD  1 
ATOM   7391  O OE1 . GLU B 1 213 ? 33.791  79.821  0.588   1.00 38.89  ? 239 GLU B OE1 1 
ATOM   7392  O OE2 . GLU B 1 213 ? 33.590  80.622  -1.445  1.00 44.99  ? 239 GLU B OE2 1 
ATOM   7393  N N   . PRO B 1 214 ? 38.406  76.755  -1.846  1.00 33.10  ? 240 PRO B N   1 
ATOM   7394  C CA  . PRO B 1 214 ? 39.156  76.017  -2.866  1.00 33.40  ? 240 PRO B CA  1 
ATOM   7395  C C   . PRO B 1 214 ? 38.411  74.846  -3.516  1.00 34.23  ? 240 PRO B C   1 
ATOM   7396  O O   . PRO B 1 214 ? 37.295  74.496  -3.124  1.00 35.10  ? 240 PRO B O   1 
ATOM   7397  C CB  . PRO B 1 214 ? 40.403  75.574  -2.110  1.00 32.38  ? 240 PRO B CB  1 
ATOM   7398  C CG  . PRO B 1 214 ? 39.848  75.284  -0.747  1.00 32.55  ? 240 PRO B CG  1 
ATOM   7399  C CD  . PRO B 1 214 ? 38.918  76.450  -0.495  1.00 31.53  ? 240 PRO B CD  1 
ATOM   7400  N N   . GLU B 1 215 ? 39.048  74.245  -4.517  1.00 33.93  ? 241 GLU B N   1 
ATOM   7401  C CA  . GLU B 1 215 ? 38.470  73.129  -5.255  1.00 32.21  ? 241 GLU B CA  1 
ATOM   7402  C C   . GLU B 1 215 ? 38.294  71.864  -4.425  1.00 28.68  ? 241 GLU B C   1 
ATOM   7403  O O   . GLU B 1 215 ? 37.259  71.216  -4.498  1.00 30.35  ? 241 GLU B O   1 
ATOM   7404  C CB  . GLU B 1 215 ? 39.328  72.817  -6.481  1.00 37.01  ? 241 GLU B CB  1 
ATOM   7405  C CG  . GLU B 1 215 ? 38.793  71.672  -7.321  1.00 44.27  ? 241 GLU B CG  1 
ATOM   7406  C CD  . GLU B 1 215 ? 39.562  71.478  -8.614  1.00 49.44  ? 241 GLU B CD  1 
ATOM   7407  O OE1 . GLU B 1 215 ? 40.802  71.318  -8.562  1.00 49.94  ? 241 GLU B OE1 1 
ATOM   7408  O OE2 . GLU B 1 215 ? 38.918  71.481  -9.685  1.00 53.55  ? 241 GLU B OE2 1 
ATOM   7409  N N   . ALA B 1 216 ? 39.307  71.502  -3.650  1.00 24.77  ? 242 ALA B N   1 
ATOM   7410  C CA  . ALA B 1 216 ? 39.222  70.311  -2.820  1.00 23.87  ? 242 ALA B CA  1 
ATOM   7411  C C   . ALA B 1 216 ? 38.036  70.416  -1.860  1.00 23.91  ? 242 ALA B C   1 
ATOM   7412  O O   . ALA B 1 216 ? 37.363  69.427  -1.561  1.00 22.23  ? 242 ALA B O   1 
ATOM   7413  C CB  . ALA B 1 216 ? 40.512  70.133  -2.039  1.00 20.27  ? 242 ALA B CB  1 
ATOM   7414  N N   . MET B 1 217 ? 37.779  71.632  -1.401  1.00 24.50  ? 243 MET B N   1 
ATOM   7415  C CA  . MET B 1 217 ? 36.709  71.894  -0.459  1.00 27.66  ? 243 MET B CA  1 
ATOM   7416  C C   . MET B 1 217 ? 35.327  71.827  -1.097  1.00 27.86  ? 243 MET B C   1 
ATOM   7417  O O   . MET B 1 217 ? 34.393  71.264  -0.520  1.00 26.94  ? 243 MET B O   1 
ATOM   7418  C CB  . MET B 1 217 ? 36.918  73.268  0.183   1.00 29.76  ? 243 MET B CB  1 
ATOM   7419  C CG  . MET B 1 217 ? 36.163  73.456  1.479   1.00 35.17  ? 243 MET B CG  1 
ATOM   7420  S SD  . MET B 1 217 ? 36.564  74.980  2.365   1.00 40.43  ? 243 MET B SD  1 
ATOM   7421  C CE  . MET B 1 217 ? 34.995  75.329  3.125   1.00 37.96  ? 243 MET B CE  1 
ATOM   7422  N N   . LEU B 1 218 ? 35.190  72.406  -2.283  1.00 27.36  ? 244 LEU B N   1 
ATOM   7423  C CA  . LEU B 1 218 ? 33.903  72.397  -2.960  1.00 27.54  ? 244 LEU B CA  1 
ATOM   7424  C C   . LEU B 1 218 ? 33.598  71.002  -3.469  1.00 27.08  ? 244 LEU B C   1 
ATOM   7425  O O   . LEU B 1 218 ? 32.433  70.637  -3.639  1.00 27.68  ? 244 LEU B O   1 
ATOM   7426  C CB  . LEU B 1 218 ? 33.899  73.386  -4.135  1.00 27.61  ? 244 LEU B CB  1 
ATOM   7427  C CG  . LEU B 1 218 ? 34.046  74.872  -3.787  1.00 29.82  ? 244 LEU B CG  1 
ATOM   7428  C CD1 . LEU B 1 218 ? 33.853  75.721  -5.034  1.00 29.01  ? 244 LEU B CD1 1 
ATOM   7429  C CD2 . LEU B 1 218 ? 33.008  75.259  -2.742  1.00 30.43  ? 244 LEU B CD2 1 
ATOM   7430  N N   . GLN B 1 219 ? 34.648  70.220  -3.697  1.00 25.02  ? 245 GLN B N   1 
ATOM   7431  C CA  . GLN B 1 219 ? 34.481  68.871  -4.210  1.00 25.25  ? 245 GLN B CA  1 
ATOM   7432  C C   . GLN B 1 219 ? 33.796  67.923  -3.220  1.00 24.79  ? 245 GLN B C   1 
ATOM   7433  O O   . GLN B 1 219 ? 32.950  67.126  -3.620  1.00 27.81  ? 245 GLN B O   1 
ATOM   7434  C CB  . GLN B 1 219 ? 35.839  68.296  -4.660  1.00 25.05  ? 245 GLN B CB  1 
ATOM   7435  C CG  . GLN B 1 219 ? 35.724  66.982  -5.447  1.00 24.77  ? 245 GLN B CG  1 
ATOM   7436  C CD  . GLN B 1 219 ? 37.048  66.480  -6.026  1.00 26.99  ? 245 GLN B CD  1 
ATOM   7437  O OE1 . GLN B 1 219 ? 37.933  66.028  -5.293  1.00 28.86  ? 245 GLN B OE1 1 
ATOM   7438  N NE2 . GLN B 1 219 ? 37.184  66.555  -7.352  1.00 20.89  ? 245 GLN B NE2 1 
ATOM   7439  N N   . VAL B 1 220 ? 34.136  67.997  -1.934  1.00 23.70  ? 246 VAL B N   1 
ATOM   7440  C CA  . VAL B 1 220 ? 33.504  67.097  -0.977  1.00 23.12  ? 246 VAL B CA  1 
ATOM   7441  C C   . VAL B 1 220 ? 32.248  67.694  -0.347  1.00 23.42  ? 246 VAL B C   1 
ATOM   7442  O O   . VAL B 1 220 ? 31.389  66.961  0.128   1.00 23.00  ? 246 VAL B O   1 
ATOM   7443  C CB  . VAL B 1 220 ? 34.485  66.646  0.164   1.00 21.32  ? 246 VAL B CB  1 
ATOM   7444  C CG1 . VAL B 1 220 ? 35.910  66.882  -0.242  1.00 21.71  ? 246 VAL B CG1 1 
ATOM   7445  C CG2 . VAL B 1 220 ? 34.166  67.347  1.457   1.00 16.92  ? 246 VAL B CG2 1 
ATOM   7446  N N   . LEU B 1 221 ? 32.130  69.016  -0.355  1.00 22.89  ? 247 LEU B N   1 
ATOM   7447  C CA  . LEU B 1 221 ? 30.967  69.675  0.242   1.00 24.77  ? 247 LEU B CA  1 
ATOM   7448  C C   . LEU B 1 221 ? 29.895  70.030  -0.772  1.00 26.78  ? 247 LEU B C   1 
ATOM   7449  O O   . LEU B 1 221 ? 28.717  70.127  -0.433  1.00 28.31  ? 247 LEU B O   1 
ATOM   7450  C CB  . LEU B 1 221 ? 31.391  70.966  0.967   1.00 23.63  ? 247 LEU B CB  1 
ATOM   7451  C CG  . LEU B 1 221 ? 32.261  70.863  2.222   1.00 20.89  ? 247 LEU B CG  1 
ATOM   7452  C CD1 . LEU B 1 221 ? 32.721  72.248  2.658   1.00 21.97  ? 247 LEU B CD1 1 
ATOM   7453  C CD2 . LEU B 1 221 ? 31.468  70.185  3.322   1.00 18.35  ? 247 LEU B CD2 1 
ATOM   7454  N N   . GLY B 1 222 ? 30.308  70.232  -2.018  1.00 29.41  ? 248 GLY B N   1 
ATOM   7455  C CA  . GLY B 1 222 ? 29.365  70.624  -3.049  1.00 31.60  ? 248 GLY B CA  1 
ATOM   7456  C C   . GLY B 1 222 ? 29.295  72.142  -3.099  1.00 33.54  ? 248 GLY B C   1 
ATOM   7457  O O   . GLY B 1 222 ? 29.936  72.815  -2.292  1.00 32.80  ? 248 GLY B O   1 
ATOM   7458  N N   . PRO B 1 223 ? 28.538  72.721  -4.038  1.00 36.09  ? 249 PRO B N   1 
ATOM   7459  C CA  . PRO B 1 223 ? 28.453  74.182  -4.106  1.00 36.57  ? 249 PRO B CA  1 
ATOM   7460  C C   . PRO B 1 223 ? 27.932  74.819  -2.813  1.00 37.21  ? 249 PRO B C   1 
ATOM   7461  O O   . PRO B 1 223 ? 27.010  74.301  -2.171  1.00 35.18  ? 249 PRO B O   1 
ATOM   7462  C CB  . PRO B 1 223 ? 27.540  74.418  -5.312  1.00 37.08  ? 249 PRO B CB  1 
ATOM   7463  C CG  . PRO B 1 223 ? 26.703  73.175  -5.364  1.00 36.16  ? 249 PRO B CG  1 
ATOM   7464  C CD  . PRO B 1 223 ? 27.712  72.099  -5.087  1.00 38.09  ? 249 PRO B CD  1 
ATOM   7465  N N   . LYS B 1 224 ? 28.538  75.949  -2.451  1.00 38.19  ? 250 LYS B N   1 
ATOM   7466  C CA  . LYS B 1 224 ? 28.206  76.688  -1.237  1.00 40.13  ? 250 LYS B CA  1 
ATOM   7467  C C   . LYS B 1 224 ? 26.909  77.475  -1.300  1.00 41.71  ? 250 LYS B C   1 
ATOM   7468  O O   . LYS B 1 224 ? 26.705  78.285  -2.198  1.00 45.42  ? 250 LYS B O   1 
ATOM   7469  C CB  . LYS B 1 224 ? 29.346  77.652  -0.889  1.00 41.22  ? 250 LYS B CB  1 
ATOM   7470  C CG  . LYS B 1 224 ? 29.149  78.402  0.423   1.00 44.42  ? 250 LYS B CG  1 
ATOM   7471  C CD  . LYS B 1 224 ? 30.353  79.287  0.775   1.00 48.10  ? 250 LYS B CD  1 
ATOM   7472  C CE  . LYS B 1 224 ? 30.394  80.584  -0.038  1.00 47.00  ? 250 LYS B CE  1 
ATOM   7473  N NZ  . LYS B 1 224 ? 29.236  81.471  0.275   1.00 46.41  ? 250 LYS B NZ  1 
ATOM   7474  N N   . PRO B 1 225 ? 26.007  77.244  -0.342  1.00 43.42  ? 251 PRO B N   1 
ATOM   7475  C CA  . PRO B 1 225 ? 24.737  77.967  -0.327  1.00 44.51  ? 251 PRO B CA  1 
ATOM   7476  C C   . PRO B 1 225 ? 24.939  79.254  0.472   1.00 47.01  ? 251 PRO B C   1 
ATOM   7477  O O   . PRO B 1 225 ? 26.071  79.629  0.792   1.00 47.56  ? 251 PRO B O   1 
ATOM   7478  C CB  . PRO B 1 225 ? 23.816  76.996  0.391   1.00 43.76  ? 251 PRO B CB  1 
ATOM   7479  C CG  . PRO B 1 225 ? 24.721  76.459  1.452   1.00 43.05  ? 251 PRO B CG  1 
ATOM   7480  C CD  . PRO B 1 225 ? 26.006  76.176  0.675   1.00 44.19  ? 251 PRO B CD  1 
ATOM   7481  N N   . THR B 1 226 ? 23.847  79.935  0.791   1.00 48.21  ? 252 THR B N   1 
ATOM   7482  C CA  . THR B 1 226 ? 23.953  81.145  1.587   1.00 49.56  ? 252 THR B CA  1 
ATOM   7483  C C   . THR B 1 226 ? 23.962  80.678  3.033   1.00 48.52  ? 252 THR B C   1 
ATOM   7484  O O   . THR B 1 226 ? 23.045  79.982  3.478   1.00 46.63  ? 252 THR B O   1 
ATOM   7485  C CB  . THR B 1 226 ? 22.771  82.092  1.336   1.00 52.06  ? 252 THR B CB  1 
ATOM   7486  O OG1 . THR B 1 226 ? 21.648  81.340  0.852   1.00 54.85  ? 252 THR B OG1 1 
ATOM   7487  C CG2 . THR B 1 226 ? 23.162  83.160  0.318   1.00 51.10  ? 252 THR B CG2 1 
ATOM   7488  N N   . LEU B 1 227 ? 25.016  81.055  3.752   1.00 47.52  ? 253 LEU B N   1 
ATOM   7489  C CA  . LEU B 1 227 ? 25.200  80.656  5.139   1.00 45.31  ? 253 LEU B CA  1 
ATOM   7490  C C   . LEU B 1 227 ? 24.494  81.533  6.169   1.00 45.49  ? 253 LEU B C   1 
ATOM   7491  O O   . LEU B 1 227 ? 24.368  82.742  5.989   1.00 47.30  ? 253 LEU B O   1 
ATOM   7492  C CB  . LEU B 1 227 ? 26.696  80.609  5.437   1.00 44.90  ? 253 LEU B CB  1 
ATOM   7493  C CG  . LEU B 1 227 ? 27.482  79.728  4.467   1.00 42.58  ? 253 LEU B CG  1 
ATOM   7494  C CD1 . LEU B 1 227 ? 28.959  79.772  4.813   1.00 40.82  ? 253 LEU B CD1 1 
ATOM   7495  C CD2 . LEU B 1 227 ? 26.947  78.307  4.533   1.00 41.84  ? 253 LEU B CD2 1 
ATOM   7496  N N   . PRO B 1 228 ? 24.031  80.926  7.275   1.00 45.79  ? 254 PRO B N   1 
ATOM   7497  C CA  . PRO B 1 228 ? 23.326  81.602  8.371   1.00 46.34  ? 254 PRO B CA  1 
ATOM   7498  C C   . PRO B 1 228 ? 24.264  82.364  9.307   1.00 48.03  ? 254 PRO B C   1 
ATOM   7499  O O   . PRO B 1 228 ? 25.487  82.261  9.204   1.00 46.74  ? 254 PRO B O   1 
ATOM   7500  C CB  . PRO B 1 228 ? 22.636  80.454  9.113   1.00 43.98  ? 254 PRO B CB  1 
ATOM   7501  C CG  . PRO B 1 228 ? 22.718  79.275  8.163   1.00 43.74  ? 254 PRO B CG  1 
ATOM   7502  C CD  . PRO B 1 228 ? 24.034  79.470  7.497   1.00 44.85  ? 254 PRO B CD  1 
ATOM   7503  N N   . GLU B 1 229 ? 23.674  83.125  10.221  1.00 50.75  ? 255 GLU B N   1 
ATOM   7504  C CA  . GLU B 1 229 ? 24.434  83.882  11.204  1.00 53.81  ? 255 GLU B CA  1 
ATOM   7505  C C   . GLU B 1 229 ? 24.753  82.923  12.335  1.00 56.24  ? 255 GLU B C   1 
ATOM   7506  O O   . GLU B 1 229 ? 24.044  81.941  12.537  1.00 55.87  ? 255 GLU B O   1 
ATOM   7507  C CB  . GLU B 1 229 ? 23.595  85.033  11.757  1.00 55.59  ? 255 GLU B CB  1 
ATOM   7508  C CG  . GLU B 1 229 ? 23.585  86.289  10.917  1.00 57.01  ? 255 GLU B CG  1 
ATOM   7509  C CD  . GLU B 1 229 ? 24.924  86.981  10.926  1.00 60.45  ? 255 GLU B CD  1 
ATOM   7510  O OE1 . GLU B 1 229 ? 25.462  87.209  12.033  1.00 60.83  ? 255 GLU B OE1 1 
ATOM   7511  O OE2 . GLU B 1 229 ? 25.436  87.299  9.831   1.00 62.28  ? 255 GLU B OE2 1 
ATOM   7512  N N   . ALA B 1 230 ? 25.813  83.204  13.077  1.00 60.12  ? 256 ALA B N   1 
ATOM   7513  C CA  . ALA B 1 230 ? 26.180  82.347  14.190  1.00 65.56  ? 256 ALA B CA  1 
ATOM   7514  C C   . ALA B 1 230 ? 25.361  82.708  15.430  1.00 70.24  ? 256 ALA B C   1 
ATOM   7515  O O   . ALA B 1 230 ? 25.111  83.884  15.712  1.00 69.38  ? 256 ALA B O   1 
ATOM   7516  C CB  . ALA B 1 230 ? 27.669  82.476  14.483  1.00 64.80  ? 256 ALA B CB  1 
ATOM   7517  N N   . THR B 1 231 ? 24.934  81.686  16.161  1.00 75.84  ? 257 THR B N   1 
ATOM   7518  C CA  . THR B 1 231 ? 24.159  81.887  17.374  1.00 82.54  ? 257 THR B CA  1 
ATOM   7519  C C   . THR B 1 231 ? 25.097  82.423  18.453  1.00 86.91  ? 257 THR B C   1 
ATOM   7520  O O   . THR B 1 231 ? 26.048  81.742  18.846  1.00 87.39  ? 257 THR B O   1 
ATOM   7521  C CB  . THR B 1 231 ? 23.543  80.563  17.854  1.00 83.22  ? 257 THR B CB  1 
ATOM   7522  O OG1 . THR B 1 231 ? 22.727  80.013  16.811  1.00 84.34  ? 257 THR B OG1 1 
ATOM   7523  C CG2 . THR B 1 231 ? 22.692  80.790  19.097  1.00 84.72  ? 257 THR B CG2 1 
ATOM   7524  N N   . GLU B 1 232 ? 24.831  83.640  18.927  1.00 91.43  ? 258 GLU B N   1 
ATOM   7525  C CA  . GLU B 1 232 ? 25.670  84.264  19.950  1.00 94.83  ? 258 GLU B CA  1 
ATOM   7526  C C   . GLU B 1 232 ? 25.367  83.779  21.365  1.00 96.44  ? 258 GLU B C   1 
ATOM   7527  O O   . GLU B 1 232 ? 25.911  84.304  22.339  1.00 97.01  ? 258 GLU B O   1 
ATOM   7528  C CB  . GLU B 1 232 ? 25.539  85.791  19.887  1.00 95.53  ? 258 GLU B CB  1 
ATOM   7529  C CG  . GLU B 1 232 ? 26.482  86.528  20.831  1.00 97.65  ? 258 GLU B CG  1 
ATOM   7530  C CD  . GLU B 1 232 ? 26.501  88.025  20.595  1.00 99.62  ? 258 GLU B CD  1 
ATOM   7531  O OE1 . GLU B 1 232 ? 25.416  88.646  20.616  1.00 100.41 ? 258 GLU B OE1 1 
ATOM   7532  O OE2 . GLU B 1 232 ? 27.603  88.582  20.393  1.00 99.84  ? 258 GLU B OE2 1 
ATOM   7533  N N   . ASP B 1 233 ? 24.502  82.776  21.478  1.00 98.11  ? 259 ASP B N   1 
ATOM   7534  C CA  . ASP B 1 233 ? 24.153  82.217  22.782  1.00 99.98  ? 259 ASP B CA  1 
ATOM   7535  C C   . ASP B 1 233 ? 25.340  81.441  23.354  1.00 100.41 ? 259 ASP B C   1 
ATOM   7536  O O   . ASP B 1 233 ? 25.164  80.372  23.946  1.00 100.41 ? 259 ASP B O   1 
ATOM   7537  C CB  . ASP B 1 233 ? 22.936  81.289  22.661  1.00 100.40 ? 259 ASP B CB  1 
ATOM   7538  C CG  . ASP B 1 233 ? 21.615  82.045  22.665  1.00 100.41 ? 259 ASP B CG  1 
ATOM   7539  O OD1 . ASP B 1 233 ? 20.564  81.407  22.434  1.00 100.41 ? 259 ASP B OD1 1 
ATOM   7540  O OD2 . ASP B 1 233 ? 21.623  83.272  22.907  1.00 100.41 ? 259 ASP B OD2 1 
ATOM   7541  N N   . THR B 1 234 ? 26.541  81.989  23.169  1.00 100.41 ? 260 THR B N   1 
ATOM   7542  C CA  . THR B 1 234 ? 27.782  81.378  23.649  1.00 100.41 ? 260 THR B CA  1 
ATOM   7543  C C   . THR B 1 234 ? 27.570  80.696  25.000  1.00 100.41 ? 260 THR B C   1 
ATOM   7544  O O   . THR B 1 234 ? 28.074  79.595  25.244  1.00 100.41 ? 260 THR B O   1 
ATOM   7545  C CB  . THR B 1 234 ? 28.902  82.438  23.806  1.00 100.41 ? 260 THR B CB  1 
ATOM   7546  O OG1 . THR B 1 234 ? 29.049  83.173  22.583  1.00 99.88  ? 260 THR B OG1 1 
ATOM   7547  C CG2 . THR B 1 234 ? 30.228  81.766  24.147  1.00 100.21 ? 260 THR B CG2 1 
ATOM   7548  N N   . VAL B 1 235 ? 26.814  81.363  25.867  1.00 100.41 ? 261 VAL B N   1 
ATOM   7549  C CA  . VAL B 1 235 ? 26.512  80.853  27.198  1.00 100.35 ? 261 VAL B CA  1 
ATOM   7550  C C   . VAL B 1 235 ? 25.734  81.915  27.967  1.00 100.41 ? 261 VAL B C   1 
ATOM   7551  O O   . VAL B 1 235 ? 25.107  81.624  28.987  1.00 100.41 ? 261 VAL B O   1 
ATOM   7552  C CB  . VAL B 1 235 ? 27.811  80.498  27.964  1.00 100.41 ? 261 VAL B CB  1 
ATOM   7553  C CG1 . VAL B 1 235 ? 28.780  81.663  27.902  1.00 100.41 ? 261 VAL B CG1 1 
ATOM   7554  C CG2 . VAL B 1 235 ? 27.491  80.131  29.408  1.00 100.31 ? 261 VAL B CG2 1 
ATOM   7555  N N   . LYS B 1 236 ? 25.776  83.146  27.460  1.00 100.41 ? 262 LYS B N   1 
ATOM   7556  C CA  . LYS B 1 236 ? 25.084  84.276  28.078  1.00 100.41 ? 262 LYS B CA  1 
ATOM   7557  C C   . LYS B 1 236 ? 25.663  84.640  29.447  1.00 100.41 ? 262 LYS B C   1 
ATOM   7558  O O   . LYS B 1 236 ? 25.458  85.754  29.934  1.00 100.40 ? 262 LYS B O   1 
ATOM   7559  C CB  . LYS B 1 236 ? 23.584  83.971  28.206  1.00 100.41 ? 262 LYS B CB  1 
ATOM   7560  C CG  . LYS B 1 236 ? 22.681  84.877  27.370  1.00 100.41 ? 262 LYS B CG  1 
ATOM   7561  C CD  . LYS B 1 236 ? 23.025  84.813  25.885  1.00 100.41 ? 262 LYS B CD  1 
ATOM   7562  C CE  . LYS B 1 236 ? 22.189  85.799  25.077  1.00 100.41 ? 262 LYS B CE  1 
ATOM   7563  N NZ  . LYS B 1 236 ? 22.565  85.815  23.634  1.00 100.25 ? 262 LYS B NZ  1 
ATOM   7564  N N   . GLU B 1 237 ? 26.386  83.697  30.052  1.00 100.41 ? 263 GLU B N   1 
ATOM   7565  C CA  . GLU B 1 237 ? 27.019  83.882  31.361  1.00 100.41 ? 263 GLU B CA  1 
ATOM   7566  C C   . GLU B 1 237 ? 26.186  84.752  32.291  1.00 100.09 ? 263 GLU B C   1 
ATOM   7567  O O   . GLU B 1 237 ? 26.736  85.523  33.077  1.00 100.02 ? 263 GLU B O   1 
ATOM   7568  C CB  . GLU B 1 237 ? 28.404  84.522  31.200  1.00 100.41 ? 263 GLU B CB  1 
ATOM   7569  C CG  . GLU B 1 237 ? 29.326  83.805  30.230  1.00 100.41 ? 263 GLU B CG  1 
ATOM   7570  C CD  . GLU B 1 237 ? 29.828  82.479  30.764  1.00 100.41 ? 263 GLU B CD  1 
ATOM   7571  O OE1 . GLU B 1 237 ? 29.003  81.682  31.265  1.00 100.41 ? 263 GLU B OE1 1 
ATOM   7572  O OE2 . GLU B 1 237 ? 31.050  82.234  30.670  1.00 100.41 ? 263 GLU B OE2 1 
ATOM   7573  N N   . ASP B 1 238 ? 24.865  84.632  32.194  1.00 99.98  ? 264 ASP B N   1 
ATOM   7574  C CA  . ASP B 1 238 ? 23.959  85.419  33.025  1.00 99.93  ? 264 ASP B CA  1 
ATOM   7575  C C   . ASP B 1 238 ? 24.200  85.171  34.511  1.00 99.52  ? 264 ASP B C   1 
ATOM   7576  O O   . ASP B 1 238 ? 23.342  84.642  35.225  1.00 99.99  ? 264 ASP B O   1 
ATOM   7577  C CB  . ASP B 1 238 ? 22.501  85.109  32.664  1.00 100.41 ? 264 ASP B CB  1 
ATOM   7578  C CG  . ASP B 1 238 ? 22.111  85.644  31.293  1.00 100.41 ? 264 ASP B CG  1 
ATOM   7579  O OD1 . ASP B 1 238 ? 22.217  86.871  31.080  1.00 100.41 ? 264 ASP B OD1 1 
ATOM   7580  O OD2 . ASP B 1 238 ? 21.699  84.841  30.431  1.00 100.41 ? 264 ASP B OD2 1 
ATOM   7581  N N   . ALA B 1 239 ? 25.388  85.562  34.957  1.00 98.08  ? 265 ALA B N   1 
ATOM   7582  C CA  . ALA B 1 239 ? 25.809  85.421  36.343  1.00 95.90  ? 265 ALA B CA  1 
ATOM   7583  C C   . ALA B 1 239 ? 26.669  86.640  36.660  1.00 93.31  ? 265 ALA B C   1 
ATOM   7584  O O   . ALA B 1 239 ? 27.719  86.533  37.297  1.00 93.44  ? 265 ALA B O   1 
ATOM   7585  C CB  . ALA B 1 239 ? 26.615  84.132  36.526  1.00 95.69  ? 265 ALA B CB  1 
ATOM   7586  N N   . ALA B 1 240 ? 26.212  87.797  36.187  1.00 89.51  ? 266 ALA B N   1 
ATOM   7587  C CA  . ALA B 1 240 ? 26.908  89.056  36.400  1.00 85.80  ? 266 ALA B CA  1 
ATOM   7588  C C   . ALA B 1 240 ? 27.397  89.158  37.837  1.00 83.80  ? 266 ALA B C   1 
ATOM   7589  O O   . ALA B 1 240 ? 28.576  89.397  38.092  1.00 82.18  ? 266 ALA B O   1 
ATOM   7590  C CB  . ALA B 1 240 ? 25.975  90.219  36.088  1.00 85.38  ? 266 ALA B CB  1 
ATOM   7591  N N   . ASN B 1 241 ? 26.481  88.952  38.773  1.00 82.15  ? 267 ASN B N   1 
ATOM   7592  C CA  . ASN B 1 241 ? 26.807  89.044  40.184  1.00 80.68  ? 267 ASN B CA  1 
ATOM   7593  C C   . ASN B 1 241 ? 26.432  87.783  40.951  1.00 78.84  ? 267 ASN B C   1 
ATOM   7594  O O   . ASN B 1 241 ? 25.255  87.500  41.161  1.00 77.75  ? 267 ASN B O   1 
ATOM   7595  C CB  . ASN B 1 241 ? 26.085  90.246  40.772  1.00 83.12  ? 267 ASN B CB  1 
ATOM   7596  C CG  . ASN B 1 241 ? 26.159  91.457  39.863  1.00 86.65  ? 267 ASN B CG  1 
ATOM   7597  O OD1 . ASN B 1 241 ? 27.244  91.952  39.561  1.00 89.27  ? 267 ASN B OD1 1 
ATOM   7598  N ND2 . ASN B 1 241 ? 25.003  91.934  39.411  1.00 88.37  ? 267 ASN B ND2 1 
ATOM   7599  N N   . ARG B 1 242 ? 27.445  87.030  41.369  1.00 76.48  ? 268 ARG B N   1 
ATOM   7600  C CA  . ARG B 1 242 ? 27.230  85.800  42.116  1.00 73.00  ? 268 ARG B CA  1 
ATOM   7601  C C   . ARG B 1 242 ? 28.258  85.685  43.238  1.00 69.42  ? 268 ARG B C   1 
ATOM   7602  O O   . ARG B 1 242 ? 29.207  84.900  43.163  1.00 67.96  ? 268 ARG B O   1 
ATOM   7603  C CB  . ARG B 1 242 ? 27.338  84.604  41.180  1.00 76.33  ? 268 ARG B CB  1 
ATOM   7604  C CG  . ARG B 1 242 ? 26.444  84.710  39.960  1.00 81.20  ? 268 ARG B CG  1 
ATOM   7605  C CD  . ARG B 1 242 ? 24.980  84.852  40.343  1.00 85.17  ? 268 ARG B CD  1 
ATOM   7606  N NE  . ARG B 1 242 ? 24.119  84.898  39.163  1.00 89.35  ? 268 ARG B NE  1 
ATOM   7607  C CZ  . ARG B 1 242 ? 22.795  85.007  39.204  1.00 90.96  ? 268 ARG B CZ  1 
ATOM   7608  N NH1 . ARG B 1 242 ? 22.170  85.083  40.372  1.00 91.54  ? 268 ARG B NH1 1 
ATOM   7609  N NH2 . ARG B 1 242 ? 22.094  85.035  38.076  1.00 91.16  ? 268 ARG B NH2 1 
ATOM   7610  N N   . LYS B 1 243 ? 28.051  86.479  44.284  1.00 64.63  ? 269 LYS B N   1 
ATOM   7611  C CA  . LYS B 1 243 ? 28.949  86.504  45.428  1.00 59.97  ? 269 LYS B CA  1 
ATOM   7612  C C   . LYS B 1 243 ? 28.368  85.789  46.636  1.00 56.89  ? 269 LYS B C   1 
ATOM   7613  O O   . LYS B 1 243 ? 29.016  85.695  47.673  1.00 56.41  ? 269 LYS B O   1 
ATOM   7614  C CB  . LYS B 1 243 ? 29.258  87.949  45.810  1.00 59.71  ? 269 LYS B CB  1 
ATOM   7615  C CG  . LYS B 1 243 ? 28.024  88.762  46.152  1.00 57.53  ? 269 LYS B CG  1 
ATOM   7616  C CD  . LYS B 1 243 ? 28.387  90.161  46.581  1.00 55.33  ? 269 LYS B CD  1 
ATOM   7617  C CE  . LYS B 1 243 ? 29.230  90.142  47.836  1.00 54.34  ? 269 LYS B CE  1 
ATOM   7618  N NZ  . LYS B 1 243 ? 29.557  91.523  48.279  1.00 55.64  ? 269 LYS B NZ  1 
ATOM   7619  N N   . LEU B 1 244 ? 27.146  85.289  46.508  1.00 54.78  ? 270 LEU B N   1 
ATOM   7620  C CA  . LEU B 1 244 ? 26.508  84.596  47.618  1.00 52.60  ? 270 LEU B CA  1 
ATOM   7621  C C   . LEU B 1 244 ? 26.738  83.090  47.583  1.00 50.05  ? 270 LEU B C   1 
ATOM   7622  O O   . LEU B 1 244 ? 26.861  82.486  46.517  1.00 48.26  ? 270 LEU B O   1 
ATOM   7623  C CB  . LEU B 1 244 ? 25.009  84.902  47.632  1.00 54.36  ? 270 LEU B CB  1 
ATOM   7624  C CG  . LEU B 1 244 ? 24.669  86.393  47.778  1.00 58.72  ? 270 LEU B CG  1 
ATOM   7625  C CD1 . LEU B 1 244 ? 23.156  86.564  47.831  1.00 59.05  ? 270 LEU B CD1 1 
ATOM   7626  C CD2 . LEU B 1 244 ? 25.326  86.972  49.039  1.00 57.41  ? 270 LEU B CD2 1 
ATOM   7627  N N   . ALA B 1 245 ? 26.810  82.492  48.765  1.00 47.42  ? 271 ALA B N   1 
ATOM   7628  C CA  . ALA B 1 245 ? 27.025  81.060  48.884  1.00 46.22  ? 271 ALA B CA  1 
ATOM   7629  C C   . ALA B 1 245 ? 26.566  80.587  50.255  1.00 45.37  ? 271 ALA B C   1 
ATOM   7630  O O   . ALA B 1 245 ? 26.443  81.380  51.184  1.00 45.88  ? 271 ALA B O   1 
ATOM   7631  C CB  . ALA B 1 245 ? 28.506  80.729  48.673  1.00 43.34  ? 271 ALA B CB  1 
ATOM   7632  N N   . LYS B 1 246 ? 26.311  79.290  50.375  1.00 45.33  ? 272 LYS B N   1 
ATOM   7633  C CA  . LYS B 1 246 ? 25.867  78.715  51.636  1.00 45.56  ? 272 LYS B CA  1 
ATOM   7634  C C   . LYS B 1 246 ? 26.740  77.529  52.005  1.00 45.04  ? 272 LYS B C   1 
ATOM   7635  O O   . LYS B 1 246 ? 27.396  76.941  51.143  1.00 45.10  ? 272 LYS B O   1 
ATOM   7636  C CB  . LYS B 1 246 ? 24.406  78.275  51.519  1.00 46.26  ? 272 LYS B CB  1 
ATOM   7637  C CG  . LYS B 1 246 ? 23.458  79.432  51.292  1.00 50.64  ? 272 LYS B CG  1 
ATOM   7638  C CD  . LYS B 1 246 ? 22.088  78.975  50.846  1.00 53.54  ? 272 LYS B CD  1 
ATOM   7639  C CE  . LYS B 1 246 ? 21.197  80.178  50.559  1.00 56.31  ? 272 LYS B CE  1 
ATOM   7640  N NZ  . LYS B 1 246 ? 19.861  79.766  50.050  1.00 60.60  ? 272 LYS B NZ  1 
ATOM   7641  N N   . LEU B 1 247 ? 26.760  77.193  53.289  1.00 43.08  ? 273 LEU B N   1 
ATOM   7642  C CA  . LEU B 1 247 ? 27.542  76.066  53.772  1.00 43.64  ? 273 LEU B CA  1 
ATOM   7643  C C   . LEU B 1 247 ? 26.615  75.087  54.487  1.00 44.21  ? 273 LEU B C   1 
ATOM   7644  O O   . LEU B 1 247 ? 25.970  75.435  55.471  1.00 45.55  ? 273 LEU B O   1 
ATOM   7645  C CB  . LEU B 1 247 ? 28.646  76.550  54.714  1.00 42.40  ? 273 LEU B CB  1 
ATOM   7646  C CG  . LEU B 1 247 ? 29.519  75.457  55.340  1.00 44.41  ? 273 LEU B CG  1 
ATOM   7647  C CD1 . LEU B 1 247 ? 30.008  74.484  54.273  1.00 43.34  ? 273 LEU B CD1 1 
ATOM   7648  C CD2 . LEU B 1 247 ? 30.693  76.105  56.058  1.00 43.33  ? 273 LEU B CD2 1 
ATOM   7649  N N   . TYR B 1 248 ? 26.544  73.865  53.970  1.00 45.06  ? 274 TYR B N   1 
ATOM   7650  C CA  . TYR B 1 248 ? 25.686  72.825  54.528  1.00 46.43  ? 274 TYR B CA  1 
ATOM   7651  C C   . TYR B 1 248 ? 26.493  71.695  55.142  1.00 48.05  ? 274 TYR B C   1 
ATOM   7652  O O   . TYR B 1 248 ? 27.627  71.443  54.747  1.00 48.02  ? 274 TYR B O   1 
ATOM   7653  C CB  . TYR B 1 248 ? 24.816  72.206  53.433  1.00 44.25  ? 274 TYR B CB  1 
ATOM   7654  C CG  . TYR B 1 248 ? 23.795  73.108  52.795  1.00 43.24  ? 274 TYR B CG  1 
ATOM   7655  C CD1 . TYR B 1 248 ? 22.456  73.058  53.183  1.00 43.01  ? 274 TYR B CD1 1 
ATOM   7656  C CD2 . TYR B 1 248 ? 24.151  73.968  51.755  1.00 44.32  ? 274 TYR B CD2 1 
ATOM   7657  C CE1 . TYR B 1 248 ? 21.491  73.833  52.545  1.00 44.07  ? 274 TYR B CE1 1 
ATOM   7658  C CE2 . TYR B 1 248 ? 23.197  74.752  51.107  1.00 43.88  ? 274 TYR B CE2 1 
ATOM   7659  C CZ  . TYR B 1 248 ? 21.866  74.680  51.505  1.00 46.23  ? 274 TYR B CZ  1 
ATOM   7660  O OH  . TYR B 1 248 ? 20.911  75.439  50.851  1.00 46.63  ? 274 TYR B OH  1 
ATOM   7661  N N   . LYS B 1 249 ? 25.894  71.010  56.107  1.00 53.34  ? 275 LYS B N   1 
ATOM   7662  C CA  . LYS B 1 249 ? 26.537  69.861  56.727  1.00 57.02  ? 275 LYS B CA  1 
ATOM   7663  C C   . LYS B 1 249 ? 25.780  68.698  56.115  1.00 58.45  ? 275 LYS B C   1 
ATOM   7664  O O   . LYS B 1 249 ? 24.559  68.763  55.973  1.00 56.27  ? 275 LYS B O   1 
ATOM   7665  C CB  . LYS B 1 249 ? 26.353  69.860  58.246  1.00 59.53  ? 275 LYS B CB  1 
ATOM   7666  C CG  . LYS B 1 249 ? 27.139  68.759  58.947  1.00 62.16  ? 275 LYS B CG  1 
ATOM   7667  C CD  . LYS B 1 249 ? 27.031  68.855  60.463  1.00 66.12  ? 275 LYS B CD  1 
ATOM   7668  C CE  . LYS B 1 249 ? 25.659  68.429  60.961  1.00 68.78  ? 275 LYS B CE  1 
ATOM   7669  N NZ  . LYS B 1 249 ? 25.398  66.990  60.673  1.00 70.29  ? 275 LYS B NZ  1 
ATOM   7670  N N   . VAL B 1 250 ? 26.496  67.645  55.739  1.00 63.01  ? 276 VAL B N   1 
ATOM   7671  C CA  . VAL B 1 250 ? 25.852  66.494  55.120  1.00 68.06  ? 276 VAL B CA  1 
ATOM   7672  C C   . VAL B 1 250 ? 26.184  65.180  55.813  1.00 71.98  ? 276 VAL B C   1 
ATOM   7673  O O   . VAL B 1 250 ? 27.281  64.648  55.664  1.00 71.93  ? 276 VAL B O   1 
ATOM   7674  C CB  . VAL B 1 250 ? 26.233  66.400  53.620  1.00 67.11  ? 276 VAL B CB  1 
ATOM   7675  C CG1 . VAL B 1 250 ? 27.744  66.303  53.468  1.00 67.59  ? 276 VAL B CG1 1 
ATOM   7676  C CG2 . VAL B 1 250 ? 25.546  65.207  52.979  1.00 68.14  ? 276 VAL B CG2 1 
ATOM   7677  N N   . SER B 1 251 ? 25.224  64.664  56.576  1.00 78.51  ? 277 SER B N   1 
ATOM   7678  C CA  . SER B 1 251 ? 25.397  63.402  57.293  1.00 85.85  ? 277 SER B CA  1 
ATOM   7679  C C   . SER B 1 251 ? 24.500  62.332  56.688  1.00 89.55  ? 277 SER B C   1 
ATOM   7680  O O   . SER B 1 251 ? 23.276  62.444  56.738  1.00 91.07  ? 277 SER B O   1 
ATOM   7681  C CB  . SER B 1 251 ? 25.053  63.571  58.778  1.00 86.72  ? 277 SER B CB  1 
ATOM   7682  O OG  . SER B 1 251 ? 26.014  64.374  59.445  1.00 89.04  ? 277 SER B OG  1 
ATOM   7683  N N   . ASN B 1 252 ? 25.110  61.296  56.121  1.00 93.42  ? 278 ASN B N   1 
ATOM   7684  C CA  . ASN B 1 252 ? 24.351  60.214  55.501  1.00 96.83  ? 278 ASN B CA  1 
ATOM   7685  C C   . ASN B 1 252 ? 24.982  58.844  55.744  1.00 97.75  ? 278 ASN B C   1 
ATOM   7686  O O   . ASN B 1 252 ? 26.164  58.638  55.464  1.00 98.22  ? 278 ASN B O   1 
ATOM   7687  C CB  . ASN B 1 252 ? 24.220  60.468  53.994  1.00 98.46  ? 278 ASN B CB  1 
ATOM   7688  C CG  . ASN B 1 252 ? 25.564  60.624  53.307  1.00 99.02  ? 278 ASN B CG  1 
ATOM   7689  O OD1 . ASN B 1 252 ? 26.351  61.509  53.647  1.00 98.94  ? 278 ASN B OD1 1 
ATOM   7690  N ND2 . ASN B 1 252 ? 25.833  59.762  52.333  1.00 99.65  ? 278 ASN B ND2 1 
ATOM   7691  N N   . GLY B 1 253 ? 24.182  57.914  56.263  1.00 98.76  ? 279 GLY B N   1 
ATOM   7692  C CA  . GLY B 1 253 ? 24.668  56.572  56.539  1.00 99.55  ? 279 GLY B CA  1 
ATOM   7693  C C   . GLY B 1 253 ? 25.172  55.849  55.303  1.00 100.21 ? 279 GLY B C   1 
ATOM   7694  O O   . GLY B 1 253 ? 26.086  55.026  55.386  1.00 100.29 ? 279 GLY B O   1 
ATOM   7695  N N   . ALA B 1 254 ? 24.573  56.156  54.154  1.00 100.41 ? 280 ALA B N   1 
ATOM   7696  C CA  . ALA B 1 254 ? 24.956  55.548  52.880  1.00 100.41 ? 280 ALA B CA  1 
ATOM   7697  C C   . ALA B 1 254 ? 24.146  56.166  51.740  1.00 100.41 ? 280 ALA B C   1 
ATOM   7698  O O   . ALA B 1 254 ? 24.706  56.667  50.761  1.00 100.25 ? 280 ALA B O   1 
ATOM   7699  C CB  . ALA B 1 254 ? 24.728  54.035  52.927  1.00 100.15 ? 280 ALA B CB  1 
ATOM   7700  N N   . GLY B 1 255 ? 22.824  56.126  51.884  1.00 100.41 ? 281 GLY B N   1 
ATOM   7701  C CA  . GLY B 1 255 ? 21.938  56.680  50.876  1.00 99.98  ? 281 GLY B CA  1 
ATOM   7702  C C   . GLY B 1 255 ? 21.078  57.811  51.414  1.00 99.65  ? 281 GLY B C   1 
ATOM   7703  O O   . GLY B 1 255 ? 20.915  58.831  50.741  1.00 100.19 ? 281 GLY B O   1 
ATOM   7704  N N   . PRO B 1 256 ? 20.500  57.658  52.622  1.00 98.66  ? 282 PRO B N   1 
ATOM   7705  C CA  . PRO B 1 256 ? 19.656  58.698  53.224  1.00 97.24  ? 282 PRO B CA  1 
ATOM   7706  C C   . PRO B 1 256 ? 20.454  59.976  53.471  1.00 95.51  ? 282 PRO B C   1 
ATOM   7707  O O   . PRO B 1 256 ? 20.966  60.193  54.572  1.00 95.33  ? 282 PRO B O   1 
ATOM   7708  C CB  . PRO B 1 256 ? 19.195  58.053  54.530  1.00 97.44  ? 282 PRO B CB  1 
ATOM   7709  C CG  . PRO B 1 256 ? 19.178  56.596  54.200  1.00 97.93  ? 282 PRO B CG  1 
ATOM   7710  C CD  . PRO B 1 256 ? 20.465  56.431  53.437  1.00 98.31  ? 282 PRO B CD  1 
ATOM   7711  N N   . MET B 1 257 ? 20.558  60.821  52.450  1.00 92.72  ? 283 MET B N   1 
ATOM   7712  C CA  . MET B 1 257 ? 21.312  62.060  52.576  1.00 89.70  ? 283 MET B CA  1 
ATOM   7713  C C   . MET B 1 257 ? 20.590  63.107  53.410  1.00 88.01  ? 283 MET B C   1 
ATOM   7714  O O   . MET B 1 257 ? 19.531  63.608  53.025  1.00 88.25  ? 283 MET B O   1 
ATOM   7715  C CB  . MET B 1 257 ? 21.631  62.641  51.197  1.00 89.10  ? 283 MET B CB  1 
ATOM   7716  C CG  . MET B 1 257 ? 22.476  63.906  51.262  1.00 88.18  ? 283 MET B CG  1 
ATOM   7717  S SD  . MET B 1 257 ? 22.953  64.537  49.649  1.00 86.86  ? 283 MET B SD  1 
ATOM   7718  C CE  . MET B 1 257 ? 21.574  65.637  49.286  1.00 86.96  ? 283 MET B CE  1 
ATOM   7719  N N   . VAL B 1 258 ? 21.176  63.431  54.557  1.00 84.98  ? 284 VAL B N   1 
ATOM   7720  C CA  . VAL B 1 258 ? 20.614  64.428  55.455  1.00 82.01  ? 284 VAL B CA  1 
ATOM   7721  C C   . VAL B 1 258 ? 21.372  65.729  55.256  1.00 79.18  ? 284 VAL B C   1 
ATOM   7722  O O   . VAL B 1 258 ? 22.524  65.853  55.670  1.00 79.78  ? 284 VAL B O   1 
ATOM   7723  C CB  . VAL B 1 258 ? 20.757  64.004  56.932  1.00 83.16  ? 284 VAL B CB  1 
ATOM   7724  C CG1 . VAL B 1 258 ? 20.172  65.076  57.842  1.00 82.56  ? 284 VAL B CG1 1 
ATOM   7725  C CG2 . VAL B 1 258 ? 20.070  62.664  57.160  1.00 83.24  ? 284 VAL B CG2 1 
ATOM   7726  N N   . VAL B 1 259 ? 20.731  66.697  54.616  1.00 75.44  ? 285 VAL B N   1 
ATOM   7727  C CA  . VAL B 1 259 ? 21.368  67.983  54.374  1.00 72.08  ? 285 VAL B CA  1 
ATOM   7728  C C   . VAL B 1 259 ? 20.860  69.023  55.373  1.00 68.85  ? 285 VAL B C   1 
ATOM   7729  O O   . VAL B 1 259 ? 19.668  69.077  55.667  1.00 67.60  ? 285 VAL B O   1 
ATOM   7730  C CB  . VAL B 1 259 ? 21.093  68.469  52.932  1.00 72.08  ? 285 VAL B CB  1 
ATOM   7731  C CG1 . VAL B 1 259 ? 19.597  68.647  52.718  1.00 72.33  ? 285 VAL B CG1 1 
ATOM   7732  C CG2 . VAL B 1 259 ? 21.836  69.764  52.667  1.00 71.88  ? 285 VAL B CG2 1 
ATOM   7733  N N   . SER B 1 260 ? 21.765  69.841  55.900  1.00 65.60  ? 286 SER B N   1 
ATOM   7734  C CA  . SER B 1 260 ? 21.375  70.865  56.863  1.00 62.77  ? 286 SER B CA  1 
ATOM   7735  C C   . SER B 1 260 ? 22.247  72.119  56.814  1.00 60.31  ? 286 SER B C   1 
ATOM   7736  O O   . SER B 1 260 ? 23.480  72.046  56.853  1.00 58.20  ? 286 SER B O   1 
ATOM   7737  C CB  . SER B 1 260 ? 21.376  70.283  58.278  1.00 62.17  ? 286 SER B CB  1 
ATOM   7738  O OG  . SER B 1 260 ? 22.595  69.623  58.555  1.00 63.43  ? 286 SER B OG  1 
ATOM   7739  N N   . LEU B 1 261 ? 21.580  73.268  56.735  1.00 57.42  ? 287 LEU B N   1 
ATOM   7740  C CA  . LEU B 1 261 ? 22.237  74.571  56.673  1.00 54.93  ? 287 LEU B CA  1 
ATOM   7741  C C   . LEU B 1 261 ? 23.037  74.851  57.944  1.00 53.73  ? 287 LEU B C   1 
ATOM   7742  O O   . LEU B 1 261 ? 22.573  74.560  59.045  1.00 54.63  ? 287 LEU B O   1 
ATOM   7743  C CB  . LEU B 1 261 ? 21.180  75.660  56.472  1.00 52.05  ? 287 LEU B CB  1 
ATOM   7744  C CG  . LEU B 1 261 ? 21.661  77.070  56.121  1.00 54.14  ? 287 LEU B CG  1 
ATOM   7745  C CD1 . LEU B 1 261 ? 22.344  77.048  54.757  1.00 54.54  ? 287 LEU B CD1 1 
ATOM   7746  C CD2 . LEU B 1 261 ? 20.479  78.031  56.100  1.00 52.52  ? 287 LEU B CD2 1 
ATOM   7747  N N   . VAL B 1 262 ? 24.237  75.407  57.794  1.00 52.91  ? 288 VAL B N   1 
ATOM   7748  C CA  . VAL B 1 262 ? 25.077  75.726  58.947  1.00 53.23  ? 288 VAL B CA  1 
ATOM   7749  C C   . VAL B 1 262 ? 25.585  77.162  58.875  1.00 54.97  ? 288 VAL B C   1 
ATOM   7750  O O   . VAL B 1 262 ? 26.073  77.713  59.866  1.00 54.98  ? 288 VAL B O   1 
ATOM   7751  C CB  . VAL B 1 262 ? 26.302  74.785  59.047  1.00 51.95  ? 288 VAL B CB  1 
ATOM   7752  C CG1 . VAL B 1 262 ? 25.885  73.358  58.775  1.00 53.44  ? 288 VAL B CG1 1 
ATOM   7753  C CG2 . VAL B 1 262 ? 27.377  75.217  58.085  1.00 52.91  ? 288 VAL B CG2 1 
ATOM   7754  N N   . ALA B 1 263 ? 25.473  77.756  57.689  1.00 56.47  ? 289 ALA B N   1 
ATOM   7755  C CA  . ALA B 1 263 ? 25.912  79.129  57.451  1.00 57.13  ? 289 ALA B CA  1 
ATOM   7756  C C   . ALA B 1 263 ? 25.087  79.689  56.306  1.00 57.99  ? 289 ALA B C   1 
ATOM   7757  O O   . ALA B 1 263 ? 25.322  79.375  55.146  1.00 60.30  ? 289 ALA B O   1 
ATOM   7758  C CB  . ALA B 1 263 ? 27.391  79.157  57.099  1.00 55.55  ? 289 ALA B CB  1 
ATOM   7759  N N   . ASP B 1 264 ? 24.117  80.525  56.643  1.00 60.78  ? 290 ASP B N   1 
ATOM   7760  C CA  . ASP B 1 264 ? 23.223  81.107  55.652  1.00 62.49  ? 290 ASP B CA  1 
ATOM   7761  C C   . ASP B 1 264 ? 23.903  81.990  54.615  1.00 62.27  ? 290 ASP B C   1 
ATOM   7762  O O   . ASP B 1 264 ? 23.540  81.970  53.435  1.00 61.17  ? 290 ASP B O   1 
ATOM   7763  C CB  . ASP B 1 264 ? 22.140  81.927  56.354  1.00 65.62  ? 290 ASP B CB  1 
ATOM   7764  C CG  . ASP B 1 264 ? 21.037  82.355  55.409  1.00 68.17  ? 290 ASP B CG  1 
ATOM   7765  O OD1 . ASP B 1 264 ? 20.249  83.252  55.781  1.00 68.75  ? 290 ASP B OD1 1 
ATOM   7766  O OD2 . ASP B 1 264 ? 20.956  81.783  54.299  1.00 69.07  ? 290 ASP B OD2 1 
ATOM   7767  N N   . GLU B 1 265 ? 24.887  82.766  55.056  1.00 62.32  ? 291 GLU B N   1 
ATOM   7768  C CA  . GLU B 1 265 ? 25.574  83.681  54.160  1.00 62.47  ? 291 GLU B CA  1 
ATOM   7769  C C   . GLU B 1 265 ? 27.072  83.778  54.420  1.00 60.48  ? 291 GLU B C   1 
ATOM   7770  O O   . GLU B 1 265 ? 27.528  83.679  55.562  1.00 61.53  ? 291 GLU B O   1 
ATOM   7771  C CB  . GLU B 1 265 ? 24.937  85.066  54.288  1.00 66.13  ? 291 GLU B CB  1 
ATOM   7772  C CG  . GLU B 1 265 ? 25.372  86.072  53.245  1.00 72.73  ? 291 GLU B CG  1 
ATOM   7773  C CD  . GLU B 1 265 ? 24.581  87.365  53.326  1.00 76.52  ? 291 GLU B CD  1 
ATOM   7774  O OE1 . GLU B 1 265 ? 23.335  87.311  53.215  1.00 77.04  ? 291 GLU B OE1 1 
ATOM   7775  O OE2 . GLU B 1 265 ? 25.205  88.435  53.499  1.00 79.42  ? 291 GLU B OE2 1 
ATOM   7776  N N   . ASN B 1 266 ? 27.833  83.966  53.346  1.00 56.15  ? 292 ASN B N   1 
ATOM   7777  C CA  . ASN B 1 266 ? 29.279  84.101  53.434  1.00 51.57  ? 292 ASN B CA  1 
ATOM   7778  C C   . ASN B 1 266 ? 29.607  85.586  53.614  1.00 51.02  ? 292 ASN B C   1 
ATOM   7779  O O   . ASN B 1 266 ? 28.799  86.451  53.276  1.00 50.60  ? 292 ASN B O   1 
ATOM   7780  C CB  . ASN B 1 266 ? 29.928  83.569  52.164  1.00 48.74  ? 292 ASN B CB  1 
ATOM   7781  C CG  . ASN B 1 266 ? 29.439  84.288  50.921  1.00 48.55  ? 292 ASN B CG  1 
ATOM   7782  O OD1 . ASN B 1 266 ? 30.217  84.934  50.220  1.00 48.62  ? 292 ASN B OD1 1 
ATOM   7783  N ND2 . ASN B 1 266 ? 28.145  84.182  50.642  1.00 46.41  ? 292 ASN B ND2 1 
ATOM   7784  N N   . PRO B 1 267 ? 30.803  85.902  54.134  1.00 50.01  ? 293 PRO B N   1 
ATOM   7785  C CA  . PRO B 1 267 ? 31.853  84.977  54.573  1.00 49.99  ? 293 PRO B CA  1 
ATOM   7786  C C   . PRO B 1 267 ? 31.362  83.946  55.590  1.00 50.28  ? 293 PRO B C   1 
ATOM   7787  O O   . PRO B 1 267 ? 30.328  84.140  56.247  1.00 51.63  ? 293 PRO B O   1 
ATOM   7788  C CB  . PRO B 1 267 ? 32.905  85.907  55.172  1.00 48.40  ? 293 PRO B CB  1 
ATOM   7789  C CG  . PRO B 1 267 ? 32.719  87.159  54.408  1.00 49.35  ? 293 PRO B CG  1 
ATOM   7790  C CD  . PRO B 1 267 ? 31.221  87.292  54.369  1.00 48.86  ? 293 PRO B CD  1 
ATOM   7791  N N   . PHE B 1 268 ? 32.103  82.849  55.702  1.00 45.94  ? 294 PHE B N   1 
ATOM   7792  C CA  . PHE B 1 268 ? 31.771  81.798  56.642  1.00 42.03  ? 294 PHE B CA  1 
ATOM   7793  C C   . PHE B 1 268 ? 32.861  81.823  57.694  1.00 40.76  ? 294 PHE B C   1 
ATOM   7794  O O   . PHE B 1 268 ? 33.880  82.484  57.513  1.00 40.01  ? 294 PHE B O   1 
ATOM   7795  C CB  . PHE B 1 268 ? 31.767  80.429  55.958  1.00 42.18  ? 294 PHE B CB  1 
ATOM   7796  C CG  . PHE B 1 268 ? 30.826  80.324  54.787  1.00 42.29  ? 294 PHE B CG  1 
ATOM   7797  C CD1 . PHE B 1 268 ? 29.513  80.778  54.885  1.00 40.35  ? 294 PHE B CD1 1 
ATOM   7798  C CD2 . PHE B 1 268 ? 31.248  79.736  53.595  1.00 39.11  ? 294 PHE B CD2 1 
ATOM   7799  C CE1 . PHE B 1 268 ? 28.634  80.648  53.815  1.00 40.08  ? 294 PHE B CE1 1 
ATOM   7800  C CE2 . PHE B 1 268 ? 30.379  79.604  52.522  1.00 39.47  ? 294 PHE B CE2 1 
ATOM   7801  C CZ  . PHE B 1 268 ? 29.066  80.060  52.631  1.00 40.07  ? 294 PHE B CZ  1 
ATOM   7802  N N   . ALA B 1 269 ? 32.645  81.101  58.789  1.00 40.29  ? 295 ALA B N   1 
ATOM   7803  C CA  . ALA B 1 269 ? 33.623  81.025  59.867  1.00 39.06  ? 295 ALA B CA  1 
ATOM   7804  C C   . ALA B 1 269 ? 34.371  79.702  59.768  1.00 38.86  ? 295 ALA B C   1 
ATOM   7805  O O   . ALA B 1 269 ? 33.761  78.634  59.854  1.00 38.61  ? 295 ALA B O   1 
ATOM   7806  C CB  . ALA B 1 269 ? 32.921  81.128  61.211  1.00 36.98  ? 295 ALA B CB  1 
ATOM   7807  N N   . GLN B 1 270 ? 35.687  79.774  59.586  1.00 39.15  ? 296 GLN B N   1 
ATOM   7808  C CA  . GLN B 1 270 ? 36.520  78.575  59.474  1.00 40.87  ? 296 GLN B CA  1 
ATOM   7809  C C   . GLN B 1 270 ? 36.228  77.542  60.562  1.00 43.70  ? 296 GLN B C   1 
ATOM   7810  O O   . GLN B 1 270 ? 36.422  76.342  60.355  1.00 45.57  ? 296 GLN B O   1 
ATOM   7811  C CB  . GLN B 1 270 ? 38.006  78.954  59.504  1.00 37.64  ? 296 GLN B CB  1 
ATOM   7812  C CG  . GLN B 1 270 ? 38.935  77.800  59.810  1.00 37.38  ? 296 GLN B CG  1 
ATOM   7813  C CD  . GLN B 1 270 ? 40.358  78.048  59.354  1.00 39.34  ? 296 GLN B CD  1 
ATOM   7814  O OE1 . GLN B 1 270 ? 40.905  79.134  59.550  1.00 45.20  ? 296 GLN B OE1 1 
ATOM   7815  N NE2 . GLN B 1 270 ? 40.973  77.035  58.749  1.00 36.57  ? 296 GLN B NE2 1 
ATOM   7816  N N   . GLY B 1 271 ? 35.763  78.010  61.716  1.00 44.46  ? 297 GLY B N   1 
ATOM   7817  C CA  . GLY B 1 271 ? 35.458  77.100  62.801  1.00 45.87  ? 297 GLY B CA  1 
ATOM   7818  C C   . GLY B 1 271 ? 34.212  76.260  62.570  1.00 47.71  ? 297 GLY B C   1 
ATOM   7819  O O   . GLY B 1 271 ? 33.905  75.383  63.374  1.00 48.71  ? 297 GLY B O   1 
ATOM   7820  N N   . ALA B 1 272 ? 33.490  76.514  61.482  1.00 47.90  ? 298 ALA B N   1 
ATOM   7821  C CA  . ALA B 1 272 ? 32.277  75.753  61.181  1.00 48.82  ? 298 ALA B CA  1 
ATOM   7822  C C   . ALA B 1 272 ? 32.598  74.389  60.570  1.00 50.04  ? 298 ALA B C   1 
ATOM   7823  O O   . ALA B 1 272 ? 31.723  73.524  60.460  1.00 48.37  ? 298 ALA B O   1 
ATOM   7824  C CB  . ALA B 1 272 ? 31.383  76.544  60.238  1.00 46.58  ? 298 ALA B CB  1 
ATOM   7825  N N   . LEU B 1 273 ? 33.855  74.208  60.175  1.00 51.14  ? 299 LEU B N   1 
ATOM   7826  C CA  . LEU B 1 273 ? 34.313  72.962  59.570  1.00 53.76  ? 299 LEU B CA  1 
ATOM   7827  C C   . LEU B 1 273 ? 34.756  71.964  60.630  1.00 54.99  ? 299 LEU B C   1 
ATOM   7828  O O   . LEU B 1 273 ? 35.859  72.068  61.163  1.00 56.54  ? 299 LEU B O   1 
ATOM   7829  C CB  . LEU B 1 273 ? 35.481  73.242  58.608  1.00 53.56  ? 299 LEU B CB  1 
ATOM   7830  C CG  . LEU B 1 273 ? 35.218  73.572  57.128  1.00 54.77  ? 299 LEU B CG  1 
ATOM   7831  C CD1 . LEU B 1 273 ? 34.063  74.538  56.972  1.00 53.70  ? 299 LEU B CD1 1 
ATOM   7832  C CD2 . LEU B 1 273 ? 36.479  74.155  56.520  1.00 54.00  ? 299 LEU B CD2 1 
ATOM   7833  N N   . ARG B 1 274 ? 33.901  70.994  60.935  1.00 56.45  ? 300 ARG B N   1 
ATOM   7834  C CA  . ARG B 1 274 ? 34.240  69.988  61.935  1.00 57.95  ? 300 ARG B CA  1 
ATOM   7835  C C   . ARG B 1 274 ? 34.787  68.707  61.308  1.00 56.93  ? 300 ARG B C   1 
ATOM   7836  O O   . ARG B 1 274 ? 34.144  68.085  60.458  1.00 56.87  ? 300 ARG B O   1 
ATOM   7837  C CB  . ARG B 1 274 ? 33.023  69.657  62.796  1.00 61.75  ? 300 ARG B CB  1 
ATOM   7838  C CG  . ARG B 1 274 ? 32.507  70.823  63.613  1.00 68.47  ? 300 ARG B CG  1 
ATOM   7839  C CD  . ARG B 1 274 ? 31.980  70.346  64.958  1.00 75.05  ? 300 ARG B CD  1 
ATOM   7840  N NE  . ARG B 1 274 ? 31.066  69.215  64.822  1.00 79.12  ? 300 ARG B NE  1 
ATOM   7841  C CZ  . ARG B 1 274 ? 30.551  68.550  65.849  1.00 80.62  ? 300 ARG B CZ  1 
ATOM   7842  N NH1 . ARG B 1 274 ? 30.861  68.905  67.088  1.00 81.69  ? 300 ARG B NH1 1 
ATOM   7843  N NH2 . ARG B 1 274 ? 29.724  67.533  65.639  1.00 82.24  ? 300 ARG B NH2 1 
ATOM   7844  N N   . SER B 1 275 ? 35.974  68.312  61.751  1.00 54.11  ? 301 SER B N   1 
ATOM   7845  C CA  . SER B 1 275 ? 36.642  67.124  61.244  1.00 53.99  ? 301 SER B CA  1 
ATOM   7846  C C   . SER B 1 275 ? 35.827  65.836  61.297  1.00 53.60  ? 301 SER B C   1 
ATOM   7847  O O   . SER B 1 275 ? 36.187  64.852  60.657  1.00 51.54  ? 301 SER B O   1 
ATOM   7848  C CB  . SER B 1 275 ? 37.952  66.914  61.999  1.00 54.24  ? 301 SER B CB  1 
ATOM   7849  O OG  . SER B 1 275 ? 38.773  68.061  61.900  1.00 55.66  ? 301 SER B OG  1 
ATOM   7850  N N   . GLU B 1 276 ? 34.735  65.836  62.055  1.00 55.16  ? 302 GLU B N   1 
ATOM   7851  C CA  . GLU B 1 276 ? 33.905  64.641  62.180  1.00 56.57  ? 302 GLU B CA  1 
ATOM   7852  C C   . GLU B 1 276 ? 32.908  64.482  61.041  1.00 55.51  ? 302 GLU B C   1 
ATOM   7853  O O   . GLU B 1 276 ? 32.356  63.397  60.840  1.00 54.70  ? 302 GLU B O   1 
ATOM   7854  C CB  . GLU B 1 276 ? 33.116  64.653  63.498  1.00 59.79  ? 302 GLU B CB  1 
ATOM   7855  C CG  . GLU B 1 276 ? 33.948  64.763  64.762  1.00 64.19  ? 302 GLU B CG  1 
ATOM   7856  C CD  . GLU B 1 276 ? 34.420  66.178  65.018  1.00 67.80  ? 302 GLU B CD  1 
ATOM   7857  O OE1 . GLU B 1 276 ? 33.564  67.090  64.997  1.00 67.52  ? 302 GLU B OE1 1 
ATOM   7858  O OE2 . GLU B 1 276 ? 35.639  66.375  65.243  1.00 68.49  ? 302 GLU B OE2 1 
ATOM   7859  N N   . ASP B 1 277 ? 32.679  65.555  60.293  1.00 53.65  ? 303 ASP B N   1 
