data_1D8J
# 
_entry.id   1D8J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1D8J         
RCSB  RCSB009887   
WWPDB D_1000009887 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1D8K           . unspecified 
TargetDB trt001000205.1 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1D8J 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Okuda, M.'                                              1 
'Watanabe, Y.'                                           2 
'Okamura, H.'                                            3 
'Hanaoka, F.'                                            4 
'Ohkuma, Y.'                                             5 
'Nishimura, Y.'                                          6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            19 
_citation.page_first                1346 
_citation.page_last                 1356 
_citation.year                      2000 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10716934 
_citation.pdbx_database_id_DOI      10.1093/emboj/19.6.1346 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Okuda, M.'     1 
primary 'Watanabe, Y.'  2 
primary 'Okamura, H.'   3 
primary 'Hanaoka, F.'   4 
primary 'Ohkuma, Y.'    5 
primary 'Nishimura, Y.' 6 
# 
_cell.entry_id           1D8J 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1D8J 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'GENERAL TRANSCRIPTION FACTOR TFIIE-BETA' 
_entity.formula_weight             9287.704 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CENTRAL CORE DOMAIN' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNV
R
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNV
R
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         trt001000205.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  LEU n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  TYR n 
1 9  LYS n 
1 10 PHE n 
1 11 GLY n 
1 12 VAL n 
1 13 LEU n 
1 14 ALA n 
1 15 LYS n 
1 16 ILE n 
1 17 VAL n 
1 18 ASN n 
1 19 TYR n 
1 20 MET n 
1 21 LYS n 
1 22 THR n 
1 23 ARG n 
1 24 HIS n 
1 25 GLN n 
1 26 ARG n 
1 27 GLY n 
1 28 ASP n 
1 29 THR n 
1 30 HIS n 
1 31 PRO n 
1 32 LEU n 
1 33 THR n 
1 34 LEU n 
1 35 ASP n 
1 36 GLU n 
1 37 ILE n 
1 38 LEU n 
1 39 ASP n 
1 40 GLU n 
1 41 THR n 
1 42 GLN n 
1 43 HIS n 
1 44 LEU n 
1 45 ASP n 
1 46 ILE n 
1 47 GLY n 
1 48 LEU n 
1 49 LYS n 
1 50 GLN n 
1 51 LYS n 
1 52 GLN n 
1 53 TRP n 
1 54 LEU n 
1 55 MET n 
1 56 THR n 
1 57 GLU n 
1 58 ALA n 
1 59 LEU n 
1 60 VAL n 
1 61 ASN n 
1 62 ASN n 
1 63 PRO n 
1 64 LYS n 
1 65 ILE n 
1 66 GLU n 
1 67 VAL n 
1 68 ILE n 
1 69 ASP n 
1 70 GLY n 
1 71 LYS n 
1 72 TYR n 
1 73 ALA n 
1 74 PHE n 
1 75 LYS n 
1 76 PRO n 
1 77 LYS n 
1 78 TYR n 
1 79 ASN n 
1 80 VAL n 
1 81 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    T2EB_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P29084 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1D8J 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 81 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29084 
_struct_ref_seq.db_align_beg                  66 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       81 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '2D NOESY'             3 
2 1 3D_13C-SEPARATED_NOESY 1 
3 1 3D_15N-SEPARATED_NOESY 2 
4 1 4D_13C-SEPARATED_NOESY 1 
5 1 HNHA                   2 
6 1 HMQC-J                 2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '500mM NACL' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1-2MM PROTEIN U-15N,13C; 20MM PHOSPHATE BUFFER, 500MM NACL' ? 
3 '1-2MM PROTEIN ; 20MM PHOSPHATE BUFFER, 500MM NACL'          ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX Bruker 600 ? 
2 AMX Bruker 500 ? 
# 
_pdbx_nmr_refine.entry_id           1D8J 
_pdbx_nmr_refine.method             '4D SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            
;THE STRUCTURES ARE BASED ON A TOTAL OF 1224 RESTRAINTS, 1184 ARE NOE-DERIVED DISTANCE CONSTRAINTS, 38 DIHEDRAL ANGLE RESTRAINTS, 40 DISTANCE RESTRAINTS FROM HYDROGEN BONDS.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1D8J 
_pdbx_nmr_details.text       'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1D8J 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1D8J 
_pdbx_nmr_representative.conformer_id         20 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing           NMRPIPE             1.6 'DELAGLIO, GRZESIEK, VUISTER, ZHU, PFEIFER, BAX' 1 
'data analysis'      'PIPP, CAPP, STAPP' 3.9 'GARRETT, POWERS, GRONENBORN, CLORE'             2 
'structure solution' EMBOSS              5   'NAKAI, KIDERA, NAKAMURA'                        3 
refinement           EMBOSS              5   'NAKAI, KIDERA, NAKAMURA'                        4 
# 
_exptl.entry_id          1D8J 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1D8J 
_struct.title                     'SOLUTION STRUCTURE OF THE CENTRAL CORE DOMAIN OF TFIIE BETA' 
_struct.pdbx_descriptor           'GENERAL TRANSCRIPTION FACTOR TFIIE-BETA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1D8J 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            
'WINGED HELIX-TURN-HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, GENE REGULATION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 10 ? GLN A 25 ? PHE A 10 GLN A 25 1 ? 16 
HELX_P HELX_P2 2 LEU A 34 ? GLU A 40 ? LEU A 34 GLU A 40 1 ? 7  
HELX_P HELX_P3 3 LEU A 48 ? MET A 55 ? LEU A 48 MET A 55 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 32 ? LEU A 32 ? LEU A 32 LEU A 32 
A 2 ILE A 65 ? ILE A 68 ? ILE A 65 ILE A 68 
A 3 LYS A 71 ? PHE A 74 ? LYS A 71 PHE A 74 
# 
_database_PDB_matrix.entry_id          1D8J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1D8J 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1  ? 15.880  18.648  1.656   1.00 0.00 ? 1  ALA A N    1  
ATOM 2     C CA   . ALA A 1 1  ? 14.758  18.418  2.584   1.00 0.00 ? 1  ALA A CA   1  
ATOM 3     C C    . ALA A 1 1  ? 13.431  18.679  1.878   1.00 0.00 ? 1  ALA A C    1  
ATOM 4     O O    . ALA A 1 1  ? 13.412  19.255  0.791   1.00 0.00 ? 1  ALA A O    1  
ATOM 5     C CB   . ALA A 1 1  ? 14.893  19.317  3.815   1.00 0.00 ? 1  ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1  ? 15.849  19.601  1.324   1.00 0.00 ? 1  ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1  ? 15.801  18.017  0.871   1.00 0.00 ? 1  ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1  ? 16.754  18.484  2.134   1.00 0.00 ? 1  ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1  ? 14.782  17.377  2.908   1.00 0.00 ? 1  ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1  ? 14.843  20.363  3.509   1.00 0.00 ? 1  ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1  ? 14.081  19.105  4.511   1.00 0.00 ? 1  ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1  ? 15.848  19.126  4.304   1.00 0.00 ? 1  ALA A HB3  1  
ATOM 13    N N    . LEU A 1 2  ? 12.322  18.258  2.500   1.00 0.00 ? 2  LEU A N    1  
ATOM 14    C CA   . LEU A 1 2  ? 10.994  18.448  1.932   1.00 0.00 ? 2  LEU A CA   1  
ATOM 15    C C    . LEU A 1 2  ? 10.499  19.863  2.241   1.00 0.00 ? 2  LEU A C    1  
ATOM 16    O O    . LEU A 1 2  ? 9.449   20.038  2.854   1.00 0.00 ? 2  LEU A O    1  
ATOM 17    C CB   . LEU A 1 2  ? 10.035  17.395  2.511   1.00 0.00 ? 2  LEU A CB   1  
ATOM 18    C CG   . LEU A 1 2  ? 10.557  15.974  2.243   1.00 0.00 ? 2  LEU A CG   1  
ATOM 19    C CD1  . LEU A 1 2  ? 9.572   14.958  2.827   1.00 0.00 ? 2  LEU A CD1  1  
ATOM 20    C CD2  . LEU A 1 2  ? 10.695  15.734  0.735   1.00 0.00 ? 2  LEU A CD2  1  
ATOM 21    H H    . LEU A 1 2  ? 12.397  17.793  3.393   1.00 0.00 ? 2  LEU A H    1  
ATOM 22    H HA   . LEU A 1 2  ? 11.044  18.325  0.850   1.00 0.00 ? 2  LEU A HA   1  
ATOM 23    H HB2  . LEU A 1 2  ? 9.945   17.547  3.588   1.00 0.00 ? 2  LEU A HB2  1  
ATOM 24    H HB3  . LEU A 1 2  ? 9.056   17.512  2.050   1.00 0.00 ? 2  LEU A HB3  1  
ATOM 25    H HG   . LEU A 1 2  ? 11.529  15.843  2.719   1.00 0.00 ? 2  LEU A HG   1  
ATOM 26    H HD11 . LEU A 1 2  ? 9.449   15.144  3.894   1.00 0.00 ? 2  LEU A HD11 1  
ATOM 27    H HD12 . LEU A 1 2  ? 9.957   13.949  2.678   1.00 0.00 ? 2  LEU A HD12 1  
ATOM 28    H HD13 . LEU A 1 2  ? 8.608   15.056  2.328   1.00 0.00 ? 2  LEU A HD13 1  
ATOM 29    H HD21 . LEU A 1 2  ? 9.792   16.073  0.227   1.00 0.00 ? 2  LEU A HD21 1  
ATOM 30    H HD22 . LEU A 1 2  ? 10.837  14.670  0.548   1.00 0.00 ? 2  LEU A HD22 1  
ATOM 31    H HD23 . LEU A 1 2  ? 11.554  16.284  0.354   1.00 0.00 ? 2  LEU A HD23 1  
ATOM 32    N N    . SER A 1 3  ? 11.267  20.870  1.812   1.00 0.00 ? 3  SER A N    1  
ATOM 33    C CA   . SER A 1 3  ? 10.924  22.264  2.041   1.00 0.00 ? 3  SER A CA   1  
ATOM 34    C C    . SER A 1 3  ? 9.899   22.730  1.007   1.00 0.00 ? 3  SER A C    1  
ATOM 35    O O    . SER A 1 3  ? 9.019   23.525  1.322   1.00 0.00 ? 3  SER A O    1  
ATOM 36    C CB   . SER A 1 3  ? 12.197  23.110  1.964   1.00 0.00 ? 3  SER A CB   1  
ATOM 37    O OG   . SER A 1 3  ? 12.922  22.775  0.797   1.00 0.00 ? 3  SER A OG   1  
ATOM 38    H H    . SER A 1 3  ? 12.121  20.667  1.308   1.00 0.00 ? 3  SER A H    1  
ATOM 39    H HA   . SER A 1 3  ? 10.491  22.367  3.037   1.00 0.00 ? 3  SER A HA   1  
ATOM 40    H HB2  . SER A 1 3  ? 11.931  24.168  1.938   1.00 0.00 ? 3  SER A HB2  1  
ATOM 41    H HB3  . SER A 1 3  ? 12.814  22.913  2.841   1.00 0.00 ? 3  SER A HB3  1  
ATOM 42    H HG   . SER A 1 3  ? 12.475  23.159  0.038   1.00 0.00 ? 3  SER A HG   1  
ATOM 43    N N    . GLY A 1 4  ? 10.020  22.230  -0.231  1.00 0.00 ? 4  GLY A N    1  
ATOM 44    C CA   . GLY A 1 4  ? 9.113   22.599  -1.306  1.00 0.00 ? 4  GLY A CA   1  
ATOM 45    C C    . GLY A 1 4  ? 7.698   22.121  -0.993  1.00 0.00 ? 4  GLY A C    1  
ATOM 46    O O    . GLY A 1 4  ? 6.781   22.932  -0.867  1.00 0.00 ? 4  GLY A O    1  
ATOM 47    H H    . GLY A 1 4  ? 10.762  21.577  -0.435  1.00 0.00 ? 4  GLY A H    1  
ATOM 48    H HA2  . GLY A 1 4  ? 9.111   23.683  -1.421  1.00 0.00 ? 4  GLY A HA2  1  
ATOM 49    H HA3  . GLY A 1 4  ? 9.450   22.139  -2.235  1.00 0.00 ? 4  GLY A HA3  1  
ATOM 50    N N    . SER A 1 5  ? 7.522   20.800  -0.871  1.00 0.00 ? 5  SER A N    1  
ATOM 51    C CA   . SER A 1 5  ? 6.224   20.212  -0.576  1.00 0.00 ? 5  SER A CA   1  
ATOM 52    C C    . SER A 1 5  ? 6.411   18.758  -0.140  1.00 0.00 ? 5  SER A C    1  
ATOM 53    O O    . SER A 1 5  ? 7.536   18.316  0.090   1.00 0.00 ? 5  SER A O    1  
ATOM 54    C CB   . SER A 1 5  ? 5.328   20.299  -1.819  1.00 0.00 ? 5  SER A CB   1  
ATOM 55    O OG   . SER A 1 5  ? 3.994   19.988  -1.469  1.00 0.00 ? 5  SER A OG   1  
ATOM 56    H H    . SER A 1 5  ? 8.311   20.178  -0.983  1.00 0.00 ? 5  SER A H    1  
ATOM 57    H HA   . SER A 1 5  ? 5.758   20.769  0.238   1.00 0.00 ? 5  SER A HA   1  
ATOM 58    H HB2  . SER A 1 5  ? 5.364   21.309  -2.228  1.00 0.00 ? 5  SER A HB2  1  
ATOM 59    H HB3  . SER A 1 5  ? 5.679   19.592  -2.573  1.00 0.00 ? 5  SER A HB3  1  
ATOM 60    H HG   . SER A 1 5  ? 3.638   20.714  -0.948  1.00 0.00 ? 5  SER A HG   1  
ATOM 61    N N    . SER A 1 6  ? 5.301   18.020  -0.029  1.00 0.00 ? 6  SER A N    1  
ATOM 62    C CA   . SER A 1 6  ? 5.323   16.621  0.374   1.00 0.00 ? 6  SER A CA   1  
ATOM 63    C C    . SER A 1 6  ? 4.110   15.912  -0.222  1.00 0.00 ? 6  SER A C    1  
ATOM 64    O O    . SER A 1 6  ? 3.018   15.974  0.338   1.00 0.00 ? 6  SER A O    1  
ATOM 65    C CB   . SER A 1 6  ? 5.308   16.526  1.904   1.00 0.00 ? 6  SER A CB   1  
ATOM 66    O OG   . SER A 1 6  ? 6.555   16.940  2.421   1.00 0.00 ? 6  SER A OG   1  
ATOM 67    H H    . SER A 1 6  ? 4.403   18.443  -0.234  1.00 0.00 ? 6  SER A H    1  
ATOM 68    H HA   . SER A 1 6  ? 6.232   16.150  -0.005  1.00 0.00 ? 6  SER A HA   1  
ATOM 69    H HB2  . SER A 1 6  ? 4.518   17.164  2.301   1.00 0.00 ? 6  SER A HB2  1  
ATOM 70    H HB3  . SER A 1 6  ? 5.120   15.493  2.201   1.00 0.00 ? 6  SER A HB3  1  
ATOM 71    H HG   . SER A 1 6  ? 6.886   17.666  1.884   1.00 0.00 ? 6  SER A HG   1  
ATOM 72    N N    . GLY A 1 7  ? 4.306   15.239  -1.362  1.00 0.00 ? 7  GLY A N    1  
ATOM 73    C CA   . GLY A 1 7  ? 3.233   14.527  -2.039  1.00 0.00 ? 7  GLY A CA   1  
ATOM 74    C C    . GLY A 1 7  ? 3.796   13.356  -2.835  1.00 0.00 ? 7  GLY A C    1  