ATOM   7860  C CA  . ASP B 1 277 ? 31.704  65.500  59.214  1.00 51.61  ? 303 ASP B CA  1 
ATOM   7861  C C   . ASP B 1 277 ? 32.192  65.919  57.832  1.00 49.22  ? 303 ASP B C   1 
ATOM   7862  O O   . ASP B 1 277 ? 33.369  66.229  57.624  1.00 50.01  ? 303 ASP B O   1 
ATOM   7863  C CB  . ASP B 1 277 ? 30.498  66.359  59.590  1.00 53.76  ? 303 ASP B CB  1 
ATOM   7864  C CG  . ASP B 1 277 ? 30.027  66.109  61.004  1.00 54.68  ? 303 ASP B CG  1 
ATOM   7865  O OD1 . ASP B 1 277 ? 29.670  64.950  61.305  1.00 54.46  ? 303 ASP B OD1 1 
ATOM   7866  O OD2 . ASP B 1 277 ? 30.016  67.069  61.809  1.00 54.59  ? 303 ASP B OD2 1 
ATOM   7867  N N   . CYS B 1 278 ? 31.254  65.903  56.891  1.00 44.59  ? 304 CYS B N   1 
ATOM   7868  C CA  . CYS B 1 278 ? 31.497  66.296  55.516  1.00 40.26  ? 304 CYS B CA  1 
ATOM   7869  C C   . CYS B 1 278 ? 30.589  67.491  55.280  1.00 38.79  ? 304 CYS B C   1 
ATOM   7870  O O   . CYS B 1 278 ? 29.426  67.482  55.685  1.00 37.18  ? 304 CYS B O   1 
ATOM   7871  C CB  . CYS B 1 278 ? 31.125  65.163  54.554  1.00 39.12  ? 304 CYS B CB  1 
ATOM   7872  S SG  . CYS B 1 278 ? 32.323  63.797  54.439  1.00 41.11  ? 304 CYS B SG  1 
ATOM   7873  N N   . PHE B 1 279 ? 31.117  68.524  54.638  1.00 38.26  ? 305 PHE B N   1 
ATOM   7874  C CA  . PHE B 1 279 ? 30.329  69.722  54.365  1.00 37.45  ? 305 PHE B CA  1 
ATOM   7875  C C   . PHE B 1 279 ? 30.241  70.021  52.880  1.00 35.62  ? 305 PHE B C   1 
ATOM   7876  O O   . PHE B 1 279 ? 31.096  69.600  52.093  1.00 34.16  ? 305 PHE B O   1 
ATOM   7877  C CB  . PHE B 1 279 ? 30.935  70.944  55.062  1.00 40.06  ? 305 PHE B CB  1 
ATOM   7878  C CG  . PHE B 1 279 ? 30.956  70.849  56.555  1.00 42.64  ? 305 PHE B CG  1 
ATOM   7879  C CD1 . PHE B 1 279 ? 31.882  70.041  57.201  1.00 45.96  ? 305 PHE B CD1 1 
ATOM   7880  C CD2 . PHE B 1 279 ? 30.047  71.569  57.318  1.00 43.52  ? 305 PHE B CD2 1 
ATOM   7881  C CE1 . PHE B 1 279 ? 31.905  69.952  58.589  1.00 47.70  ? 305 PHE B CE1 1 
ATOM   7882  C CE2 . PHE B 1 279 ? 30.059  71.488  58.702  1.00 45.51  ? 305 PHE B CE2 1 
ATOM   7883  C CZ  . PHE B 1 279 ? 30.990  70.679  59.341  1.00 47.17  ? 305 PHE B CZ  1 
ATOM   7884  N N   . ILE B 1 280 ? 29.200  70.752  52.504  1.00 32.75  ? 306 ILE B N   1 
ATOM   7885  C CA  . ILE B 1 280 ? 29.016  71.144  51.119  1.00 31.42  ? 306 ILE B CA  1 
ATOM   7886  C C   . ILE B 1 280 ? 28.933  72.654  50.995  1.00 30.68  ? 306 ILE B C   1 
ATOM   7887  O O   . ILE B 1 280 ? 27.966  73.267  51.430  1.00 32.17  ? 306 ILE B O   1 
ATOM   7888  C CB  . ILE B 1 280 ? 27.729  70.544  50.496  1.00 32.91  ? 306 ILE B CB  1 
ATOM   7889  C CG1 . ILE B 1 280 ? 27.887  69.033  50.298  1.00 32.44  ? 306 ILE B CG1 1 
ATOM   7890  C CG2 . ILE B 1 280 ? 27.444  71.207  49.140  1.00 31.88  ? 306 ILE B CG2 1 
ATOM   7891  C CD1 . ILE B 1 280 ? 26.701  68.396  49.591  1.00 28.40  ? 306 ILE B CD1 1 
ATOM   7892  N N   . LEU B 1 281 ? 29.968  73.250  50.422  1.00 29.58  ? 307 LEU B N   1 
ATOM   7893  C CA  . LEU B 1 281 ? 29.999  74.688  50.181  1.00 30.64  ? 307 LEU B CA  1 
ATOM   7894  C C   . LEU B 1 281 ? 29.166  74.845  48.895  1.00 30.31  ? 307 LEU B C   1 
ATOM   7895  O O   . LEU B 1 281 ? 29.545  74.339  47.842  1.00 28.14  ? 307 LEU B O   1 
ATOM   7896  C CB  . LEU B 1 281 ? 31.447  75.125  49.940  1.00 31.24  ? 307 LEU B CB  1 
ATOM   7897  C CG  . LEU B 1 281 ? 31.921  76.574  49.738  1.00 33.12  ? 307 LEU B CG  1 
ATOM   7898  C CD1 . LEU B 1 281 ? 30.814  77.469  49.197  1.00 28.09  ? 307 LEU B CD1 1 
ATOM   7899  C CD2 . LEU B 1 281 ? 32.447  77.088  51.052  1.00 31.21  ? 307 LEU B CD2 1 
ATOM   7900  N N   . ASP B 1 282 ? 28.028  75.522  48.977  1.00 33.58  ? 308 ASP B N   1 
ATOM   7901  C CA  . ASP B 1 282 ? 27.181  75.694  47.802  1.00 37.10  ? 308 ASP B CA  1 
ATOM   7902  C C   . ASP B 1 282 ? 27.338  77.045  47.110  1.00 39.89  ? 308 ASP B C   1 
ATOM   7903  O O   . ASP B 1 282 ? 27.086  78.099  47.702  1.00 41.70  ? 308 ASP B O   1 
ATOM   7904  C CB  . ASP B 1 282 ? 25.709  75.490  48.169  1.00 36.70  ? 308 ASP B CB  1 
ATOM   7905  C CG  . ASP B 1 282 ? 24.772  75.678  46.977  1.00 38.35  ? 308 ASP B CG  1 
ATOM   7906  O OD1 . ASP B 1 282 ? 23.542  75.561  47.164  1.00 39.70  ? 308 ASP B OD1 1 
ATOM   7907  O OD2 . ASP B 1 282 ? 25.252  75.937  45.854  1.00 38.83  ? 308 ASP B OD2 1 
ATOM   7908  N N   . HIS B 1 283 ? 27.754  76.994  45.848  1.00 40.54  ? 309 HIS B N   1 
ATOM   7909  C CA  . HIS B 1 283 ? 27.931  78.187  45.030  1.00 40.79  ? 309 HIS B CA  1 
ATOM   7910  C C   . HIS B 1 283 ? 27.261  77.863  43.698  1.00 42.50  ? 309 HIS B C   1 
ATOM   7911  O O   . HIS B 1 283 ? 27.801  78.145  42.626  1.00 43.03  ? 309 HIS B O   1 
ATOM   7912  C CB  . HIS B 1 283 ? 29.418  78.473  44.810  1.00 39.59  ? 309 HIS B CB  1 
ATOM   7913  C CG  . HIS B 1 283 ? 29.709  79.881  44.386  1.00 41.52  ? 309 HIS B CG  1 
ATOM   7914  N ND1 . HIS B 1 283 ? 30.902  80.250  43.801  1.00 41.19  ? 309 HIS B ND1 1 
ATOM   7915  C CD2 . HIS B 1 283 ? 28.982  81.017  44.502  1.00 42.42  ? 309 HIS B CD2 1 
ATOM   7916  C CE1 . HIS B 1 283 ? 30.897  81.552  43.575  1.00 41.41  ? 309 HIS B CE1 1 
ATOM   7917  N NE2 . HIS B 1 283 ? 29.744  82.041  43.992  1.00 43.39  ? 309 HIS B NE2 1 
ATOM   7918  N N   . GLY B 1 284 ? 26.085  77.247  43.785  1.00 42.85  ? 310 GLY B N   1 
ATOM   7919  C CA  . GLY B 1 284 ? 25.340  76.867  42.597  1.00 45.48  ? 310 GLY B CA  1 
ATOM   7920  C C   . GLY B 1 284 ? 25.026  78.010  41.652  1.00 46.76  ? 310 GLY B C   1 
ATOM   7921  O O   . GLY B 1 284 ? 25.083  77.841  40.433  1.00 46.87  ? 310 GLY B O   1 
ATOM   7922  N N   . LYS B 1 285 ? 24.682  79.170  42.208  1.00 48.31  ? 311 LYS B N   1 
ATOM   7923  C CA  . LYS B 1 285 ? 24.366  80.341  41.396  1.00 49.69  ? 311 LYS B CA  1 
ATOM   7924  C C   . LYS B 1 285 ? 25.466  80.557  40.365  1.00 49.62  ? 311 LYS B C   1 
ATOM   7925  O O   . LYS B 1 285 ? 25.189  80.841  39.198  1.00 49.58  ? 311 LYS B O   1 
ATOM   7926  C CB  . LYS B 1 285 ? 24.243  81.589  42.274  1.00 53.34  ? 311 LYS B CB  1 
ATOM   7927  C CG  . LYS B 1 285 ? 23.002  81.645  43.163  1.00 56.36  ? 311 LYS B CG  1 
ATOM   7928  C CD  . LYS B 1 285 ? 21.726  81.709  42.343  1.00 58.80  ? 311 LYS B CD  1 
ATOM   7929  C CE  . LYS B 1 285 ? 20.542  82.143  43.197  1.00 61.77  ? 311 LYS B CE  1 
ATOM   7930  N NZ  . LYS B 1 285 ? 20.327  81.259  44.373  1.00 63.39  ? 311 LYS B NZ  1 
ATOM   7931  N N   . ASP B 1 286 ? 26.715  80.410  40.807  1.00 47.93  ? 312 ASP B N   1 
ATOM   7932  C CA  . ASP B 1 286 ? 27.868  80.577  39.934  1.00 44.82  ? 312 ASP B CA  1 
ATOM   7933  C C   . ASP B 1 286 ? 28.267  79.233  39.304  1.00 42.54  ? 312 ASP B C   1 
ATOM   7934  O O   . ASP B 1 286 ? 29.364  79.098  38.762  1.00 41.69  ? 312 ASP B O   1 
ATOM   7935  C CB  . ASP B 1 286 ? 29.050  81.158  40.721  1.00 46.55  ? 312 ASP B CB  1 
ATOM   7936  C CG  . ASP B 1 286 ? 30.067  81.854  39.825  1.00 47.73  ? 312 ASP B CG  1 
ATOM   7937  O OD1 . ASP B 1 286 ? 31.227  82.032  40.255  1.00 50.06  ? 312 ASP B OD1 1 
ATOM   7938  O OD2 . ASP B 1 286 ? 29.705  82.235  38.694  1.00 48.36  ? 312 ASP B OD2 1 
ATOM   7939  N N   . GLY B 1 287 ? 27.378  78.243  39.398  1.00 39.55  ? 313 GLY B N   1 
ATOM   7940  C CA  . GLY B 1 287 ? 27.623  76.930  38.810  1.00 36.02  ? 313 GLY B CA  1 
ATOM   7941  C C   . GLY B 1 287 ? 28.712  76.038  39.393  1.00 33.71  ? 313 GLY B C   1 
ATOM   7942  O O   . GLY B 1 287 ? 29.326  75.258  38.669  1.00 32.43  ? 313 GLY B O   1 
ATOM   7943  N N   . LYS B 1 288 ? 28.935  76.113  40.699  1.00 31.68  ? 314 LYS B N   1 
ATOM   7944  C CA  . LYS B 1 288 ? 29.970  75.304  41.324  1.00 32.49  ? 314 LYS B CA  1 
ATOM   7945  C C   . LYS B 1 288 ? 29.625  74.934  42.774  1.00 32.56  ? 314 LYS B C   1 
ATOM   7946  O O   . LYS B 1 288 ? 28.946  75.694  43.463  1.00 33.44  ? 314 LYS B O   1 
ATOM   7947  C CB  . LYS B 1 288 ? 31.294  76.084  41.264  1.00 33.87  ? 314 LYS B CB  1 
ATOM   7948  C CG  . LYS B 1 288 ? 32.438  75.545  42.110  1.00 39.44  ? 314 LYS B CG  1 
ATOM   7949  C CD  . LYS B 1 288 ? 32.835  74.121  41.716  1.00 45.64  ? 314 LYS B CD  1 
ATOM   7950  C CE  . LYS B 1 288 ? 34.199  73.738  42.294  1.00 47.50  ? 314 LYS B CE  1 
ATOM   7951  N NZ  . LYS B 1 288 ? 35.301  74.560  41.698  1.00 51.16  ? 314 LYS B NZ  1 
ATOM   7952  N N   . ILE B 1 289 ? 30.060  73.754  43.217  1.00 30.88  ? 315 ILE B N   1 
ATOM   7953  C CA  . ILE B 1 289 ? 29.849  73.319  44.604  1.00 30.05  ? 315 ILE B CA  1 
ATOM   7954  C C   . ILE B 1 289 ? 31.073  72.535  45.043  1.00 27.47  ? 315 ILE B C   1 
ATOM   7955  O O   . ILE B 1 289 ? 31.692  71.851  44.234  1.00 25.65  ? 315 ILE B O   1 
ATOM   7956  C CB  . ILE B 1 289 ? 28.607  72.405  44.790  1.00 30.72  ? 315 ILE B CB  1 
ATOM   7957  C CG1 . ILE B 1 289 ? 28.828  71.060  44.098  1.00 34.00  ? 315 ILE B CG1 1 
ATOM   7958  C CG2 . ILE B 1 289 ? 27.358  73.103  44.267  1.00 31.83  ? 315 ILE B CG2 1 
ATOM   7959  C CD1 . ILE B 1 289 ? 27.782  70.014  44.438  1.00 32.12  ? 315 ILE B CD1 1 
ATOM   7960  N N   . PHE B 1 290 ? 31.427  72.643  46.317  1.00 26.68  ? 316 PHE B N   1 
ATOM   7961  C CA  . PHE B 1 290 ? 32.589  71.930  46.852  1.00 27.57  ? 316 PHE B CA  1 
ATOM   7962  C C   . PHE B 1 290 ? 32.137  71.005  47.974  1.00 27.44  ? 316 PHE B C   1 
ATOM   7963  O O   . PHE B 1 290 ? 31.231  71.353  48.726  1.00 28.86  ? 316 PHE B O   1 
ATOM   7964  C CB  . PHE B 1 290 ? 33.607  72.893  47.478  1.00 27.71  ? 316 PHE B CB  1 
ATOM   7965  C CG  . PHE B 1 290 ? 33.960  74.073  46.626  1.00 27.07  ? 316 PHE B CG  1 
ATOM   7966  C CD1 . PHE B 1 290 ? 35.258  74.230  46.145  1.00 26.70  ? 316 PHE B CD1 1 
ATOM   7967  C CD2 . PHE B 1 290 ? 33.016  75.054  46.342  1.00 25.95  ? 316 PHE B CD2 1 
ATOM   7968  C CE1 . PHE B 1 290 ? 35.614  75.355  45.392  1.00 25.50  ? 316 PHE B CE1 1 
ATOM   7969  C CE2 . PHE B 1 290 ? 33.359  76.178  45.593  1.00 25.26  ? 316 PHE B CE2 1 
ATOM   7970  C CZ  . PHE B 1 290 ? 34.663  76.329  45.117  1.00 25.27  ? 316 PHE B CZ  1 
ATOM   7971  N N   . VAL B 1 291 ? 32.737  69.827  48.089  1.00 25.48  ? 317 VAL B N   1 
ATOM   7972  C CA  . VAL B 1 291 ? 32.383  68.979  49.211  1.00 26.80  ? 317 VAL B CA  1 
ATOM   7973  C C   . VAL B 1 291 ? 33.694  68.873  49.971  1.00 28.58  ? 317 VAL B C   1 
ATOM   7974  O O   . VAL B 1 291 ? 34.738  68.536  49.395  1.00 25.75  ? 317 VAL B O   1 
ATOM   7975  C CB  . VAL B 1 291 ? 31.844  67.562  48.812  1.00 26.47  ? 317 VAL B CB  1 
ATOM   7976  C CG1 . VAL B 1 291 ? 31.150  67.617  47.466  1.00 22.84  ? 317 VAL B CG1 1 
ATOM   7977  C CG2 . VAL B 1 291 ? 32.945  66.532  48.859  1.00 27.96  ? 317 VAL B CG2 1 
ATOM   7978  N N   . TRP B 1 292 ? 33.635  69.223  51.252  1.00 28.99  ? 318 TRP B N   1 
ATOM   7979  C CA  . TRP B 1 292 ? 34.795  69.200  52.134  1.00 30.70  ? 318 TRP B CA  1 
ATOM   7980  C C   . TRP B 1 292 ? 34.727  67.934  52.995  1.00 29.55  ? 318 TRP B C   1 
ATOM   7981  O O   . TRP B 1 292 ? 33.682  67.622  53.555  1.00 25.59  ? 318 TRP B O   1 
ATOM   7982  C CB  . TRP B 1 292 ? 34.776  70.459  53.018  1.00 31.42  ? 318 TRP B CB  1 
ATOM   7983  C CG  . TRP B 1 292 ? 35.994  70.655  53.871  1.00 33.12  ? 318 TRP B CG  1 
ATOM   7984  C CD1 . TRP B 1 292 ? 37.201  71.147  53.475  1.00 33.77  ? 318 TRP B CD1 1 
ATOM   7985  C CD2 . TRP B 1 292 ? 36.119  70.362  55.269  1.00 34.65  ? 318 TRP B CD2 1 
ATOM   7986  N NE1 . TRP B 1 292 ? 38.074  71.183  54.541  1.00 32.64  ? 318 TRP B NE1 1 
ATOM   7987  C CE2 . TRP B 1 292 ? 37.433  70.705  55.654  1.00 34.22  ? 318 TRP B CE2 1 
ATOM   7988  C CE3 . TRP B 1 292 ? 35.245  69.841  56.236  1.00 36.78  ? 318 TRP B CE3 1 
ATOM   7989  C CZ2 . TRP B 1 292 ? 37.900  70.544  56.966  1.00 35.54  ? 318 TRP B CZ2 1 
ATOM   7990  C CZ3 . TRP B 1 292 ? 35.710  69.683  57.546  1.00 36.52  ? 318 TRP B CZ3 1 
ATOM   7991  C CH2 . TRP B 1 292 ? 37.025  70.035  57.895  1.00 34.90  ? 318 TRP B CH2 1 
ATOM   7992  N N   . LYS B 1 293 ? 35.835  67.206  53.094  1.00 33.17  ? 319 LYS B N   1 
ATOM   7993  C CA  . LYS B 1 293 ? 35.870  65.977  53.891  1.00 37.52  ? 319 LYS B CA  1 
ATOM   7994  C C   . LYS B 1 293 ? 36.750  66.102  55.135  1.00 41.05  ? 319 LYS B C   1 
ATOM   7995  O O   . LYS B 1 293 ? 37.947  66.390  55.037  1.00 40.42  ? 319 LYS B O   1 
ATOM   7996  C CB  . LYS B 1 293 ? 36.374  64.804  53.046  1.00 37.26  ? 319 LYS B CB  1 
ATOM   7997  C CG  . LYS B 1 293 ? 35.578  64.545  51.779  1.00 39.35  ? 319 LYS B CG  1 
ATOM   7998  C CD  . LYS B 1 293 ? 36.123  63.332  51.039  1.00 42.33  ? 319 LYS B CD  1 
ATOM   7999  C CE  . LYS B 1 293 ? 37.602  63.502  50.703  1.00 42.76  ? 319 LYS B CE  1 
ATOM   8000  N NZ  . LYS B 1 293 ? 38.200  62.269  50.108  1.00 43.65  ? 319 LYS B NZ  1 
ATOM   8001  N N   . GLY B 1 294 ? 36.150  65.876  56.302  1.00 45.15  ? 320 GLY B N   1 
ATOM   8002  C CA  . GLY B 1 294 ? 36.889  65.957  57.551  1.00 49.26  ? 320 GLY B CA  1 
ATOM   8003  C C   . GLY B 1 294 ? 37.916  64.845  57.685  1.00 52.99  ? 320 GLY B C   1 
ATOM   8004  O O   . GLY B 1 294 ? 37.688  63.724  57.224  1.00 50.34  ? 320 GLY B O   1 
ATOM   8005  N N   . LYS B 1 295 ? 39.045  65.152  58.322  1.00 56.71  ? 321 LYS B N   1 
ATOM   8006  C CA  . LYS B 1 295 ? 40.109  64.174  58.503  1.00 61.01  ? 321 LYS B CA  1 
ATOM   8007  C C   . LYS B 1 295 ? 39.660  63.001  59.353  1.00 62.90  ? 321 LYS B C   1 
ATOM   8008  O O   . LYS B 1 295 ? 40.335  61.976  59.410  1.00 64.41  ? 321 LYS B O   1 
ATOM   8009  C CB  . LYS B 1 295 ? 41.331  64.816  59.157  1.00 64.66  ? 321 LYS B CB  1 
ATOM   8010  C CG  . LYS B 1 295 ? 41.077  65.360  60.560  1.00 71.21  ? 321 LYS B CG  1 
ATOM   8011  C CD  . LYS B 1 295 ? 42.386  65.587  61.322  1.00 74.76  ? 321 LYS B CD  1 
ATOM   8012  C CE  . LYS B 1 295 ? 43.344  66.495  60.557  1.00 77.03  ? 321 LYS B CE  1 
ATOM   8013  N NZ  . LYS B 1 295 ? 44.675  66.581  61.223  1.00 78.63  ? 321 LYS B NZ  1 
ATOM   8014  N N   . GLN B 1 296 ? 38.521  63.150  60.015  1.00 64.78  ? 322 GLN B N   1 
ATOM   8015  C CA  . GLN B 1 296 ? 38.007  62.092  60.868  1.00 67.13  ? 322 GLN B CA  1 
ATOM   8016  C C   . GLN B 1 296 ? 36.586  61.715  60.493  1.00 67.27  ? 322 GLN B C   1 
ATOM   8017  O O   . GLN B 1 296 ? 35.785  61.358  61.353  1.00 67.66  ? 322 GLN B O   1 
ATOM   8018  C CB  . GLN B 1 296 ? 38.049  62.533  62.331  1.00 70.89  ? 322 GLN B CB  1 
ATOM   8019  C CG  . GLN B 1 296 ? 39.444  62.852  62.847  1.00 76.21  ? 322 GLN B CG  1 
ATOM   8020  C CD  . GLN B 1 296 ? 39.426  63.457  64.242  1.00 80.23  ? 322 GLN B CD  1 
ATOM   8021  O OE1 . GLN B 1 296 ? 40.473  63.804  64.797  1.00 83.04  ? 322 GLN B OE1 1 
ATOM   8022  N NE2 . GLN B 1 296 ? 38.233  63.590  64.817  1.00 80.65  ? 322 GLN B NE2 1 
ATOM   8023  N N   . ALA B 1 297 ? 36.270  61.801  59.206  1.00 68.68  ? 323 ALA B N   1 
ATOM   8024  C CA  . ALA B 1 297 ? 34.939  61.450  58.730  1.00 68.94  ? 323 ALA B CA  1 
ATOM   8025  C C   . ALA B 1 297 ? 34.903  59.955  58.462  1.00 69.68  ? 323 ALA B C   1 
ATOM   8026  O O   . ALA B 1 297 ? 35.942  59.328  58.258  1.00 68.03  ? 323 ALA B O   1 
ATOM   8027  C CB  . ALA B 1 297 ? 34.611  62.218  57.455  1.00 69.11  ? 323 ALA B CB  1 
ATOM   8028  N N   . ASN B 1 298 ? 33.703  59.390  58.466  1.00 71.97  ? 324 ASN B N   1 
ATOM   8029  C CA  . ASN B 1 298 ? 33.527  57.964  58.230  1.00 74.43  ? 324 ASN B CA  1 
ATOM   8030  C C   . ASN B 1 298 ? 34.040  57.563  56.844  1.00 74.22  ? 324 ASN B C   1 
ATOM   8031  O O   . ASN B 1 298 ? 33.758  58.236  55.850  1.00 73.51  ? 324 ASN B O   1 
ATOM   8032  C CB  . ASN B 1 298 ? 32.046  57.605  58.357  1.00 77.53  ? 324 ASN B CB  1 
ATOM   8033  C CG  . ASN B 1 298 ? 31.802  56.117  58.276  1.00 81.70  ? 324 ASN B CG  1 
ATOM   8034  O OD1 . ASN B 1 298 ? 30.658  55.670  58.164  1.00 84.13  ? 324 ASN B OD1 1 
ATOM   8035  N ND2 . ASN B 1 298 ? 32.877  55.334  58.339  1.00 83.16  ? 324 ASN B ND2 1 
ATOM   8036  N N   . MET B 1 299 ? 34.794  56.467  56.782  1.00 73.62  ? 325 MET B N   1 
ATOM   8037  C CA  . MET B 1 299 ? 35.332  55.988  55.514  1.00 73.46  ? 325 MET B CA  1 
ATOM   8038  C C   . MET B 1 299 ? 34.209  55.772  54.505  1.00 72.33  ? 325 MET B C   1 
ATOM   8039  O O   . MET B 1 299 ? 34.380  56.010  53.312  1.00 72.35  ? 325 MET B O   1 
ATOM   8040  C CB  . MET B 1 299 ? 36.081  54.672  55.708  1.00 75.26  ? 325 MET B CB  1 
ATOM   8041  C CG  . MET B 1 299 ? 36.497  54.033  54.395  1.00 78.92  ? 325 MET B CG  1 
ATOM   8042  S SD  . MET B 1 299 ? 36.906  52.279  54.513  1.00 83.59  ? 325 MET B SD  1 
ATOM   8043  C CE  . MET B 1 299 ? 35.301  51.523  54.207  1.00 81.65  ? 325 MET B CE  1 
ATOM   8044  N N   . GLU B 1 300 ? 33.064  55.312  54.997  1.00 71.56  ? 326 GLU B N   1 
ATOM   8045  C CA  . GLU B 1 300 ? 31.902  55.050  54.156  1.00 70.26  ? 326 GLU B CA  1 
ATOM   8046  C C   . GLU B 1 300 ? 31.311  56.331  53.578  1.00 68.26  ? 326 GLU B C   1 
ATOM   8047  O O   . GLU B 1 300 ? 30.548  56.289  52.616  1.00 67.83  ? 326 GLU B O   1 
ATOM   8048  C CB  . GLU B 1 300 ? 30.845  54.295  54.964  1.00 71.90  ? 326 GLU B CB  1 
ATOM   8049  C CG  . GLU B 1 300 ? 31.386  53.014  55.579  1.00 78.68  ? 326 GLU B CG  1 
ATOM   8050  C CD  . GLU B 1 300 ? 30.339  52.220  56.340  1.00 83.07  ? 326 GLU B CD  1 
ATOM   8051  O OE1 . GLU B 1 300 ? 29.343  51.785  55.720  1.00 85.15  ? 326 GLU B OE1 1 
ATOM   8052  O OE2 . GLU B 1 300 ? 30.517  52.024  57.562  1.00 85.42  ? 326 GLU B OE2 1 
ATOM   8053  N N   . GLU B 1 301 ? 31.660  57.471  54.163  1.00 66.54  ? 327 GLU B N   1 
ATOM   8054  C CA  . GLU B 1 301 ? 31.159  58.745  53.669  1.00 65.68  ? 327 GLU B CA  1 
ATOM   8055  C C   . GLU B 1 301 ? 32.176  59.454  52.780  1.00 63.21  ? 327 GLU B C   1 
ATOM   8056  O O   . GLU B 1 301 ? 31.812  60.305  51.973  1.00 62.61  ? 327 GLU B O   1 
ATOM   8057  C CB  . GLU B 1 301 ? 30.761  59.658  54.828  1.00 68.50  ? 327 GLU B CB  1 
ATOM   8058  C CG  . GLU B 1 301 ? 29.401  59.347  55.425  1.00 72.11  ? 327 GLU B CG  1 
ATOM   8059  C CD  . GLU B 1 301 ? 28.981  60.378  56.456  1.00 75.43  ? 327 GLU B CD  1 
ATOM   8060  O OE1 . GLU B 1 301 ? 28.960  61.580  56.112  1.00 76.16  ? 327 GLU B OE1 1 
ATOM   8061  O OE2 . GLU B 1 301 ? 28.671  59.991  57.606  1.00 77.31  ? 327 GLU B OE2 1 
ATOM   8062  N N   . ARG B 1 302 ? 33.450  59.112  52.932  1.00 59.97  ? 328 ARG B N   1 
ATOM   8063  C CA  . ARG B 1 302 ? 34.480  59.723  52.107  1.00 58.24  ? 328 ARG B CA  1 
ATOM   8064  C C   . ARG B 1 302 ? 34.426  59.100  50.720  1.00 54.96  ? 328 ARG B C   1 
ATOM   8065  O O   . ARG B 1 302 ? 34.510  59.796  49.708  1.00 53.78  ? 328 ARG B O   1 
ATOM   8066  C CB  . ARG B 1 302 ? 35.873  59.505  52.708  1.00 61.21  ? 328 ARG B CB  1 
ATOM   8067  C CG  . ARG B 1 302 ? 36.178  60.353  53.936  1.00 65.78  ? 328 ARG B CG  1 
ATOM   8068  C CD  . ARG B 1 302 ? 37.681  60.577  54.059  1.00 69.06  ? 328 ARG B CD  1 
ATOM   8069  N NE  . ARG B 1 302 ? 38.404  59.317  54.205  1.00 71.15  ? 328 ARG B NE  1 
ATOM   8070  C CZ  . ARG B 1 302 ? 38.429  58.598  55.323  1.00 72.20  ? 328 ARG B CZ  1 
ATOM   8071  N NH1 . ARG B 1 302 ? 37.774  59.019  56.399  1.00 71.11  ? 328 ARG B NH1 1 
ATOM   8072  N NH2 . ARG B 1 302 ? 39.093  57.449  55.360  1.00 71.87  ? 328 ARG B NH2 1 
ATOM   8073  N N   . LYS B 1 303 ? 34.284  57.779  50.683  1.00 50.74  ? 329 LYS B N   1 
ATOM   8074  C CA  . LYS B 1 303 ? 34.211  57.053  49.423  1.00 46.38  ? 329 LYS B CA  1 
ATOM   8075  C C   . LYS B 1 303 ? 32.879  57.294  48.722  1.00 42.92  ? 329 LYS B C   1 
ATOM   8076  O O   . LYS B 1 303 ? 32.676  56.849  47.596  1.00 41.06  ? 329 LYS B O   1 
ATOM   8077  C CB  . LYS B 1 303 ? 34.401  55.553  49.659  1.00 46.13  ? 329 LYS B CB  1 
ATOM   8078  C CG  . LYS B 1 303 ? 35.840  55.130  49.843  1.00 46.05  ? 329 LYS B CG  1 
ATOM   8079  C CD  . LYS B 1 303 ? 35.969  53.624  49.813  1.00 48.35  ? 329 LYS B CD  1 
ATOM   8080  C CE  . LYS B 1 303 ? 37.427  53.197  49.735  1.00 52.72  ? 329 LYS B CE  1 
ATOM   8081  N NZ  . LYS B 1 303 ? 38.234  53.714  50.880  1.00 52.99  ? 329 LYS B NZ  1 
ATOM   8082  N N   . ALA B 1 304 ? 31.977  58.004  49.391  1.00 38.59  ? 330 ALA B N   1 
ATOM   8083  C CA  . ALA B 1 304 ? 30.669  58.296  48.827  1.00 36.52  ? 330 ALA B CA  1 
ATOM   8084  C C   . ALA B 1 304 ? 30.504  59.776  48.480  1.00 34.36  ? 330 ALA B C   1 
ATOM   8085  O O   . ALA B 1 304 ? 29.438  60.203  48.028  1.00 35.61  ? 330 ALA B O   1 
ATOM   8086  C CB  . ALA B 1 304 ? 29.593  57.868  49.800  1.00 36.23  ? 330 ALA B CB  1 
ATOM   8087  N N   . ALA B 1 305 ? 31.567  60.550  48.682  1.00 32.40  ? 331 ALA B N   1 
ATOM   8088  C CA  . ALA B 1 305 ? 31.546  61.987  48.412  1.00 30.79  ? 331 ALA B CA  1 
ATOM   8089  C C   . ALA B 1 305 ? 31.017  62.357  47.023  1.00 29.93  ? 331 ALA B C   1 
ATOM   8090  O O   . ALA B 1 305 ? 30.187  63.252  46.898  1.00 26.69  ? 331 ALA B O   1 
ATOM   8091  C CB  . ALA B 1 305 ? 32.936  62.566  48.617  1.00 28.34  ? 331 ALA B CB  1 
ATOM   8092  N N   . LEU B 1 306 ? 31.499  61.675  45.985  1.00 31.51  ? 332 LEU B N   1 
ATOM   8093  C CA  . LEU B 1 306 ? 31.053  61.952  44.620  1.00 32.52  ? 332 LEU B CA  1 
ATOM   8094  C C   . LEU B 1 306 ? 29.552  61.745  44.484  1.00 34.22  ? 332 LEU B C   1 
ATOM   8095  O O   . LEU B 1 306 ? 28.859  62.554  43.856  1.00 34.81  ? 332 LEU B O   1 
ATOM   8096  C CB  . LEU B 1 306 ? 31.770  61.047  43.615  1.00 32.11  ? 332 LEU B CB  1 
ATOM   8097  C CG  . LEU B 1 306 ? 32.908  61.591  42.743  1.00 30.74  ? 332 LEU B CG  1 
ATOM   8098  C CD1 . LEU B 1 306 ? 33.265  63.019  43.129  1.00 33.29  ? 332 LEU B CD1 1 
ATOM   8099  C CD2 . LEU B 1 306 ? 34.113  60.674  42.881  1.00 29.68  ? 332 LEU B CD2 1 
ATOM   8100  N N   . LYS B 1 307 ? 29.040  60.662  45.063  1.00 35.60  ? 333 LYS B N   1 
ATOM   8101  C CA  . LYS B 1 307 ? 27.615  60.405  44.968  1.00 37.01  ? 333 LYS B CA  1 
ATOM   8102  C C   . LYS B 1 307 ? 26.868  61.448  45.773  1.00 36.83  ? 333 LYS B C   1 
ATOM   8103  O O   . LYS B 1 307 ? 25.803  61.915  45.366  1.00 37.40  ? 333 LYS B O   1 
ATOM   8104  C CB  . LYS B 1 307 ? 27.252  59.008  45.476  1.00 40.99  ? 333 LYS B CB  1 
ATOM   8105  C CG  . LYS B 1 307 ? 25.779  58.722  45.228  1.00 48.43  ? 333 LYS B CG  1 
ATOM   8106  C CD  . LYS B 1 307 ? 25.275  57.404  45.771  1.00 53.01  ? 333 LYS B CD  1 
ATOM   8107  C CE  . LYS B 1 307 ? 23.755  57.338  45.578  1.00 57.53  ? 333 LYS B CE  1 
ATOM   8108  N NZ  . LYS B 1 307 ? 23.168  56.029  45.988  1.00 61.71  ? 333 LYS B NZ  1 
ATOM   8109  N N   . THR B 1 308 ? 27.433  61.819  46.915  1.00 35.15  ? 334 THR B N   1 
ATOM   8110  C CA  . THR B 1 308 ? 26.814  62.826  47.767  1.00 36.53  ? 334 THR B CA  1 
ATOM   8111  C C   . THR B 1 308 ? 26.684  64.157  47.019  1.00 36.81  ? 334 THR B C   1 
ATOM   8112  O O   . THR B 1 308 ? 25.702  64.884  47.187  1.00 37.66  ? 334 THR B O   1 
ATOM   8113  C CB  . THR B 1 308 ? 27.636  63.033  49.055  1.00 36.57  ? 334 THR B CB  1 
ATOM   8114  O OG1 . THR B 1 308 ? 27.625  61.821  49.820  1.00 36.69  ? 334 THR B OG1 1 
ATOM   8115  C CG2 . THR B 1 308 ? 27.057  64.163  49.891  1.00 36.12  ? 334 THR B CG2 1 
ATOM   8116  N N   . ALA B 1 309 ? 27.677  64.466  46.193  1.00 35.91  ? 335 ALA B N   1 
ATOM   8117  C CA  . ALA B 1 309 ? 27.673  65.691  45.403  1.00 35.45  ? 335 ALA B CA  1 
ATOM   8118  C C   . ALA B 1 309 ? 26.531  65.640  44.392  1.00 36.37  ? 335 ALA B C   1 
ATOM   8119  O O   . ALA B 1 309 ? 25.807  66.619  44.212  1.00 35.12  ? 335 ALA B O   1 
ATOM   8120  C CB  . ALA B 1 309 ? 28.999  65.842  44.682  1.00 33.29  ? 335 ALA B CB  1 
ATOM   8121  N N   . SER B 1 310 ? 26.375  64.487  43.744  1.00 37.36  ? 336 SER B N   1 
ATOM   8122  C CA  . SER B 1 310 ? 25.325  64.275  42.744  1.00 39.56  ? 336 SER B CA  1 
ATOM   8123  C C   . SER B 1 310 ? 23.928  64.383  43.352  1.00 39.20  ? 336 SER B C   1 
ATOM   8124  O O   . SER B 1 310 ? 23.048  65.028  42.789  1.00 38.07  ? 336 SER B O   1 
ATOM   8125  C CB  . SER B 1 310 ? 25.468  62.889  42.094  1.00 40.43  ? 336 SER B CB  1 
ATOM   8126  O OG  . SER B 1 310 ? 26.703  62.750  41.416  1.00 43.40  ? 336 SER B OG  1 
ATOM   8127  N N   . ASP B 1 311 ? 23.727  63.726  44.491  1.00 39.08  ? 337 ASP B N   1 
ATOM   8128  C CA  . ASP B 1 311 ? 22.441  63.758  45.166  1.00 40.92  ? 337 ASP B CA  1 
ATOM   8129  C C   . ASP B 1 311 ? 22.104  65.183  45.584  1.00 41.45  ? 337 ASP B C   1 
ATOM   8130  O O   . ASP B 1 311 ? 20.951  65.604  45.507  1.00 41.34  ? 337 ASP B O   1 
ATOM   8131  C CB  . ASP B 1 311 ? 22.459  62.840  46.392  1.00 44.86  ? 337 ASP B CB  1 
ATOM   8132  C CG  . ASP B 1 311 ? 22.409  61.365  46.021  1.00 49.04  ? 337 ASP B CG  1 
ATOM   8133  O OD1 . ASP B 1 311 ? 22.540  60.514  46.928  1.00 54.18  ? 337 ASP B OD1 1 
ATOM   8134  O OD2 . ASP B 1 311 ? 22.232  61.051  44.826  1.00 51.60  ? 337 ASP B OD2 1 
ATOM   8135  N N   . PHE B 1 312 ? 23.112  65.926  46.027  1.00 42.49  ? 338 PHE B N   1 
ATOM   8136  C CA  . PHE B 1 312 ? 22.903  67.305  46.437  1.00 43.26  ? 338 PHE B CA  1 
ATOM   8137  C C   . PHE B 1 312 ? 22.427  68.133  45.249  1.00 44.37  ? 338 PHE B C   1 
ATOM   8138  O O   . PHE B 1 312 ? 21.505  68.939  45.366  1.00 44.16  ? 338 PHE B O   1 
ATOM   8139  C CB  . PHE B 1 312 ? 24.198  67.911  46.965  1.00 43.76  ? 338 PHE B CB  1 
ATOM   8140  C CG  . PHE B 1 312 ? 24.047  69.331  47.423  1.00 45.06  ? 338 PHE B CG  1 
ATOM   8141  C CD1 . PHE B 1 312 ? 23.509  69.617  48.674  1.00 46.57  ? 338 PHE B CD1 1 
ATOM   8142  C CD2 . PHE B 1 312 ? 24.391  70.385  46.584  1.00 44.74  ? 338 PHE B CD2 1 
ATOM   8143  C CE1 . PHE B 1 312 ? 23.313  70.935  49.082  1.00 47.55  ? 338 PHE B CE1 1 
ATOM   8144  C CE2 . PHE B 1 312 ? 24.199  71.702  46.979  1.00 46.60  ? 338 PHE B CE2 1 
ATOM   8145  C CZ  . PHE B 1 312 ? 23.658  71.978  48.233  1.00 47.81  ? 338 PHE B CZ  1 
ATOM   8146  N N   . ILE B 1 313 ? 23.071  67.925  44.106  1.00 45.56  ? 339 ILE B N   1 
ATOM   8147  C CA  . ILE B 1 313 ? 22.744  68.643  42.878  1.00 46.45  ? 339 ILE B CA  1 
ATOM   8148  C C   . ILE B 1 313 ? 21.338  68.348  42.368  1.00 47.75  ? 339 ILE B C   1 
ATOM   8149  O O   . ILE B 1 313 ? 20.676  69.224  41.814  1.00 47.65  ? 339 ILE B O   1 
ATOM   8150  C CB  . ILE B 1 313 ? 23.761  68.312  41.759  1.00 45.17  ? 339 ILE B CB  1 
ATOM   8151  C CG1 . ILE B 1 313 ? 25.117  68.945  42.091  1.00 45.47  ? 339 ILE B CG1 1 
ATOM   8152  C CG2 . ILE B 1 313 ? 23.243  68.801  40.418  1.00 45.12  ? 339 ILE B CG2 1 
ATOM   8153  C CD1 . ILE B 1 313 ? 26.214  68.625  41.094  1.00 44.65  ? 339 ILE B CD1 1 
ATOM   8154  N N   . SER B 1 314 ? 20.879  67.116  42.543  1.00 49.53  ? 340 SER B N   1 
ATOM   8155  C CA  . SER B 1 314 ? 19.546  66.767  42.080  1.00 50.89  ? 340 SER B CA  1 
ATOM   8156  C C   . SER B 1 314 ? 18.530  67.276  43.091  1.00 51.24  ? 340 SER B C   1 
ATOM   8157  O O   . SER B 1 314 ? 17.469  67.766  42.720  1.00 52.71  ? 340 SER B O   1 
ATOM   8158  C CB  . SER B 1 314 ? 19.404  65.252  41.910  1.00 49.71  ? 340 SER B CB  1 
ATOM   8159  O OG  . SER B 1 314 ? 19.041  64.635  43.130  1.00 54.79  ? 340 SER B OG  1 
ATOM   8160  N N   . LYS B 1 315 ? 18.862  67.166  44.372  1.00 52.07  ? 341 LYS B N   1 
ATOM   8161  C CA  . LYS B 1 315 ? 17.969  67.625  45.422  1.00 53.01  ? 341 LYS B CA  1 
ATOM   8162  C C   . LYS B 1 315 ? 17.721  69.125  45.300  1.00 53.63  ? 341 LYS B C   1 
ATOM   8163  O O   . LYS B 1 315 ? 16.578  69.581  45.378  1.00 54.95  ? 341 LYS B O   1 
ATOM   8164  C CB  . LYS B 1 315 ? 18.559  67.300  46.798  1.00 55.26  ? 341 LYS B CB  1 
ATOM   8165  C CG  . LYS B 1 315 ? 17.711  67.771  47.980  1.00 59.22  ? 341 LYS B CG  1 
ATOM   8166  C CD  . LYS B 1 315 ? 18.072  67.031  49.276  1.00 63.68  ? 341 LYS B CD  1 
ATOM   8167  C CE  . LYS B 1 315 ? 17.786  65.528  49.166  1.00 66.08  ? 341 LYS B CE  1 
ATOM   8168  N NZ  . LYS B 1 315 ? 18.051  64.786  50.431  1.00 66.87  ? 341 LYS B NZ  1 
ATOM   8169  N N   . MET B 1 316 ? 18.789  69.891  45.094  1.00 52.60  ? 342 MET B N   1 
ATOM   8170  C CA  . MET B 1 316 ? 18.671  71.339  44.978  1.00 50.48  ? 342 MET B CA  1 
ATOM   8171  C C   . MET B 1 316 ? 18.202  71.763  43.597  1.00 50.13  ? 342 MET B C   1 
ATOM   8172  O O   . MET B 1 316 ? 18.052  72.951  43.314  1.00 50.45  ? 342 MET B O   1 
ATOM   8173  C CB  . MET B 1 316 ? 20.004  72.004  45.307  1.00 50.93  ? 342 MET B CB  1 
ATOM   8174  C CG  . MET B 1 316 ? 20.434  71.823  46.755  1.00 52.37  ? 342 MET B CG  1 
ATOM   8175  S SD  . MET B 1 316 ? 19.182  72.383  47.935  1.00 52.11  ? 342 MET B SD  1 
ATOM   8176  C CE  . MET B 1 316 ? 19.631  74.099  48.136  1.00 53.30  ? 342 MET B CE  1 
ATOM   8177  N N   . ASP B 1 317 ? 17.981  70.778  42.738  1.00 50.39  ? 343 ASP B N   1 
ATOM   8178  C CA  . ASP B 1 317 ? 17.500  71.027  41.386  1.00 51.20  ? 343 ASP B CA  1 
ATOM   8179  C C   . ASP B 1 317 ? 18.447  71.831  40.471  1.00 49.46  ? 343 ASP B C   1 
ATOM   8180  O O   . ASP B 1 317 ? 17.986  72.545  39.587  1.00 48.77  ? 343 ASP B O   1 
ATOM   8181  C CB  . ASP B 1 317 ? 16.136  71.722  41.462  1.00 54.34  ? 343 ASP B CB  1 
ATOM   8182  C CG  . ASP B 1 317 ? 15.305  71.522  40.207  1.00 58.97  ? 343 ASP B CG  1 
ATOM   8183  O OD1 . ASP B 1 317 ? 15.138  70.353  39.793  1.00 60.87  ? 343 ASP B OD1 1 
ATOM   8184  O OD2 . ASP B 1 317 ? 14.811  72.524  39.641  1.00 60.67  ? 343 ASP B OD2 1 
ATOM   8185  N N   . TYR B 1 318 ? 19.758  71.707  40.675  1.00 47.50  ? 344 TYR B N   1 
ATOM   8186  C CA  . TYR B 1 318 ? 20.740  72.418  39.846  1.00 45.25  ? 344 TYR B CA  1 
ATOM   8187  C C   . TYR B 1 318 ? 21.034  71.660  38.550  1.00 43.97  ? 344 TYR B C   1 
ATOM   8188  O O   . TYR B 1 318 ? 20.717  70.478  38.429  1.00 43.31  ? 344 TYR B O   1 
ATOM   8189  C CB  . TYR B 1 318 ? 22.067  72.595  40.590  1.00 45.35  ? 344 TYR B CB  1 
ATOM   8190  C CG  . TYR B 1 318 ? 22.031  73.522  41.781  1.00 45.24  ? 344 TYR B CG  1 
ATOM   8191  C CD1 . TYR B 1 318 ? 21.444  74.781  41.690  1.00 45.81  ? 344 TYR B CD1 1 
ATOM   8192  C CD2 . TYR B 1 318 ? 22.638  73.161  42.983  1.00 43.89  ? 344 TYR B CD2 1 
ATOM   8193  C CE1 . TYR B 1 318 ? 21.466  75.662  42.766  1.00 46.74  ? 344 TYR B CE1 1 
ATOM   8194  C CE2 . TYR B 1 318 ? 22.666  74.032  44.066  1.00 44.99  ? 344 TYR B CE2 1 
ATOM   8195  C CZ  . TYR B 1 318 ? 22.079  75.282  43.949  1.00 45.72  ? 344 TYR B CZ  1 
ATOM   8196  O OH  . TYR B 1 318 ? 22.109  76.156  45.008  1.00 47.67  ? 344 TYR B OH  1 
ATOM   8197  N N   . PRO B 1 319 ? 21.651  72.336  37.564  1.00 41.74  ? 345 PRO B N   1 
ATOM   8198  C CA  . PRO B 1 319 ? 21.984  71.696  36.285  1.00 41.08  ? 345 PRO B CA  1 
ATOM   8199  C C   . PRO B 1 319 ? 22.974  70.545  36.494  1.00 42.49  ? 345 PRO B C   1 
ATOM   8200  O O   . PRO B 1 319 ? 23.846  70.613  37.360  1.00 42.25  ? 345 PRO B O   1 
ATOM   8201  C CB  . PRO B 1 319 ? 22.594  72.839  35.478  1.00 38.88  ? 345 PRO B CB  1 
ATOM   8202  C CG  . PRO B 1 319 ? 21.915  74.047  36.032  1.00 37.41  ? 345 PRO B CG  1 
ATOM   8203  C CD  . PRO B 1 319 ? 21.932  73.780  37.511  1.00 37.94  ? 345 PRO B CD  1 
ATOM   8204  N N   . LYS B 1 320 ? 22.840  69.493  35.693  1.00 44.43  ? 346 LYS B N   1 
ATOM   8205  C CA  . LYS B 1 320 ? 23.712  68.331  35.803  1.00 44.66  ? 346 LYS B CA  1 
ATOM   8206  C C   . LYS B 1 320 ? 25.170  68.643  35.486  1.00 42.65  ? 346 LYS B C   1 
ATOM   8207  O O   . LYS B 1 320 ? 26.073  67.907  35.888  1.00 40.90  ? 346 LYS B O   1 
ATOM   8208  C CB  . LYS B 1 320 ? 23.213  67.214  34.878  1.00 49.38  ? 346 LYS B CB  1 
ATOM   8209  C CG  . LYS B 1 320 ? 21.836  66.662  35.255  1.00 53.98  ? 346 LYS B CG  1 
ATOM   8210  C CD  . LYS B 1 320 ? 21.476  65.441  34.421  1.00 58.89  ? 346 LYS B CD  1 
ATOM   8211  C CE  . LYS B 1 320 ? 21.456  65.762  32.926  1.00 61.63  ? 346 LYS B CE  1 
ATOM   8212  N NZ  . LYS B 1 320 ? 21.161  64.553  32.104  1.00 62.00  ? 346 LYS B NZ  1 
ATOM   8213  N N   . GLN B 1 321 ? 25.396  69.737  34.768  1.00 40.54  ? 347 GLN B N   1 
ATOM   8214  C CA  . GLN B 1 321 ? 26.747  70.138  34.388  1.00 40.10  ? 347 GLN B CA  1 
ATOM   8215  C C   . GLN B 1 321 ? 27.492  70.921  35.475  1.00 38.89  ? 347 GLN B C   1 
ATOM   8216  O O   . GLN B 1 321 ? 28.682  71.209  35.330  1.00 38.01  ? 347 GLN B O   1 
ATOM   8217  C CB  . GLN B 1 321 ? 26.697  70.952  33.091  1.00 40.59  ? 347 GLN B CB  1 
ATOM   8218  C CG  . GLN B 1 321 ? 25.477  71.852  32.986  1.00 46.12  ? 347 GLN B CG  1 
ATOM   8219  C CD  . GLN B 1 321 ? 24.194  71.072  32.727  1.00 47.83  ? 347 GLN B CD  1 
ATOM   8220  O OE1 . GLN B 1 321 ? 23.105  71.508  33.101  1.00 48.73  ? 347 GLN B OE1 1 
ATOM   8221  N NE2 . GLN B 1 321 ? 24.318  69.920  32.073  1.00 48.24  ? 347 GLN B NE2 1 
ATOM   8222  N N   . THR B 1 322 ? 26.789  71.252  36.558  1.00 37.08  ? 348 THR B N   1 
ATOM   8223  C CA  . THR B 1 322 ? 27.372  71.994  37.674  1.00 36.49  ? 348 THR B CA  1 
ATOM   8224  C C   . THR B 1 322 ? 28.729  71.403  38.023  1.00 35.03  ? 348 THR B C   1 
ATOM   8225  O O   . THR B 1 322 ? 28.853  70.189  38.127  1.00 36.27  ? 348 THR B O   1 
ATOM   8226  C CB  . THR B 1 322 ? 26.485  71.906  38.928  1.00 38.18  ? 348 THR B CB  1 
ATOM   8227  O OG1 . THR B 1 322 ? 25.152  72.324  38.607  1.00 38.54  ? 348 THR B OG1 1 
ATOM   8228  C CG2 . THR B 1 322 ? 27.041  72.797  40.033  1.00 38.17  ? 348 THR B CG2 1 
ATOM   8229  N N   . GLN B 1 323 ? 29.740  72.254  38.206  1.00 32.16  ? 349 GLN B N   1 
ATOM   8230  C CA  . GLN B 1 323 ? 31.086  71.775  38.536  1.00 30.13  ? 349 GLN B CA  1 
ATOM   8231  C C   . GLN B 1 323 ? 31.187  71.322  39.988  1.00 27.50  ? 349 GLN B C   1 
ATOM   8232  O O   . GLN B 1 323 ? 30.695  71.988  40.897  1.00 28.09  ? 349 GLN B O   1 
ATOM   8233  C CB  . GLN B 1 323 ? 32.125  72.865  38.284  1.00 30.14  ? 349 GLN B CB  1 
ATOM   8234  C CG  . GLN B 1 323 ? 31.964  73.568  36.953  1.00 34.58  ? 349 GLN B CG  1 
ATOM   8235  C CD  . GLN B 1 323 ? 33.009  74.646  36.733  1.00 36.21  ? 349 GLN B CD  1 
ATOM   8236  O OE1 . GLN B 1 323 ? 33.366  75.381  37.657  1.00 38.74  ? 349 GLN B OE1 1 
ATOM   8237  N NE2 . GLN B 1 323 ? 33.496  74.755  35.505  1.00 36.06  ? 349 GLN B NE2 1 
ATOM   8238  N N   . VAL B 1 324 ? 31.833  70.182  40.195  1.00 24.63  ? 350 VAL B N   1 
ATOM   8239  C CA  . VAL B 1 324 ? 32.010  69.631  41.524  1.00 22.27  ? 350 VAL B CA  1 
ATOM   8240  C C   . VAL B 1 324 ? 33.474  69.363  41.843  1.00 22.70  ? 350 VAL B C   1 
ATOM   8241  O O   . VAL B 1 324 ? 34.209  68.802  41.034  1.00 24.83  ? 350 VAL B O   1 
ATOM   8242  C CB  . VAL B 1 324 ? 31.245  68.304  41.694  1.00 21.37  ? 350 VAL B CB  1 
ATOM   8243  C CG1 . VAL B 1 324 ? 31.545  67.718  43.063  1.00 16.80  ? 350 VAL B CG1 1 
ATOM   8244  C CG2 . VAL B 1 324 ? 29.756  68.531  41.532  1.00 17.77  ? 350 VAL B CG2 1 
ATOM   8245  N N   . SER B 1 325 ? 33.886  69.776  43.033  1.00 22.90  ? 351 SER B N   1 
ATOM   8246  C CA  . SER B 1 325 ? 35.246  69.561  43.506  1.00 24.18  ? 351 SER B CA  1 
ATOM   8247  C C   . SER B 1 325 ? 35.132  69.017  44.918  1.00 23.08  ? 351 SER B C   1 
ATOM   8248  O O   . SER B 1 325 ? 34.370  69.539  45.733  1.00 23.15  ? 351 SER B O   1 
ATOM   8249  C CB  . SER B 1 325 ? 36.049  70.872  43.530  1.00 26.86  ? 351 SER B CB  1 
ATOM   8250  O OG  . SER B 1 325 ? 36.458  71.271  42.231  1.00 29.97  ? 351 SER B OG  1 
ATOM   8251  N N   . VAL B 1 326 ? 35.861  67.950  45.203  1.00 22.31  ? 352 VAL B N   1 
ATOM   8252  C CA  . VAL B 1 326 ? 35.836  67.384  46.536  1.00 25.39  ? 352 VAL B CA  1 
ATOM   8253  C C   . VAL B 1 326 ? 37.241  67.431  47.101  1.00 24.80  ? 352 VAL B C   1 
ATOM   8254  O O   . VAL B 1 326 ? 38.171  66.915  46.494  1.00 27.61  ? 352 VAL B O   1 
ATOM   8255  C CB  . VAL B 1 326 ? 35.254  65.930  46.538  1.00 25.00  ? 352 VAL B CB  1 
ATOM   8256  C CG1 . VAL B 1 326 ? 35.327  65.330  45.156  1.00 26.40  ? 352 VAL B CG1 1 
ATOM   8257  C CG2 . VAL B 1 326 ? 35.976  65.068  47.564  1.00 20.13  ? 352 VAL B CG2 1 
ATOM   8258  N N   . LEU B 1 327 ? 37.407  68.085  48.248  1.00 26.19  ? 353 LEU B N   1 
ATOM   8259  C CA  . LEU B 1 327 ? 38.731  68.186  48.839  1.00 28.57  ? 353 LEU B CA  1 
ATOM   8260  C C   . LEU B 1 327 ? 38.847  67.735  50.280  1.00 29.85  ? 353 LEU B C   1 
ATOM   8261  O O   . LEU B 1 327 ? 37.886  67.780  51.047  1.00 32.71  ? 353 LEU B O   1 
ATOM   8262  C CB  . LEU B 1 327 ? 39.278  69.606  48.706  1.00 33.20  ? 353 LEU B CB  1 
ATOM   8263  C CG  . LEU B 1 327 ? 38.364  70.819  48.737  1.00 31.27  ? 353 LEU B CG  1 
ATOM   8264  C CD1 . LEU B 1 327 ? 39.216  72.059  48.674  1.00 33.99  ? 353 LEU B CD1 1 
ATOM   8265  C CD2 . LEU B 1 327 ? 37.435  70.788  47.546  1.00 35.82  ? 353 LEU B CD2 1 
ATOM   8266  N N   . PRO B 1 328 ? 40.046  67.284  50.663  1.00 29.82  ? 354 PRO B N   1 
ATOM   8267  C CA  . PRO B 1 328 ? 40.330  66.809  52.016  1.00 29.73  ? 354 PRO B CA  1 
ATOM   8268  C C   . PRO B 1 328 ? 40.728  67.936  52.961  1.00 31.54  ? 354 PRO B C   1 
ATOM   8269  O O   . PRO B 1 328 ? 41.357  68.919  52.553  1.00 31.94  ? 354 PRO B O   1 
ATOM   8270  C CB  . PRO B 1 328 ? 41.477  65.843  51.789  1.00 27.96  ? 354 PRO B CB  1 
ATOM   8271  C CG  . PRO B 1 328 ? 42.284  66.582  50.755  1.00 31.44  ? 354 PRO B CG  1 
ATOM   8272  C CD  . PRO B 1 328 ? 41.224  67.110  49.789  1.00 28.22  ? 354 PRO B CD  1 
ATOM   8273  N N   . GLU B 1 329 ? 40.346  67.791  54.225  1.00 33.81  ? 355 GLU B N   1 
ATOM   8274  C CA  . GLU B 1 329 ? 40.704  68.768  55.236  1.00 35.07  ? 355 GLU B CA  1 
ATOM   8275  C C   . GLU B 1 329 ? 42.221  68.890  55.191  1.00 33.44  ? 355 GLU B C   1 
ATOM   8276  O O   . GLU B 1 329 ? 42.926  67.880  55.132  1.00 32.64  ? 355 GLU B O   1 
ATOM   8277  C CB  . GLU B 1 329 ? 40.268  68.287  56.622  1.00 39.47  ? 355 GLU B CB  1 
ATOM   8278  C CG  . GLU B 1 329 ? 40.875  69.088  57.764  1.00 42.39  ? 355 GLU B CG  1 
ATOM   8279  C CD  . GLU B 1 329 ? 40.308  68.720  59.121  1.00 44.04  ? 355 GLU B CD  1 
ATOM   8280  O OE1 . GLU B 1 329 ? 40.797  69.276  60.126  1.00 47.23  ? 355 GLU B OE1 1 
ATOM   8281  O OE2 . GLU B 1 329 ? 39.377  67.889  59.186  1.00 43.15  ? 355 GLU B OE2 1 
ATOM   8282  N N   . GLY B 1 330 ? 42.715  70.124  55.202  1.00 31.90  ? 356 GLY B N   1 
ATOM   8283  C CA  . GLY B 1 330 ? 44.145  70.346  55.161  1.00 29.88  ? 356 GLY B CA  1 
ATOM   8284  C C   . GLY B 1 330 ? 44.650  70.441  53.742  1.00 30.43  ? 356 GLY B C   1 
ATOM   8285  O O   . GLY B 1 330 ? 45.791  70.840  53.501  1.00 32.01  ? 356 GLY B O   1 
ATOM   8286  N N   . GLY B 1 331 ? 43.805  70.074  52.789  1.00 29.70  ? 357 GLY B N   1 
ATOM   8287  C CA  . GLY B 1 331 ? 44.227  70.141  51.403  1.00 30.46  ? 357 GLY B CA  1 
ATOM   8288  C C   . GLY B 1 331 ? 43.384  71.105  50.605  1.00 30.17  ? 357 GLY B C   1 
ATOM   8289  O O   . GLY B 1 331 ? 43.311  70.999  49.383  1.00 28.68  ? 357 GLY B O   1 
ATOM   8290  N N   . GLU B 1 332 ? 42.755  72.050  51.299  1.00 29.49  ? 358 GLU B N   1 
ATOM   8291  C CA  . GLU B 1 332 ? 41.893  73.024  50.660  1.00 29.70  ? 358 GLU B CA  1 
ATOM   8292  C C   . GLU B 1 332 ? 42.630  73.857  49.622  1.00 31.00  ? 358 GLU B C   1 
ATOM   8293  O O   . GLU B 1 332 ? 43.855  74.012  49.673  1.00 28.56  ? 358 GLU B O   1 
ATOM   8294  C CB  . GLU B 1 332 ? 41.264  73.943  51.706  1.00 31.53  ? 358 GLU B CB  1 
ATOM   8295  C CG  . GLU B 1 332 ? 40.528  73.228  52.843  1.00 33.53  ? 358 GLU B CG  1 
ATOM   8296  C CD  . GLU B 1 332 ? 41.463  72.707  53.937  1.00 33.02  ? 358 GLU B CD  1 
ATOM   8297  O OE1 . GLU B 1 332 ? 40.955  72.190  54.956  1.00 27.74  ? 358 GLU B OE1 1 
ATOM   8298  O OE2 . GLU B 1 332 ? 42.700  72.815  53.780  1.00 32.41  ? 358 GLU B OE2 1 
ATOM   8299  N N   . THR B 1 333 ? 41.867  74.389  48.672  1.00 31.79  ? 359 THR B N   1 
ATOM   8300  C CA  . THR B 1 333 ? 42.415  75.214  47.603  1.00 32.20  ? 359 THR B CA  1 
ATOM   8301  C C   . THR B 1 333 ? 41.990  76.668  47.798  1.00 30.20  ? 359 THR B C   1 
ATOM   8302  O O   . THR B 1 333 ? 41.024  76.943  48.507  1.00 27.58  ? 359 THR B O   1 
ATOM   8303  C CB  . THR B 1 333 ? 41.909  74.738  46.233  1.00 30.65  ? 359 THR B CB  1 
ATOM   8304  O OG1 . THR B 1 333 ? 40.483  74.828  46.203  1.00 30.98  ? 359 THR B OG1 1 
ATOM   8305  C CG2 . THR B 1 333 ? 42.317  73.295  45.983  1.00 29.52  ? 359 THR B CG2 1 
ATOM   8306  N N   . PRO B 1 334 ? 42.712  77.615  47.167  1.00 31.25  ? 360 PRO B N   1 
ATOM   8307  C CA  . PRO B 1 334 ? 42.432  79.056  47.252  1.00 30.87  ? 360 PRO B CA  1 
ATOM   8308  C C   . PRO B 1 334 ? 40.970  79.398  46.963  1.00 31.02  ? 360 PRO B C   1 
ATOM   8309  O O   . PRO B 1 334 ? 40.357  80.191  47.676  1.00 31.70  ? 360 PRO B O   1 
ATOM   8310  C CB  . PRO B 1 334 ? 43.375  79.652  46.210  1.00 30.10  ? 360 PRO B CB  1 
ATOM   8311  C CG  . PRO B 1 334 ? 44.547  78.742  46.268  1.00 30.50  ? 360 PRO B CG  1 
ATOM   8312  C CD  . PRO B 1 334 ? 43.900  77.370  46.325  1.00 30.11  ? 360 PRO B CD  1 
ATOM   8313  N N   . LEU B 1 335 ? 40.412  78.799  45.920  1.00 31.66  ? 361 LEU B N   1 
ATOM   8314  C CA  . LEU B 1 335 ? 39.022  79.060  45.574  1.00 33.51  ? 361 LEU B CA  1 
ATOM   8315  C C   . LEU B 1 335 ? 38.053  78.630  46.682  1.00 34.93  ? 361 LEU B C   1 
ATOM   8316  O O   . LEU B 1 335 ? 36.947  79.163  46.780  1.00 34.36  ? 361 LEU B O   1 
ATOM   8317  C CB  . LEU B 1 335 ? 38.661  78.350  44.267  1.00 35.80  ? 361 LEU B CB  1 
ATOM   8318  C CG  . LEU B 1 335 ? 39.447  78.781  43.023  1.00 37.27  ? 361 LEU B CG  1 
ATOM   8319  C CD1 . LEU B 1 335 ? 39.091  77.876  41.854  1.00 37.68  ? 361 LEU B CD1 1 
ATOM   8320  C CD2 . LEU B 1 335 ? 39.145  80.240  42.696  1.00 38.56  ? 361 LEU B CD2 1 
ATOM   8321  N N   . PHE B 1 336 ? 38.452  77.668  47.513  1.00 34.92  ? 362 PHE B N   1 
ATOM   8322  C CA  . PHE B 1 336 ? 37.573  77.214  48.590  1.00 35.86  ? 362 PHE B CA  1 
ATOM   8323  C C   . PHE B 1 336 ? 37.660  78.131  49.810  1.00 37.96  ? 362 PHE B C   1 
ATOM   8324  O O   . PHE B 1 336 ? 36.654  78.677  50.264  1.00 36.64  ? 362 PHE B O   1 
ATOM   8325  C CB  . PHE B 1 336 ? 37.916  75.777  49.009  1.00 32.95  ? 362 PHE B CB  1 
ATOM   8326  C CG  . PHE B 1 336 ? 37.088  75.256  50.170  1.00 28.80  ? 362 PHE B CG  1 
ATOM   8327  C CD1 . PHE B 1 336 ? 35.762  74.870  49.988  1.00 28.32  ? 362 PHE B CD1 1 
ATOM   8328  C CD2 . PHE B 1 336 ? 37.644  75.147  51.449  1.00 24.95  ? 362 PHE B CD2 1 