ATOM 75    O O    . GLY A 1 7  ? 3.281   12.242  -2.747  1.00 0.00 ? 7  GLY A O    1  
ATOM 76    H H    . GLY A 1 7  ? 5.227   15.221  -1.775  1.00 0.00 ? 7  GLY A H    1  
ATOM 77    H HA2  . GLY A 1 7  ? 2.522   14.152  -1.301  1.00 0.00 ? 7  GLY A HA2  1  
ATOM 78    H HA3  . GLY A 1 7  ? 2.719   15.211  -2.717  1.00 0.00 ? 7  GLY A HA3  1  
ATOM 79    N N    . TYR A 1 8  ? 4.858   13.609  -3.611  1.00 0.00 ? 8  TYR A N    1  
ATOM 80    C CA   . TYR A 1 8  ? 5.496   12.580  -4.417  1.00 0.00 ? 8  TYR A CA   1  
ATOM 81    C C    . TYR A 1 8  ? 5.869   11.387  -3.532  1.00 0.00 ? 8  TYR A C    1  
ATOM 82    O O    . TYR A 1 8  ? 6.581   11.553  -2.546  1.00 0.00 ? 8  TYR A O    1  
ATOM 83    C CB   . TYR A 1 8  ? 6.736   13.175  -5.094  1.00 0.00 ? 8  TYR A CB   1  
ATOM 84    C CG   . TYR A 1 8  ? 7.554   12.161  -5.868  1.00 0.00 ? 8  TYR A CG   1  
ATOM 85    C CD1  . TYR A 1 8  ? 6.956   11.403  -6.892  1.00 0.00 ? 8  TYR A CD1  1  
ATOM 86    C CD2  . TYR A 1 8  ? 8.917   11.978  -5.565  1.00 0.00 ? 8  TYR A CD2  1  
ATOM 87    C CE1  . TYR A 1 8  ? 7.718   10.463  -7.607  1.00 0.00 ? 8  TYR A CE1  1  
ATOM 88    C CE2  . TYR A 1 8  ? 9.676   11.037  -6.279  1.00 0.00 ? 8  TYR A CE2  1  
ATOM 89    C CZ   . TYR A 1 8  ? 9.078   10.280  -7.300  1.00 0.00 ? 8  TYR A CZ   1  
ATOM 90    O OH   . TYR A 1 8  ? 9.816   9.365   -7.991  1.00 0.00 ? 8  TYR A OH   1  
ATOM 91    H H    . TYR A 1 8  ? 5.236   14.544  -3.647  1.00 0.00 ? 8  TYR A H    1  
ATOM 92    H HA   . TYR A 1 8  ? 4.796   12.248  -5.185  1.00 0.00 ? 8  TYR A HA   1  
ATOM 93    H HB2  . TYR A 1 8  ? 6.415   13.959  -5.780  1.00 0.00 ? 8  TYR A HB2  1  
ATOM 94    H HB3  . TYR A 1 8  ? 7.369   13.623  -4.326  1.00 0.00 ? 8  TYR A HB3  1  
ATOM 95    H HD1  . TYR A 1 8  ? 5.912   11.543  -7.129  1.00 0.00 ? 8  TYR A HD1  1  
ATOM 96    H HD2  . TYR A 1 8  ? 9.379   12.560  -4.781  1.00 0.00 ? 8  TYR A HD2  1  
ATOM 97    H HE1  . TYR A 1 8  ? 7.258   9.883   -8.392  1.00 0.00 ? 8  TYR A HE1  1  
ATOM 98    H HE2  . TYR A 1 8  ? 10.721  10.897  -6.042  1.00 0.00 ? 8  TYR A HE2  1  
ATOM 99    H HH   . TYR A 1 8  ? 9.337   8.975   -8.727  1.00 0.00 ? 8  TYR A HH   1  
ATOM 100   N N    . LYS A 1 9  ? 5.370   10.192  -3.900  1.00 0.00 ? 9  LYS A N    1  
ATOM 101   C CA   . LYS A 1 9  ? 5.603   8.941   -3.165  1.00 0.00 ? 9  LYS A CA   1  
ATOM 102   C C    . LYS A 1 9  ? 4.772   8.902   -1.893  1.00 0.00 ? 9  LYS A C    1  
ATOM 103   O O    . LYS A 1 9  ? 3.969   7.995   -1.702  1.00 0.00 ? 9  LYS A O    1  
ATOM 104   C CB   . LYS A 1 9  ? 7.086   8.754   -2.784  1.00 0.00 ? 9  LYS A CB   1  
ATOM 105   C CG   . LYS A 1 9  ? 8.002   9.174   -3.913  1.00 0.00 ? 9  LYS A CG   1  
ATOM 106   C CD   . LYS A 1 9  ? 9.250   8.281   -3.932  1.00 0.00 ? 9  LYS A CD   1  
ATOM 107   C CE   . LYS A 1 9  ? 10.023  8.428   -2.614  1.00 0.00 ? 9  LYS A CE   1  
ATOM 108   N NZ   . LYS A 1 9  ? 11.192  7.531   -2.579  1.00 0.00 ? 9  LYS A NZ   1  
ATOM 109   H H    . LYS A 1 9  ? 4.795   10.142  -4.729  1.00 0.00 ? 9  LYS A H    1  
ATOM 110   H HA   . LYS A 1 9  ? 5.302   8.109   -3.801  1.00 0.00 ? 9  LYS A HA   1  
ATOM 111   H HB2  . LYS A 1 9  ? 7.315   9.345   -1.899  1.00 0.00 ? 9  LYS A HB2  1  
ATOM 112   H HB3  . LYS A 1 9  ? 7.259   7.710   -2.562  1.00 0.00 ? 9  LYS A HB3  1  
ATOM 113   H HG2  . LYS A 1 9  ? 7.476   9.083   -4.858  1.00 0.00 ? 9  LYS A HG2  1  
ATOM 114   H HG3  . LYS A 1 9  ? 8.297   10.206  -3.754  1.00 0.00 ? 9  LYS A HG3  1  
ATOM 115   H HD2  . LYS A 1 9  ? 8.949   7.240   -4.064  1.00 0.00 ? 9  LYS A HD2  1  
ATOM 116   H HD3  . LYS A 1 9  ? 9.892   8.577   -4.763  1.00 0.00 ? 9  LYS A HD3  1  
ATOM 117   H HE2  . LYS A 1 9  ? 10.361  9.460   -2.510  1.00 0.00 ? 9  LYS A HE2  1  
ATOM 118   H HE3  . LYS A 1 9  ? 9.366   8.184   -1.779  1.00 0.00 ? 9  LYS A HE3  1  
ATOM 119   H HZ1  . LYS A 1 9  ? 11.819  7.763   -3.336  1.00 0.00 ? 9  LYS A HZ1  1  
ATOM 120   H HZ2  . LYS A 1 9  ? 11.675  7.638   -1.698  1.00 0.00 ? 9  LYS A HZ2  1  
ATOM 121   H HZ3  . LYS A 1 9  ? 10.885  6.573   -2.678  1.00 0.00 ? 9  LYS A HZ3  1  
ATOM 122   N N    . PHE A 1 10 ? 5.000   9.875   -1.016  1.00 0.00 ? 10 PHE A N    1  
ATOM 123   C CA   . PHE A 1 10 ? 4.390   9.909   0.293   1.00 0.00 ? 10 PHE A CA   1  
ATOM 124   C C    . PHE A 1 10 ? 2.862   9.860   0.209   1.00 0.00 ? 10 PHE A C    1  
ATOM 125   O O    . PHE A 1 10 ? 2.234   9.036   0.870   1.00 0.00 ? 10 PHE A O    1  
ATOM 126   C CB   . PHE A 1 10 ? 4.861   11.167  1.034   1.00 0.00 ? 10 PHE A CB   1  
ATOM 127   C CG   . PHE A 1 10 ? 6.328   11.481  0.801   1.00 0.00 ? 10 PHE A CG   1  
ATOM 128   C CD1  . PHE A 1 10 ? 7.306   10.498  1.043   1.00 0.00 ? 10 PHE A CD1  1  
ATOM 129   C CD2  . PHE A 1 10 ? 6.709   12.747  0.318   1.00 0.00 ? 10 PHE A CD2  1  
ATOM 130   C CE1  . PHE A 1 10 ? 8.662   10.782  0.799   1.00 0.00 ? 10 PHE A CE1  1  
ATOM 131   C CE2  . PHE A 1 10 ? 8.065   13.028  0.075   1.00 0.00 ? 10 PHE A CE2  1  
ATOM 132   C CZ   . PHE A 1 10 ? 9.041   12.046  0.312   1.00 0.00 ? 10 PHE A CZ   1  
ATOM 133   H H    . PHE A 1 10 ? 5.646   10.614  -1.255  1.00 0.00 ? 10 PHE A H    1  
ATOM 134   H HA   . PHE A 1 10 ? 4.741   9.035   0.832   1.00 0.00 ? 10 PHE A HA   1  
ATOM 135   H HB2  . PHE A 1 10 ? 4.264   12.016  0.700   1.00 0.00 ? 10 PHE A HB2  1  
ATOM 136   H HB3  . PHE A 1 10 ? 4.698   11.025  2.104   1.00 0.00 ? 10 PHE A HB3  1  
ATOM 137   H HD1  . PHE A 1 10 ? 7.016   9.524   1.409   1.00 0.00 ? 10 PHE A HD1  1  
ATOM 138   H HD2  . PHE A 1 10 ? 5.961   13.501  0.128   1.00 0.00 ? 10 PHE A HD2  1  
ATOM 139   H HE1  . PHE A 1 10 ? 9.413   10.027  0.981   1.00 0.00 ? 10 PHE A HE1  1  
ATOM 140   H HE2  . PHE A 1 10 ? 8.355   13.999  -0.299  1.00 0.00 ? 10 PHE A HE2  1  
ATOM 141   H HZ   . PHE A 1 10 ? 10.082  12.261  0.121   1.00 0.00 ? 10 PHE A HZ   1  
ATOM 142   N N    . GLY A 1 11 ? 2.266   10.747  -0.595  1.00 0.00 ? 11 GLY A N    1  
ATOM 143   C CA   . GLY A 1 11 ? 0.818   10.816  -0.735  1.00 0.00 ? 11 GLY A CA   1  
ATOM 144   C C    . GLY A 1 11 ? 0.263   9.487   -1.241  1.00 0.00 ? 11 GLY A C    1  
ATOM 145   O O    . GLY A 1 11 ? -0.684  8.948   -0.670  1.00 0.00 ? 11 GLY A O    1  
ATOM 146   H H    . GLY A 1 11 ? 2.830   11.399  -1.125  1.00 0.00 ? 11 GLY A H    1  
ATOM 147   H HA2  . GLY A 1 11 ? 0.374   11.048  0.233   1.00 0.00 ? 11 GLY A HA2  1  
ATOM 148   H HA3  . GLY A 1 11 ? 0.563   11.604  -1.444  1.00 0.00 ? 11 GLY A HA3  1  
ATOM 149   N N    . VAL A 1 12 ? 0.857   8.963   -2.316  1.00 0.00 ? 12 VAL A N    1  
ATOM 150   C CA   . VAL A 1 12 ? 0.425   7.704   -2.905  1.00 0.00 ? 12 VAL A CA   1  
ATOM 151   C C    . VAL A 1 12 ? 0.520   6.577   -1.868  1.00 0.00 ? 12 VAL A C    1  
ATOM 152   O O    . VAL A 1 12 ? -0.409  5.784   -1.730  1.00 0.00 ? 12 VAL A O    1  
ATOM 153   C CB   . VAL A 1 12 ? 1.286   7.419   -4.153  1.00 0.00 ? 12 VAL A CB   1  
ATOM 154   C CG1  . VAL A 1 12 ? 1.309   5.918   -4.454  1.00 0.00 ? 12 VAL A CG1  1  
ATOM 155   C CG2  . VAL A 1 12 ? 0.698   8.173   -5.355  1.00 0.00 ? 12 VAL A CG2  1  
ATOM 156   H H    . VAL A 1 12 ? 1.633   9.448   -2.742  1.00 0.00 ? 12 VAL A H    1  
ATOM 157   H HA   . VAL A 1 12 ? -0.616  7.803   -3.214  1.00 0.00 ? 12 VAL A HA   1  
ATOM 158   H HB   . VAL A 1 12 ? 2.306   7.763   -3.976  1.00 0.00 ? 12 VAL A HB   1  
ATOM 159   H HG11 . VAL A 1 12 ? 2.051   5.430   -3.821  1.00 0.00 ? 12 VAL A HG11 1  
ATOM 160   H HG12 . VAL A 1 12 ? 1.567   5.760   -5.501  1.00 0.00 ? 12 VAL A HG12 1  
ATOM 161   H HG13 . VAL A 1 12 ? 0.332   5.492   -4.256  1.00 0.00 ? 12 VAL A HG13 1  
ATOM 162   H HG21 . VAL A 1 12 ? 1.322   8.007   -6.232  1.00 0.00 ? 12 VAL A HG21 1  
ATOM 163   H HG22 . VAL A 1 12 ? -0.308  7.811   -5.557  1.00 0.00 ? 12 VAL A HG22 1  
ATOM 164   H HG23 . VAL A 1 12 ? 0.659   9.239   -5.134  1.00 0.00 ? 12 VAL A HG23 1  
ATOM 165   N N    . LEU A 1 13 ? 1.638   6.510   -1.138  1.00 0.00 ? 13 LEU A N    1  
ATOM 166   C CA   . LEU A 1 13 ? 1.843   5.481   -0.126  1.00 0.00 ? 13 LEU A CA   1  
ATOM 167   C C    . LEU A 1 13 ? 0.775   5.594   0.962   1.00 0.00 ? 13 LEU A C    1  
ATOM 168   O O    . LEU A 1 13 ? 0.197   4.589   1.369   1.00 0.00 ? 13 LEU A O    1  
ATOM 169   C CB   . LEU A 1 13 ? 3.251   5.628   0.458   1.00 0.00 ? 13 LEU A CB   1  
ATOM 170   C CG   . LEU A 1 13 ? 3.485   4.601   1.579   1.00 0.00 ? 13 LEU A CG   1  
ATOM 171   C CD1  . LEU A 1 13 ? 3.271   3.180   1.047   1.00 0.00 ? 13 LEU A CD1  1  
ATOM 172   C CD2  . LEU A 1 13 ? 4.920   4.740   2.093   1.00 0.00 ? 13 LEU A CD2  1  
ATOM 173   H H    . LEU A 1 13 ? 2.373   7.188   -1.286  1.00 0.00 ? 13 LEU A H    1  
ATOM 174   H HA   . LEU A 1 13 ? 1.758   4.506   -0.601  1.00 0.00 ? 13 LEU A HA   1  
ATOM 175   H HB2  . LEU A 1 13 ? 3.980   5.467   -0.335  1.00 0.00 ? 13 LEU A HB2  1  
ATOM 176   H HB3  . LEU A 1 13 ? 3.373   6.633   0.860   1.00 0.00 ? 13 LEU A HB3  1  
ATOM 177   H HG   . LEU A 1 13 ? 2.792   4.789   2.398   1.00 0.00 ? 13 LEU A HG   1  
ATOM 178   H HD11 . LEU A 1 13 ? 2.203   2.974   0.974   1.00 0.00 ? 13 LEU A HD11 1  
ATOM 179   H HD12 . LEU A 1 13 ? 3.726   3.085   0.061   1.00 0.00 ? 13 LEU A HD12 1  
ATOM 180   H HD13 . LEU A 1 13 ? 3.728   2.462   1.728   1.00 0.00 ? 13 LEU A HD13 1  
ATOM 181   H HD21 . LEU A 1 13 ? 5.086   4.036   2.908   1.00 0.00 ? 13 LEU A HD21 1  
ATOM 182   H HD22 . LEU A 1 13 ? 5.621   4.529   1.285   1.00 0.00 ? 13 LEU A HD22 1  
ATOM 183   H HD23 . LEU A 1 13 ? 5.079   5.756   2.456   1.00 0.00 ? 13 LEU A HD23 1  
ATOM 184   N N    . ALA A 1 14 ? 0.512   6.816   1.432   1.00 0.00 ? 14 ALA A N    1  
ATOM 185   C CA   . ALA A 1 14 ? -0.493  7.045   2.458   1.00 0.00 ? 14 ALA A CA   1  
ATOM 186   C C    . ALA A 1 14 ? -1.863  6.585   1.959   1.00 0.00 ? 14 ALA A C    1  
ATOM 187   O O    . ALA A 1 14 ? -2.646  6.034   2.730   1.00 0.00 ? 14 ALA A O    1  
ATOM 188   C CB   . ALA A 1 14 ? -0.518  8.530   2.822   1.00 0.00 ? 14 ALA A CB   1  
ATOM 189   H H    . ALA A 1 14 ? 1.018   7.614   1.068   1.00 0.00 ? 14 ALA A H    1  
ATOM 190   H HA   . ALA A 1 14 ? -0.230  6.465   3.350   1.00 0.00 ? 14 ALA A HA   1  
ATOM 191   H HB1  . ALA A 1 14 ? -0.788  9.116   1.944   1.00 0.00 ? 14 ALA A HB1  1  
ATOM 192   H HB2  . ALA A 1 14 ? -1.253  8.699   3.610   1.00 0.00 ? 14 ALA A HB2  1  
ATOM 193   H HB3  . ALA A 1 14 ? 0.467   8.836   3.175   1.00 0.00 ? 14 ALA A HB3  1  
ATOM 194   N N    . LYS A 1 15 ? -2.155  6.810   0.668   1.00 0.00 ? 15 LYS A N    1  
ATOM 195   C CA   . LYS A 1 15 ? -3.426  6.409   0.094   1.00 0.00 ? 15 LYS A CA   1  
ATOM 196   C C    . LYS A 1 15 ? -3.497  4.888   0.011   1.00 0.00 ? 15 LYS A C    1  
ATOM 197   O O    . LYS A 1 15 ? -4.549  4.312   0.252   1.00 0.00 ? 15 LYS A O    1  
ATOM 198   C CB   . LYS A 1 15 ? -3.597  7.045   -1.287  1.00 0.00 ? 15 LYS A CB   1  
ATOM 199   C CG   . LYS A 1 15 ? -5.047  6.871   -1.749  1.00 0.00 ? 15 LYS A CG   1  
ATOM 200   C CD   . LYS A 1 15 ? -5.290  7.710   -3.005  1.00 0.00 ? 15 LYS A CD   1  
ATOM 201   C CE   . LYS A 1 15 ? -6.730  7.520   -3.492  1.00 0.00 ? 15 LYS A CE   1  
ATOM 202   N NZ   . LYS A 1 15 ? -7.701  8.059   -2.523  1.00 0.00 ? 15 LYS A NZ   1  
ATOM 203   H H    . LYS A 1 15 ? -1.480  7.265   0.069   1.00 0.00 ? 15 LYS A H    1  
ATOM 204   H HA   . LYS A 1 15 ? -4.228  6.764   0.743   1.00 0.00 ? 15 LYS A HA   1  
ATOM 205   H HB2  . LYS A 1 15 ? -3.361  8.108   -1.228  1.00 0.00 ? 15 LYS A HB2  1  
ATOM 206   H HB3  . LYS A 1 15 ? -2.926  6.563   -1.999  1.00 0.00 ? 15 LYS A HB3  1  
ATOM 207   H HG2  . LYS A 1 15 ? -5.233  5.820   -1.973  1.00 0.00 ? 15 LYS A HG2  1  
ATOM 208   H HG3  . LYS A 1 15 ? -5.720  7.198   -0.957  1.00 0.00 ? 15 LYS A HG3  1  
ATOM 209   H HD2  . LYS A 1 15 ? -5.117  8.764   -2.779  1.00 0.00 ? 15 LYS A HD2  1  
ATOM 210   H HD3  . LYS A 1 15 ? -4.602  7.393   -3.786  1.00 0.00 ? 15 LYS A HD3  1  
ATOM 211   H HE2  . LYS A 1 15 ? -6.852  8.038   -4.446  1.00 0.00 ? 15 LYS A HE2  1  
ATOM 212   H HE3  . LYS A 1 15 ? -6.922  6.457   -3.637  1.00 0.00 ? 15 LYS A HE3  1  
ATOM 213   H HZ1  . LYS A 1 15 ? -7.632  7.549   -1.654  1.00 0.00 ? 15 LYS A HZ1  1  
ATOM 214   H HZ2  . LYS A 1 15 ? -8.636  7.965   -2.895  1.00 0.00 ? 15 LYS A HZ2  1  
ATOM 215   H HZ3  . LYS A 1 15 ? -7.505  9.036   -2.355  1.00 0.00 ? 15 LYS A HZ3  1  
ATOM 216   N N    . ILE A 1 16 ? -2.373  4.238   -0.324  1.00 0.00 ? 16 ILE A N    1  
ATOM 217   C CA   . ILE A 1 16 ? -2.319  2.785   -0.398  1.00 0.00 ? 16 ILE A CA   1  
ATOM 218   C C    . ILE A 1 16 ? -2.586  2.201   0.986   1.00 0.00 ? 16 ILE A C    1  
ATOM 219   O O    . ILE A 1 16 ? -3.412  1.303   1.134   1.00 0.00 ? 16 ILE A O    1  
ATOM 220   C CB   . ILE A 1 16 ? -0.945  2.343   -0.936  1.00 0.00 ? 16 ILE A CB   1  
ATOM 221   C CG1  . ILE A 1 16 ? -0.892  2.586   -2.453  1.00 0.00 ? 16 ILE A CG1  1  
ATOM 222   C CG2  . ILE A 1 16 ? -0.732  0.853   -0.642  1.00 0.00 ? 16 ILE A CG2  1  
ATOM 223   C CD1  . ILE A 1 16 ? 0.562   2.651   -2.932  1.00 0.00 ? 16 ILE A CD1  1  
ATOM 224   H H    . ILE A 1 16 ? -1.532  4.763   -0.528  1.00 0.00 ? 16 ILE A H    1  
ATOM 225   H HA   . ILE A 1 16 ? -3.091  2.435   -1.077  1.00 0.00 ? 16 ILE A HA   1  
ATOM 226   H HB   . ILE A 1 16 ? -0.161  2.922   -0.449  1.00 0.00 ? 16 ILE A HB   1  
ATOM 227   H HG12 . ILE A 1 16 ? -1.401  1.776   -2.967  1.00 0.00 ? 16 ILE A HG12 1  
ATOM 228   H HG13 . ILE A 1 16 ? -1.386  3.528   -2.687  1.00 0.00 ? 16 ILE A HG13 1  
ATOM 229   H HG21 . ILE A 1 16 ? -0.513  0.716   0.417   1.00 0.00 ? 16 ILE A HG21 1  
ATOM 230   H HG22 . ILE A 1 16 ? -1.633  0.298   -0.899  1.00 0.00 ? 16 ILE A HG22 1  
ATOM 231   H HG23 . ILE A 1 16 ? 0.103   0.477   -1.231  1.00 0.00 ? 16 ILE A HG23 1  
ATOM 232   H HD11 . ILE A 1 16 ? 0.581   2.818   -4.009  1.00 0.00 ? 16 ILE A HD11 1  
ATOM 233   H HD12 . ILE A 1 16 ? 1.068   1.715   -2.703  1.00 0.00 ? 16 ILE A HD12 1  
ATOM 234   H HD13 . ILE A 1 16 ? 1.073   3.471   -2.433  1.00 0.00 ? 16 ILE A HD13 1  
ATOM 235   N N    . VAL A 1 17 ? -1.890  2.720   1.999   1.00 0.00 ? 17 VAL A N    1  
ATOM 236   C CA   . VAL A 1 17 ? -2.057  2.269   3.370   1.00 0.00 ? 17 VAL A CA   1  
ATOM 237   C C    . VAL A 1 17 ? -3.507  2.482   3.810   1.00 0.00 ? 17 VAL A C    1  
ATOM 238   O O    . VAL A 1 17 ? -4.124  1.574   4.359   1.00 0.00 ? 17 VAL A O    1  
ATOM 239   C CB   . VAL A 1 17 ? -1.073  3.040   4.266   1.00 0.00 ? 17 VAL A CB   1  
ATOM 240   C CG1  . VAL A 1 17 ? -1.535  3.015   5.726   1.00 0.00 ? 17 VAL A CG1  1  
ATOM 241   C CG2  . VAL A 1 17 ? 0.311   2.394   4.165   1.00 0.00 ? 17 VAL A CG2  1  
ATOM 242   H H    . VAL A 1 17 ? -1.219  3.456   1.816   1.00 0.00 ? 17 VAL A H    1  
ATOM 243   H HA   . VAL A 1 17 ? -1.826  1.204   3.424   1.00 0.00 ? 17 VAL A HA   1  
ATOM 244   H HB   . VAL A 1 17 ? -1.012  4.074   3.929   1.00 0.00 ? 17 VAL A HB   1  
ATOM 245   H HG11 . VAL A 1 17 ? -0.740  3.406   6.362   1.00 0.00 ? 17 VAL A HG11 1  
ATOM 246   H HG12 . VAL A 1 17 ? -1.766  1.991   6.023   1.00 0.00 ? 17 VAL A HG12 1  
ATOM 247   H HG13 . VAL A 1 17 ? -2.423  3.637   5.839   1.00 0.00 ? 17 VAL A HG13 1  
ATOM 248   H HG21 . VAL A 1 17 ? 1.033   3.002   4.707   1.00 0.00 ? 17 VAL A HG21 1  
ATOM 249   H HG22 . VAL A 1 17 ? 0.609   2.326   3.119   1.00 0.00 ? 17 VAL A HG22 1  
ATOM 250   H HG23 . VAL A 1 17 ? 0.281   1.393   4.600   1.00 0.00 ? 17 VAL A HG23 1  
ATOM 251   N N    . ASN A 1 18 ? -4.046  3.681   3.566   1.00 0.00 ? 18 ASN A N    1  
ATOM 252   C CA   . ASN A 1 18 ? -5.415  4.008   3.943   1.00 0.00 ? 18 ASN A CA   1  
ATOM 253   C C    . ASN A 1 18 ? -6.399  3.075   3.236   1.00 0.00 ? 18 ASN A C    1  
ATOM 254   O O    . ASN A 1 18 ? -7.344  2.586   3.854   1.00 0.00 ? 18 ASN A O    1  
ATOM 255   C CB   . ASN A 1 18 ? -5.704  5.466   3.579   1.00 0.00 ? 18 ASN A CB   1  
ATOM 256   C CG   . ASN A 1 18 ? -7.172  5.807   3.817   1.00 0.00 ? 18 ASN A CG   1  
ATOM 257   O OD1  . ASN A 1 18 ? -7.927  6.003   2.870   1.00 0.00 ? 18 ASN A OD1  1  
ATOM 258   N ND2  . ASN A 1 18 ? -7.576  5.874   5.086   1.00 0.00 ? 18 ASN A ND2  1  
ATOM 259   H H    . ASN A 1 18 ? -3.493  4.394   3.108   1.00 0.00 ? 18 ASN A H    1  
ATOM 260   H HA   . ASN A 1 18 ? -5.522  3.884   5.022   1.00 0.00 ? 18 ASN A HA   1  
ATOM 261   H HB2  . ASN A 1 18 ? -5.081  6.120   4.189   1.00 0.00 ? 18 ASN A HB2  1  
ATOM 262   H HB3  . ASN A 1 18 ? -5.468  5.627   2.527   1.00 0.00 ? 18 ASN A HB3  1  
ATOM 263   H HD21 . ASN A 1 18 ? -6.917  5.715   5.834   1.00 0.00 ? 18 ASN A HD21 1  
ATOM 264   H HD22 . ASN A 1 18 ? -8.540  6.084   5.296   1.00 0.00 ? 18 ASN A HD22 1  
ATOM 265   N N    . TYR A 1 19 ? -6.179  2.832   1.941   1.00 0.00 ? 19 TYR A N    1  
ATOM 266   C CA   . TYR A 1 19 ? -7.045  1.969   1.156   1.00 0.00 ? 19 TYR A CA   1  
ATOM 267   C C    . TYR A 1 19 ? -7.048  0.562   1.746   1.00 0.00 ? 19 TYR A C    1  
ATOM 268   O O    . TYR A 1 19 ? -8.103  0.043   2.096   1.00 0.00 ? 19 TYR A O    1  
ATOM 269   C CB   . TYR A 1 19 ? -6.565  1.945   -0.299  1.00 0.00 ? 19 TYR A CB   1  
ATOM 270   C CG   . TYR A 1 19 ? -6.955  0.678   -1.024  1.00 0.00 ? 19 TYR A CG   1  
ATOM 271   C CD1  . TYR A 1 19 ? -8.311  0.361   -1.205  1.00 0.00 ? 19 TYR A CD1  1  
ATOM 272   C CD2  . TYR A 1 19 ? -5.961  -0.201  -1.487  1.00 0.00 ? 19 TYR A CD2  1  
ATOM 273   C CE1  . TYR A 1 19 ? -8.672  -0.831  -1.847  1.00 0.00 ? 19 TYR A CE1  1  
ATOM 274   C CE2  . TYR A 1 19 ? -6.324  -1.393  -2.130  1.00 0.00 ? 19 TYR A CE2  1  
ATOM 275   C CZ   . TYR A 1 19 ? -7.677  -1.707  -2.312  1.00 0.00 ? 19 TYR A CZ   1  
ATOM 276   O OH   . TYR A 1 19 ? -8.025  -2.862  -2.940  1.00 0.00 ? 19 TYR A OH   1  
ATOM 277   H H    . TYR A 1 19 ? -5.388  3.259   1.482   1.00 0.00 ? 19 TYR A H    1  
ATOM 278   H HA   . TYR A 1 19 ? -8.061  2.367   1.186   1.00 0.00 ? 19 TYR A HA   1  
ATOM 279   H HB2  . TYR A 1 19 ? -6.991  2.800   -0.826  1.00 0.00 ? 19 TYR A HB2  1  
ATOM 280   H HB3  . TYR A 1 19 ? -5.479  2.032   -0.312  1.00 0.00 ? 19 TYR A HB3  1  
ATOM 281   H HD1  . TYR A 1 19 ? -9.077  1.032   -0.842  1.00 0.00 ? 19 TYR A HD1  1  
ATOM 282   H HD2  . TYR A 1 19 ? -4.918  0.038   -1.344  1.00 0.00 ? 19 TYR A HD2  1  
ATOM 283   H HE1  . TYR A 1 19 ? -9.715  -1.074  -1.983  1.00 0.00 ? 19 TYR A HE1  1  
ATOM 284   H HE2  . TYR A 1 19 ? -5.562  -2.069  -2.482  1.00 0.00 ? 19 TYR A HE2  1  
ATOM 285   H HH   . TYR A 1 19 ? -8.889  -2.809  -3.363  1.00 0.00 ? 19 TYR A HH   1  
ATOM 286   N N    . MET A 1 20 ? -5.863  -0.052  1.851   1.00 0.00 ? 20 MET A N    1  
ATOM 287   C CA   . MET A 1 20 ? -5.732  -1.398  2.390   1.00 0.00 ? 20 MET A CA   1  
ATOM 288   C C    . MET A 1 20 ? -6.346  -1.457  3.785   1.00 0.00 ? 20 MET A C    1  
ATOM 289   O O    . MET A 1 20 ? -7.019  -2.424  4.115   1.00 0.00 ? 20 MET A O    1  
ATOM 290   C CB   . MET A 1 20 ? -4.252  -1.793  2.420   1.00 0.00 ? 20 MET A CB   1  
ATOM 291   C CG   . MET A 1 20 ? -3.734  -1.970  0.987   1.00 0.00 ? 20 MET A CG   1  
ATOM 292   S SD   . MET A 1 20 ? -1.952  -2.274  0.872   1.00 0.00 ? 20 MET A SD   1  
ATOM 293   C CE   . MET A 1 20 ? -1.870  -3.874  1.711   1.00 0.00 ? 20 MET A CE   1  
ATOM 294   H H    . MET A 1 20 ? -5.024  0.426   1.547   1.00 0.00 ? 20 MET A H    1  
ATOM 295   H HA   . MET A 1 20 ? -6.268  -2.099  1.747   1.00 0.00 ? 20 MET A HA   1  
ATOM 296   H HB2  . MET A 1 20 ? -3.676  -1.015  2.924   1.00 0.00 ? 20 MET A HB2  1  
ATOM 297   H HB3  . MET A 1 20 ? -4.142  -2.731  2.958   1.00 0.00 ? 20 MET A HB3  1  
ATOM 298   H HG2  . MET A 1 20 ? -4.259  -2.807  0.529   1.00 0.00 ? 20 MET A HG2  1  
ATOM 299   H HG3  . MET A 1 20 ? -3.961  -1.068  0.423   1.00 0.00 ? 20 MET A HG3  1  
ATOM 300   H HE1  . MET A 1 20 ? -0.856  -4.268  1.641   1.00 0.00 ? 20 MET A HE1  1  
ATOM 301   H HE2  . MET A 1 20 ? -2.563  -4.569  1.238   1.00 0.00 ? 20 MET A HE2  1  
ATOM 302   H HE3  . MET A 1 20 ? -2.138  -3.749  2.759   1.00 0.00 ? 20 MET A HE3  1  
ATOM 303   N N    . LYS A 1 21 ? -6.122  -0.419  4.597   1.00 0.00 ? 21 LYS A N    1  
ATOM 304   C CA   . LYS A 1 21 ? -6.672  -0.354  5.941   1.00 0.00 ? 21 LYS A CA   1  
ATOM 305   C C    . LYS A 1 21 ? -8.198  -0.420  5.885   1.00 0.00 ? 21 LYS A C    1  
ATOM 306   O O    . LYS A 1 21 ? -8.806  -1.187  6.620   1.00 0.00 ? 21 LYS A O    1  
ATOM 307   C CB   . LYS A 1 21 ? -6.195  0.943   6.615   1.00 0.00 ? 21 LYS A CB   1  
ATOM 308   C CG   . LYS A 1 21 ? -6.642  0.989   8.086   1.00 0.00 ? 21 LYS A CG   1  
ATOM 309   C CD   . LYS A 1 21 ? -8.090  1.490   8.197   1.00 0.00 ? 21 LYS A CD   1  
ATOM 310   C CE   . LYS A 1 21 ? -8.199  2.512   9.332   1.00 0.00 ? 21 LYS A CE   1  
ATOM 311   N NZ   . LYS A 1 21 ? -9.582  2.999   9.476   1.00 0.00 ? 21 LYS A NZ   1  
ATOM 312   H H    . LYS A 1 21 ? -5.553  0.354   4.274   1.00 0.00 ? 21 LYS A H    1  
ATOM 313   H HA   . LYS A 1 21 ? -6.305  -1.205  6.513   1.00 0.00 ? 21 LYS A HA   1  
ATOM 314   H HB2  . LYS A 1 21 ? -5.108  0.984   6.577   1.00 0.00 ? 21 LYS A HB2  1  
ATOM 315   H HB3  . LYS A 1 21 ? -6.601  1.802   6.085   1.00 0.00 ? 21 LYS A HB3  1  
ATOM 316   H HG2  . LYS A 1 21 ? -6.572  -0.009  8.520   1.00 0.00 ? 21 LYS A HG2  1  
ATOM 317   H HG3  . LYS A 1 21 ? -5.985  1.664   8.636   1.00 0.00 ? 21 LYS A HG3  1  
ATOM 318   H HD2  . LYS A 1 21 ? -8.390  1.961   7.261   1.00 0.00 ? 21 LYS A HD2  1  
ATOM 319   H HD3  . LYS A 1 21 ? -8.748  0.647   8.406   1.00 0.00 ? 21 LYS A HD3  1  
ATOM 320   H HE2  . LYS A 1 21 ? -7.885  2.045   10.266  1.00 0.00 ? 21 LYS A HE2  1  
ATOM 321   H HE3  . LYS A 1 21 ? -7.544  3.359   9.116   1.00 0.00 ? 21 LYS A HE3  1  
ATOM 322   H HZ1  . LYS A 1 21 ? -9.868  3.459   8.624   1.00 0.00 ? 21 LYS A HZ1  1  
ATOM 323   H HZ2  . LYS A 1 21 ? -9.632  3.651   10.245  1.00 0.00 ? 21 LYS A HZ2  1  
ATOM 324   H HZ3  . LYS A 1 21 ? -10.200 2.215   9.658   1.00 0.00 ? 21 LYS A HZ3  1  
ATOM 325   N N    . THR A 1 22 ? -8.812  0.389   5.016   1.00 0.00 ? 22 THR A N    1  
ATOM 326   C CA   . THR A 1 22 ? -10.264 0.442   4.899   1.00 0.00 ? 22 THR A CA   1  
ATOM 327   C C    . THR A 1 22 ? -10.814 -0.881  4.357   1.00 0.00 ? 22 THR A C    1  
ATOM 328   O O    . THR A 1 22 ? -11.730 -1.453  4.947   1.00 0.00 ? 22 THR A O    1  
ATOM 329   C CB   . THR A 1 22 ? -10.652 1.614   3.988   1.00 0.00 ? 22 THR A CB   1  
ATOM 330   O OG1  . THR A 1 22 ? -10.083 2.806   4.489   1.00 0.00 ? 22 THR A OG1  1  
ATOM 331   C CG2  . THR A 1 22 ? -12.174 1.762   3.949   1.00 0.00 ? 22 THR A CG2  1  
ATOM 332   H H    . THR A 1 22 ? -8.260  0.994   4.420   1.00 0.00 ? 22 THR A H    1  
ATOM 333   H HA   . THR A 1 22 ? -10.689 0.614   5.893   1.00 0.00 ? 22 THR A HA   1  
ATOM 334   H HB   . THR A 1 22 ? -10.280 1.432   2.978   1.00 0.00 ? 22 THR A HB   1  
ATOM 335   H HG1  . THR A 1 22 ? -9.137  2.795   4.302   1.00 0.00 ? 22 THR A HG1  1  
ATOM 336   H HG21 . THR A 1 22 ? -12.438 2.652   3.376   1.00 0.00 ? 22 THR A HG21 1  
ATOM 337   H HG22 . THR A 1 22 ? -12.558 1.860   4.965   1.00 0.00 ? 22 THR A HG22 1  
ATOM 338   H HG23 . THR A 1 22 ? -12.616 0.885   3.476   1.00 0.00 ? 22 THR A HG23 1  
ATOM 339   N N    . ARG A 1 23 ? -10.263 -1.370  3.236   1.00 0.00 ? 23 ARG A N    1  
ATOM 340   C CA   . ARG A 1 23 ? -10.721 -2.618  2.639   1.00 0.00 ? 23 ARG A CA   1  
ATOM 341   C C    . ARG A 1 23 ? -10.558 -3.764  3.649   1.00 0.00 ? 23 ARG A C    1  
ATOM 342   O O    . ARG A 1 23 ? -11.396 -4.662  3.718   1.00 0.00 ? 23 ARG A O    1  
ATOM 343   C CB   . ARG A 1 23 ? -9.947  -2.899  1.341   1.00 0.00 ? 23 ARG A CB   1  
ATOM 344   C CG   . ARG A 1 23 ? -10.419 -4.237  0.770   1.00 0.00 ? 23 ARG A CG   1  
ATOM 345   C CD   . ARG A 1 23 ? -10.214 -4.301  -0.747  1.00 0.00 ? 23 ARG A CD   1  
ATOM 346   N NE   . ARG A 1 23 ? -10.736 -5.577  -1.264  1.00 0.00 ? 23 ARG A NE   1  
ATOM 347   C CZ   . ARG A 1 23 ? -10.688 -5.943  -2.558  1.00 0.00 ? 23 ARG A CZ   1  
ATOM 348   N NH1  . ARG A 1 23 ? -10.289 -5.083  -3.499  1.00 0.00 ? 23 ARG A NH1  1  
ATOM 349   N NH2  . ARG A 1 23 ? -11.048 -7.185  -2.899  1.00 0.00 ? 23 ARG A NH2  1  
ATOM 350   H H    . ARG A 1 23 ? -9.511  -0.868  2.786   1.00 0.00 ? 23 ARG A H    1  
ATOM 351   H HA   . ARG A 1 23 ? -11.778 -2.516  2.394   1.00 0.00 ? 23 ARG A HA   1  
ATOM 352   H HB2  . ARG A 1 23 ? -10.144 -2.102  0.623   1.00 0.00 ? 23 ARG A HB2  1  
ATOM 353   H HB3  . ARG A 1 23 ? -8.878  -2.946  1.552   1.00 0.00 ? 23 ARG A HB3  1  
ATOM 354   H HG2  . ARG A 1 23 ? -9.858  -5.043  1.243   1.00 0.00 ? 23 ARG A HG2  1  