ATOM   8329  C CE1 . PHE B 1 336 ? 35.002  74.376  51.067  1.00 26.48  ? 362 PHE B CE1 1 
ATOM   8330  C CE2 . PHE B 1 336 ? 36.893  74.659  52.522  1.00 23.22  ? 362 PHE B CE2 1 
ATOM   8331  C CZ  . PHE B 1 336 ? 35.575  74.274  52.332  1.00 20.33  ? 362 PHE B CZ  1 
ATOM   8332  N N   . ARG B 1 337 ? 38.863  78.311  50.337  1.00 40.29  ? 363 ARG B N   1 
ATOM   8333  C CA  . ARG B 1 337 ? 39.012  79.144  51.514  1.00 45.00  ? 363 ARG B CA  1 
ATOM   8334  C C   . ARG B 1 337 ? 38.726  80.623  51.266  1.00 45.48  ? 363 ARG B C   1 
ATOM   8335  O O   . ARG B 1 337 ? 38.568  81.392  52.216  1.00 44.18  ? 363 ARG B O   1 
ATOM   8336  C CB  . ARG B 1 337 ? 40.398  78.940  52.136  1.00 46.95  ? 363 ARG B CB  1 
ATOM   8337  C CG  . ARG B 1 337 ? 41.539  79.142  51.201  1.00 53.30  ? 363 ARG B CG  1 
ATOM   8338  C CD  . ARG B 1 337 ? 42.820  78.530  51.744  1.00 58.03  ? 363 ARG B CD  1 
ATOM   8339  N NE  . ARG B 1 337 ? 43.902  78.704  50.780  1.00 65.63  ? 363 ARG B NE  1 
ATOM   8340  C CZ  . ARG B 1 337 ? 45.053  78.043  50.808  1.00 68.63  ? 363 ARG B CZ  1 
ATOM   8341  N NH1 . ARG B 1 337 ? 45.284  77.151  51.764  1.00 71.31  ? 363 ARG B NH1 1 
ATOM   8342  N NH2 . ARG B 1 337 ? 45.968  78.266  49.870  1.00 69.56  ? 363 ARG B NH2 1 
ATOM   8343  N N   . GLN B 1 338 ? 38.628  81.022  49.999  1.00 44.58  ? 364 GLN B N   1 
ATOM   8344  C CA  . GLN B 1 338 ? 38.338  82.420  49.690  1.00 42.84  ? 364 GLN B CA  1 
ATOM   8345  C C   . GLN B 1 338 ? 36.966  82.773  50.265  1.00 41.54  ? 364 GLN B C   1 
ATOM   8346  O O   . GLN B 1 338 ? 36.666  83.942  50.509  1.00 39.19  ? 364 GLN B O   1 
ATOM   8347  C CB  . GLN B 1 338 ? 38.340  82.666  48.174  1.00 44.65  ? 364 GLN B CB  1 
ATOM   8348  C CG  . GLN B 1 338 ? 36.971  82.542  47.502  1.00 48.70  ? 364 GLN B CG  1 
ATOM   8349  C CD  . GLN B 1 338 ? 37.010  82.793  45.996  1.00 49.28  ? 364 GLN B CD  1 
ATOM   8350  O OE1 . GLN B 1 338 ? 37.595  83.773  45.532  1.00 50.19  ? 364 GLN B OE1 1 
ATOM   8351  N NE2 . GLN B 1 338 ? 36.369  81.911  45.230  1.00 47.08  ? 364 GLN B NE2 1 
ATOM   8352  N N   . PHE B 1 339 ? 36.138  81.753  50.479  1.00 39.80  ? 365 PHE B N   1 
ATOM   8353  C CA  . PHE B 1 339 ? 34.803  81.964  51.019  1.00 40.69  ? 365 PHE B CA  1 
ATOM   8354  C C   . PHE B 1 339 ? 34.804  82.197  52.523  1.00 42.49  ? 365 PHE B C   1 
ATOM   8355  O O   . PHE B 1 339 ? 33.812  82.670  53.080  1.00 42.12  ? 365 PHE B O   1 
ATOM   8356  C CB  . PHE B 1 339 ? 33.892  80.772  50.713  1.00 37.85  ? 365 PHE B CB  1 
ATOM   8357  C CG  . PHE B 1 339 ? 33.483  80.671  49.276  1.00 36.83  ? 365 PHE B CG  1 
ATOM   8358  C CD1 . PHE B 1 339 ? 34.213  79.895  48.380  1.00 32.29  ? 365 PHE B CD1 1 
ATOM   8359  C CD2 . PHE B 1 339 ? 32.368  81.364  48.812  1.00 35.50  ? 365 PHE B CD2 1 
ATOM   8360  C CE1 . PHE B 1 339 ? 33.839  79.813  47.048  1.00 32.09  ? 365 PHE B CE1 1 
ATOM   8361  C CE2 . PHE B 1 339 ? 31.988  81.285  47.476  1.00 33.33  ? 365 PHE B CE2 1 
ATOM   8362  C CZ  . PHE B 1 339 ? 32.724  80.510  46.593  1.00 31.87  ? 365 PHE B CZ  1 
ATOM   8363  N N   . PHE B 1 340 ? 35.910  81.868  53.181  1.00 45.26  ? 366 PHE B N   1 
ATOM   8364  C CA  . PHE B 1 340 ? 35.990  82.033  54.625  1.00 48.86  ? 366 PHE B CA  1 
ATOM   8365  C C   . PHE B 1 340 ? 36.742  83.275  55.076  1.00 51.93  ? 366 PHE B C   1 
ATOM   8366  O O   . PHE B 1 340 ? 37.836  83.568  54.593  1.00 51.38  ? 366 PHE B O   1 
ATOM   8367  C CB  . PHE B 1 340 ? 36.614  80.789  55.265  1.00 47.07  ? 366 PHE B CB  1 
ATOM   8368  C CG  . PHE B 1 340 ? 35.847  79.531  54.999  1.00 47.60  ? 366 PHE B CG  1 
ATOM   8369  C CD1 . PHE B 1 340 ? 35.952  78.883  53.770  1.00 48.57  ? 366 PHE B CD1 1 
ATOM   8370  C CD2 . PHE B 1 340 ? 34.982  79.016  55.957  1.00 46.02  ? 366 PHE B CD2 1 
ATOM   8371  C CE1 . PHE B 1 340 ? 35.207  77.739  53.501  1.00 48.05  ? 366 PHE B CE1 1 
ATOM   8372  C CE2 . PHE B 1 340 ? 34.231  77.876  55.702  1.00 45.08  ? 366 PHE B CE2 1 
ATOM   8373  C CZ  . PHE B 1 340 ? 34.341  77.234  54.471  1.00 47.59  ? 366 PHE B CZ  1 
ATOM   8374  N N   . LYS B 1 341 ? 36.136  83.998  56.013  1.00 56.52  ? 367 LYS B N   1 
ATOM   8375  C CA  . LYS B 1 341 ? 36.727  85.210  56.560  1.00 61.24  ? 367 LYS B CA  1 
ATOM   8376  C C   . LYS B 1 341 ? 37.895  84.834  57.469  1.00 62.54  ? 367 LYS B C   1 
ATOM   8377  O O   . LYS B 1 341 ? 37.734  84.047  58.403  1.00 62.88  ? 367 LYS B O   1 
ATOM   8378  C CB  . LYS B 1 341 ? 35.674  85.989  57.358  1.00 63.49  ? 367 LYS B CB  1 
ATOM   8379  C CG  . LYS B 1 341 ? 36.179  87.286  57.989  1.00 69.06  ? 367 LYS B CG  1 
ATOM   8380  C CD  . LYS B 1 341 ? 36.480  88.372  56.951  1.00 72.58  ? 367 LYS B CD  1 
ATOM   8381  C CE  . LYS B 1 341 ? 35.203  88.990  56.376  1.00 74.13  ? 367 LYS B CE  1 
ATOM   8382  N NZ  . LYS B 1 341 ? 35.484  90.077  55.388  1.00 72.47  ? 367 LYS B NZ  1 
ATOM   8383  N N   . ASN B 1 342 ? 39.070  85.385  57.183  1.00 64.15  ? 368 ASN B N   1 
ATOM   8384  C CA  . ASN B 1 342 ? 40.259  85.116  57.987  1.00 66.69  ? 368 ASN B CA  1 
ATOM   8385  C C   . ASN B 1 342 ? 40.484  83.614  58.169  1.00 66.40  ? 368 ASN B C   1 
ATOM   8386  O O   . ASN B 1 342 ? 39.962  83.001  59.099  1.00 67.40  ? 368 ASN B O   1 
ATOM   8387  C CB  . ASN B 1 342 ? 40.116  85.809  59.351  1.00 69.51  ? 368 ASN B CB  1 
ATOM   8388  C CG  . ASN B 1 342 ? 41.374  85.718  60.196  1.00 72.94  ? 368 ASN B CG  1 
ATOM   8389  O OD1 . ASN B 1 342 ? 42.475  86.012  59.724  1.00 74.68  ? 368 ASN B OD1 1 
ATOM   8390  N ND2 . ASN B 1 342 ? 41.215  85.324  61.461  1.00 73.48  ? 368 ASN B ND2 1 
ATOM   8391  N N   . TRP B 1 343 ? 41.260  83.028  57.266  1.00 65.91  ? 369 TRP B N   1 
ATOM   8392  C CA  . TRP B 1 343 ? 41.570  81.602  57.310  1.00 66.34  ? 369 TRP B CA  1 
ATOM   8393  C C   . TRP B 1 343 ? 43.001  81.432  57.819  1.00 70.64  ? 369 TRP B C   1 
ATOM   8394  O O   . TRP B 1 343 ? 43.903  82.156  57.397  1.00 70.92  ? 369 TRP B O   1 
ATOM   8395  C CB  . TRP B 1 343 ? 41.425  80.998  55.903  1.00 59.69  ? 369 TRP B CB  1 
ATOM   8396  C CG  . TRP B 1 343 ? 41.648  79.518  55.838  1.00 51.88  ? 369 TRP B CG  1 
ATOM   8397  C CD1 . TRP B 1 343 ? 42.837  78.859  55.972  1.00 51.65  ? 369 TRP B CD1 1 
ATOM   8398  C CD2 . TRP B 1 343 ? 40.647  78.505  55.662  1.00 48.64  ? 369 TRP B CD2 1 
ATOM   8399  N NE1 . TRP B 1 343 ? 42.640  77.500  55.894  1.00 49.55  ? 369 TRP B NE1 1 
ATOM   8400  C CE2 . TRP B 1 343 ? 41.306  77.256  55.705  1.00 48.69  ? 369 TRP B CE2 1 
ATOM   8401  C CE3 . TRP B 1 343 ? 39.259  78.533  55.478  1.00 46.68  ? 369 TRP B CE3 1 
ATOM   8402  C CZ2 . TRP B 1 343 ? 40.621  76.045  55.566  1.00 45.51  ? 369 TRP B CZ2 1 
ATOM   8403  C CZ3 . TRP B 1 343 ? 38.580  77.326  55.340  1.00 45.23  ? 369 TRP B CZ3 1 
ATOM   8404  C CH2 . TRP B 1 343 ? 39.264  76.101  55.388  1.00 44.31  ? 369 TRP B CH2 1 
ATOM   8405  N N   . ARG B 1 344 ? 43.214  80.483  58.725  1.00 76.03  ? 370 ARG B N   1 
ATOM   8406  C CA  . ARG B 1 344 ? 44.554  80.266  59.267  1.00 82.40  ? 370 ARG B CA  1 
ATOM   8407  C C   . ARG B 1 344 ? 44.977  78.799  59.240  1.00 84.94  ? 370 ARG B C   1 
ATOM   8408  O O   . ARG B 1 344 ? 44.152  77.900  59.398  1.00 85.09  ? 370 ARG B O   1 
ATOM   8409  C CB  . ARG B 1 344 ? 44.630  80.788  60.707  1.00 85.03  ? 370 ARG B CB  1 
ATOM   8410  C CG  . ARG B 1 344 ? 46.038  80.788  61.301  1.00 88.73  ? 370 ARG B CG  1 
ATOM   8411  C CD  . ARG B 1 344 ? 46.013  80.710  62.827  1.00 91.70  ? 370 ARG B CD  1 
ATOM   8412  N NE  . ARG B 1 344 ? 45.366  81.864  63.448  1.00 94.23  ? 370 ARG B NE  1 
ATOM   8413  C CZ  . ARG B 1 344 ? 45.072  81.948  64.743  1.00 94.75  ? 370 ARG B CZ  1 
ATOM   8414  N NH1 . ARG B 1 344 ? 45.359  80.941  65.560  1.00 94.44  ? 370 ARG B NH1 1 
ATOM   8415  N NH2 . ARG B 1 344 ? 44.487  83.037  65.224  1.00 95.01  ? 370 ARG B NH2 1 
ATOM   8416  N N   . ASP B 1 345 ? 46.271  78.570  59.038  1.00 88.68  ? 371 ASP B N   1 
ATOM   8417  C CA  . ASP B 1 345 ? 46.830  77.220  59.003  1.00 92.82  ? 371 ASP B CA  1 
ATOM   8418  C C   . ASP B 1 345 ? 47.598  76.928  60.292  1.00 95.18  ? 371 ASP B C   1 
ATOM   8419  O O   . ASP B 1 345 ? 48.458  77.709  60.704  1.00 95.47  ? 371 ASP B O   1 
ATOM   8420  C CB  . ASP B 1 345 ? 47.767  77.058  57.803  1.00 94.38  ? 371 ASP B CB  1 
ATOM   8421  C CG  . ASP B 1 345 ? 47.027  76.715  56.526  1.00 95.58  ? 371 ASP B CG  1 
ATOM   8422  O OD1 . ASP B 1 345 ? 46.086  77.449  56.160  1.00 97.05  ? 371 ASP B OD1 1 
ATOM   8423  O OD2 . ASP B 1 345 ? 47.391  75.707  55.884  1.00 96.92  ? 371 ASP B OD2 1 
ATOM   8424  N N   . PRO B 1 346 ? 47.300  75.788  60.938  1.00 97.23  ? 372 PRO B N   1 
ATOM   8425  C CA  . PRO B 1 346 ? 47.945  75.366  62.188  1.00 98.50  ? 372 PRO B CA  1 
ATOM   8426  C C   . PRO B 1 346 ? 49.462  75.575  62.213  1.00 99.96  ? 372 PRO B C   1 
ATOM   8427  O O   . PRO B 1 346 ? 49.965  76.452  62.923  1.00 100.41 ? 372 PRO B O   1 
ATOM   8428  C CB  . PRO B 1 346 ? 47.559  73.893  62.284  1.00 98.34  ? 372 PRO B CB  1 
ATOM   8429  C CG  . PRO B 1 346 ? 46.193  73.881  61.675  1.00 98.32  ? 372 PRO B CG  1 
ATOM   8430  C CD  . PRO B 1 346 ? 46.375  74.748  60.451  1.00 97.32  ? 372 PRO B CD  1 
ATOM   8431  N N   . ASP B 1 347 ? 50.182  74.765  61.438  1.00 100.41 ? 373 ASP B N   1 
ATOM   8432  C CA  . ASP B 1 347 ? 51.641  74.851  61.370  1.00 100.41 ? 373 ASP B CA  1 
ATOM   8433  C C   . ASP B 1 347 ? 52.168  75.195  59.979  1.00 100.21 ? 373 ASP B C   1 
ATOM   8434  O O   . ASP B 1 347 ? 52.803  74.366  59.322  1.00 99.85  ? 373 ASP B O   1 
ATOM   8435  C CB  . ASP B 1 347 ? 52.278  73.536  61.842  1.00 100.41 ? 373 ASP B CB  1 
ATOM   8436  C CG  . ASP B 1 347 ? 52.231  73.371  63.352  1.00 100.41 ? 373 ASP B CG  1 
ATOM   8437  O OD1 . ASP B 1 347 ? 51.118  73.277  63.913  1.00 100.40 ? 373 ASP B OD1 1 
ATOM   8438  O OD2 . ASP B 1 347 ? 53.313  73.340  63.978  1.00 100.05 ? 373 ASP B OD2 1 
ATOM   8439  N N   . GLN B 1 348 ? 51.899  76.419  59.537  1.00 100.10 ? 374 GLN B N   1 
ATOM   8440  C CA  . GLN B 1 348 ? 52.364  76.887  58.235  1.00 100.41 ? 374 GLN B CA  1 
ATOM   8441  C C   . GLN B 1 348 ? 52.914  78.304  58.320  1.00 100.41 ? 374 GLN B C   1 
ATOM   8442  O O   . GLN B 1 348 ? 53.411  78.848  57.330  1.00 100.41 ? 374 GLN B O   1 
ATOM   8443  C CB  . GLN B 1 348 ? 51.244  76.820  57.192  1.00 100.41 ? 374 GLN B CB  1 
ATOM   8444  C CG  . GLN B 1 348 ? 51.108  75.450  56.549  1.00 100.41 ? 374 GLN B CG  1 
ATOM   8445  C CD  . GLN B 1 348 ? 52.439  74.927  56.034  1.00 100.38 ? 374 GLN B CD  1 
ATOM   8446  O OE1 . GLN B 1 348 ? 53.080  75.554  55.193  1.00 100.10 ? 374 GLN B OE1 1 
ATOM   8447  N NE2 . GLN B 1 348 ? 52.861  73.775  56.545  1.00 100.41 ? 374 GLN B NE2 1 
ATOM   8448  N N   . THR B 1 349 ? 52.817  78.900  59.505  1.00 100.41 ? 375 THR B N   1 
ATOM   8449  C CA  . THR B 1 349 ? 53.338  80.243  59.726  1.00 100.41 ? 375 THR B CA  1 
ATOM   8450  C C   . THR B 1 349 ? 54.817  80.155  59.365  1.00 100.41 ? 375 THR B C   1 
ATOM   8451  O O   . THR B 1 349 ? 55.446  81.143  58.983  1.00 100.34 ? 375 THR B O   1 
ATOM   8452  C CB  . THR B 1 349 ? 53.194  80.664  61.212  1.00 100.41 ? 375 THR B CB  1 
ATOM   8453  O OG1 . THR B 1 349 ? 51.808  80.661  61.579  1.00 100.41 ? 375 THR B OG1 1 
ATOM   8454  C CG2 . THR B 1 349 ? 53.773  82.054  61.440  1.00 99.88  ? 375 THR B CG2 1 
ATOM   8455  N N   . GLU B 1 350 ? 55.350  78.942  59.487  1.00 100.41 ? 376 GLU B N   1 
ATOM   8456  C CA  . GLU B 1 350 ? 56.742  78.638  59.181  1.00 100.28 ? 376 GLU B CA  1 
ATOM   8457  C C   . GLU B 1 350 ? 56.775  77.718  57.959  1.00 100.35 ? 376 GLU B C   1 
ATOM   8458  O O   . GLU B 1 350 ? 56.646  76.499  58.089  1.00 99.89  ? 376 GLU B O   1 
ATOM   8459  C CB  . GLU B 1 350 ? 57.399  77.931  60.372  1.00 100.41 ? 376 GLU B CB  1 
ATOM   8460  C CG  . GLU B 1 350 ? 57.389  78.728  61.676  1.00 100.41 ? 376 GLU B CG  1 
ATOM   8461  C CD  . GLU B 1 350 ? 58.468  79.797  61.726  1.00 100.41 ? 376 GLU B CD  1 
ATOM   8462  O OE1 . GLU B 1 350 ? 58.455  80.613  62.674  1.00 100.41 ? 376 GLU B OE1 1 
ATOM   8463  O OE2 . GLU B 1 350 ? 59.334  79.817  60.823  1.00 100.41 ? 376 GLU B OE2 1 
ATOM   8464  N N   . GLY B 1 351 ? 56.936  78.305  56.776  1.00 100.41 ? 377 GLY B N   1 
ATOM   8465  C CA  . GLY B 1 351 ? 56.980  77.514  55.558  1.00 99.70  ? 377 GLY B CA  1 
ATOM   8466  C C   . GLY B 1 351 ? 56.679  78.322  54.310  1.00 99.84  ? 377 GLY B C   1 
ATOM   8467  O O   . GLY B 1 351 ? 56.485  79.539  54.375  1.00 100.35 ? 377 GLY B O   1 
ATOM   8468  N N   . LEU B 1 352 ? 56.642  77.639  53.168  1.00 99.40  ? 378 LEU B N   1 
ATOM   8469  C CA  . LEU B 1 352 ? 56.362  78.279  51.883  1.00 97.80  ? 378 LEU B CA  1 
ATOM   8470  C C   . LEU B 1 352 ? 55.360  77.447  51.084  1.00 96.21  ? 378 LEU B C   1 
ATOM   8471  O O   . LEU B 1 352 ? 55.708  76.393  50.551  1.00 96.55  ? 378 LEU B O   1 
ATOM   8472  C CB  . LEU B 1 352 ? 57.654  78.429  51.074  1.00 98.00  ? 378 LEU B CB  1 
ATOM   8473  C CG  . LEU B 1 352 ? 58.809  79.191  51.728  1.00 98.22  ? 378 LEU B CG  1 
ATOM   8474  C CD1 . LEU B 1 352 ? 60.034  79.112  50.830  1.00 98.26  ? 378 LEU B CD1 1 
ATOM   8475  C CD2 . LEU B 1 352 ? 58.408  80.639  51.977  1.00 97.57  ? 378 LEU B CD2 1 
ATOM   8476  N N   . GLY B 1 353 ? 54.122  77.927  51.003  1.00 94.35  ? 379 GLY B N   1 
ATOM   8477  C CA  . GLY B 1 353 ? 53.093  77.209  50.268  1.00 91.80  ? 379 GLY B CA  1 
ATOM   8478  C C   . GLY B 1 353 ? 52.117  76.515  51.199  1.00 89.32  ? 379 GLY B C   1 
ATOM   8479  O O   . GLY B 1 353 ? 52.471  75.545  51.870  1.00 89.21  ? 379 GLY B O   1 
ATOM   8480  N N   . LEU B 1 354 ? 50.882  77.007  51.234  1.00 86.61  ? 380 LEU B N   1 
ATOM   8481  C CA  . LEU B 1 354 ? 49.861  76.441  52.107  1.00 82.78  ? 380 LEU B CA  1 
ATOM   8482  C C   . LEU B 1 354 ? 49.351  75.082  51.643  1.00 79.51  ? 380 LEU B C   1 
ATOM   8483  O O   . LEU B 1 354 ? 48.141  74.868  51.536  1.00 80.85  ? 380 LEU B O   1 
ATOM   8484  C CB  . LEU B 1 354 ? 48.685  77.417  52.250  1.00 84.47  ? 380 LEU B CB  1 
ATOM   8485  C CG  . LEU B 1 354 ? 48.936  78.751  52.966  1.00 85.42  ? 380 LEU B CG  1 
ATOM   8486  C CD1 . LEU B 1 354 ? 47.657  79.580  52.953  1.00 84.85  ? 380 LEU B CD1 1 
ATOM   8487  C CD2 . LEU B 1 354 ? 49.394  78.501  54.404  1.00 86.17  ? 380 LEU B CD2 1 
ATOM   8488  N N   . ALA B 1 355 ? 50.281  74.170  51.367  1.00 73.82  ? 381 ALA B N   1 
ATOM   8489  C CA  . ALA B 1 355 ? 49.954  72.809  50.940  1.00 67.59  ? 381 ALA B CA  1 
ATOM   8490  C C   . ALA B 1 355 ? 49.296  72.702  49.563  1.00 64.26  ? 381 ALA B C   1 
ATOM   8491  O O   . ALA B 1 355 ? 49.051  71.594  49.073  1.00 63.66  ? 381 ALA B O   1 
ATOM   8492  C CB  . ALA B 1 355 ? 49.073  72.131  51.992  1.00 64.69  ? 381 ALA B CB  1 
ATOM   8493  N N   . TYR B 1 356 ? 49.003  73.840  48.941  1.00 58.15  ? 382 TYR B N   1 
ATOM   8494  C CA  . TYR B 1 356 ? 48.386  73.821  47.622  1.00 52.27  ? 382 TYR B CA  1 
ATOM   8495  C C   . TYR B 1 356 ? 48.905  74.940  46.740  1.00 50.09  ? 382 TYR B C   1 
ATOM   8496  O O   . TYR B 1 356 ? 48.845  76.114  47.112  1.00 51.32  ? 382 TYR B O   1 
ATOM   8497  C CB  . TYR B 1 356 ? 46.868  73.941  47.711  1.00 49.20  ? 382 TYR B CB  1 
ATOM   8498  C CG  . TYR B 1 356 ? 46.208  73.676  46.379  1.00 45.28  ? 382 TYR B CG  1 
ATOM   8499  C CD1 . TYR B 1 356 ? 45.979  72.375  45.939  1.00 43.83  ? 382 TYR B CD1 1 
ATOM   8500  C CD2 . TYR B 1 356 ? 45.867  74.725  45.531  1.00 45.36  ? 382 TYR B CD2 1 
ATOM   8501  C CE1 . TYR B 1 356 ? 45.425  72.125  44.683  1.00 43.71  ? 382 TYR B CE1 1 
ATOM   8502  C CE2 . TYR B 1 356 ? 45.315  74.486  44.273  1.00 43.41  ? 382 TYR B CE2 1 
ATOM   8503  C CZ  . TYR B 1 356 ? 45.095  73.187  43.856  1.00 42.23  ? 382 TYR B CZ  1 
ATOM   8504  O OH  . TYR B 1 356 ? 44.535  72.957  42.621  1.00 41.74  ? 382 TYR B OH  1 
ATOM   8505  N N   . LEU B 1 357 ? 49.390  74.560  45.561  1.00 44.56  ? 383 LEU B N   1 
ATOM   8506  C CA  . LEU B 1 357 ? 49.940  75.497  44.595  1.00 40.41  ? 383 LEU B CA  1 
ATOM   8507  C C   . LEU B 1 357 ? 49.141  75.456  43.289  1.00 39.28  ? 383 LEU B C   1 
ATOM   8508  O O   . LEU B 1 357 ? 49.130  74.442  42.595  1.00 40.55  ? 383 LEU B O   1 
ATOM   8509  C CB  . LEU B 1 357 ? 51.398  75.135  44.330  1.00 39.02  ? 383 LEU B CB  1 
ATOM   8510  C CG  . LEU B 1 357 ? 52.217  76.060  43.441  1.00 40.25  ? 383 LEU B CG  1 
ATOM   8511  C CD1 . LEU B 1 357 ? 52.431  77.369  44.145  1.00 41.44  ? 383 LEU B CD1 1 
ATOM   8512  C CD2 . LEU B 1 357 ? 53.552  75.417  43.129  1.00 42.09  ? 383 LEU B CD2 1 
ATOM   8513  N N   . SER B 1 358 ? 48.475  76.557  42.956  1.00 37.12  ? 384 SER B N   1 
ATOM   8514  C CA  . SER B 1 358 ? 47.682  76.622  41.735  1.00 34.05  ? 384 SER B CA  1 
ATOM   8515  C C   . SER B 1 358 ? 48.532  76.321  40.513  1.00 34.11  ? 384 SER B C   1 
ATOM   8516  O O   . SER B 1 358 ? 49.589  76.924  40.296  1.00 32.57  ? 384 SER B O   1 
ATOM   8517  C CB  . SER B 1 358 ? 47.031  77.994  41.584  1.00 34.54  ? 384 SER B CB  1 
ATOM   8518  O OG  . SER B 1 358 ? 46.126  78.239  42.645  1.00 38.31  ? 384 SER B OG  1 
ATOM   8519  N N   . SER B 1 359 ? 48.042  75.378  39.719  1.00 33.69  ? 385 SER B N   1 
ATOM   8520  C CA  . SER B 1 359 ? 48.703  74.925  38.511  1.00 33.52  ? 385 SER B CA  1 
ATOM   8521  C C   . SER B 1 359 ? 49.223  76.031  37.585  1.00 33.27  ? 385 SER B C   1 
ATOM   8522  O O   . SER B 1 359 ? 50.346  75.947  37.085  1.00 30.86  ? 385 SER B O   1 
ATOM   8523  C CB  . SER B 1 359 ? 47.746  74.019  37.741  1.00 37.91  ? 385 SER B CB  1 
ATOM   8524  O OG  . SER B 1 359 ? 48.438  73.190  36.824  1.00 47.02  ? 385 SER B OG  1 
ATOM   8525  N N   . HIS B 1 360 ? 48.428  77.072  37.361  1.00 32.65  ? 386 HIS B N   1 
ATOM   8526  C CA  . HIS B 1 360 ? 48.853  78.130  36.454  1.00 35.07  ? 386 HIS B CA  1 
ATOM   8527  C C   . HIS B 1 360 ? 50.021  78.997  36.916  1.00 35.89  ? 386 HIS B C   1 
ATOM   8528  O O   . HIS B 1 360 ? 50.561  79.771  36.128  1.00 36.31  ? 386 HIS B O   1 
ATOM   8529  C CB  . HIS B 1 360 ? 47.658  79.012  36.066  1.00 37.75  ? 386 HIS B CB  1 
ATOM   8530  C CG  . HIS B 1 360 ? 47.075  79.793  37.200  1.00 39.40  ? 386 HIS B CG  1 
ATOM   8531  N ND1 . HIS B 1 360 ? 47.223  81.158  37.315  1.00 41.39  ? 386 HIS B ND1 1 
ATOM   8532  C CD2 . HIS B 1 360 ? 46.323  79.406  38.257  1.00 41.46  ? 386 HIS B CD2 1 
ATOM   8533  C CE1 . HIS B 1 360 ? 46.586  81.579  38.392  1.00 39.23  ? 386 HIS B CE1 1 
ATOM   8534  N NE2 . HIS B 1 360 ? 46.031  80.536  38.983  1.00 38.84  ? 386 HIS B NE2 1 
ATOM   8535  N N   . ILE B 1 361 ? 50.421  78.880  38.179  1.00 35.49  ? 387 ILE B N   1 
ATOM   8536  C CA  . ILE B 1 361 ? 51.558  79.662  38.666  1.00 34.29  ? 387 ILE B CA  1 
ATOM   8537  C C   . ILE B 1 361 ? 52.636  78.752  39.251  1.00 34.19  ? 387 ILE B C   1 
ATOM   8538  O O   . ILE B 1 361 ? 53.628  79.232  39.796  1.00 33.91  ? 387 ILE B O   1 
ATOM   8539  C CB  . ILE B 1 361 ? 51.156  80.685  39.765  1.00 33.52  ? 387 ILE B CB  1 
ATOM   8540  C CG1 . ILE B 1 361 ? 50.642  79.944  40.998  1.00 31.91  ? 387 ILE B CG1 1 
ATOM   8541  C CG2 . ILE B 1 361 ? 50.138  81.683  39.214  1.00 32.15  ? 387 ILE B CG2 1 
ATOM   8542  C CD1 . ILE B 1 361 ? 50.408  80.831  42.189  1.00 32.21  ? 387 ILE B CD1 1 
ATOM   8543  N N   . ALA B 1 362 ? 52.436  77.443  39.127  1.00 35.37  ? 388 ALA B N   1 
ATOM   8544  C CA  . ALA B 1 362 ? 53.376  76.458  39.657  1.00 38.20  ? 388 ALA B CA  1 
ATOM   8545  C C   . ALA B 1 362 ? 54.810  76.654  39.172  1.00 40.24  ? 388 ALA B C   1 
ATOM   8546  O O   . ALA B 1 362 ? 55.763  76.318  39.874  1.00 40.71  ? 388 ALA B O   1 
ATOM   8547  C CB  . ALA B 1 362 ? 52.903  75.058  39.302  1.00 34.24  ? 388 ALA B CB  1 
ATOM   8548  N N   . HIS B 1 363 ? 54.948  77.214  37.975  1.00 43.78  ? 389 HIS B N   1 
ATOM   8549  C CA  . HIS B 1 363 ? 56.244  77.442  37.334  1.00 44.96  ? 389 HIS B CA  1 
ATOM   8550  C C   . HIS B 1 363 ? 56.880  78.787  37.679  1.00 45.27  ? 389 HIS B C   1 
ATOM   8551  O O   . HIS B 1 363 ? 58.065  79.002  37.416  1.00 46.40  ? 389 HIS B O   1 
ATOM   8552  C CB  . HIS B 1 363 ? 56.053  77.387  35.828  1.00 47.09  ? 389 HIS B CB  1 
ATOM   8553  C CG  . HIS B 1 363 ? 55.220  78.514  35.307  1.00 48.84  ? 389 HIS B CG  1 
ATOM   8554  N ND1 . HIS B 1 363 ? 55.755  79.742  34.984  1.00 49.48  ? 389 HIS B ND1 1 
ATOM   8555  C CD2 . HIS B 1 363 ? 53.880  78.634  35.154  1.00 49.49  ? 389 HIS B CD2 1 
ATOM   8556  C CE1 . HIS B 1 363 ? 54.781  80.571  34.654  1.00 50.70  ? 389 HIS B CE1 1 
ATOM   8557  N NE2 . HIS B 1 363 ? 53.634  79.924  34.750  1.00 51.92  ? 389 HIS B NE2 1 
ATOM   8558  N N   . VAL B 1 364 ? 56.089  79.699  38.234  1.00 45.35  ? 390 VAL B N   1 
ATOM   8559  C CA  . VAL B 1 364 ? 56.587  81.024  38.590  1.00 45.18  ? 390 VAL B CA  1 
ATOM   8560  C C   . VAL B 1 364 ? 57.567  81.000  39.761  1.00 44.54  ? 390 VAL B C   1 
ATOM   8561  O O   . VAL B 1 364 ? 57.266  80.474  40.832  1.00 44.32  ? 390 VAL B O   1 
ATOM   8562  C CB  . VAL B 1 364 ? 55.421  81.973  38.925  1.00 44.22  ? 390 VAL B CB  1 
ATOM   8563  C CG1 . VAL B 1 364 ? 55.954  83.334  39.365  1.00 40.89  ? 390 VAL B CG1 1 
ATOM   8564  C CG2 . VAL B 1 364 ? 54.522  82.112  37.712  1.00 42.02  ? 390 VAL B CG2 1 
ATOM   8565  N N   . GLU B 1 365 ? 58.742  81.578  39.540  1.00 46.01  ? 391 GLU B N   1 
ATOM   8566  C CA  . GLU B 1 365 ? 59.780  81.636  40.558  1.00 48.60  ? 391 GLU B CA  1 
ATOM   8567  C C   . GLU B 1 365 ? 59.601  82.821  41.489  1.00 46.73  ? 391 GLU B C   1 
ATOM   8568  O O   . GLU B 1 365 ? 59.491  83.959  41.042  1.00 45.37  ? 391 GLU B O   1 
ATOM   8569  C CB  . GLU B 1 365 ? 61.163  81.732  39.906  1.00 53.72  ? 391 GLU B CB  1 
ATOM   8570  C CG  . GLU B 1 365 ? 61.691  80.433  39.311  1.00 63.04  ? 391 GLU B CG  1 
ATOM   8571  C CD  . GLU B 1 365 ? 63.078  80.597  38.698  1.00 69.31  ? 391 GLU B CD  1 
ATOM   8572  O OE1 . GLU B 1 365 ? 64.000  81.050  39.417  1.00 71.90  ? 391 GLU B OE1 1 
ATOM   8573  O OE2 . GLU B 1 365 ? 63.246  80.272  37.499  1.00 71.70  ? 391 GLU B OE2 1 
ATOM   8574  N N   . ARG B 1 366 ? 59.567  82.544  42.786  1.00 45.03  ? 392 ARG B N   1 
ATOM   8575  C CA  . ARG B 1 366 ? 59.440  83.587  43.790  1.00 44.11  ? 392 ARG B CA  1 
ATOM   8576  C C   . ARG B 1 366 ? 60.765  84.355  43.814  1.00 41.61  ? 392 ARG B C   1 
ATOM   8577  O O   . ARG B 1 366 ? 61.834  83.757  43.876  1.00 41.00  ? 392 ARG B O   1 
ATOM   8578  C CB  . ARG B 1 366 ? 59.197  82.967  45.163  1.00 47.23  ? 392 ARG B CB  1 
ATOM   8579  C CG  . ARG B 1 366 ? 57.897  82.214  45.305  1.00 52.73  ? 392 ARG B CG  1 
ATOM   8580  C CD  . ARG B 1 366 ? 56.743  83.172  45.535  1.00 61.59  ? 392 ARG B CD  1 
ATOM   8581  N NE  . ARG B 1 366 ? 55.501  82.482  45.878  1.00 64.85  ? 392 ARG B NE  1 
ATOM   8582  C CZ  . ARG B 1 366 ? 54.912  81.577  45.105  1.00 67.75  ? 392 ARG B CZ  1 
ATOM   8583  N NH1 . ARG B 1 366 ? 55.447  81.241  43.937  1.00 68.73  ? 392 ARG B NH1 1 
ATOM   8584  N NH2 . ARG B 1 366 ? 53.780  81.013  45.499  1.00 69.26  ? 392 ARG B NH2 1 
ATOM   8585  N N   . VAL B 1 367 ? 60.699  85.675  43.758  1.00 37.68  ? 393 VAL B N   1 
ATOM   8586  C CA  . VAL B 1 367 ? 61.916  86.469  43.783  1.00 37.83  ? 393 VAL B CA  1 
ATOM   8587  C C   . VAL B 1 367 ? 61.796  87.604  44.801  1.00 36.29  ? 393 VAL B C   1 
ATOM   8588  O O   . VAL B 1 367 ? 61.027  88.540  44.614  1.00 35.22  ? 393 VAL B O   1 
ATOM   8589  C CB  . VAL B 1 367 ? 62.235  87.026  42.371  1.00 37.41  ? 393 VAL B CB  1 
ATOM   8590  C CG1 . VAL B 1 367 ? 60.960  87.460  41.690  1.00 40.42  ? 393 VAL B CG1 1 
ATOM   8591  C CG2 . VAL B 1 367 ? 63.196  88.195  42.464  1.00 36.50  ? 393 VAL B CG2 1 
ATOM   8592  N N   . PRO B 1 368 ? 62.550  87.516  45.907  1.00 35.89  ? 394 PRO B N   1 
ATOM   8593  C CA  . PRO B 1 368 ? 62.539  88.525  46.966  1.00 36.50  ? 394 PRO B CA  1 
ATOM   8594  C C   . PRO B 1 368 ? 62.990  89.909  46.511  1.00 36.34  ? 394 PRO B C   1 
ATOM   8595  O O   . PRO B 1 368 ? 63.856  90.047  45.638  1.00 34.62  ? 394 PRO B O   1 
ATOM   8596  C CB  . PRO B 1 368 ? 63.466  87.927  48.019  1.00 35.86  ? 394 PRO B CB  1 
ATOM   8597  C CG  . PRO B 1 368 ? 64.411  87.129  47.211  1.00 36.45  ? 394 PRO B CG  1 
ATOM   8598  C CD  . PRO B 1 368 ? 63.498  86.441  46.240  1.00 37.26  ? 394 PRO B CD  1 
ATOM   8599  N N   . PHE B 1 369 ? 62.395  90.932  47.116  1.00 36.00  ? 395 PHE B N   1 
ATOM   8600  C CA  . PHE B 1 369 ? 62.726  92.305  46.774  1.00 39.59  ? 395 PHE B CA  1 
ATOM   8601  C C   . PHE B 1 369 ? 64.183  92.662  47.051  1.00 41.32  ? 395 PHE B C   1 
ATOM   8602  O O   . PHE B 1 369 ? 64.806  92.140  47.980  1.00 43.28  ? 395 PHE B O   1 
ATOM   8603  C CB  . PHE B 1 369 ? 61.811  93.276  47.519  1.00 38.77  ? 395 PHE B CB  1 
ATOM   8604  C CG  . PHE B 1 369 ? 62.032  94.708  47.145  1.00 40.47  ? 395 PHE B CG  1 
ATOM   8605  C CD1 . PHE B 1 369 ? 62.907  95.503  47.876  1.00 39.57  ? 395 PHE B CD1 1 
ATOM   8606  C CD2 . PHE B 1 369 ? 61.411  95.246  46.019  1.00 39.58  ? 395 PHE B CD2 1 
ATOM   8607  C CE1 . PHE B 1 369 ? 63.167  96.817  47.493  1.00 40.65  ? 395 PHE B CE1 1 
ATOM   8608  C CE2 . PHE B 1 369 ? 61.663  96.556  45.626  1.00 43.07  ? 395 PHE B CE2 1 
ATOM   8609  C CZ  . PHE B 1 369 ? 62.546  97.346  46.366  1.00 40.53  ? 395 PHE B CZ  1 
ATOM   8610  N N   . ASP B 1 370 ? 64.715  93.558  46.228  1.00 43.01  ? 396 ASP B N   1 
ATOM   8611  C CA  . ASP B 1 370 ? 66.092  94.020  46.342  1.00 44.33  ? 396 ASP B CA  1 
ATOM   8612  C C   . ASP B 1 370 ? 66.228  95.260  45.469  1.00 43.80  ? 396 ASP B C   1 
ATOM   8613  O O   . ASP B 1 370 ? 66.379  95.152  44.251  1.00 42.18  ? 396 ASP B O   1 
ATOM   8614  C CB  . ASP B 1 370 ? 67.061  92.931  45.860  1.00 47.19  ? 396 ASP B CB  1 
ATOM   8615  C CG  . ASP B 1 370 ? 68.517  93.297  46.096  1.00 49.26  ? 396 ASP B CG  1 
ATOM   8616  O OD1 . ASP B 1 370 ? 68.867  93.621  47.250  1.00 49.75  ? 396 ASP B OD1 1 
ATOM   8617  O OD2 . ASP B 1 370 ? 69.313  93.257  45.132  1.00 51.44  ? 396 ASP B OD2 1 
ATOM   8618  N N   . ALA B 1 371 ? 66.160  96.432  46.096  1.00 44.14  ? 397 ALA B N   1 
ATOM   8619  C CA  . ALA B 1 371 ? 66.262  97.701  45.378  1.00 45.61  ? 397 ALA B CA  1 
ATOM   8620  C C   . ALA B 1 371 ? 67.451  97.737  44.429  1.00 46.78  ? 397 ALA B C   1 
ATOM   8621  O O   . ALA B 1 371 ? 67.368  98.313  43.340  1.00 47.03  ? 397 ALA B O   1 
ATOM   8622  C CB  . ALA B 1 371 ? 66.354  98.855  46.368  1.00 45.07  ? 397 ALA B CB  1 
ATOM   8623  N N   . ALA B 1 372 ? 68.554  97.116  44.841  1.00 48.43  ? 398 ALA B N   1 
ATOM   8624  C CA  . ALA B 1 372 ? 69.771  97.080  44.032  1.00 49.52  ? 398 ALA B CA  1 
ATOM   8625  C C   . ALA B 1 372 ? 69.567  96.465  42.645  1.00 50.27  ? 398 ALA B C   1 
ATOM   8626  O O   . ALA B 1 372 ? 70.220  96.871  41.681  1.00 52.17  ? 398 ALA B O   1 
ATOM   8627  C CB  . ALA B 1 372 ? 70.864  96.325  44.778  1.00 50.43  ? 398 ALA B CB  1 
ATOM   8628  N N   . THR B 1 373 ? 68.664  95.493  42.537  1.00 48.38  ? 399 THR B N   1 
ATOM   8629  C CA  . THR B 1 373 ? 68.419  94.846  41.252  1.00 44.63  ? 399 THR B CA  1 
ATOM   8630  C C   . THR B 1 373 ? 66.995  94.974  40.704  1.00 41.72  ? 399 THR B C   1 
ATOM   8631  O O   . THR B 1 373 ? 66.669  94.373  39.684  1.00 39.56  ? 399 THR B O   1 
ATOM   8632  C CB  . THR B 1 373 ? 68.795  93.360  41.323  1.00 44.21  ? 399 THR B CB  1 
ATOM   8633  O OG1 . THR B 1 373 ? 68.096  92.737  42.405  1.00 44.94  ? 399 THR B OG1 1 
ATOM   8634  C CG2 . THR B 1 373 ? 70.279  93.214  41.548  1.00 44.79  ? 399 THR B CG2 1 
ATOM   8635  N N   . LEU B 1 374 ? 66.158  95.766  41.367  1.00 40.35  ? 400 LEU B N   1 
ATOM   8636  C CA  . LEU B 1 374 ? 64.780  95.959  40.928  1.00 40.18  ? 400 LEU B CA  1 
ATOM   8637  C C   . LEU B 1 374 ? 64.664  96.329  39.456  1.00 42.69  ? 400 LEU B C   1 
ATOM   8638  O O   . LEU B 1 374 ? 63.964  95.662  38.696  1.00 43.25  ? 400 LEU B O   1 
ATOM   8639  C CB  . LEU B 1 374 ? 64.091  97.049  41.756  1.00 35.98  ? 400 LEU B CB  1 
ATOM   8640  C CG  . LEU B 1 374 ? 62.651  97.362  41.316  1.00 32.88  ? 400 LEU B CG  1 
ATOM   8641  C CD1 . LEU B 1 374 ? 61.801  96.089  41.387  1.00 26.14  ? 400 LEU B CD1 1 
ATOM   8642  C CD2 . LEU B 1 374 ? 62.059  98.450  42.193  1.00 29.17  ? 400 LEU B CD2 1 
ATOM   8643  N N   . HIS B 1 375 ? 65.346  97.396  39.059  1.00 45.12  ? 401 HIS B N   1 
ATOM   8644  C CA  . HIS B 1 375 ? 65.293  97.866  37.681  1.00 48.24  ? 401 HIS B CA  1 
ATOM   8645  C C   . HIS B 1 375 ? 65.743  96.813  36.679  1.00 47.34  ? 401 HIS B C   1 
ATOM   8646  O O   . HIS B 1 375 ? 65.638  97.014  35.466  1.00 47.52  ? 401 HIS B O   1 
ATOM   8647  C CB  . HIS B 1 375 ? 66.176  99.096  37.522  1.00 54.38  ? 401 HIS B CB  1 
ATOM   8648  C CG  . HIS B 1 375 ? 67.622  98.824  37.777  1.00 61.74  ? 401 HIS B CG  1 
ATOM   8649  N ND1 . HIS B 1 375 ? 68.328  97.863  37.086  1.00 65.72  ? 401 HIS B ND1 1 
ATOM   8650  C CD2 . HIS B 1 375 ? 68.491  99.363  38.665  1.00 65.05  ? 401 HIS B CD2 1 
ATOM   8651  C CE1 . HIS B 1 375 ? 69.569  97.819  37.539  1.00 67.11  ? 401 HIS B CE1 1 
ATOM   8652  N NE2 . HIS B 1 375 ? 69.692  98.720  38.498  1.00 67.84  ? 401 HIS B NE2 1 
ATOM   8653  N N   . THR B 1 376 ? 66.242  95.691  37.178  1.00 44.40  ? 402 THR B N   1 
ATOM   8654  C CA  . THR B 1 376 ? 66.726  94.643  36.294  1.00 44.45  ? 402 THR B CA  1 
ATOM   8655  C C   . THR B 1 376 ? 65.743  93.483  36.116  1.00 43.07  ? 402 THR B C   1 
ATOM   8656  O O   . THR B 1 376 ? 65.913  92.642  35.238  1.00 44.18  ? 402 THR B O   1 
ATOM   8657  C CB  . THR B 1 376 ? 68.080  94.103  36.818  1.00 45.38  ? 402 THR B CB  1 
ATOM   8658  O OG1 . THR B 1 376 ? 68.975  93.932  35.718  1.00 48.78  ? 402 THR B OG1 1 
ATOM   8659  C CG2 . THR B 1 376 ? 67.905  92.764  37.544  1.00 44.07  ? 402 THR B CG2 1 
ATOM   8660  N N   . SER B 1 377 ? 64.703  93.456  36.941  1.00 41.11  ? 403 SER B N   1 
ATOM   8661  C CA  . SER B 1 377 ? 63.728  92.375  36.900  1.00 38.43  ? 403 SER B CA  1 
ATOM   8662  C C   . SER B 1 377 ? 62.272  92.818  36.884  1.00 35.85  ? 403 SER B C   1 
ATOM   8663  O O   . SER B 1 377 ? 61.834  93.544  37.771  1.00 37.40  ? 403 SER B O   1 
ATOM   8664  C CB  . SER B 1 377 ? 63.950  91.467  38.109  1.00 37.40  ? 403 SER B CB  1 
ATOM   8665  O OG  . SER B 1 377 ? 62.870  90.571  38.274  1.00 41.16  ? 403 SER B OG  1 
ATOM   8666  N N   . THR B 1 378 ? 61.511  92.368  35.894  1.00 31.97  ? 404 THR B N   1 
ATOM   8667  C CA  . THR B 1 378 ? 60.100  92.728  35.843  1.00 33.07  ? 404 THR B CA  1 
ATOM   8668  C C   . THR B 1 378 ? 59.325  91.804  36.793  1.00 30.49  ? 404 THR B C   1 
ATOM   8669  O O   . THR B 1 378 ? 58.285  92.182  37.336  1.00 27.62  ? 404 THR B O   1 
ATOM   8670  C CB  . THR B 1 378 ? 59.527  92.610  34.411  1.00 33.36  ? 404 THR B CB  1 
ATOM   8671  O OG1 . THR B 1 378 ? 59.643  91.258  33.958  1.00 39.33  ? 404 THR B OG1 1 
ATOM   8672  C CG2 . THR B 1 378 ? 60.281  93.520  33.459  1.00 33.78  ? 404 THR B CG2 1 
ATOM   8673  N N   . ALA B 1 379 ? 59.848  90.598  36.993  1.00 28.13  ? 405 ALA B N   1 
ATOM   8674  C CA  . ALA B 1 379 ? 59.226  89.625  37.885  1.00 28.27  ? 405 ALA B CA  1 
ATOM   8675  C C   . ALA B 1 379 ? 59.185  90.183  39.306  1.00 28.22  ? 405 ALA B C   1 
ATOM   8676  O O   . ALA B 1 379 ? 58.193  90.025  40.018  1.00 28.50  ? 405 ALA B O   1 
ATOM   8677  C CB  . ALA B 1 379 ? 60.003  88.316  37.860  1.00 27.02  ? 405 ALA B CB  1 
ATOM   8678  N N   . MET B 1 380 ? 60.271  90.833  39.712  1.00 27.78  ? 406 MET B N   1 
ATOM   8679  C CA  . MET B 1 380 ? 60.352  91.434  41.040  1.00 27.63  ? 406 MET B CA  1 
ATOM   8680  C C   . MET B 1 380 ? 59.360  92.593  41.116  1.00 24.61  ? 406 MET B C   1 
ATOM   8681  O O   . MET B 1 380 ? 58.692  92.788  42.129  1.00 22.47  ? 406 MET B O   1 
ATOM   8682  C CB  . MET B 1 380 ? 61.765  91.959  41.309  1.00 29.03  ? 406 MET B CB  1 
ATOM   8683  C CG  . MET B 1 380 ? 61.972  92.475  42.727  1.00 30.24  ? 406 MET B CG  1 
ATOM   8684  S SD  . MET B 1 380 ? 63.615  93.182  42.985  1.00 32.04  ? 406 MET B SD  1 
ATOM   8685  C CE  . MET B 1 380 ? 64.588  91.664  43.206  1.00 34.73  ? 406 MET B CE  1 
ATOM   8686  N N   . ALA B 1 381 ? 59.272  93.360  40.035  1.00 22.14  ? 407 ALA B N   1 
ATOM   8687  C CA  . ALA B 1 381 ? 58.353  94.490  39.985  1.00 21.96  ? 407 ALA B CA  1 
ATOM   8688  C C   . ALA B 1 381 ? 56.909  94.016  40.193  1.00 22.83  ? 407 ALA B C   1 
ATOM   8689  O O   . ALA B 1 381 ? 56.169  94.577  41.012  1.00 23.53  ? 407 ALA B O   1 
ATOM   8690  C CB  . ALA B 1 381 ? 58.482  95.213  38.643  1.00 18.56  ? 407 ALA B CB  1 
ATOM   8691  N N   . ALA B 1 382 ? 56.526  92.975  39.457  1.00 20.68  ? 408 ALA B N   1 
ATOM   8692  C CA  . ALA B 1 382 ? 55.186  92.416  39.531  1.00 19.58  ? 408 ALA B CA  1 
ATOM   8693  C C   . ALA B 1 382 ? 54.851  91.823  40.896  1.00 21.33  ? 408 ALA B C   1 
ATOM   8694  O O   . ALA B 1 382 ? 53.810  92.118  41.473  1.00 23.47  ? 408 ALA B O   1 
ATOM   8695  C CB  . ALA B 1 382 ? 55.017  91.355  38.459  1.00 17.84  ? 408 ALA B CB  1 
ATOM   8696  N N   . GLN B 1 383 ? 55.734  90.981  41.409  1.00 22.71  ? 409 GLN B N   1 
ATOM   8697  C CA  . GLN B 1 383 ? 55.508  90.331  42.690  1.00 24.99  ? 409 GLN B CA  1 
ATOM   8698  C C   . GLN B 1 383 ? 55.527  91.267  43.887  1.00 25.30  ? 409 GLN B C   1 
ATOM   8699  O O   . GLN B 1 383 ? 55.008  90.934  44.947  1.00 27.54  ? 409 GLN B O   1 
ATOM   8700  C CB  . GLN B 1 383 ? 56.545  89.227  42.891  1.00 28.37  ? 409 GLN B CB  1 
ATOM   8701  C CG  . GLN B 1 383 ? 56.301  87.987  42.048  1.00 27.90  ? 409 GLN B CG  1 
ATOM   8702  C CD  . GLN B 1 383 ? 57.477  87.028  42.064  1.00 31.75  ? 409 GLN B CD  1 
ATOM   8703  O OE1 . GLN B 1 383 ? 58.135  86.827  43.100  1.00 26.48  ? 409 GLN B OE1 1 
ATOM   8704  N NE2 . GLN B 1 383 ? 57.743  86.415  40.913  1.00 31.42  ? 409 GLN B NE2 1 
ATOM   8705  N N   . HIS B 1 384 ? 56.122  92.440  43.723  1.00 24.88  ? 410 HIS B N   1 
ATOM   8706  C CA  . HIS B 1 384 ? 56.203  93.388  44.822  1.00 22.16  ? 410 HIS B CA  1 
ATOM   8707  C C   . HIS B 1 384 ? 55.490  94.698  44.540  1.00 23.06  ? 410 HIS B C   1 
ATOM   8708  O O   . HIS B 1 384 ? 55.520  95.618  45.361  1.00 23.80  ? 410 HIS B O   1 
ATOM   8709  C CB  . HIS B 1 384 ? 57.673  93.629  45.170  1.00 22.87  ? 410 HIS B CB  1 
ATOM   8710  C CG  . HIS B 1 384 ? 58.351  92.419  45.733  1.00 22.23  ? 410 HIS B CG  1 
ATOM   8711  N ND1 . HIS B 1 384 ? 58.074  91.936  46.995  1.00 23.02  ? 410 HIS B ND1 1 
ATOM   8712  C CD2 . HIS B 1 384 ? 59.216  91.540  45.178  1.00 21.92  ? 410 HIS B CD2 1 
ATOM   8713  C CE1 . HIS B 1 384 ? 58.736  90.810  47.188  1.00 21.86  ? 410 HIS B CE1 1 
ATOM   8714  N NE2 . HIS B 1 384 ? 59.434  90.547  46.100  1.00 20.69  ? 410 HIS B NE2 1 
ATOM   8715  N N   . GLY B 1 385 ? 54.833  94.773  43.386  1.00 21.78  ? 411 GLY B N   1 
ATOM   8716  C CA  . GLY B 1 385 ? 54.111  95.980  43.021  1.00 23.52  ? 411 GLY B CA  1 
ATOM   8717  C C   . GLY B 1 385 ? 54.954  97.244  43.060  1.00 23.08  ? 411 GLY B C   1 
ATOM   8718  O O   . GLY B 1 385 ? 54.537  98.259  43.609  1.00 23.75  ? 411 GLY B O   1 
ATOM   8719  N N   . MET B 1 386 ? 56.144  97.180  42.474  1.00 23.78  ? 412 MET B N   1 
ATOM   8720  C CA  . MET B 1 386 ? 57.053  98.321  42.447  1.00 25.33  ? 412 MET B CA  1 
ATOM   8721  C C   . MET B 1 386 ? 57.517  98.570  41.025  1.00 24.66  ? 412 MET B C   1 
ATOM   8722  O O   . MET B 1 386 ? 58.384  97.862  40.532  1.00 28.59  ? 412 MET B O   1 
ATOM   8723  C CB  . MET B 1 386 ? 58.285  98.045  43.320  1.00 24.90  ? 412 MET B CB  1 
ATOM   8724  C CG  . MET B 1 386 ? 58.028  97.935  44.818  1.00 23.51  ? 412 MET B CG  1 
ATOM   8725  S SD  . MET B 1 386 ? 57.702  99.517  45.632  1.00 22.06  ? 412 MET B SD  1 
ATOM   8726  C CE  . MET B 1 386 ? 59.352  100.240 45.699  1.00 16.12  ? 412 MET B CE  1 
ATOM   8727  N N   . ASP B 1 387 ? 56.960  99.578  40.369  1.00 25.53  ? 413 ASP B N   1 
ATOM   8728  C CA  . ASP B 1 387 ? 57.356  99.886  38.996  1.00 26.51  ? 413 ASP B CA  1 
ATOM   8729  C C   . ASP B 1 387 ? 58.779  100.447 38.899  1.00 26.17  ? 413 ASP B C   1 
ATOM   8730  O O   . ASP B 1 387 ? 59.346  100.554 37.808  1.00 26.30  ? 413 ASP B O   1 
ATOM   8731  C CB  . ASP B 1 387 ? 56.336  100.836 38.370  1.00 26.39  ? 413 ASP B CB  1 
ATOM   8732  C CG  . ASP B 1 387 ? 55.008  100.149 38.096  1.00 26.52  ? 413 ASP B CG  1 
ATOM   8733  O OD1 . ASP B 1 387 ? 53.947  100.744 38.380  1.00 27.93  ? 413 ASP B OD1 1 
ATOM   8734  O OD2 . ASP B 1 387 ? 55.030  99.006  37.592  1.00 23.20  ? 413 ASP B OD2 1 
ATOM   8735  N N   . ASP B 1 388 ? 59.344  100.805 40.047  1.00 24.10  ? 414 ASP B N   1 
ATOM   8736  C CA  . ASP B 1 388 ? 60.717  101.296 40.144  1.00 25.68  ? 414 ASP B CA  1 
ATOM   8737  C C   . ASP B 1 388 ? 60.961  101.679 41.595  1.00 27.04  ? 414 ASP B C   1 
ATOM   8738  O O   . ASP B 1 388 ? 60.056  101.543 42.411  1.00 29.40  ? 414 ASP B O   1 
ATOM   8739  C CB  . ASP B 1 388 ? 61.000  102.456 39.158  1.00 23.34  ? 414 ASP B CB  1 
ATOM   8740  C CG  . ASP B 1 388 ? 60.453  103.802 39.612  1.00 23.68  ? 414 ASP B CG  1 
ATOM   8741  O OD1 . ASP B 1 388 ? 60.809  104.816 38.958  1.00 15.70  ? 414 ASP B OD1 1 
ATOM   8742  O OD2 . ASP B 1 388 ? 59.683  103.860 40.600  1.00 22.83  ? 414 ASP B OD2 1 
ATOM   8743  N N   . ASP B 1 389 ? 62.166  102.129 41.936  1.00 29.88  ? 415 ASP B N   1 
ATOM   8744  C CA  . ASP B 1 389 ? 62.464  102.466 43.331  1.00 30.21  ? 415 ASP B CA  1 
ATOM   8745  C C   . ASP B 1 389 ? 61.780  103.731 43.876  1.00 29.06  ? 415 ASP B C   1 
ATOM   8746  O O   . ASP B 1 389 ? 61.972  104.095 45.036  1.00 27.16  ? 415 ASP B O   1 
ATOM   8747  C CB  . ASP B 1 389 ? 63.983  102.549 43.548  1.00 32.81  ? 415 ASP B CB  1 
ATOM   8748  C CG  . ASP B 1 389 ? 64.645  103.554 42.644  1.00 37.55  ? 415 ASP B CG  1 
ATOM   8749  O OD1 . ASP B 1 389 ? 64.167  104.702 42.581  1.00 42.44  ? 415 ASP B OD1 1 
ATOM   8750  O OD2 . ASP B 1 389 ? 65.648  103.202 41.996  1.00 42.14  ? 415 ASP B OD2 1 
ATOM   8751  N N   . GLY B 1 390 ? 60.990  104.397 43.039  1.00 28.51  ? 416 GLY B N   1 
ATOM   8752  C CA  . GLY B 1 390 ? 60.267  105.580 43.483  1.00 26.99  ? 416 GLY B CA  1 
ATOM   8753  C C   . GLY B 1 390 ? 61.045  106.855 43.755  1.00 25.87  ? 416 GLY B C   1 
ATOM   8754  O O   . GLY B 1 390 ? 60.595  107.711 44.516  1.00 25.47  ? 416 GLY B O   1 
ATOM   8755  N N   . THR B 1 391 ? 62.206  106.990 43.132  1.00 23.99  ? 417 THR B N   1 
ATOM   8756  C CA  . THR B 1 391 ? 63.027  108.172 43.318  1.00 24.82  ? 417 THR B CA  1 
ATOM   8757  C C   . THR B 1 391 ? 62.910  109.041 42.077  1.00 25.47  ? 417 THR B C   1 
ATOM   8758  O O   . THR B 1 391 ? 63.791  109.840 41.783  1.00 25.28  ? 417 THR B O   1 
ATOM   8759  C CB  . THR B 1 391 ? 64.493  107.788 43.507  1.00 23.56  ? 417 THR B CB  1 
ATOM   8760  O OG1 . THR B 1 391 ? 64.952  107.117 42.331  1.00 24.23  ? 417 THR B OG1 1 
ATOM   8761  C CG2 . THR B 1 391 ? 64.654  106.862 44.708  1.00 23.42  ? 417 THR B CG2 1 
ATOM   8762  N N   . GLY B 1 392 ? 61.810  108.873 41.350  1.00 27.65  ? 418 GLY B N   1 
ATOM   8763  C CA  . GLY B 1 392 ? 61.601  109.637 40.137  1.00 24.81  ? 418 GLY B CA  1 
ATOM   8764  C C   . GLY B 1 392 ? 60.976  110.987 40.409  1.00 25.29  ? 418 GLY B C   1 
ATOM   8765  O O   . GLY B 1 392 ? 60.571  111.274 41.531  1.00 22.64  ? 418 GLY B O   1 
ATOM   8766  N N   . GLN B 1 393 ? 60.911  111.814 39.369  1.00 24.75  ? 419 GLN B N   1 
ATOM   8767  C CA  . GLN B 1 393 ? 60.331  113.146 39.450  1.00 25.09  ? 419 GLN B CA  1 
ATOM   8768  C C   . GLN B 1 393 ? 58.832  113.014 39.698  1.00 23.56  ? 419 GLN B C   1 
ATOM   8769  O O   . GLN B 1 393 ? 58.179  112.097 39.181  1.00 21.37  ? 419 GLN B O   1 
ATOM   8770  C CB  . GLN B 1 393 ? 60.557  113.889 38.133  1.00 30.75  ? 419 GLN B CB  1 
ATOM   8771  C CG  . GLN B 1 393 ? 61.999  114.239 37.824  1.00 41.43  ? 419 GLN B CG  1 
ATOM   8772  C CD  . GLN B 1 393 ? 62.400  115.600 38.389  1.00 50.91  ? 419 GLN B CD  1 
ATOM   8773  O OE1 . GLN B 1 393 ? 62.430  115.805 39.612  1.00 48.92  ? 419 GLN B OE1 1 
ATOM   8774  N NE2 . GLN B 1 393 ? 62.702  116.545 37.491  1.00 54.74  ? 419 GLN B NE2 1 
ATOM   8775  N N   . LYS B 1 394 ? 58.278  113.930 40.482  1.00 20.13  ? 420 LYS B N   1 
ATOM   8776  C CA  . LYS B 1 394 ? 56.853  113.881 40.765  1.00 19.21  ? 420 LYS B CA  1 
ATOM   8777  C C   . LYS B 1 394 ? 56.275  115.251 41.071  1.00 18.49  ? 420 LYS B C   1 
ATOM   8778  O O   . LYS B 1 394 ? 56.991  116.172 41.453  1.00 15.33  ? 420 LYS B O   1 
ATOM   8779  C CB  . LYS B 1 394 ? 56.573  112.937 41.940  1.00 16.42  ? 420 LYS B CB  1 
ATOM   8780  C CG  . LYS B 1 394 ? 57.131  113.405 43.257  1.00 18.39  ? 420 LYS B CG  1 
ATOM   8781  C CD  . LYS B 1 394 ? 56.703  112.487 44.391  1.00 22.21  ? 420 LYS B CD  1 
ATOM   8782  C CE  . LYS B 1 394 ? 57.521  112.741 45.649  1.00 21.34  ? 420 LYS B CE  1 
ATOM   8783  N NZ  . LYS B 1 394 ? 58.983  112.532 45.429  1.00 16.09  ? 420 LYS B NZ  1 
ATOM   8784  N N   . GLN B 1 395 ? 54.964  115.365 40.891  1.00 19.96  ? 421 GLN B N   1 
ATOM   8785  C CA  . GLN B 1 395 ? 54.237  116.589 41.154  1.00 19.40  ? 421 GLN B CA  1 
ATOM   8786  C C   . GLN B 1 395 ? 52.992  116.208 41.908  1.00 19.15  ? 421 GLN B C   1 
ATOM   8787  O O   . GLN B 1 395 ? 52.238  115.353 41.461  1.00 22.92  ? 421 GLN B O   1 
ATOM   8788  C CB  . GLN B 1 395 ? 53.832  117.269 39.847  1.00 23.15  ? 421 GLN B CB  1 
ATOM   8789  C CG  . GLN B 1 395 ? 52.872  118.432 40.019  1.00 25.48  ? 421 GLN B CG  1 
ATOM   8790  C CD  . GLN B 1 395 ? 53.510  119.609 40.720  1.00 29.60  ? 421 GLN B CD  1 
ATOM   8791  O OE1 . GLN B 1 395 ? 54.587  120.056 40.333  1.00 29.80  ? 421 GLN B OE1 1 
ATOM   8792  N NE2 . GLN B 1 395 ? 52.846  120.126 41.753  1.00 32.39  ? 421 GLN B NE2 1 
ATOM   8793  N N   . ILE B 1 396 ? 52.767  116.842 43.050  1.00 20.17  ? 422 ILE B N   1 
ATOM   8794  C CA  . ILE B 1 396 ? 51.574  116.559 43.828  1.00 19.34  ? 422 ILE B CA  1 
ATOM   8795  C C   . ILE B 1 396 ? 50.662  117.785 43.875  1.00 18.46  ? 422 ILE B C   1 
ATOM   8796  O O   . ILE B 1 396 ? 51.105  118.892 44.164  1.00 17.84  ? 422 ILE B O   1 
ATOM   8797  C CB  . ILE B 1 396 ? 51.932  116.139 45.267  1.00 21.22  ? 422 ILE B CB  1 
ATOM   8798  C CG1 . ILE B 1 396 ? 52.893  114.947 45.226  1.00 21.64  ? 422 ILE B CG1 1 
ATOM   8799  C CG2 . ILE B 1 396 ? 50.664  115.796 46.040  1.00 21.40  ? 422 ILE B CG2 1 
ATOM   8800  C CD1 . ILE B 1 396 ? 53.146  114.308 46.565  1.00 20.74  ? 422 ILE B CD1 1 
ATOM   8801  N N   . TRP B 1 397 ? 49.384  117.571 43.576  1.00 17.64  ? 423 TRP B N   1 
ATOM   8802  C CA  . TRP B 1 397 ? 48.387  118.633 43.596  1.00 15.44  ? 423 TRP B CA  1 
ATOM   8803  C C   . TRP B 1 397 ? 47.264  118.256 44.557  1.00 16.84  ? 423 TRP B C   1 
ATOM   8804  O O   . TRP B 1 397 ? 46.895  117.085 44.676  1.00 18.23  ? 423 TRP B O   1 
ATOM   8805  C CB  . TRP B 1 397 ? 47.727  118.803 42.230  1.00 15.30  ? 423 TRP B CB  1 
ATOM   8806  C CG  . TRP B 1 397 ? 48.540  119.364 41.130  1.00 14.40  ? 423 TRP B CG  1 
ATOM   8807  C CD1 . TRP B 1 397 ? 48.780  120.682 40.875  1.00 14.32  ? 423 TRP B CD1 1 
ATOM   8808  C CD2 . TRP B 1 397 ? 49.099  118.633 40.035  1.00 16.11  ? 423 TRP B CD2 1 
ATOM   8809  N NE1 . TRP B 1 397 ? 49.444  120.819 39.674  1.00 19.59  ? 423 TRP B NE1 1 
ATOM   8810  C CE2 . TRP B 1 397 ? 49.652  119.574 39.138  1.00 17.05  ? 423 TRP B CE2 1 
ATOM   8811  C CE3 . TRP B 1 397 ? 49.173  117.268 39.719  1.00 15.30  ? 423 TRP B CE3 1 
ATOM   8812  C CZ2 . TRP B 1 397 ? 50.280  119.197 37.944  1.00 16.58  ? 423 TRP B CZ2 1 
ATOM   8813  C CZ3 . TRP B 1 397 ? 49.798  116.891 38.520  1.00 19.26  ? 423 TRP B CZ3 1 
ATOM   8814  C CH2 . TRP B 1 397 ? 50.340  117.854 37.651  1.00 15.54  ? 423 TRP B CH2 1 
ATOM   8815  N N   . ARG B 1 398 ? 46.721  119.252 45.237  1.00 12.97  ? 424 ARG B N   1 
ATOM   8816  C CA  . ARG B 1 398 ? 45.591  119.043 46.117  1.00 15.58  ? 424 ARG B CA  1 
ATOM   8817  C C   . ARG B 1 398 ? 44.430  119.563 45.268  1.00 16.44  ? 424 ARG B C   1 
ATOM   8818  O O   . ARG B 1 398 ? 44.599  120.513 44.496  1.00 16.52  ? 424 ARG B O   1 
ATOM   8819  C CB  . ARG B 1 398 ? 45.728  119.881 47.386  1.00 14.54  ? 424 ARG B CB  1 
ATOM   8820  C CG  . ARG B 1 398 ? 44.531  119.796 48.299  1.00 19.58  ? 424 ARG B CG  1 
ATOM   8821  C CD  . ARG B 1 398 ? 44.751  120.593 49.576  1.00 25.96  ? 424 ARG B CD  1 
ATOM   8822  N NE  . ARG B 1 398 ? 45.141  121.962 49.260  1.00 27.37  ? 424 ARG B NE  1 
ATOM   8823  C CZ  . ARG B 1 398 ? 46.381  122.430 49.362  1.00 28.40  ? 424 ARG B CZ  1 
ATOM   8824  N NH1 . ARG B 1 398 ? 47.365  121.643 49.787  1.00 27.36  ? 424 ARG B NH1 1 
ATOM   8825  N NH2 . ARG B 1 398 ? 46.638  123.681 49.015  1.00 32.06  ? 424 ARG B NH2 1 
ATOM   8826  N N   . VAL B 1 399 ? 43.266  118.945 45.373  1.00 13.49  ? 425 VAL B N   1 
ATOM   8827  C CA  . VAL B 1 399 ? 42.147  119.414 44.587  1.00 15.27  ? 425 VAL B CA  1 
ATOM   8828  C C   . VAL B 1 399 ? 41.282  120.293 45.467  1.00 18.74  ? 425 VAL B C   1 
ATOM   8829  O O   . VAL B 1 399 ? 40.845  119.869 46.532  1.00 20.60  ? 425 VAL B O   1 
ATOM   8830  C CB  . VAL B 1 399 ? 41.309  118.229 44.043  1.00 14.83  ? 425 VAL B CB  1 
ATOM   8831  C CG1 . VAL B 1 399 ? 40.027  118.743 43.402  1.00 13.94  ? 425 VAL B CG1 1 
ATOM   8832  C CG2 . VAL B 1 399 ? 42.126  117.444 43.027  1.00 11.32  ? 425 VAL B CG2 1 
ATOM   8833  N N   . GLU B 1 400 ? 41.056  121.523 45.023  1.00 22.60  ? 426 GLU B N   1 
ATOM   8834  C CA  . GLU B 1 400 ? 40.225  122.484 45.753  1.00 27.31  ? 426 GLU B CA  1 
ATOM   8835  C C   . GLU B 1 400 ? 39.151  122.958 44.782  1.00 27.87  ? 426 GLU B C   1 
ATOM   8836  O O   . GLU B 1 400 ? 39.452  123.649 43.805  1.00 27.53  ? 426 GLU B O   1 
ATOM   8837  C CB  . GLU B 1 400 ? 41.054  123.690 46.220  1.00 30.32  ? 426 GLU B CB  1 
ATOM   8838  C CG  . GLU B 1 400 ? 42.191  123.338 47.179  1.00 40.09  ? 426 GLU B CG  1 
ATOM   8839  C CD  . GLU B 1 400 ? 43.065  124.534 47.544  1.00 41.47  ? 426 GLU B CD  1 
ATOM   8840  O OE1 . GLU B 1 400 ? 44.109  124.335 48.204  1.00 41.51  ? 426 GLU B OE1 1 
ATOM   8841  O OE2 . GLU B 1 400 ? 42.709  125.670 47.172  1.00 44.16  ? 426 GLU B OE2 1 
ATOM   8842  N N   . GLY B 1 401 ? 37.904  122.583 45.049  1.00 26.68  ? 427 GLY B N   1 
ATOM   8843  C CA  . GLY B 1 401 ? 36.820  122.973 44.168  1.00 27.48  ? 427 GLY B CA  1 
ATOM   8844  C C   . GLY B 1 401 ? 36.918  122.201 42.868  1.00 28.31  ? 427 GLY B C   1 
ATOM   8845  O O   . GLY B 1 401 ? 36.630  121.014 42.827  1.00 27.73  ? 427 GLY B O   1 
ATOM   8846  N N   . SER B 1 402 ? 37.345  122.875 41.809  1.00 29.80  ? 428 SER B N   1 
ATOM   8847  C CA  . SER B 1 402 ? 37.492  122.252 40.500  1.00 30.51  ? 428 SER B CA  1 
ATOM   8848  C C   . SER B 1 402 ? 38.897  122.490 39.958  1.00 29.42  ? 428 SER B C   1 
ATOM   8849  O O   . SER B 1 402 ? 39.147  122.309 38.770  1.00 27.88  ? 428 SER B O   1 
ATOM   8850  C CB  . SER B 1 402 ? 36.469  122.845 39.529  1.00 34.19  ? 428 SER B CB  1 
ATOM   8851  O OG  . SER B 1 402 ? 36.577  124.263 39.485  1.00 38.35  ? 428 SER B OG  1 
ATOM   8852  N N   . ASN B 1 403 ? 39.807  122.895 40.835  1.00 30.70  ? 429 ASN B N   1 
ATOM   8853  C CA  . ASN B 1 403 ? 41.186  123.182 40.453  1.00 31.62  ? 429 ASN B CA  1 
ATOM   8854  C C   . ASN B 1 403 ? 42.223  122.295 41.131  1.00 30.63  ? 429 ASN B C   1 
ATOM   8855  O O   . ASN B 1 403 ? 41.997  121.766 42.217  1.00 28.32  ? 429 ASN B O   1 
ATOM   8856  C CB  . ASN B 1 403 ? 41.523  124.630 40.796  1.00 36.74  ? 429 ASN B CB  1 
ATOM   8857  C CG  . ASN B 1 403 ? 40.625  125.625 40.093  1.00 44.76  ? 429 ASN B CG  1 
ATOM   8858  O OD1 . ASN B 1 403 ? 40.319  126.686 40.638  1.00 47.83  ? 429 ASN B OD1 1 
ATOM   8859  N ND2 . ASN B 1 403 ? 40.207  125.298 38.872  1.00 48.60  ? 429 ASN B ND2 1 
ATOM   8860  N N   . LYS B 1 404 ? 43.363  122.152 40.463  1.00 28.29  ? 430 LYS B N   1 
ATOM   8861  C CA  . LYS B 1 404 ? 44.500  121.400 40.974  1.00 26.23  ? 430 LYS B CA  1 
ATOM   8862  C C   . LYS B 1 404 ? 45.406  122.467 41.561  1.00 25.39  ? 430 LYS B C   1 
ATOM   8863  O O   . LYS B 1 404 ? 45.881  123.341 40.837  1.00 23.80  ? 430 LYS B O   1 
ATOM   8864  C CB  . LYS B 1 404 ? 45.262  120.694 39.851  1.00 25.88  ? 430 LYS B CB  1 
ATOM   8865  C CG  . LYS B 1 404 ? 44.670  119.386 39.402  1.00 27.34  ? 430 LYS B CG  1 
ATOM   8866  C CD  . LYS B 1 404 ? 45.545  118.734 38.352  1.00 26.37  ? 430 LYS B CD  1 
ATOM   8867  C CE  . LYS B 1 404 ? 45.572  119.555 37.080  1.00 28.72  ? 430 LYS B CE  1 
ATOM   8868  N NZ  . LYS B 1 404 ? 46.524  118.992 36.103  1.00 27.89  ? 430 LYS B NZ  1 
ATOM   8869  N N   . VAL B 1 405 ? 45.644  122.396 42.867  1.00 22.63  ? 431 VAL B N   1 
ATOM   8870  C CA  . VAL B 1 405 ? 46.491  123.373 43.533  1.00 20.82  ? 431 VAL B CA  1 
ATOM   8871  C C   . VAL B 1 405 ? 47.792  122.688 43.942  1.00 20.33  ? 431 VAL B C   1 
ATOM   8872  O O   . VAL B 1 405 ? 47.785  121.702 44.658  1.00 20.67  ? 431 VAL B O   1 
ATOM   8873  C CB  . VAL B 1 405 ? 45.759  123.951 44.771  1.00 23.21  ? 431 VAL B CB  1 
ATOM   8874  C CG1 . VAL B 1 405 ? 46.606  125.018 45.439  1.00 24.63  ? 431 VAL B CG1 1 
ATOM   8875  C CG2 . VAL B 1 405 ? 44.415  124.534 44.350  1.00 17.68  ? 431 VAL B CG2 1 
ATOM   8876  N N   . PRO B 1 406 ? 48.936  123.191 43.470  1.00 22.70  ? 432 PRO B N   1 
ATOM   8877  C CA  . PRO B 1 406 ? 50.200  122.543 43.849  1.00 22.80  ? 432 PRO B CA  1 
ATOM   8878  C C   . PRO B 1 406 ? 50.443  122.507 45.356  1.00 21.35  ? 432 PRO B C   1 
ATOM   8879  O O   . PRO B 1 406 ? 50.243  123.492 46.052  1.00 22.68  ? 432 PRO B O   1 
ATOM   8880  C CB  . PRO B 1 406 ? 51.250  123.358 43.091  1.00 21.56  ? 432 PRO B CB  1 
ATOM   8881  C CG  . PRO B 1 406 ? 50.594  124.698 42.913  1.00 23.96  ? 432 PRO B CG  1 
ATOM   8882  C CD  . PRO B 1 406 ? 49.172  124.345 42.588  1.00 23.32  ? 432 PRO B CD  1 
ATOM   8883  N N   . VAL B 1 407 ? 50.870  121.356 45.853  1.00 20.96  ? 433 VAL B N   1 
ATOM   8884  C CA  . VAL B 1 407 ? 51.130  121.185 47.277  1.00 23.63  ? 433 VAL B CA  1 
ATOM   8885  C C   . VAL B 1 407 ? 52.494  121.760 47.656  1.00 24.16  ? 433 VAL B C   1 
ATOM   8886  O O   . VAL B 1 407 ? 53.421  121.773 46.849  1.00 25.83  ? 433 VAL B O   1 
ATOM   8887  C CB  . VAL B 1 407 ? 51.031  119.663 47.671  1.00 22.34  ? 433 VAL B CB  1 
ATOM   8888  C CG1 . VAL B 1 407 ? 51.717  119.386 48.992  1.00 18.76  ? 433 VAL B CG1 1 
ATOM   8889  C CG2 . VAL B 1 407 ? 49.575  119.259 47.774  1.00 19.74  ? 433 VAL B CG2 1 
ATOM   8890  N N   . ASP B 1 408 ? 52.600  122.252 48.884  1.00 27.25  ? 434 ASP B N   1 
ATOM   8891  C CA  . ASP B 1 408 ? 53.853  122.817 49.374  1.00 29.84  ? 434 ASP B CA  1 
ATOM   8892  C C   . ASP B 1 408 ? 54.926  121.730 49.387  1.00 28.51  ? 434 ASP B C   1 
ATOM   8893  O O   . ASP B 1 408 ? 54.840  120.762 50.143  1.00 26.43  ? 434 ASP B O   1 
ATOM   8894  C CB  . ASP B 1 408 ? 53.664  123.376 50.785  1.00 33.71  ? 434 ASP B CB  1 
ATOM   8895  C CG  . ASP B 1 408 ? 54.796  124.284 51.200  1.00 39.45  ? 434 ASP B CG  1 
ATOM   8896  O OD1 . ASP B 1 408 ? 55.939  123.796 51.351  1.00 41.62  ? 434 ASP B OD1 1 
ATOM   8897  O OD2 . ASP B 1 408 ? 54.539  125.497 51.367  1.00 44.93  ? 434 ASP B OD2 1 
ATOM   8898  N N   . PRO B 1 409 ? 55.953  121.884 48.543  1.00 29.02  ? 435 PRO B N   1 
ATOM   8899  C CA  . PRO B 1 409 ? 57.072  120.945 48.411  1.00 31.02  ? 435 PRO B CA  1 
ATOM   8900  C C   . PRO B 1 409 ? 57.563  120.368 49.735  1.00 33.20  ? 435 PRO B C   1 
ATOM   8901  O O   . PRO B 1 409 ? 57.883  119.179 49.834  1.00 33.73  ? 435 PRO B O   1 
ATOM   8902  C CB  . PRO B 1 409 ? 58.135  121.786 47.717  1.00 30.95  ? 435 PRO B CB  1 
ATOM   8903  C CG  . PRO B 1 409 ? 57.317  122.664 46.819  1.00 27.63  ? 435 PRO B CG  1 
ATOM   8904  C CD  . PRO B 1 409 ? 56.165  123.077 47.700  1.00 28.54  ? 435 PRO B CD  1 
ATOM   8905  N N   . ALA B 1 410 ? 57.612  121.212 50.757  1.00 34.67  ? 436 ALA B N   1 
ATOM   8906  C CA  . ALA B 1 410 ? 58.077  120.779 52.066  1.00 36.70  ? 436 ALA B CA  1 
ATOM   8907  C C   . ALA B 1 410 ? 57.036  119.945 52.806  1.00 36.68  ? 436 ALA B C   1 
ATOM   8908  O O   . ALA B 1 410 ? 57.285  119.474 53.914  1.00 38.57  ? 436 ALA B O   1 
ATOM   8909  C CB  . ALA B 1 410 ? 58.478  121.997 52.905  1.00 36.88  ? 436 ALA B CB  1 
ATOM   8910  N N   . THR B 1 411 ? 55.872  119.760 52.195  1.00 35.79  ? 437 THR B N   1 
ATOM   8911  C CA  . THR B 1 411 ? 54.812  118.978 52.820  1.00 35.91  ? 437 THR B CA  1 
ATOM   8912  C C   . THR B 1 411 ? 54.677  117.614 52.145  1.00 33.62  ? 437 THR B C   1 
ATOM   8913  O O   . THR B 1 411 ? 53.950  116.746 52.624  1.00 33.45  ? 437 THR B O   1 
ATOM   8914  C CB  . THR B 1 411 ? 53.463  119.711 52.727  1.00 38.82  ? 437 THR B CB  1 
ATOM   8915  O OG1 . THR B 1 411 ? 53.615  121.042 53.227  1.00 42.64  ? 437 THR B OG1 1 
ATOM   8916  C CG2 . THR B 1 411 ? 52.405  118.995 53.552  1.00 40.00  ? 437 THR B CG2 1 
ATOM   8917  N N   . TYR B 1 412 ? 55.376  117.437 51.026  1.00 30.52  ? 438 TYR B N   1 
ATOM   8918  C CA  . TYR B 1 412 ? 55.341  116.184 50.278  1.00 28.69  ? 438 TYR B CA  1 
ATOM   8919  C C   . TYR B 1 412 ? 55.460  114.972 51.190  1.00 28.18  ? 438 TYR B C   1 
ATOM   8920  O O   . TYR B 1 412 ? 56.446  114.828 51.903  1.00 32.52  ? 438 TYR B O   1 
ATOM   8921  C CB  . TYR B 1 412 ? 56.474  116.168 49.254  1.00 27.00  ? 438 TYR B CB  1 
ATOM   8922  C CG  . TYR B 1 412 ? 56.121  116.805 47.928  1.00 26.47  ? 438 TYR B CG  1 
ATOM   8923  C CD1 . TYR B 1 412 ? 55.333  117.957 47.864  1.00 28.34  ? 438 TYR B CD1 1 
ATOM   8924  C CD2 . TYR B 1 412 ? 56.587  116.261 46.737  1.00 24.55  ? 438 TYR B CD2 1 
ATOM   8925  C CE1 . TYR B 1 412 ? 55.018  118.543 46.640  1.00 27.97  ? 438 TYR B CE1 1 
ATOM   8926  C CE2 . TYR B 1 412 ? 56.283  116.836 45.517  1.00 25.58  ? 438 TYR B CE2 1 
ATOM   8927  C CZ  . TYR B 1 412 ? 55.500  117.973 45.468  1.00 27.14  ? 438 TYR B CZ  1 
ATOM   8928  O OH  . TYR B 1 412 ? 55.202  118.527 44.240  1.00 27.29  ? 438 TYR B OH  1 
ATOM   8929  N N   . GLY B 1 413 ? 54.461  114.095 51.163  1.00 27.53  ? 439 GLY B N   1 
ATOM   8930  C CA  . GLY B 1 413 ? 54.501  112.913 52.010  1.00 23.86  ? 439 GLY B CA  1 
ATOM   8931  C C   . GLY B 1 413 ? 53.438  112.959 53.094  1.00 23.90  ? 439 GLY B C   1 
ATOM   8932  O O   . GLY B 1 413 ? 53.186  111.965 53.786  1.00 20.84  ? 439 GLY B O   1 
ATOM   8933  N N   . GLN B 1 414 ? 52.810  114.120 53.243  1.00 24.27  ? 440 GLN B N   1 
ATOM   8934  C CA  . GLN B 1 414 ? 51.763  114.300 54.245  1.00 26.71  ? 440 GLN B CA  1 
ATOM   8935  C C   . GLN B 1 414 ? 50.429  114.504 53.566  1.00 25.44  ? 440 GLN B C   1 
ATOM   8936  O O   . GLN B 1 414 ? 50.235  115.462 52.822  1.00 25.23  ? 440 GLN B O   1 
ATOM   8937  C CB  . GLN B 1 414 ? 52.087  115.487 55.150  1.00 26.95  ? 440 GLN B CB  1 
ATOM   8938  C CG  . GLN B 1 414 ? 53.105  115.147 56.224  1.00 26.27  ? 440 GLN B CG  1 
ATOM   8939  C CD  . GLN B 1 414 ? 53.732  116.376 56.827  1.00 26.00  ? 440 GLN B CD  1 
ATOM   8940  O OE1 . GLN B 1 414 ? 54.807  116.802 56.411  1.00 22.97  ? 440 GLN B OE1 1 
ATOM   8941  N NE2 . GLN B 1 414 ? 53.053  116.969 57.804  1.00 23.03  ? 440 GLN B NE2 1 
ATOM   8942  N N   . PHE B 1 415 ? 49.516  113.581 53.832  1.00 24.74  ? 441 PHE B N   1 
ATOM   8943  C CA  . PHE B 1 415 ? 48.198  113.607 53.231  1.00 26.05  ? 441 PHE B CA  1 
ATOM   8944  C C   . PHE B 1 415 ? 47.128  113.748 54.297  1.00 26.36  ? 441 PHE B C   1 
ATOM   8945  O O   . PHE B 1 415 ? 47.159  113.057 55.320  1.00 25.18  ? 441 PHE B O   1 
ATOM   8946  C CB  . PHE B 1 415 ? 47.994  112.321 52.417  1.00 24.59  ? 441 PHE B CB  1 
ATOM   8947  C CG  . PHE B 1 415 ? 48.950  112.189 51.263  1.00 26.54  ? 441 PHE B CG  1 
ATOM   8948  C CD1 . PHE B 1 415 ? 48.613  112.680 50.001  1.00 28.06  ? 441 PHE B CD1 1 
ATOM   8949  C CD2 . PHE B 1 415 ? 50.221  111.650 51.454  1.00 26.39  ? 441 PHE B CD2 1 
ATOM   8950  C CE1 . PHE B 1 415 ? 49.530  112.640 48.950  1.00 27.51  ? 441 PHE B CE1 1 
ATOM   8951  C CE2 . PHE B 1 415 ? 51.150  111.604 50.410  1.00 25.36  ? 441 PHE B CE2 1 
ATOM   8952  C CZ  . PHE B 1 415 ? 50.804  112.100 49.158  1.00 29.63  ? 441 PHE B CZ  1 
ATOM   8953  N N   . TYR B 1 416 ? 46.187  114.656 54.052  1.00 26.83  ? 442 TYR B N   1 
ATOM   8954  C CA  . TYR B 1 416 ? 45.096  114.900 54.984  1.00 27.17  ? 442 TYR B CA  1 
ATOM   8955  C C   . TYR B 1 416 ? 43.817  114.236 54.478  1.00 25.71  ? 442 TYR B C   1 
ATOM   8956  O O   . TYR B 1 416 ? 43.441  114.415 53.322  1.00 29.73  ? 442 TYR B O   1 
ATOM   8957  C CB  . TYR B 1 416 ? 44.902  116.406 55.153  1.00 27.48  ? 442 TYR B CB  1 
ATOM   8958  C CG  . TYR B 1 416 ? 46.076  117.083 55.827  1.00 33.58  ? 442 TYR B CG  1 
ATOM   8959  C CD1 . TYR B 1 416 ? 46.036  117.425 57.186  1.00 35.93  ? 442 TYR B CD1 1 
ATOM   8960  C CD2 . TYR B 1 416 ? 47.245  117.352 55.118  1.00 34.13  ? 442 TYR B CD2 1 
ATOM   8961  C CE1 . TYR B 1 416 ? 47.136  118.020 57.817  1.00 35.55  ? 442 TYR B CE1 1 
ATOM   8962  C CE2 . TYR B 1 416 ? 48.347  117.942 55.734  1.00 36.45  ? 442 TYR B CE2 1 
ATOM   8963  C CZ  . TYR B 1 416 ? 48.289  118.273 57.079  1.00 37.34  ? 442 TYR B CZ  1 
ATOM   8964  O OH  . TYR B 1 416 ? 49.391  118.849 57.668  1.00 36.92  ? 442 TYR B OH  1 
ATOM   8965  N N   . GLY B 1 417 ? 43.165  113.465 55.343  1.00 22.79  ? 443 GLY B N   1 
ATOM   8966  C CA  . GLY B 1 417 ? 41.941  112.775 54.968  1.00 22.11  ? 443 GLY B CA  1 
ATOM   8967  C C   . GLY B 1 417 ? 40.791  113.640 54.473  1.00 21.50  ? 443 GLY B C   1 
ATOM   8968  O O   . GLY B 1 417 ? 39.794  113.118 53.980  1.00 21.20  ? 443 GLY B O   1 
ATOM   8969  N N   . GLY B 1 418 ? 40.910  114.956 54.609  1.00 21.90  ? 444 GLY B N   1 
ATOM   8970  C CA  . GLY B 1 418 ? 39.853  115.843 54.145  1.00 21.98  ? 444 GLY B CA  1 
ATOM   8971  C C   . GLY B 1 418 ? 40.087  116.350 52.730  1.00 21.64  ? 444 GLY B C   1 
ATOM   8972  O O   . GLY B 1 418 ? 39.303  117.121 52.191  1.00 19.77  ? 444 GLY B O   1 
ATOM   8973  N N   . ASP B 1 419 ? 41.187  115.922 52.127  1.00 22.27  ? 445 ASP B N   1 
ATOM   8974  C CA  . ASP B 1 419 ? 41.500  116.330 50.771  1.00 24.48  ? 445 ASP B CA  1 
ATOM   8975  C C   . ASP B 1 419 ? 41.585  115.133 49.837  1.00 23.72  ? 445 ASP B C   1 
ATOM   8976  O O   . ASP B 1 419 ? 41.516  113.976 50.257  1.00 24.37  ? 445 ASP B O   1 
ATOM   8977  C CB  . ASP B 1 419 ? 42.853  117.043 50.706  1.00 27.40  ? 445 ASP B CB  1 
ATOM   8978  C CG  . ASP B 1 419 ? 42.905  118.290 51.540  1.00 30.77  ? 445 ASP B CG  1 
ATOM   8979  O OD1 . ASP B 1 419 ? 41.912  119.048 51.572  1.00 31.51  ? 445 ASP B OD1 1 
ATOM   8980  O OD2 . ASP B 1 419 ? 43.966  118.521 52.149  1.00 35.60  ? 445 ASP B OD2 1 
ATOM   8981  N N   . SER B 1 420 ? 41.748  115.445 48.559  1.00 21.42  ? 446 SER B N   1 
ATOM   8982  C CA  . SER B 1 420 ? 41.935  114.447 47.515  1.00 19.75  ? 446 SER B CA  1 
ATOM   8983  C C   . SER B 1 420 ? 43.138  114.969 46.749  1.00 16.00  ? 446 SER B C   1 
ATOM   8984  O O   . SER B 1 420 ? 43.301  116.177 46.575  1.00 13.90  ? 446 SER B O   1 
ATOM   8985  C CB  . SER B 1 420 ? 40.711  114.333 46.605  1.00 15.40  ? 446 SER B CB  1 
ATOM   8986  O OG  . SER B 1 420 ? 39.765  113.450 47.179  1.00 13.03  ? 446 SER B OG  1 
ATOM   8987  N N   . TYR B 1 421 ? 43.989  114.061 46.305  1.00 16.08  ? 447 TYR B N   1 
ATOM   8988  C CA  . TYR B 1 421 ? 45.190  114.466 45.607  1.00 16.34  ? 447 TYR B CA  1 
ATOM   8989  C C   . TYR B 1 421 ? 45.417  113.749 44.304  1.00 16.55  ? 447 TYR B C   1 
ATOM   8990  O O   . TYR B 1 421 ? 44.935  112.634 44.074  1.00 17.21  ? 447 TYR B O   1 
ATOM   8991  C CB  . TYR B 1 421 ? 46.429  114.244 46.479  1.00 14.25  ? 447 TYR B CB  1 
ATOM   8992  C CG  . TYR B 1 421 ? 46.374  114.903 47.832  1.00 19.20  ? 447 TYR B CG  1 
ATOM   8993  C CD1 . TYR B 1 421 ? 45.784  114.253 48.919  1.00 18.50  ? 447 TYR B CD1 1 
ATOM   8994  C CD2 . TYR B 1 421 ? 46.929  116.166 48.036  1.00 19.26  ? 447 TYR B CD2 1 
ATOM   8995  C CE1 . TYR B 1 421 ? 45.752  114.839 50.175  1.00 22.87  ? 447 TYR B CE1 1 
ATOM   8996  C CE2 . TYR B 1 421 ? 46.905  116.767 49.292  1.00 21.29  ? 447 TYR B CE2 1 
ATOM   8997  C CZ  . TYR B 1 421 ? 46.319  116.094 50.359  1.00 25.28  ? 447 TYR B CZ  1 
ATOM   8998  O OH  . TYR B 1 421 ? 46.323  116.655 51.617  1.00 26.75  ? 447 TYR B OH  1 
ATOM   8999  N N   . ILE B 1 422 ? 46.188  114.416 43.465  1.00 15.52  ? 448 ILE B N   1 
ATOM   9000  C CA  . ILE B 1 422 ? 46.566  113.897 42.183  1.00 15.98  ? 448 ILE B CA  1 
ATOM   9001  C C   . ILE B 1 422 ? 48.087  113.953 42.190  1.00 16.71  ? 448 ILE B C   1 
ATOM   9002  O O   . ILE B 1 422 ? 48.675  114.990 42.487  1.00 18.73  ? 448 ILE B O   1 
ATOM   9003  C CB  . ILE B 1 422 ? 45.994  114.759 41.063  1.00 11.77  ? 448 ILE B CB  1 
ATOM   9004  C CG1 . ILE B 1 422 ? 44.464  114.747 41.152  1.00 14.55  ? 448 ILE B CG1 1 
ATOM   9005  C CG2 . ILE B 1 422 ? 46.469  114.233 39.738  1.00 14.25  ? 448 ILE B CG2 1 
ATOM   9006  C CD1 . ILE B 1 422 ? 43.734  115.561 40.099  1.00 15.23  ? 448 ILE B CD1 1 
ATOM   9007  N N   . ILE B 1 423 ? 48.715  112.821 41.899  1.00 18.89  ? 449 ILE B N   1 
ATOM   9008  C CA  . ILE B 1 423 ? 50.167  112.716 41.871  1.00 17.27  ? 449 ILE B CA  1 
ATOM   9009  C C   . ILE B 1 423 ? 50.631  112.218 40.499  1.00 18.15  ? 449 ILE B C   1 
ATOM   9010  O O   . ILE B 1 423 ? 50.258  111.127 40.077  1.00 17.20  ? 449 ILE B O   1 
ATOM   9011  C CB  . ILE B 1 423 ? 50.660  111.706 42.929  1.00 18.10  ? 449 ILE B CB  1 
ATOM   9012  C CG1 . ILE B 1 423 ? 50.115  112.080 44.306  1.00 16.11  ? 449 ILE B CG1 1 
ATOM   9013  C CG2 . ILE B 1 423 ? 52.184  111.659 42.942  1.00 20.91  ? 449 ILE B CG2 1 
ATOM   9014  C CD1 . ILE B 1 423 ? 50.393  111.032 45.362  1.00 17.33  ? 449 ILE B CD1 1 
ATOM   9015  N N   . LEU B 1 424 ? 51.425  113.026 39.803  1.00 19.40  ? 450 LEU B N   1 
ATOM   9016  C CA  . LEU B 1 424 ? 51.964  112.646 38.499  1.00 17.39  ? 450 LEU B CA  1 
ATOM   9017  C C   . LEU B 1 424 ? 53.401  112.221 38.774  1.00 20.25  ? 450 LEU B C   1 
ATOM   9018  O O   . LEU B 1 424 ? 54.196  112.999 39.310  1.00 17.38  ? 450 LEU B O   1 
ATOM   9019  C CB  . LEU B 1 424 ? 51.940  113.830 37.538  1.00 18.90  ? 450 LEU B CB  1 
ATOM   9020  C CG  . LEU B 1 424 ? 52.640  113.653 36.191  1.00 19.59  ? 450 LEU B CG  1 
ATOM   9021  C CD1 . LEU B 1 424 ? 52.113  112.426 35.476  1.00 20.38  ? 450 LEU B CD1 1 
ATOM   9022  C CD2 . LEU B 1 424 ? 52.415  114.892 35.347  1.00 21.42  ? 450 LEU B CD2 1 
ATOM   9023  N N   . TYR B 1 425 ? 53.725  110.983 38.418  1.00 20.51  ? 451 TYR B N   1 
ATOM   9024  C CA  . TYR B 1 425 ? 55.050  110.434 38.666  1.00 20.70  ? 451 TYR B CA  1 
ATOM   9025  C C   . TYR B 1 425 ? 55.699  109.856 37.415  1.00 22.28  ? 451 TYR B C   1 
ATOM   9026  O O   . TYR B 1 425 ? 55.037  109.215 36.610  1.00 27.04  ? 451 TYR B O   1 
ATOM   9027  C CB  . TYR B 1 425 ? 54.947  109.336 39.731  1.00 18.91  ? 451 TYR B CB  1 
ATOM   9028  C CG  . TYR B 1 425 ? 56.254  108.676 40.064  1.00 15.30  ? 451 TYR B CG  1 
ATOM   9029  C CD1 . TYR B 1 425 ? 57.183  109.309 40.879  1.00 17.90  ? 451 TYR B CD1 1 
ATOM   9030  C CD2 . TYR B 1 425 ? 56.583  107.440 39.527  1.00 15.39  ? 451 TYR B CD2 1 
ATOM   9031  C CE1 . TYR B 1 425 ? 58.417  108.725 41.152  1.00 18.66  ? 451 TYR B CE1 1 
ATOM   9032  C CE2 . TYR B 1 425 ? 57.811  106.846 39.787  1.00 17.74  ? 451 TYR B CE2 1 
ATOM   9033  C CZ  . TYR B 1 425 ? 58.728  107.494 40.598  1.00 19.75  ? 451 TYR B CZ  1 
ATOM   9034  O OH  . TYR B 1 425 ? 59.969  106.929 40.826  1.00 22.43  ? 451 TYR B OH  1 
ATOM   9035  N N   . ASN B 1 426 ? 57.002  110.075 37.267  1.00 21.91  ? 452 ASN B N   1 
ATOM   9036  C CA  . ASN B 1 426 ? 57.759  109.549 36.133  1.00 22.00  ? 452 ASN B CA  1 
ATOM   9037  C C   . ASN B 1 426 ? 58.601  108.364 36.589  1.00 22.21  ? 452 ASN B C   1 
ATOM   9038  O O   . ASN B 1 426 ? 59.537  108.545 37.363  1.00 21.58  ? 452 ASN B O   1 
ATOM   9039  C CB  . ASN B 1 426 ? 58.680  110.627 35.575  1.00 21.14  ? 452 ASN B CB  1 
ATOM   9040  C CG  . ASN B 1 426 ? 57.970  111.562 34.646  1.00 23.49  ? 452 ASN B CG  1 
ATOM   9041  O OD1 . ASN B 1 426 ? 56.746  111.538 34.536  1.00 27.12  ? 452 ASN B OD1 1 
ATOM   9042  N ND2 . ASN B 1 426 ? 58.726  112.402 33.969  1.00 25.75  ? 452 ASN B ND2 1 
ATOM   9043  N N   . TYR B 1 427 ? 58.292  107.160 36.118  1.00 22.79  ? 453 TYR B N   1 
ATOM   9044  C CA  . TYR B 1 427 ? 59.073  105.990 36.545  1.00 27.37  ? 453 TYR B CA  1 
ATOM   9045  C C   . TYR B 1 427 ? 60.137  105.574 35.536  1.00 29.96  ? 453 TYR B C   1 
ATOM   9046  O O   . TYR B 1 427 ? 59.999  105.810 34.339  1.00 25.32  ? 453 TYR B O   1 
ATOM   9047  C CB  . TYR B 1 427 ? 58.152  104.792 36.853  1.00 23.40  ? 453 TYR B CB  1 
ATOM   9048  C CG  . TYR B 1 427 ? 57.565  104.084 35.635  1.00 21.14  ? 453 TYR B CG  1 
ATOM   9049  C CD1 . TYR B 1 427 ? 58.312  103.148 34.912  1.00 17.95  ? 453 TYR B CD1 1 
ATOM   9050  C CD2 . TYR B 1 427 ? 56.262  104.346 35.219  1.00 16.85  ? 453 TYR B CD2 1 
ATOM   9051  C CE1 . TYR B 1 427 ? 57.770  102.490 33.801  1.00 17.46  ? 453 TYR B CE1 1 
ATOM   9052  C CE2 . TYR B 1 427 ? 55.714  103.698 34.119  1.00 19.45  ? 453 TYR B CE2 1 
ATOM   9053  C CZ  . TYR B 1 427 ? 56.467  102.768 33.415  1.00 19.97  ? 453 TYR B CZ  1 
ATOM   9054  O OH  . TYR B 1 427 ? 55.897  102.105 32.347  1.00 19.03  ? 453 TYR B OH  1 
ATOM   9055  N N   . ARG B 1 428 ? 61.202  104.958 36.040  1.00 35.39  ? 454 ARG B N   1 
ATOM   9056  C CA  . ARG B 1 428 ? 62.300  104.492 35.201  1.00 39.61  ? 454 ARG B CA  1 
ATOM   9057  C C   . ARG B 1 428 ? 62.632  103.077 35.619  1.00 38.91  ? 454 ARG B C   1 
ATOM   9058  O O   . ARG B 1 428 ? 63.001  102.840 36.765  1.00 38.67  ? 454 ARG B O   1 
ATOM   9059  C CB  . ARG B 1 428 ? 63.553  105.338 35.410  1.00 46.80  ? 454 ARG B CB  1 
ATOM   9060  C CG  . ARG B 1 428 ? 63.311  106.795 35.730  1.00 58.14  ? 454 ARG B CG  1 
ATOM   9061  C CD  . ARG B 1 428 ? 64.620  107.453 36.155  1.00 65.77  ? 454 ARG B CD  1 
ATOM   9062  N NE  . ARG B 1 428 ? 64.521  108.910 36.204  1.00 71.96  ? 454 ARG B NE  1 
ATOM   9063  C CZ  . ARG B 1 428 ? 65.544  109.719 36.464  1.00 73.85  ? 454 ARG B CZ  1 
ATOM   9064  N NH1 . ARG B 1 428 ? 66.746  109.213 36.704  1.00 74.81  ? 454 ARG B NH1 1 
ATOM   9065  N NH2 . ARG B 1 428 ? 65.368  111.034 36.477  1.00 75.41  ? 454 ARG B NH2 1 
ATOM   9066  N N   . HIS B 1 429 ? 62.504  102.141 34.689  1.00 39.29  ? 455 HIS B N   1 
ATOM   9067  C CA  . HIS B 1 429 ? 62.814  100.741 34.955  1.00 42.04  ? 455 HIS B CA  1 
ATOM   9068  C C   . HIS B 1 429 ? 63.562  100.232 33.732  1.00 46.10  ? 455 HIS B C   1 
ATOM   9069  O O   . HIS B 1 429 ? 63.003  100.191 32.636  1.00 48.02  ? 455 HIS B O   1 
ATOM   9070  C CB  . HIS B 1 429 ? 61.519  99.945  35.171  1.00 38.30  ? 455 HIS B CB  1 
ATOM   9071  C CG  . HIS B 1 429 ? 61.731  98.532  35.627  1.00 31.99  ? 455 HIS B CG  1 
ATOM   9072  N ND1 . HIS B 1 429 ? 62.028  97.502  34.760  1.00 32.36  ? 455 HIS B ND1 1 
ATOM   9073  C CD2 . HIS B 1 429 ? 61.657  97.974  36.857  1.00 31.46  ? 455 HIS B CD2 1 
ATOM   9074  C CE1 . HIS B 1 429 ? 62.124  96.371  35.436  1.00 29.58  ? 455 HIS B CE1 1 
ATOM   9075  N NE2 . HIS B 1 429 ? 61.903  96.630  36.711  1.00 29.23  ? 455 HIS B NE2 1 
ATOM   9076  N N   . GLY B 1 430 ? 64.829  99.872  33.925  1.00 49.11  ? 456 GLY B N   1 
ATOM   9077  C CA  . GLY B 1 430 ? 65.658  99.378  32.835  1.00 54.27  ? 456 GLY B CA  1 
ATOM   9078  C C   . GLY B 1 430 ? 64.926  98.972  31.565  1.00 57.06  ? 456 GLY B C   1 
ATOM   9079  O O   . GLY B 1 430 ? 65.298  99.399  30.467  1.00 57.22  ? 456 GLY B O   1 
ATOM   9080  N N   . SER B 1 431 ? 63.889  98.146  31.718  1.00 58.09  ? 457 SER B N   1 
ATOM   9081  C CA  . SER B 1 431 ? 63.088  97.677  30.590  1.00 59.87  ? 457 SER B CA  1 
ATOM   9082  C C   . SER B 1 431 ? 62.299  98.797  29.883  1.00 60.36  ? 457 SER B C   1 
ATOM   9083  O O   . SER B 1 431 ? 62.340  98.897  28.653  1.00 62.23  ? 457 SER B O   1 
ATOM   9084  C CB  . SER B 1 431 ? 62.135  96.566  31.050  1.00 59.04  ? 457 SER B CB  1 
ATOM   9085  O OG  . SER B 1 431 ? 61.304  97.006  32.108  1.00 60.26  ? 457 SER B OG  1 
ATOM   9086  N N   . ARG B 1 432 ? 61.590  99.634  30.642  1.00 57.05  ? 458 ARG B N   1 
ATOM   9087  C CA  . ARG B 1 432 ? 60.826  100.726 30.039  1.00 54.31  ? 458 ARG B CA  1 
ATOM   9088  C C   . ARG B 1 432 ? 60.658  101.921 30.975  1.00 51.13  ? 458 ARG B C   1 
ATOM   9089  O O   . ARG B 1 432 ? 60.992  101.851 32.156  1.00 50.92  ? 458 ARG B O   1 
ATOM   9090  C CB  . ARG B 1 432 ? 59.445  100.228 29.605  1.00 56.94  ? 458 ARG B CB  1 
ATOM   9091  C CG  . ARG B 1 432 ? 58.473  100.005 30.757  1.00 60.65  ? 458 ARG B CG  1 
ATOM   9092  C CD  . ARG B 1 432 ? 57.441  98.964  30.392  1.00 62.59  ? 458 ARG B CD  1 
ATOM   9093  N NE  . ARG B 1 432 ? 58.088  97.686  30.105  1.00 65.09  ? 458 ARG B NE  1 
ATOM   9094  C CZ  . ARG B 1 432 ? 57.764  96.892  29.089  1.00 66.48  ? 458 ARG B CZ  1 
ATOM   9095  N NH1 . ARG B 1 432 ? 56.789  97.241  28.255  1.00 65.62  ? 458 ARG B NH1 1 
ATOM   9096  N NH2 . ARG B 1 432 ? 58.422  95.753  28.902  1.00 65.85  ? 458 ARG B NH2 1 
ATOM   9097  N N   . GLN B 1 433 ? 60.130  103.014 30.432  1.00 46.65  ? 459 GLN B N   1 
ATOM   9098  C CA  . GLN B 1 433 ? 59.896  104.238 31.190  1.00 42.19  ? 459 GLN B CA  1 
ATOM   9099  C C   . GLN B 1 433 ? 58.465  104.683 30.922  1.00 37.12  ? 459 GLN B C   1 
ATOM   9100  O O   . GLN B 1 433 ? 57.868  104.299 29.920  1.00 37.68  ? 459 GLN B O   1 
ATOM   9101  C CB  . GLN B 1 433 ? 60.854  105.332 30.730  1.00 46.66  ? 459 GLN B CB  1 
ATOM   9102  C CG  . GLN B 1 433 ? 62.297  104.885 30.634  1.00 56.59  ? 459 GLN B CG  1 
ATOM   9103  C CD  . GLN B 1 433 ? 62.961  105.372 29.360  1.00 63.23  ? 459 GLN B CD  1 
ATOM   9104  O OE1 . GLN B 1 433 ? 64.126  105.069 29.099  1.00 68.25  ? 459 GLN B OE1 1 
ATOM   9105  N NE2 . GLN B 1 433 ? 62.219  106.131 28.555  1.00 65.27  ? 459 GLN B NE2 1 
ATOM   9106  N N   . GLY B 1 434 ? 57.908  105.495 31.808  1.00 32.40  ? 460 GLY B N   1 
ATOM   9107  C CA  . GLY B 1 434 ? 56.550  105.952 31.596  1.00 25.87  ? 460 GLY B CA  1 
ATOM   9108  C C   . GLY B 1 434 ? 56.041  106.824 32.717  1.00 22.97  ? 460 GLY B C   1 
ATOM   9109  O O   . GLY B 1 434 ? 56.816  107.364 33.503  1.00 20.61  ? 460 GLY B O   1 
ATOM   9110  N N   . GLN B 1 435 ? 54.726  106.958 32.806  1.00 20.90  ? 461 GLN B N   1 
ATOM   9111  C CA  . GLN B 1 435 ? 54.156  107.788 33.846  1.00 19.65  ? 461 GLN B CA  1 
ATOM   9112  C C   . GLN B 1 435 ? 52.974  107.138 34.531  1.00 19.11  ? 461 GLN B C   1 
ATOM   9113  O O   . GLN B 1 435 ? 52.240  106.344 33.933  1.00 17.22  ? 461 GLN B O   1 
ATOM   9114  C CB  . GLN B 1 435 ? 53.749  109.145 33.266  1.00 21.10  ? 461 GLN B CB  1 
ATOM   9115  C CG  . GLN B 1 435 ? 54.890  109.878 32.608  1.00 19.95  ? 461 GLN B CG  1 
ATOM   9116  C CD  . GLN B 1 435 ? 54.423  111.086 31.857  1.00 23.44  ? 461 GLN B CD  1 
ATOM   9117  O OE1 . GLN B 1 435 ? 53.725  110.966 30.851  1.00 28.64  ? 461 GLN B OE1 1 
ATOM   9118  N NE2 . GLN B 1 435 ? 54.795  112.271 32.341  1.00 27.01  ? 461 GLN B NE2 1 
ATOM   9119  N N   . ILE B 1 436 ? 52.813  107.486 35.802  1.00 17.93  ? 462 ILE B N   1 
ATOM   9120  C CA  . ILE B 1 436 ? 51.739  106.976 36.628  1.00 16.57  ? 462 ILE B CA  1 
ATOM   9121  C C   . ILE B 1 436 ? 51.062  108.163 37.280  1.00 18.36  ? 462 ILE B C   1 
ATOM   9122  O O   . ILE B 1 436 ? 51.721  109.065 37.793  1.00 17.44  ? 462 ILE B O   1 
ATOM   9123  C CB  . ILE B 1 436 ? 52.266  106.098 37.777  1.00 18.37  ? 462 ILE B CB  1 
ATOM   9124  C CG1 . ILE B 1 436 ? 52.992  104.872 37.226  1.00 15.63  ? 462 ILE B CG1 1 
ATOM   9125  C CG2 . ILE B 1 436 ? 51.104  105.705 38.711  1.00 17.87  ? 462 ILE B CG2 1 
ATOM   9126  C CD1 . ILE B 1 436 ? 53.653  104.046 38.320  1.00 15.22  ? 462 ILE B CD1 1 
ATOM   9127  N N   . ILE B 1 437 ? 49.741  108.143 37.279  1.00 16.77  ? 463 ILE B N   1 
ATOM   9128  C CA  . ILE B 1 437 ? 48.971  109.199 37.896  1.00 15.15  ? 463 ILE B CA  1 
ATOM   9129  C C   . ILE B 1 437 ? 48.199  108.580 39.046  1.00 15.60  ? 463 ILE B C   1 
ATOM   9130  O O   . ILE B 1 437 ? 47.298  107.775 38.836  1.00 13.93  ? 463 ILE B O   1 
ATOM   9131  C CB  . ILE B 1 437 ? 47.962  109.794 36.916  1.00 17.35  ? 463 ILE B CB  1 
ATOM   9132  C CG1 . ILE B 1 437 ? 48.689  110.301 35.671  1.00 17.57  ? 463 ILE B CG1 1 
ATOM   9133  C CG2 . ILE B 1 437 ? 47.175  110.903 37.596  1.00 11.57  ? 463 ILE B CG2 1 
ATOM   9134  C CD1 . ILE B 1 437 ? 47.745  110.688 34.564  1.00 20.24  ? 463 ILE B CD1 1 
ATOM   9135  N N   . TYR B 1 438 ? 48.555  108.954 40.264  1.00 15.88  ? 464 TYR B N   1 
ATOM   9136  C CA  . TYR B 1 438 ? 47.866  108.437 41.429  1.00 17.19  ? 464 TYR B CA  1 
ATOM   9137  C C   . TYR B 1 438 ? 46.781  109.396 41.884  1.00 19.37  ? 464 TYR B C   1 
ATOM   9138  O O   . TYR B 1 438 ? 47.038  110.584 42.098  1.00 20.33  ? 464 TYR B O   1 
ATOM   9139  C CB  . TYR B 1 438 ? 48.849  108.237 42.577  1.00 17.52  ? 464 TYR B CB  1 
ATOM   9140  C CG  . TYR B 1 438 ? 49.756  107.043 42.436  1.00 14.91  ? 464 TYR B CG  1 
ATOM   9141  C CD1 . TYR B 1 438 ? 49.261  105.743 42.598  1.00 12.96  ? 464 TYR B CD1 1 
ATOM   9142  C CD2 . TYR B 1 438 ? 51.118  107.212 42.176  1.00 14.24  ? 464 TYR B CD2 1 
ATOM   9143  C CE1 . TYR B 1 438 ? 50.106  104.637 42.513  1.00 14.86  ? 464 TYR B CE1 1 
ATOM   9144  C CE2 . TYR B 1 438 ? 51.973  106.118 42.089  1.00 15.10  ? 464 TYR B CE2 1 
ATOM   9145  C CZ  . TYR B 1 438 ? 51.464  104.835 42.258  1.00 14.25  ? 464 TYR B CZ  1 
ATOM   9146  O OH  . TYR B 1 438 ? 52.319  103.762 42.191  1.00 13.68  ? 464 TYR B OH  1 
ATOM   9147  N N   . ASN B 1 439 ? 45.564  108.881 42.019  1.00 20.27  ? 465 ASN B N   1 
ATOM   9148  C CA  . ASN B 1 439 ? 44.448  109.684 42.499  1.00 17.41  ? 465 ASN B CA  1 
ATOM   9149  C C   . ASN B 1 439 ? 44.142  109.148 43.894  1.00 18.01  ? 465 ASN B C   1 
ATOM   9150  O O   . ASN B 1 439 ? 43.519  108.095 44.042  1.00 16.53  ? 465 ASN B O   1 
ATOM   9151  C CB  . ASN B 1 439 ? 43.229  109.526 41.591  1.00 14.66  ? 465 ASN B CB  1 
ATOM   9152  C CG  . ASN B 1 439 ? 42.023  110.326 42.079  1.00 17.05  ? 465 ASN B CG  1 
ATOM   9153  O OD1 . ASN B 1 439 ? 40.885  110.070 41.672  1.00 17.49  ? 465 ASN B OD1 1 
ATOM   9154  N ND2 . ASN B 1 439 ? 42.268  111.301 42.945  1.00 12.08  ? 465 ASN B ND2 1 
ATOM   9155  N N   . TRP B 1 440 ? 44.608  109.866 44.912  1.00 18.50  ? 466 TRP B N   1 
ATOM   9156  C CA  . TRP B 1 440 ? 44.391  109.467 46.297  1.00 20.17  ? 466 TRP B CA  1 
ATOM   9157  C C   . TRP B 1 440 ? 43.120  110.152 46.778  1.00 21.06  ? 466 TRP B C   1 
ATOM   9158  O O   . TRP B 1 440 ? 43.016  111.378 46.720  1.00 22.97  ? 466 TRP B O   1 
ATOM   9159  C CB  . TRP B 1 440 ? 45.575  109.915 47.158  1.00 18.87  ? 466 TRP B CB  1 
ATOM   9160  C CG  . TRP B 1 440 ? 45.605  109.305 48.526  1.00 17.70  ? 466 TRP B CG  1 
ATOM   9161  C CD1 . TRP B 1 440 ? 46.099  108.079 48.864  1.00 16.67  ? 466 TRP B CD1 1 
ATOM   9162  C CD2 . TRP B 1 440 ? 45.120  109.891 49.743  1.00 18.40  ? 466 TRP B CD2 1 
ATOM   9163  N NE1 . TRP B 1 440 ? 45.954  107.864 50.216  1.00 15.66  ? 466 TRP B NE1 1 
ATOM   9164  C CE2 . TRP B 1 440 ? 45.356  108.955 50.779  1.00 14.40  ? 466 TRP B CE2 1 
ATOM   9165  C CE3 . TRP B 1 440 ? 44.506  111.111 50.055  1.00 16.75  ? 466 TRP B CE3 1 
ATOM   9166  C CZ2 . TRP B 1 440 ? 45.004  109.202 52.106  1.00 16.43  ? 466 TRP B CZ2 1 
ATOM   9167  C CZ3 . TRP B 1 440 ? 44.154  111.359 51.375  1.00 17.74  ? 466 TRP B CZ3 1 
ATOM   9168  C CH2 . TRP B 1 440 ? 44.403  110.404 52.388  1.00 18.88  ? 466 TRP B CH2 1 
ATOM   9169  N N   . GLN B 1 441 ? 42.144  109.386 47.247  1.00 20.78  ? 467 GLN B N   1 
ATOM   9170  C CA  . GLN B 1 441 ? 40.907  110.018 47.708  1.00 21.57  ? 467 GLN B CA  1 
ATOM   9171  C C   . GLN B 1 441 ? 40.762  109.841 49.210  1.00 22.07  ? 467 GLN B C   1 
ATOM   9172  O O   . GLN B 1 441 ? 40.731  108.710 49.700  1.00 23.25  ? 467 GLN B O   1 
ATOM   9173  C CB  . GLN B 1 441 ? 39.695  109.426 46.973  1.00 20.11  ? 467 GLN B CB  1 
ATOM   9174  C CG  . GLN B 1 441 ? 39.848  109.435 45.444  1.00 21.64  ? 467 GLN B CG  1 
ATOM   9175  C CD  . GLN B 1 441 ? 38.671  108.792 44.698  1.00 21.57  ? 467 GLN B CD  1 
ATOM   9176  O OE1 . GLN B 1 441 ? 37.981  107.921 45.227  1.00 18.87  ? 467 GLN B OE1 1 
ATOM   9177  N NE2 . GLN B 1 441 ? 38.460  109.210 43.454  1.00 19.50  ? 467 GLN B NE2 1 
ATOM   9178  N N   . GLY B 1 442 ? 40.689  110.959 49.933  1.00 20.00  ? 468 GLY B N   1 
ATOM   9179  C CA  . GLY B 1 442 ? 40.554  110.910 51.379  1.00 18.29  ? 468 GLY B CA  1 
ATOM   9180  C C   . GLY B 1 442 ? 39.179  110.485 51.872  1.00 20.99  ? 468 GLY B C   1 
ATOM   9181  O O   . GLY B 1 442 ? 38.157  110.828 51.276  1.00 21.62  ? 468 GLY B O   1 
ATOM   9182  N N   . ALA B 1 443 ? 39.155  109.756 52.982  1.00 21.96  ? 469 ALA B N   1 
ATOM   9183  C CA  . ALA B 1 443 ? 37.910  109.250 53.563  1.00 24.46  ? 469 ALA B CA  1 
ATOM   9184  C C   . ALA B 1 443 ? 36.922  110.310 54.033  1.00 25.96  ? 469 ALA B C   1 
ATOM   9185  O O   . ALA B 1 443 ? 35.731  110.032 54.174  1.00 27.58  ? 469 ALA B O   1 
ATOM   9186  C CB  . ALA B 1 443 ? 38.227  108.298 54.721  1.00 20.61  ? 469 ALA B CB  1 
ATOM   9187  N N   . GLN B 1 444 ? 37.409  111.517 54.285  1.00 28.62  ? 470 GLN B N   1 
ATOM   9188  C CA  . GLN B 1 444 ? 36.538  112.587 54.751  1.00 33.30  ? 470 GLN B CA  1 
ATOM   9189  C C   . GLN B 1 444 ? 36.471  113.716 53.747  1.00 32.12  ? 470 GLN B C   1 
ATOM   9190  O O   . GLN B 1 444 ? 36.095  114.837 54.079  1.00 36.23  ? 470 GLN B O   1 
ATOM   9191  C CB  . GLN B 1 444 ? 37.031  113.108 56.097  1.00 38.14  ? 470 GLN B CB  1 
ATOM   9192  C CG  . GLN B 1 444 ? 36.927  112.066 57.196  1.00 49.67  ? 470 GLN B CG  1 
ATOM   9193  C CD  . GLN B 1 444 ? 37.562  112.509 58.494  1.00 55.88  ? 470 GLN B CD  1 
ATOM   9194  O OE1 . GLN B 1 444 ? 37.588  111.756 59.468  1.00 60.28  ? 470 GLN B OE1 1 
ATOM   9195  N NE2 . GLN B 1 444 ? 38.081  113.737 58.519  1.00 59.69  ? 470 GLN B NE2 1 
ATOM   9196  N N   . SER B 1 445 ? 36.846  113.410 52.515  1.00 29.36  ? 471 SER B N   1 
ATOM   9197  C CA  . SER B 1 445 ? 36.823  114.388 51.450  1.00 25.97  ? 471 SER B CA  1 
ATOM   9198  C C   . SER B 1 445 ? 35.390  114.465 50.958  1.00 25.89  ? 471 SER B C   1 
ATOM   9199  O O   . SER B 1 445 ? 34.719  113.444 50.861  1.00 25.14  ? 471 SER B O   1 
ATOM   9200  C CB  . SER B 1 445 ? 37.740  113.940 50.319  1.00 25.25  ? 471 SER B CB  1 
ATOM   9201  O OG  . SER B 1 445 ? 37.823  114.940 49.333  1.00 22.85  ? 471 SER B OG  1 
ATOM   9202  N N   . THR B 1 446 ? 34.924  115.672 50.653  1.00 24.75  ? 472 THR B N   1 
ATOM   9203  C CA  . THR B 1 446 ? 33.564  115.869 50.184  1.00 24.91  ? 472 THR B CA  1 
ATOM   9204  C C   . THR B 1 446 ? 33.366  115.310 48.779  1.00 27.13  ? 472 THR B C   1 
ATOM   9205  O O   . THR B 1 446 ? 34.295  115.294 47.967  1.00 28.02  ? 472 THR B O   1 
ATOM   9206  C CB  . THR B 1 446 ? 33.194  117.355 50.188  1.00 26.99  ? 472 THR B CB  1 
ATOM   9207  O OG1 . THR B 1 446 ? 34.117  118.081 49.369  1.00 26.97  ? 472 THR B OG1 1 
ATOM   9208  C CG2 . THR B 1 446 ? 33.233  117.901 51.603  1.00 27.11  ? 472 THR B CG2 1 
ATOM   9209  N N   . GLN B 1 447 ? 32.143  114.866 48.498  1.00 25.61  ? 473 GLN B N   1 
ATOM   9210  C CA  . GLN B 1 447 ? 31.815  114.285 47.211  1.00 28.05  ? 473 GLN B CA  1 
ATOM   9211  C C   . GLN B 1 447 ? 32.219  115.104 46.003  1.00 27.47  ? 473 GLN B C   1 
ATOM   9212  O O   . GLN B 1 447 ? 32.790  114.564 45.048  1.00 28.71  ? 473 GLN B O   1 
ATOM   9213  C CB  . GLN B 1 447 ? 30.325  113.970 47.142  1.00 34.96  ? 473 GLN B CB  1 
ATOM   9214  C CG  . GLN B 1 447 ? 29.969  112.729 47.926  1.00 44.87  ? 473 GLN B CG  1 
ATOM   9215  C CD  . GLN B 1 447 ? 30.875  111.551 47.580  1.00 49.81  ? 473 GLN B CD  1 
ATOM   9216  O OE1 . GLN B 1 447 ? 30.855  111.037 46.452  1.00 50.97  ? 473 GLN B OE1 1 
ATOM   9217  N NE2 . GLN B 1 447 ? 31.684  111.126 48.551  1.00 50.69  ? 473 GLN B NE2 1 
ATOM   9218  N N   . ASP B 1 448 ? 31.926  116.398 46.024  1.00 23.94  ? 474 ASP B N   1 
ATOM   9219  C CA  . ASP B 1 448 ? 32.297  117.226 44.895  1.00 23.03  ? 474 ASP B CA  1 
ATOM   9220  C C   . ASP B 1 448 ? 33.799  117.150 44.631  1.00 21.32  ? 474 ASP B C   1 
ATOM   9221  O O   . ASP B 1 448 ? 34.222  116.978 43.490  1.00 19.64  ? 474 ASP B O   1 
ATOM   9222  C CB  . ASP B 1 448 ? 31.851  118.675 45.119  1.00 24.87  ? 474 ASP B CB  1 
ATOM   9223  C CG  . ASP B 1 448 ? 32.376  119.264 46.419  1.00 27.19  ? 474 ASP B CG  1 
ATOM   9224  O OD1 . ASP B 1 448 ? 32.343  118.547 47.446  1.00 28.03  ? 474 ASP B OD1 1 
ATOM   9225  O OD2 . ASP B 1 448 ? 32.801  120.447 46.411  1.00 20.04  ? 474 ASP B OD2 1 
ATOM   9226  N N   . GLU B 1 449 ? 34.614  117.243 45.676  1.00 20.41  ? 475 GLU B N   1 
ATOM   9227  C CA  . GLU B 1 449 ? 36.056  117.192 45.468  1.00 20.44  ? 475 GLU B CA  1 
ATOM   9228  C C   . GLU B 1 449 ? 36.560  115.783 45.117  1.00 19.97  ? 475 GLU B C   1 
ATOM   9229  O O   . GLU B 1 449 ? 37.463  115.628 44.286  1.00 16.76  ? 475 GLU B O   1 
ATOM   9230  C CB  . GLU B 1 449 ? 36.779  117.809 46.673  1.00 21.02  ? 475 GLU B CB  1 
ATOM   9231  C CG  . GLU B 1 449 ? 36.619  119.342 46.709  1.00 22.52  ? 475 GLU B CG  1 
ATOM   9232  C CD  . GLU B 1 449 ? 37.459  120.038 47.773  1.00 24.93  ? 475 GLU B CD  1 
ATOM   9233  O OE1 . GLU B 1 449 ? 37.648  121.267 47.655  1.00 23.08  ? 475 GLU B OE1 1 
ATOM   9234  O OE2 . GLU B 1 449 ? 37.926  119.372 48.725  1.00 24.94  ? 475 GLU B OE2 1 
ATOM   9235  N N   . VAL B 1 450 ? 35.967  114.753 45.712  1.00 18.82  ? 476 VAL B N   1 
ATOM   9236  C CA  . VAL B 1 450 ? 36.362  113.397 45.357  1.00 20.42  ? 476 VAL B CA  1 
ATOM   9237  C C   . VAL B 1 450 ? 36.047  113.214 43.868  1.00 20.82  ? 476 VAL B C   1 
ATOM   9238  O O   . VAL B 1 450 ? 36.874  112.743 43.092  1.00 19.18  ? 476 VAL B O   1 
ATOM   9239  C CB  . VAL B 1 450 ? 35.571  112.342 46.157  1.00 20.64  ? 476 VAL B CB  1 
ATOM   9240  C CG1 . VAL B 1 450 ? 35.796  110.946 45.553  1.00 21.14  ? 476 VAL B CG1 1 
ATOM   9241  C CG2 . VAL B 1 450 ? 36.017  112.359 47.610  1.00 21.12  ? 476 VAL B CG2 1 
ATOM   9242  N N   . ALA B 1 451 ? 34.833  113.597 43.482  1.00 23.57  ? 477 ALA B N   1 
ATOM   9243  C CA  . ALA B 1 451 ? 34.383  113.482 42.099  1.00 22.21  ? 477 ALA B CA  1 
ATOM   9244  C C   . ALA B 1 451 ? 35.302  114.253 41.158  1.00 22.33  ? 477 ALA B C   1 
ATOM   9245  O O   . ALA B 1 451 ? 35.726  113.737 40.120  1.00 25.05  ? 477 ALA B O   1 
ATOM   9246  C CB  . ALA B 1 451 ? 32.956  114.004 41.980  1.00 21.42  ? 477 ALA B CB  1 
ATOM   9247  N N   . ALA B 1 452 ? 35.604  115.489 41.540  1.00 21.37  ? 478 ALA B N   1 
ATOM   9248  C CA  . ALA B 1 452 ? 36.461  116.380 40.763  1.00 17.42  ? 478 ALA B CA  1 
ATOM   9249  C C   . ALA B 1 452 ? 37.861  115.837 40.603  1.00 17.83  ? 478 ALA B C   1 
ATOM   9250  O O   . ALA B 1 452 ? 38.516  116.106 39.600  1.00 18.50  ? 478 ALA B O   1 
ATOM   9251  C CB  . ALA B 1 452 ? 36.525  117.767 41.423  1.00 17.87  ? 478 ALA B CB  1 
ATOM   9252  N N   . SER B 1 453 ? 38.334  115.086 41.592  1.00 17.97  ? 479 SER B N   1 
ATOM   9253  C CA  . SER B 1 453 ? 39.678  114.545 41.501  1.00 17.73  ? 479 SER B CA  1 
ATOM   9254  C C   . SER B 1 453 ? 39.734  113.416 40.475  1.00 17.98  ? 479 SER B C   1 
ATOM   9255  O O   . SER B 1 453 ? 40.735  113.264 39.779  1.00 18.98  ? 479 SER B O   1 
ATOM   9256  C CB  . SER B 1 453 ? 40.176  114.075 42.873  1.00 16.97  ? 479 SER B CB  1 
ATOM   9257  O OG  . SER B 1 453 ? 39.540  112.892 43.295  1.00 17.58  ? 479 SER B OG  1 
ATOM   9258  N N   . ALA B 1 454 ? 38.658  112.641 40.358  1.00 17.89  ? 480 ALA B N   1 
ATOM   9259  C CA  . ALA B 1 454 ? 38.619  111.540 39.381  1.00 17.02  ? 480 ALA B CA  1 
ATOM   9260  C C   . ALA B 1 454 ? 38.587  112.110 37.965  1.00 15.33  ? 480 ALA B C   1 
ATOM   9261  O O   . ALA B 1 454 ? 39.340  111.680 37.088  1.00 15.60  ? 480 ALA B O   1 
ATOM   9262  C CB  . ALA B 1 454 ? 37.393  110.660 39.617  1.00 10.60  ? 480 ALA B CB  1 
ATOM   9263  N N   . ILE B 1 455 ? 37.723  113.095 37.748  1.00 14.86  ? 481 ILE B N   1 
ATOM   9264  C CA  . ILE B 1 455 ? 37.609  113.724 36.437  1.00 15.64  ? 481 ILE B CA  1 
ATOM   9265  C C   . ILE B 1 455 ? 38.922  114.388 36.033  1.00 14.72  ? 481 ILE B C   1 
ATOM   9266  O O   . ILE B 1 455 ? 39.386  114.234 34.907  1.00 16.44  ? 481 ILE B O   1 
ATOM   9267  C CB  . ILE B 1 455 ? 36.496  114.795 36.427  1.00 16.89  ? 481 ILE B CB  1 