ATOM 355   H HG3  . ARG A 1 23 ? -11.480 -4.360  0.985   1.00 0.00 ? 23 ARG A HG3  1  
ATOM 356   H HD2  . ARG A 1 23 ? -10.745 -3.473  -1.220  1.00 0.00 ? 23 ARG A HD2  1  
ATOM 357   H HD3  . ARG A 1 23 ? -9.150  -4.226  -0.970  1.00 0.00 ? 23 ARG A HD3  1  
ATOM 358   H HE   . ARG A 1 23 ? -11.152 -6.214  -0.596  1.00 0.00 ? 23 ARG A HE   1  
ATOM 359   H HH11 . ARG A 1 23 ? -10.179 -4.097  -3.279  1.00 0.00 ? 23 ARG A HH11 1  
ATOM 360   H HH12 . ARG A 1 23 ? -10.102 -5.409  -4.435  1.00 0.00 ? 23 ARG A HH12 1  
ATOM 361   H HH21 . ARG A 1 23 ? -11.406 -7.823  -2.188  1.00 0.00 ? 23 ARG A HH21 1  
ATOM 362   H HH22 . ARG A 1 23 ? -10.968 -7.492  -3.856  1.00 0.00 ? 23 ARG A HH22 1  
ATOM 363   N N    . HIS A 1 24 ? -9.481  -3.716  4.435   1.00 0.00 ? 24 HIS A N    1  
ATOM 364   C CA   . HIS A 1 24 ? -9.219  -4.707  5.465   1.00 0.00 ? 24 HIS A CA   1  
ATOM 365   C C    . HIS A 1 24 ? -10.254 -4.565  6.587   1.00 0.00 ? 24 HIS A C    1  
ATOM 366   O O    . HIS A 1 24 ? -10.760 -5.560  7.098   1.00 0.00 ? 24 HIS A O    1  
ATOM 367   C CB   . HIS A 1 24 ? -7.790  -4.485  5.985   1.00 0.00 ? 24 HIS A CB   1  
ATOM 368   C CG   . HIS A 1 24 ? -7.407  -5.372  7.138   1.00 0.00 ? 24 HIS A CG   1  
ATOM 369   N ND1  . HIS A 1 24 ? -6.593  -6.488  6.990   1.00 0.00 ? 24 HIS A ND1  1  
ATOM 370   C CD2  . HIS A 1 24 ? -7.679  -5.311  8.479   1.00 0.00 ? 24 HIS A CD2  1  
ATOM 371   C CE1  . HIS A 1 24 ? -6.436  -7.017  8.219   1.00 0.00 ? 24 HIS A CE1  1  
ATOM 372   N NE2  . HIS A 1 24 ? -7.073  -6.344  9.172   1.00 0.00 ? 24 HIS A NE2  1  
ATOM 373   H H    . HIS A 1 24 ? -8.817  -2.961  4.324   1.00 0.00 ? 24 HIS A H    1  
ATOM 374   H HA   . HIS A 1 24 ? -9.293  -5.703  5.035   1.00 0.00 ? 24 HIS A HA   1  
ATOM 375   H HB2  . HIS A 1 24 ? -7.093  -4.665  5.166   1.00 0.00 ? 24 HIS A HB2  1  
ATOM 376   H HB3  . HIS A 1 24 ? -7.693  -3.449  6.304   1.00 0.00 ? 24 HIS A HB3  1  
ATOM 377   H HD1  . HIS A 1 24 ? -6.192  -6.834  6.129   1.00 0.00 ? 24 HIS A HD1  1  
ATOM 378   H HD2  . HIS A 1 24 ? -8.276  -4.545  8.940   1.00 0.00 ? 24 HIS A HD2  1  
ATOM 379   H HE1  . HIS A 1 24 ? -5.839  -7.892  8.414   1.00 0.00 ? 24 HIS A HE1  1  
ATOM 380   N N    . GLN A 1 25 ? -10.562 -3.320  6.959   1.00 0.00 ? 25 GLN A N    1  
ATOM 381   C CA   . GLN A 1 25 ? -11.508 -3.025  8.027   1.00 0.00 ? 25 GLN A CA   1  
ATOM 382   C C    . GLN A 1 25 ? -12.886 -3.630  7.736   1.00 0.00 ? 25 GLN A C    1  
ATOM 383   O O    . GLN A 1 25 ? -13.474 -4.262  8.610   1.00 0.00 ? 25 GLN A O    1  
ATOM 384   C CB   . GLN A 1 25 ? -11.613 -1.503  8.189   1.00 0.00 ? 25 GLN A CB   1  
ATOM 385   C CG   . GLN A 1 25 ? -12.329 -1.159  9.493   1.00 0.00 ? 25 GLN A CG   1  
ATOM 386   C CD   . GLN A 1 25 ? -12.522 0.348   9.621   1.00 0.00 ? 25 GLN A CD   1  
ATOM 387   O OE1  . GLN A 1 25 ? -11.551 1.090   9.755   1.00 0.00 ? 25 GLN A OE1  1  
ATOM 388   N NE2  . GLN A 1 25 ? -13.775 0.802   9.577   1.00 0.00 ? 25 GLN A NE2  1  
ATOM 389   H H    . GLN A 1 25 ? -10.121 -2.539  6.491   1.00 0.00 ? 25 GLN A H    1  
ATOM 390   H HA   . GLN A 1 25 ? -11.127 -3.451  8.956   1.00 0.00 ? 25 GLN A HA   1  
ATOM 391   H HB2  . GLN A 1 25 ? -10.614 -1.071  8.210   1.00 0.00 ? 25 GLN A HB2  1  
ATOM 392   H HB3  . GLN A 1 25 ? -12.169 -1.084  7.351   1.00 0.00 ? 25 GLN A HB3  1  
ATOM 393   H HG2  . GLN A 1 25 ? -13.301 -1.651  9.513   1.00 0.00 ? 25 GLN A HG2  1  
ATOM 394   H HG3  . GLN A 1 25 ? -11.732 -1.513  10.330  1.00 0.00 ? 25 GLN A HG3  1  
ATOM 395   H HE21 . GLN A 1 25 ? -14.542 0.155   9.466   1.00 0.00 ? 25 GLN A HE21 1  
ATOM 396   H HE22 . GLN A 1 25 ? -13.955 1.792   9.655   1.00 0.00 ? 25 GLN A HE22 1  
ATOM 397   N N    . ARG A 1 26 ? -13.412 -3.423  6.518   1.00 0.00 ? 26 ARG A N    1  
ATOM 398   C CA   . ARG A 1 26 ? -14.752 -3.900  6.177   1.00 0.00 ? 26 ARG A CA   1  
ATOM 399   C C    . ARG A 1 26 ? -14.829 -5.435  6.186   1.00 0.00 ? 26 ARG A C    1  
ATOM 400   O O    . ARG A 1 26 ? -15.874 -5.980  6.536   1.00 0.00 ? 26 ARG A O    1  
ATOM 401   C CB   . ARG A 1 26 ? -15.209 -3.322  4.828   1.00 0.00 ? 26 ARG A CB   1  
ATOM 402   C CG   . ARG A 1 26 ? -14.207 -3.652  3.722   1.00 0.00 ? 26 ARG A CG   1  
ATOM 403   C CD   . ARG A 1 26 ? -14.791 -3.260  2.359   1.00 0.00 ? 26 ARG A CD   1  
ATOM 404   N NE   . ARG A 1 26 ? -15.949 -4.099  2.012   1.00 0.00 ? 26 ARG A NE   1  
ATOM 405   C CZ   . ARG A 1 26 ? -15.841 -5.390  1.651   1.00 0.00 ? 26 ARG A CZ   1  
ATOM 406   N NH1  . ARG A 1 26 ? -14.638 -5.967  1.575   1.00 0.00 ? 26 ARG A NH1  1  
ATOM 407   N NH2  . ARG A 1 26 ? -16.940 -6.101  1.369   1.00 0.00 ? 26 ARG A NH2  1  
ATOM 408   H H    . ARG A 1 26 ? -12.884 -2.913  5.821   1.00 0.00 ? 26 ARG A H    1  
ATOM 409   H HA   . ARG A 1 26 ? -15.438 -3.531  6.940   1.00 0.00 ? 26 ARG A HA   1  
ATOM 410   H HB2  . ARG A 1 26 ? -16.181 -3.743  4.571   1.00 0.00 ? 26 ARG A HB2  1  
ATOM 411   H HB3  . ARG A 1 26 ? -15.301 -2.239  4.915   1.00 0.00 ? 26 ARG A HB3  1  
ATOM 412   H HG2  . ARG A 1 26 ? -13.292 -3.094  3.891   1.00 0.00 ? 26 ARG A HG2  1  
ATOM 413   H HG3  . ARG A 1 26 ? -13.988 -4.717  3.731   1.00 0.00 ? 26 ARG A HG3  1  
ATOM 414   H HD2  . ARG A 1 26 ? -15.105 -2.216  2.394   1.00 0.00 ? 26 ARG A HD2  1  
ATOM 415   H HD3  . ARG A 1 26 ? -14.023 -3.373  1.594   1.00 0.00 ? 26 ARG A HD3  1  
ATOM 416   H HE   . ARG A 1 26 ? -16.864 -3.671  2.050   1.00 0.00 ? 26 ARG A HE   1  
ATOM 417   H HH11 . ARG A 1 26 ? -13.809 -5.425  1.757   1.00 0.00 ? 26 ARG A HH11 1  
ATOM 418   H HH12 . ARG A 1 26 ? -14.556 -6.953  1.335   1.00 0.00 ? 26 ARG A HH12 1  
ATOM 419   H HH21 . ARG A 1 26 ? -17.850 -5.668  1.423   1.00 0.00 ? 26 ARG A HH21 1  
ATOM 420   H HH22 . ARG A 1 26 ? -16.858 -7.073  1.102   1.00 0.00 ? 26 ARG A HH22 1  
ATOM 421   N N    . GLY A 1 27 ? -13.747 -6.142  5.812   1.00 0.00 ? 27 GLY A N    1  
ATOM 422   C CA   . GLY A 1 27 ? -13.770 -7.604  5.824   1.00 0.00 ? 27 GLY A CA   1  
ATOM 423   C C    . GLY A 1 27 ? -12.712 -8.217  4.904   1.00 0.00 ? 27 GLY A C    1  
ATOM 424   O O    . GLY A 1 27 ? -12.217 -9.307  5.190   1.00 0.00 ? 27 GLY A O    1  
ATOM 425   H H    . GLY A 1 27 ? -12.901 -5.669  5.525   1.00 0.00 ? 27 GLY A H    1  
ATOM 426   H HA2  . GLY A 1 27 ? -13.594 -7.950  6.844   1.00 0.00 ? 27 GLY A HA2  1  
ATOM 427   H HA3  . GLY A 1 27 ? -14.753 -7.947  5.501   1.00 0.00 ? 27 GLY A HA3  1  
ATOM 428   N N    . ASP A 1 28 ? -12.368 -7.537  3.802   1.00 0.00 ? 28 ASP A N    1  
ATOM 429   C CA   . ASP A 1 28 ? -11.387 -8.059  2.850   1.00 0.00 ? 28 ASP A CA   1  
ATOM 430   C C    . ASP A 1 28 ? -9.974  -7.900  3.416   1.00 0.00 ? 28 ASP A C    1  
ATOM 431   O O    . ASP A 1 28 ? -9.187  -7.092  2.926   1.00 0.00 ? 28 ASP A O    1  
ATOM 432   C CB   . ASP A 1 28 ? -11.526 -7.326  1.509   1.00 0.00 ? 28 ASP A CB   1  
ATOM 433   C CG   . ASP A 1 28 ? -12.500 -8.032  0.576   1.00 0.00 ? 28 ASP A CG   1  
ATOM 434   O OD1  . ASP A 1 28 ? -13.599 -8.387  1.057   1.00 0.00 ? 28 ASP A OD1  1  
ATOM 435   O OD2  . ASP A 1 28 ? -12.127 -8.195  -0.607  1.00 0.00 ? 28 ASP A OD2  1  
ATOM 436   H H    . ASP A 1 28 ? -12.792 -6.643  3.612   1.00 0.00 ? 28 ASP A H    1  
ATOM 437   H HA   . ASP A 1 28 ? -11.580 -9.121  2.689   1.00 0.00 ? 28 ASP A HA   1  
ATOM 438   H HB2  . ASP A 1 28 ? -11.878 -6.316  1.691   1.00 0.00 ? 28 ASP A HB2  1  
ATOM 439   H HB3  . ASP A 1 28 ? -10.552 -7.283  1.022   1.00 0.00 ? 28 ASP A HB3  1  
ATOM 440   N N    . THR A 1 29 ? -9.654  -8.685  4.449   1.00 0.00 ? 29 THR A N    1  
ATOM 441   C CA   . THR A 1 29 ? -8.339  -8.652  5.071   1.00 0.00 ? 29 THR A CA   1  
ATOM 442   C C    . THR A 1 29 ? -7.338  -9.456  4.227   1.00 0.00 ? 29 THR A C    1  
ATOM 443   O O    . THR A 1 29 ? -6.150  -9.492  4.547   1.00 0.00 ? 29 THR A O    1  
ATOM 444   C CB   . THR A 1 29 ? -8.431  -9.228  6.493   1.00 0.00 ? 29 THR A CB   1  
ATOM 445   O OG1  . THR A 1 29 ? -8.803  -10.589 6.432   1.00 0.00 ? 29 THR A OG1  1  
ATOM 446   C CG2  . THR A 1 29 ? -9.468  -8.459  7.313   1.00 0.00 ? 29 THR A CG2  1  
ATOM 447   H H    . THR A 1 29 ? -10.343 -9.327  4.817   1.00 0.00 ? 29 THR A H    1  
ATOM 448   H HA   . THR A 1 29 ? -8.000  -7.619  5.128   1.00 0.00 ? 29 THR A HA   1  
ATOM 449   H HB   . THR A 1 29 ? -7.460  -9.138  6.980   1.00 0.00 ? 29 THR A HB   1  
ATOM 450   H HG1  . THR A 1 29 ? -9.727  -10.644 6.177   1.00 0.00 ? 29 THR A HG1  1  
ATOM 451   H HG21 . THR A 1 29 ? -10.457 -8.593  6.880   1.00 0.00 ? 29 THR A HG21 1  
ATOM 452   H HG22 . THR A 1 29 ? -9.469  -8.831  8.338   1.00 0.00 ? 29 THR A HG22 1  
ATOM 453   H HG23 . THR A 1 29 ? -9.215  -7.403  7.315   1.00 0.00 ? 29 THR A HG23 1  
ATOM 454   N N    . HIS A 1 30 ? -7.827  -10.102 3.156   1.00 0.00 ? 30 HIS A N    1  
ATOM 455   C CA   . HIS A 1 30 ? -6.997  -10.924 2.288   1.00 0.00 ? 30 HIS A CA   1  
ATOM 456   C C    . HIS A 1 30 ? -5.897  -10.077 1.621   1.00 0.00 ? 30 HIS A C    1  
ATOM 457   O O    . HIS A 1 30 ? -6.056  -8.863  1.469   1.00 0.00 ? 30 HIS A O    1  
ATOM 458   C CB   . HIS A 1 30 ? -7.898  -11.581 1.227   1.00 0.00 ? 30 HIS A CB   1  
ATOM 459   C CG   . HIS A 1 30 ? -8.171  -10.684 0.042   1.00 0.00 ? 30 HIS A CG   1  
ATOM 460   N ND1  . HIS A 1 30 ? -8.477  -9.332  0.169   1.00 0.00 ? 30 HIS A ND1  1  
ATOM 461   C CD2  . HIS A 1 30 ? -8.179  -10.918 -1.311  1.00 0.00 ? 30 HIS A CD2  1  
ATOM 462   C CE1  . HIS A 1 30 ? -8.642  -8.852  -1.079  1.00 0.00 ? 30 HIS A CE1  1  
ATOM 463   N NE2  . HIS A 1 30 ? -8.477  -9.772  -2.028  1.00 0.00 ? 30 HIS A NE2  1  
ATOM 464   H H    . HIS A 1 30 ? -8.808  -10.029 2.938   1.00 0.00 ? 30 HIS A H    1  
ATOM 465   H HA   . HIS A 1 30 ? -6.538  -11.703 2.891   1.00 0.00 ? 30 HIS A HA   1  
ATOM 466   H HB2  . HIS A 1 30 ? -7.417  -12.489 0.870   1.00 0.00 ? 30 HIS A HB2  1  
ATOM 467   H HB3  . HIS A 1 30 ? -8.849  -11.850 1.690   1.00 0.00 ? 30 HIS A HB3  1  
ATOM 468   H HD1  . HIS A 1 30 ? -8.555  -8.809  1.031   1.00 0.00 ? 30 HIS A HD1  1  
ATOM 469   H HD2  . HIS A 1 30 ? -7.971  -11.876 -1.761  1.00 0.00 ? 30 HIS A HD2  1  
ATOM 470   H HE1  . HIS A 1 30 ? -8.877  -7.823  -1.290  1.00 0.00 ? 30 HIS A HE1  1  
ATOM 471   N N    . PRO A 1 31 ? -4.781  -10.714 1.212   1.00 0.00 ? 31 PRO A N    1  
ATOM 472   C CA   . PRO A 1 31 ? -3.700  -10.034 0.529   1.00 0.00 ? 31 PRO A CA   1  
ATOM 473   C C    . PRO A 1 31 ? -4.149  -9.564  -0.857  1.00 0.00 ? 31 PRO A C    1  
ATOM 474   O O    . PRO A 1 31 ? -5.103  -10.102 -1.416  1.00 0.00 ? 31 PRO A O    1  
ATOM 475   C CB   . PRO A 1 31 ? -2.573  -11.062 0.410   1.00 0.00 ? 31 PRO A CB   1  
ATOM 476   C CG   . PRO A 1 31 ? -3.134  -12.403 0.896   1.00 0.00 ? 31 PRO A CG   1  
ATOM 477   C CD   . PRO A 1 31 ? -4.545  -12.131 1.411   1.00 0.00 ? 31 PRO A CD   1  
ATOM 478   H HA   . PRO A 1 31 ? -3.367  -9.181  1.119   1.00 0.00 ? 31 PRO A HA   1  
ATOM 479   H HB2  . PRO A 1 31 ? -2.263  -11.150 -0.627  1.00 0.00 ? 31 PRO A HB2  1  
ATOM 480   H HB3  . PRO A 1 31 ? -1.726  -10.765 1.027   1.00 0.00 ? 31 PRO A HB3  1  
ATOM 481   H HG2  . PRO A 1 31 ? -3.170  -13.113 0.069   1.00 0.00 ? 31 PRO A HG2  1  
ATOM 482   H HG3  . PRO A 1 31 ? -2.513  -12.799 1.699   1.00 0.00 ? 31 PRO A HG3  1  
ATOM 483   H HD2  . PRO A 1 31 ? -5.266  -12.718 0.845   1.00 0.00 ? 31 PRO A HD2  1  
ATOM 484   H HD3  . PRO A 1 31 ? -4.604  -12.380 2.471   1.00 0.00 ? 31 PRO A HD3  1  
ATOM 485   N N    . LEU A 1 32 ? -3.443  -8.567  -1.409  1.00 0.00 ? 32 LEU A N    1  
ATOM 486   C CA   . LEU A 1 32 ? -3.730  -8.038  -2.736  1.00 0.00 ? 32 LEU A CA   1  
ATOM 487   C C    . LEU A 1 32 ? -2.420  -7.822  -3.490  1.00 0.00 ? 32 LEU A C    1  
ATOM 488   O O    . LEU A 1 32 ? -1.438  -7.362  -2.905  1.00 0.00 ? 32 LEU A O    1  
ATOM 489   C CB   . LEU A 1 32 ? -4.460  -6.693  -2.619  1.00 0.00 ? 32 LEU A CB   1  
ATOM 490   C CG   . LEU A 1 32 ? -5.979  -6.875  -2.455  1.00 0.00 ? 32 LEU A CG   1  
ATOM 491   C CD1  . LEU A 1 32 ? -6.644  -5.502  -2.543  1.00 0.00 ? 32 LEU A CD1  1  
ATOM 492   C CD2  . LEU A 1 32 ? -6.546  -7.765  -3.565  1.00 0.00 ? 32 LEU A CD2  1  
ATOM 493   H H    . LEU A 1 32 ? -2.672  -8.159  -0.894  1.00 0.00 ? 32 LEU A H    1  
ATOM 494   H HA   . LEU A 1 32 ? -4.345  -8.748  -3.285  1.00 0.00 ? 32 LEU A HA   1  
ATOM 495   H HB2  . LEU A 1 32 ? -4.071  -6.150  -1.757  1.00 0.00 ? 32 LEU A HB2  1  