ATOM   9268  C CG1 . ILE B 1 455 ? 35.140  114.126 36.651  1.00 16.88  ? 481 ILE B CG1 1 
ATOM   9269  C CG2 . ILE B 1 455 ? 36.518  115.572 35.112  1.00 14.70  ? 481 ILE B CG2 1 
ATOM   9270  C CD1 . ILE B 1 455 ? 34.018  115.100 36.941  1.00 16.48  ? 481 ILE B CD1 1 
ATOM   9271  N N   . LEU B 1 456 ? 39.519  115.134 36.953  1.00 15.14  ? 482 LEU B N   1 
ATOM   9272  C CA  . LEU B 1 456 ? 40.772  115.815 36.658  1.00 15.60  ? 482 LEU B CA  1 
ATOM   9273  C C   . LEU B 1 456 ? 41.874  114.797 36.378  1.00 15.68  ? 482 LEU B C   1 
ATOM   9274  O O   . LEU B 1 456 ? 42.794  115.063 35.599  1.00 11.90  ? 482 LEU B O   1 
ATOM   9275  C CB  . LEU B 1 456 ? 41.157  116.731 37.825  1.00 14.06  ? 482 LEU B CB  1 
ATOM   9276  C CG  . LEU B 1 456 ? 40.243  117.955 37.943  1.00 15.86  ? 482 LEU B CG  1 
ATOM   9277  C CD1 . LEU B 1 456 ? 40.573  118.704 39.209  1.00 14.11  ? 482 LEU B CD1 1 
ATOM   9278  C CD2 . LEU B 1 456 ? 40.406  118.864 36.730  1.00 10.32  ? 482 LEU B CD2 1 
ATOM   9279  N N   . THR B 1 457 ? 41.769  113.636 37.020  1.00 14.94  ? 483 THR B N   1 
ATOM   9280  C CA  . THR B 1 457 ? 42.735  112.565 36.833  1.00 17.79  ? 483 THR B CA  1 
ATOM   9281  C C   . THR B 1 457 ? 42.625  112.042 35.414  1.00 19.67  ? 483 THR B C   1 
ATOM   9282  O O   . THR B 1 457 ? 43.627  111.918 34.707  1.00 20.86  ? 483 THR B O   1 
ATOM   9283  C CB  . THR B 1 457 ? 42.481  111.392 37.808  1.00 18.19  ? 483 THR B CB  1 
ATOM   9284  O OG1 . THR B 1 457 ? 42.790  111.811 39.141  1.00 24.09  ? 483 THR B OG1 1 
ATOM   9285  C CG2 . THR B 1 457 ? 43.353  110.192 37.455  1.00 13.05  ? 483 THR B CG2 1 
ATOM   9286  N N   . ALA B 1 458 ? 41.399  111.733 35.005  1.00 20.54  ? 484 ALA B N   1 
ATOM   9287  C CA  . ALA B 1 458 ? 41.144  111.215 33.670  1.00 20.92  ? 484 ALA B CA  1 
ATOM   9288  C C   . ALA B 1 458 ? 41.477  112.270 32.622  1.00 21.71  ? 484 ALA B C   1 
ATOM   9289  O O   . ALA B 1 458 ? 41.964  111.945 31.542  1.00 20.72  ? 484 ALA B O   1 
ATOM   9290  C CB  . ALA B 1 458 ? 39.685  110.793 33.543  1.00 16.82  ? 484 ALA B CB  1 
ATOM   9291  N N   . GLN B 1 459 ? 41.226  113.533 32.954  1.00 23.13  ? 485 GLN B N   1 
ATOM   9292  C CA  . GLN B 1 459 ? 41.497  114.633 32.033  1.00 25.95  ? 485 GLN B CA  1 
ATOM   9293  C C   . GLN B 1 459 ? 43.004  114.829 31.825  1.00 24.49  ? 485 GLN B C   1 
ATOM   9294  O O   . GLN B 1 459 ? 43.446  115.173 30.733  1.00 24.29  ? 485 GLN B O   1 
ATOM   9295  C CB  . GLN B 1 459 ? 40.868  115.917 32.571  1.00 29.92  ? 485 GLN B CB  1 
ATOM   9296  C CG  . GLN B 1 459 ? 40.482  116.916 31.499  1.00 38.79  ? 485 GLN B CG  1 
ATOM   9297  C CD  . GLN B 1 459 ? 39.652  118.073 32.044  1.00 42.69  ? 485 GLN B CD  1 
ATOM   9298  O OE1 . GLN B 1 459 ? 40.168  118.959 32.731  1.00 42.14  ? 485 GLN B OE1 1 
ATOM   9299  N NE2 . GLN B 1 459 ? 38.353  118.061 31.744  1.00 44.20  ? 485 GLN B NE2 1 
ATOM   9300  N N   . LEU B 1 460 ? 43.789  114.608 32.874  1.00 22.93  ? 486 LEU B N   1 
ATOM   9301  C CA  . LEU B 1 460 ? 45.234  114.755 32.773  1.00 23.99  ? 486 LEU B CA  1 
ATOM   9302  C C   . LEU B 1 460 ? 45.789  113.640 31.904  1.00 23.75  ? 486 LEU B C   1 
ATOM   9303  O O   . LEU B 1 460 ? 46.678  113.848 31.086  1.00 23.85  ? 486 LEU B O   1 
ATOM   9304  C CB  . LEU B 1 460 ? 45.886  114.689 34.161  1.00 24.86  ? 486 LEU B CB  1 
ATOM   9305  C CG  . LEU B 1 460 ? 47.412  114.853 34.179  1.00 24.66  ? 486 LEU B CG  1 
ATOM   9306  C CD1 . LEU B 1 460 ? 47.766  116.269 33.767  1.00 26.31  ? 486 LEU B CD1 1 
ATOM   9307  C CD2 . LEU B 1 460 ? 47.968  114.560 35.559  1.00 24.38  ? 486 LEU B CD2 1 
ATOM   9308  N N   . ASP B 1 461 ? 45.257  112.442 32.102  1.00 24.27  ? 487 ASP B N   1 
ATOM   9309  C CA  . ASP B 1 461 ? 45.672  111.268 31.349  1.00 22.65  ? 487 ASP B CA  1 
ATOM   9310  C C   . ASP B 1 461 ? 45.472  111.538 29.854  1.00 22.12  ? 487 ASP B C   1 
ATOM   9311  O O   . ASP B 1 461 ? 46.334  111.240 29.028  1.00 19.38  ? 487 ASP B O   1 
ATOM   9312  C CB  . ASP B 1 461 ? 44.833  110.076 31.827  1.00 23.48  ? 487 ASP B CB  1 
ATOM   9313  C CG  . ASP B 1 461 ? 44.950  108.856 30.938  1.00 21.96  ? 487 ASP B CG  1 
ATOM   9314  O OD1 . ASP B 1 461 ? 44.195  107.908 31.186  1.00 27.42  ? 487 ASP B OD1 1 
ATOM   9315  O OD2 . ASP B 1 461 ? 45.769  108.817 30.007  1.00 24.38  ? 487 ASP B OD2 1 
ATOM   9316  N N   . GLU B 1 462 ? 44.335  112.123 29.515  1.00 22.60  ? 488 GLU B N   1 
ATOM   9317  C CA  . GLU B 1 462 ? 44.018  112.428 28.133  1.00 25.26  ? 488 GLU B CA  1 
ATOM   9318  C C   . GLU B 1 462 ? 44.967  113.445 27.508  1.00 26.84  ? 488 GLU B C   1 
ATOM   9319  O O   . GLU B 1 462 ? 45.621  113.155 26.509  1.00 28.51  ? 488 GLU B O   1 
ATOM   9320  C CB  . GLU B 1 462 ? 42.576  112.932 28.039  1.00 31.02  ? 488 GLU B CB  1 
ATOM   9321  C CG  . GLU B 1 462 ? 42.150  113.372 26.655  1.00 41.70  ? 488 GLU B CG  1 
ATOM   9322  C CD  . GLU B 1 462 ? 40.727  113.896 26.633  1.00 49.30  ? 488 GLU B CD  1 
ATOM   9323  O OE1 . GLU B 1 462 ? 40.181  114.196 27.724  1.00 49.73  ? 488 GLU B OE1 1 
ATOM   9324  O OE2 . GLU B 1 462 ? 40.157  114.019 25.524  1.00 52.41  ? 488 GLU B OE2 1 
ATOM   9325  N N   . GLU B 1 463 ? 45.066  114.634 28.092  1.00 26.28  ? 489 GLU B N   1 
ATOM   9326  C CA  . GLU B 1 463 ? 45.935  115.642 27.510  1.00 26.40  ? 489 GLU B CA  1 
ATOM   9327  C C   . GLU B 1 463 ? 47.420  115.334 27.611  1.00 25.25  ? 489 GLU B C   1 
ATOM   9328  O O   . GLU B 1 463 ? 48.262  116.099 27.131  1.00 22.75  ? 489 GLU B O   1 
ATOM   9329  C CB  . GLU B 1 463 ? 45.613  117.023 28.077  1.00 26.56  ? 489 GLU B CB  1 
ATOM   9330  C CG  . GLU B 1 463 ? 45.703  117.160 29.557  1.00 34.16  ? 489 GLU B CG  1 
ATOM   9331  C CD  . GLU B 1 463 ? 44.767  118.245 30.050  1.00 38.51  ? 489 GLU B CD  1 
ATOM   9332  O OE1 . GLU B 1 463 ? 44.929  118.702 31.206  1.00 42.26  ? 489 GLU B OE1 1 
ATOM   9333  O OE2 . GLU B 1 463 ? 43.861  118.629 29.275  1.00 36.53  ? 489 GLU B OE2 1 
ATOM   9334  N N   . LEU B 1 464 ? 47.740  114.199 28.217  1.00 23.88  ? 490 LEU B N   1 
ATOM   9335  C CA  . LEU B 1 464 ? 49.125  113.786 28.332  1.00 24.00  ? 490 LEU B CA  1 
ATOM   9336  C C   . LEU B 1 464 ? 49.355  112.676 27.296  1.00 25.42  ? 490 LEU B C   1 
ATOM   9337  O O   . LEU B 1 464 ? 50.431  112.097 27.208  1.00 25.30  ? 490 LEU B O   1 
ATOM   9338  C CB  . LEU B 1 464 ? 49.409  113.302 29.752  1.00 23.57  ? 490 LEU B CB  1 
ATOM   9339  C CG  . LEU B 1 464 ? 50.675  113.833 30.441  1.00 26.18  ? 490 LEU B CG  1 
ATOM   9340  C CD1 . LEU B 1 464 ? 50.879  115.316 30.137  1.00 22.68  ? 490 LEU B CD1 1 
ATOM   9341  C CD2 . LEU B 1 464 ? 50.552  113.607 31.949  1.00 20.24  ? 490 LEU B CD2 1 
ATOM   9342  N N   . GLY B 1 465 ? 48.321  112.393 26.505  1.00 26.70  ? 491 GLY B N   1 
ATOM   9343  C CA  . GLY B 1 465 ? 48.428  111.392 25.459  1.00 25.63  ? 491 GLY B CA  1 
ATOM   9344  C C   . GLY B 1 465 ? 47.754  110.050 25.695  1.00 27.38  ? 491 GLY B C   1 
ATOM   9345  O O   . GLY B 1 465 ? 47.943  109.125 24.903  1.00 27.86  ? 491 GLY B O   1 
ATOM   9346  N N   . GLY B 1 466 ? 46.965  109.928 26.758  1.00 26.10  ? 492 GLY B N   1 
ATOM   9347  C CA  . GLY B 1 466 ? 46.328  108.656 27.035  1.00 22.52  ? 492 GLY B CA  1 
ATOM   9348  C C   . GLY B 1 466 ? 47.387  107.593 27.297  1.00 24.80  ? 492 GLY B C   1 
ATOM   9349  O O   . GLY B 1 466 ? 47.116  106.405 27.227  1.00 26.12  ? 492 GLY B O   1 
ATOM   9350  N N   . THR B 1 467 ? 48.595  108.037 27.627  1.00 25.12  ? 493 THR B N   1 
ATOM   9351  C CA  . THR B 1 467 ? 49.732  107.161 27.891  1.00 24.92  ? 493 THR B CA  1 
ATOM   9352  C C   . THR B 1 467 ? 50.003  106.740 29.341  1.00 24.35  ? 493 THR B C   1 
ATOM   9353  O O   . THR B 1 467 ? 50.420  105.616 29.613  1.00 23.00  ? 493 THR B O   1 
ATOM   9354  C CB  . THR B 1 467 ? 51.000  107.822 27.379  1.00 26.48  ? 493 THR B CB  1 
ATOM   9355  O OG1 . THR B 1 467 ? 50.973  107.832 25.953  1.00 35.43  ? 493 THR B OG1 1 
ATOM   9356  C CG2 . THR B 1 467 ? 52.234  107.089 27.851  1.00 29.30  ? 493 THR B CG2 1 
ATOM   9357  N N   . PRO B 1 468 ? 49.789  107.647 30.295  1.00 22.14  ? 494 PRO B N   1 
ATOM   9358  C CA  . PRO B 1 468 ? 50.072  107.231 31.671  1.00 19.64  ? 494 PRO B CA  1 
ATOM   9359  C C   . PRO B 1 468 ? 49.301  106.038 32.197  1.00 19.04  ? 494 PRO B C   1 
ATOM   9360  O O   . PRO B 1 468 ? 48.328  105.589 31.614  1.00 19.38  ? 494 PRO B O   1 
ATOM   9361  C CB  . PRO B 1 468 ? 49.754  108.497 32.478  1.00 18.76  ? 494 PRO B CB  1 
ATOM   9362  C CG  . PRO B 1 468 ? 49.982  109.602 31.488  1.00 20.52  ? 494 PRO B CG  1 
ATOM   9363  C CD  . PRO B 1 468 ? 49.359  109.045 30.238  1.00 18.20  ? 494 PRO B CD  1 
ATOM   9364  N N   . VAL B 1 469 ? 49.778  105.519 33.319  1.00 21.07  ? 495 VAL B N   1 
ATOM   9365  C CA  . VAL B 1 469 ? 49.096  104.445 34.006  1.00 17.90  ? 495 VAL B CA  1 
ATOM   9366  C C   . VAL B 1 469 ? 48.186  105.272 34.927  1.00 19.30  ? 495 VAL B C   1 
ATOM   9367  O O   . VAL B 1 469 ? 48.599  106.317 35.434  1.00 18.24  ? 495 VAL B O   1 
ATOM   9368  C CB  . VAL B 1 469 ? 50.073  103.615 34.825  1.00 15.06  ? 495 VAL B CB  1 
ATOM   9369  C CG1 . VAL B 1 469 ? 49.318  102.750 35.801  1.00 10.58  ? 495 VAL B CG1 1 
ATOM   9370  C CG2 . VAL B 1 469 ? 50.921  102.772 33.891  1.00 15.17  ? 495 VAL B CG2 1 
ATOM   9371  N N   . GLN B 1 470 ? 46.959  104.827 35.139  1.00 20.59  ? 496 GLN B N   1 
ATOM   9372  C CA  . GLN B 1 470 ? 46.034  105.593 35.954  1.00 22.47  ? 496 GLN B CA  1 
ATOM   9373  C C   . GLN B 1 470 ? 45.577  104.775 37.162  1.00 24.68  ? 496 GLN B C   1 
ATOM   9374  O O   . GLN B 1 470 ? 44.889  103.763 37.012  1.00 25.70  ? 496 GLN B O   1 
ATOM   9375  C CB  . GLN B 1 470 ? 44.849  105.993 35.083  1.00 21.33  ? 496 GLN B CB  1 
ATOM   9376  C CG  . GLN B 1 470 ? 44.018  107.114 35.632  1.00 25.83  ? 496 GLN B CG  1 
ATOM   9377  C CD  . GLN B 1 470 ? 42.735  107.317 34.861  1.00 25.32  ? 496 GLN B CD  1 
ATOM   9378  O OE1 . GLN B 1 470 ? 42.733  107.341 33.628  1.00 28.56  ? 496 GLN B OE1 1 
ATOM   9379  N NE2 . GLN B 1 470 ? 41.636  107.475 35.582  1.00 21.94  ? 496 GLN B NE2 1 
ATOM   9380  N N   . SER B 1 471 ? 45.939  105.224 38.361  1.00 24.45  ? 497 SER B N   1 
ATOM   9381  C CA  . SER B 1 471 ? 45.589  104.484 39.570  1.00 23.97  ? 497 SER B CA  1 
ATOM   9382  C C   . SER B 1 471 ? 44.715  105.191 40.617  1.00 21.28  ? 497 SER B C   1 
ATOM   9383  O O   . SER B 1 471 ? 45.024  106.294 41.070  1.00 18.45  ? 497 SER B O   1 
ATOM   9384  C CB  . SER B 1 471 ? 46.878  103.998 40.236  1.00 25.22  ? 497 SER B CB  1 
ATOM   9385  O OG  . SER B 1 471 ? 46.583  103.164 41.337  1.00 33.55  ? 497 SER B OG  1 
ATOM   9386  N N   . ARG B 1 472 ? 43.619  104.548 41.008  1.00 18.95  ? 498 ARG B N   1 
ATOM   9387  C CA  . ARG B 1 472 ? 42.750  105.124 42.023  1.00 17.52  ? 498 ARG B CA  1 
ATOM   9388  C C   . ARG B 1 472 ? 42.993  104.439 43.354  1.00 18.50  ? 498 ARG B C   1 
ATOM   9389  O O   . ARG B 1 472 ? 42.944  103.213 43.456  1.00 18.50  ? 498 ARG B O   1 
ATOM   9390  C CB  . ARG B 1 472 ? 41.277  104.959 41.672  1.00 16.49  ? 498 ARG B CB  1 
ATOM   9391  C CG  . ARG B 1 472 ? 40.352  105.202 42.865  1.00 19.39  ? 498 ARG B CG  1 
ATOM   9392  C CD  . ARG B 1 472 ? 38.975  104.709 42.543  1.00 25.36  ? 498 ARG B CD  1 
ATOM   9393  N NE  . ARG B 1 472 ? 38.304  103.949 43.606  1.00 28.43  ? 498 ARG B NE  1 
ATOM   9394  C CZ  . ARG B 1 472 ? 38.819  102.920 44.274  1.00 27.19  ? 498 ARG B CZ  1 
ATOM   9395  N NH1 . ARG B 1 472 ? 40.055  102.487 44.044  1.00 26.60  ? 498 ARG B NH1 1 
ATOM   9396  N NH2 . ARG B 1 472 ? 38.055  102.273 45.138  1.00 28.66  ? 498 ARG B NH2 1 
ATOM   9397  N N   . VAL B 1 473 ? 43.247  105.231 44.386  1.00 19.09  ? 499 VAL B N   1 
ATOM   9398  C CA  . VAL B 1 473 ? 43.470  104.650 45.690  1.00 21.76  ? 499 VAL B CA  1 
ATOM   9399  C C   . VAL B 1 473 ? 42.677  105.399 46.745  1.00 22.64  ? 499 VAL B C   1 
ATOM   9400  O O   . VAL B 1 473 ? 42.469  106.614 46.655  1.00 22.53  ? 499 VAL B O   1 
ATOM   9401  C CB  . VAL B 1 473 ? 44.994  104.607 46.046  1.00 21.63  ? 499 VAL B CB  1 
ATOM   9402  C CG1 . VAL B 1 473 ? 45.802  105.271 44.960  1.00 21.19  ? 499 VAL B CG1 1 
ATOM   9403  C CG2 . VAL B 1 473 ? 45.249  105.255 47.386  1.00 21.59  ? 499 VAL B CG2 1 
ATOM   9404  N N   . VAL B 1 474 ? 42.206  104.649 47.731  1.00 23.61  ? 500 VAL B N   1 
ATOM   9405  C CA  . VAL B 1 474 ? 41.430  105.224 48.813  1.00 25.61  ? 500 VAL B CA  1 
ATOM   9406  C C   . VAL B 1 474 ? 42.275  105.210 50.082  1.00 28.77  ? 500 VAL B C   1 
ATOM   9407  O O   . VAL B 1 474 ? 43.082  104.300 50.294  1.00 31.14  ? 500 VAL B O   1 
ATOM   9408  C CB  . VAL B 1 474 ? 40.120  104.429 49.034  1.00 24.00  ? 500 VAL B CB  1 
ATOM   9409  C CG1 . VAL B 1 474 ? 39.319  105.051 50.161  1.00 24.14  ? 500 VAL B CG1 1 
ATOM   9410  C CG2 . VAL B 1 474 ? 39.284  104.425 47.749  1.00 19.59  ? 500 VAL B CG2 1 
ATOM   9411  N N   . GLN B 1 475 ? 42.097  106.236 50.911  1.00 27.63  ? 501 GLN B N   1 
ATOM   9412  C CA  . GLN B 1 475 ? 42.830  106.364 52.166  1.00 26.64  ? 501 GLN B CA  1 
ATOM   9413  C C   . GLN B 1 475 ? 42.873  105.065 52.984  1.00 24.65  ? 501 GLN B C   1 
ATOM   9414  O O   . GLN B 1 475 ? 41.857  104.404 53.162  1.00 25.18  ? 501 GLN B O   1 
ATOM   9415  C CB  . GLN B 1 475 ? 42.201  107.488 52.988  1.00 25.72  ? 501 GLN B CB  1 
ATOM   9416  C CG  . GLN B 1 475 ? 42.683  107.577 54.416  1.00 28.86  ? 501 GLN B CG  1 
ATOM   9417  C CD  . GLN B 1 475 ? 42.147  108.802 55.110  1.00 30.21  ? 501 GLN B CD  1 
ATOM   9418  O OE1 . GLN B 1 475 ? 41.022  109.218 54.855  1.00 34.88  ? 501 GLN B OE1 1 
ATOM   9419  N NE2 . GLN B 1 475 ? 42.939  109.383 56.001  1.00 31.30  ? 501 GLN B NE2 1 
ATOM   9420  N N   . GLY B 1 476 ? 44.055  104.700 53.472  1.00 23.80  ? 502 GLY B N   1 
ATOM   9421  C CA  . GLY B 1 476 ? 44.178  103.487 54.269  1.00 26.75  ? 502 GLY B CA  1 
ATOM   9422  C C   . GLY B 1 476 ? 44.497  102.222 53.485  1.00 28.96  ? 502 GLY B C   1 
ATOM   9423  O O   . GLY B 1 476 ? 44.857  101.200 54.063  1.00 26.41  ? 502 GLY B O   1 
ATOM   9424  N N   . LYS B 1 477 ? 44.356  102.282 52.165  1.00 30.78  ? 503 LYS B N   1 
ATOM   9425  C CA  . LYS B 1 477 ? 44.652  101.139 51.316  1.00 31.52  ? 503 LYS B CA  1 
ATOM   9426  C C   . LYS B 1 477 ? 45.655  101.540 50.254  1.00 29.42  ? 503 LYS B C   1 
ATOM   9427  O O   . LYS B 1 477 ? 45.498  101.221 49.074  1.00 27.84  ? 503 LYS B O   1 
ATOM   9428  C CB  . LYS B 1 477 ? 43.381  100.611 50.656  1.00 35.87  ? 503 LYS B CB  1 
ATOM   9429  C CG  . LYS B 1 477 ? 42.766  99.428  51.384  1.00 41.27  ? 503 LYS B CG  1 
ATOM   9430  C CD  . LYS B 1 477 ? 43.659  98.195  51.297  1.00 43.04  ? 503 LYS B CD  1 
ATOM   9431  C CE  . LYS B 1 477 ? 42.916  96.957  51.797  1.00 46.70  ? 503 LYS B CE  1 
ATOM   9432  N NZ  . LYS B 1 477 ? 43.710  95.706  51.660  1.00 46.04  ? 503 LYS B NZ  1 
ATOM   9433  N N   . GLU B 1 478 ? 46.689  102.244 50.694  1.00 25.69  ? 504 GLU B N   1 
ATOM   9434  C CA  . GLU B 1 478 ? 47.738  102.709 49.811  1.00 24.64  ? 504 GLU B CA  1 
ATOM   9435  C C   . GLU B 1 478 ? 48.595  101.571 49.254  1.00 23.41  ? 504 GLU B C   1 
ATOM   9436  O O   . GLU B 1 478 ? 48.990  100.661 49.978  1.00 25.13  ? 504 GLU B O   1 
ATOM   9437  C CB  . GLU B 1 478 ? 48.650  103.683 50.560  1.00 26.03  ? 504 GLU B CB  1 
ATOM   9438  C CG  . GLU B 1 478 ? 48.052  105.046 50.900  1.00 26.00  ? 504 GLU B CG  1 
ATOM   9439  C CD  . GLU B 1 478 ? 47.056  105.017 52.037  1.00 25.78  ? 504 GLU B CD  1 
ATOM   9440  O OE1 . GLU B 1 478 ? 47.043  104.035 52.811  1.00 25.14  ? 504 GLU B OE1 1 
ATOM   9441  O OE2 . GLU B 1 478 ? 46.292  105.997 52.162  1.00 24.61  ? 504 GLU B OE2 1 
ATOM   9442  N N   . PRO B 1 479 ? 48.878  101.599 47.944  1.00 22.11  ? 505 PRO B N   1 
ATOM   9443  C CA  . PRO B 1 479 ? 49.711  100.553 47.333  1.00 21.36  ? 505 PRO B CA  1 
ATOM   9444  C C   . PRO B 1 479 ? 51.210  100.815 47.626  1.00 20.25  ? 505 PRO B C   1 
ATOM   9445  O O   . PRO B 1 479 ? 51.626  101.957 47.832  1.00 18.44  ? 505 PRO B O   1 
ATOM   9446  C CB  . PRO B 1 479 ? 49.352  100.652 45.847  1.00 17.91  ? 505 PRO B CB  1 
ATOM   9447  C CG  . PRO B 1 479 ? 49.050  102.095 45.677  1.00 19.93  ? 505 PRO B CG  1 
ATOM   9448  C CD  . PRO B 1 479 ? 48.228  102.425 46.911  1.00 20.30  ? 505 PRO B CD  1 
ATOM   9449  N N   . ALA B 1 480 ? 52.007  99.754  47.644  1.00 21.24  ? 506 ALA B N   1 
ATOM   9450  C CA  . ALA B 1 480 ? 53.432  99.851  47.952  1.00 22.31  ? 506 ALA B CA  1 
ATOM   9451  C C   . ALA B 1 480 ? 54.218  100.922 47.212  1.00 23.31  ? 506 ALA B C   1 
ATOM   9452  O O   . ALA B 1 480 ? 54.950  101.685 47.837  1.00 25.38  ? 506 ALA B O   1 
ATOM   9453  C CB  . ALA B 1 480 ? 54.095  98.508  47.740  1.00 20.97  ? 506 ALA B CB  1 
ATOM   9454  N N   . HIS B 1 481 ? 54.084  100.979 45.891  1.00 21.68  ? 507 HIS B N   1 
ATOM   9455  C CA  . HIS B 1 481 ? 54.826  101.962 45.115  1.00 21.17  ? 507 HIS B CA  1 
ATOM   9456  C C   . HIS B 1 481 ? 54.582  103.404 45.550  1.00 19.98  ? 507 HIS B C   1 
ATOM   9457  O O   . HIS B 1 481 ? 55.510  104.203 45.570  1.00 22.29  ? 507 HIS B O   1 
ATOM   9458  C CB  . HIS B 1 481 ? 54.500  101.820 43.633  1.00 23.75  ? 507 HIS B CB  1 
ATOM   9459  C CG  . HIS B 1 481 ? 55.391  102.625 42.745  1.00 22.51  ? 507 HIS B CG  1 
ATOM   9460  N ND1 . HIS B 1 481 ? 56.743  102.376 42.627  1.00 24.85  ? 507 HIS B ND1 1 
ATOM   9461  C CD2 . HIS B 1 481 ? 55.137  103.699 41.962  1.00 20.69  ? 507 HIS B CD2 1 
ATOM   9462  C CE1 . HIS B 1 481 ? 57.283  103.266 41.813  1.00 20.94  ? 507 HIS B CE1 1 
ATOM   9463  N NE2 . HIS B 1 481 ? 56.330  104.080 41.397  1.00 22.31  ? 507 HIS B NE2 1 
ATOM   9464  N N   . LEU B 1 482 ? 53.337  103.735 45.891  1.00 19.84  ? 508 LEU B N   1 
ATOM   9465  C CA  . LEU B 1 482 ? 52.983  105.086 46.337  1.00 20.16  ? 508 LEU B CA  1 
ATOM   9466  C C   . LEU B 1 482 ? 53.691  105.457 47.655  1.00 22.21  ? 508 LEU B C   1 
ATOM   9467  O O   . LEU B 1 482 ? 54.079  106.600 47.862  1.00 18.07  ? 508 LEU B O   1 
ATOM   9468  C CB  . LEU B 1 482 ? 51.462  105.206 46.502  1.00 18.33  ? 508 LEU B CB  1 
ATOM   9469  C CG  . LEU B 1 482 ? 50.932  106.516 47.101  1.00 16.98  ? 508 LEU B CG  1 
ATOM   9470  C CD1 . LEU B 1 482 ? 51.334  107.704 46.229  1.00 19.22  ? 508 LEU B CD1 1 
ATOM   9471  C CD2 . LEU B 1 482 ? 49.429  106.443 47.237  1.00 14.08  ? 508 LEU B CD2 1 
ATOM   9472  N N   . MET B 1 483 ? 53.847  104.478 48.542  1.00 24.43  ? 509 MET B N   1 
ATOM   9473  C CA  . MET B 1 483 ? 54.530  104.681 49.817  1.00 26.07  ? 509 MET B CA  1 
ATOM   9474  C C   . MET B 1 483 ? 56.028  104.980 49.646  1.00 26.28  ? 509 MET B C   1 
ATOM   9475  O O   . MET B 1 483 ? 56.633  105.627 50.501  1.00 27.73  ? 509 MET B O   1 
ATOM   9476  C CB  . MET B 1 483 ? 54.388  103.429 50.687  1.00 25.92  ? 509 MET B CB  1 
ATOM   9477  C CG  . MET B 1 483 ? 53.029  103.249 51.339  1.00 28.91  ? 509 MET B CG  1 
ATOM   9478  S SD  . MET B 1 483 ? 52.684  101.515 51.700  1.00 28.26  ? 509 MET B SD  1 
ATOM   9479  C CE  . MET B 1 483 ? 53.973  101.095 52.849  1.00 29.41  ? 509 MET B CE  1 
ATOM   9480  N N   . SER B 1 484 ? 56.615  104.513 48.548  1.00 23.54  ? 510 SER B N   1 
ATOM   9481  C CA  . SER B 1 484 ? 58.049  104.681 48.287  1.00 24.59  ? 510 SER B CA  1 
ATOM   9482  C C   . SER B 1 484 ? 58.448  106.001 47.642  1.00 24.60  ? 510 SER B C   1 
ATOM   9483  O O   . SER B 1 484 ? 59.636  106.266 47.444  1.00 24.00  ? 510 SER B O   1 
ATOM   9484  C CB  . SER B 1 484 ? 58.548  103.559 47.372  1.00 24.23  ? 510 SER B CB  1 
ATOM   9485  O OG  . SER B 1 484 ? 57.833  102.363 47.598  1.00 29.05  ? 510 SER B OG  1 
ATOM   9486  N N   . LEU B 1 485 ? 57.464  106.821 47.300  1.00 26.60  ? 511 LEU B N   1 
ATOM   9487  C CA  . LEU B 1 485 ? 57.743  108.088 46.637  1.00 26.80  ? 511 LEU B CA  1 
ATOM   9488  C C   . LEU B 1 485 ? 58.451  109.144 47.482  1.00 25.93  ? 511 LEU B C   1 
ATOM   9489  O O   . LEU B 1 485 ? 58.977  110.112 46.945  1.00 24.18  ? 511 LEU B O   1 
ATOM   9490  C CB  . LEU B 1 485 ? 56.434  108.657 46.086  1.00 25.30  ? 511 LEU B CB  1 
ATOM   9491  C CG  . LEU B 1 485 ? 56.036  108.274 44.651  1.00 28.59  ? 511 LEU B CG  1 
ATOM   9492  C CD1 . LEU B 1 485 ? 56.455  106.843 44.293  1.00 23.21  ? 511 LEU B CD1 1 
ATOM   9493  C CD2 . LEU B 1 485 ? 54.528  108.476 44.505  1.00 25.02  ? 511 LEU B CD2 1 
ATOM   9494  N N   . PHE B 1 486 ? 58.524  108.937 48.791  1.00 26.45  ? 512 PHE B N   1 
ATOM   9495  C CA  . PHE B 1 486 ? 59.111  109.959 49.651  1.00 28.81  ? 512 PHE B CA  1 
ATOM   9496  C C   . PHE B 1 486 ? 60.456  109.691 50.335  1.00 30.48  ? 512 PHE B C   1 
ATOM   9497  O O   . PHE B 1 486 ? 60.607  109.896 51.541  1.00 28.85  ? 512 PHE B O   1 
ATOM   9498  C CB  . PHE B 1 486 ? 58.033  110.362 50.661  1.00 24.99  ? 512 PHE B CB  1 
ATOM   9499  C CG  . PHE B 1 486 ? 56.675  110.473 50.034  1.00 22.08  ? 512 PHE B CG  1 
ATOM   9500  C CD1 . PHE B 1 486 ? 55.801  109.385 50.037  1.00 19.94  ? 512 PHE B CD1 1 
ATOM   9501  C CD2 . PHE B 1 486 ? 56.323  111.614 49.314  1.00 17.98  ? 512 PHE B CD2 1 
ATOM   9502  C CE1 . PHE B 1 486 ? 54.601  109.427 49.324  1.00 16.84  ? 512 PHE B CE1 1 
ATOM   9503  C CE2 . PHE B 1 486 ? 55.131  111.665 48.601  1.00 18.79  ? 512 PHE B CE2 1 
ATOM   9504  C CZ  . PHE B 1 486 ? 54.268  110.562 48.605  1.00 18.87  ? 512 PHE B CZ  1 
ATOM   9505  N N   . GLY B 1 487 ? 61.440  109.278 49.541  1.00 33.76  ? 513 GLY B N   1 
ATOM   9506  C CA  . GLY B 1 487 ? 62.758  108.994 50.079  1.00 36.99  ? 513 GLY B CA  1 
ATOM   9507  C C   . GLY B 1 487 ? 62.667  107.920 51.141  1.00 40.01  ? 513 GLY B C   1 
ATOM   9508  O O   . GLY B 1 487 ? 61.953  106.922 50.980  1.00 43.17  ? 513 GLY B O   1 
ATOM   9509  N N   . GLY B 1 488 ? 63.384  108.108 52.236  1.00 38.73  ? 514 GLY B N   1 
ATOM   9510  C CA  . GLY B 1 488 ? 63.313  107.120 53.286  1.00 41.46  ? 514 GLY B CA  1 
ATOM   9511  C C   . GLY B 1 488 ? 62.159  107.433 54.215  1.00 41.85  ? 514 GLY B C   1 
ATOM   9512  O O   . GLY B 1 488 ? 61.796  106.622 55.065  1.00 46.07  ? 514 GLY B O   1 
ATOM   9513  N N   . LYS B 1 489 ? 61.581  108.619 54.054  1.00 40.37  ? 515 LYS B N   1 
ATOM   9514  C CA  . LYS B 1 489 ? 60.472  109.054 54.892  1.00 38.14  ? 515 LYS B CA  1 
ATOM   9515  C C   . LYS B 1 489 ? 59.209  108.255 54.618  1.00 35.20  ? 515 LYS B C   1 
ATOM   9516  O O   . LYS B 1 489 ? 58.947  107.854 53.490  1.00 33.46  ? 515 LYS B O   1 
ATOM   9517  C CB  . LYS B 1 489 ? 60.198  110.541 54.662  1.00 43.20  ? 515 LYS B CB  1 
ATOM   9518  C CG  . LYS B 1 489 ? 61.052  111.480 55.498  1.00 49.78  ? 515 LYS B CG  1 
ATOM   9519  C CD  . LYS B 1 489 ? 62.539  111.212 55.336  1.00 54.75  ? 515 LYS B CD  1 
ATOM   9520  C CE  . LYS B 1 489 ? 63.368  112.127 56.234  1.00 55.92  ? 515 LYS B CE  1 
ATOM   9521  N NZ  . LYS B 1 489 ? 64.822  111.818 56.139  1.00 58.55  ? 515 LYS B NZ  1 
ATOM   9522  N N   . PRO B 1 490 ? 58.405  108.015 55.655  1.00 33.55  ? 516 PRO B N   1 
ATOM   9523  C CA  . PRO B 1 490 ? 57.170  107.252 55.473  1.00 30.99  ? 516 PRO B CA  1 
ATOM   9524  C C   . PRO B 1 490 ? 56.066  108.166 54.983  1.00 27.80  ? 516 PRO B C   1 
ATOM   9525  O O   . PRO B 1 490 ? 56.116  109.370 55.206  1.00 25.63  ? 516 PRO B O   1 
ATOM   9526  C CB  . PRO B 1 490 ? 56.882  106.743 56.874  1.00 31.25  ? 516 PRO B CB  1 
ATOM   9527  C CG  . PRO B 1 490 ? 57.255  107.945 57.706  1.00 31.83  ? 516 PRO B CG  1 
ATOM   9528  C CD  . PRO B 1 490 ? 58.582  108.388 57.072  1.00 33.52  ? 516 PRO B CD  1 
ATOM   9529  N N   . MET B 1 491 ? 55.073  107.590 54.314  1.00 26.81  ? 517 MET B N   1 
ATOM   9530  C CA  . MET B 1 491 ? 53.944  108.370 53.846  1.00 25.94  ? 517 MET B CA  1 
ATOM   9531  C C   . MET B 1 491 ? 53.061  108.631 55.064  1.00 24.53  ? 517 MET B C   1 
ATOM   9532  O O   . MET B 1 491 ? 52.488  107.700 55.617  1.00 23.82  ? 517 MET B O   1 
ATOM   9533  C CB  . MET B 1 491 ? 53.145  107.594 52.797  1.00 26.69  ? 517 MET B CB  1 
ATOM   9534  C CG  . MET B 1 491 ? 51.928  108.360 52.307  1.00 27.58  ? 517 MET B CG  1 
ATOM   9535  S SD  . MET B 1 491 ? 50.928  107.450 51.133  1.00 27.80  ? 517 MET B SD  1 
ATOM   9536  C CE  . MET B 1 491 ? 52.134  107.133 49.939  1.00 35.63  ? 517 MET B CE  1 
ATOM   9537  N N   . ILE B 1 492 ? 52.961  109.887 55.491  1.00 23.52  ? 518 ILE B N   1 
ATOM   9538  C CA  . ILE B 1 492 ? 52.132  110.222 56.655  1.00 24.24  ? 518 ILE B CA  1 
ATOM   9539  C C   . ILE B 1 492 ? 50.705  110.543 56.229  1.00 23.33  ? 518 ILE B C   1 
ATOM   9540  O O   . ILE B 1 492 ? 50.486  111.422 55.396  1.00 23.84  ? 518 ILE B O   1 
ATOM   9541  C CB  . ILE B 1 492 ? 52.644  111.483 57.405  1.00 28.17  ? 518 ILE B CB  1 
ATOM   9542  C CG1 . ILE B 1 492 ? 54.121  111.346 57.783  1.00 26.58  ? 518 ILE B CG1 1 
ATOM   9543  C CG2 . ILE B 1 492 ? 51.784  111.721 58.634  1.00 20.86  ? 518 ILE B CG2 1 
ATOM   9544  C CD1 . ILE B 1 492 ? 54.361  110.423 58.943  1.00 32.69  ? 518 ILE B CD1 1 
ATOM   9545  N N   . VAL B 1 493 ? 49.730  109.853 56.798  1.00 22.65  ? 519 VAL B N   1 
ATOM   9546  C CA  . VAL B 1 493 ? 48.351  110.145 56.449  1.00 24.06  ? 519 VAL B CA  1 
ATOM   9547  C C   . VAL B 1 493 ? 47.493  110.399 57.682  1.00 23.91  ? 519 VAL B C   1 
ATOM   9548  O O   . VAL B 1 493 ? 47.258  109.500 58.483  1.00 23.21  ? 519 VAL B O   1 
ATOM   9549  C CB  . VAL B 1 493 ? 47.737  109.014 55.559  1.00 25.60  ? 519 VAL B CB  1 
ATOM   9550  C CG1 . VAL B 1 493 ? 48.357  107.683 55.897  1.00 31.02  ? 519 VAL B CG1 1 
ATOM   9551  C CG2 . VAL B 1 493 ? 46.229  108.948 55.746  1.00 26.91  ? 519 VAL B CG2 1 
ATOM   9552  N N   . TYR B 1 494 ? 47.055  111.648 57.838  1.00 27.21  ? 520 TYR B N   1 
ATOM   9553  C CA  . TYR B 1 494 ? 46.202  112.048 58.960  1.00 31.26  ? 520 TYR B CA  1 
ATOM   9554  C C   . TYR B 1 494 ? 44.749  111.884 58.524  1.00 34.44  ? 520 TYR B C   1 
ATOM   9555  O O   . TYR B 1 494 ? 44.392  112.281 57.416  1.00 35.91  ? 520 TYR B O   1 
ATOM   9556  C CB  . TYR B 1 494 ? 46.406  113.528 59.327  1.00 29.88  ? 520 TYR B CB  1 
ATOM   9557  C CG  . TYR B 1 494 ? 47.843  114.010 59.381  1.00 30.23  ? 520 TYR B CG  1 
ATOM   9558  C CD1 . TYR B 1 494 ? 48.378  114.769 58.342  1.00 28.59  ? 520 TYR B CD1 1 
ATOM   9559  C CD2 . TYR B 1 494 ? 48.671  113.702 60.465  1.00 29.57  ? 520 TYR B CD2 1 
ATOM   9560  C CE1 . TYR B 1 494 ? 49.696  115.207 58.374  1.00 28.16  ? 520 TYR B CE1 1 
ATOM   9561  C CE2 . TYR B 1 494 ? 49.996  114.136 60.508  1.00 27.42  ? 520 TYR B CE2 1 
ATOM   9562  C CZ  . TYR B 1 494 ? 50.499  114.888 59.457  1.00 29.62  ? 520 TYR B CZ  1 
ATOM   9563  O OH  . TYR B 1 494 ? 51.805  115.325 59.475  1.00 32.33  ? 520 TYR B OH  1 
ATOM   9564  N N   . LYS B 1 495 ? 43.903  111.301 59.371  1.00 37.61  ? 521 LYS B N   1 
ATOM   9565  C CA  . LYS B 1 495 ? 42.505  111.173 58.988  1.00 41.51  ? 521 LYS B CA  1 
ATOM   9566  C C   . LYS B 1 495 ? 41.946  112.580 59.133  1.00 42.40  ? 521 LYS B C   1 
ATOM   9567  O O   . LYS B 1 495 ? 40.783  112.854 58.847  1.00 42.91  ? 521 LYS B O   1 
ATOM   9568  C CB  . LYS B 1 495 ? 41.769  110.200 59.910  1.00 43.97  ? 521 LYS B CB  1 
ATOM   9569  C CG  . LYS B 1 495 ? 41.614  110.656 61.335  1.00 47.91  ? 521 LYS B CG  1 
ATOM   9570  C CD  . LYS B 1 495 ? 40.800  109.636 62.128  1.00 52.82  ? 521 LYS B CD  1 
ATOM   9571  C CE  . LYS B 1 495 ? 40.583  110.088 63.568  1.00 55.03  ? 521 LYS B CE  1 
ATOM   9572  N NZ  . LYS B 1 495 ? 39.816  111.372 63.631  1.00 57.79  ? 521 LYS B NZ  1 
ATOM   9573  N N   . GLY B 1 496 ? 42.836  113.467 59.560  1.00 44.35  ? 522 GLY B N   1 
ATOM   9574  C CA  . GLY B 1 496 ? 42.526  114.865 59.793  1.00 43.09  ? 522 GLY B CA  1 
ATOM   9575  C C   . GLY B 1 496 ? 41.670  115.665 58.833  1.00 38.84  ? 522 GLY B C   1 
ATOM   9576  O O   . GLY B 1 496 ? 40.697  115.177 58.266  1.00 37.34  ? 522 GLY B O   1 
ATOM   9577  N N   . GLY B 1 497 ? 42.046  116.928 58.681  1.00 36.72  ? 523 GLY B N   1 
ATOM   9578  C CA  . GLY B 1 497 ? 41.308  117.830 57.834  1.00 34.96  ? 523 GLY B CA  1 
ATOM   9579  C C   . GLY B 1 497 ? 41.968  118.142 56.516  1.00 34.93  ? 523 GLY B C   1 
ATOM   9580  O O   . GLY B 1 497 ? 42.170  117.258 55.693  1.00 38.62  ? 523 GLY B O   1 
ATOM   9581  N N   . THR B 1 498 ? 42.307  119.404 56.306  1.00 34.43  ? 524 THR B N   1 
ATOM   9582  C CA  . THR B 1 498 ? 42.905  119.798 55.047  1.00 33.10  ? 524 THR B CA  1 
ATOM   9583  C C   . THR B 1 498 ? 44.208  120.547 55.213  1.00 34.14  ? 524 THR B C   1 
ATOM   9584  O O   . THR B 1 498 ? 44.484  121.111 56.262  1.00 33.94  ? 524 THR B O   1 
ATOM   9585  C CB  . THR B 1 498 ? 41.923  120.665 54.235  1.00 30.36  ? 524 THR B CB  1 
ATOM   9586  O OG1 . THR B 1 498 ? 42.537  121.067 53.004  1.00 30.84  ? 524 THR B OG1 1 
ATOM   9587  C CG2 . THR B 1 498 ? 41.519  121.893 55.028  1.00 31.33  ? 524 THR B CG2 1 
ATOM   9588  N N   . SER B 1 499 ? 45.009  120.533 54.155  1.00 37.12  ? 525 SER B N   1 
ATOM   9589  C CA  . SER B 1 499 ? 46.291  121.210 54.135  1.00 40.00  ? 525 SER B CA  1 
ATOM   9590  C C   . SER B 1 499 ? 46.180  122.498 53.326  1.00 43.96  ? 525 SER B C   1 
ATOM   9591  O O   . SER B 1 499 ? 47.170  123.207 53.146  1.00 44.95  ? 525 SER B O   1 
ATOM   9592  C CB  . SER B 1 499 ? 47.357  120.299 53.513  1.00 39.88  ? 525 SER B CB  1 
ATOM   9593  O OG  . SER B 1 499 ? 47.020  119.929 52.183  1.00 39.96  ? 525 SER B OG  1 
ATOM   9594  N N   . ARG B 1 500 ? 44.978  122.802 52.836  1.00 47.80  ? 526 ARG B N   1 
ATOM   9595  C CA  . ARG B 1 500 ? 44.774  124.015 52.040  1.00 53.80  ? 526 ARG B CA  1 
ATOM   9596  C C   . ARG B 1 500 ? 44.914  125.239 52.941  1.00 60.79  ? 526 ARG B C   1 
ATOM   9597  O O   . ARG B 1 500 ? 45.552  125.162 53.990  1.00 63.63  ? 526 ARG B O   1 
ATOM   9598  C CB  . ARG B 1 500 ? 43.394  123.993 51.375  1.00 48.07  ? 526 ARG B CB  1 
ATOM   9599  C CG  . ARG B 1 500 ? 42.219  124.098 52.332  1.00 44.71  ? 526 ARG B CG  1 
ATOM   9600  C CD  . ARG B 1 500 ? 40.916  123.747 51.629  1.00 41.81  ? 526 ARG B CD  1 
ATOM   9601  N NE  . ARG B 1 500 ? 40.846  122.318 51.318  1.00 40.47  ? 526 ARG B NE  1 
ATOM   9602  C CZ  . ARG B 1 500 ? 39.965  121.758 50.493  1.00 37.15  ? 526 ARG B CZ  1 
ATOM   9603  N NH1 . ARG B 1 500 ? 39.053  122.496 49.871  1.00 34.73  ? 526 ARG B NH1 1 
ATOM   9604  N NH2 . ARG B 1 500 ? 40.000  120.449 50.291  1.00 35.41  ? 526 ARG B NH2 1 
ATOM   9605  N N   . GLU B 1 501 ? 44.337  126.368 52.541  1.00 68.49  ? 527 GLU B N   1 
ATOM   9606  C CA  . GLU B 1 501 ? 44.427  127.571 53.363  1.00 75.02  ? 527 GLU B CA  1 
ATOM   9607  C C   . GLU B 1 501 ? 43.598  127.407 54.636  1.00 78.60  ? 527 GLU B C   1 
ATOM   9608  O O   . GLU B 1 501 ? 43.797  126.450 55.388  1.00 80.05  ? 527 GLU B O   1 
ATOM   9609  C CB  . GLU B 1 501 ? 43.953  128.798 52.581  1.00 77.72  ? 527 GLU B CB  1 
ATOM   9610  C CG  . GLU B 1 501 ? 44.880  129.217 51.447  1.00 82.23  ? 527 GLU B CG  1 
ATOM   9611  C CD  . GLU B 1 501 ? 46.324  129.388 51.896  1.00 84.49  ? 527 GLU B CD  1 
ATOM   9612  O OE1 . GLU B 1 501 ? 46.555  129.558 53.114  1.00 86.33  ? 527 GLU B OE1 1 
ATOM   9613  O OE2 . GLU B 1 501 ? 47.227  129.362 51.029  1.00 84.05  ? 527 GLU B OE2 1 
ATOM   9614  N N   . GLY B 1 502 ? 42.675  128.332 54.881  1.00 80.71  ? 528 GLY B N   1 
ATOM   9615  C CA  . GLY B 1 502 ? 41.849  128.239 56.071  1.00 83.94  ? 528 GLY B CA  1 
ATOM   9616  C C   . GLY B 1 502 ? 41.407  126.808 56.309  1.00 86.40  ? 528 GLY B C   1 
ATOM   9617  O O   . GLY B 1 502 ? 40.554  126.296 55.585  1.00 86.84  ? 528 GLY B O   1 
ATOM   9618  N N   . GLY B 1 503 ? 41.988  126.155 57.313  1.00 88.39  ? 529 GLY B N   1 
ATOM   9619  C CA  . GLY B 1 503 ? 41.621  124.777 57.590  1.00 91.38  ? 529 GLY B CA  1 
ATOM   9620  C C   . GLY B 1 503 ? 42.049  124.208 58.932  1.00 93.83  ? 529 GLY B C   1 
ATOM   9621  O O   . GLY B 1 503 ? 42.405  123.030 59.021  1.00 93.21  ? 529 GLY B O   1 
ATOM   9622  N N   . GLN B 1 504 ? 42.024  125.032 59.976  1.00 96.60  ? 530 GLN B N   1 
ATOM   9623  C CA  . GLN B 1 504 ? 42.393  124.563 61.311  1.00 99.09  ? 530 GLN B CA  1 
ATOM   9624  C C   . GLN B 1 504 ? 41.345  123.530 61.732  1.00 100.09 ? 530 GLN B C   1 
ATOM   9625  O O   . GLN B 1 504 ? 40.247  123.893 62.162  1.00 100.41 ? 530 GLN B O   1 
ATOM   9626  C CB  . GLN B 1 504 ? 42.411  125.733 62.309  1.00 99.49  ? 530 GLN B CB  1 
ATOM   9627  C CG  . GLN B 1 504 ? 43.560  126.727 62.113  1.00 100.41 ? 530 GLN B CG  1 
ATOM   9628  C CD  . GLN B 1 504 ? 43.491  127.923 63.064  1.00 100.41 ? 530 GLN B CD  1 
ATOM   9629  O OE1 . GLN B 1 504 ? 43.463  127.765 64.288  1.00 100.41 ? 530 GLN B OE1 1 
ATOM   9630  N NE2 . GLN B 1 504 ? 43.470  129.126 62.499  1.00 100.41 ? 530 GLN B NE2 1 
ATOM   9631  N N   . THR B 1 505 ? 41.681  122.247 61.602  1.00 100.29 ? 531 THR B N   1 
ATOM   9632  C CA  . THR B 1 505 ? 40.748  121.177 61.951  1.00 100.16 ? 531 THR B CA  1 
ATOM   9633  C C   . THR B 1 505 ? 41.443  119.853 62.276  1.00 99.71  ? 531 THR B C   1 
ATOM   9634  O O   . THR B 1 505 ? 42.514  119.552 61.744  1.00 99.88  ? 531 THR B O   1 
ATOM   9635  C CB  . THR B 1 505 ? 39.740  120.926 60.792  1.00 100.41 ? 531 THR B CB  1 
ATOM   9636  O OG1 . THR B 1 505 ? 38.966  122.110 60.566  1.00 100.41 ? 531 THR B OG1 1 
ATOM   9637  C CG2 . THR B 1 505 ? 38.804  119.764 61.119  1.00 99.83  ? 531 THR B CG2 1 
ATOM   9638  N N   . ALA B 1 506 ? 40.819  119.080 63.165  1.00 98.48  ? 532 ALA B N   1 
ATOM   9639  C CA  . ALA B 1 506 ? 41.310  117.766 63.583  1.00 96.62  ? 532 ALA B CA  1 
ATOM   9640  C C   . ALA B 1 506 ? 42.463  117.708 64.598  1.00 94.68  ? 532 ALA B C   1 
ATOM   9641  O O   . ALA B 1 506 ? 43.048  116.643 64.807  1.00 94.66  ? 532 ALA B O   1 
ATOM   9642  C CB  . ALA B 1 506 ? 41.669  116.934 62.344  1.00 96.66  ? 532 ALA B CB  1 
ATOM   9643  N N   . PRO B 1 507 ? 42.808  118.836 65.245  1.00 92.24  ? 533 PRO B N   1 
ATOM   9644  C CA  . PRO B 1 507 ? 43.911  118.714 66.202  1.00 89.09  ? 533 PRO B CA  1 
ATOM   9645  C C   . PRO B 1 507 ? 43.449  118.049 67.500  1.00 85.53  ? 533 PRO B C   1 
ATOM   9646  O O   . PRO B 1 507 ? 43.271  118.715 68.521  1.00 86.00  ? 533 PRO B O   1 
ATOM   9647  C CB  . PRO B 1 507 ? 44.342  120.162 66.406  1.00 90.38  ? 533 PRO B CB  1 
ATOM   9648  C CG  . PRO B 1 507 ? 43.042  120.893 66.327  1.00 91.06  ? 533 PRO B CG  1 
ATOM   9649  C CD  . PRO B 1 507 ? 42.363  120.239 65.137  1.00 91.90  ? 533 PRO B CD  1 
ATOM   9650  N N   . ALA B 1 508 ? 43.252  116.735 67.453  1.00 80.69  ? 534 ALA B N   1 
ATOM   9651  C CA  . ALA B 1 508 ? 42.806  115.983 68.621  1.00 76.04  ? 534 ALA B CA  1 
ATOM   9652  C C   . ALA B 1 508 ? 43.885  115.891 69.703  1.00 73.28  ? 534 ALA B C   1 
ATOM   9653  O O   . ALA B 1 508 ? 45.083  115.872 69.412  1.00 71.36  ? 534 ALA B O   1 
ATOM   9654  C CB  . ALA B 1 508 ? 42.366  114.592 68.199  1.00 76.21  ? 534 ALA B CB  1 
ATOM   9655  N N   . SER B 1 509 ? 43.444  115.827 70.956  1.00 69.50  ? 535 SER B N   1 
ATOM   9656  C CA  . SER B 1 509 ? 44.349  115.751 72.097  1.00 65.73  ? 535 SER B CA  1 
ATOM   9657  C C   . SER B 1 509 ? 45.136  114.450 72.138  1.00 61.86  ? 535 SER B C   1 
ATOM   9658  O O   . SER B 1 509 ? 46.288  114.430 72.571  1.00 61.77  ? 535 SER B O   1 
ATOM   9659  C CB  . SER B 1 509 ? 43.567  115.901 73.404  1.00 66.59  ? 535 SER B CB  1 
ATOM   9660  O OG  . SER B 1 509 ? 42.681  114.810 73.599  1.00 70.36  ? 535 SER B OG  1 
ATOM   9661  N N   . THR B 1 510 ? 44.508  113.362 71.706  1.00 56.94  ? 536 THR B N   1 
ATOM   9662  C CA  . THR B 1 510 ? 45.164  112.058 71.692  1.00 52.90  ? 536 THR B CA  1 
ATOM   9663  C C   . THR B 1 510 ? 45.070  111.471 70.291  1.00 48.32  ? 536 THR B C   1 
ATOM   9664  O O   . THR B 1 510 ? 44.002  111.461 69.684  1.00 46.02  ? 536 THR B O   1 
ATOM   9665  C CB  . THR B 1 510 ? 44.513  111.088 72.699  1.00 53.44  ? 536 THR B CB  1 
ATOM   9666  O OG1 . THR B 1 510 ? 44.548  111.668 74.008  1.00 58.13  ? 536 THR B OG1 1 
ATOM   9667  C CG2 . THR B 1 510 ? 45.264  109.770 72.730  1.00 53.14  ? 536 THR B CG2 1 
ATOM   9668  N N   . ARG B 1 511 ? 46.192  110.982 69.778  1.00 44.28  ? 537 ARG B N   1 
ATOM   9669  C CA  . ARG B 1 511 ? 46.206  110.427 68.432  1.00 40.71  ? 537 ARG B CA  1 
ATOM   9670  C C   . ARG B 1 511 ? 47.009  109.141 68.329  1.00 37.60  ? 537 ARG B C   1 
ATOM   9671  O O   . ARG B 1 511 ? 48.092  109.021 68.905  1.00 36.40  ? 537 ARG B O   1 
ATOM   9672  C CB  . ARG B 1 511 ? 46.787  111.458 67.462  1.00 39.71  ? 537 ARG B CB  1 
ATOM   9673  C CG  . ARG B 1 511 ? 46.241  112.856 67.656  1.00 38.39  ? 537 ARG B CG  1 
ATOM   9674  C CD  . ARG B 1 511 ? 47.014  113.853 66.831  1.00 40.37  ? 537 ARG B CD  1 
ATOM   9675  N NE  . ARG B 1 511 ? 46.710  113.725 65.413  1.00 43.02  ? 537 ARG B NE  1 
ATOM   9676  C CZ  . ARG B 1 511 ? 47.338  114.395 64.453  1.00 42.19  ? 537 ARG B CZ  1 
ATOM   9677  N NH1 . ARG B 1 511 ? 48.308  115.241 64.766  1.00 41.34  ? 537 ARG B NH1 1 
ATOM   9678  N NH2 . ARG B 1 511 ? 46.986  114.225 63.185  1.00 40.88  ? 537 ARG B NH2 1 
ATOM   9679  N N   . LEU B 1 512 ? 46.474  108.176 67.590  1.00 34.74  ? 538 LEU B N   1 
ATOM   9680  C CA  . LEU B 1 512 ? 47.175  106.915 67.399  1.00 32.66  ? 538 LEU B CA  1 
ATOM   9681  C C   . LEU B 1 512 ? 47.587  106.771 65.934  1.00 32.21  ? 538 LEU B C   1 
ATOM   9682  O O   . LEU B 1 512 ? 46.812  107.059 65.023  1.00 30.51  ? 538 LEU B O   1 
ATOM   9683  C CB  . LEU B 1 512 ? 46.298  105.735 67.822  1.00 29.59  ? 538 LEU B CB  1 
ATOM   9684  C CG  . LEU B 1 512 ? 46.985  104.363 67.779  1.00 29.12  ? 538 LEU B CG  1 
ATOM   9685  C CD1 . LEU B 1 512 ? 48.282  104.403 68.577  1.00 25.99  ? 538 LEU B CD1 1 
ATOM   9686  C CD2 . LEU B 1 512 ? 46.041  103.297 68.328  1.00 27.24  ? 538 LEU B CD2 1 
ATOM   9687  N N   . PHE B 1 513 ? 48.822  106.334 65.718  1.00 32.90  ? 539 PHE B N   1 
ATOM   9688  C CA  . PHE B 1 513 ? 49.344  106.153 64.373  1.00 32.73  ? 539 PHE B CA  1 
ATOM   9689  C C   . PHE B 1 513 ? 49.894  104.755 64.159  1.00 34.13  ? 539 PHE B C   1 
ATOM   9690  O O   . PHE B 1 513 ? 50.853  104.348 64.822  1.00 34.80  ? 539 PHE B O   1 
ATOM   9691  C CB  . PHE B 1 513 ? 50.463  107.153 64.102  1.00 32.72  ? 539 PHE B CB  1 
ATOM   9692  C CG  . PHE B 1 513 ? 49.990  108.556 63.887  1.00 33.05  ? 539 PHE B CG  1 
ATOM   9693  C CD1 . PHE B 1 513 ? 49.618  108.988 62.624  1.00 31.18  ? 539 PHE B CD1 1 
ATOM   9694  C CD2 . PHE B 1 513 ? 49.951  109.458 64.943  1.00 32.82  ? 539 PHE B CD2 1 
ATOM   9695  C CE1 . PHE B 1 513 ? 49.221  110.300 62.412  1.00 33.46  ? 539 PHE B CE1 1 
ATOM   9696  C CE2 . PHE B 1 513 ? 49.552  110.773 64.740  1.00 33.72  ? 539 PHE B CE2 1 
ATOM   9697  C CZ  . PHE B 1 513 ? 49.188  111.196 63.472  1.00 33.38  ? 539 PHE B CZ  1 
ATOM   9698  N N   . GLN B 1 514 ? 49.292  104.021 63.230  1.00 34.60  ? 540 GLN B N   1 
ATOM   9699  C CA  . GLN B 1 514 ? 49.767  102.685 62.907  1.00 34.36  ? 540 GLN B CA  1 
ATOM   9700  C C   . GLN B 1 514 ? 50.815  102.830 61.804  1.00 34.97  ? 540 GLN B C   1 
ATOM   9701  O O   . GLN B 1 514 ? 50.542  103.386 60.742  1.00 34.91  ? 540 GLN B O   1 
ATOM   9702  C CB  . GLN B 1 514 ? 48.608  101.809 62.438  1.00 34.61  ? 540 GLN B CB  1 
ATOM   9703  C CG  . GLN B 1 514 ? 49.038  100.522 61.758  1.00 36.96  ? 540 GLN B CG  1 
ATOM   9704  C CD  . GLN B 1 514 ? 47.928  99.487  61.714  1.00 38.54  ? 540 GLN B CD  1 
ATOM   9705  O OE1 . GLN B 1 514 ? 46.749  99.829  61.630  1.00 37.49  ? 540 GLN B OE1 1 
ATOM   9706  N NE2 . GLN B 1 514 ? 48.304  98.211  61.759  1.00 37.64  ? 540 GLN B NE2 1 
ATOM   9707  N N   . VAL B 1 515 ? 52.023  102.348 62.073  1.00 36.13  ? 541 VAL B N   1 
ATOM   9708  C CA  . VAL B 1 515 ? 53.118  102.430 61.119  1.00 36.14  ? 541 VAL B CA  1 
ATOM   9709  C C   . VAL B 1 515 ? 53.385  101.067 60.488  1.00 38.87  ? 541 VAL B C   1 
ATOM   9710  O O   . VAL B 1 515 ? 54.005  100.198 61.099  1.00 39.65  ? 541 VAL B O   1 
ATOM   9711  C CB  . VAL B 1 515 ? 54.394  102.947 61.812  1.00 33.65  ? 541 VAL B CB  1 
ATOM   9712  C CG1 . VAL B 1 515 ? 55.515  103.114 60.802  1.00 32.46  ? 541 VAL B CG1 1 
ATOM   9713  C CG2 . VAL B 1 515 ? 54.099  104.271 62.488  1.00 32.16  ? 541 VAL B CG2 1 
ATOM   9714  N N   . ARG B 1 516 ? 52.912  100.899 59.255  1.00 41.47  ? 542 ARG B N   1 
ATOM   9715  C CA  . ARG B 1 516 ? 53.056  99.647  58.512  1.00 42.98  ? 542 ARG B CA  1 
ATOM   9716  C C   . ARG B 1 516 ? 54.230  99.705  57.536  1.00 41.61  ? 542 ARG B C   1 
ATOM   9717  O O   . ARG B 1 516 ? 54.662  100.784 57.137  1.00 43.95  ? 542 ARG B O   1 
ATOM   9718  C CB  . ARG B 1 516 ? 51.771  99.361  57.732  1.00 44.16  ? 542 ARG B CB  1 
ATOM   9719  C CG  . ARG B 1 516 ? 51.114  98.033  58.042  1.00 49.89  ? 542 ARG B CG  1 
ATOM   9720  C CD  . ARG B 1 516 ? 50.014  97.725  57.026  1.00 57.03  ? 542 ARG B CD  1 
ATOM   9721  N NE  . ARG B 1 516 ? 49.418  96.399  57.210  1.00 62.53  ? 542 ARG B NE  1 
ATOM   9722  C CZ  . ARG B 1 516 ? 48.742  95.738  56.271  1.00 63.98  ? 542 ARG B CZ  1 
ATOM   9723  N NH1 . ARG B 1 516 ? 48.569  96.269  55.067  1.00 64.74  ? 542 ARG B NH1 1 
ATOM   9724  N NH2 . ARG B 1 516 ? 48.232  94.543  56.537  1.00 65.79  ? 542 ARG B NH2 1 
ATOM   9725  N N   . ALA B 1 517 ? 54.745  98.541  57.159  1.00 39.14  ? 543 ALA B N   1 
ATOM   9726  C CA  . ALA B 1 517 ? 55.858  98.457  56.216  1.00 37.99  ? 543 ALA B CA  1 
ATOM   9727  C C   . ALA B 1 517 ? 55.486  97.462  55.121  1.00 38.84  ? 543 ALA B C   1 
ATOM   9728  O O   . ALA B 1 517 ? 54.738  96.517  55.363  1.00 41.23  ? 543 ALA B O   1 
ATOM   9729  C CB  . ALA B 1 517 ? 57.112  98.005  56.925  1.00 32.86  ? 543 ALA B CB  1 
ATOM   9730  N N   . SER B 1 518 ? 55.988  97.677  53.913  1.00 38.55  ? 544 SER B N   1 
ATOM   9731  C CA  . SER B 1 518 ? 55.678  96.772  52.814  1.00 38.64  ? 544 SER B CA  1 
ATOM   9732  C C   . SER B 1 518 ? 56.865  95.866  52.497  1.00 40.59  ? 544 SER B C   1 
ATOM   9733  O O   . SER B 1 518 ? 57.993  96.147  52.900  1.00 39.02  ? 544 SER B O   1 
ATOM   9734  C CB  . SER B 1 518 ? 55.284  97.568  51.571  1.00 36.02  ? 544 SER B CB  1 
ATOM   9735  O OG  . SER B 1 518 ? 56.318  98.454  51.198  1.00 32.97  ? 544 SER B OG  1 
ATOM   9736  N N   . SER B 1 519 ? 56.599  94.780  51.773  1.00 43.18  ? 545 SER B N   1 
ATOM   9737  C CA  . SER B 1 519 ? 57.642  93.831  51.406  1.00 45.93  ? 545 SER B CA  1 
ATOM   9738  C C   . SER B 1 519 ? 58.824  94.545  50.767  1.00 47.01  ? 545 SER B C   1 
ATOM   9739  O O   . SER B 1 519 ? 59.965  94.096  50.880  1.00 47.89  ? 545 SER B O   1 
ATOM   9740  C CB  . SER B 1 519 ? 57.088  92.769  50.444  1.00 46.48  ? 545 SER B CB  1 
ATOM   9741  O OG  . SER B 1 519 ? 56.641  93.343  49.229  1.00 49.90  ? 545 SER B OG  1 
ATOM   9742  N N   . SER B 1 520 ? 58.548  95.667  50.111  1.00 47.74  ? 546 SER B N   1 
ATOM   9743  C CA  . SER B 1 520 ? 59.592  96.440  49.455  1.00 48.80  ? 546 SER B CA  1 
ATOM   9744  C C   . SER B 1 520 ? 60.390  97.312  50.424  1.00 48.00  ? 546 SER B C   1 
ATOM   9745  O O   . SER B 1 520 ? 61.421  97.867  50.052  1.00 49.69  ? 546 SER B O   1 
ATOM   9746  C CB  . SER B 1 520 ? 58.983  97.315  48.355  1.00 51.28  ? 546 SER B CB  1 
ATOM   9747  O OG  . SER B 1 520 ? 57.963  98.154  48.870  1.00 53.78  ? 546 SER B OG  1 
ATOM   9748  N N   . GLY B 1 521 ? 59.918  97.435  51.662  1.00 45.92  ? 547 GLY B N   1 
ATOM   9749  C CA  . GLY B 1 521 ? 60.628  98.245  52.636  1.00 43.02  ? 547 GLY B CA  1 
ATOM   9750  C C   . GLY B 1 521 ? 60.003  99.605  52.904  1.00 42.42  ? 547 GLY B C   1 
ATOM   9751  O O   . GLY B 1 521 ? 60.302  100.244 53.913  1.00 40.88  ? 547 GLY B O   1 
ATOM   9752  N N   . ALA B 1 522 ? 59.139  100.059 52.002  1.00 41.91  ? 548 ALA B N   1 
ATOM   9753  C CA  . ALA B 1 522 ? 58.478  101.349 52.174  1.00 38.38  ? 548 ALA B CA  1 
ATOM   9754  C C   . ALA B 1 522 ? 57.555  101.251 53.375  1.00 35.71  ? 548 ALA B C   1 
ATOM   9755  O O   . ALA B 1 522 ? 57.225  100.153 53.824  1.00 32.97  ? 548 ALA B O   1 
ATOM   9756  C CB  . ALA B 1 522 ? 57.678  101.700 50.935  1.00 39.41  ? 548 ALA B CB  1 
ATOM   9757  N N   . THR B 1 523 ? 57.134  102.398 53.893  1.00 33.39  ? 549 THR B N   1 
ATOM   9758  C CA  . THR B 1 523 ? 56.249  102.409 55.047  1.00 31.76  ? 549 THR B CA  1 
ATOM   9759  C C   . THR B 1 523 ? 55.298  103.585 55.008  1.00 29.60  ? 549 THR B C   1 
ATOM   9760  O O   . THR B 1 523 ? 55.537  104.562 54.308  1.00 27.70  ? 549 THR B O   1 
ATOM   9761  C CB  . THR B 1 523 ? 57.047  102.521 56.354  1.00 32.73  ? 549 THR B CB  1 
ATOM   9762  O OG1 . THR B 1 523 ? 57.843  103.710 56.310  1.00 35.40  ? 549 THR B OG1 1 
ATOM   9763  C CG2 . THR B 1 523 ? 57.960  101.328 56.536  1.00 34.96  ? 549 THR B CG2 1 
ATOM   9764  N N   . ARG B 1 524 ? 54.218  103.476 55.771  1.00 28.95  ? 550 ARG B N   1 
ATOM   9765  C CA  . ARG B 1 524 ? 53.244  104.544 55.882  1.00 28.90  ? 550 ARG B CA  1 
ATOM   9766  C C   . ARG B 1 524 ? 52.707  104.581 57.315  1.00 29.03  ? 550 ARG B C   1 
ATOM   9767  O O   . ARG B 1 524 ? 52.541  103.540 57.953  1.00 27.68  ? 550 ARG B O   1 
ATOM   9768  C CB  . ARG B 1 524 ? 52.090  104.337 54.902  1.00 29.93  ? 550 ARG B CB  1 
ATOM   9769  C CG  . ARG B 1 524 ? 51.241  103.125 55.195  1.00 36.66  ? 550 ARG B CG  1 
ATOM   9770  C CD  . ARG B 1 524 ? 50.122  102.972 54.179  1.00 38.97  ? 550 ARG B CD  1 
ATOM   9771  N NE  . ARG B 1 524 ? 49.818  101.565 53.931  1.00 39.66  ? 550 ARG B NE  1 
ATOM   9772  C CZ  . ARG B 1 524 ? 48.748  100.935 54.394  1.00 38.79  ? 550 ARG B CZ  1 
ATOM   9773  N NH1 . ARG B 1 524 ? 47.863  101.587 55.135  1.00 37.92  ? 550 ARG B NH1 1 
ATOM   9774  N NH2 . ARG B 1 524 ? 48.577  99.647  54.129  1.00 38.33  ? 550 ARG B NH2 1 
ATOM   9775  N N   . ALA B 1 525 ? 52.469  105.788 57.818  1.00 27.57  ? 551 ALA B N   1 
ATOM   9776  C CA  . ALA B 1 525 ? 51.919  105.986 59.151  1.00 27.88  ? 551 ALA B CA  1 
ATOM   9777  C C   . ALA B 1 525 ? 50.499  106.465 58.926  1.00 28.16  ? 551 ALA B C   1 
ATOM   9778  O O   . ALA B 1 525 ? 50.285  107.539 58.372  1.00 28.90  ? 551 ALA B O   1 
ATOM   9779  C CB  . ALA B 1 525 ? 52.707  107.048 59.903  1.00 27.66  ? 551 ALA B CB  1 
ATOM   9780  N N   . VAL B 1 526 ? 49.529  105.668 59.351  1.00 29.88  ? 552 VAL B N   1 
ATOM   9781  C CA  . VAL B 1 526 ? 48.130  106.021 59.167  1.00 31.80  ? 552 VAL B CA  1 
ATOM   9782  C C   . VAL B 1 526 ? 47.460  106.317 60.496  1.00 32.73  ? 552 VAL B C   1 
ATOM   9783  O O   . VAL B 1 526 ? 47.503  105.502 61.415  1.00 31.85  ? 552 VAL B O   1 
ATOM   9784  C CB  . VAL B 1 526 ? 47.347  104.877 58.480  1.00 33.37  ? 552 VAL B CB  1 
ATOM   9785  C CG1 . VAL B 1 526 ? 45.918  105.312 58.213  1.00 30.85  ? 552 VAL B CG1 1 
ATOM   9786  C CG2 . VAL B 1 526 ? 48.034  104.482 57.181  1.00 36.33  ? 552 VAL B CG2 1 
ATOM   9787  N N   . GLU B 1 527 ? 46.838  107.486 60.592  1.00 33.14  ? 553 GLU B N   1 
ATOM   9788  C CA  . GLU B 1 527 ? 46.152  107.861 61.811  1.00 35.25  ? 553 GLU B CA  1 
ATOM   9789  C C   . GLU B 1 527 ? 44.884  107.036 61.951  1.00 36.94  ? 553 GLU B C   1 
ATOM   9790  O O   . GLU B 1 527 ? 44.045  107.010 61.058  1.00 36.77  ? 553 GLU B O   1 
ATOM   9791  C CB  . GLU B 1 527 ? 45.812  109.350 61.810  1.00 34.46  ? 553 GLU B CB  1 
ATOM   9792  C CG  . GLU B 1 527 ? 45.204  109.818 63.118  1.00 34.35  ? 553 GLU B CG  1 
ATOM   9793  C CD  . GLU B 1 527 ? 45.196  111.327 63.263  1.00 36.09  ? 553 GLU B CD  1 
ATOM   9794  O OE1 . GLU B 1 527 ? 44.669  111.816 64.286  1.00 35.22  ? 553 GLU B OE1 1 
ATOM   9795  O OE2 . GLU B 1 527 ? 45.719  112.027 62.364  1.00 36.61  ? 553 GLU B OE2 1 
ATOM   9796  N N   . ILE B 1 528 ? 44.772  106.354 63.082  1.00 40.64  ? 554 ILE B N   1 
ATOM   9797  C CA  . ILE B 1 528 ? 43.632  105.503 63.396  1.00 43.17  ? 554 ILE B CA  1 
ATOM   9798  C C   . ILE B 1 528 ? 42.987  106.030 64.677  1.00 45.27  ? 554 ILE B C   1 
ATOM   9799  O O   . ILE B 1 528 ? 43.607  106.805 65.408  1.00 45.91  ? 554 ILE B O   1 
ATOM   9800  C CB  . ILE B 1 528 ? 44.105  104.054 63.632  1.00 42.84  ? 554 ILE B CB  1 
ATOM   9801  C CG1 . ILE B 1 528 ? 44.840  103.554 62.396  1.00 45.03  ? 554 ILE B CG1 1 
ATOM   9802  C CG2 . ILE B 1 528 ? 42.926  103.145 63.915  1.00 48.28  ? 554 ILE B CG2 1 
ATOM   9803  C CD1 . ILE B 1 528 ? 44.001  103.604 61.135  1.00 45.30  ? 554 ILE B CD1 1 
ATOM   9804  N N   . ILE B 1 529 ? 41.746  105.632 64.946  1.00 47.20  ? 555 ILE B N   1 
ATOM   9805  C CA  . ILE B 1 529 ? 41.075  106.063 66.169  1.00 50.28  ? 555 ILE B CA  1 
ATOM   9806  C C   . ILE B 1 529 ? 41.766  105.363 67.350  1.00 49.72  ? 555 ILE B C   1 
ATOM   9807  O O   . ILE B 1 529 ? 41.975  104.152 67.329  1.00 47.87  ? 555 ILE B O   1 
ATOM   9808  C CB  . ILE B 1 529 ? 39.574  105.714 66.138  1.00 52.50  ? 555 ILE B CB  1 
ATOM   9809  C CG1 . ILE B 1 529 ? 38.934  106.082 67.481  1.00 54.14  ? 555 ILE B CG1 1 
ATOM   9810  C CG2 . ILE B 1 529 ? 39.386  104.238 65.802  1.00 53.44  ? 555 ILE B CG2 1 
ATOM   9811  C CD1 . ILE B 1 529 ? 37.434  105.838 67.541  1.00 57.48  ? 555 ILE B CD1 1 
ATOM   9812  N N   . PRO B 1 530 ? 42.133  106.125 68.396  1.00 51.01  ? 556 PRO B N   1 
ATOM   9813  C CA  . PRO B 1 530 ? 42.815  105.606 69.589  1.00 53.03  ? 556 PRO B CA  1 
ATOM   9814  C C   . PRO B 1 530 ? 42.101  104.584 70.479  1.00 54.65  ? 556 PRO B C   1 
ATOM   9815  O O   . PRO B 1 530 ? 41.451  104.940 71.462  1.00 56.47  ? 556 PRO B O   1 
ATOM   9816  C CB  . PRO B 1 530 ? 43.190  106.880 70.346  1.00 52.02  ? 556 PRO B CB  1 
ATOM   9817  C CG  . PRO B 1 530 ? 42.085  107.814 69.989  1.00 51.09  ? 556 PRO B CG  1 
ATOM   9818  C CD  . PRO B 1 530 ? 41.918  107.579 68.509  1.00 49.84  ? 556 PRO B CD  1 
ATOM   9819  N N   . LYS B 1 531 ? 42.247  103.310 70.133  1.00 56.23  ? 557 LYS B N   1 
ATOM   9820  C CA  . LYS B 1 531 ? 41.648  102.222 70.898  1.00 58.37  ? 557 LYS B CA  1 
ATOM   9821  C C   . LYS B 1 531 ? 42.627  101.059 70.983  1.00 58.01  ? 557 LYS B C   1 
ATOM   9822  O O   . LYS B 1 531 ? 43.280  100.711 69.999  1.00 58.05  ? 557 LYS B O   1 
ATOM   9823  C CB  . LYS B 1 531 ? 40.344  101.753 70.250  1.00 61.72  ? 557 LYS B CB  1 
ATOM   9824  C CG  . LYS B 1 531 ? 39.200  102.752 70.376  1.00 68.45  ? 557 LYS B CG  1 
ATOM   9825  C CD  . LYS B 1 531 ? 37.922  102.226 69.721  1.00 72.62  ? 557 LYS B CD  1 
ATOM   9826  C CE  . LYS B 1 531 ? 36.770  103.224 69.835  1.00 73.39  ? 557 LYS B CE  1 
ATOM   9827  N NZ  . LYS B 1 531 ? 35.581  102.777 69.050  1.00 73.64  ? 557 LYS B NZ  1 
ATOM   9828  N N   . ALA B 1 532 ? 42.730  100.468 72.167  1.00 56.88  ? 558 ALA B N   1 
ATOM   9829  C CA  . ALA B 1 532 ? 43.632  99.348  72.393  1.00 55.12  ? 558 ALA B CA  1 
ATOM   9830  C C   . ALA B 1 532 ? 43.347  98.200  71.436  1.00 54.05  ? 558 ALA B C   1 
ATOM   9831  O O   . ALA B 1 532 ? 44.264  97.567  70.915  1.00 52.89  ? 558 ALA B O   1 
ATOM   9832  C CB  . ALA B 1 532 ? 43.505  98.872  73.826  1.00 56.03  ? 558 ALA B CB  1 
ATOM   9833  N N   . GLY B 1 533 ? 42.068  97.935  71.205  1.00 54.50  ? 559 GLY B N   1 
ATOM   9834  C CA  . GLY B 1 533 ? 41.690  96.857  70.313  1.00 55.10  ? 559 GLY B CA  1 
ATOM   9835  C C   . GLY B 1 533 ? 41.912  97.209  68.858  1.00 55.74  ? 559 GLY B C   1 
ATOM   9836  O O   . GLY B 1 533 ? 41.148  96.796  67.985  1.00 57.34  ? 559 GLY B O   1 
ATOM   9837  N N   . ALA B 1 534 ? 42.961  97.980  68.599  1.00 54.77  ? 560 ALA B N   1 
ATOM   9838  C CA  . ALA B 1 534 ? 43.296  98.396  67.246  1.00 52.79  ? 560 ALA B CA  1 
ATOM   9839  C C   . ALA B 1 534 ? 44.782  98.189  67.018  1.00 53.15  ? 560 ALA B C   1 
ATOM   9840  O O   . ALA B 1 534 ? 45.293  98.429  65.927  1.00 53.79  ? 560 ALA B O   1 
ATOM   9841  C CB  . ALA B 1 534 ? 42.934  99.861  67.040  1.00 52.33  ? 560 ALA B CB  1 
ATOM   9842  N N   . LEU B 1 535 ? 45.475  97.746  68.061  1.00 53.41  ? 561 LEU B N   1 
ATOM   9843  C CA  . LEU B 1 535 ? 46.902  97.502  67.965  1.00 54.14  ? 561 LEU B CA  1 
ATOM   9844  C C   . LEU B 1 535 ? 47.151  96.253  67.143  1.00 55.66  ? 561 LEU B C   1 
ATOM   9845  O O   . LEU B 1 535 ? 46.249  95.432  66.941  1.00 55.07  ? 561 LEU B O   1 
ATOM   9846  C CB  . LEU B 1 535 ? 47.509  97.325  69.354  1.00 54.89  ? 561 LEU B CB  1 
ATOM   9847  C CG  . LEU B 1 535 ? 47.542  98.554  70.262  1.00 55.96  ? 561 LEU B CG  1 
ATOM   9848  C CD1 . LEU B 1 535 ? 48.146  98.176  71.606  1.00 54.02  ? 561 LEU B CD1 1 
ATOM   9849  C CD2 . LEU B 1 535 ? 48.362  99.656  69.599  1.00 56.40  ? 561 LEU B CD2 1 
ATOM   9850  N N   . ASN B 1 536 ? 48.384  96.119  66.670  1.00 57.06  ? 562 ASN B N   1 
ATOM   9851  C CA  . ASN B 1 536 ? 48.792  94.975  65.865  1.00 57.29  ? 562 ASN B CA  1 
ATOM   9852  C C   . ASN B 1 536 ? 50.249  94.678  66.191  1.00 57.27  ? 562 ASN B C   1 
ATOM   9853  O O   . ASN B 1 536 ? 51.105  95.565  66.147  1.00 57.44  ? 562 ASN B O   1 
ATOM   9854  C CB  . ASN B 1 536 ? 48.635  95.287  64.372  1.00 56.76  ? 562 ASN B CB  1 
ATOM   9855  C CG  . ASN B 1 536 ? 48.805  94.059  63.494  1.00 57.45  ? 562 ASN B CG  1 
ATOM   9856  O OD1 . ASN B 1 536 ? 49.881  93.465  63.435  1.00 57.31  ? 562 ASN B OD1 1 
ATOM   9857  N ND2 . ASN B 1 536 ? 47.736  93.674  62.807  1.00 57.65  ? 562 ASN B ND2 1 
ATOM   9858  N N   . SER B 1 537 ? 50.521  93.423  66.522  1.00 57.25  ? 563 SER B N   1 
ATOM   9859  C CA  . SER B 1 537 ? 51.861  92.990  66.881  1.00 57.00  ? 563 SER B CA  1 
ATOM   9860  C C   . SER B 1 537 ? 52.853  93.022  65.723  1.00 55.74  ? 563 SER B C   1 
ATOM   9861  O O   . SER B 1 537 ? 54.064  93.017  65.938  1.00 55.99  ? 563 SER B O   1 
ATOM   9862  C CB  . SER B 1 537 ? 51.790  91.578  67.458  1.00 58.01  ? 563 SER B CB  1 
ATOM   9863  O OG  . SER B 1 537 ? 53.048  91.172  67.956  1.00 62.94  ? 563 SER B OG  1 
ATOM   9864  N N   . ASN B 1 538 ? 52.342  93.067  64.497  1.00 54.57  ? 564 ASN B N   1 
ATOM   9865  C CA  . ASN B 1 538 ? 53.196  93.064  63.310  1.00 53.87  ? 564 ASN B CA  1 
ATOM   9866  C C   . ASN B 1 538 ? 53.910  94.371  63.003  1.00 53.07  ? 564 ASN B C   1 
ATOM   9867  O O   . ASN B 1 538 ? 54.995  94.365  62.427  1.00 52.24  ? 564 ASN B O   1 
ATOM   9868  C CB  . ASN B 1 538 ? 52.378  92.643  62.094  1.00 54.68  ? 564 ASN B CB  1 
ATOM   9869  C CG  . ASN B 1 538 ? 51.904  91.213  62.188  1.00 56.52  ? 564 ASN B CG  1 
ATOM   9870  O OD1 . ASN B 1 538 ? 50.829  90.869  61.698  1.00 58.77  ? 564 ASN B OD1 1 
ATOM   9871  N ND2 . ASN B 1 538 ? 52.712  90.363  62.811  1.00 57.67  ? 564 ASN B ND2 1 
ATOM   9872  N N   . ASP B 1 539 ? 53.309  95.492  63.376  1.00 52.46  ? 565 ASP B N   1 
ATOM   9873  C CA  . ASP B 1 539 ? 53.933  96.778  63.106  1.00 52.23  ? 565 ASP B CA  1 
ATOM   9874  C C   . ASP B 1 539 ? 54.029  97.694  64.323  1.00 50.36  ? 565 ASP B C   1 
ATOM   9875  O O   . ASP B 1 539 ? 53.494  97.381  65.388  1.00 52.91  ? 565 ASP B O   1 
ATOM   9876  C CB  . ASP B 1 539 ? 53.207  97.480  61.945  1.00 53.67  ? 565 ASP B CB  1 
ATOM   9877  C CG  . ASP B 1 539 ? 51.758  97.057  61.813  1.00 52.71  ? 565 ASP B CG  1 
ATOM   9878  O OD1 . ASP B 1 539 ? 50.915  97.569  62.575  1.00 55.27  ? 565 ASP B OD1 1 
ATOM   9879  O OD2 . ASP B 1 539 ? 51.462  96.206  60.947  1.00 50.66  ? 565 ASP B OD2 1 
ATOM   9880  N N   . ALA B 1 540 ? 54.730  98.814  64.160  1.00 45.52  ? 566 ALA B N   1 
ATOM   9881  C CA  . ALA B 1 540 ? 54.920  99.777  65.236  1.00 43.42  ? 566 ALA B CA  1 
ATOM   9882  C C   . ALA B 1 540 ? 53.811  100.830 65.311  1.00 41.49  ? 566 ALA B C   1 
ATOM   9883  O O   . ALA B 1 540 ? 53.196  101.177 64.306  1.00 41.64  ? 566 ALA B O   1 
ATOM   9884  C CB  . ALA B 1 540 ? 56.270  100.461 65.075  1.00 43.76  ? 566 ALA B CB  1 
ATOM   9885  N N   . PHE B 1 541 ? 53.556  101.331 66.513  1.00 38.92  ? 567 PHE B N   1 
ATOM   9886  C CA  . PHE B 1 541 ? 52.536  102.349 66.700  1.00 38.08  ? 567 PHE B CA  1 
ATOM   9887  C C   . PHE B 1 541 ? 53.079  103.558 67.441  1.00 36.73  ? 567 PHE B C   1 
ATOM   9888  O O   . PHE B 1 541 ? 54.047  103.467 68.185  1.00 36.65  ? 567 PHE B O   1 
ATOM   9889  C CB  . PHE B 1 541 ? 51.344  101.788 67.473  1.00 36.67  ? 567 PHE B CB  1 
ATOM   9890  C CG  . PHE B 1 541 ? 50.513  100.814 66.687  1.00 38.11  ? 567 PHE B CG  1 
ATOM   9891  C CD1 . PHE B 1 541 ? 51.040  99.587  66.290  1.00 36.84  ? 567 PHE B CD1 1 
ATOM   9892  C CD2 . PHE B 1 541 ? 49.198  101.128 66.338  1.00 35.80  ? 567 PHE B CD2 1 
ATOM   9893  C CE1 . PHE B 1 541 ? 50.272  98.685  65.556  1.00 36.80  ? 567 PHE B CE1 1 
ATOM   9894  C CE2 . PHE B 1 541 ? 48.421  100.238 65.605  1.00 35.86  ? 567 PHE B CE2 1 
ATOM   9895  C CZ  . PHE B 1 541 ? 48.957  99.011  65.211  1.00 36.67  ? 567 PHE B CZ  1 
ATOM   9896  N N   . VAL B 1 542 ? 52.458  104.704 67.211  1.00 36.47  ? 568 VAL B N   1 
ATOM   9897  C CA  . VAL B 1 542 ? 52.858  105.920 67.890  1.00 36.58  ? 568 VAL B CA  1 
ATOM   9898  C C   . VAL B 1 542 ? 51.601  106.483 68.532  1.00 37.76  ? 568 VAL B C   1 
ATOM   9899  O O   . VAL B 1 542 ? 50.552  106.588 67.891  1.00 35.74  ? 568 VAL B O   1 
ATOM   9900  C CB  . VAL B 1 542 ? 53.467  106.960 66.920  1.00 34.57  ? 568 VAL B CB  1 
ATOM   9901  C CG1 . VAL B 1 542 ? 53.541  108.316 67.585  1.00 34.80  ? 568 VAL B CG1 1 
ATOM   9902  C CG2 . VAL B 1 542 ? 54.862  106.536 66.521  1.00 36.53  ? 568 VAL B CG2 1 
ATOM   9903  N N   . LEU B 1 543 ? 51.709  106.804 69.816  1.00 40.13  ? 569 LEU B N   1 
ATOM   9904  C CA  . LEU B 1 543 ? 50.597  107.357 70.570  1.00 42.45  ? 569 LEU B CA  1 
ATOM   9905  C C   . LEU B 1 543 ? 50.972  108.751 71.053  1.00 43.32  ? 569 LEU B C   1 
ATOM   9906  O O   . LEU B 1 543 ? 51.978  108.943 71.725  1.00 43.60  ? 569 LEU B O   1 
ATOM   9907  C CB  . LEU B 1 543 ? 50.256  106.452 71.759  1.00 41.94  ? 569 LEU B CB  1 
ATOM   9908  C CG  . LEU B 1 543 ? 49.071  106.906 72.613  1.00 41.57  ? 569 LEU B CG  1 
ATOM   9909  C CD1 . LEU B 1 543 ? 47.896  107.241 71.725  1.00 42.09  ? 569 LEU B CD1 1 
ATOM   9910  C CD2 . LEU B 1 543 ? 48.704  105.813 73.595  1.00 42.61  ? 569 LEU B CD2 1 
ATOM   9911  N N   . LYS B 1 544 ? 50.155  109.724 70.684  1.00 46.26  ? 570 LYS B N   1 
ATOM   9912  C CA  . LYS B 1 544 ? 50.389  111.104 71.058  1.00 47.68  ? 570 LYS B CA  1 
ATOM   9913  C C   . LYS B 1 544 ? 49.294  111.563 71.996  1.00 49.43  ? 570 LYS B C   1 
ATOM   9914  O O   . LYS B 1 544 ? 48.141  111.706 71.590  1.00 49.07  ? 570 LYS B O   1 
ATOM   9915  C CB  . LYS B 1 544 ? 50.392  111.986 69.812  1.00 48.73  ? 570 LYS B CB  1 
ATOM   9916  C CG  . LYS B 1 544 ? 50.309  113.475 70.084  1.00 49.13  ? 570 LYS B CG  1 
ATOM   9917  C CD  . LYS B 1 544 ? 51.596  114.007 70.670  1.00 51.84  ? 570 LYS B CD  1 
ATOM   9918  C CE  . LYS B 1 544 ? 51.526  115.514 70.829  1.00 53.50  ? 570 LYS B CE  1 
ATOM   9919  N NZ  . LYS B 1 544 ? 50.325  115.915 71.613  1.00 55.64  ? 570 LYS B NZ  1 
ATOM   9920  N N   . THR B 1 545 ? 49.656  111.767 73.256  1.00 50.99  ? 571 THR B N   1 
ATOM   9921  C CA  . THR B 1 545 ? 48.710  112.242 74.253  1.00 51.83  ? 571 THR B CA  1 
ATOM   9922  C C   . THR B 1 545 ? 49.194  113.629 74.622  1.00 53.01  ? 571 THR B C   1 
ATOM   9923  O O   . THR B 1 545 ? 50.344  113.985 74.341  1.00 52.04  ? 571 THR B O   1 
ATOM   9924  C CB  . THR B 1 545 ? 48.711  111.364 75.520  1.00 52.02  ? 571 THR B CB  1 
ATOM   9925  O OG1 . THR B 1 545 ? 50.013  111.380 76.116  1.00 52.73  ? 571 THR B OG1 1 
ATOM   9926  C CG2 . THR B 1 545 ? 48.327  109.931 75.177  1.00 53.34  ? 571 THR B CG2 1 
ATOM   9927  N N   . PRO B 1 546 ? 48.328  114.440 75.239  1.00 54.33  ? 572 PRO B N   1 
ATOM   9928  C CA  . PRO B 1 546 ? 48.761  115.788 75.615  1.00 55.75  ? 572 PRO B CA  1 
ATOM   9929  C C   . PRO B 1 546 ? 49.926  115.775 76.606  1.00 56.34  ? 572 PRO B C   1 
ATOM   9930  O O   . PRO B 1 546 ? 50.775  116.666 76.589  1.00 56.77  ? 572 PRO B O   1 
ATOM   9931  C CB  . PRO B 1 546 ? 47.488  116.416 76.187  1.00 55.68  ? 572 PRO B CB  1 
ATOM   9932  C CG  . PRO B 1 546 ? 46.698  115.228 76.672  1.00 54.21  ? 572 PRO B CG  1 
ATOM   9933  C CD  . PRO B 1 546 ? 46.913  114.218 75.584  1.00 53.90  ? 572 PRO B CD  1 
ATOM   9934  N N   . SER B 1 547 ? 49.975  114.745 77.447  1.00 57.73  ? 573 SER B N   1 
ATOM   9935  C CA  . SER B 1 547 ? 51.032  114.611 78.448  1.00 58.86  ? 573 SER B CA  1 
ATOM   9936  C C   . SER B 1 547 ? 52.340  114.096 77.849  1.00 58.04  ? 573 SER B C   1 
ATOM   9937  O O   . SER B 1 547 ? 53.405  114.641 78.122  1.00 58.72  ? 573 SER B O   1 
ATOM   9938  C CB  . SER B 1 547 ? 50.583  113.662 79.563  1.00 60.29  ? 573 SER B CB  1 
ATOM   9939  O OG  . SER B 1 547 ? 49.324  114.046 80.094  1.00 64.09  ? 573 SER B OG  1 
ATOM   9940  N N   . ALA B 1 548 ? 52.258  113.047 77.034  1.00 58.96  ? 574 ALA B N   1 
ATOM   9941  C CA  . ALA B 1 548 ? 53.452  112.467 76.423  1.00 57.95  ? 574 ALA B CA  1 
ATOM   9942  C C   . ALA B 1 548 ? 53.223  111.731 75.097  1.00 57.16  ? 574 ALA B C   1 
ATOM   9943  O O   . ALA B 1 548 ? 52.096  111.602 74.610  1.00 55.67  ? 574 ALA B O   1 
ATOM   9944  C CB  . ALA B 1 548 ? 54.121  111.530 77.417  1.00 58.71  ? 574 ALA B CB  1 
ATOM   9945  N N   . ALA B 1 549 ? 54.321  111.243 74.527  1.00 55.52  ? 575 ALA B N   1 
ATOM   9946  C CA  . ALA B 1 549 ? 54.298  110.517 73.267  1.00 53.83  ? 575 ALA B CA  1 
ATOM   9947  C C   . ALA B 1 549 ? 54.959  109.147 73.435  1.00 53.59  ? 575 ALA B C   1 
ATOM   9948  O O   . ALA B 1 549 ? 56.099  109.048 73.889  1.00 54.78  ? 575 ALA B O   1 
ATOM   9949  C CB  . ALA B 1 549 ? 55.024  111.321 72.203  1.00 52.24  ? 575 ALA B CB  1 
ATOM   9950  N N   . TYR B 1 550 ? 54.234  108.096 73.059  1.00 52.34  ? 576 TYR B N   1 
ATOM   9951  C CA  . TYR B 1 550 ? 54.725  106.725 73.165  1.00 51.86  ? 576 TYR B CA  1 
ATOM   9952  C C   . TYR B 1 550 ? 55.068  106.120 71.810  1.00 50.02  ? 576 TYR B C   1 
ATOM   9953  O O   . TYR B 1 550 ? 54.390  106.374 70.818  1.00 49.32  ? 576 TYR B O   1 
ATOM   9954  C CB  . TYR B 1 550 ? 53.664  105.828 73.801  1.00 54.73  ? 576 TYR B CB  1 
ATOM   9955  C CG  . TYR B 1 550 ? 53.237  106.219 75.192  1.00 58.77  ? 576 TYR B CG  1 
ATOM   9956  C CD1 . TYR B 1 550 ? 53.993  105.853 76.306  1.00 59.77  ? 576 TYR B CD1 1 
ATOM   9957  C CD2 . TYR B 1 550 ? 52.059  106.936 75.396  1.00 59.25  ? 576 TYR B CD2 1 
ATOM   9958  C CE1 . TYR B 1 550 ? 53.581  106.188 77.593  1.00 61.38  ? 576 TYR B CE1 1 
ATOM   9959  C CE2 . TYR B 1 550 ? 51.638  107.277 76.672  1.00 61.67  ? 576 TYR B CE2 1 
ATOM   9960  C CZ  . TYR B 1 550 ? 52.400  106.900 77.768  1.00 62.15  ? 576 TYR B CZ  1 
ATOM   9961  O OH  . TYR B 1 550 ? 51.967  107.234 79.031  1.00 60.77  ? 576 TYR B OH  1 
ATOM   9962  N N   . LEU B 1 551 ? 56.122  105.314 71.779  1.00 47.37  ? 577 LEU B N   1 
ATOM   9963  C CA  . LEU B 1 551 ? 56.515  104.617 70.566  1.00 45.38  ? 577 LEU B CA  1 
ATOM   9964  C C   . LEU B 1 551 ? 56.430  103.133 70.898  1.00 44.55  ? 577 LEU B C   1 
ATOM   9965  O O   . LEU B 1 551 ? 57.369  102.538 71.418  1.00 43.32  ? 577 LEU B O   1 
ATOM   9966  C CB  . LEU B 1 551 ? 57.937  104.991 70.141  1.00 45.54  ? 577 LEU B CB  1 
ATOM   9967  C CG  . LEU B 1 551 ? 58.557  104.142 69.020  1.00 45.60  ? 577 LEU B CG  1 
ATOM   9968  C CD1 . LEU B 1 551 ? 57.555  103.941 67.898  1.00 44.75  ? 577 LEU B CD1 1 
ATOM   9969  C CD2 . LEU B 1 551 ? 59.828  104.809 68.508  1.00 41.71  ? 577 LEU B CD2 1 
ATOM   9970  N N   . TRP B 1 552 ? 55.271  102.557 70.614  1.00 45.46  ? 578 TRP B N   1 
ATOM   9971  C CA  . TRP B 1 552 ? 54.998  101.152 70.872  1.00 47.86  ? 578 TRP B CA  1 
ATOM   9972  C C   . TRP B 1 552 ? 55.484  100.271 69.717  1.00 49.24  ? 578 TRP B C   1 
ATOM   9973  O O   . TRP B 1 552 ? 54.971  100.359 68.598  1.00 48.16  ? 578 TRP B O   1 
ATOM   9974  C CB  . TRP B 1 552 ? 53.496  100.973 71.060  1.00 48.59  ? 578 TRP B CB  1 
ATOM   9975  C CG  . TRP B 1 552 ? 53.102  99.628  71.499  1.00 50.64  ? 578 TRP B CG  1 
ATOM   9976  C CD1 . TRP B 1 552 ? 53.088  99.156  72.772  1.00 50.66  ? 578 TRP B CD1 1 
ATOM   9977  C CD2 . TRP B 1 552 ? 52.649  98.561  70.666  1.00 52.82  ? 578 TRP B CD2 1 
ATOM   9978  N NE1 . TRP B 1 552 ? 52.652  97.853  72.790  1.00 52.32  ? 578 TRP B NE1 1 
ATOM   9979  C CE2 . TRP B 1 552 ? 52.379  97.461  71.506  1.00 52.40  ? 578 TRP B CE2 1 
ATOM   9980  C CE3 . TRP B 1 552 ? 52.452  98.422  69.285  1.00 53.22  ? 578 TRP B CE3 1 
ATOM   9981  C CZ2 . TRP B 1 552 ? 51.913  96.240  71.016  1.00 52.50  ? 578 TRP B CZ2 1 
ATOM   9982  C CZ3 . TRP B 1 552 ? 51.989  97.206  68.798  1.00 53.39  ? 578 TRP B CZ3 1 
ATOM   9983  C CH2 . TRP B 1 552 ? 51.728  96.131  69.663  1.00 51.95  ? 578 TRP B CH2 1 
ATOM   9984  N N   . VAL B 1 553 ? 56.469  99.420  69.990  1.00 49.65  ? 579 VAL B N   1 
ATOM   9985  C CA  . VAL B 1 553 ? 57.012  98.537  68.965  1.00 51.37  ? 579 VAL B CA  1 
ATOM   9986  C C   . VAL B 1 553 ? 56.617  97.072  69.165  1.00 53.01  ? 579 VAL B C   1 
ATOM   9987  O O   . VAL B 1 553 ? 57.185  96.375  70.007  1.00 53.19  ? 579 VAL B O   1 
ATOM   9988  C CB  . VAL B 1 553 ? 58.550  98.644  68.911  1.00 49.36  ? 579 VAL B CB  1 
ATOM   9989  C CG1 . VAL B 1 553 ? 59.122  98.546  70.298  1.00 51.68  ? 579 VAL B CG1 1 
ATOM   9990  C CG2 . VAL B 1 553 ? 59.116  97.547  68.035  1.00 48.49  ? 579 VAL B CG2 1 
ATOM   9991  N N   . GLY B 1 554 ? 55.643  96.615  68.377  1.00 55.01  ? 580 GLY B N   1 
ATOM   9992  C CA  . GLY B 1 554 ? 55.180  95.238  68.468  1.00 54.92  ? 580 GLY B CA  1 
ATOM   9993  C C   . GLY B 1 554 ? 56.307  94.237  68.290  1.00 55.81  ? 580 GLY B C   1 
ATOM   9994  O O   . GLY B 1 554 ? 57.348  94.565  67.718  1.00 54.91  ? 580 GLY B O   1 
ATOM   9995  N N   . ALA B 1 555 ? 56.103  93.016  68.779  1.00 56.28  ? 581 ALA B N   1 
ATOM   9996  C CA  . ALA B 1 555 ? 57.116  91.971  68.681  1.00 57.11  ? 581 ALA B CA  1 
ATOM   9997  C C   . ALA B 1 555 ? 57.470  91.644  67.234  1.00 57.05  ? 581 ALA B C   1 
ATOM   9998  O O   . ALA B 1 555 ? 58.630  91.397  66.913  1.00 56.67  ? 581 ALA B O   1 
ATOM   9999  C CB  . ALA B 1 555 ? 56.639  90.716  69.399  1.00 58.04  ? 581 ALA B CB  1 
ATOM   10000 N N   . GLY B 1 556 ? 56.469  91.652  66.361  1.00 57.77  ? 582 GLY B N   1 
ATOM   10001 C CA  . GLY B 1 556 ? 56.711  91.351  64.960  1.00 58.94  ? 582 GLY B CA  1 
ATOM   10002 C C   . GLY B 1 556 ? 57.396  92.461  64.179  1.00 58.90  ? 582 GLY B C   1 
ATOM   10003 O O   . GLY B 1 556 ? 57.995  92.208  63.134  1.00 58.27  ? 582 GLY B O   1 
ATOM   10004 N N   . ALA B 1 557 ? 57.310  93.688  64.688  1.00 59.66  ? 583 ALA B N   1 
ATOM   10005 C CA  . ALA B 1 557 ? 57.908  94.856  64.041  1.00 59.52  ? 583 ALA B CA  1 
ATOM   10006 C C   . ALA B 1 557 ? 59.354  94.639  63.614  1.00 59.94  ? 583 ALA B C   1 
ATOM   10007 O O   . ALA B 1 557 ? 60.014  93.703  64.062  1.00 61.78  ? 583 ALA B O   1 
ATOM   10008 C CB  . ALA B 1 557 ? 57.819  96.059  64.969  1.00 60.93  ? 583 ALA B CB  1 
ATOM   10009 N N   . SER B 1 558 ? 59.840  95.517  62.745  1.00 59.82  ? 584 SER B N   1 
ATOM   10010 C CA  . SER B 1 558 ? 61.204  95.429  62.246  1.00 60.38  ? 584 SER B CA  1 
ATOM   10011 C C   . SER B 1 558 ? 61.877  96.788  62.295  1.00 59.69  ? 584 SER B C   1 
ATOM   10012 O O   . SER B 1 558 ? 61.314  97.752  62.807  1.00 58.76  ? 584 SER B O   1 
ATOM   10013 C CB  . SER B 1 558 ? 61.212  94.919  60.805  1.00 62.23  ? 584 SER B CB  1 
ATOM   10014 O OG  . SER B 1 558 ? 60.572  93.659  60.709  1.00 66.37  ? 584 SER B OG  1 
ATOM   10015 N N   . GLU B 1 559 ? 63.084  96.853  61.747  1.00 59.95  ? 585 GLU B N   1 
ATOM   10016 C CA  . GLU B 1 559 ? 63.860  98.083  61.721  1.00 60.18  ? 585 GLU B CA  1 
ATOM   10017 C C   . GLU B 1 559 ? 63.159  99.121  60.852  1.00 58.54  ? 585 GLU B C   1 
ATOM   10018 O O   . GLU B 1 559 ? 63.371  100.326 61.008  1.00 57.97  ? 585 GLU B O   1 
ATOM   10019 C CB  . GLU B 1 559 ? 65.257  97.797  61.166  1.00 64.30  ? 585 GLU B CB  1 
ATOM   10020 C CG  . GLU B 1 559 ? 66.316  98.810  61.565  1.00 70.83  ? 585 GLU B CG  1 
ATOM   10021 C CD  . GLU B 1 559 ? 66.563  98.834  63.066  1.00 75.94  ? 585 GLU B CD  1 
ATOM   10022 O OE1 . GLU B 1 559 ? 65.648  99.242  63.817  1.00 79.61  ? 585 GLU B OE1 1 
ATOM   10023 O OE2 . GLU B 1 559 ? 67.669  98.439  63.499  1.00 78.67  ? 585 GLU B OE2 1 
ATOM   10024 N N   . ALA B 1 560 ? 62.318  98.638  59.942  1.00 56.08  ? 586 ALA B N   1 
ATOM   10025 C CA  . ALA B 1 560 ? 61.579  99.501  59.028  1.00 52.51  ? 586 ALA B CA  1 
ATOM   10026 C C   . ALA B 1 560 ? 60.423  100.231 59.699  1.00 50.26  ? 586 ALA B C   1 
ATOM   10027 O O   . ALA B 1 560 ? 60.187  101.403 59.407  1.00 49.27  ? 586 ALA B O   1 
ATOM   10028 C CB  . ALA B 1 560 ? 61.060  98.688  57.846  1.00 51.93  ? 586 ALA B CB  1 
ATOM   10029 N N   . GLU B 1 561 ? 59.698  99.550  60.586  1.00 47.49  ? 587 GLU B N   1 
ATOM   10030 C CA  . GLU B 1 561 ? 58.575  100.199 61.257  1.00 47.23  ? 587 GLU B CA  1 
ATOM   10031 C C   . GLU B 1 561 ? 59.025  101.161 62.336  1.00 45.74  ? 587 GLU B C   1 
ATOM   10032 O O   . GLU B 1 561 ? 58.360  102.159 62.581  1.00 44.06  ? 587 GLU B O   1 
ATOM   10033 C CB  . GLU B 1 561 ? 57.610  99.182  61.876  1.00 48.90  ? 587 GLU B CB  1 
ATOM   10034 C CG  . GLU B 1 561 ? 58.055  97.743  61.828  1.00 52.00  ? 587 GLU B CG  1 
ATOM   10035 C CD  . GLU B 1 561 ? 57.670  97.056  60.544  1.00 51.62  ? 587 GLU B CD  1 
ATOM   10036 O OE1 . GLU B 1 561 ? 56.461  97.049  60.219  1.00 50.37  ? 587 GLU B OE1 1 
ATOM   10037 O OE2 . GLU B 1 561 ? 58.577  96.520  59.870  1.00 51.52  ? 587 GLU B OE2 1 
ATOM   10038 N N   . LYS B 1 562 ? 60.147  100.861 62.986  1.00 47.43  ? 588 LYS B N   1 
ATOM   10039 C CA  . LYS B 1 562 ? 60.669  101.729 64.043  1.00 48.47  ? 588 LYS B CA  1 
ATOM   10040 C C   . LYS B 1 562 ? 61.209  103.021 63.443  1.00 45.81  ? 588 LYS B C   1 
ATOM   10041 O O   . LYS B 1 562 ? 60.889  104.118 63.902  1.00 43.38  ? 588 LYS B O   1 
ATOM   10042 C CB  . LYS B 1 562 ? 61.794  101.033 64.823  1.00 53.16  ? 588 LYS B CB  1 
ATOM   10043 C CG  . LYS B 1 562 ? 61.380  99.774  65.581  1.00 59.61  ? 588 LYS B CG  1 
ATOM   10044 C CD  . LYS B 1 562 ? 62.577  99.176  66.322  1.00 64.33  ? 588 LYS B CD  1 
ATOM   10045 C CE  . LYS B 1 562 ? 62.249  97.818  66.934  1.00 67.00  ? 588 LYS B CE  1 
ATOM   10046 N NZ  . LYS B 1 562 ? 63.424  97.202  67.627  1.00 68.40  ? 588 LYS B NZ  1 
ATOM   10047 N N   . THR B 1 563 ? 62.034  102.879 62.413  1.00 43.68  ? 589 THR B N   1 
ATOM   10048 C CA  . THR B 1 563 ? 62.616  104.031 61.748  1.00 42.94  ? 589 THR B CA  1 
ATOM   10049 C C   . THR B 1 563 ? 61.499  104.923 61.197  1.00 42.47  ? 589 THR B C   1 
ATOM   10050 O O   . THR B 1 563 ? 61.618  106.154 61.186  1.00 42.93  ? 589 THR B O   1 
ATOM   10051 C CB  . THR B 1 563 ? 63.563  103.579 60.611  1.00 42.69  ? 589 THR B CB  1 
ATOM   10052 O OG1 . THR B 1 563 ? 64.116  104.724 59.954  1.00 43.53  ? 589 THR B OG1 1 
ATOM   10053 C CG2 . THR B 1 563 ? 62.814  102.749 59.598  1.00 48.19  ? 589 THR B CG2 1 
ATOM   10054 N N   . GLY B 1 564 ? 60.408  104.301 60.758  1.00 41.20  ? 590 GLY B N   1 
ATOM   10055 C CA  . GLY B 1 564 ? 59.292  105.063 60.229  1.00 39.23  ? 590 GLY B CA  1 
ATOM   10056 C C   . GLY B 1 564 ? 58.526  105.743 61.349  1.00 39.40  ? 590 GLY B C   1 
ATOM   10057 O O   . GLY B 1 564 ? 58.090  106.890 61.229  1.00 37.82  ? 590 GLY B O   1 
ATOM   10058 N N   . ALA B 1 565 ? 58.363  105.033 62.455  1.00 40.88  ? 591 ALA B N   1 
ATOM   10059 C CA  . ALA B 1 565 ? 57.645  105.583 63.595  1.00 42.08  ? 591 ALA B CA  1 
ATOM   10060 C C   . ALA B 1 565 ? 58.397  106.775 64.189  1.00 42.76  ? 591 ALA B C   1 
ATOM   10061 O O   . ALA B 1 565 ? 57.779  107.770 64.570  1.00 41.92  ? 591 ALA B O   1 
ATOM   10062 C CB  . ALA B 1 565 ? 57.429  104.507 64.649  1.00 41.70  ? 591 ALA B CB  1 
ATOM   10063 N N   . GLN B 1 566 ? 59.723  106.692 64.258  1.00 43.13  ? 592 GLN B N   1 
ATOM   10064 C CA  . GLN B 1 566 ? 60.477  107.806 64.812  1.00 45.29  ? 592 GLN B CA  1 
ATOM   10065 C C   . GLN B 1 566 ? 60.568  108.948 63.815  1.00 42.77  ? 592 GLN B C   1 
ATOM   10066 O O   . GLN B 1 566 ? 60.616  110.121 64.200  1.00 40.50  ? 592 GLN B O   1 
ATOM   10067 C CB  . GLN B 1 566 ? 61.875  107.366 65.273  1.00 50.40  ? 592 GLN B CB  1 
ATOM   10068 C CG  . GLN B 1 566 ? 62.654  106.484 64.322  1.00 55.76  ? 592 GLN B CG  1 
ATOM   10069 C CD  . GLN B 1 566 ? 63.974  106.017 64.935  1.00 60.66  ? 592 GLN B CD  1 
ATOM   10070 O OE1 . GLN B 1 566 ? 64.028  105.626 66.110  1.00 61.06  ? 592 GLN B OE1 1 
ATOM   10071 N NE2 . GLN B 1 566 ? 65.041  106.045 64.140  1.00 60.48  ? 592 GLN B NE2 1 
ATOM   10072 N N   . GLU B 1 567 ? 60.579  108.606 62.532  1.00 41.23  ? 593 GLU B N   1 
ATOM   10073 C CA  . GLU B 1 567 ? 60.627  109.627 61.494  1.00 40.42  ? 593 GLU B CA  1 
ATOM   10074 C C   . GLU B 1 567 ? 59.308  110.420 61.572  1.00 37.90  ? 593 GLU B C   1 
ATOM   10075 O O   . GLU B 1 567 ? 59.235  111.584 61.177  1.00 36.85  ? 593 GLU B O   1 
ATOM   10076 C CB  . GLU B 1 567 ? 60.793  108.969 60.125  1.00 41.94  ? 593 GLU B CB  1 
ATOM   10077 C CG  . GLU B 1 567 ? 61.141  109.939 59.009  1.00 46.87  ? 593 GLU B CG  1 
ATOM   10078 C CD  . GLU B 1 567 ? 62.427  110.688 59.275  1.00 49.76  ? 593 GLU B CD  1 
ATOM   10079 O OE1 . GLU B 1 567 ? 63.474  110.021 59.442  1.00 51.59  ? 593 GLU B OE1 1 
ATOM   10080 O OE2 . GLU B 1 567 ? 62.391  111.939 59.318  1.00 49.38  ? 593 GLU B OE2 1 
ATOM   10081 N N   . LEU B 1 568 ? 58.277  109.777 62.116  1.00 36.59  ? 594 LEU B N   1 
ATOM   10082 C CA  . LEU B 1 568 ? 56.964  110.386 62.290  1.00 34.58  ? 594 LEU B CA  1 
ATOM   10083 C C   . LEU B 1 568 ? 57.021  111.289 63.520  1.00 35.99  ? 594 LEU B C   1 
ATOM   10084 O O   . LEU B 1 568 ? 56.567  112.440 63.481  1.00 34.12  ? 594 LEU B O   1 
ATOM   10085 C CB  . LEU B 1 568 ? 55.916  109.299 62.518  1.00 32.82  ? 594 LEU B CB  1 
ATOM   10086 C CG  . LEU B 1 568 ? 54.433  109.600 62.311  1.00 31.46  ? 594 LEU B CG  1 
ATOM   10087 C CD1 . LEU B 1 568 ? 53.655  108.651 63.194  1.00 32.19  ? 594 LEU B CD1 1 
ATOM   10088 C CD2 . LEU B 1 568 ? 54.085  111.037 62.654  1.00 35.13  ? 594 LEU B CD2 1 
ATOM   10089 N N   . LEU B 1 569 ? 57.567  110.750 64.613  1.00 37.46  ? 595 LEU B N   1 
ATOM   10090 C CA  . LEU B 1 569 ? 57.707  111.493 65.870  1.00 37.07  ? 595 LEU B CA  1 
ATOM   10091 C C   . LEU B 1 569 ? 58.369  112.828 65.567  1.00 37.98  ? 595 LEU B C   1 
ATOM   10092 O O   . LEU B 1 569 ? 57.955  113.881 66.056  1.00 34.47  ? 595 LEU B O   1 
ATOM   10093 C CB  . LEU B 1 569 ? 58.574  110.715 66.869  1.00 36.41  ? 595 LEU B CB  1 
ATOM   10094 C CG  . LEU B 1 569 ? 57.981  109.808 67.966  1.00 35.82  ? 595 LEU B CG  1 
ATOM   10095 C CD1 . LEU B 1 569 ? 56.488  110.041 68.115  1.00 32.92  ? 595 LEU B CD1 1 
ATOM   10096 C CD2 . LEU B 1 569 ? 58.280  108.353 67.637  1.00 33.67  ? 595 LEU B CD2 1 
ATOM   10097 N N   . ARG B 1 570 ? 59.400  112.748 64.733  1.00 40.24  ? 596 ARG B N   1 
ATOM   10098 C CA  . ARG B 1 570 ? 60.182  113.890 64.285  1.00 44.43  ? 596 ARG B CA  1 
ATOM   10099 C C   . ARG B 1 570 ? 59.302  114.943 63.598  1.00 45.31  ? 596 ARG B C   1 
ATOM   10100 O O   . ARG B 1 570 ? 59.494  116.145 63.791  1.00 45.99  ? 596 ARG B O   1 
ATOM   10101 C CB  . ARG B 1 570 ? 61.256  113.388 63.324  1.00 48.64  ? 596 ARG B CB  1 
ATOM   10102 C CG  . ARG B 1 570 ? 62.438  114.307 63.094  1.00 54.50  ? 596 ARG B CG  1 
ATOM   10103 C CD  . ARG B 1 570 ? 63.521  113.527 62.353  1.00 61.88  ? 596 ARG B CD  1 
ATOM   10104 N NE  . ARG B 1 570 ? 63.771  112.246 63.018  1.00 68.04  ? 596 ARG B NE  1 
ATOM   10105 C CZ  . ARG B 1 570 ? 64.473  111.240 62.501  1.00 70.33  ? 596 ARG B CZ  1 
ATOM   10106 N NH1 . ARG B 1 570 ? 65.014  111.347 61.294  1.00 72.04  ? 596 ARG B NH1 1 
ATOM   10107 N NH2 . ARG B 1 570 ? 64.621  110.115 63.193  1.00 71.57  ? 596 ARG B NH2 1 
ATOM   10108 N N   . VAL B 1 571 ? 58.340  114.491 62.796  1.00 44.91  ? 597 VAL B N   1 
ATOM   10109 C CA  . VAL B 1 571 ? 57.437  115.408 62.100  1.00 42.96  ? 597 VAL B CA  1 
ATOM   10110 C C   . VAL B 1 571 ? 56.469  116.055 63.089  1.00 44.64  ? 597 VAL B C   1 
ATOM   10111 O O   . VAL B 1 571 ? 56.109  117.228 62.947  1.00 44.32  ? 597 VAL B O   1 
ATOM   10112 C CB  . VAL B 1 571 ? 56.620  114.671 60.994  1.00 42.76  ? 597 VAL B CB  1 
ATOM   10113 C CG1 . VAL B 1 571 ? 55.610  115.620 60.353  1.00 36.81  ? 597 VAL B CG1 1 
ATOM   10114 C CG2 . VAL B 1 571 ? 57.560  114.116 59.934  1.00 40.15  ? 597 VAL B CG2 1 
ATOM   10115 N N   . LEU B 1 572 ? 56.045  115.290 64.090  1.00 45.20  ? 598 LEU B N   1 
ATOM   10116 C CA  . LEU B 1 572 ? 55.124  115.813 65.091  1.00 46.71  ? 598 LEU B CA  1 
ATOM   10117 C C   . LEU B 1 572 ? 55.874  116.644 66.129  1.00 48.61  ? 598 LEU B C   1 
ATOM   10118 O O   . LEU B 1 572 ? 55.261  117.281 66.982  1.00 48.42  ? 598 LEU B O   1 
ATOM   10119 C CB  . LEU B 1 572 ? 54.392  114.664 65.789  1.00 45.78  ? 598 LEU B CB  1 
ATOM   10120 C CG  . LEU B 1 572 ? 53.611  113.703 64.890  1.00 47.28  ? 598 LEU B CG  1 
ATOM   10121 C CD1 . LEU B 1 572 ? 53.071  112.553 65.731  1.00 46.16  ? 598 LEU B CD1 1 
ATOM   10122 C CD2 . LEU B 1 572 ? 52.480  114.443 64.189  1.00 46.02  ? 598 LEU B CD2 1 
ATOM   10123 N N   . ARG B 1 573 ? 57.202  116.633 66.049  1.00 51.10  ? 599 ARG B N   1 
ATOM   10124 C CA  . ARG B 1 573 ? 58.042  117.377 66.983  1.00 55.67  ? 599 ARG B CA  1 
ATOM   10125 C C   . ARG B 1 573 ? 57.746  116.977 68.431  1.00 55.50  ? 599 ARG B C   1 
ATOM   10126 O O   . ARG B 1 573 ? 57.417  117.812 69.274  1.00 54.38  ? 599 ARG B O   1 
ATOM   10127 C CB  . ARG B 1 573 ? 57.851  118.888 66.784  1.00 59.88  ? 599 ARG B CB  1 
ATOM   10128 C CG  . ARG B 1 573 ? 58.274  119.359 65.394  1.00 66.58  ? 599 ARG B CG  1 
ATOM   10129 C CD  . ARG B 1 573 ? 58.353  120.875 65.260  1.00 72.08  ? 599 ARG B CD  1 
ATOM   10130 N NE  . ARG B 1 573 ? 58.804  121.256 63.919  1.00 79.06  ? 599 ARG B NE  1 
ATOM   10131 C CZ  . ARG B 1 573 ? 59.043  122.504 63.519  1.00 81.09  ? 599 ARG B CZ  1 
ATOM   10132 N NH1 . ARG B 1 573 ? 58.878  123.519 64.357  1.00 82.92  ? 599 ARG B NH1 1 
ATOM   10133 N NH2 . ARG B 1 573 ? 59.440  122.741 62.273  1.00 81.66  ? 599 ARG B NH2 1 
ATOM   10134 N N   . ALA B 1 574 ? 57.873  115.682 68.704  1.00 55.87  ? 600 ALA B N   1 
ATOM   10135 C CA  . ALA B 1 574 ? 57.622  115.139 70.031  1.00 54.81  ? 600 ALA B CA  1 
ATOM   10136 C C   . ALA B 1 574 ? 58.753  114.191 70.431  1.00 54.38  ? 600 ALA B C   1 
ATOM   10137 O O   . ALA B 1 574 ? 59.264  113.435 69.601  1.00 52.96  ? 600 ALA B O   1 
ATOM   10138 C CB  . ALA B 1 574 ? 56.282  114.402 70.049  1.00 52.42  ? 600 ALA B CB  1 
ATOM   10139 N N   . GLN B 1 575 ? 59.147  114.251 71.702  1.00 53.85  ? 601 GLN B N   1 
ATOM   10140 C CA  . GLN B 1 575 ? 60.209  113.398 72.215  1.00 53.10  ? 601 GLN B CA  1 
ATOM   10141 C C   . GLN B 1 575 ? 59.570  112.103 72.695  1.00 52.25  ? 601 GLN B C   1 
ATOM   10142 O O   . GLN B 1 575 ? 58.793  112.096 73.645  1.00 52.61  ? 601 GLN B O   1 
ATOM   10143 C CB  . GLN B 1 575 ? 60.942  114.094 73.357  1.00 53.45  ? 601 GLN B CB  1 
ATOM   10144 C CG  . GLN B 1 575 ? 62.412  113.741 73.411  1.00 56.22  ? 601 GLN B CG  1 
ATOM   10145 C CD  . GLN B 1 575 ? 63.106  113.982 72.082  1.00 57.47  ? 601 GLN B CD  1 
ATOM   10146 O OE1 . GLN B 1 575 ? 63.173  115.113 71.593  1.00 57.74  ? 601 GLN B OE1 1 
ATOM   10147 N NE2 . GLN B 1 575 ? 63.620  112.914 71.484  1.00 55.89  ? 601 GLN B NE2 1 
ATOM   10148 N N   . PRO B 1 576 ? 59.905  110.983 72.042  1.00 51.52  ? 602 PRO B N   1 
ATOM   10149 C CA  . PRO B 1 576 ? 59.384  109.649 72.345  1.00 52.34  ? 602 PRO B CA  1 
ATOM   10150 C C   . PRO B 1 576 ? 59.813  108.947 73.625  1.00 54.34  ? 602 PRO B C   1 
ATOM   10151 O O   . PRO B 1 576 ? 60.897  109.175 74.165  1.00 53.58  ? 602 PRO B O   1 
ATOM   10152 C CB  . PRO B 1 576 ? 59.794  108.847 71.119  1.00 51.84  ? 602 PRO B CB  1 
ATOM   10153 C CG  . PRO B 1 576 ? 61.140  109.422 70.818  1.00 49.64  ? 602 PRO B CG  1 
ATOM   10154 C CD  . PRO B 1 576 ? 60.896  110.915 70.953  1.00 50.50  ? 602 PRO B CD  1 
ATOM   10155 N N   . VAL B 1 577 ? 58.923  108.074 74.081  1.00 56.30  ? 603 VAL B N   1 
ATOM   10156 C CA  . VAL B 1 577 ? 59.126  107.238 75.252  1.00 56.41  ? 603 VAL B CA  1 
ATOM   10157 C C   . VAL B 1 577 ? 58.929  105.864 74.632  1.00 57.78  ? 603 VAL B C   1 
ATOM   10158 O O   . VAL B 1 577 ? 57.794  105.458 74.392  1.00 58.81  ? 603 VAL B O   1 
ATOM   10159 C CB  . VAL B 1 577 ? 58.023  107.459 76.315  1.00 56.25  ? 603 VAL B CB  1 
ATOM   10160 C CG1 . VAL B 1 577 ? 58.272  106.561 77.515  1.00 53.34  ? 603 VAL B CG1 1 
ATOM   10161 C CG2 . VAL B 1 577 ? 57.976  108.922 76.734  1.00 56.19  ? 603 VAL B CG2 1 
ATOM   10162 N N   . GLN B 1 578 ? 60.013  105.156 74.339  1.00 59.57  ? 604 GLN B N   1 
ATOM   10163 C CA  . GLN B 1 578 ? 59.862  103.847 73.716  1.00 62.21  ? 604 GLN B CA  1 
ATOM   10164 C C   . GLN B 1 578 ? 59.397  102.767 74.675  1.00 61.99  ? 604 GLN B C   1 
ATOM   10165 O O   . GLN B 1 578 ? 59.876  102.674 75.805  1.00 63.06  ? 604 GLN B O   1 
ATOM   10166 C CB  . GLN B 1 578 ? 61.160  103.392 73.046  1.00 64.01  ? 604 GLN B CB  1 
ATOM   10167 C CG  . GLN B 1 578 ? 60.981  102.072 72.291  1.00 69.30  ? 604 GLN B CG  1 
ATOM   10168 C CD  . GLN B 1 578 ? 62.219  101.639 71.529  1.00 71.97  ? 604 GLN B CD  1 
ATOM   10169 O OE1 . GLN B 1 578 ? 62.740  102.381 70.694  1.00 72.93  ? 604 GLN B OE1 1 
ATOM   10170 N NE2 . GLN B 1 578 ? 62.691  100.426 71.807  1.00 73.31  ? 604 GLN B NE2 1 
ATOM   10171 N N   . VAL B 1 579 ? 58.455  101.955 74.206  1.00 61.41  ? 605 VAL B N   1 
ATOM   10172 C CA  . VAL B 1 579 ? 57.914  100.856 74.990  1.00 61.45  ? 605 VAL B CA  1 
ATOM   10173 C C   . VAL B 1 579 ? 57.843  99.641  74.074  1.00 61.47  ? 605 VAL B C   1 
ATOM   10174 O O   . VAL B 1 579 ? 57.632  99.780  72.871  1.00 60.63  ? 605 VAL B O   1 
ATOM   10175 C CB  . VAL B 1 579 ? 56.497  101.181 75.521  1.00 61.09  ? 605 VAL B CB  1 
ATOM   10176 C CG1 . VAL B 1 579 ? 56.414  102.646 75.890  1.00 60.96  ? 605 VAL B CG1 1 
ATOM   10177 C CG2 . VAL B 1 579 ? 55.443  100.830 74.489  1.00 62.70  ? 605 VAL B CG2 1 
ATOM   10178 N N   . ALA B 1 580 ? 58.026  98.453  74.634  1.00 62.66  ? 606 ALA B N   1 
ATOM   10179 C CA  . ALA B 1 580 ? 57.973  97.242  73.829  1.00 63.78  ? 606 ALA B CA  1 
ATOM   10180 C C   . ALA B 1 580 ? 56.730  96.425  74.157  1.00 65.12  ? 606 ALA B C   1 
ATOM   10181 O O   . ALA B 1 580 ? 56.281  96.385  75.304  1.00 63.82  ? 606 ALA B O   1 
ATOM   10182 C CB  . ALA B 1 580 ? 59.226  96.413  74.051  1.00 64.34  ? 606 ALA B CB  1 
ATOM   10183 N N   . GLU B 1 581 ? 56.169  95.782  73.139  1.00 67.02  ? 607 GLU B N   1 
ATOM   10184 C CA  . GLU B 1 581 ? 54.978  94.967  73.332  1.00 69.36  ? 607 GLU B CA  1 
ATOM   10185 C C   . GLU B 1 581 ? 55.215  94.017  74.497  1.00 71.93  ? 607 GLU B C   1 
ATOM   10186 O O   . GLU B 1 581 ? 56.120  93.182  74.452  1.00 73.64  ? 607 GLU B O   1 
ATOM   10187 C CB  . GLU B 1 581 ? 54.665  94.169  72.064  1.00 67.29  ? 607 GLU B CB  1 
ATOM   10188 C CG  . GLU B 1 581 ? 53.494  93.213  72.209  1.00 64.46  ? 607 GLU B CG  1 
ATOM   10189 C CD  . GLU B 1 581 ? 53.155  92.507  70.914  1.00 63.68  ? 607 GLU B CD  1 
ATOM   10190 O OE1 . GLU B 1 581 ? 54.093  92.053  70.224  1.00 63.26  ? 607 GLU B OE1 1 
ATOM   10191 O OE2 . GLU B 1 581 ? 51.953  92.399  70.591  1.00 60.92  ? 607 GLU B OE2 1 
ATOM   10192 N N   . GLY B 1 582 ? 54.406  94.154  75.541  1.00 72.88  ? 608 GLY B N   1 
ATOM   10193 C CA  . GLY B 1 582 ? 54.556  93.296  76.700  1.00 74.12  ? 608 GLY B CA  1 
ATOM   10194 C C   . GLY B 1 582 ? 54.641  94.100  77.979  1.00 74.83  ? 608 GLY B C   1 
ATOM   10195 O O   . GLY B 1 582 ? 53.952  93.801  78.952  1.00 75.61  ? 608 GLY B O   1 
ATOM   10196 N N   . SER B 1 583 ? 55.477  95.132  77.976  1.00 74.51  ? 609 SER B N   1 
ATOM   10197 C CA  . SER B 1 583 ? 55.637  95.975  79.150  1.00 74.80  ? 609 SER B CA  1 
ATOM   10198 C C   . SER B 1 583 ? 55.029  97.360  78.944  1.00 74.14  ? 609 SER B C   1 
ATOM   10199 O O   . SER B 1 583 ? 55.708  98.374  79.096  1.00 73.09  ? 609 SER B O   1 
ATOM   10200 C CB  . SER B 1 583 ? 57.121  96.095  79.494  1.00 76.37  ? 609 SER B CB  1 
ATOM   10201 O OG  . SER B 1 583 ? 57.863  96.547  78.379  1.00 78.27  ? 609 SER B OG  1 
ATOM   10202 N N   . GLU B 1 584 ? 53.740  97.394  78.611  1.00 75.44  ? 610 GLU B N   1 
ATOM   10203 C CA  . GLU B 1 584 ? 53.029  98.653  78.377  1.00 76.40  ? 610 GLU B CA  1 
ATOM   10204 C C   . GLU B 1 584 ? 52.625  99.356  79.669  1.00 77.57  ? 610 GLU B C   1 
ATOM   10205 O O   . GLU B 1 584 ? 51.690  98.931  80.349  1.00 77.53  ? 610 GLU B O   1 