ATOM 496   H HB3  . LEU A 1 32 ? -4.268  -6.112  -3.519  1.00 0.00 ? 32 LEU A HB3  1  
ATOM 497   H HG   . LEU A 1 32 ? -6.191  -7.322  -1.483  1.00 0.00 ? 32 LEU A HG   1  
ATOM 498   H HD11 . LEU A 1 32 ? -6.487  -5.086  -3.544  1.00 0.00 ? 32 LEU A HD11 1  
ATOM 499   H HD12 . LEU A 1 32 ? -6.206  -4.836  -1.800  1.00 0.00 ? 32 LEU A HD12 1  
ATOM 500   H HD13 . LEU A 1 32 ? -7.712  -5.602  -2.356  1.00 0.00 ? 32 LEU A HD13 1  
ATOM 501   H HD21 . LEU A 1 32 ? -7.612  -7.569  -3.679  1.00 0.00 ? 32 LEU A HD21 1  
ATOM 502   H HD22 . LEU A 1 32 ? -6.038  -7.544  -4.498  1.00 0.00 ? 32 LEU A HD22 1  
ATOM 503   H HD23 . LEU A 1 32 ? -6.401  -8.813  -3.309  1.00 0.00 ? 32 LEU A HD23 1  
ATOM 504   N N    . THR A 1 33 ? -2.406  -8.137  -4.792  1.00 0.00 ? 33 THR A N    1  
ATOM 505   C CA   . THR A 1 33 ? -1.228  -7.912  -5.622  1.00 0.00 ? 33 THR A CA   1  
ATOM 506   C C    . THR A 1 33 ? -0.962  -6.409  -5.711  1.00 0.00 ? 33 THR A C    1  
ATOM 507   O O    . THR A 1 33 ? -1.813  -5.596  -5.343  1.00 0.00 ? 33 THR A O    1  
ATOM 508   C CB   . THR A 1 33 ? -1.445  -8.477  -7.036  1.00 0.00 ? 33 THR A CB   1  
ATOM 509   O OG1  . THR A 1 33 ? -2.553  -7.843  -7.630  1.00 0.00 ? 33 THR A OG1  1  
ATOM 510   C CG2  . THR A 1 33 ? -1.685  -9.986  -6.989  1.00 0.00 ? 33 THR A CG2  1  
ATOM 511   H H    . THR A 1 33 ? -3.233  -8.532  -5.224  1.00 0.00 ? 33 THR A H    1  
ATOM 512   H HA   . THR A 1 33 ? -0.368  -8.407  -5.163  1.00 0.00 ? 33 THR A HA   1  
ATOM 513   H HB   . THR A 1 33 ? -0.559  -8.279  -7.640  1.00 0.00 ? 33 THR A HB   1  
ATOM 514   H HG1  . THR A 1 33 ? -3.352  -8.134  -7.175  1.00 0.00 ? 33 THR A HG1  1  
ATOM 515   H HG21 . THR A 1 33 ? -2.438  -10.218 -6.238  1.00 0.00 ? 33 THR A HG21 1  
ATOM 516   H HG22 . THR A 1 33 ? -2.033  -10.327 -7.965  1.00 0.00 ? 33 THR A HG22 1  
ATOM 517   H HG23 . THR A 1 33 ? -0.755  -10.492 -6.742  1.00 0.00 ? 33 THR A HG23 1  
ATOM 518   N N    . LEU A 1 34 ? 0.215   -6.039  -6.215  1.00 0.00 ? 34 LEU A N    1  
ATOM 519   C CA   . LEU A 1 34 ? 0.571   -4.642  -6.381  1.00 0.00 ? 34 LEU A CA   1  
ATOM 520   C C    . LEU A 1 34 ? -0.435  -3.984  -7.333  1.00 0.00 ? 34 LEU A C    1  
ATOM 521   O O    . LEU A 1 34 ? -0.973  -2.923  -7.032  1.00 0.00 ? 34 LEU A O    1  
ATOM 522   C CB   . LEU A 1 34 ? 2.015   -4.568  -6.921  1.00 0.00 ? 34 LEU A CB   1  
ATOM 523   C CG   . LEU A 1 34 ? 2.594   -3.131  -6.895  1.00 0.00 ? 34 LEU A CG   1  
ATOM 524   C CD1  . LEU A 1 34 ? 2.245   -2.396  -8.190  1.00 0.00 ? 34 LEU A CD1  1  
ATOM 525   C CD2  . LEU A 1 34 ? 2.074   -2.335  -5.692  1.00 0.00 ? 34 LEU A CD2  1  
ATOM 526   H H    . LEU A 1 34 ? 0.882   -6.741  -6.498  1.00 0.00 ? 34 LEU A H    1  
ATOM 527   H HA   . LEU A 1 34 ? 0.518   -4.155  -5.411  1.00 0.00 ? 34 LEU A HA   1  
ATOM 528   H HB2  . LEU A 1 34 ? 2.648   -5.208  -6.306  1.00 0.00 ? 34 LEU A HB2  1  
ATOM 529   H HB3  . LEU A 1 34 ? 2.032   -4.941  -7.945  1.00 0.00 ? 34 LEU A HB3  1  
ATOM 530   H HG   . LEU A 1 34 ? 3.680   -3.197  -6.819  1.00 0.00 ? 34 LEU A HG   1  
ATOM 531   H HD11 . LEU A 1 34 ? 2.748   -1.430  -8.206  1.00 0.00 ? 34 LEU A HD11 1  
ATOM 532   H HD12 . LEU A 1 34 ? 1.174   -2.244  -8.248  1.00 0.00 ? 34 LEU A HD12 1  
ATOM 533   H HD13 . LEU A 1 34 ? 2.573   -2.988  -9.045  1.00 0.00 ? 34 LEU A HD13 1  
ATOM 534   H HD21 . LEU A 1 34 ? 2.175   -2.933  -4.788  1.00 0.00 ? 34 LEU A HD21 1  
ATOM 535   H HD22 . LEU A 1 34 ? 2.660   -1.422  -5.585  1.00 0.00 ? 34 LEU A HD22 1  
ATOM 536   H HD23 . LEU A 1 34 ? 1.029   -2.073  -5.844  1.00 0.00 ? 34 LEU A HD23 1  
ATOM 537   N N    . ASP A 1 35 ? -0.688  -4.625  -8.480  1.00 0.00 ? 35 ASP A N    1  
ATOM 538   C CA   . ASP A 1 35 ? -1.614  -4.107  -9.480  1.00 0.00 ? 35 ASP A CA   1  
ATOM 539   C C    . ASP A 1 35 ? -3.002  -3.876  -8.873  1.00 0.00 ? 35 ASP A C    1  
ATOM 540   O O    . ASP A 1 35 ? -3.573  -2.801  -9.041  1.00 0.00 ? 35 ASP A O    1  
ATOM 541   C CB   . ASP A 1 35 ? -1.683  -5.091  -10.648 1.00 0.00 ? 35 ASP A CB   1  
ATOM 542   C CG   . ASP A 1 35 ? -0.307  -5.272  -11.278 1.00 0.00 ? 35 ASP A CG   1  
ATOM 543   O OD1  . ASP A 1 35 ? 0.416   -6.179  -10.806 1.00 0.00 ? 35 ASP A OD1  1  
ATOM 544   O OD2  . ASP A 1 35 ? -0.001  -4.500  -12.213 1.00 0.00 ? 35 ASP A OD2  1  
ATOM 545   H H    . ASP A 1 35 ? -0.221  -5.501  -8.673  1.00 0.00 ? 35 ASP A H    1  
ATOM 546   H HA   . ASP A 1 35 ? -1.231  -3.156  -9.850  1.00 0.00 ? 35 ASP A HA   1  
ATOM 547   H HB2  . ASP A 1 35 ? -2.045  -6.055  -10.288 1.00 0.00 ? 35 ASP A HB2  1  
ATOM 548   H HB3  . ASP A 1 35 ? -2.374  -4.707  -11.400 1.00 0.00 ? 35 ASP A HB3  1  
ATOM 549   N N    . GLU A 1 36 ? -3.544  -4.881  -8.166  1.00 0.00 ? 36 GLU A N    1  
ATOM 550   C CA   . GLU A 1 36 ? -4.862  -4.769  -7.538  1.00 0.00 ? 36 GLU A CA   1  
ATOM 551   C C    . GLU A 1 36 ? -4.934  -3.511  -6.668  1.00 0.00 ? 36 GLU A C    1  
ATOM 552   O O    . GLU A 1 36 ? -5.978  -2.866  -6.599  1.00 0.00 ? 36 GLU A O    1  
ATOM 553   C CB   . GLU A 1 36 ? -5.145  -6.023  -6.706  1.00 0.00 ? 36 GLU A CB   1  
ATOM 554   C CG   . GLU A 1 36 ? -5.590  -7.163  -7.630  1.00 0.00 ? 36 GLU A CG   1  
ATOM 555   C CD   . GLU A 1 36 ? -5.688  -8.482  -6.869  1.00 0.00 ? 36 GLU A CD   1  
ATOM 556   O OE1  . GLU A 1 36 ? -4.656  -8.876  -6.279  1.00 0.00 ? 36 GLU A OE1  1  
ATOM 557   O OE2  . GLU A 1 36 ? -6.790  -9.069  -6.890  1.00 0.00 ? 36 GLU A OE2  1  
ATOM 558   H H    . GLU A 1 36 ? -3.034  -5.749  -8.056  1.00 0.00 ? 36 GLU A H    1  
ATOM 559   H HA   . GLU A 1 36 ? -5.620  -4.692  -8.313  1.00 0.00 ? 36 GLU A HA   1  
ATOM 560   H HB2  . GLU A 1 36 ? -4.244  -6.314  -6.167  1.00 0.00 ? 36 GLU A HB2  1  
ATOM 561   H HB3  . GLU A 1 36 ? -5.941  -5.809  -5.991  1.00 0.00 ? 36 GLU A HB3  1  
ATOM 562   H HG2  . GLU A 1 36 ? -6.566  -6.922  -8.052  1.00 0.00 ? 36 GLU A HG2  1  
ATOM 563   H HG3  . GLU A 1 36 ? -4.869  -7.273  -8.440  1.00 0.00 ? 36 GLU A HG3  1  
ATOM 564   N N    . ILE A 1 37 ? -3.825  -3.163  -6.008  1.00 0.00 ? 37 ILE A N    1  
ATOM 565   C CA   . ILE A 1 37 ? -3.779  -1.987  -5.157  1.00 0.00 ? 37 ILE A CA   1  
ATOM 566   C C    . ILE A 1 37 ? -3.799  -0.713  -6.013  1.00 0.00 ? 37 ILE A C    1  
ATOM 567   O O    . ILE A 1 37 ? -4.535  0.220   -5.693  1.00 0.00 ? 37 ILE A O    1  
ATOM 568   C CB   . ILE A 1 37 ? -2.529  -2.052  -4.262  1.00 0.00 ? 37 ILE A CB   1  
ATOM 569   C CG1  . ILE A 1 37 ? -2.716  -3.157  -3.209  1.00 0.00 ? 37 ILE A CG1  1  
ATOM 570   C CG2  . ILE A 1 37 ? -2.317  -0.707  -3.562  1.00 0.00 ? 37 ILE A CG2  1  
ATOM 571   C CD1  . ILE A 1 37 ? -1.363  -3.561  -2.618  1.00 0.00 ? 37 ILE A CD1  1  
ATOM 572   H H    . ILE A 1 37 ? -2.988  -3.727  -6.096  1.00 0.00 ? 37 ILE A H    1  
ATOM 573   H HA   . ILE A 1 37 ? -4.665  -1.985  -4.520  1.00 0.00 ? 37 ILE A HA   1  
ATOM 574   H HB   . ILE A 1 37 ? -1.658  -2.277  -4.871  1.00 0.00 ? 37 ILE A HB   1  
ATOM 575   H HG12 . ILE A 1 37 ? -3.364  -2.795  -2.411  1.00 0.00 ? 37 ILE A HG12 1  
ATOM 576   H HG13 . ILE A 1 37 ? -3.173  -4.028  -3.675  1.00 0.00 ? 37 ILE A HG13 1  
ATOM 577   H HG21 . ILE A 1 37 ? -2.120  0.065   -4.304  1.00 0.00 ? 37 ILE A HG21 1  
ATOM 578   H HG22 . ILE A 1 37 ? -3.211  -0.446  -2.995  1.00 0.00 ? 37 ILE A HG22 1  
ATOM 579   H HG23 . ILE A 1 37 ? -1.468  -0.778  -2.888  1.00 0.00 ? 37 ILE A HG23 1  
ATOM 580   H HD11 . ILE A 1 37 ? -0.932  -2.719  -2.077  1.00 0.00 ? 37 ILE A HD11 1  
ATOM 581   H HD12 . ILE A 1 37 ? -1.505  -4.395  -1.932  1.00 0.00 ? 37 ILE A HD12 1  
ATOM 582   H HD13 . ILE A 1 37 ? -0.690  -3.861  -3.419  1.00 0.00 ? 37 ILE A HD13 1  
ATOM 583   N N    . LEU A 1 38 ? -2.993  -0.667  -7.093  1.00 0.00 ? 38 LEU A N    1  
ATOM 584   C CA   . LEU A 1 38 ? -2.918  0.516   -7.959  1.00 0.00 ? 38 LEU A CA   1  
ATOM 585   C C    . LEU A 1 38 ? -4.317  1.004   -8.327  1.00 0.00 ? 38 LEU A C    1  
ATOM 586   O O    . LEU A 1 38 ? -4.656  2.155   -8.071  1.00 0.00 ? 38 LEU A O    1  
ATOM 587   C CB   . LEU A 1 38 ? -2.156  0.203   -9.256  1.00 0.00 ? 38 LEU A CB   1  
ATOM 588   C CG   . LEU A 1 38 ? -0.704  -0.219  -8.999  1.00 0.00 ? 38 LEU A CG   1  
ATOM 589   C CD1  . LEU A 1 38 ? 0.059   -0.184  -10.322 1.00 0.00 ? 38 LEU A CD1  1  
ATOM 590   C CD2  . LEU A 1 38 ? -0.007  0.713   -7.996  1.00 0.00 ? 38 LEU A CD2  1  
ATOM 591   H H    . LEU A 1 38 ? -2.413  -1.467  -7.319  1.00 0.00 ? 38 LEU A H    1  
ATOM 592   H HA   . LEU A 1 38 ? -2.402  1.311   -7.426  1.00 0.00 ? 38 LEU A HA   1  
ATOM 593   H HB2  . LEU A 1 38 ? -2.667  -0.600  -9.786  1.00 0.00 ? 38 LEU A HB2  1  
ATOM 594   H HB3  . LEU A 1 38 ? -2.160  1.087   -9.881  1.00 0.00 ? 38 LEU A HB3  1  
ATOM 595   H HG   . LEU A 1 38 ? -0.699  -1.229  -8.618  1.00 0.00 ? 38 LEU A HG   1  
ATOM 596   H HD11 . LEU A 1 38 ? -0.482  -0.760  -11.071 1.00 0.00 ? 38 LEU A HD11 1  
ATOM 597   H HD12 . LEU A 1 38 ? 0.158   0.849   -10.658 1.00 0.00 ? 38 LEU A HD12 1  
ATOM 598   H HD13 . LEU A 1 38 ? 1.048   -0.612  -10.180 1.00 0.00 ? 38 LEU A HD13 1  
ATOM 599   H HD21 . LEU A 1 38 ? -0.209  1.747   -8.256  1.00 0.00 ? 38 LEU A HD21 1  
ATOM 600   H HD22 . LEU A 1 38 ? -0.375  0.511   -6.991  1.00 0.00 ? 38 LEU A HD22 1  
ATOM 601   H HD23 . LEU A 1 38 ? 1.073   0.540   -8.027  1.00 0.00 ? 38 LEU A HD23 1  
ATOM 602   N N    . ASP A 1 39 ? -5.114  0.124   -8.945  1.00 0.00 ? 39 ASP A N    1  
ATOM 603   C CA   . ASP A 1 39 ? -6.454  0.459   -9.410  1.00 0.00 ? 39 ASP A CA   1  
ATOM 604   C C    . ASP A 1 39 ? -7.244  1.224   -8.346  1.00 0.00 ? 39 ASP A C    1  
ATOM 605   O O    . ASP A 1 39 ? -7.617  2.376   -8.557  1.00 0.00 ? 39 ASP A O    1  
ATOM 606   C CB   . ASP A 1 39 ? -7.191  -0.832  -9.785  1.00 0.00 ? 39 ASP A CB   1  
ATOM 607   C CG   . ASP A 1 39 ? -6.670  -1.404  -11.098 1.00 0.00 ? 39 ASP A CG   1  
ATOM 608   O OD1  . ASP A 1 39 ? -5.453  -1.680  -11.156 1.00 0.00 ? 39 ASP A OD1  1  
ATOM 609   O OD2  . ASP A 1 39 ? -7.500  -1.553  -12.020 1.00 0.00 ? 39 ASP A OD2  1  
ATOM 610   H H    . ASP A 1 39 ? -4.776  -0.818  -9.114  1.00 0.00 ? 39 ASP A H    1  
ATOM 611   H HA   . ASP A 1 39 ? -6.368  1.085   -10.301 1.00 0.00 ? 39 ASP A HA   1  
ATOM 612   H HB2  . ASP A 1 39 ? -7.051  -1.571  -8.994  1.00 0.00 ? 39 ASP A HB2  1  
ATOM 613   H HB3  . ASP A 1 39 ? -8.256  -0.620  -9.888  1.00 0.00 ? 39 ASP A HB3  1  
ATOM 614   N N    . GLU A 1 40 ? -7.509  0.571   -7.211  1.00 0.00 ? 40 GLU A N    1  
ATOM 615   C CA   . GLU A 1 40 ? -8.320  1.146   -6.141  1.00 0.00 ? 40 GLU A CA   1  
ATOM 616   C C    . GLU A 1 40 ? -7.718  2.445   -5.587  1.00 0.00 ? 40 GLU A C    1  
ATOM 617   O O    . GLU A 1 40 ? -8.455  3.288   -5.074  1.00 0.00 ? 40 GLU A O    1  
ATOM 618   C CB   . GLU A 1 40 ? -8.468  0.106   -5.030  1.00 0.00 ? 40 GLU A CB   1  
ATOM 619   C CG   . GLU A 1 40 ? -9.286  -1.091  -5.540  1.00 0.00 ? 40 GLU A CG   1  
ATOM 620   C CD   . GLU A 1 40 ? -10.469 -1.382  -4.620  1.00 0.00 ? 40 GLU A CD   1  
ATOM 621   O OE1  . GLU A 1 40 ? -11.369 -0.519  -4.563  1.00 0.00 ? 40 GLU A OE1  1  
ATOM 622   O OE2  . GLU A 1 40 ? -10.447 -2.465  -3.989  1.00 0.00 ? 40 GLU A OE2  1  
ATOM 623   H H    . GLU A 1 40 ? -7.154  -0.366  -7.086  1.00 0.00 ? 40 GLU A H    1  
ATOM 624   H HA   . GLU A 1 40 ? -9.310  1.370   -6.540  1.00 0.00 ? 40 GLU A HA   1  
ATOM 625   H HB2  . GLU A 1 40 ? -7.480  -0.235  -4.718  1.00 0.00 ? 40 GLU A HB2  1  
ATOM 626   H HB3  . GLU A 1 40 ? -8.976  0.560   -4.179  1.00 0.00 ? 40 GLU A HB3  1  
ATOM 627   H HG2  . GLU A 1 40 ? -9.663  -0.873  -6.540  1.00 0.00 ? 40 GLU A HG2  1  
ATOM 628   H HG3  . GLU A 1 40 ? -8.644  -1.970  -5.586  1.00 0.00 ? 40 GLU A HG3  1  
ATOM 629   N N    . THR A 1 41 ? -6.392  2.610   -5.673  1.00 0.00 ? 41 THR A N    1  
ATOM 630   C CA   . THR A 1 41 ? -5.730  3.802   -5.146  1.00 0.00 ? 41 THR A CA   1  
ATOM 631   C C    . THR A 1 41 ? -5.565  4.874   -6.224  1.00 0.00 ? 41 THR A C    1  
ATOM 632   O O    . THR A 1 41 ? -5.049  5.935   -5.927  1.00 0.00 ? 41 THR A O    1  
ATOM 633   C CB   . THR A 1 41 ? -4.373  3.417   -4.553  1.00 0.00 ? 41 THR A CB   1  
ATOM 634   O OG1  . THR A 1 41 ? -3.581  2.783   -5.532  1.00 0.00 ? 41 THR A OG1  1  
ATOM 635   C CG2  . THR A 1 41 ? -4.572  2.479   -3.364  1.00 0.00 ? 41 THR A CG2  1  
ATOM 636   H H    . THR A 1 41 ? -5.823  1.895   -6.109  1.00 0.00 ? 41 THR A H    1  
ATOM 637   H HA   . THR A 1 41 ? -6.335  4.226   -4.348  1.00 0.00 ? 41 THR A HA   1  
ATOM 638   H HB   . THR A 1 41 ? -3.867  4.315   -4.208  1.00 0.00 ? 41 THR A HB   1  
ATOM 639   H HG1  . THR A 1 41 ? -4.028  1.981   -5.816  1.00 0.00 ? 41 THR A HG1  1  
ATOM 640   H HG21 . THR A 1 41 ? -4.930  3.052   -2.507  1.00 0.00 ? 41 THR A HG21 1  
ATOM 641   H HG22 . THR A 1 41 ? -3.624  2.009   -3.115  1.00 0.00 ? 41 THR A HG22 1  
ATOM 642   H HG23 . THR A 1 41 ? -5.300  1.710   -3.616  1.00 0.00 ? 41 THR A HG23 1  
ATOM 643   N N    . GLN A 1 42 ? -6.005  4.600   -7.466  1.00 0.00 ? 42 GLN A N    1  
ATOM 644   C CA   . GLN A 1 42 ? -5.893  5.552   -8.579  1.00 0.00 ? 42 GLN A CA   1  
ATOM 645   C C    . GLN A 1 42 ? -4.422  5.768   -8.935  1.00 0.00 ? 42 GLN A C    1  
ATOM 646   O O    . GLN A 1 42 ? -4.004  6.896   -9.201  1.00 0.00 ? 42 GLN A O    1  
ATOM 647   C CB   . GLN A 1 42 ? -6.564  6.904   -8.233  1.00 0.00 ? 42 GLN A CB   1  
ATOM 648   C CG   . GLN A 1 42 ? -8.080  6.794   -8.310  1.00 0.00 ? 42 GLN A CG   1  
ATOM 649   C CD   . GLN A 1 42 ? -8.634  5.727   -7.370  1.00 0.00 ? 42 GLN A CD   1  
ATOM 650   O OE1  . GLN A 1 42 ? -9.218  4.748   -7.818  1.00 0.00 ? 42 GLN A OE1  1  
ATOM 651   N NE2  . GLN A 1 42 ? -8.449  5.921   -6.066  1.00 0.00 ? 42 GLN A NE2  1  
ATOM 652   H H    . GLN A 1 42 ? -6.434  3.702   -7.654  1.00 0.00 ? 42 GLN A H    1  
ATOM 653   H HA   . GLN A 1 42 ? -6.398  5.127   -9.448  1.00 0.00 ? 42 GLN A HA   1  
ATOM 654   H HB2  . GLN A 1 42 ? -6.278  7.225   -7.239  1.00 0.00 ? 42 GLN A HB2  1  
ATOM 655   H HB3  . GLN A 1 42 ? -6.238  7.656   -8.951  1.00 0.00 ? 42 GLN A HB3  1  
ATOM 656   H HG2  . GLN A 1 42 ? -8.506  7.757   -8.040  1.00 0.00 ? 42 GLN A HG2  1  
ATOM 657   H HG3  . GLN A 1 42 ? -8.362  6.552   -9.331  1.00 0.00 ? 42 GLN A HG3  1  
ATOM 658   H HE21 . GLN A 1 42 ? -8.001  6.762   -5.741  1.00 0.00 ? 42 GLN A HE21 1  
ATOM 659   H HE22 . GLN A 1 42 ? -8.759  5.217   -5.405  1.00 0.00 ? 42 GLN A HE22 1  
ATOM 660   N N    . HIS A 1 43 ? -3.631  4.689   -8.941  1.00 0.00 ? 43 HIS A N    1  
ATOM 661   C CA   . HIS A 1 43 ? -2.212  4.769   -9.267  1.00 0.00 ? 43 HIS A CA   1  
ATOM 662   C C    . HIS A 1 43 ? -1.867  3.725   -10.324 1.00 0.00 ? 43 HIS A C    1  
ATOM 663   O O    . HIS A 1 43 ? -0.858  3.048   -10.211 1.00 0.00 ? 43 HIS A O    1  
ATOM 664   C CB   . HIS A 1 43 ? -1.374  4.539   -8.001  1.00 0.00 ? 43 HIS A CB   1  
ATOM 665   C CG   . HIS A 1 43 ? -1.811  5.369   -6.822  1.00 0.00 ? 43 HIS A CG   1  
ATOM 666   N ND1  . HIS A 1 43 ? -2.388  6.626   -6.942  1.00 0.00 ? 43 HIS A ND1  1  
ATOM 667   C CD2  . HIS A 1 43 ? -1.767  5.133   -5.475  1.00 0.00 ? 43 HIS A CD2  1  
ATOM 668   C CE1  . HIS A 1 43 ? -2.652  7.054   -5.691  1.00 0.00 ? 43 HIS A CE1  1  
ATOM 669   N NE2  . HIS A 1 43 ? -2.293  6.187   -4.748  1.00 0.00 ? 43 HIS A NE2  1  
ATOM 670   H H    . HIS A 1 43 ? -4.021  3.783   -8.713  1.00 0.00 ? 43 HIS A H    1  
ATOM 671   H HA   . HIS A 1 43 ? -1.984  5.757   -9.667  1.00 0.00 ? 43 HIS A HA   1  
ATOM 672   H HB2  . HIS A 1 43 ? -1.445  3.490   -7.722  1.00 0.00 ? 43 HIS A HB2  1  
ATOM 673   H HB3  . HIS A 1 43 ? -0.332  4.772   -8.223  1.00 0.00 ? 43 HIS A HB3  1  
ATOM 674   H HD1  . HIS A 1 43 ? -2.581  7.123   -7.803  1.00 0.00 ? 43 HIS A HD1  1  
ATOM 675   H HD2  . HIS A 1 43 ? -1.374  4.230   -5.033  1.00 0.00 ? 43 HIS A HD2  1  
ATOM 676   H HE1  . HIS A 1 43 ? -3.122  7.998   -5.475  1.00 0.00 ? 43 HIS A HE1  1  
ATOM 677   N N    . LEU A 1 44 ? -2.704  3.590   -11.356 1.00 0.00 ? 44 LEU A N    1  
ATOM 678   C CA   . LEU A 1 44 ? -2.450  2.621   -12.415 1.00 0.00 ? 44 LEU A CA   1  
ATOM 679   C C    . LEU A 1 44 ? -1.362  3.159   -13.342 1.00 0.00 ? 44 LEU A C    1  
ATOM 680   O O    . LEU A 1 44 ? -0.379  2.466   -13.612 1.00 0.00 ? 44 LEU A O    1  
ATOM 681   C CB   . LEU A 1 44 ? -3.749  2.330   -13.176 1.00 0.00 ? 44 LEU A CB   1  
ATOM 682   C CG   . LEU A 1 44 ? -4.057  0.828   -13.112 1.00 0.00 ? 44 LEU A CG   1  
ATOM 683   C CD1  . LEU A 1 44 ? -5.482  0.583   -13.614 1.00 0.00 ? 44 LEU A CD1  1  
ATOM 684   C CD2  . LEU A 1 44 ? -3.069  0.058   -13.996 1.00 0.00 ? 44 LEU A CD2  1  
ATOM 685   H H    . LEU A 1 44 ? -3.529  4.166   -11.414 1.00 0.00 ? 44 LEU A H    1  
ATOM 686   H HA   . LEU A 1 44 ? -2.094  1.697   -11.964 1.00 0.00 ? 44 LEU A HA   1  
ATOM 687   H HB2  . LEU A 1 44 ? -4.570  2.887   -12.721 1.00 0.00 ? 44 LEU A HB2  1  
ATOM 688   H HB3  . LEU A 1 44 ? -3.641  2.637   -14.218 1.00 0.00 ? 44 LEU A HB3  1  
ATOM 689   H HG   . LEU A 1 44 ? -3.970  0.479   -12.076 1.00 0.00 ? 44 LEU A HG   1  
ATOM 690   H HD11 . LEU A 1 44 ? -5.671  -0.489  -13.660 1.00 0.00 ? 44 LEU A HD11 1  
ATOM 691   H HD12 . LEU A 1 44 ? -5.597  1.013   -14.609 1.00 0.00 ? 44 LEU A HD12 1  
ATOM 692   H HD13 . LEU A 1 44 ? -6.193  1.047   -12.932 1.00 0.00 ? 44 LEU A HD13 1  
ATOM 693   H HD21 . LEU A 1 44 ? -3.321  -1.003  -13.982 1.00 0.00 ? 44 LEU A HD21 1  
ATOM 694   H HD22 . LEU A 1 44 ? -3.127  0.430   -15.019 1.00 0.00 ? 44 LEU A HD22 1  
ATOM 695   H HD23 . LEU A 1 44 ? -2.057  0.193   -13.618 1.00 0.00 ? 44 LEU A HD23 1  
ATOM 696   N N    . ASP A 1 45 ? -1.537  4.397   -13.819 1.00 0.00 ? 45 ASP A N    1  
ATOM 697   C CA   . ASP A 1 45 ? -0.560  5.047   -14.685 1.00 0.00 ? 45 ASP A CA   1  
ATOM 698   C C    . ASP A 1 45 ? 0.769   5.179   -13.940 1.00 0.00 ? 45 ASP A C    1  
ATOM 699   O O    . ASP A 1 45 ? 1.829   4.977   -14.530 1.00 0.00 ? 45 ASP A O    1  
ATOM 700   C CB   . ASP A 1 45 ? -1.087  6.425   -15.096 1.00 0.00 ? 45 ASP A CB   1  
ATOM 701   C CG   . ASP A 1 45 ? -2.486  6.321   -15.691 1.00 0.00 ? 45 ASP A CG   1  
ATOM 702   O OD1  . ASP A 1 45 ? -3.435  6.181   -14.887 1.00 0.00 ? 45 ASP A OD1  1  
ATOM 703   O OD2  . ASP A 1 45 ? -2.581  6.380   -16.936 1.00 0.00 ? 45 ASP A OD2  1  
ATOM 704   H H    . ASP A 1 45 ? -2.373  4.915   -13.574 1.00 0.00 ? 45 ASP A H    1  
ATOM 705   H HA   . ASP A 1 45 ? -0.413  4.439   -15.578 1.00 0.00 ? 45 ASP A HA   1  
ATOM 706   H HB2  . ASP A 1 45 ? -1.121  7.073   -14.220 1.00 0.00 ? 45 ASP A HB2  1  
ATOM 707   H HB3  . ASP A 1 45 ? -0.414  6.860   -15.836 1.00 0.00 ? 45 ASP A HB3  1  
ATOM 708   N N    . ILE A 1 46 ? 0.676   5.513   -12.634 1.00 0.00 ? 46 ILE A N    1  
ATOM 709   C CA   . ILE A 1 46 ? 1.818   5.669   -11.724 1.00 0.00 ? 46 ILE A CA   1  
ATOM 710   C C    . ILE A 1 46 ? 3.116   6.053   -12.471 1.00 0.00 ? 46 ILE A C    1  
ATOM 711   O O    . ILE A 1 46 ? 3.265   7.198   -12.896 1.00 0.00 ? 46 ILE A O    1  
ATOM 712   C CB   . ILE A 1 46 ? 1.950   4.391   -10.853 1.00 0.00 ? 46 ILE A CB   1  
ATOM 713   C CG1  . ILE A 1 46 ? 3.098   4.535   -9.845  1.00 0.00 ? 46 ILE A CG1  1  
ATOM 714   C CG2  . ILE A 1 46 ? 2.149   3.127   -11.712 1.00 0.00 ? 46 ILE A CG2  1  
ATOM 715   C CD1  . ILE A 1 46 ? 2.999   3.428   -8.793  1.00 0.00 ? 46 ILE A CD1  1  
ATOM 716   H H    . ILE A 1 46 ? -0.242  5.665   -12.246 1.00 0.00 ? 46 ILE A H    1  
ATOM 717   H HA   . ILE A 1 46 ? 1.580   6.485   -11.050 1.00 0.00 ? 46 ILE A HA   1  
ATOM 718   H HB   . ILE A 1 46 ? 1.032   4.280   -10.292 1.00 0.00 ? 46 ILE A HB   1  
ATOM 719   H HG12 . ILE A 1 46 ? 4.051   4.454   -10.353 1.00 0.00 ? 46 ILE A HG12 1  
ATOM 720   H HG13 . ILE A 1 46 ? 3.029   5.506   -9.354  1.00 0.00 ? 46 ILE A HG13 1  
ATOM 721   H HG21 . ILE A 1 46 ? 1.343   2.429   -11.510 1.00 0.00 ? 46 ILE A HG21 1  
ATOM 722   H HG22 . ILE A 1 46 ? 2.142   3.383   -12.763 1.00 0.00 ? 46 ILE A HG22 1  
ATOM 723   H HG23 . ILE A 1 46 ? 3.099   2.659   -11.462 1.00 0.00 ? 46 ILE A HG23 1  
ATOM 724   H HD11 . ILE A 1 46 ? 3.772   3.576   -8.041  1.00 0.00 ? 46 ILE A HD11 1  
ATOM 725   H HD12 . ILE A 1 46 ? 3.140   2.458   -9.269  1.00 0.00 ? 46 ILE A HD12 1  
ATOM 726   H HD13 . ILE A 1 46 ? 2.020   3.462   -8.319  1.00 0.00 ? 46 ILE A HD13 1  
ATOM 727   N N    . GLY A 1 47 ? 4.045   5.106   -12.618 1.00 0.00 ? 47 GLY A N    1  
ATOM 728   C CA   . GLY A 1 47 ? 5.320   5.337   -13.264 1.00 0.00 ? 47 GLY A CA   1  
ATOM 729   C C    . GLY A 1 47 ? 6.298   4.281   -12.768 1.00 0.00 ? 47 GLY A C    1  
ATOM 730   O O    . GLY A 1 47 ? 6.181   3.821   -11.634 1.00 0.00 ? 47 GLY A O    1  
ATOM 731   H H    . GLY A 1 47 ? 3.870   4.188   -12.260 1.00 0.00 ? 47 GLY A H    1  
ATOM 732   H HA2  . GLY A 1 47 ? 5.203   5.255   -14.344 1.00 0.00 ? 47 GLY A HA2  1  
ATOM 733   H HA3  . GLY A 1 47 ? 5.691   6.330   -13.007 1.00 0.00 ? 47 GLY A HA3  1  
ATOM 734   N N    . LEU A 1 48 ? 7.252   3.885   -13.610 1.00 0.00 ? 48 LEU A N    1  
ATOM 735   C CA   . LEU A 1 48 ? 8.216   2.852   -13.253 1.00 0.00 ? 48 LEU A CA   1  
ATOM 736   C C    . LEU A 1 48 ? 8.921   3.201   -11.937 1.00 0.00 ? 48 LEU A C    1  
ATOM 737   O O    . LEU A 1 48 ? 9.155   2.323   -11.111 1.00 0.00 ? 48 LEU A O    1  
ATOM 738   C CB   . LEU A 1 48 ? 9.229   2.698   -14.397 1.00 0.00 ? 48 LEU A CB   1  
ATOM 739   C CG   . LEU A 1 48 ? 10.270  1.615   -14.067 1.00 0.00 ? 48 LEU A CG   1  
ATOM 740   C CD1  . LEU A 1 48 ? 9.587   0.252   -13.904 1.00 0.00 ? 48 LEU A CD1  1  
ATOM 741   C CD2  . LEU A 1 48 ? 11.291  1.533   -15.205 1.00 0.00 ? 48 LEU A CD2  1  
ATOM 742   H H    . LEU A 1 48 ? 7.313   4.301   -14.528 1.00 0.00 ? 48 LEU A H    1  
ATOM 743   H HA   . LEU A 1 48 ? 7.678   1.913   -13.122 1.00 0.00 ? 48 LEU A HA   1  
ATOM 744   H HB2  . LEU A 1 48 ? 8.700   2.423   -15.310 1.00 0.00 ? 48 LEU A HB2  1  
ATOM 745   H HB3  . LEU A 1 48 ? 9.739   3.650   -14.554 1.00 0.00 ? 48 LEU A HB3  1  
ATOM 746   H HG   . LEU A 1 48 ? 10.788  1.873   -13.143 1.00 0.00 ? 48 LEU A HG   1  
ATOM 747   H HD11 . LEU A 1 48 ? 9.030   0.231   -12.967 1.00 0.00 ? 48 LEU A HD11 1  
ATOM 748   H HD12 . LEU A 1 48 ? 10.342  -0.533  -13.890 1.00 0.00 ? 48 LEU A HD12 1  
ATOM 749   H HD13 . LEU A 1 48 ? 8.904   0.084   -14.737 1.00 0.00 ? 48 LEU A HD13 1  
ATOM 750   H HD21 . LEU A 1 48 ? 10.784  1.258   -16.131 1.00 0.00 ? 48 LEU A HD21 1  
ATOM 751   H HD22 . LEU A 1 48 ? 12.044  0.781   -14.967 1.00 0.00 ? 48 LEU A HD22 1  
ATOM 752   H HD23 . LEU A 1 48 ? 11.774  2.502   -15.332 1.00 0.00 ? 48 LEU A HD23 1  
ATOM 753   N N    . LYS A 1 49 ? 9.257   4.483   -11.748 1.00 0.00 ? 49 LYS A N    1  
ATOM 754   C CA   . LYS A 1 49 ? 9.951   4.936   -10.549 1.00 0.00 ? 49 LYS A CA   1  
ATOM 755   C C    . LYS A 1 49 ? 9.164   4.544   -9.290  1.00 0.00 ? 49 LYS A C    1  
ATOM 756   O O    . LYS A 1 49 ? 9.684   3.835   -8.428  1.00 0.00 ? 49 LYS A O    1  
ATOM 757   C CB   . LYS A 1 49 ? 10.146  6.461   -10.627 1.00 0.00 ? 49 LYS A CB   1  
ATOM 758   C CG   . LYS A 1 49 ? 11.503  6.859   -10.031 1.00 0.00 ? 49 LYS A CG   1  
ATOM 759   C CD   . LYS A 1 49 ? 11.566  6.477   -8.546  1.00 0.00 ? 49 LYS A CD   1  
ATOM 760   C CE   . LYS A 1 49 ? 12.740  7.196   -7.874  1.00 0.00 ? 49 LYS A CE   1  
ATOM 761   N NZ   . LYS A 1 49 ? 14.028  6.795   -8.472  1.00 0.00 ? 49 LYS A NZ   1  
ATOM 762   H H    . LYS A 1 49 ? 9.031   5.166   -12.456 1.00 0.00 ? 49 LYS A H    1  
ATOM 763   H HA   . LYS A 1 49 ? 10.930  4.457   -10.515 1.00 0.00 ? 49 LYS A HA   1  
ATOM 764   H HB2  . LYS A 1 49 ? 10.112  6.776   -11.670 1.00 0.00 ? 49 LYS A HB2  1  
ATOM 765   H HB3  . LYS A 1 49 ? 9.348   6.962   -10.078 1.00 0.00 ? 49 LYS A HB3  1  
ATOM 766   H HG2  . LYS A 1 49 ? 12.299  6.347   -10.575 1.00 0.00 ? 49 LYS A HG2  1  
ATOM 767   H HG3  . LYS A 1 49 ? 11.633  7.937   -10.134 1.00 0.00 ? 49 LYS A HG3  1  
ATOM 768   H HD2  . LYS A 1 49 ? 10.637  6.770   -8.056  1.00 0.00 ? 49 LYS A HD2  1  
ATOM 769   H HD3  . LYS A 1 49 ? 11.701  5.399   -8.452  1.00 0.00 ? 49 LYS A HD3  1  
ATOM 770   H HE2  . LYS A 1 49 ? 12.614  8.274   -7.985  1.00 0.00 ? 49 LYS A HE2  1  
ATOM 771   H HE3  . LYS A 1 49 ? 12.748  6.947   -6.812  1.00 0.00 ? 49 LYS A HE3  1  
ATOM 772   H HZ1  . LYS A 1 49 ? 14.144  5.794   -8.385  1.00 0.00 ? 49 LYS A HZ1  1  
ATOM 773   H HZ2  . LYS A 1 49 ? 14.783  7.263   -7.990  1.00 0.00 ? 49 LYS A HZ2  1  
ATOM 774   H HZ3  . LYS A 1 49 ? 14.042  7.053   -9.448  1.00 0.00 ? 49 LYS A HZ3  1  
ATOM 775   N N    . GLN A 1 50 ? 7.913   5.011   -9.183  1.00 0.00 ? 50 GLN A N    1  