ATOM   10206 C CB  . GLU B 1 584 ? 51.763  98.425  77.537  1.00 74.01  ? 610 GLU B CB  1 
ATOM   10207 C CG  . GLU B 1 584 ? 51.988  97.830  76.155  1.00 73.85  ? 610 GLU B CG  1 
ATOM   10208 C CD  . GLU B 1 584 ? 52.022  96.313  76.161  1.00 73.33  ? 610 GLU B CD  1 
ATOM   10209 O OE1 . GLU B 1 584 ? 52.874  95.740  76.863  1.00 73.97  ? 610 GLU B OE1 1 
ATOM   10210 O OE2 . GLU B 1 584 ? 51.194  95.691  75.463  1.00 72.00  ? 610 GLU B OE2 1 
ATOM   10211 N N   . PRO B 1 585 ? 53.322  100.449 80.019  1.00 78.68  ? 611 PRO B N   1 
ATOM   10212 C CA  . PRO B 1 585 ? 53.013  101.205 81.237  1.00 79.22  ? 611 PRO B CA  1 
ATOM   10213 C C   . PRO B 1 585 ? 51.512  101.463 81.332  1.00 79.91  ? 611 PRO B C   1 
ATOM   10214 O O   . PRO B 1 585 ? 50.840  101.630 80.313  1.00 80.25  ? 611 PRO B O   1 
ATOM   10215 C CB  . PRO B 1 585 ? 53.809  102.490 81.047  1.00 79.68  ? 611 PRO B CB  1 
ATOM   10216 C CG  . PRO B 1 585 ? 55.020  102.012 80.312  1.00 79.47  ? 611 PRO B CG  1 
ATOM   10217 C CD  . PRO B 1 585 ? 54.434  101.074 79.282  1.00 78.52  ? 611 PRO B CD  1 
ATOM   10218 N N   . ASP B 1 586 ? 50.988  101.496 82.552  1.00 80.57  ? 612 ASP B N   1 
ATOM   10219 C CA  . ASP B 1 586 ? 49.563  101.723 82.756  1.00 80.68  ? 612 ASP B CA  1 
ATOM   10220 C C   . ASP B 1 586 ? 49.074  103.043 82.164  1.00 79.21  ? 612 ASP B C   1 
ATOM   10221 O O   . ASP B 1 586 ? 47.880  103.213 81.913  1.00 78.59  ? 612 ASP B O   1 
ATOM   10222 C CB  . ASP B 1 586 ? 49.226  101.649 84.250  1.00 83.57  ? 612 ASP B CB  1 
ATOM   10223 C CG  . ASP B 1 586 ? 49.156  100.215 84.763  1.00 85.68  ? 612 ASP B CG  1 
ATOM   10224 O OD1 . ASP B 1 586 ? 48.285  99.454  84.287  1.00 87.48  ? 612 ASP B OD1 1 
ATOM   10225 O OD2 . ASP B 1 586 ? 49.968  99.846  85.640  1.00 87.28  ? 612 ASP B OD2 1 
ATOM   10226 N N   . SER B 1 587 ? 49.993  103.975 81.937  1.00 77.74  ? 613 SER B N   1 
ATOM   10227 C CA  . SER B 1 587 ? 49.634  105.265 81.356  1.00 76.64  ? 613 SER B CA  1 
ATOM   10228 C C   . SER B 1 587 ? 49.225  105.053 79.898  1.00 75.84  ? 613 SER B C   1 
ATOM   10229 O O   . SER B 1 587 ? 48.300  105.692 79.392  1.00 74.11  ? 613 SER B O   1 
ATOM   10230 C CB  . SER B 1 587 ? 50.824  106.222 81.421  1.00 76.30  ? 613 SER B CB  1 
ATOM   10231 O OG  . SER B 1 587 ? 51.263  106.407 82.752  1.00 77.72  ? 613 SER B OG  1 
ATOM   10232 N N   . PHE B 1 588 ? 49.934  104.146 79.233  1.00 74.46  ? 614 PHE B N   1 
ATOM   10233 C CA  . PHE B 1 588 ? 49.676  103.812 77.842  1.00 73.20  ? 614 PHE B CA  1 
ATOM   10234 C C   . PHE B 1 588 ? 48.261  103.251 77.715  1.00 73.41  ? 614 PHE B C   1 
ATOM   10235 O O   . PHE B 1 588 ? 47.426  103.816 77.006  1.00 72.39  ? 614 PHE B O   1 
ATOM   10236 C CB  . PHE B 1 588 ? 50.715  102.790 77.373  1.00 72.23  ? 614 PHE B CB  1 
ATOM   10237 C CG  . PHE B 1 588 ? 50.581  102.385 75.931  1.00 71.35  ? 614 PHE B CG  1 
ATOM   10238 C CD1 . PHE B 1 588 ? 49.552  101.546 75.519  1.00 71.94  ? 614 PHE B CD1 1 
ATOM   10239 C CD2 . PHE B 1 588 ? 51.509  102.815 74.991  1.00 70.75  ? 614 PHE B CD2 1 
ATOM   10240 C CE1 . PHE B 1 588 ? 49.451  101.140 74.194  1.00 71.72  ? 614 PHE B CE1 1 
ATOM   10241 C CE2 . PHE B 1 588 ? 51.417  102.415 73.666  1.00 71.04  ? 614 PHE B CE2 1 
ATOM   10242 C CZ  . PHE B 1 588 ? 50.387  101.575 73.267  1.00 71.60  ? 614 PHE B CZ  1 
ATOM   10243 N N   . TRP B 1 589 ? 47.996  102.148 78.415  1.00 73.73  ? 615 TRP B N   1 
ATOM   10244 C CA  . TRP B 1 589 ? 46.682  101.502 78.392  1.00 73.79  ? 615 TRP B CA  1 
ATOM   10245 C C   . TRP B 1 589 ? 45.540  102.448 78.761  1.00 73.90  ? 615 TRP B C   1 
ATOM   10246 O O   . TRP B 1 589 ? 44.520  102.494 78.078  1.00 73.19  ? 615 TRP B O   1 
ATOM   10247 C CB  . TRP B 1 589 ? 46.657  100.298 79.342  1.00 72.94  ? 615 TRP B CB  1 
ATOM   10248 C CG  . TRP B 1 589 ? 47.510  99.142  78.903  1.00 73.44  ? 615 TRP B CG  1 
ATOM   10249 C CD1 . TRP B 1 589 ? 48.505  98.540  79.621  1.00 74.17  ? 615 TRP B CD1 1 
ATOM   10250 C CD2 . TRP B 1 589 ? 47.445  98.447  77.649  1.00 72.68  ? 615 TRP B CD2 1 
ATOM   10251 N NE1 . TRP B 1 589 ? 49.065  97.516  78.891  1.00 73.58  ? 615 TRP B NE1 1 
ATOM   10252 C CE2 . TRP B 1 589 ? 48.436  97.438  77.678  1.00 72.54  ? 615 TRP B CE2 1 
ATOM   10253 C CE3 . TRP B 1 589 ? 46.649  98.582  76.502  1.00 71.08  ? 615 TRP B CE3 1 
ATOM   10254 C CZ2 . TRP B 1 589 ? 48.650  96.565  76.605  1.00 71.52  ? 615 TRP B CZ2 1 
ATOM   10255 C CZ3 . TRP B 1 589 ? 46.864  97.714  75.435  1.00 70.46  ? 615 TRP B CZ3 1 
ATOM   10256 C CH2 . TRP B 1 589 ? 47.859  96.719  75.496  1.00 70.74  ? 615 TRP B CH2 1 
ATOM   10257 N N   . GLU B 1 590 ? 45.708  103.200 79.843  1.00 75.17  ? 616 GLU B N   1 
ATOM   10258 C CA  . GLU B 1 590 ? 44.671  104.122 80.285  1.00 76.84  ? 616 GLU B CA  1 
ATOM   10259 C C   . GLU B 1 590 ? 44.379  105.210 79.252  1.00 76.70  ? 616 GLU B C   1 
ATOM   10260 O O   . GLU B 1 590 ? 43.277  105.757 79.218  1.00 77.94  ? 616 GLU B O   1 
ATOM   10261 C CB  . GLU B 1 590 ? 45.062  104.758 81.623  1.00 79.35  ? 616 GLU B CB  1 
ATOM   10262 C CG  . GLU B 1 590 ? 43.949  105.576 82.267  1.00 82.92  ? 616 GLU B CG  1 
ATOM   10263 C CD  . GLU B 1 590 ? 44.327  106.106 83.641  1.00 85.43  ? 616 GLU B CD  1 
ATOM   10264 O OE1 . GLU B 1 590 ? 44.624  105.284 84.536  1.00 85.65  ? 616 GLU B OE1 1 
ATOM   10265 O OE2 . GLU B 1 590 ? 44.325  107.343 83.825  1.00 86.25  ? 616 GLU B OE2 1 
ATOM   10266 N N   . ALA B 1 591 ? 45.361  105.523 78.410  1.00 76.18  ? 617 ALA B N   1 
ATOM   10267 C CA  . ALA B 1 591 ? 45.182  106.543 77.377  1.00 75.00  ? 617 ALA B CA  1 
ATOM   10268 C C   . ALA B 1 591 ? 44.396  105.979 76.192  1.00 74.98  ? 617 ALA B C   1 
ATOM   10269 O O   . ALA B 1 591 ? 43.642  106.697 75.531  1.00 74.54  ? 617 ALA B O   1 
ATOM   10270 C CB  . ALA B 1 591 ? 46.536  107.055 76.909  1.00 74.44  ? 617 ALA B CB  1 
ATOM   10271 N N   . LEU B 1 592 ? 44.579  104.687 75.932  1.00 73.93  ? 618 LEU B N   1 
ATOM   10272 C CA  . LEU B 1 592 ? 43.897  104.010 74.836  1.00 73.09  ? 618 LEU B CA  1 
ATOM   10273 C C   . LEU B 1 592 ? 42.455  103.679 75.200  1.00 72.76  ? 618 LEU B C   1 
ATOM   10274 O O   . LEU B 1 592 ? 41.752  103.015 74.438  1.00 72.33  ? 618 LEU B O   1 
ATOM   10275 C CB  . LEU B 1 592 ? 44.644  102.724 74.472  1.00 73.57  ? 618 LEU B CB  1 
ATOM   10276 C CG  . LEU B 1 592 ? 45.312  102.662 73.096  1.00 72.91  ? 618 LEU B CG  1 
ATOM   10277 C CD1 . LEU B 1 592 ? 46.201  103.869 72.889  1.00 72.89  ? 618 LEU B CD1 1 
ATOM   10278 C CD2 . LEU B 1 592 ? 46.120  101.385 72.987  1.00 73.72  ? 618 LEU B CD2 1 
ATOM   10279 N N   . GLY B 1 593 ? 42.021  104.146 76.366  1.00 72.64  ? 619 GLY B N   1 
ATOM   10280 C CA  . GLY B 1 593 ? 40.665  103.883 76.811  1.00 72.36  ? 619 GLY B CA  1 
ATOM   10281 C C   . GLY B 1 593 ? 40.564  102.567 77.556  1.00 72.72  ? 619 GLY B C   1 
ATOM   10282 O O   . GLY B 1 593 ? 39.482  101.989 77.665  1.00 72.33  ? 619 GLY B O   1 
ATOM   10283 N N   . GLY B 1 594 ? 41.700  102.093 78.062  1.00 73.49  ? 620 GLY B N   1 
ATOM   10284 C CA  . GLY B 1 594 ? 41.730  100.844 78.803  1.00 74.93  ? 620 GLY B CA  1 
ATOM   10285 C C   . GLY B 1 594 ? 42.219  99.661  77.992  1.00 76.31  ? 620 GLY B C   1 
ATOM   10286 O O   . GLY B 1 594 ? 41.833  99.496  76.836  1.00 77.68  ? 620 GLY B O   1 
ATOM   10287 N N   . LYS B 1 595 ? 43.071  98.837  78.597  1.00 77.13  ? 621 LYS B N   1 
ATOM   10288 C CA  . LYS B 1 595 ? 43.613  97.652  77.937  1.00 77.99  ? 621 LYS B CA  1 
ATOM   10289 C C   . LYS B 1 595 ? 42.476  96.836  77.329  1.00 79.08  ? 621 LYS B C   1 
ATOM   10290 O O   . LYS B 1 595 ? 41.376  96.804  77.874  1.00 78.27  ? 621 LYS B O   1 
ATOM   10291 C CB  . LYS B 1 595 ? 44.379  96.799  78.950  1.00 77.20  ? 621 LYS B CB  1 
ATOM   10292 C CG  . LYS B 1 595 ? 44.884  95.476  78.409  1.00 76.97  ? 621 LYS B CG  1 
ATOM   10293 C CD  . LYS B 1 595 ? 45.395  94.595  79.537  1.00 77.98  ? 621 LYS B CD  1 
ATOM   10294 C CE  . LYS B 1 595 ? 45.645  93.168  79.070  1.00 79.03  ? 621 LYS B CE  1 
ATOM   10295 N NZ  . LYS B 1 595 ? 45.929  92.254  80.214  1.00 79.44  ? 621 LYS B NZ  1 
ATOM   10296 N N   . ALA B 1 596 ? 42.739  96.180  76.202  1.00 81.77  ? 622 ALA B N   1 
ATOM   10297 C CA  . ALA B 1 596 ? 41.711  95.381  75.537  1.00 84.68  ? 622 ALA B CA  1 
ATOM   10298 C C   . ALA B 1 596 ? 42.286  94.230  74.716  1.00 86.32  ? 622 ALA B C   1 
ATOM   10299 O O   . ALA B 1 596 ? 43.475  93.923  74.808  1.00 86.18  ? 622 ALA B O   1 
ATOM   10300 C CB  . ALA B 1 596 ? 40.853  96.275  74.646  1.00 84.72  ? 622 ALA B CB  1 
ATOM   10301 N N   . THR B 1 597 ? 41.429  93.599  73.915  1.00 89.23  ? 623 THR B N   1 
ATOM   10302 C CA  . THR B 1 597 ? 41.831  92.474  73.069  1.00 92.04  ? 623 THR B CA  1 
ATOM   10303 C C   . THR B 1 597 ? 42.997  92.884  72.170  1.00 93.13  ? 623 THR B C   1 
ATOM   10304 O O   . THR B 1 597 ? 43.376  94.054  72.127  1.00 94.43  ? 623 THR B O   1 
ATOM   10305 C CB  . THR B 1 597 ? 40.655  91.980  72.182  1.00 92.77  ? 623 THR B CB  1 
ATOM   10306 O OG1 . THR B 1 597 ? 39.490  91.773  72.992  1.00 93.78  ? 623 THR B OG1 1 
ATOM   10307 C CG2 . THR B 1 597 ? 41.009  90.660  71.510  1.00 92.31  ? 623 THR B CG2 1 
ATOM   10308 N N   . TYR B 1 598 ? 43.559  91.924  71.445  1.00 93.66  ? 624 TYR B N   1 
ATOM   10309 C CA  . TYR B 1 598 ? 44.698  92.205  70.583  1.00 93.91  ? 624 TYR B CA  1 
ATOM   10310 C C   . TYR B 1 598 ? 44.516  91.800  69.133  1.00 93.33  ? 624 TYR B C   1 
ATOM   10311 O O   . TYR B 1 598 ? 43.426  91.884  68.572  1.00 93.05  ? 624 TYR B O   1 
ATOM   10312 C CB  . TYR B 1 598 ? 45.931  91.494  71.129  1.00 95.45  ? 624 TYR B CB  1 
ATOM   10313 C CG  . TYR B 1 598 ? 47.026  92.418  71.586  1.00 96.91  ? 624 TYR B CG  1 
ATOM   10314 C CD1 . TYR B 1 598 ? 46.803  93.343  72.602  1.00 97.11  ? 624 TYR B CD1 1 
ATOM   10315 C CD2 . TYR B 1 598 ? 48.300  92.340  71.030  1.00 97.55  ? 624 TYR B CD2 1 
ATOM   10316 C CE1 . TYR B 1 598 ? 47.823  94.159  73.059  1.00 97.49  ? 624 TYR B CE1 1 
ATOM   10317 C CE2 . TYR B 1 598 ? 49.326  93.150  71.479  1.00 97.18  ? 624 TYR B CE2 1 
ATOM   10318 C CZ  . TYR B 1 598 ? 49.082  94.056  72.493  1.00 97.80  ? 624 TYR B CZ  1 
ATOM   10319 O OH  . TYR B 1 598 ? 50.105  94.842  72.962  1.00 100.41 ? 624 TYR B OH  1 
ATOM   10320 N N   . ARG B 1 599 ? 45.624  91.364  68.542  1.00 93.26  ? 625 ARG B N   1 
ATOM   10321 C CA  . ARG B 1 599 ? 45.687  90.911  67.161  1.00 93.42  ? 625 ARG B CA  1 
ATOM   10322 C C   . ARG B 1 599 ? 47.170  90.685  66.895  1.00 92.96  ? 625 ARG B C   1 
ATOM   10323 O O   . ARG B 1 599 ? 47.870  91.572  66.411  1.00 91.41  ? 625 ARG B O   1 
ATOM   10324 C CB  . ARG B 1 599 ? 45.125  91.977  66.217  1.00 94.17  ? 625 ARG B CB  1 
ATOM   10325 C CG  . ARG B 1 599 ? 44.570  91.418  64.911  1.00 96.14  ? 625 ARG B CG  1 
ATOM   10326 C CD  . ARG B 1 599 ? 45.668  90.913  63.982  1.00 98.17  ? 625 ARG B CD  1 
ATOM   10327 N NE  . ARG B 1 599 ? 45.121  90.204  62.826  1.00 99.32  ? 625 ARG B NE  1 
ATOM   10328 C CZ  . ARG B 1 599 ? 45.807  89.924  61.720  1.00 99.21  ? 625 ARG B CZ  1 
ATOM   10329 N NH1 . ARG B 1 599 ? 47.075  90.297  61.607  1.00 98.72  ? 625 ARG B NH1 1 
ATOM   10330 N NH2 . ARG B 1 599 ? 45.225  89.264  60.727  1.00 98.49  ? 625 ARG B NH2 1 
ATOM   10331 N N   . THR B 1 600 ? 47.642  89.491  67.236  1.00 93.39  ? 626 THR B N   1 
ATOM   10332 C CA  . THR B 1 600 ? 49.045  89.133  67.074  1.00 94.38  ? 626 THR B CA  1 
ATOM   10333 C C   . THR B 1 600 ? 49.275  88.215  65.875  1.00 94.46  ? 626 THR B C   1 
ATOM   10334 O O   . THR B 1 600 ? 50.383  87.719  65.661  1.00 94.18  ? 626 THR B O   1 
ATOM   10335 C CB  . THR B 1 600 ? 49.568  88.437  68.347  1.00 94.79  ? 626 THR B CB  1 
ATOM   10336 O OG1 . THR B 1 600 ? 49.104  89.152  69.498  1.00 95.29  ? 626 THR B OG1 1 
ATOM   10337 C CG2 . THR B 1 600 ? 51.092  88.414  68.368  1.00 95.34  ? 626 THR B CG2 1 
ATOM   10338 N N   . SER B 1 601 ? 48.225  87.994  65.093  1.00 94.89  ? 627 SER B N   1 
ATOM   10339 C CA  . SER B 1 601 ? 48.313  87.133  63.917  1.00 95.17  ? 627 SER B CA  1 
ATOM   10340 C C   . SER B 1 601 ? 49.353  87.667  62.927  1.00 95.03  ? 627 SER B C   1 
ATOM   10341 O O   . SER B 1 601 ? 49.361  88.854  62.602  1.00 95.56  ? 627 SER B O   1 
ATOM   10342 C CB  . SER B 1 601 ? 46.946  87.050  63.226  1.00 95.74  ? 627 SER B CB  1 
ATOM   10343 O OG  . SER B 1 601 ? 45.912  86.739  64.147  1.00 95.04  ? 627 SER B OG  1 
ATOM   10344 N N   . PRO B 1 602 ? 50.252  86.795  62.443  1.00 94.31  ? 628 PRO B N   1 
ATOM   10345 C CA  . PRO B 1 602 ? 51.288  87.200  61.484  1.00 93.87  ? 628 PRO B CA  1 
ATOM   10346 C C   . PRO B 1 602 ? 50.725  87.348  60.067  1.00 93.34  ? 628 PRO B C   1 
ATOM   10347 O O   . PRO B 1 602 ? 49.591  86.946  59.805  1.00 93.43  ? 628 PRO B O   1 
ATOM   10348 C CB  . PRO B 1 602 ? 52.312  86.078  61.599  1.00 93.79  ? 628 PRO B CB  1 
ATOM   10349 C CG  . PRO B 1 602 ? 51.452  84.887  61.874  1.00 94.39  ? 628 PRO B CG  1 
ATOM   10350 C CD  . PRO B 1 602 ? 50.466  85.409  62.894  1.00 93.67  ? 628 PRO B CD  1 
ATOM   10351 N N   . ARG B 1 603 ? 51.514  87.915  59.157  1.00 92.93  ? 629 ARG B N   1 
ATOM   10352 C CA  . ARG B 1 603 ? 51.063  88.122  57.780  1.00 91.99  ? 629 ARG B CA  1 
ATOM   10353 C C   . ARG B 1 603 ? 51.707  87.219  56.727  1.00 92.63  ? 629 ARG B C   1 
ATOM   10354 O O   . ARG B 1 603 ? 52.739  86.591  56.969  1.00 92.72  ? 629 ARG B O   1 
ATOM   10355 C CB  . ARG B 1 603 ? 51.251  89.589  57.396  1.00 89.72  ? 629 ARG B CB  1 
ATOM   10356 C CG  . ARG B 1 603 ? 50.280  90.509  58.108  1.00 87.14  ? 629 ARG B CG  1 
ATOM   10357 C CD  . ARG B 1 603 ? 50.688  91.963  57.989  1.00 86.36  ? 629 ARG B CD  1 
ATOM   10358 N NE  . ARG B 1 603 ? 49.701  92.842  58.608  1.00 85.12  ? 629 ARG B NE  1 
ATOM   10359 C CZ  . ARG B 1 603 ? 49.929  94.107  58.942  1.00 83.37  ? 629 ARG B CZ  1 
ATOM   10360 N NH1 . ARG B 1 603 ? 51.118  94.649  58.720  1.00 81.72  ? 629 ARG B NH1 1 
ATOM   10361 N NH2 . ARG B 1 603 ? 48.968  94.830  59.500  1.00 82.41  ? 629 ARG B NH2 1 
ATOM   10362 N N   . LEU B 1 604 ? 51.077  87.167  55.556  1.00 93.19  ? 630 LEU B N   1 
ATOM   10363 C CA  . LEU B 1 604 ? 51.533  86.338  54.441  1.00 93.86  ? 630 LEU B CA  1 
ATOM   10364 C C   . LEU B 1 604 ? 52.595  87.042  53.597  1.00 93.94  ? 630 LEU B C   1 
ATOM   10365 O O   . LEU B 1 604 ? 52.406  87.266  52.402  1.00 95.61  ? 630 LEU B O   1 
ATOM   10366 C CB  . LEU B 1 604 ? 50.337  85.985  53.552  1.00 94.25  ? 630 LEU B CB  1 
ATOM   10367 C CG  . LEU B 1 604 ? 49.107  85.360  54.213  1.00 94.46  ? 630 LEU B CG  1 
ATOM   10368 C CD1 . LEU B 1 604 ? 47.927  85.423  53.259  1.00 94.06  ? 630 LEU B CD1 1 
ATOM   10369 C CD2 . LEU B 1 604 ? 49.410  83.926  54.609  1.00 95.22  ? 630 LEU B CD2 1 
ATOM   10370 N N   . LYS B 1 605 ? 53.720  87.374  54.211  1.00 93.13  ? 631 LYS B N   1 
ATOM   10371 C CA  . LYS B 1 605 ? 54.788  88.076  53.506  1.00 92.73  ? 631 LYS B CA  1 
ATOM   10372 C C   . LYS B 1 605 ? 55.598  87.171  52.572  1.00 91.00  ? 631 LYS B C   1 
ATOM   10373 O O   . LYS B 1 605 ? 56.801  87.366  52.412  1.00 92.28  ? 631 LYS B O   1 
ATOM   10374 C CB  . LYS B 1 605 ? 55.723  88.719  54.530  1.00 93.20  ? 631 LYS B CB  1 
ATOM   10375 C CG  . LYS B 1 605 ? 54.992  89.343  55.705  1.00 94.37  ? 631 LYS B CG  1 
ATOM   10376 C CD  . LYS B 1 605 ? 55.827  89.266  56.978  1.00 94.97  ? 631 LYS B CD  1 
ATOM   10377 C CE  . LYS B 1 605 ? 55.001  89.644  58.204  1.00 94.59  ? 631 LYS B CE  1 
ATOM   10378 N NZ  . LYS B 1 605 ? 55.722  89.389  59.479  1.00 92.34  ? 631 LYS B NZ  1 
ATOM   10379 N N   . ASP B 1 606 ? 54.944  86.196  51.946  1.00 87.79  ? 632 ASP B N   1 
ATOM   10380 C CA  . ASP B 1 606 ? 55.638  85.269  51.050  1.00 84.82  ? 632 ASP B CA  1 
ATOM   10381 C C   . ASP B 1 606 ? 54.667  84.285  50.409  1.00 81.50  ? 632 ASP B C   1 
ATOM   10382 O O   . ASP B 1 606 ? 54.683  84.071  49.194  1.00 81.53  ? 632 ASP B O   1 
ATOM   10383 C CB  . ASP B 1 606 ? 56.696  84.476  51.829  1.00 87.35  ? 632 ASP B CB  1 
ATOM   10384 C CG  . ASP B 1 606 ? 58.116  84.907  51.503  1.00 89.11  ? 632 ASP B CG  1 
ATOM   10385 O OD1 . ASP B 1 606 ? 58.515  84.804  50.322  1.00 88.34  ? 632 ASP B OD1 1 
ATOM   10386 O OD2 . ASP B 1 606 ? 58.836  85.341  52.431  1.00 90.56  ? 632 ASP B OD2 1 
ATOM   10387 N N   . LYS B 1 607 ? 53.837  83.673  51.246  1.00 76.71  ? 633 LYS B N   1 
ATOM   10388 C CA  . LYS B 1 607 ? 52.853  82.708  50.788  1.00 72.13  ? 633 LYS B CA  1 
ATOM   10389 C C   . LYS B 1 607 ? 51.640  83.450  50.246  1.00 67.66  ? 633 LYS B C   1 
ATOM   10390 O O   . LYS B 1 607 ? 50.634  82.849  49.875  1.00 66.61  ? 633 LYS B O   1 
ATOM   10391 C CB  . LYS B 1 607 ? 52.454  81.789  51.946  1.00 74.09  ? 633 LYS B CB  1 
ATOM   10392 C CG  . LYS B 1 607 ? 53.603  80.928  52.458  1.00 75.75  ? 633 LYS B CG  1 
ATOM   10393 C CD  . LYS B 1 607 ? 53.152  79.933  53.525  1.00 78.44  ? 633 LYS B CD  1 
ATOM   10394 C CE  . LYS B 1 607 ? 52.928  80.593  54.883  1.00 80.32  ? 633 LYS B CE  1 
ATOM   10395 N NZ  . LYS B 1 607 ? 51.829  81.599  54.883  1.00 81.62  ? 633 LYS B NZ  1 
ATOM   10396 N N   . LYS B 1 608 ? 51.761  84.770  50.202  1.00 62.61  ? 634 LYS B N   1 
ATOM   10397 C CA  . LYS B 1 608 ? 50.712  85.652  49.711  1.00 58.96  ? 634 LYS B CA  1 
ATOM   10398 C C   . LYS B 1 608 ? 50.263  85.238  48.311  1.00 54.91  ? 634 LYS B C   1 
ATOM   10399 O O   . LYS B 1 608 ? 49.072  85.183  48.008  1.00 52.94  ? 634 LYS B O   1 
ATOM   10400 C CB  . LYS B 1 608 ? 51.260  87.072  49.687  1.00 62.66  ? 634 LYS B CB  1 
ATOM   10401 C CG  . LYS B 1 608 ? 50.317  88.138  49.201  1.00 67.27  ? 634 LYS B CG  1 
ATOM   10402 C CD  . LYS B 1 608 ? 51.069  89.447  49.233  1.00 72.89  ? 634 LYS B CD  1 
ATOM   10403 C CE  . LYS B 1 608 ? 50.181  90.631  48.964  1.00 76.66  ? 634 LYS B CE  1 
ATOM   10404 N NZ  . LYS B 1 608 ? 50.973  91.888  49.101  1.00 78.11  ? 634 LYS B NZ  1 
ATOM   10405 N N   . MET B 1 609 ? 51.243  84.950  47.465  1.00 51.31  ? 635 MET B N   1 
ATOM   10406 C CA  . MET B 1 609 ? 51.002  84.531  46.096  1.00 47.96  ? 635 MET B CA  1 
ATOM   10407 C C   . MET B 1 609 ? 50.337  83.155  46.091  1.00 46.30  ? 635 MET B C   1 
ATOM   10408 O O   . MET B 1 609 ? 49.540  82.842  45.212  1.00 45.68  ? 635 MET B O   1 
ATOM   10409 C CB  . MET B 1 609 ? 52.330  84.475  45.351  1.00 46.18  ? 635 MET B CB  1 
ATOM   10410 C CG  . MET B 1 609 ? 52.214  84.355  43.861  1.00 46.93  ? 635 MET B CG  1 
ATOM   10411 S SD  . MET B 1 609 ? 53.842  84.501  43.115  1.00 50.66  ? 635 MET B SD  1 
ATOM   10412 C CE  . MET B 1 609 ? 53.883  83.006  42.118  1.00 53.39  ? 635 MET B CE  1 
ATOM   10413 N N   . ASP B 1 610 ? 50.669  82.343  47.088  1.00 45.00  ? 636 ASP B N   1 
ATOM   10414 C CA  . ASP B 1 610 ? 50.113  81.000  47.211  1.00 43.61  ? 636 ASP B CA  1 
ATOM   10415 C C   . ASP B 1 610 ? 48.673  81.040  47.694  1.00 39.45  ? 636 ASP B C   1 
ATOM   10416 O O   . ASP B 1 610 ? 47.811  80.369  47.144  1.00 39.58  ? 636 ASP B O   1 
ATOM   10417 C CB  . ASP B 1 610 ? 50.948  80.175  48.197  1.00 47.34  ? 636 ASP B CB  1 
ATOM   10418 C CG  . ASP B 1 610 ? 52.394  80.039  47.766  1.00 49.90  ? 636 ASP B CG  1 
ATOM   10419 O OD1 . ASP B 1 610 ? 52.661  79.282  46.808  1.00 49.17  ? 636 ASP B OD1 1 
ATOM   10420 O OD2 . ASP B 1 610 ? 53.262  80.696  48.382  1.00 52.31  ? 636 ASP B OD2 1 
ATOM   10421 N N   . ALA B 1 611 ? 48.425  81.831  48.729  1.00 37.01  ? 637 ALA B N   1 
ATOM   10422 C CA  . ALA B 1 611 ? 47.093  81.951  49.308  1.00 35.77  ? 637 ALA B CA  1 
ATOM   10423 C C   . ALA B 1 611 ? 46.115  82.689  48.394  1.00 36.34  ? 637 ALA B C   1 
ATOM   10424 O O   . ALA B 1 611 ? 44.906  82.450  48.455  1.00 36.74  ? 637 ALA B O   1 
ATOM   10425 C CB  . ALA B 1 611 ? 47.177  82.653  50.664  1.00 34.93  ? 637 ALA B CB  1 
ATOM   10426 N N   . HIS B 1 612 ? 46.633  83.596  47.563  1.00 33.94  ? 638 HIS B N   1 
ATOM   10427 C CA  . HIS B 1 612 ? 45.789  84.346  46.638  1.00 31.00  ? 638 HIS B CA  1 
ATOM   10428 C C   . HIS B 1 612 ? 46.476  84.495  45.295  1.00 30.00  ? 638 HIS B C   1 
ATOM   10429 O O   . HIS B 1 612 ? 47.047  85.539  44.991  1.00 31.32  ? 638 HIS B O   1 
ATOM   10430 C CB  . HIS B 1 612 ? 45.464  85.732  47.191  1.00 31.48  ? 638 HIS B CB  1 
ATOM   10431 C CG  . HIS B 1 612 ? 44.838  85.705  48.549  1.00 33.67  ? 638 HIS B CG  1 
ATOM   10432 N ND1 . HIS B 1 612 ? 45.557  85.935  49.704  1.00 33.07  ? 638 HIS B ND1 1 
ATOM   10433 C CD2 . HIS B 1 612 ? 43.569  85.447  48.941  1.00 32.65  ? 638 HIS B CD2 1 
ATOM   10434 C CE1 . HIS B 1 612 ? 44.756  85.820  50.748  1.00 33.20  ? 638 HIS B CE1 1 
ATOM   10435 N NE2 . HIS B 1 612 ? 43.544  85.524  50.312  1.00 34.60  ? 638 HIS B NE2 1 
ATOM   10436 N N   . PRO B 1 613 ? 46.425  83.446  44.465  1.00 28.09  ? 639 PRO B N   1 
ATOM   10437 C CA  . PRO B 1 613 ? 47.059  83.493  43.150  1.00 27.08  ? 639 PRO B CA  1 
ATOM   10438 C C   . PRO B 1 613 ? 46.414  84.511  42.227  1.00 25.89  ? 639 PRO B C   1 
ATOM   10439 O O   . PRO B 1 613 ? 45.209  84.733  42.290  1.00 25.64  ? 639 PRO B O   1 
ATOM   10440 C CB  . PRO B 1 613 ? 46.890  82.068  42.642  1.00 26.80  ? 639 PRO B CB  1 
ATOM   10441 C CG  . PRO B 1 613 ? 45.594  81.683  43.227  1.00 27.69  ? 639 PRO B CG  1 
ATOM   10442 C CD  . PRO B 1 613 ? 45.731  82.163  44.652  1.00 26.26  ? 639 PRO B CD  1 
ATOM   10443 N N   . PRO B 1 614 ? 47.219  85.154  41.367  1.00 25.47  ? 640 PRO B N   1 
ATOM   10444 C CA  . PRO B 1 614 ? 46.707  86.151  40.421  1.00 21.28  ? 640 PRO B CA  1 
ATOM   10445 C C   . PRO B 1 614 ? 45.748  85.437  39.475  1.00 20.30  ? 640 PRO B C   1 
ATOM   10446 O O   . PRO B 1 614 ? 45.883  84.237  39.244  1.00 20.26  ? 640 PRO B O   1 
ATOM   10447 C CB  . PRO B 1 614 ? 47.963  86.614  39.681  1.00 18.66  ? 640 PRO B CB  1 
ATOM   10448 C CG  . PRO B 1 614 ? 49.060  86.350  40.634  1.00 20.35  ? 640 PRO B CG  1 
ATOM   10449 C CD  . PRO B 1 614 ? 48.681  85.020  41.239  1.00 22.87  ? 640 PRO B CD  1 
ATOM   10450 N N   . ARG B 1 615 ? 44.784  86.168  38.933  1.00 21.81  ? 641 ARG B N   1 
ATOM   10451 C CA  . ARG B 1 615 ? 43.830  85.593  37.993  1.00 22.30  ? 641 ARG B CA  1 
ATOM   10452 C C   . ARG B 1 615 ? 43.535  86.644  36.937  1.00 23.96  ? 641 ARG B C   1 
ATOM   10453 O O   . ARG B 1 615 ? 43.451  87.830  37.243  1.00 24.92  ? 641 ARG B O   1 
ATOM   10454 C CB  . ARG B 1 615 ? 42.543  85.180  38.707  1.00 25.36  ? 641 ARG B CB  1 
ATOM   10455 C CG  . ARG B 1 615 ? 42.765  84.192  39.862  1.00 30.38  ? 641 ARG B CG  1 
ATOM   10456 C CD  . ARG B 1 615 ? 41.497  83.943  40.671  1.00 31.11  ? 641 ARG B CD  1 
ATOM   10457 N NE  . ARG B 1 615 ? 40.504  83.183  39.913  1.00 35.33  ? 641 ARG B NE  1 
ATOM   10458 C CZ  . ARG B 1 615 ? 39.246  82.993  40.306  1.00 35.18  ? 641 ARG B CZ  1 
ATOM   10459 N NH1 . ARG B 1 615 ? 38.817  83.506  41.457  1.00 34.58  ? 641 ARG B NH1 1 
ATOM   10460 N NH2 . ARG B 1 615 ? 38.415  82.301  39.538  1.00 33.45  ? 641 ARG B NH2 1 
ATOM   10461 N N   . LEU B 1 616 ? 43.393  86.189  35.695  1.00 24.34  ? 642 LEU B N   1 
ATOM   10462 C CA  . LEU B 1 616 ? 43.122  87.036  34.542  1.00 21.70  ? 642 LEU B CA  1 
ATOM   10463 C C   . LEU B 1 616 ? 41.710  86.801  34.015  1.00 24.97  ? 642 LEU B C   1 
ATOM   10464 O O   . LEU B 1 616 ? 41.293  85.662  33.828  1.00 25.76  ? 642 LEU B O   1 
ATOM   10465 C CB  . LEU B 1 616 ? 44.138  86.712  33.446  1.00 20.35  ? 642 LEU B CB  1 
ATOM   10466 C CG  . LEU B 1 616 ? 44.145  87.514  32.142  1.00 20.98  ? 642 LEU B CG  1 
ATOM   10467 C CD1 . LEU B 1 616 ? 44.435  88.983  32.422  1.00 15.72  ? 642 LEU B CD1 1 
ATOM   10468 C CD2 . LEU B 1 616 ? 45.203  86.923  31.214  1.00 15.43  ? 642 LEU B CD2 1 
ATOM   10469 N N   . PHE B 1 617 ? 40.973  87.880  33.778  1.00 28.38  ? 643 PHE B N   1 
ATOM   10470 C CA  . PHE B 1 617 ? 39.615  87.782  33.253  1.00 28.61  ? 643 PHE B CA  1 
ATOM   10471 C C   . PHE B 1 617 ? 39.405  88.740  32.086  1.00 30.81  ? 643 PHE B C   1 
ATOM   10472 O O   . PHE B 1 617 ? 40.225  89.630  31.814  1.00 32.13  ? 643 PHE B O   1 
ATOM   10473 C CB  . PHE B 1 617 ? 38.558  88.137  34.309  1.00 28.10  ? 643 PHE B CB  1 
ATOM   10474 C CG  . PHE B 1 617 ? 38.543  87.238  35.506  1.00 25.99  ? 643 PHE B CG  1 
ATOM   10475 C CD1 . PHE B 1 617 ? 39.508  87.364  36.501  1.00 28.12  ? 643 PHE B CD1 1 
ATOM   10476 C CD2 . PHE B 1 617 ? 37.535  86.293  35.664  1.00 27.66  ? 643 PHE B CD2 1 
ATOM   10477 C CE1 . PHE B 1 617 ? 39.469  86.560  37.647  1.00 27.38  ? 643 PHE B CE1 1 
ATOM   10478 C CE2 . PHE B 1 617 ? 37.484  85.483  36.799  1.00 27.91  ? 643 PHE B CE2 1 
ATOM   10479 C CZ  . PHE B 1 617 ? 38.454  85.617  37.794  1.00 28.14  ? 643 PHE B CZ  1 
ATOM   10480 N N   . ALA B 1 618 ? 38.274  88.548  31.416  1.00 31.48  ? 644 ALA B N   1 
ATOM   10481 C CA  . ALA B 1 618 ? 37.861  89.368  30.301  1.00 30.58  ? 644 ALA B CA  1 
ATOM   10482 C C   . ALA B 1 618 ? 36.564  90.024  30.759  1.00 33.86  ? 644 ALA B C   1 
ATOM   10483 O O   . ALA B 1 618 ? 35.784  89.411  31.481  1.00 30.00  ? 644 ALA B O   1 
ATOM   10484 C CB  . ALA B 1 618 ? 37.617  88.502  29.099  1.00 30.59  ? 644 ALA B CB  1 
ATOM   10485 N N   . CYS B 1 619 ? 36.343  91.272  30.357  1.00 40.49  ? 645 CYS B N   1 
ATOM   10486 C CA  . CYS B 1 619 ? 35.131  91.994  30.730  1.00 48.29  ? 645 CYS B CA  1 
ATOM   10487 C C   . CYS B 1 619 ? 34.225  92.266  29.551  1.00 53.64  ? 645 CYS B C   1 
ATOM   10488 O O   . CYS B 1 619 ? 34.639  92.183  28.393  1.00 57.01  ? 645 CYS B O   1 
ATOM   10489 C CB  . CYS B 1 619 ? 35.477  93.329  31.372  1.00 49.83  ? 645 CYS B CB  1 
ATOM   10490 S SG  . CYS B 1 619 ? 36.227  93.170  32.962  1.00 56.04  ? 645 CYS B SG  1 
ATOM   10491 N N   . SER B 1 620 ? 32.983  92.617  29.854  1.00 58.93  ? 646 SER B N   1 
ATOM   10492 C CA  . SER B 1 620 ? 32.015  92.918  28.819  1.00 63.93  ? 646 SER B CA  1 
ATOM   10493 C C   . SER B 1 620 ? 30.706  93.393  29.435  1.00 67.53  ? 646 SER B C   1 
ATOM   10494 O O   . SER B 1 620 ? 30.435  93.145  30.611  1.00 65.19  ? 646 SER B O   1 
ATOM   10495 C CB  . SER B 1 620 ? 31.773  91.675  27.963  1.00 63.92  ? 646 SER B CB  1 
ATOM   10496 O OG  . SER B 1 620 ? 30.904  91.968  26.885  1.00 68.55  ? 646 SER B OG  1 
ATOM   10497 N N   . ASN B 1 621 ? 29.909  94.093  28.631  1.00 74.14  ? 647 ASN B N   1 
ATOM   10498 C CA  . ASN B 1 621 ? 28.608  94.607  29.055  1.00 79.09  ? 647 ASN B CA  1 
ATOM   10499 C C   . ASN B 1 621 ? 27.609  94.382  27.916  1.00 82.32  ? 647 ASN B C   1 
ATOM   10500 O O   . ASN B 1 621 ? 26.684  95.170  27.722  1.00 83.04  ? 647 ASN B O   1 
ATOM   10501 C CB  . ASN B 1 621 ? 28.697  96.106  29.379  1.00 78.24  ? 647 ASN B CB  1 
ATOM   10502 C CG  . ASN B 1 621 ? 29.826  96.433  30.343  1.00 78.08  ? 647 ASN B CG  1 
ATOM   10503 O OD1 . ASN B 1 621 ? 31.001  96.348  29.989  1.00 79.32  ? 647 ASN B OD1 1 
ATOM   10504 N ND2 . ASN B 1 621 ? 29.474  96.803  31.569  1.00 77.74  ? 647 ASN B ND2 1 
ATOM   10505 N N   . LYS B 1 622 ? 27.820  93.297  27.172  1.00 86.61  ? 648 LYS B N   1 
ATOM   10506 C CA  . LYS B 1 622 ? 26.987  92.911  26.030  1.00 90.54  ? 648 LYS B CA  1 
ATOM   10507 C C   . LYS B 1 622 ? 25.549  93.428  26.085  1.00 92.02  ? 648 LYS B C   1 
ATOM   10508 O O   . LYS B 1 622 ? 25.183  94.344  25.343  1.00 91.40  ? 648 LYS B O   1 
ATOM   10509 C CB  . LYS B 1 622 ? 26.983  91.380  25.884  1.00 91.98  ? 648 LYS B CB  1 
ATOM   10510 C CG  . LYS B 1 622 ? 26.125  90.852  24.732  1.00 94.01  ? 648 LYS B CG  1 
ATOM   10511 C CD  . LYS B 1 622 ? 26.393  89.372  24.445  1.00 94.38  ? 648 LYS B CD  1 
ATOM   10512 C CE  . LYS B 1 622 ? 25.975  88.463  25.597  1.00 94.86  ? 648 LYS B CE  1 
ATOM   10513 N NZ  . LYS B 1 622 ? 24.500  88.422  25.801  1.00 93.96  ? 648 LYS B NZ  1 
ATOM   10514 N N   . ILE B 1 623 ? 24.739  92.835  26.957  1.00 93.61  ? 649 ILE B N   1 
ATOM   10515 C CA  . ILE B 1 623 ? 23.344  93.241  27.098  1.00 94.48  ? 649 ILE B CA  1 
ATOM   10516 C C   . ILE B 1 623 ? 23.101  93.983  28.411  1.00 93.39  ? 649 ILE B C   1 
ATOM   10517 O O   . ILE B 1 623 ? 22.439  93.471  29.318  1.00 93.53  ? 649 ILE B O   1 
ATOM   10518 C CB  . ILE B 1 623 ? 22.392  92.017  27.007  1.00 95.47  ? 649 ILE B CB  1 
ATOM   10519 C CG1 . ILE B 1 623 ? 22.605  91.297  25.673  1.00 96.70  ? 649 ILE B CG1 1 
ATOM   10520 C CG2 . ILE B 1 623 ? 20.939  92.465  27.101  1.00 95.71  ? 649 ILE B CG2 1 
ATOM   10521 C CD1 . ILE B 1 623 ? 22.408  92.185  24.453  1.00 96.93  ? 649 ILE B CD1 1 
ATOM   10522 N N   . GLY B 1 624 ? 23.653  95.191  28.500  1.00 91.98  ? 650 GLY B N   1 
ATOM   10523 C CA  . GLY B 1 624 ? 23.491  96.020  29.683  1.00 90.08  ? 650 GLY B CA  1 
ATOM   10524 C C   . GLY B 1 624 ? 24.005  95.454  30.995  1.00 87.96  ? 650 GLY B C   1 
ATOM   10525 O O   . GLY B 1 624 ? 24.189  96.197  31.962  1.00 88.41  ? 650 GLY B O   1 
ATOM   10526 N N   . ARG B 1 625 ? 24.241  94.146  31.039  1.00 85.59  ? 651 ARG B N   1 
ATOM   10527 C CA  . ARG B 1 625 ? 24.725  93.501  32.256  1.00 81.95  ? 651 ARG B CA  1 
ATOM   10528 C C   . ARG B 1 625 ? 26.247  93.354  32.229  1.00 77.00  ? 651 ARG B C   1 
ATOM   10529 O O   . ARG B 1 625 ? 26.867  93.421  31.164  1.00 76.55  ? 651 ARG B O   1 
ATOM   10530 C CB  . ARG B 1 625 ? 24.064  92.127  32.411  1.00 84.64  ? 651 ARG B CB  1 
ATOM   10531 C CG  . ARG B 1 625 ? 23.977  91.630  33.847  1.00 88.53  ? 651 ARG B CG  1 
ATOM   10532 C CD  . ARG B 1 625 ? 23.193  92.602  34.729  1.00 92.15  ? 651 ARG B CD  1 
ATOM   10533 N NE  . ARG B 1 625 ? 21.905  92.973  34.140  1.00 94.27  ? 651 ARG B NE  1 
ATOM   10534 C CZ  . ARG B 1 625 ? 21.004  93.761  34.725  1.00 94.70  ? 651 ARG B CZ  1 
ATOM   10535 N NH1 . ARG B 1 625 ? 21.241  94.269  35.928  1.00 94.18  ? 651 ARG B NH1 1 
ATOM   10536 N NH2 . ARG B 1 625 ? 19.866  94.045  34.105  1.00 94.80  ? 651 ARG B NH2 1 
ATOM   10537 N N   . PHE B 1 626 ? 26.842  93.162  33.404  1.00 69.74  ? 652 PHE B N   1 
ATOM   10538 C CA  . PHE B 1 626 ? 28.291  93.008  33.520  1.00 62.80  ? 652 PHE B CA  1 
ATOM   10539 C C   . PHE B 1 626 ? 28.719  91.536  33.562  1.00 59.07  ? 652 PHE B C   1 
ATOM   10540 O O   . PHE B 1 626 ? 28.347  90.798  34.475  1.00 56.87  ? 652 PHE B O   1 
ATOM   10541 C CB  . PHE B 1 626 ? 28.791  93.716  34.780  1.00 59.77  ? 652 PHE B CB  1 
ATOM   10542 C CG  . PHE B 1 626 ? 30.270  93.599  34.991  1.00 56.62  ? 652 PHE B CG  1 
ATOM   10543 C CD1 . PHE B 1 626 ? 31.164  94.149  34.073  1.00 56.86  ? 652 PHE B CD1 1 
ATOM   10544 C CD2 . PHE B 1 626 ? 30.774  92.933  36.101  1.00 54.03  ? 652 PHE B CD2 1 
ATOM   10545 C CE1 . PHE B 1 626 ? 32.538  94.038  34.261  1.00 55.15  ? 652 PHE B CE1 1 
ATOM   10546 C CE2 . PHE B 1 626 ? 32.142  92.815  36.301  1.00 51.95  ? 652 PHE B CE2 1 
ATOM   10547 C CZ  . PHE B 1 626 ? 33.028  93.368  35.380  1.00 54.81  ? 652 PHE B CZ  1 
ATOM   10548 N N   . VAL B 1 627 ? 29.506  91.114  32.577  1.00 54.57  ? 653 VAL B N   1 
ATOM   10549 C CA  . VAL B 1 627 ? 29.967  89.731  32.524  1.00 50.99  ? 653 VAL B CA  1 
ATOM   10550 C C   . VAL B 1 627 ? 31.497  89.589  32.521  1.00 47.67  ? 653 VAL B C   1 
ATOM   10551 O O   . VAL B 1 627 ? 32.214  90.321  31.831  1.00 46.05  ? 653 VAL B O   1 
ATOM   10552 C CB  . VAL B 1 627 ? 29.374  88.997  31.289  1.00 50.82  ? 653 VAL B CB  1 
ATOM   10553 C CG1 . VAL B 1 627 ? 29.596  89.809  30.039  1.00 53.13  ? 653 VAL B CG1 1 
ATOM   10554 C CG2 . VAL B 1 627 ? 30.013  87.636  31.134  1.00 51.80  ? 653 VAL B CG2 1 
ATOM   10555 N N   . ILE B 1 628 ? 31.991  88.648  33.319  1.00 43.17  ? 654 ILE B N   1 
ATOM   10556 C CA  . ILE B 1 628 ? 33.419  88.400  33.395  1.00 41.80  ? 654 ILE B CA  1 
ATOM   10557 C C   . ILE B 1 628 ? 33.684  86.952  33.060  1.00 41.40  ? 654 ILE B C   1 
ATOM   10558 O O   . ILE B 1 628 ? 32.942  86.064  33.465  1.00 42.69  ? 654 ILE B O   1 
ATOM   10559 C CB  . ILE B 1 628 ? 33.996  88.668  34.797  1.00 40.99  ? 654 ILE B CB  1 
ATOM   10560 C CG1 . ILE B 1 628 ? 33.351  87.732  35.819  1.00 38.17  ? 654 ILE B CG1 1 
ATOM   10561 C CG2 . ILE B 1 628 ? 33.795  90.122  35.170  1.00 40.41  ? 654 ILE B CG2 1 
ATOM   10562 C CD1 . ILE B 1 628 ? 34.071  87.709  37.137  1.00 36.19  ? 654 ILE B CD1 1 
ATOM   10563 N N   . GLU B 1 629 ? 34.760  86.725  32.324  1.00 41.25  ? 655 GLU B N   1 
ATOM   10564 C CA  . GLU B 1 629 ? 35.140  85.389  31.911  1.00 39.73  ? 655 GLU B CA  1 
ATOM   10565 C C   . GLU B 1 629 ? 36.629  85.197  32.161  1.00 36.97  ? 655 GLU B C   1 
ATOM   10566 O O   . GLU B 1 629 ? 37.465  85.940  31.658  1.00 34.87  ? 655 GLU B O   1 
ATOM   10567 C CB  . GLU B 1 629 ? 34.806  85.201  30.436  1.00 42.56  ? 655 GLU B CB  1 
ATOM   10568 C CG  . GLU B 1 629 ? 35.305  83.911  29.846  1.00 52.82  ? 655 GLU B CG  1 
ATOM   10569 C CD  . GLU B 1 629 ? 34.730  83.649  28.466  1.00 58.22  ? 655 GLU B CD  1 
ATOM   10570 O OE1 . GLU B 1 629 ? 34.751  84.579  27.621  1.00 60.57  ? 655 GLU B OE1 1 
ATOM   10571 O OE2 . GLU B 1 629 ? 34.265  82.510  28.228  1.00 61.18  ? 655 GLU B OE2 1 
ATOM   10572 N N   . GLU B 1 630 ? 36.953  84.189  32.954  1.00 34.47  ? 656 GLU B N   1 
ATOM   10573 C CA  . GLU B 1 630 ? 38.331  83.896  33.298  1.00 30.78  ? 656 GLU B CA  1 
ATOM   10574 C C   . GLU B 1 630 ? 39.092  83.229  32.158  1.00 28.72  ? 656 GLU B C   1 
ATOM   10575 O O   . GLU B 1 630 ? 38.538  82.414  31.429  1.00 29.67  ? 656 GLU B O   1 
ATOM   10576 C CB  . GLU B 1 630 ? 38.341  82.999  34.535  1.00 31.15  ? 656 GLU B CB  1 
ATOM   10577 C CG  . GLU B 1 630 ? 39.705  82.608  35.052  1.00 30.89  ? 656 GLU B CG  1 
ATOM   10578 C CD  . GLU B 1 630 ? 39.603  81.843  36.354  1.00 32.99  ? 656 GLU B CD  1 
ATOM   10579 O OE1 . GLU B 1 630 ? 38.501  81.314  36.643  1.00 33.12  ? 656 GLU B OE1 1 
ATOM   10580 O OE2 . GLU B 1 630 ? 40.618  81.762  37.081  1.00 32.05  ? 656 GLU B OE2 1 
ATOM   10581 N N   . VAL B 1 631 ? 40.357  83.599  31.985  1.00 26.25  ? 657 VAL B N   1 
ATOM   10582 C CA  . VAL B 1 631 ? 41.172  82.973  30.959  1.00 25.39  ? 657 VAL B CA  1 
ATOM   10583 C C   . VAL B 1 631 ? 42.066  82.002  31.724  1.00 25.73  ? 657 VAL B C   1 
ATOM   10584 O O   . VAL B 1 631 ? 42.887  82.391  32.550  1.00 27.27  ? 657 VAL B O   1 
ATOM   10585 C CB  . VAL B 1 631 ? 41.966  84.025  30.095  1.00 22.58  ? 657 VAL B CB  1 
ATOM   10586 C CG1 . VAL B 1 631 ? 41.971  85.361  30.779  1.00 23.48  ? 657 VAL B CG1 1 
ATOM   10587 C CG2 . VAL B 1 631 ? 43.380  83.531  29.793  1.00 19.82  ? 657 VAL B CG2 1 
ATOM   10588 N N   . PRO B 1 632 ? 41.865  80.700  31.485  1.00 27.10  ? 658 PRO B N   1 
ATOM   10589 C CA  . PRO B 1 632 ? 42.606  79.610  32.124  1.00 26.68  ? 658 PRO B CA  1 
ATOM   10590 C C   . PRO B 1 632 ? 44.056  79.440  31.732  1.00 24.78  ? 658 PRO B C   1 
ATOM   10591 O O   . PRO B 1 632 ? 44.470  79.847  30.650  1.00 22.92  ? 658 PRO B O   1 
ATOM   10592 C CB  . PRO B 1 632 ? 41.771  78.380  31.765  1.00 28.06  ? 658 PRO B CB  1 
ATOM   10593 C CG  . PRO B 1 632 ? 41.246  78.735  30.419  1.00 30.12  ? 658 PRO B CG  1 
ATOM   10594 C CD  . PRO B 1 632 ? 40.818  80.168  30.595  1.00 27.10  ? 658 PRO B CD  1 
ATOM   10595 N N   . GLY B 1 633 ? 44.822  78.830  32.634  1.00 23.43  ? 659 GLY B N   1 
ATOM   10596 C CA  . GLY B 1 633 ? 46.224  78.566  32.369  1.00 23.31  ? 659 GLY B CA  1 
ATOM   10597 C C   . GLY B 1 633 ? 47.198  79.668  32.716  1.00 23.63  ? 659 GLY B C   1 
ATOM   10598 O O   . GLY B 1 633 ? 46.865  80.620  33.421  1.00 25.12  ? 659 GLY B O   1 
ATOM   10599 N N   . GLU B 1 634 ? 48.418  79.520  32.212  1.00 26.24  ? 660 GLU B N   1 
ATOM   10600 C CA  . GLU B 1 634 ? 49.493  80.477  32.434  1.00 30.22  ? 660 GLU B CA  1 
ATOM   10601 C C   . GLU B 1 634 ? 49.227  81.752  31.655  1.00 29.51  ? 660 GLU B C   1 
ATOM   10602 O O   . GLU B 1 634 ? 48.773  81.709  30.508  1.00 27.94  ? 660 GLU B O   1 
ATOM   10603 C CB  . GLU B 1 634 ? 50.816  79.866  31.991  1.00 34.20  ? 660 GLU B CB  1 
ATOM   10604 C CG  . GLU B 1 634 ? 51.114  78.577  32.715  1.00 46.42  ? 660 GLU B CG  1 
ATOM   10605 C CD  . GLU B 1 634 ? 52.122  77.717  31.994  1.00 54.38  ? 660 GLU B CD  1 
ATOM   10606 O OE1 . GLU B 1 634 ? 52.422  76.615  32.511  1.00 57.64  ? 660 GLU B OE1 1 
ATOM   10607 O OE2 . GLU B 1 634 ? 52.608  78.138  30.915  1.00 57.81  ? 660 GLU B OE2 1 
ATOM   10608 N N   . PHE B 1 635 ? 49.511  82.886  32.283  1.00 29.95  ? 661 PHE B N   1 
ATOM   10609 C CA  . PHE B 1 635 ? 49.287  84.174  31.646  1.00 31.25  ? 661 PHE B CA  1 
ATOM   10610 C C   . PHE B 1 635 ? 50.146  84.319  30.402  1.00 29.23  ? 661 PHE B C   1 
ATOM   10611 O O   . PHE B 1 635 ? 51.353  84.106  30.449  1.00 29.74  ? 661 PHE B O   1 
ATOM   10612 C CB  . PHE B 1 635 ? 49.573  85.308  32.633  1.00 29.96  ? 661 PHE B CB  1 
ATOM   10613 C CG  . PHE B 1 635 ? 48.833  85.172  33.935  1.00 32.42  ? 661 PHE B CG  1 
ATOM   10614 C CD1 . PHE B 1 635 ? 47.535  84.668  33.963  1.00 33.31  ? 661 PHE B CD1 1 
ATOM   10615 C CD2 . PHE B 1 635 ? 49.438  85.526  35.137  1.00 35.45  ? 661 PHE B CD2 1 
ATOM   10616 C CE1 . PHE B 1 635 ? 46.853  84.513  35.171  1.00 34.81  ? 661 PHE B CE1 1 
ATOM   10617 C CE2 . PHE B 1 635 ? 48.765  85.376  36.350  1.00 35.02  ? 661 PHE B CE2 1 
ATOM   10618 C CZ  . PHE B 1 635 ? 47.472  84.867  36.367  1.00 33.70  ? 661 PHE B CZ  1 
ATOM   10619 N N   . MET B 1 636 ? 49.511  84.673  29.289  1.00 29.54  ? 662 MET B N   1 
ATOM   10620 C CA  . MET B 1 636 ? 50.219  84.840  28.025  1.00 31.08  ? 662 MET B CA  1 
ATOM   10621 C C   . MET B 1 636 ? 49.788  86.088  27.270  1.00 30.20  ? 662 MET B C   1 
ATOM   10622 O O   . MET B 1 636 ? 48.599  86.405  27.172  1.00 29.44  ? 662 MET B O   1 
ATOM   10623 C CB  . MET B 1 636 ? 50.002  83.622  27.129  1.00 35.35  ? 662 MET B CB  1 
ATOM   10624 C CG  . MET B 1 636 ? 50.349  82.302  27.774  1.00 40.54  ? 662 MET B CG  1 
ATOM   10625 S SD  . MET B 1 636 ? 50.554  81.032  26.534  1.00 47.58  ? 662 MET B SD  1 
ATOM   10626 C CE  . MET B 1 636 ? 52.367  80.875  26.577  1.00 45.51  ? 662 MET B CE  1 
ATOM   10627 N N   . GLN B 1 637 ? 50.769  86.783  26.716  1.00 29.72  ? 663 GLN B N   1 
ATOM   10628 C CA  . GLN B 1 637 ? 50.513  88.005  25.978  1.00 29.37  ? 663 GLN B CA  1 
ATOM   10629 C C   . GLN B 1 637 ? 49.506  87.796  24.852  1.00 30.08  ? 663 GLN B C   1 
ATOM   10630 O O   . GLN B 1 637 ? 48.739  88.698  24.523  1.00 29.43  ? 663 GLN B O   1 
ATOM   10631 C CB  . GLN B 1 637 ? 51.839  88.553  25.447  1.00 30.09  ? 663 GLN B CB  1 
ATOM   10632 C CG  . GLN B 1 637 ? 51.743  89.876  24.722  1.00 30.90  ? 663 GLN B CG  1 
ATOM   10633 C CD  . GLN B 1 637 ? 53.068  90.601  24.689  1.00 29.92  ? 663 GLN B CD  1 
ATOM   10634 O OE1 . GLN B 1 637 ? 54.103  90.032  25.037  1.00 31.87  ? 663 GLN B OE1 1 
ATOM   10635 N NE2 . GLN B 1 637 ? 53.048  91.862  24.270  1.00 27.11  ? 663 GLN B NE2 1 
ATOM   10636 N N   . GLU B 1 638 ? 49.484  86.594  24.287  1.00 32.14  ? 664 GLU B N   1 
ATOM   10637 C CA  . GLU B 1 638 ? 48.565  86.285  23.204  1.00 33.81  ? 664 GLU B CA  1 
ATOM   10638 C C   . GLU B 1 638 ? 47.104  86.292  23.635  1.00 33.13  ? 664 GLU B C   1 
ATOM   10639 O O   . GLU B 1 638 ? 46.219  86.480  22.807  1.00 35.31  ? 664 GLU B O   1 
ATOM   10640 C CB  . GLU B 1 638 ? 48.907  84.925  22.590  1.00 39.15  ? 664 GLU B CB  1 
ATOM   10641 C CG  . GLU B 1 638 ? 50.369  84.775  22.186  1.00 47.59  ? 664 GLU B CG  1 
ATOM   10642 C CD  . GLU B 1 638 ? 51.274  84.418  23.364  1.00 52.95  ? 664 GLU B CD  1 
ATOM   10643 O OE1 . GLU B 1 638 ? 51.136  83.293  23.897  1.00 59.11  ? 664 GLU B OE1 1 
ATOM   10644 O OE2 . GLU B 1 638 ? 52.117  85.253  23.760  1.00 51.62  ? 664 GLU B OE2 1 
ATOM   10645 N N   . ASP B 1 639 ? 46.837  86.084  24.920  1.00 33.38  ? 665 ASP B N   1 
ATOM   10646 C CA  . ASP B 1 639 ? 45.451  86.081  25.396  1.00 32.42  ? 665 ASP B CA  1 
ATOM   10647 C C   . ASP B 1 639 ? 44.873  87.482  25.586  1.00 30.29  ? 665 ASP B C   1 
ATOM   10648 O O   . ASP B 1 639 ? 43.713  87.629  25.953  1.00 31.06  ? 665 ASP B O   1 
ATOM   10649 C CB  . ASP B 1 639 ? 45.326  85.311  26.717  1.00 34.88  ? 665 ASP B CB  1 
ATOM   10650 C CG  . ASP B 1 639 ? 45.708  83.846  26.583  1.00 36.60  ? 665 ASP B CG  1 
ATOM   10651 O OD1 . ASP B 1 639 ? 45.189  83.168  25.674  1.00 34.12  ? 665 ASP B OD1 1 
ATOM   10652 O OD2 . ASP B 1 639 ? 46.525  83.368  27.398  1.00 39.37  ? 665 ASP B OD2 1 
ATOM   10653 N N   . LEU B 1 640 ? 45.678  88.507  25.337  1.00 28.52  ? 666 LEU B N   1 
ATOM   10654 C CA  . LEU B 1 640 ? 45.224  89.885  25.490  1.00 29.69  ? 666 LEU B CA  1 
ATOM   10655 C C   . LEU B 1 640 ? 44.668  90.422  24.169  1.00 29.56  ? 666 LEU B C   1 
ATOM   10656 O O   . LEU B 1 640 ? 45.365  91.119  23.435  1.00 28.61  ? 666 LEU B O   1 
ATOM   10657 C CB  . LEU B 1 640 ? 46.387  90.775  25.973  1.00 30.38  ? 666 LEU B CB  1 
ATOM   10658 C CG  . LEU B 1 640 ? 46.632  91.084  27.462  1.00 29.30  ? 666 LEU B CG  1 
ATOM   10659 C CD1 . LEU B 1 640 ? 46.385  89.884  28.326  1.00 27.90  ? 666 LEU B CD1 1 
ATOM   10660 C CD2 . LEU B 1 640 ? 48.055  91.567  27.642  1.00 28.27  ? 666 LEU B CD2 1 
ATOM   10661 N N   . ALA B 1 641 ? 43.409  90.096  23.876  1.00 28.97  ? 667 ALA B N   1 
ATOM   10662 C CA  . ALA B 1 641 ? 42.762  90.543  22.640  1.00 28.84  ? 667 ALA B CA  1 
ATOM   10663 C C   . ALA B 1 641 ? 42.736  92.073  22.561  1.00 27.83  ? 667 ALA B C   1 
ATOM   10664 O O   . ALA B 1 641 ? 42.185  92.732  23.444  1.00 27.30  ? 667 ALA B O   1 
ATOM   10665 C CB  . ALA B 1 641 ? 41.341  89.981  22.564  1.00 28.50  ? 667 ALA B CB  1 
ATOM   10666 N N   . THR B 1 642 ? 43.318  92.634  21.499  1.00 26.23  ? 668 THR B N   1 
ATOM   10667 C CA  . THR B 1 642 ? 43.379  94.083  21.354  1.00 27.17  ? 668 THR B CA  1 
ATOM   10668 C C   . THR B 1 642 ? 42.039  94.787  21.352  1.00 27.11  ? 668 THR B C   1 
ATOM   10669 O O   . THR B 1 642 ? 41.988  96.009  21.445  1.00 29.78  ? 668 THR B O   1 
ATOM   10670 C CB  . THR B 1 642 ? 44.148  94.517  20.093  1.00 28.20  ? 668 THR B CB  1 
ATOM   10671 O OG1 . THR B 1 642 ? 43.400  94.178  18.921  1.00 30.45  ? 668 THR B OG1 1 
ATOM   10672 C CG2 . THR B 1 642 ? 45.508  93.859  20.055  1.00 27.96  ? 668 THR B CG2 1 
ATOM   10673 N N   . ASP B 1 643 ? 40.955  94.031  21.248  1.00 26.96  ? 669 ASP B N   1 
ATOM   10674 C CA  . ASP B 1 643 ? 39.632  94.644  21.266  1.00 29.39  ? 669 ASP B CA  1 