ATOM 776   C CA   . GLN A 1 50 ? 7.085   4.733   -8.018  1.00 0.00 ? 50 GLN A CA   1  
ATOM 777   C C    . GLN A 1 50 ? 6.740   3.243   -7.952  1.00 0.00 ? 50 GLN A C    1  
ATOM 778   O O    . GLN A 1 50 ? 6.925   2.629   -6.915  1.00 0.00 ? 50 GLN A O    1  
ATOM 779   C CB   . GLN A 1 50 ? 5.824   5.597   -8.067  1.00 0.00 ? 50 GLN A CB   1  
ATOM 780   C CG   . GLN A 1 50 ? 6.195   7.061   -7.819  1.00 0.00 ? 50 GLN A CG   1  
ATOM 781   C CD   . GLN A 1 50 ? 4.952   7.907   -7.565  1.00 0.00 ? 50 GLN A CD   1  
ATOM 782   O OE1  . GLN A 1 50 ? 4.602   8.758   -8.376  1.00 0.00 ? 50 GLN A OE1  1  
ATOM 783   N NE2  . GLN A 1 50 ? 4.285   7.671   -6.434  1.00 0.00 ? 50 GLN A NE2  1  
ATOM 784   H H    . GLN A 1 50 ? 7.526   5.579   -9.923  1.00 0.00 ? 50 GLN A H    1  
ATOM 785   H HA   . GLN A 1 50 ? 7.645   4.996   -7.120  1.00 0.00 ? 50 GLN A HA   1  
ATOM 786   H HB2  . GLN A 1 50 ? 5.360   5.505   -9.044  1.00 0.00 ? 50 GLN A HB2  1  
ATOM 787   H HB3  . GLN A 1 50 ? 5.128   5.263   -7.299  1.00 0.00 ? 50 GLN A HB3  1  
ATOM 788   H HG2  . GLN A 1 50 ? 6.851   7.124   -6.950  1.00 0.00 ? 50 GLN A HG2  1  
ATOM 789   H HG3  . GLN A 1 50 ? 6.720   7.450   -8.692  1.00 0.00 ? 50 GLN A HG3  1  
ATOM 790   H HE21 . GLN A 1 50 ? 4.609   6.959   -5.797  1.00 0.00 ? 50 GLN A HE21 1  
ATOM 791   H HE22 . GLN A 1 50 ? 3.457   8.206   -6.220  1.00 0.00 ? 50 GLN A HE22 1  
ATOM 792   N N    . LYS A 1 51 ? 6.248   2.664   -9.057  1.00 0.00 ? 51 LYS A N    1  
ATOM 793   C CA   . LYS A 1 51 ? 5.920   1.240   -9.120  1.00 0.00 ? 51 LYS A CA   1  
ATOM 794   C C    . LYS A 1 51 ? 7.053   0.401   -8.514  1.00 0.00 ? 51 LYS A C    1  
ATOM 795   O O    . LYS A 1 51 ? 6.808   -0.447  -7.656  1.00 0.00 ? 51 LYS A O    1  
ATOM 796   C CB   . LYS A 1 51 ? 5.687   0.850   -10.587 1.00 0.00 ? 51 LYS A CB   1  
ATOM 797   C CG   . LYS A 1 51 ? 5.111   -0.573  -10.679 1.00 0.00 ? 51 LYS A CG   1  
ATOM 798   C CD   . LYS A 1 51 ? 3.627   -0.520  -11.063 1.00 0.00 ? 51 LYS A CD   1  
ATOM 799   C CE   . LYS A 1 51 ? 3.477   -0.245  -12.565 1.00 0.00 ? 51 LYS A CE   1  
ATOM 800   N NZ   . LYS A 1 51 ? 2.054   -0.216  -12.961 1.00 0.00 ? 51 LYS A NZ   1  
ATOM 801   H H    . LYS A 1 51 ? 6.094   3.220   -9.884  1.00 0.00 ? 51 LYS A H    1  
ATOM 802   H HA   . LYS A 1 51 ? 5.004   1.062   -8.554  1.00 0.00 ? 51 LYS A HA   1  
ATOM 803   H HB2  . LYS A 1 51 ? 4.992   1.554   -11.040 1.00 0.00 ? 51 LYS A HB2  1  
ATOM 804   H HB3  . LYS A 1 51 ? 6.635   0.890   -11.126 1.00 0.00 ? 51 LYS A HB3  1  
ATOM 805   H HG2  . LYS A 1 51 ? 5.660   -1.137  -11.435 1.00 0.00 ? 51 LYS A HG2  1  
ATOM 806   H HG3  . LYS A 1 51 ? 5.216   -1.071  -9.716  1.00 0.00 ? 51 LYS A HG3  1  
ATOM 807   H HD2  . LYS A 1 51 ? 3.163   -1.477  -10.826 1.00 0.00 ? 51 LYS A HD2  1  
ATOM 808   H HD3  . LYS A 1 51 ? 3.133   0.270   -10.495 1.00 0.00 ? 51 LYS A HD3  1  
ATOM 809   H HE2  . LYS A 1 51 ? 3.933   0.715   -12.805 1.00 0.00 ? 51 LYS A HE2  1  
ATOM 810   H HE3  . LYS A 1 51 ? 3.985   -1.031  -13.125 1.00 0.00 ? 51 LYS A HE3  1  
ATOM 811   H HZ1  . LYS A 1 51 ? 1.983   -0.052  -13.956 1.00 0.00 ? 51 LYS A HZ1  1  
ATOM 812   H HZ2  . LYS A 1 51 ? 1.580   0.526   -12.464 1.00 0.00 ? 51 LYS A HZ2  1  
ATOM 813   H HZ3  . LYS A 1 51 ? 1.621   -1.102  -12.734 1.00 0.00 ? 51 LYS A HZ3  1  
ATOM 814   N N    . GLN A 1 52 ? 8.290   0.639   -8.964  1.00 0.00 ? 52 GLN A N    1  
ATOM 815   C CA   . GLN A 1 52 ? 9.445   -0.101  -8.477  1.00 0.00 ? 52 GLN A CA   1  
ATOM 816   C C    . GLN A 1 52 ? 9.668   0.185   -6.993  1.00 0.00 ? 52 GLN A C    1  
ATOM 817   O O    . GLN A 1 52 ? 9.865   -0.740  -6.212  1.00 0.00 ? 52 GLN A O    1  
ATOM 818   C CB   . GLN A 1 52 ? 10.683  0.289   -9.297  1.00 0.00 ? 52 GLN A CB   1  
ATOM 819   C CG   . GLN A 1 52 ? 11.893  -0.564  -8.892  1.00 0.00 ? 52 GLN A CG   1  
ATOM 820   C CD   . GLN A 1 52 ? 11.653  -2.040  -9.182  1.00 0.00 ? 52 GLN A CD   1  
ATOM 821   O OE1  . GLN A 1 52 ? 11.914  -2.509  -10.285 1.00 0.00 ? 52 GLN A OE1  1  
ATOM 822   N NE2  . GLN A 1 52 ? 11.155  -2.772  -8.187  1.00 0.00 ? 52 GLN A NE2  1  
ATOM 823   H H    . GLN A 1 52 ? 8.437   1.352   -9.668  1.00 0.00 ? 52 GLN A H    1  
ATOM 824   H HA   . GLN A 1 52 ? 9.253   -1.165  -8.608  1.00 0.00 ? 52 GLN A HA   1  
ATOM 825   H HB2  . GLN A 1 52 ? 10.478  0.141   -10.358 1.00 0.00 ? 52 GLN A HB2  1  
ATOM 826   H HB3  . GLN A 1 52 ? 10.915  1.335   -9.119  1.00 0.00 ? 52 GLN A HB3  1  
ATOM 827   H HG2  . GLN A 1 52 ? 12.765  -0.230  -9.455  1.00 0.00 ? 52 GLN A HG2  1  
ATOM 828   H HG3  . GLN A 1 52 ? 12.088  -0.432  -7.828  1.00 0.00 ? 52 GLN A HG3  1  
ATOM 829   H HE21 . GLN A 1 52 ? 10.944  -2.336  -7.297  1.00 0.00 ? 52 GLN A HE21 1  
ATOM 830   H HE22 . GLN A 1 52 ? 10.990  -3.758  -8.322  1.00 0.00 ? 52 GLN A HE22 1  
ATOM 831   N N    . TRP A 1 53 ? 9.639   1.468   -6.610  1.00 0.00 ? 53 TRP A N    1  
ATOM 832   C CA   . TRP A 1 53 ? 9.851   1.875   -5.225  1.00 0.00 ? 53 TRP A CA   1  
ATOM 833   C C    . TRP A 1 53 ? 8.848   1.183   -4.299  1.00 0.00 ? 53 TRP A C    1  
ATOM 834   O O    . TRP A 1 53 ? 9.211   0.744   -3.212  1.00 0.00 ? 53 TRP A O    1  
ATOM 835   C CB   . TRP A 1 53 ? 9.716   3.393   -5.124  1.00 0.00 ? 53 TRP A CB   1  
ATOM 836   C CG   . TRP A 1 53 ? 9.620   3.921   -3.728  1.00 0.00 ? 53 TRP A CG   1  
ATOM 837   C CD1  . TRP A 1 53 ? 10.613  3.929   -2.824  1.00 0.00 ? 53 TRP A CD1  1  
ATOM 838   C CD2  . TRP A 1 53 ? 8.472   4.512   -3.044  1.00 0.00 ? 53 TRP A CD2  1  
ATOM 839   N NE1  . TRP A 1 53 ? 10.195  4.483   -1.641  1.00 0.00 ? 53 TRP A NE1  1  
ATOM 840   C CE2  . TRP A 1 53 ? 8.873   4.869   -1.718  1.00 0.00 ? 53 TRP A CE2  1  
ATOM 841   C CE3  . TRP A 1 53 ? 7.128   4.785   -3.400  1.00 0.00 ? 53 TRP A CE3  1  
ATOM 842   C CZ2  . TRP A 1 53 ? 8.002   5.469   -0.808  1.00 0.00 ? 53 TRP A CZ2  1  
ATOM 843   C CZ3  . TRP A 1 53 ? 6.243   5.383   -2.478  1.00 0.00 ? 53 TRP A CZ3  1  
ATOM 844   C CH2  . TRP A 1 53 ? 6.682   5.728   -1.186  1.00 0.00 ? 53 TRP A CH2  1  
ATOM 845   H H    . TRP A 1 53 ? 9.470   2.190   -7.299  1.00 0.00 ? 53 TRP A H    1  
ATOM 846   H HA   . TRP A 1 53 ? 10.861  1.590   -4.924  1.00 0.00 ? 53 TRP A HA   1  
ATOM 847   H HB2  . TRP A 1 53 ? 10.581  3.850   -5.607  1.00 0.00 ? 53 TRP A HB2  1  
ATOM 848   H HB3  . TRP A 1 53 ? 8.822   3.696   -5.663  1.00 0.00 ? 53 TRP A HB3  1  
ATOM 849   H HD1  . TRP A 1 53 ? 11.607  3.537   -2.997  1.00 0.00 ? 53 TRP A HD1  1  
ATOM 850   H HE1  . TRP A 1 53 ? 10.766  4.598   -0.806  1.00 0.00 ? 53 TRP A HE1  1  
ATOM 851   H HE3  . TRP A 1 53 ? 6.776   4.532   -4.387  1.00 0.00 ? 53 TRP A HE3  1  
ATOM 852   H HZ2  . TRP A 1 53 ? 8.344   5.733   0.179   1.00 0.00 ? 53 TRP A HZ2  1  
ATOM 853   H HZ3  . TRP A 1 53 ? 5.221   5.582   -2.767  1.00 0.00 ? 53 TRP A HZ3  1  
ATOM 854   H HH2  . TRP A 1 53 ? 6.004   6.194   -0.490  1.00 0.00 ? 53 TRP A HH2  1  
ATOM 855   N N    . LEU A 1 54 ? 7.588   1.086   -4.723  1.00 0.00 ? 54 LEU A N    1  
ATOM 856   C CA   . LEU A 1 54 ? 6.560   0.448   -3.924  1.00 0.00 ? 54 LEU A CA   1  
ATOM 857   C C    . LEU A 1 54 ? 6.936   -1.010  -3.687  1.00 0.00 ? 54 LEU A C    1  
ATOM 858   O O    . LEU A 1 54 ? 6.830   -1.508  -2.570  1.00 0.00 ? 54 LEU A O    1  
ATOM 859   C CB   . LEU A 1 54 ? 5.203   0.537   -4.640  1.00 0.00 ? 54 LEU A CB   1  
ATOM 860   C CG   . LEU A 1 54 ? 4.665   1.977   -4.622  1.00 0.00 ? 54 LEU A CG   1  
ATOM 861   C CD1  . LEU A 1 54 ? 3.450   2.069   -5.547  1.00 0.00 ? 54 LEU A CD1  1  
ATOM 862   C CD2  . LEU A 1 54 ? 4.248   2.373   -3.202  1.00 0.00 ? 54 LEU A CD2  1  
ATOM 863   H H    . LEU A 1 54 ? 7.333   1.461   -5.624  1.00 0.00 ? 54 LEU A H    1  
ATOM 864   H HA   . LEU A 1 54 ? 6.494   0.953   -2.970  1.00 0.00 ? 54 LEU A HA   1  
ATOM 865   H HB2  . LEU A 1 54 ? 5.322   0.212   -5.674  1.00 0.00 ? 54 LEU A HB2  1  
ATOM 866   H HB3  . LEU A 1 54 ? 4.489   -0.118  -4.141  1.00 0.00 ? 54 LEU A HB3  1  
ATOM 867   H HG   . LEU A 1 54 ? 5.436   2.660   -4.975  1.00 0.00 ? 54 LEU A HG   1  
ATOM 868   H HD11 . LEU A 1 54 ? 2.653   1.431   -5.165  1.00 0.00 ? 54 LEU A HD11 1  
ATOM 869   H HD12 . LEU A 1 54 ? 3.100   3.101   -5.588  1.00 0.00 ? 54 LEU A HD12 1  
ATOM 870   H HD13 . LEU A 1 54 ? 3.729   1.741   -6.547  1.00 0.00 ? 54 LEU A HD13 1  
ATOM 871   H HD21 . LEU A 1 54 ? 3.693   1.556   -2.742  1.00 0.00 ? 54 LEU A HD21 1  
ATOM 872   H HD22 . LEU A 1 54 ? 5.133   2.591   -2.609  1.00 0.00 ? 54 LEU A HD22 1  
ATOM 873   H HD23 . LEU A 1 54 ? 3.618   3.261   -3.243  1.00 0.00 ? 54 LEU A HD23 1  
ATOM 874   N N    . MET A 1 55 ? 7.369   -1.689  -4.750  1.00 0.00 ? 55 MET A N    1  
ATOM 875   C CA   . MET A 1 55 ? 7.714   -3.097  -4.686  1.00 0.00 ? 55 MET A CA   1  
ATOM 876   C C    . MET A 1 55 ? 8.953   -3.339  -3.815  1.00 0.00 ? 55 MET A C    1  
ATOM 877   O O    . MET A 1 55 ? 8.952   -4.252  -2.994  1.00 0.00 ? 55 MET A O    1  
ATOM 878   C CB   . MET A 1 55 ? 7.985   -3.611  -6.110  1.00 0.00 ? 55 MET A CB   1  
ATOM 879   C CG   . MET A 1 55 ? 6.688   -3.689  -6.922  1.00 0.00 ? 55 MET A CG   1  
ATOM 880   S SD   . MET A 1 55 ? 5.809   -5.263  -6.746  1.00 0.00 ? 55 MET A SD   1  
ATOM 881   C CE   . MET A 1 55 ? 5.053   -5.355  -8.390  1.00 0.00 ? 55 MET A CE   1  
ATOM 882   H H    . MET A 1 55 ? 7.453   -1.218  -5.642  1.00 0.00 ? 55 MET A H    1  
ATOM 883   H HA   . MET A 1 55 ? 6.873   -3.644  -4.261  1.00 0.00 ? 55 MET A HA   1  
ATOM 884   H HB2  . MET A 1 55 ? 8.677   -2.935  -6.610  1.00 0.00 ? 55 MET A HB2  1  
ATOM 885   H HB3  . MET A 1 55 ? 8.432   -4.603  -6.055  1.00 0.00 ? 55 MET A HB3  1  
ATOM 886   H HG2  . MET A 1 55 ? 6.026   -2.881  -6.614  1.00 0.00 ? 55 MET A HG2  1  
ATOM 887   H HG3  . MET A 1 55 ? 6.937   -3.551  -7.974  1.00 0.00 ? 55 MET A HG3  1  
ATOM 888   H HE1  . MET A 1 55 ? 5.835   -5.451  -9.144  1.00 0.00 ? 55 MET A HE1  1  
ATOM 889   H HE2  . MET A 1 55 ? 4.478   -4.452  -8.579  1.00 0.00 ? 55 MET A HE2  1  
ATOM 890   H HE3  . MET A 1 55 ? 4.395   -6.222  -8.438  1.00 0.00 ? 55 MET A HE3  1  
ATOM 891   N N    . THR A 1 56 ? 10.020  -2.548  -4.020  1.00 0.00 ? 56 THR A N    1  
ATOM 892   C CA   . THR A 1 56 ? 11.301  -2.785  -3.352  1.00 0.00 ? 56 THR A CA   1  
ATOM 893   C C    . THR A 1 56 ? 11.641  -1.709  -2.312  1.00 0.00 ? 56 THR A C    1  
ATOM 894   O O    . THR A 1 56 ? 12.818  -1.403  -2.123  1.00 0.00 ? 56 THR A O    1  
ATOM 895   C CB   . THR A 1 56 ? 12.397  -2.842  -4.428  1.00 0.00 ? 56 THR A CB   1  
ATOM 896   O OG1  . THR A 1 56 ? 12.429  -1.621  -5.138  1.00 0.00 ? 56 THR A OG1  1  
ATOM 897   C CG2  . THR A 1 56 ? 12.111  -3.983  -5.406  1.00 0.00 ? 56 THR A CG2  1  
ATOM 898   H H    . THR A 1 56 ? 9.958   -1.780  -4.675  1.00 0.00 ? 56 THR A H    1  
ATOM 899   H HA   . THR A 1 56 ? 11.265  -3.749  -2.846  1.00 0.00 ? 56 THR A HA   1  
ATOM 900   H HB   . THR A 1 56 ? 13.365  -3.010  -3.953  1.00 0.00 ? 56 THR A HB   1  
ATOM 901   H HG1  . THR A 1 56 ? 13.190  -1.629  -5.724  1.00 0.00 ? 56 THR A HG1  1  
ATOM 902   H HG21 . THR A 1 56 ? 11.131  -3.838  -5.859  1.00 0.00 ? 56 THR A HG21 1  
ATOM 903   H HG22 . THR A 1 56 ? 12.872  -3.991  -6.186  1.00 0.00 ? 56 THR A HG22 1  
ATOM 904   H HG23 . THR A 1 56 ? 12.127  -4.933  -4.873  1.00 0.00 ? 56 THR A HG23 1  
ATOM 905   N N    . GLU A 1 57 ? 10.643  -1.138  -1.623  1.00 0.00 ? 57 GLU A N    1  
ATOM 906   C CA   . GLU A 1 57 ? 10.924  -0.139  -0.593  1.00 0.00 ? 57 GLU A CA   1  
ATOM 907   C C    . GLU A 1 57 ? 9.697   0.102   0.290   1.00 0.00 ? 57 GLU A C    1  
ATOM 908   O O    . GLU A 1 57 ? 9.710   -0.222  1.476   1.00 0.00 ? 57 GLU A O    1  
ATOM 909   C CB   . GLU A 1 57 ? 11.393  1.172   -1.255  1.00 0.00 ? 57 GLU A CB   1  
ATOM 910   C CG   . GLU A 1 57 ? 12.445  1.875   -0.380  1.00 0.00 ? 57 GLU A CG   1  
ATOM 911   C CD   . GLU A 1 57 ? 11.792  2.730   0.703   1.00 0.00 ? 57 GLU A CD   1  
ATOM 912   O OE1  . GLU A 1 57 ? 11.354  2.137   1.710   1.00 0.00 ? 57 GLU A OE1  1  
ATOM 913   O OE2  . GLU A 1 57 ? 11.746  3.964   0.501   1.00 0.00 ? 57 GLU A OE2  1  
ATOM 914   H H    . GLU A 1 57 ? 9.684   -1.398  -1.805  1.00 0.00 ? 57 GLU A H    1  
ATOM 915   H HA   . GLU A 1 57 ? 11.727  -0.516  0.033   1.00 0.00 ? 57 GLU A HA   1  
ATOM 916   H HB2  . GLU A 1 57 ? 11.833  0.951   -2.227  1.00 0.00 ? 57 GLU A HB2  1  