ATOM   10675 C C   . ASP B 1 643 ? 38.845  94.248  22.512  1.00 29.93  ? 669 ASP B C   1 
ATOM   10676 O O   . ASP B 1 643 ? 37.620  94.312  22.525  1.00 29.49  ? 669 ASP B O   1 
ATOM   10677 C CB  . ASP B 1 643 ? 38.850  94.268  20.008  1.00 29.28  ? 669 ASP B CB  1 
ATOM   10678 C CG  . ASP B 1 643 ? 38.490  92.803  19.960  1.00 30.08  ? 669 ASP B CG  1 
ATOM   10679 O OD1 . ASP B 1 643 ? 39.324  91.962  20.354  1.00 29.02  ? 669 ASP B OD1 1 
ATOM   10680 O OD2 . ASP B 1 643 ? 37.369  92.492  19.505  1.00 34.56  ? 669 ASP B OD2 1 
ATOM   10681 N N   . ASP B 1 644 ? 39.565  93.849  23.558  1.00 31.64  ? 670 ASP B N   1 
ATOM   10682 C CA  . ASP B 1 644 ? 38.959  93.454  24.828  1.00 33.35  ? 670 ASP B CA  1 
ATOM   10683 C C   . ASP B 1 644 ? 39.451  94.288  26.022  1.00 32.34  ? 670 ASP B C   1 
ATOM   10684 O O   . ASP B 1 644 ? 40.422  95.041  25.927  1.00 31.64  ? 670 ASP B O   1 
ATOM   10685 C CB  . ASP B 1 644 ? 39.259  91.978  25.117  1.00 36.46  ? 670 ASP B CB  1 
ATOM   10686 C CG  . ASP B 1 644 ? 38.040  91.091  24.963  1.00 40.99  ? 670 ASP B CG  1 
ATOM   10687 O OD1 . ASP B 1 644 ? 36.941  91.513  25.379  1.00 42.69  ? 670 ASP B OD1 1 
ATOM   10688 O OD2 . ASP B 1 644 ? 38.181  89.967  24.440  1.00 44.36  ? 670 ASP B OD2 1 
ATOM   10689 N N   . VAL B 1 645 ? 38.758  94.158  27.147  1.00 30.88  ? 671 VAL B N   1 
ATOM   10690 C CA  . VAL B 1 645 ? 39.159  94.840  28.370  1.00 29.95  ? 671 VAL B CA  1 
ATOM   10691 C C   . VAL B 1 645 ? 39.412  93.683  29.323  1.00 29.77  ? 671 VAL B C   1 
ATOM   10692 O O   . VAL B 1 645 ? 38.494  92.915  29.613  1.00 30.23  ? 671 VAL B O   1 
ATOM   10693 C CB  . VAL B 1 645 ? 38.048  95.751  28.955  1.00 29.90  ? 671 VAL B CB  1 
ATOM   10694 C CG1 . VAL B 1 645 ? 38.501  96.306  30.293  1.00 27.80  ? 671 VAL B CG1 1 
ATOM   10695 C CG2 . VAL B 1 645 ? 37.754  96.907  28.008  1.00 29.24  ? 671 VAL B CG2 1 
ATOM   10696 N N   . MET B 1 646 ? 40.657  93.553  29.780  1.00 27.68  ? 672 MET B N   1 
ATOM   10697 C CA  . MET B 1 646 ? 41.055  92.478  30.682  1.00 25.41  ? 672 MET B CA  1 
ATOM   10698 C C   . MET B 1 646 ? 41.281  92.965  32.113  1.00 27.27  ? 672 MET B C   1 
ATOM   10699 O O   . MET B 1 646 ? 41.666  94.122  32.347  1.00 23.47  ? 672 MET B O   1 
ATOM   10700 C CB  . MET B 1 646 ? 42.355  91.833  30.193  1.00 24.35  ? 672 MET B CB  1 
ATOM   10701 C CG  . MET B 1 646 ? 42.432  91.562  28.690  1.00 24.40  ? 672 MET B CG  1 
ATOM   10702 S SD  . MET B 1 646 ? 41.216  90.366  28.131  1.00 27.70  ? 672 MET B SD  1 
ATOM   10703 C CE  . MET B 1 646 ? 42.008  88.821  28.634  1.00 17.29  ? 672 MET B CE  1 
ATOM   10704 N N   . LEU B 1 647 ? 41.047  92.063  33.065  1.00 26.31  ? 673 LEU B N   1 
ATOM   10705 C CA  . LEU B 1 647 ? 41.259  92.352  34.478  1.00 23.24  ? 673 LEU B CA  1 
ATOM   10706 C C   . LEU B 1 647 ? 42.321  91.395  35.025  1.00 22.30  ? 673 LEU B C   1 
ATOM   10707 O O   . LEU B 1 647 ? 42.110  90.185  35.045  1.00 21.63  ? 673 LEU B O   1 
ATOM   10708 C CB  . LEU B 1 647 ? 39.968  92.163  35.279  1.00 23.56  ? 673 LEU B CB  1 
ATOM   10709 C CG  . LEU B 1 647 ? 38.807  93.144  35.099  1.00 26.17  ? 673 LEU B CG  1 
ATOM   10710 C CD1 . LEU B 1 647 ? 37.665  92.741  36.019  1.00 27.29  ? 673 LEU B CD1 1 
ATOM   10711 C CD2 . LEU B 1 647 ? 39.251  94.556  35.417  1.00 27.82  ? 673 LEU B CD2 1 
ATOM   10712 N N   . LEU B 1 648 ? 43.467  91.930  35.431  1.00 21.00  ? 674 LEU B N   1 
ATOM   10713 C CA  . LEU B 1 648 ? 44.521  91.112  36.015  1.00 21.87  ? 674 LEU B CA  1 
ATOM   10714 C C   . LEU B 1 648 ? 44.339  91.393  37.495  1.00 23.97  ? 674 LEU B C   1 
ATOM   10715 O O   . LEU B 1 648 ? 44.674  92.469  37.988  1.00 24.04  ? 674 LEU B O   1 
ATOM   10716 C CB  . LEU B 1 648 ? 45.913  91.565  35.570  1.00 20.10  ? 674 LEU B CB  1 
ATOM   10717 C CG  . LEU B 1 648 ? 47.023  90.505  35.635  1.00 20.53  ? 674 LEU B CG  1 
ATOM   10718 C CD1 . LEU B 1 648 ? 48.377  91.181  35.667  1.00 21.03  ? 674 LEU B CD1 1 
ATOM   10719 C CD2 . LEU B 1 648 ? 46.872  89.645  36.865  1.00 20.34  ? 674 LEU B CD2 1 
ATOM   10720 N N   . ASP B 1 649 ? 43.798  90.412  38.196  1.00 27.30  ? 675 ASP B N   1 
ATOM   10721 C CA  . ASP B 1 649 ? 43.505  90.543  39.606  1.00 30.35  ? 675 ASP B CA  1 
ATOM   10722 C C   . ASP B 1 649 ? 44.543  89.932  40.520  1.00 32.58  ? 675 ASP B C   1 
ATOM   10723 O O   . ASP B 1 649 ? 44.587  88.726  40.708  1.00 32.87  ? 675 ASP B O   1 
ATOM   10724 C CB  . ASP B 1 649 ? 42.127  89.916  39.889  1.00 32.78  ? 675 ASP B CB  1 
ATOM   10725 C CG  . ASP B 1 649 ? 41.771  89.854  41.377  1.00 32.18  ? 675 ASP B CG  1 
ATOM   10726 O OD1 . ASP B 1 649 ? 42.534  90.351  42.210  1.00 31.34  ? 675 ASP B OD1 1 
ATOM   10727 O OD2 . ASP B 1 649 ? 40.702  89.300  41.715  1.00 30.67  ? 675 ASP B OD2 1 
ATOM   10728 N N   . THR B 1 650 ? 45.410  90.755  41.071  1.00 32.92  ? 676 THR B N   1 
ATOM   10729 C CA  . THR B 1 650 ? 46.356  90.233  42.047  1.00 36.76  ? 676 THR B CA  1 
ATOM   10730 C C   . THR B 1 650 ? 45.490  90.379  43.281  1.00 38.83  ? 676 THR B C   1 
ATOM   10731 O O   . THR B 1 650 ? 44.325  90.826  43.192  1.00 40.76  ? 676 THR B O   1 
ATOM   10732 C CB  . THR B 1 650 ? 47.583  91.172  42.220  1.00 37.47  ? 676 THR B CB  1 
ATOM   10733 O OG1 . THR B 1 650 ? 48.284  91.348  40.980  1.00 38.27  ? 676 THR B OG1 1 
ATOM   10734 C CG2 . THR B 1 650 ? 48.533  90.617  43.245  1.00 43.29  ? 676 THR B CG2 1 
ATOM   10735 N N   . TRP B 1 651 ? 45.963  90.046  44.475  1.00 37.39  ? 677 TRP B N   1 
ATOM   10736 C CA  . TRP B 1 651 ? 45.099  90.264  45.646  1.00 37.37  ? 677 TRP B CA  1 
ATOM   10737 C C   . TRP B 1 651 ? 45.263  91.749  46.040  1.00 37.07  ? 677 TRP B C   1 
ATOM   10738 O O   . TRP B 1 651 ? 44.328  92.459  46.320  1.00 34.81  ? 677 TRP B O   1 
ATOM   10739 C CB  . TRP B 1 651 ? 45.552  89.347  46.763  1.00 39.01  ? 677 TRP B CB  1 
ATOM   10740 C CG  . TRP B 1 651 ? 44.530  89.205  47.782  1.00 42.49  ? 677 TRP B CG  1 
ATOM   10741 C CD1 . TRP B 1 651 ? 44.644  89.502  49.096  1.00 43.83  ? 677 TRP B CD1 1 
ATOM   10742 C CD2 . TRP B 1 651 ? 43.233  88.645  47.609  1.00 42.94  ? 677 TRP B CD2 1 
ATOM   10743 N NE1 . TRP B 1 651 ? 43.504  89.147  49.762  1.00 46.59  ? 677 TRP B NE1 1 
ATOM   10744 C CE2 . TRP B 1 651 ? 42.618  88.618  48.872  1.00 46.26  ? 677 TRP B CE2 1 
ATOM   10745 C CE3 . TRP B 1 651 ? 42.517  88.157  46.495  1.00 48.82  ? 677 TRP B CE3 1 
ATOM   10746 C CZ2 . TRP B 1 651 ? 41.326  88.122  49.071  1.00 50.69  ? 677 TRP B CZ2 1 
ATOM   10747 C CZ3 . TRP B 1 651 ? 41.234  87.659  46.695  1.00 55.97  ? 677 TRP B CZ3 1 
ATOM   10748 C CH2 . TRP B 1 651 ? 40.655  87.641  47.971  1.00 55.00  ? 677 TRP B CH2 1 
ATOM   10749 N N   . ASP B 1 652 ? 46.512  92.229  46.022  1.00 36.02  ? 678 ASP B N   1 
ATOM   10750 C CA  . ASP B 1 652 ? 46.767  93.632  46.362  1.00 35.80  ? 678 ASP B CA  1 
ATOM   10751 C C   . ASP B 1 652 ? 46.021  94.704  45.613  1.00 33.42  ? 678 ASP B C   1 
ATOM   10752 O O   . ASP B 1 652 ? 45.525  95.738  46.160  1.00 32.35  ? 678 ASP B O   1 
ATOM   10753 C CB  . ASP B 1 652 ? 48.241  93.917  46.260  1.00 40.57  ? 678 ASP B CB  1 
ATOM   10754 C CG  . ASP B 1 652 ? 49.038  93.074  47.144  1.00 44.13  ? 678 ASP B CG  1 
ATOM   10755 O OD1 . ASP B 1 652 ? 48.728  93.087  48.359  1.00 46.29  ? 678 ASP B OD1 1 
ATOM   10756 O OD2 . ASP B 1 652 ? 49.914  92.367  46.659  1.00 48.81  ? 678 ASP B OD2 1 
ATOM   10757 N N   . GLN B 1 653 ? 45.947  94.503  44.307  1.00 31.09  ? 679 GLN B N   1 
ATOM   10758 C CA  . GLN B 1 653 ? 45.323  95.423  43.429  1.00 28.50  ? 679 GLN B CA  1 
ATOM   10759 C C   . GLN B 1 653 ? 44.692  94.757  42.232  1.00 24.67  ? 679 GLN B C   1 
ATOM   10760 O O   . GLN B 1 653 ? 44.879  93.573  41.970  1.00 22.07  ? 679 GLN B O   1 
ATOM   10761 C CB  . GLN B 1 653 ? 46.359  96.460  42.981  1.00 32.53  ? 679 GLN B CB  1 
ATOM   10762 C CG  . GLN B 1 653 ? 47.532  95.930  42.189  1.00 34.89  ? 679 GLN B CG  1 
ATOM   10763 C CD  . GLN B 1 653 ? 48.563  97.019  41.934  1.00 41.07  ? 679 GLN B CD  1 
ATOM   10764 O OE1 . GLN B 1 653 ? 48.222  98.127  41.502  1.00 40.94  ? 679 GLN B OE1 1 
ATOM   10765 N NE2 . GLN B 1 653 ? 49.829  96.711  42.197  1.00 41.90  ? 679 GLN B NE2 1 
ATOM   10766 N N   . VAL B 1 654 ? 43.921  95.552  41.509  1.00 21.06  ? 680 VAL B N   1 
ATOM   10767 C CA  . VAL B 1 654 ? 43.255  95.060  40.335  1.00 19.89  ? 680 VAL B CA  1 
ATOM   10768 C C   . VAL B 1 654 ? 43.747  95.879  39.170  1.00 20.04  ? 680 VAL B C   1 
ATOM   10769 O O   . VAL B 1 654 ? 43.607  97.095  39.157  1.00 21.32  ? 680 VAL B O   1 
ATOM   10770 C CB  . VAL B 1 654 ? 41.716  95.209  40.469  1.00 21.60  ? 680 VAL B CB  1 
ATOM   10771 C CG1 . VAL B 1 654 ? 41.045  94.856  39.165  1.00 20.53  ? 680 VAL B CG1 1 
ATOM   10772 C CG2 . VAL B 1 654 ? 41.201  94.293  41.572  1.00 21.39  ? 680 VAL B CG2 1 
ATOM   10773 N N   . PHE B 1 655 ? 44.357  95.207  38.203  1.00 20.59  ? 681 PHE B N   1 
ATOM   10774 C CA  . PHE B 1 655 ? 44.834  95.866  36.992  1.00 18.06  ? 681 PHE B CA  1 
ATOM   10775 C C   . PHE B 1 655 ? 43.746  95.698  35.939  1.00 18.92  ? 681 PHE B C   1 
ATOM   10776 O O   . PHE B 1 655 ? 43.180  94.623  35.798  1.00 18.88  ? 681 PHE B O   1 
ATOM   10777 C CB  . PHE B 1 655 ? 46.094  95.192  36.454  1.00 13.96  ? 681 PHE B CB  1 
ATOM   10778 C CG  . PHE B 1 655 ? 47.356  95.557  37.181  1.00 16.39  ? 681 PHE B CG  1 
ATOM   10779 C CD1 . PHE B 1 655 ? 48.007  96.759  36.910  1.00 18.72  ? 681 PHE B CD1 1 
ATOM   10780 C CD2 . PHE B 1 655 ? 47.943  94.663  38.074  1.00 16.25  ? 681 PHE B CD2 1 
ATOM   10781 C CE1 . PHE B 1 655 ? 49.224  97.058  37.509  1.00 15.42  ? 681 PHE B CE1 1 
ATOM   10782 C CE2 . PHE B 1 655 ? 49.153  94.958  38.673  1.00 18.96  ? 681 PHE B CE2 1 
ATOM   10783 C CZ  . PHE B 1 655 ? 49.798  96.161  38.386  1.00 17.17  ? 681 PHE B CZ  1 
ATOM   10784 N N   . VAL B 1 656 ? 43.430  96.761  35.219  1.00 21.47  ? 682 VAL B N   1 
ATOM   10785 C CA  . VAL B 1 656 ? 42.456  96.658  34.149  1.00 22.31  ? 682 VAL B CA  1 
ATOM   10786 C C   . VAL B 1 656 ? 43.196  97.104  32.892  1.00 21.67  ? 682 VAL B C   1 
ATOM   10787 O O   . VAL B 1 656 ? 43.614  98.258  32.779  1.00 21.45  ? 682 VAL B O   1 
ATOM   10788 C CB  . VAL B 1 656 ? 41.182  97.519  34.420  1.00 24.14  ? 682 VAL B CB  1 
ATOM   10789 C CG1 . VAL B 1 656 ? 41.557  98.862  35.003  1.00 28.43  ? 682 VAL B CG1 1 
ATOM   10790 C CG2 . VAL B 1 656 ? 40.397  97.693  33.137  1.00 25.37  ? 682 VAL B CG2 1 
ATOM   10791 N N   . TRP B 1 657 ? 43.391  96.154  31.973  1.00 20.68  ? 683 TRP B N   1 
ATOM   10792 C CA  . TRP B 1 657 ? 44.103  96.383  30.711  1.00 18.57  ? 683 TRP B CA  1 
ATOM   10793 C C   . TRP B 1 657 ? 43.108  96.706  29.596  1.00 19.02  ? 683 TRP B C   1 
ATOM   10794 O O   . TRP B 1 657 ? 42.196  95.933  29.348  1.00 19.96  ? 683 TRP B O   1 
ATOM   10795 C CB  . TRP B 1 657 ? 44.878  95.119  30.363  1.00 16.89  ? 683 TRP B CB  1 
ATOM   10796 C CG  . TRP B 1 657 ? 45.764  95.199  29.160  1.00 17.61  ? 683 TRP B CG  1 
ATOM   10797 C CD1 . TRP B 1 657 ? 47.074  95.556  29.139  1.00 16.49  ? 683 TRP B CD1 1 
ATOM   10798 C CD2 . TRP B 1 657 ? 45.411  94.876  27.809  1.00 16.27  ? 683 TRP B CD2 1 
ATOM   10799 N NE1 . TRP B 1 657 ? 47.564  95.475  27.862  1.00 19.31  ? 683 TRP B NE1 1 
ATOM   10800 C CE2 . TRP B 1 657 ? 46.563  95.063  27.023  1.00 17.47  ? 683 TRP B CE2 1 
ATOM   10801 C CE3 . TRP B 1 657 ? 44.229  94.451  27.186  1.00 17.52  ? 683 TRP B CE3 1 
ATOM   10802 C CZ2 . TRP B 1 657 ? 46.581  94.833  25.641  1.00 19.98  ? 683 TRP B CZ2 1 
ATOM   10803 C CZ3 . TRP B 1 657 ? 44.244  94.221  25.802  1.00 22.20  ? 683 TRP B CZ3 1 
ATOM   10804 C CH2 . TRP B 1 657 ? 45.412  94.416  25.049  1.00 21.08  ? 683 TRP B CH2 1 
ATOM   10805 N N   . VAL B 1 658 ? 43.270  97.839  28.921  1.00 20.62  ? 684 VAL B N   1 
ATOM   10806 C CA  . VAL B 1 658 ? 42.334  98.183  27.856  1.00 22.17  ? 684 VAL B CA  1 
ATOM   10807 C C   . VAL B 1 658 ? 42.955  98.037  26.471  1.00 25.48  ? 684 VAL B C   1 
ATOM   10808 O O   . VAL B 1 658 ? 43.971  98.667  26.154  1.00 24.30  ? 684 VAL B O   1 
ATOM   10809 C CB  . VAL B 1 658 ? 41.778  99.633  28.007  1.00 24.62  ? 684 VAL B CB  1 
ATOM   10810 C CG1 . VAL B 1 658 ? 41.440  99.921  29.473  1.00 23.32  ? 684 VAL B CG1 1 
ATOM   10811 C CG2 . VAL B 1 658 ? 42.767  100.637 27.481  1.00 26.69  ? 684 VAL B CG2 1 
ATOM   10812 N N   . GLY B 1 659 ? 42.337  97.185  25.652  1.00 26.04  ? 685 GLY B N   1 
ATOM   10813 C CA  . GLY B 1 659 ? 42.821  96.969  24.305  1.00 24.69  ? 685 GLY B CA  1 
ATOM   10814 C C   . GLY B 1 659 ? 42.616  98.220  23.484  1.00 26.07  ? 685 GLY B C   1 
ATOM   10815 O O   . GLY B 1 659 ? 41.613  98.913  23.635  1.00 24.35  ? 685 GLY B O   1 
ATOM   10816 N N   . LYS B 1 660 ? 43.568  98.507  22.609  1.00 30.41  ? 686 LYS B N   1 
ATOM   10817 C CA  . LYS B 1 660 ? 43.496  99.689  21.765  1.00 35.85  ? 686 LYS B CA  1 
ATOM   10818 C C   . LYS B 1 660 ? 42.255  99.716  20.875  1.00 36.04  ? 686 LYS B C   1 
ATOM   10819 O O   . LYS B 1 660 ? 41.785  100.790 20.494  1.00 35.53  ? 686 LYS B O   1 
ATOM   10820 C CB  . LYS B 1 660 ? 44.742  99.779  20.877  1.00 40.08  ? 686 LYS B CB  1 
ATOM   10821 C CG  . LYS B 1 660 ? 44.837  101.086 20.115  1.00 47.32  ? 686 LYS B CG  1 
ATOM   10822 C CD  . LYS B 1 660 ? 45.573  100.938 18.791  1.00 54.70  ? 686 LYS B CD  1 
ATOM   10823 C CE  . LYS B 1 660 ? 47.010  100.476 18.974  1.00 58.15  ? 686 LYS B CE  1 
ATOM   10824 N NZ  . LYS B 1 660 ? 47.720  100.448 17.659  1.00 59.75  ? 686 LYS B NZ  1 
ATOM   10825 N N   . ASP B 1 661 ? 41.721  98.544  20.546  1.00 35.93  ? 687 ASP B N   1 
ATOM   10826 C CA  . ASP B 1 661 ? 40.557  98.478  19.670  1.00 37.99  ? 687 ASP B CA  1 
ATOM   10827 C C   . ASP B 1 661 ? 39.215  98.237  20.341  1.00 39.10  ? 687 ASP B C   1 
ATOM   10828 O O   . ASP B 1 661 ? 38.210  97.994  19.666  1.00 38.40  ? 687 ASP B O   1 
ATOM   10829 C CB  . ASP B 1 661 ? 40.794  97.425  18.591  1.00 38.96  ? 687 ASP B CB  1 
ATOM   10830 C CG  . ASP B 1 661 ? 41.974  97.767  17.712  1.00 40.76  ? 687 ASP B CG  1 
ATOM   10831 O OD1 . ASP B 1 661 ? 41.933  98.852  17.094  1.00 39.69  ? 687 ASP B OD1 1 
ATOM   10832 O OD2 . ASP B 1 661 ? 42.939  96.969  17.645  1.00 41.77  ? 687 ASP B OD2 1 
ATOM   10833 N N   . SER B 1 662 ? 39.199  98.304  21.665  1.00 39.90  ? 688 SER B N   1 
ATOM   10834 C CA  . SER B 1 662 ? 37.969  98.119  22.412  1.00 42.23  ? 688 SER B CA  1 
ATOM   10835 C C   . SER B 1 662 ? 37.086  99.328  22.134  1.00 44.84  ? 688 SER B C   1 
ATOM   10836 O O   . SER B 1 662 ? 37.575  100.350 21.659  1.00 43.91  ? 688 SER B O   1 
ATOM   10837 C CB  . SER B 1 662 ? 38.282  97.999  23.911  1.00 42.67  ? 688 SER B CB  1 
ATOM   10838 O OG  . SER B 1 662 ? 39.266  98.939  24.320  1.00 38.53  ? 688 SER B OG  1 
ATOM   10839 N N   . GLN B 1 663 ? 35.791  99.217  22.414  1.00 50.58  ? 689 GLN B N   1 
ATOM   10840 C CA  . GLN B 1 663 ? 34.875  100.333 22.181  1.00 56.37  ? 689 GLN B CA  1 
ATOM   10841 C C   . GLN B 1 663 ? 35.140  101.496 23.124  1.00 57.58  ? 689 GLN B C   1 
ATOM   10842 O O   . GLN B 1 663 ? 35.460  101.298 24.293  1.00 58.74  ? 689 GLN B O   1 
ATOM   10843 C CB  . GLN B 1 663 ? 33.425  99.889  22.355  1.00 59.97  ? 689 GLN B CB  1 
ATOM   10844 C CG  . GLN B 1 663 ? 32.960  98.866  21.350  1.00 66.51  ? 689 GLN B CG  1 
ATOM   10845 C CD  . GLN B 1 663 ? 31.502  98.525  21.531  1.00 70.44  ? 689 GLN B CD  1 
ATOM   10846 O OE1 . GLN B 1 663 ? 31.079  98.131  22.620  1.00 71.84  ? 689 GLN B OE1 1 
ATOM   10847 N NE2 . GLN B 1 663 ? 30.719  98.674  20.465  1.00 73.14  ? 689 GLN B NE2 1 
ATOM   10848 N N   . ASP B 1 664 ? 34.989  102.709 22.610  1.00 59.28  ? 690 ASP B N   1 
ATOM   10849 C CA  . ASP B 1 664 ? 35.206  103.908 23.402  1.00 60.29  ? 690 ASP B CA  1 
ATOM   10850 C C   . ASP B 1 664 ? 34.485  103.834 24.743  1.00 60.39  ? 690 ASP B C   1 
ATOM   10851 O O   . ASP B 1 664 ? 35.032  104.252 25.759  1.00 60.36  ? 690 ASP B O   1 
ATOM   10852 C CB  . ASP B 1 664 ? 34.730  105.137 22.627  1.00 61.79  ? 690 ASP B CB  1 
ATOM   10853 C CG  . ASP B 1 664 ? 35.843  106.131 22.371  1.00 62.98  ? 690 ASP B CG  1 
ATOM   10854 O OD1 . ASP B 1 664 ? 36.956  105.697 22.007  1.00 62.51  ? 690 ASP B OD1 1 
ATOM   10855 O OD2 . ASP B 1 664 ? 35.602  107.347 22.521  1.00 66.62  ? 690 ASP B OD2 1 
ATOM   10856 N N   . GLU B 1 665 ? 33.268  103.297 24.755  1.00 60.93  ? 691 GLU B N   1 
ATOM   10857 C CA  . GLU B 1 665 ? 32.513  103.205 26.003  1.00 62.74  ? 691 GLU B CA  1 
ATOM   10858 C C   . GLU B 1 665 ? 33.205  102.272 26.990  1.00 61.84  ? 691 GLU B C   1 
ATOM   10859 O O   . GLU B 1 665 ? 33.191  102.508 28.198  1.00 62.69  ? 691 GLU B O   1 
ATOM   10860 C CB  . GLU B 1 665 ? 31.101  102.664 25.773  1.00 65.26  ? 691 GLU B CB  1 
ATOM   10861 C CG  . GLU B 1 665 ? 30.421  103.065 24.487  1.00 71.72  ? 691 GLU B CG  1 
ATOM   10862 C CD  . GLU B 1 665 ? 29.090  102.350 24.329  1.00 74.82  ? 691 GLU B CD  1 
ATOM   10863 O OE1 . GLU B 1 665 ? 28.978  101.206 24.826  1.00 75.27  ? 691 GLU B OE1 1 
ATOM   10864 O OE2 . GLU B 1 665 ? 28.164  102.915 23.705  1.00 75.41  ? 691 GLU B OE2 1 
ATOM   10865 N N   . GLU B 1 666 ? 33.794  101.201 26.469  1.00 60.32  ? 692 GLU B N   1 
ATOM   10866 C CA  . GLU B 1 666 ? 34.474  100.219 27.304  1.00 57.58  ? 692 GLU B CA  1 
ATOM   10867 C C   . GLU B 1 666 ? 35.693  100.773 28.036  1.00 56.10  ? 692 GLU B C   1 
ATOM   10868 O O   . GLU B 1 666 ? 35.862  100.533 29.228  1.00 54.97  ? 692 GLU B O   1 
ATOM   10869 C CB  . GLU B 1 666 ? 34.879  99.010  26.456  1.00 58.45  ? 692 GLU B CB  1 
ATOM   10870 C CG  . GLU B 1 666 ? 33.734  98.054  26.126  1.00 59.78  ? 692 GLU B CG  1 
ATOM   10871 C CD  . GLU B 1 666 ? 33.293  97.220  27.325  1.00 61.73  ? 692 GLU B CD  1 
ATOM   10872 O OE1 . GLU B 1 666 ? 34.156  96.574  27.959  1.00 63.30  ? 692 GLU B OE1 1 
ATOM   10873 O OE2 . GLU B 1 666 ? 32.082  97.198  27.630  1.00 62.08  ? 692 GLU B OE2 1 
ATOM   10874 N N   . LYS B 1 667 ? 36.540  101.517 27.333  1.00 55.07  ? 693 LYS B N   1 
ATOM   10875 C CA  . LYS B 1 667 ? 37.741  102.068 27.956  1.00 54.62  ? 693 LYS B CA  1 
ATOM   10876 C C   . LYS B 1 667 ? 37.456  103.307 28.794  1.00 53.38  ? 693 LYS B C   1 
ATOM   10877 O O   . LYS B 1 667 ? 38.308  103.774 29.552  1.00 53.06  ? 693 LYS B O   1 
ATOM   10878 C CB  . LYS B 1 667 ? 38.792  102.386 26.888  1.00 54.76  ? 693 LYS B CB  1 
ATOM   10879 C CG  . LYS B 1 667 ? 38.354  103.382 25.847  1.00 54.82  ? 693 LYS B CG  1 
ATOM   10880 C CD  . LYS B 1 667 ? 39.420  103.546 24.781  1.00 56.16  ? 693 LYS B CD  1 
ATOM   10881 C CE  . LYS B 1 667 ? 39.596  102.277 23.968  1.00 56.55  ? 693 LYS B CE  1 
ATOM   10882 N NZ  . LYS B 1 667 ? 40.670  102.434 22.946  1.00 55.99  ? 693 LYS B NZ  1 
ATOM   10883 N N   . THR B 1 668 ? 36.246  103.830 28.659  1.00 51.54  ? 694 THR B N   1 
ATOM   10884 C CA  . THR B 1 668 ? 35.836  105.008 29.403  1.00 48.51  ? 694 THR B CA  1 
ATOM   10885 C C   . THR B 1 668 ? 35.209  104.508 30.705  1.00 46.19  ? 694 THR B C   1 
ATOM   10886 O O   . THR B 1 668 ? 35.086  105.240 31.684  1.00 43.52  ? 694 THR B O   1 
ATOM   10887 C CB  . THR B 1 668 ? 34.808  105.835 28.572  1.00 46.51  ? 694 THR B CB  1 
ATOM   10888 O OG1 . THR B 1 668 ? 34.978  107.227 28.849  1.00 50.94  ? 694 THR B OG1 1 
ATOM   10889 C CG2 . THR B 1 668 ? 33.379  105.442 28.914  1.00 48.52  ? 694 THR B CG2 1 
ATOM   10890 N N   . GLU B 1 669 ? 34.845  103.229 30.692  1.00 45.67  ? 695 GLU B N   1 
ATOM   10891 C CA  . GLU B 1 669 ? 34.209  102.560 31.819  1.00 45.18  ? 695 GLU B CA  1 
ATOM   10892 C C   . GLU B 1 669 ? 35.162  101.625 32.565  1.00 41.08  ? 695 GLU B C   1 
ATOM   10893 O O   . GLU B 1 669 ? 34.739  100.882 33.450  1.00 37.05  ? 695 GLU B O   1 
ATOM   10894 C CB  . GLU B 1 669 ? 33.013  101.750 31.314  1.00 51.80  ? 695 GLU B CB  1 
ATOM   10895 C CG  . GLU B 1 669 ? 31.744  101.936 32.120  1.00 59.94  ? 695 GLU B CG  1 
ATOM   10896 C CD  . GLU B 1 669 ? 31.144  103.314 31.935  1.00 64.27  ? 695 GLU B CD  1 
ATOM   10897 O OE1 . GLU B 1 669 ? 31.869  104.312 32.138  1.00 67.07  ? 695 GLU B OE1 1 
ATOM   10898 O OE2 . GLU B 1 669 ? 29.946  103.395 31.587  1.00 67.73  ? 695 GLU B OE2 1 
ATOM   10899 N N   . ALA B 1 670 ? 36.441  101.665 32.200  1.00 39.51  ? 696 ALA B N   1 
ATOM   10900 C CA  . ALA B 1 670 ? 37.464  100.822 32.824  1.00 36.89  ? 696 ALA B CA  1 
ATOM   10901 C C   . ALA B 1 670 ? 37.356  100.751 34.350  1.00 35.01  ? 696 ALA B C   1 
ATOM   10902 O O   . ALA B 1 670 ? 37.089  99.685  34.906  1.00 34.92  ? 696 ALA B O   1 
ATOM   10903 C CB  . ALA B 1 670 ? 38.840  101.313 32.427  1.00 39.49  ? 696 ALA B CB  1 
ATOM   10904 N N   . LEU B 1 671 ? 37.565  101.881 35.025  1.00 31.15  ? 697 LEU B N   1 
ATOM   10905 C CA  . LEU B 1 671 ? 37.486  101.919 36.482  1.00 31.95  ? 697 LEU B CA  1 
ATOM   10906 C C   . LEU B 1 671 ? 36.202  101.312 37.039  1.00 32.55  ? 697 LEU B C   1 
ATOM   10907 O O   . LEU B 1 671 ? 36.242  100.507 37.969  1.00 32.46  ? 697 LEU B O   1 
ATOM   10908 C CB  . LEU B 1 671 ? 37.606  103.354 37.001  1.00 32.92  ? 697 LEU B CB  1 
ATOM   10909 C CG  . LEU B 1 671 ? 38.992  103.997 37.100  1.00 36.66  ? 697 LEU B CG  1 
ATOM   10910 C CD1 . LEU B 1 671 ? 38.848  105.394 37.686  1.00 36.33  ? 697 LEU B CD1 1 
ATOM   10911 C CD2 . LEU B 1 671 ? 39.904  103.156 37.978  1.00 38.21  ? 697 LEU B CD2 1 
ATOM   10912 N N   . THR B 1 672 ? 35.064  101.706 36.474  1.00 32.23  ? 698 THR B N   1 
ATOM   10913 C CA  . THR B 1 672 ? 33.767  101.210 36.927  1.00 31.86  ? 698 THR B CA  1 
ATOM   10914 C C   . THR B 1 672 ? 33.678  99.687  36.858  1.00 31.28  ? 698 THR B C   1 
ATOM   10915 O O   . THR B 1 672 ? 33.146  99.050  37.771  1.00 31.45  ? 698 THR B O   1 
ATOM   10916 C CB  . THR B 1 672 ? 32.628  101.794 36.078  1.00 32.52  ? 698 THR B CB  1 
ATOM   10917 O OG1 . THR B 1 672 ? 32.841  103.197 35.892  1.00 39.00  ? 698 THR B OG1 1 
ATOM   10918 C CG2 . THR B 1 672 ? 31.302  101.601 36.775  1.00 31.41  ? 698 THR B CG2 1 
ATOM   10919 N N   . SER B 1 673 ? 34.188  99.110  35.770  1.00 29.61  ? 699 SER B N   1 
ATOM   10920 C CA  . SER B 1 673 ? 34.164  97.660  35.590  1.00 26.99  ? 699 SER B CA  1 
ATOM   10921 C C   . SER B 1 673 ? 34.955  97.001  36.703  1.00 26.82  ? 699 SER B C   1 
ATOM   10922 O O   . SER B 1 673 ? 34.517  96.012  37.291  1.00 23.11  ? 699 SER B O   1 
ATOM   10923 C CB  . SER B 1 673 ? 34.776  97.272  34.242  1.00 27.26  ? 699 SER B CB  1 
ATOM   10924 O OG  . SER B 1 673 ? 34.039  97.826  33.176  1.00 28.05  ? 699 SER B OG  1 
ATOM   10925 N N   . ALA B 1 674 ? 36.127  97.565  36.981  1.00 26.85  ? 700 ALA B N   1 
ATOM   10926 C CA  . ALA B 1 674 ? 36.994  97.047  38.021  1.00 27.44  ? 700 ALA B CA  1 
ATOM   10927 C C   . ALA B 1 674 ? 36.289  97.063  39.375  1.00 29.92  ? 700 ALA B C   1 
ATOM   10928 O O   . ALA B 1 674 ? 36.273  96.053  40.081  1.00 27.19  ? 700 ALA B O   1 
ATOM   10929 C CB  . ALA B 1 674 ? 38.271  97.859  38.079  1.00 25.50  ? 700 ALA B CB  1 
ATOM   10930 N N   . LYS B 1 675 ? 35.702  98.202  39.740  1.00 32.85  ? 701 LYS B N   1 
ATOM   10931 C CA  . LYS B 1 675 ? 35.004  98.306  41.024  1.00 36.79  ? 701 LYS B CA  1 
ATOM   10932 C C   . LYS B 1 675 ? 33.885  97.288  41.076  1.00 36.08  ? 701 LYS B C   1 
ATOM   10933 O O   . LYS B 1 675 ? 33.711  96.582  42.069  1.00 33.09  ? 701 LYS B O   1 
ATOM   10934 C CB  . LYS B 1 675 ? 34.431  99.715  41.229  1.00 37.98  ? 701 LYS B CB  1 
ATOM   10935 C CG  . LYS B 1 675 ? 35.439  100.708 41.786  1.00 45.02  ? 701 LYS B CG  1 
ATOM   10936 C CD  . LYS B 1 675 ? 34.800  102.056 42.127  1.00 50.98  ? 701 LYS B CD  1 
ATOM   10937 C CE  . LYS B 1 675 ? 34.406  102.837 40.876  1.00 52.50  ? 701 LYS B CE  1 
ATOM   10938 N NZ  . LYS B 1 675 ? 33.874  104.193 41.210  1.00 55.79  ? 701 LYS B NZ  1 
ATOM   10939 N N   . ARG B 1 676 ? 33.133  97.233  39.984  1.00 38.76  ? 702 ARG B N   1 
ATOM   10940 C CA  . ARG B 1 676 ? 32.021  96.311  39.825  1.00 38.66  ? 702 ARG B CA  1 
ATOM   10941 C C   . ARG B 1 676 ? 32.518  94.887  40.072  1.00 35.63  ? 702 ARG B C   1 
ATOM   10942 O O   . ARG B 1 676 ? 31.852  94.087  40.727  1.00 34.38  ? 702 ARG B O   1 
ATOM   10943 C CB  . ARG B 1 676 ? 31.477  96.446  38.410  1.00 43.72  ? 702 ARG B CB  1 
ATOM   10944 C CG  . ARG B 1 676 ? 30.398  95.470  38.058  1.00 54.51  ? 702 ARG B CG  1 
ATOM   10945 C CD  . ARG B 1 676 ? 29.055  95.852  38.650  1.00 64.30  ? 702 ARG B CD  1 
ATOM   10946 N NE  . ARG B 1 676 ? 27.992  95.023  38.083  1.00 73.53  ? 702 ARG B NE  1 
ATOM   10947 C CZ  . ARG B 1 676 ? 26.691  95.221  38.279  1.00 77.83  ? 702 ARG B CZ  1 
ATOM   10948 N NH1 . ARG B 1 676 ? 26.274  96.228  39.036  1.00 80.62  ? 702 ARG B NH1 1 
ATOM   10949 N NH2 . ARG B 1 676 ? 25.808  94.410  37.710  1.00 80.12  ? 702 ARG B NH2 1 
ATOM   10950 N N   . TYR B 1 677 ? 33.699  94.580  39.548  1.00 30.24  ? 703 TYR B N   1 
ATOM   10951 C CA  . TYR B 1 677 ? 34.293  93.268  39.730  1.00 28.48  ? 703 TYR B CA  1 
ATOM   10952 C C   . TYR B 1 677 ? 34.559  92.991  41.209  1.00 30.81  ? 703 TYR B C   1 
ATOM   10953 O O   . TYR B 1 677 ? 34.299  91.894  41.708  1.00 30.94  ? 703 TYR B O   1 
ATOM   10954 C CB  . TYR B 1 677 ? 35.597  93.180  38.935  1.00 27.04  ? 703 TYR B CB  1 
ATOM   10955 C CG  . TYR B 1 677 ? 36.465  91.997  39.297  1.00 25.40  ? 703 TYR B CG  1 
ATOM   10956 C CD1 . TYR B 1 677 ? 37.488  92.123  40.236  1.00 23.60  ? 703 TYR B CD1 1 
ATOM   10957 C CD2 . TYR B 1 677 ? 36.260  90.748  38.706  1.00 23.02  ? 703 TYR B CD2 1 
ATOM   10958 C CE1 . TYR B 1 677 ? 38.287  91.039  40.575  1.00 23.85  ? 703 TYR B CE1 1 
ATOM   10959 C CE2 . TYR B 1 677 ? 37.051  89.663  39.038  1.00 22.51  ? 703 TYR B CE2 1 
ATOM   10960 C CZ  . TYR B 1 677 ? 38.066  89.816  39.970  1.00 22.86  ? 703 TYR B CZ  1 
ATOM   10961 O OH  . TYR B 1 677 ? 38.883  88.762  40.278  1.00 20.33  ? 703 TYR B OH  1 
ATOM   10962 N N   . ILE B 1 678 ? 35.071  93.995  41.914  1.00 32.65  ? 704 ILE B N   1 
ATOM   10963 C CA  . ILE B 1 678 ? 35.377  93.849  43.326  1.00 35.78  ? 704 ILE B CA  1 
ATOM   10964 C C   . ILE B 1 678 ? 34.135  93.798  44.203  1.00 38.24  ? 704 ILE B C   1 
ATOM   10965 O O   . ILE B 1 678 ? 34.100  93.045  45.174  1.00 40.15  ? 704 ILE B O   1 
ATOM   10966 C CB  . ILE B 1 678 ? 36.293  94.984  43.808  1.00 38.42  ? 704 ILE B CB  1 
ATOM   10967 C CG1 . ILE B 1 678 ? 37.650  94.870  43.113  1.00 38.55  ? 704 ILE B CG1 1 
ATOM   10968 C CG2 . ILE B 1 678 ? 36.466  94.918  45.322  1.00 38.27  ? 704 ILE B CG2 1 
ATOM   10969 C CD1 . ILE B 1 678 ? 38.589  96.012  43.424  1.00 43.66  ? 704 ILE B CD1 1 
ATOM   10970 N N   . ASP B 1 679 ? 33.117  94.588  43.868  1.00 40.59  ? 705 ASP B N   1 
ATOM   10971 C CA  . ASP B 1 679 ? 31.882  94.591  44.654  1.00 43.11  ? 705 ASP B CA  1 
ATOM   10972 C C   . ASP B 1 679 ? 31.169  93.249  44.575  1.00 42.87  ? 705 ASP B C   1 
ATOM   10973 O O   . ASP B 1 679 ? 30.434  92.879  45.483  1.00 41.08  ? 705 ASP B O   1 
ATOM   10974 C CB  . ASP B 1 679 ? 30.922  95.694  44.186  1.00 44.83  ? 705 ASP B CB  1 
ATOM   10975 C CG  . ASP B 1 679 ? 31.439  97.095  44.493  1.00 50.00  ? 705 ASP B CG  1 
ATOM   10976 O OD1 . ASP B 1 679 ? 32.090  97.270  45.548  1.00 53.20  ? 705 ASP B OD1 1 
ATOM   10977 O OD2 . ASP B 1 679 ? 31.185  98.023  43.690  1.00 49.89  ? 705 ASP B OD2 1 
ATOM   10978 N N   . THR B 1 680 ? 31.410  92.524  43.487  1.00 46.57  ? 706 THR B N   1 
ATOM   10979 C CA  . THR B 1 680 ? 30.788  91.223  43.232  1.00 47.81  ? 706 THR B CA  1 
ATOM   10980 C C   . THR B 1 680 ? 31.603  90.021  43.706  1.00 47.68  ? 706 THR B C   1 
ATOM   10981 O O   . THR B 1 680 ? 31.105  88.896  43.722  1.00 46.26  ? 706 THR B O   1 
ATOM   10982 C CB  . THR B 1 680 ? 30.538  91.045  41.728  1.00 48.51  ? 706 THR B CB  1 
ATOM   10983 O OG1 . THR B 1 680 ? 29.740  92.132  41.251  1.00 51.97  ? 706 THR B OG1 1 
ATOM   10984 C CG2 . THR B 1 680 ? 29.814  89.739  41.452  1.00 53.72  ? 706 THR B CG2 1 
ATOM   10985 N N   . ASP B 1 681 ? 32.852  90.255  44.088  1.00 49.01  ? 707 ASP B N   1 
ATOM   10986 C CA  . ASP B 1 681 ? 33.712  89.168  44.525  1.00 49.51  ? 707 ASP B CA  1 
ATOM   10987 C C   . ASP B 1 681 ? 33.159  88.442  45.743  1.00 48.39  ? 707 ASP B C   1 
ATOM   10988 O O   . ASP B 1 681 ? 32.695  89.068  46.694  1.00 48.92  ? 707 ASP B O   1 
ATOM   10989 C CB  . ASP B 1 681 ? 35.119  89.686  44.817  1.00 52.02  ? 707 ASP B CB  1 
ATOM   10990 C CG  . ASP B 1 681 ? 36.134  88.567  44.928  1.00 51.94  ? 707 ASP B CG  1 
ATOM   10991 O OD1 . ASP B 1 681 ? 36.032  87.772  45.879  1.00 56.34  ? 707 ASP B OD1 1 
ATOM   10992 O OD2 . ASP B 1 681 ? 37.028  88.474  44.063  1.00 51.49  ? 707 ASP B OD2 1 
ATOM   10993 N N   . PRO B 1 682 ? 33.200  87.099  45.719  1.00 47.49  ? 708 PRO B N   1 
ATOM   10994 C CA  . PRO B 1 682 ? 32.717  86.226  46.796  1.00 46.14  ? 708 PRO B CA  1 
ATOM   10995 C C   . PRO B 1 682 ? 33.516  86.400  48.081  1.00 44.23  ? 708 PRO B C   1 
ATOM   10996 O O   . PRO B 1 682 ? 32.980  86.273  49.182  1.00 43.39  ? 708 PRO B O   1 
ATOM   10997 C CB  . PRO B 1 682 ? 32.893  84.824  46.211  1.00 46.69  ? 708 PRO B CB  1 
ATOM   10998 C CG  . PRO B 1 682 ? 32.806  85.047  44.732  1.00 48.24  ? 708 PRO B CG  1 
ATOM   10999 C CD  . PRO B 1 682 ? 33.625  86.297  44.559  1.00 47.99  ? 708 PRO B CD  1 
ATOM   11000 N N   . ALA B 1 683 ? 34.803  86.689  47.920  1.00 42.27  ? 709 ALA B N   1 
ATOM   11001 C CA  . ALA B 1 683 ? 35.715  86.870  49.038  1.00 43.16  ? 709 ALA B CA  1 
ATOM   11002 C C   . ALA B 1 683 ? 35.369  88.042  49.956  1.00 42.59  ? 709 ALA B C   1 
ATOM   11003 O O   . ALA B 1 683 ? 35.883  88.125  51.071  1.00 42.02  ? 709 ALA B O   1 
ATOM   11004 C CB  . ALA B 1 683 ? 37.144  87.020  48.511  1.00 41.97  ? 709 ALA B CB  1 
ATOM   11005 N N   . HIS B 1 684 ? 34.494  88.935  49.499  1.00 44.34  ? 710 HIS B N   1 
ATOM   11006 C CA  . HIS B 1 684 ? 34.101  90.107  50.285  1.00 45.38  ? 710 HIS B CA  1 
ATOM   11007 C C   . HIS B 1 684 ? 35.330  90.899  50.700  1.00 44.16  ? 710 HIS B C   1 
ATOM   11008 O O   . HIS B 1 684 ? 35.511  91.260  51.864  1.00 42.30  ? 710 HIS B O   1 
ATOM   11009 C CB  . HIS B 1 684 ? 33.304  89.695  51.528  1.00 48.63  ? 710 HIS B CB  1 
ATOM   11010 C CG  . HIS B 1 684 ? 31.906  89.257  51.224  1.00 53.24  ? 710 HIS B CG  1 
ATOM   11011 N ND1 . HIS B 1 684 ? 30.903  89.261  52.169  1.00 56.29  ? 710 HIS B ND1 1 
ATOM   11012 C CD2 . HIS B 1 684 ? 31.340  88.813  50.077  1.00 55.70  ? 710 HIS B CD2 1 
ATOM   11013 C CE1 . HIS B 1 684 ? 29.778  88.841  51.617  1.00 57.15  ? 710 HIS B CE1 1 
ATOM   11014 N NE2 . HIS B 1 684 ? 30.016  88.562  50.348  1.00 57.97  ? 710 HIS B NE2 1 
ATOM   11015 N N   . ARG B 1 685 ? 36.175  91.170  49.721  1.00 44.55  ? 711 ARG B N   1 
ATOM   11016 C CA  . ARG B 1 685 ? 37.403  91.905  49.953  1.00 46.23  ? 711 ARG B CA  1 
ATOM   11017 C C   . ARG B 1 685 ? 37.147  93.400  50.111  1.00 45.87  ? 711 ARG B C   1 
ATOM   11018 O O   . ARG B 1 685 ? 36.063  93.901  49.793  1.00 45.20  ? 711 ARG B O   1 
ATOM   11019 C CB  . ARG B 1 685 ? 38.353  91.633  48.793  1.00 46.34  ? 711 ARG B CB  1 
ATOM   11020 C CG  . ARG B 1 685 ? 37.605  91.528  47.489  1.00 46.88  ? 711 ARG B CG  1 
ATOM   11021 C CD  . ARG B 1 685 ? 38.341  90.686  46.480  1.00 47.10  ? 711 ARG B CD  1 
ATOM   11022 N NE  . ARG B 1 685 ? 39.654  91.235  46.178  1.00 43.37  ? 711 ARG B NE  1 
ATOM   11023 C CZ  . ARG B 1 685 ? 40.322  90.962  45.070  1.00 40.17  ? 711 ARG B CZ  1 
ATOM   11024 N NH1 . ARG B 1 685 ? 39.793  90.151  44.168  1.00 39.12  ? 711 ARG B NH1 1 
ATOM   11025 N NH2 . ARG B 1 685 ? 41.516  91.497  44.870  1.00 40.43  ? 711 ARG B NH2 1 
ATOM   11026 N N   . ASP B 1 686 ? 38.158  94.108  50.603  1.00 45.30  ? 712 ASP B N   1 
ATOM   11027 C CA  . ASP B 1 686 ? 38.046  95.541  50.818  1.00 45.06  ? 712 ASP B CA  1 
ATOM   11028 C C   . ASP B 1 686 ? 37.612  96.315  49.569  1.00 43.15  ? 712 ASP B C   1 
ATOM   11029 O O   . ASP B 1 686 ? 38.221  96.217  48.505  1.00 42.14  ? 712 ASP B O   1 
ATOM   11030 C CB  . ASP B 1 686 ? 39.376  96.097  51.327  1.00 45.75  ? 712 ASP B CB  1 
ATOM   11031 C CG  . ASP B 1 686 ? 39.193  97.352  52.140  1.00 47.02  ? 712 ASP B CG  1 
ATOM   11032 O OD1 . ASP B 1 686 ? 38.360  98.199  51.746  1.00 43.70  ? 712 ASP B OD1 1 
ATOM   11033 O OD2 . ASP B 1 686 ? 39.879  97.490  53.173  1.00 50.51  ? 712 ASP B OD2 1 
ATOM   11034 N N   . ARG B 1 687 ? 36.555  97.097  49.711  1.00 43.83  ? 713 ARG B N   1 
ATOM   11035 C CA  . ARG B 1 687 ? 36.049  97.889  48.602  1.00 46.48  ? 713 ARG B CA  1 
ATOM   11036 C C   . ARG B 1 687 ? 37.037  99.010  48.263  1.00 43.03  ? 713 ARG B C   1 
ATOM   11037 O O   . ARG B 1 687 ? 36.853  99.742  47.290  1.00 42.25  ? 713 ARG B O   1 
ATOM   11038 C CB  . ARG B 1 687 ? 34.687  98.487  48.976  1.00 52.22  ? 713 ARG B CB  1 
ATOM   11039 C CG  . ARG B 1 687 ? 33.741  97.490  49.635  1.00 59.48  ? 713 ARG B CG  1 
ATOM   11040 C CD  . ARG B 1 687 ? 32.370  98.087  49.957  1.00 65.96  ? 713 ARG B CD  1 
ATOM   11041 N NE  . ARG B 1 687 ? 31.518  98.232  48.776  1.00 71.81  ? 713 ARG B NE  1 
ATOM   11042 C CZ  . ARG B 1 687 ? 31.630  99.202  47.871  1.00 75.43  ? 713 ARG B CZ  1 
ATOM   11043 N NH1 . ARG B 1 687 ? 30.802  99.239  46.832  1.00 76.18  ? 713 ARG B NH1 1 
ATOM   11044 N NH2 . ARG B 1 687 ? 32.557  100.146 48.003  1.00 76.73  ? 713 ARG B NH2 1 
ATOM   11045 N N   . ARG B 1 688 ? 38.087  99.130  49.072  1.00 39.70  ? 714 ARG B N   1 
ATOM   11046 C CA  . ARG B 1 688 ? 39.104  100.163 48.886  1.00 35.11  ? 714 ARG B CA  1 
ATOM   11047 C C   . ARG B 1 688 ? 40.316  99.673  48.101  1.00 29.78  ? 714 ARG B C   1 
ATOM   11048 O O   . ARG B 1 688 ? 41.261  100.429 47.863  1.00 26.02  ? 714 ARG B O   1 
ATOM   11049 C CB  . ARG B 1 688 ? 39.576  100.693 50.247  1.00 37.79  ? 714 ARG B CB  1 
ATOM   11050 C CG  . ARG B 1 688 ? 38.515  101.421 51.071  1.00 41.06  ? 714 ARG B CG  1 
ATOM   11051 C CD  . ARG B 1 688 ? 39.100  101.852 52.413  1.00 46.01  ? 714 ARG B CD  1 
ATOM   11052 N NE  . ARG B 1 688 ? 39.551  100.703 53.200  1.00 49.33  ? 714 ARG B NE  1 
ATOM   11053 C CZ  . ARG B 1 688 ? 40.280  100.779 54.312  1.00 49.59  ? 714 ARG B CZ  1 
ATOM   11054 N NH1 . ARG B 1 688 ? 40.660  101.961 54.787  1.00 51.53  ? 714 ARG B NH1 1 
ATOM   11055 N NH2 . ARG B 1 688 ? 40.629  99.667  54.951  1.00 46.78  ? 714 ARG B NH2 1 
ATOM   11056 N N   . THR B 1 689 ? 40.291  98.409  47.702  1.00 24.98  ? 715 THR B N   1 
ATOM   11057 C CA  . THR B 1 689 ? 41.393  97.838  46.952  1.00 23.43  ? 715 THR B CA  1 
ATOM   11058 C C   . THR B 1 689 ? 41.788  98.759  45.795  1.00 23.80  ? 715 THR B C   1 
ATOM   11059 O O   . THR B 1 689 ? 40.939  99.211  45.016  1.00 23.51  ? 715 THR B O   1 
ATOM   11060 C CB  . THR B 1 689 ? 41.011  96.456  46.387  1.00 23.94  ? 715 THR B CB  1 
ATOM   11061 O OG1 . THR B 1 689 ? 40.546  95.624  47.454  1.00 27.93  ? 715 THR B OG1 1 
ATOM   11062 C CG2 . THR B 1 689 ? 42.217  95.790  45.702  1.00 19.71  ? 715 THR B CG2 1 
ATOM   11063 N N   . PRO B 1 690 ? 43.086  99.066  45.678  1.00 22.60  ? 716 PRO B N   1 
ATOM   11064 C CA  . PRO B 1 690 ? 43.531  99.939  44.585  1.00 22.07  ? 716 PRO B CA  1 
ATOM   11065 C C   . PRO B 1 690 ? 43.261  99.340  43.200  1.00 20.39  ? 716 PRO B C   1 
ATOM   11066 O O   . PRO B 1 690 ? 43.372  98.132  43.004  1.00 19.66  ? 716 PRO B O   1 
ATOM   11067 C CB  . PRO B 1 690 ? 45.023  100.135 44.874  1.00 21.80  ? 716 PRO B CB  1 
ATOM   11068 C CG  . PRO B 1 690 ? 45.392  98.938  45.705  1.00 23.66  ? 716 PRO B CG  1 
ATOM   11069 C CD  . PRO B 1 690 ? 44.194  98.739  46.589  1.00 21.09  ? 716 PRO B CD  1 
ATOM   11070 N N   . ILE B 1 691 ? 42.880  100.207 42.264  1.00 19.16  ? 717 ILE B N   1 
ATOM   11071 C CA  . ILE B 1 691 ? 42.574  99.847  40.880  1.00 17.83  ? 717 ILE B CA  1 
ATOM   11072 C C   . ILE B 1 691 ? 43.524  100.615 39.958  1.00 18.95  ? 717 ILE B C   1 
ATOM   11073 O O   . ILE B 1 691 ? 43.639  101.842 40.048  1.00 19.23  ? 717 ILE B O   1 
ATOM   11074 C CB  . ILE B 1 691 ? 41.148  100.254 40.495  1.00 16.37  ? 717 ILE B CB  1 
ATOM   11075 C CG1 . ILE B 1 691 ? 40.135  99.522  41.374  1.00 15.30  ? 717 ILE B CG1 1 
ATOM   11076 C CG2 . ILE B 1 691 ? 40.906  99.941  39.027  1.00 18.06  ? 717 ILE B CG2 1 
ATOM   11077 C CD1 . ILE B 1 691 ? 38.703  99.958  41.144  1.00 11.04  ? 717 ILE B CD1 1 
ATOM   11078 N N   . THR B 1 692 ? 44.180  99.897  39.056  1.00 14.72  ? 718 THR B N   1 
ATOM   11079 C CA  . THR B 1 692 ? 45.132  100.515 38.156  1.00 14.94  ? 718 THR B CA  1 
ATOM   11080 C C   . THR B 1 692 ? 44.810  100.245 36.690  1.00 16.98  ? 718 THR B C   1 
ATOM   11081 O O   . THR B 1 692 ? 44.830  99.099  36.243  1.00 15.24  ? 718 THR B O   1 
ATOM   11082 C CB  . THR B 1 692 ? 46.525  100.021 38.507  1.00 13.24  ? 718 THR B CB  1 
ATOM   11083 O OG1 . THR B 1 692 ? 46.803  100.389 39.866  1.00 19.40  ? 718 THR B OG1 1 
ATOM   11084 C CG2 . THR B 1 692 ? 47.557  100.634 37.616  1.00 13.53  ? 718 THR B CG2 1 
ATOM   11085 N N   . VAL B 1 693 ? 44.505  101.319 35.961  1.00 16.52  ? 719 VAL B N   1 
ATOM   11086 C CA  . VAL B 1 693 ? 44.137  101.256 34.549  1.00 18.27  ? 719 VAL B CA  1 
ATOM   11087 C C   . VAL B 1 693 ? 45.371  101.308 33.671  1.00 20.06  ? 719 VAL B C   1 
ATOM   11088 O O   . VAL B 1 693 ? 46.104  102.297 33.669  1.00 20.39  ? 719 VAL B O   1 
ATOM   11089 C CB  . VAL B 1 693 ? 43.206  102.434 34.155  1.00 19.96  ? 719 VAL B CB  1 
ATOM   11090 C CG1 . VAL B 1 693 ? 42.936  102.413 32.664  1.00 19.65  ? 719 VAL B CG1 1 
ATOM   11091 C CG2 . VAL B 1 693 ? 41.902  102.348 34.922  1.00 20.91  ? 719 VAL B CG2 1 
ATOM   11092 N N   . VAL B 1 694 ? 45.572  100.249 32.898  1.00 21.63  ? 720 VAL B N   1 
ATOM   11093 C CA  . VAL B 1 694 ? 46.728  100.130 32.020  1.00 22.71  ? 720 VAL B CA  1 
ATOM   11094 C C   . VAL B 1 694 ? 46.358  100.100 30.527  1.00 22.79  ? 720 VAL B C   1 
ATOM   11095 O O   . VAL B 1 694 ? 45.352  99.513  30.140  1.00 23.70  ? 720 VAL B O   1 
ATOM   11096 C CB  . VAL B 1 694 ? 47.508  98.871  32.439  1.00 23.12  ? 720 VAL B CB  1 
ATOM   11097 C CG1 . VAL B 1 694 ? 48.463  98.439  31.368  1.00 26.08  ? 720 VAL B CG1 1 
ATOM   11098 C CG2 . VAL B 1 694 ? 48.251  99.171  33.739  1.00 22.85  ? 720 VAL B CG2 1 
ATOM   11099 N N   . LYS B 1 695 ? 47.167  100.750 29.694  1.00 23.80  ? 721 LYS B N   1 
ATOM   11100 C CA  . LYS B 1 695 ? 46.909  100.795 28.255  1.00 25.52  ? 721 LYS B CA  1 
ATOM   11101 C C   . LYS B 1 695 ? 47.852  99.962  27.406  1.00 25.36  ? 721 LYS B C   1 
ATOM   11102 O O   . LYS B 1 695 ? 49.057  99.912  27.653  1.00 25.09  ? 721 LYS B O   1 
ATOM   11103 C CB  . LYS B 1 695 ? 46.929  102.237 27.737  1.00 25.70  ? 721 LYS B CB  1 
ATOM   11104 C CG  . LYS B 1 695 ? 45.565  102.890 27.709  1.00 27.20  ? 721 LYS B CG  1 
ATOM   11105 C CD  . LYS B 1 695 ? 45.068  103.199 29.110  1.00 28.02  ? 721 LYS B CD  1 
ATOM   11106 C CE  . LYS B 1 695 ? 45.874  104.331 29.732  1.00 30.81  ? 721 LYS B CE  1 
ATOM   11107 N NZ  . LYS B 1 695 ? 45.256  104.808 30.989  1.00 29.27  ? 721 LYS B NZ  1 
ATOM   11108 N N   . GLN B 1 696 ? 47.277  99.323  26.390  1.00 26.48  ? 722 GLN B N   1 
ATOM   11109 C CA  . GLN B 1 696 ? 48.005  98.469  25.452  1.00 27.63  ? 722 GLN B CA  1 
ATOM   11110 C C   . GLN B 1 696 ? 49.250  99.127  24.881  1.00 27.89  ? 722 GLN B C   1 
ATOM   11111 O O   . GLN B 1 696 ? 49.168  100.184 24.265  1.00 30.48  ? 722 GLN B O   1 
ATOM   11112 C CB  . GLN B 1 696 ? 47.104  98.079  24.285  1.00 27.25  ? 722 GLN B CB  1 
ATOM   11113 C CG  . GLN B 1 696 ? 47.760  97.090  23.329  1.00 31.23  ? 722 GLN B CG  1 
ATOM   11114 C CD  . GLN B 1 696 ? 46.910  96.821  22.108  1.00 32.06  ? 722 GLN B CD  1 
ATOM   11115 O OE1 . GLN B 1 696 ? 45.692  96.673  22.208  1.00 32.58  ? 722 GLN B OE1 1 
ATOM   11116 N NE2 . GLN B 1 696 ? 47.547  96.752  20.947  1.00 34.11  ? 722 GLN B NE2 1 
ATOM   11117 N N   . GLY B 1 697 ? 50.396  98.488  25.062  1.00 26.18  ? 723 GLY B N   1 
ATOM   11118 C CA  . GLY B 1 697 ? 51.621  99.051  24.539  1.00 25.59  ? 723 GLY B CA  1 
ATOM   11119 C C   . GLY B 1 697 ? 52.281  99.987  25.527  1.00 27.07  ? 723 GLY B C   1 
ATOM   11120 O O   . GLY B 1 697 ? 53.335  100.547 25.246  1.00 29.42  ? 723 GLY B O   1 
ATOM   11121 N N   . PHE B 1 698 ? 51.660  100.171 26.686  1.00 25.58  ? 724 PHE B N   1 
ATOM   11122 C CA  . PHE B 1 698 ? 52.227  101.044 27.701  1.00 24.14  ? 724 PHE B CA  1 
ATOM   11123 C C   . PHE B 1 698 ? 52.066  100.423 29.077  1.00 24.81  ? 724 PHE B C   1 
ATOM   11124 O O   . PHE B 1 698 ? 51.892  101.118 30.074  1.00 24.36  ? 724 PHE B O   1 
ATOM   11125 C CB  . PHE B 1 698 ? 51.555  102.412 27.654  1.00 23.54  ? 724 PHE B CB  1 
ATOM   11126 C CG  . PHE B 1 698 ? 51.726  103.117 26.343  1.00 24.08  ? 724 PHE B CG  1 
ATOM   11127 C CD1 . PHE B 1 698 ? 50.729  103.063 25.369  1.00 25.83  ? 724 PHE B CD1 1 
ATOM   11128 C CD2 . PHE B 1 698 ? 52.898  103.804 26.059  1.00 23.47  ? 724 PHE B CD2 1 
ATOM   11129 C CE1 . PHE B 1 698 ? 50.903  103.687 24.126  1.00 24.46  ? 724 PHE B CE1 1 
ATOM   11130 C CE2 . PHE B 1 698 ? 53.081  104.431 24.819  1.00 24.24  ? 724 PHE B CE2 1 
ATOM   11131 C CZ  . PHE B 1 698 ? 52.082  104.371 23.855  1.00 22.48  ? 724 PHE B CZ  1 
ATOM   11132 N N   . GLU B 1 699 ? 52.136  99.098  29.116  1.00 25.07  ? 725 GLU B N   1 
ATOM   11133 C CA  . GLU B 1 699 ? 51.989  98.360  30.354  1.00 22.96  ? 725 GLU B CA  1 
ATOM   11134 C C   . GLU B 1 699 ? 53.219  98.588  31.215  1.00 22.92  ? 725 GLU B C   1 
ATOM   11135 O O   . GLU B 1 699 ? 54.344  98.577  30.724  1.00 22.92  ? 725 GLU B O   1 
ATOM   11136 C CB  . GLU B 1 699 ? 51.827  96.862  30.061  1.00 23.56  ? 725 GLU B CB  1 
ATOM   11137 C CG  . GLU B 1 699 ? 50.680  96.493  29.105  1.00 23.44  ? 725 GLU B CG  1 
ATOM   11138 C CD  . GLU B 1 699 ? 51.021  96.695  27.623  1.00 22.75  ? 725 GLU B CD  1 
ATOM   11139 O OE1 . GLU B 1 699 ? 50.166  96.397  26.770  1.00 20.27  ? 725 GLU B OE1 1 
ATOM   11140 O OE2 . GLU B 1 699 ? 52.138  97.148  27.304  1.00 22.70  ? 725 GLU B OE2 1 
ATOM   11141 N N   . PRO B 1 700 ? 53.020  98.821  32.519  1.00 23.78  ? 726 PRO B N   1 
ATOM   11142 C CA  . PRO B 1 700 ? 54.141  99.047  33.437  1.00 21.90  ? 726 PRO B CA  1 
ATOM   11143 C C   . PRO B 1 700 ? 54.824  97.728  33.823  1.00 22.71  ? 726 PRO B C   1 
ATOM   11144 O O