ATOM 917   H HB3  . GLU A 1 57 ? 10.543  1.834   -1.392  1.00 0.00 ? 57 GLU A HB3  1  
ATOM 918   H HG2  . GLU A 1 57 ? 13.086  1.129   0.089   1.00 0.00 ? 57 GLU A HG2  1  
ATOM 919   H HG3  . GLU A 1 57 ? 13.058  2.518   -1.012  1.00 0.00 ? 57 GLU A HG3  1  
ATOM 920   N N    . ALA A 1 58 ? 8.646   0.683   -0.281  1.00 0.00 ? 58 ALA A N    1  
ATOM 921   C CA   . ALA A 1 58 ? 7.465   1.045   0.483   1.00 0.00 ? 58 ALA A CA   1  
ATOM 922   C C    . ALA A 1 58 ? 6.770   -0.184  1.069   1.00 0.00 ? 58 ALA A C    1  
ATOM 923   O O    . ALA A 1 58 ? 6.653   -0.307  2.284   1.00 0.00 ? 58 ALA A O    1  
ATOM 924   C CB   . ALA A 1 58 ? 6.505   1.823   -0.411  1.00 0.00 ? 58 ALA A CB   1  
ATOM 925   H H    . ALA A 1 58 ? 8.667   0.900   -1.270  1.00 0.00 ? 58 ALA A H    1  
ATOM 926   H HA   . ALA A 1 58 ? 7.773   1.695   1.304   1.00 0.00 ? 58 ALA A HA   1  
ATOM 927   H HB1  . ALA A 1 58 ? 7.071   2.462   -1.089  1.00 0.00 ? 58 ALA A HB1  1  
ATOM 928   H HB2  . ALA A 1 58 ? 5.855   2.438   0.207   1.00 0.00 ? 58 ALA A HB2  1  
ATOM 929   H HB3  . ALA A 1 58 ? 5.899   1.126   -0.989  1.00 0.00 ? 58 ALA A HB3  1  
ATOM 930   N N    . LEU A 1 59 ? 6.288   -1.082  0.205   1.00 0.00 ? 59 LEU A N    1  
ATOM 931   C CA   . LEU A 1 59 ? 5.500   -2.231  0.636   1.00 0.00 ? 59 LEU A CA   1  
ATOM 932   C C    . LEU A 1 59 ? 6.380   -3.363  1.178   1.00 0.00 ? 59 LEU A C    1  
ATOM 933   O O    . LEU A 1 59 ? 5.990   -4.527  1.119   1.00 0.00 ? 59 LEU A O    1  
ATOM 934   C CB   . LEU A 1 59 ? 4.646   -2.717  -0.543  1.00 0.00 ? 59 LEU A CB   1  
ATOM 935   C CG   . LEU A 1 59 ? 3.847   -1.547  -1.154  1.00 0.00 ? 59 LEU A CG   1  
ATOM 936   C CD1  . LEU A 1 59 ? 2.885   -2.095  -2.199  1.00 0.00 ? 59 LEU A CD1  1  
ATOM 937   C CD2  . LEU A 1 59 ? 3.042   -0.815  -0.075  1.00 0.00 ? 59 LEU A CD2  1  
ATOM 938   H H    . LEU A 1 59 ? 6.453   -0.961  -0.784  1.00 0.00 ? 59 LEU A H    1  
ATOM 939   H HA   . LEU A 1 59 ? 4.832   -1.912  1.436   1.00 0.00 ? 59 LEU A HA   1  
ATOM 940   H HB2  . LEU A 1 59 ? 5.296   -3.144  -1.306  1.00 0.00 ? 59 LEU A HB2  1  
ATOM 941   H HB3  . LEU A 1 59 ? 3.955   -3.482  -0.197  1.00 0.00 ? 59 LEU A HB3  1  
ATOM 942   H HG   . LEU A 1 59 ? 4.531   -0.846  -1.631  1.00 0.00 ? 59 LEU A HG   1  
ATOM 943   H HD11 . LEU A 1 59 ? 3.444   -2.660  -2.943  1.00 0.00 ? 59 LEU A HD11 1  
ATOM 944   H HD12 . LEU A 1 59 ? 2.365   -1.269  -2.683  1.00 0.00 ? 59 LEU A HD12 1  
ATOM 945   H HD13 . LEU A 1 59 ? 2.158   -2.748  -1.715  1.00 0.00 ? 59 LEU A HD13 1  
ATOM 946   H HD21 . LEU A 1 59 ? 2.369   -0.102  -0.549  1.00 0.00 ? 59 LEU A HD21 1  
ATOM 947   H HD22 . LEU A 1 59 ? 2.461   -1.535  0.498   1.00 0.00 ? 59 LEU A HD22 1  
ATOM 948   H HD23 . LEU A 1 59 ? 3.719   -0.279  0.590   1.00 0.00 ? 59 LEU A HD23 1  
ATOM 949   N N    . VAL A 1 60 ? 7.553   -3.020  1.722   1.00 0.00 ? 60 VAL A N    1  
ATOM 950   C CA   . VAL A 1 60 ? 8.447   -4.000  2.335   1.00 0.00 ? 60 VAL A CA   1  
ATOM 951   C C    . VAL A 1 60 ? 8.957   -3.449  3.670   1.00 0.00 ? 60 VAL A C    1  
ATOM 952   O O    . VAL A 1 60 ? 9.077   -4.197  4.638   1.00 0.00 ? 60 VAL A O    1  
ATOM 953   C CB   . VAL A 1 60 ? 9.611   -4.356  1.386   1.00 0.00 ? 60 VAL A CB   1  
ATOM 954   C CG1  . VAL A 1 60 ? 9.082   -5.173  0.206   1.00 0.00 ? 60 VAL A CG1  1  
ATOM 955   C CG2  . VAL A 1 60 ? 10.289  -3.096  0.853   1.00 0.00 ? 60 VAL A CG2  1  
ATOM 956   H H    . VAL A 1 60 ? 7.832   -2.053  1.725   1.00 0.00 ? 60 VAL A H    1  
ATOM 957   H HA   . VAL A 1 60 ? 7.883   -4.910  2.540   1.00 0.00 ? 60 VAL A HA   1  
ATOM 958   H HB   . VAL A 1 60 ? 10.346  -4.950  1.930   1.00 0.00 ? 60 VAL A HB   1  
ATOM 959   H HG11 . VAL A 1 60 ? 9.915   -5.471  -0.431  1.00 0.00 ? 60 VAL A HG11 1  
ATOM 960   H HG12 . VAL A 1 60 ? 8.573   -6.062  0.577   1.00 0.00 ? 60 VAL A HG12 1  
ATOM 961   H HG13 . VAL A 1 60 ? 8.384   -4.568  -0.373  1.00 0.00 ? 60 VAL A HG13 1  
ATOM 962   H HG21 . VAL A 1 60 ? 9.559   -2.492  0.320   1.00 0.00 ? 60 VAL A HG21 1  
ATOM 963   H HG22 . VAL A 1 60 ? 10.704  -2.524  1.681   1.00 0.00 ? 60 VAL A HG22 1  
ATOM 964   H HG23 . VAL A 1 60 ? 11.092  -3.377  0.173   1.00 0.00 ? 60 VAL A HG23 1  
ATOM 965   N N    . ASN A 1 61 ? 9.249   -2.140  3.723   1.00 0.00 ? 61 ASN A N    1  
ATOM 966   C CA   . ASN A 1 61 ? 9.720   -1.500  4.943   1.00 0.00 ? 61 ASN A CA   1  
ATOM 967   C C    . ASN A 1 61 ? 8.532   -1.019  5.781   1.00 0.00 ? 61 ASN A C    1  
ATOM 968   O O    . ASN A 1 61 ? 8.623   -0.978  7.007   1.00 0.00 ? 61 ASN A O    1  
ATOM 969   C CB   . ASN A 1 61 ? 10.640  -0.329  4.586   1.00 0.00 ? 61 ASN A CB   1  
ATOM 970   C CG   . ASN A 1 61 ? 11.928  -0.822  3.926   1.00 0.00 ? 61 ASN A CG   1  
ATOM 971   O OD1  . ASN A 1 61 ? 12.521  -1.801  4.373   1.00 0.00 ? 61 ASN A OD1  1  
ATOM 972   N ND2  . ASN A 1 61 ? 12.360  -0.146  2.863   1.00 0.00 ? 61 ASN A ND2  1  
ATOM 973   H H    . ASN A 1 61 ? 9.141   -1.567  2.896   1.00 0.00 ? 61 ASN A H    1  
ATOM 974   H HA   . ASN A 1 61 ? 10.287  -2.225  5.529   1.00 0.00 ? 61 ASN A HA   1  
ATOM 975   H HB2  . ASN A 1 61 ? 10.118  0.344   3.905   1.00 0.00 ? 61 ASN A HB2  1  
ATOM 976   H HB3  . ASN A 1 61 ? 10.895  0.215   5.496   1.00 0.00 ? 61 ASN A HB3  1  
ATOM 977   H HD21 . ASN A 1 61 ? 11.831  0.654   2.518   1.00 0.00 ? 61 ASN A HD21 1  
ATOM 978   H HD22 . ASN A 1 61 ? 13.210  -0.428  2.401   1.00 0.00 ? 61 ASN A HD22 1  
ATOM 979   N N    . ASN A 1 62 ? 7.417   -0.652  5.125   1.00 0.00 ? 62 ASN A N    1  
ATOM 980   C CA   . ASN A 1 62 ? 6.231   -0.170  5.827   1.00 0.00 ? 62 ASN A CA   1  
ATOM 981   C C    . ASN A 1 62 ? 5.708   -1.269  6.773   1.00 0.00 ? 62 ASN A C    1  
ATOM 982   O O    . ASN A 1 62 ? 5.381   -2.361  6.316   1.00 0.00 ? 62 ASN A O    1  
ATOM 983   C CB   . ASN A 1 62 ? 5.162   0.232   4.804   1.00 0.00 ? 62 ASN A CB   1  
ATOM 984   C CG   . ASN A 1 62 ? 4.005   0.957   5.483   1.00 0.00 ? 62 ASN A CG   1  
ATOM 985   O OD1  . ASN A 1 62 ? 3.455   0.473   6.466   1.00 0.00 ? 62 ASN A OD1  1  
ATOM 986   N ND2  . ASN A 1 62 ? 3.640   2.125   4.956   1.00 0.00 ? 62 ASN A ND2  1  
ATOM 987   H H    . ASN A 1 62 ? 7.388   -0.705  4.114   1.00 0.00 ? 62 ASN A H    1  
ATOM 988   H HA   . ASN A 1 62 ? 6.507   0.710   6.402   1.00 0.00 ? 62 ASN A HA   1  
ATOM 989   H HB2  . ASN A 1 62 ? 5.609   0.895   4.065   1.00 0.00 ? 62 ASN A HB2  1  
ATOM 990   H HB3  . ASN A 1 62 ? 4.785   -0.661  4.302   1.00 0.00 ? 62 ASN A HB3  1  
ATOM 991   H HD21 . ASN A 1 62 ? 4.110   2.476   4.135   1.00 0.00 ? 62 ASN A HD21 1  
ATOM 992   H HD22 . ASN A 1 62 ? 2.893   2.654   5.379   1.00 0.00 ? 62 ASN A HD22 1  
ATOM 993   N N    . PRO A 1 63 ? 5.634   -0.988  8.098   1.00 0.00 ? 63 PRO A N    1  
ATOM 994   C CA   . PRO A 1 63 ? 5.199   -1.964  9.084   1.00 0.00 ? 63 PRO A CA   1  
ATOM 995   C C    . PRO A 1 63 ? 3.746   -2.401  8.864   1.00 0.00 ? 63 PRO A C    1  
ATOM 996   O O    . PRO A 1 63 ? 3.421   -3.568  9.082   1.00 0.00 ? 63 PRO A O    1  
ATOM 997   C CB   . PRO A 1 63 ? 5.365   -1.283  10.446  1.00 0.00 ? 63 PRO A CB   1  
ATOM 998   C CG   . PRO A 1 63 ? 5.752   0.174   10.175  1.00 0.00 ? 63 PRO A CG   1  
ATOM 999   C CD   . PRO A 1 63 ? 5.991   0.296   8.671   1.00 0.00 ? 63 PRO A CD   1  
ATOM 1000  H HA   . PRO A 1 63 ? 5.849   -2.838  9.036   1.00 0.00 ? 63 PRO A HA   1  
ATOM 1001  H HB2  . PRO A 1 63 ? 4.429   -1.324  11.005  1.00 0.00 ? 63 PRO A HB2  1  
ATOM 1002  H HB3  . PRO A 1 63 ? 6.156   -1.777  11.013  1.00 0.00 ? 63 PRO A HB3  1  
ATOM 1003  H HG2  . PRO A 1 63 ? 4.940   0.837   10.476  1.00 0.00 ? 63 PRO A HG2  1  
ATOM 1004  H HG3  . PRO A 1 63 ? 6.661   0.428   10.720  1.00 0.00 ? 63 PRO A HG3  1  
ATOM 1005  H HD2  . PRO A 1 63 ? 5.363   1.084   8.256   1.00 0.00 ? 63 PRO A HD2  1  
ATOM 1006  H HD3  . PRO A 1 63 ? 7.043   0.513   8.480   1.00 0.00 ? 63 PRO A HD3  1  
ATOM 1007  N N    . LYS A 1 64 ? 2.874   -1.469  8.447   1.00 0.00 ? 64 LYS A N    1  
ATOM 1008  C CA   . LYS A 1 64 ? 1.457   -1.767  8.247   1.00 0.00 ? 64 LYS A CA   1  
ATOM 1009  C C    . LYS A 1 64 ? 1.263   -2.738  7.086   1.00 0.00 ? 64 LYS A C    1  
ATOM 1010  O O    . LYS A 1 64 ? 0.223   -3.387  7.003   1.00 0.00 ? 64 LYS A O    1  
ATOM 1011  C CB   . LYS A 1 64 ? 0.679   -0.466  7.991   1.00 0.00 ? 64 LYS A CB   1  
ATOM 1012  C CG   . LYS A 1 64 ? 0.700   0.438   9.237   1.00 0.00 ? 64 LYS A CG   1  
ATOM 1013  C CD   . LYS A 1 64 ? 0.067   -0.265  10.455  1.00 0.00 ? 64 LYS A CD   1  
ATOM 1014  C CE   . LYS A 1 64 ? -1.316  -0.827  10.097  1.00 0.00 ? 64 LYS A CE   1  
ATOM 1015  N NZ   . LYS A 1 64 ? -1.980  -1.398  11.279  1.00 0.00 ? 64 LYS A NZ   1  
ATOM 1016  H H    . LYS A 1 64 ? 3.196   -0.526  8.268   1.00 0.00 ? 64 LYS A H    1  
ATOM 1017  H HA   . LYS A 1 64 ? 1.070   -2.237  9.144   1.00 0.00 ? 64 LYS A HA   1  
ATOM 1018  H HB2  . LYS A 1 64 ? 1.135   0.065   7.157   1.00 0.00 ? 64 LYS A HB2  1  
ATOM 1019  H HB3  . LYS A 1 64 ? -0.355  -0.705  7.732   1.00 0.00 ? 64 LYS A HB3  1  
ATOM 1020  H HG2  . LYS A 1 64 ? 1.732   0.701   9.473   1.00 0.00 ? 64 LYS A HG2  1  
ATOM 1021  H HG3  . LYS A 1 64 ? 0.141   1.350   9.022   1.00 0.00 ? 64 LYS A HG3  1  
ATOM 1022  H HD2  . LYS A 1 64 ? 0.715   -1.073  10.792  1.00 0.00 ? 64 LYS A HD2  1  
ATOM 1023  H HD3  . LYS A 1 64 ? -0.041  0.461   11.261  1.00 0.00 ? 64 LYS A HD3  1  
ATOM 1024  H HE2  . LYS A 1 64 ? -1.934  -0.025  9.694   1.00 0.00 ? 64 LYS A HE2  1  
ATOM 1025  H HE3  . LYS A 1 64 ? -1.212  -1.610  9.348   1.00 0.00 ? 64 LYS A HE3  1  
ATOM 1026  H HZ1  . LYS A 1 64 ? -2.969  -1.479  11.104  1.00 0.00 ? 64 LYS A HZ1  1  
ATOM 1027  H HZ2  . LYS A 1 64 ? -1.826  -0.796  12.079  1.00 0.00 ? 64 LYS A HZ2  1  
ATOM 1028  H HZ3  . LYS A 1 64 ? -1.598  -2.319  11.468  1.00 0.00 ? 64 LYS A HZ3  1  
ATOM 1029  N N    . ILE A 1 65 ? 2.253   -2.839  6.192   1.00 0.00 ? 65 ILE A N    1  
ATOM 1030  C CA   . ILE A 1 65 ? 2.166   -3.733  5.053   1.00 0.00 ? 65 ILE A CA   1  
ATOM 1031  C C    . ILE A 1 65 ? 2.789   -5.078  5.415   1.00 0.00 ? 65 ILE A C    1  
ATOM 1032  O O    . ILE A 1 65 ? 3.982   -5.156  5.705   1.00 0.00 ? 65 ILE A O    1  
ATOM 1033  C CB   . ILE A 1 65 ? 2.880   -3.104  3.849   1.00 0.00 ? 65 ILE A CB   1  
ATOM 1034  C CG1  . ILE A 1 65 ? 2.284   -1.716  3.530   1.00 0.00 ? 65 ILE A CG1  1  
ATOM 1035  C CG2  . ILE A 1 65 ? 2.741   -4.031  2.636   1.00 0.00 ? 65 ILE A CG2  1  
ATOM 1036  C CD1  . ILE A 1 65 ? 0.829   -1.831  3.058   1.00 0.00 ? 65 ILE A CD1  1  
ATOM 1037  H H    . ILE A 1 65 ? 3.090   -2.284  6.304   1.00 0.00 ? 65 ILE A H    1  
ATOM 1038  H HA   . ILE A 1 65 ? 1.118   -3.888  4.801   1.00 0.00 ? 65 ILE A HA   1  
ATOM 1039  H HB   . ILE A 1 65 ? 3.938   -2.987  4.084   1.00 0.00 ? 65 ILE A HB   1  
ATOM 1040  H HG12 . ILE A 1 65 ? 2.320   -1.093  4.422   1.00 0.00 ? 65 ILE A HG12 1  
ATOM 1041  H HG13 . ILE A 1 65 ? 2.876   -1.245  2.748   1.00 0.00 ? 65 ILE A HG13 1  
ATOM 1042  H HG21 . ILE A 1 65 ? 1.727   -4.430  2.593   1.00 0.00 ? 65 ILE A HG21 1  
ATOM 1043  H HG22 . ILE A 1 65 ? 3.449   -4.857  2.727   1.00 0.00 ? 65 ILE A HG22 1  
ATOM 1044  H HG23 . ILE A 1 65 ? 2.951   -3.475  1.728   1.00 0.00 ? 65 ILE A HG23 1  
ATOM 1045  H HD11 . ILE A 1 65 ? 0.212   -2.247  3.852   1.00 0.00 ? 65 ILE A HD11 1  
ATOM 1046  H HD12 . ILE A 1 65 ? 0.776   -2.473  2.181   1.00 0.00 ? 65 ILE A HD12 1  
ATOM 1047  H HD13 . ILE A 1 65 ? 0.455   -0.839  2.797   1.00 0.00 ? 65 ILE A HD13 1  
ATOM 1048  N N    . GLU A 1 66 ? 1.970   -6.135  5.397   1.00 0.00 ? 66 GLU A N    1  
ATOM 1049  C CA   . GLU A 1 66 ? 2.415   -7.481  5.718   1.00 0.00 ? 66 GLU A CA   1  
ATOM 1050  C C    . GLU A 1 66 ? 2.498   -8.311  4.438   1.00 0.00 ? 66 GLU A C    1  
ATOM 1051  O O    . GLU A 1 66 ? 1.505   -8.456  3.726   1.00 0.00 ? 66 GLU A O    1  
ATOM 1052  C CB   . GLU A 1 66 ? 1.427   -8.106  6.707   1.00 0.00 ? 66 GLU A CB   1  
ATOM 1053  C CG   . GLU A 1 66 ? 2.023   -9.380  7.310   1.00 0.00 ? 66 GLU A CG   1  
ATOM 1054  C CD   . GLU A 1 66 ? 1.155   -9.892  8.452   1.00 0.00 ? 66 GLU A CD   1  
ATOM 1055  O OE1  . GLU A 1 66 ? 1.340   -9.382  9.579   1.00 0.00 ? 66 GLU A OE1  1  
ATOM 1056  O OE2  . GLU A 1 66 ? 0.321   -10.782 8.178   1.00 0.00 ? 66 GLU A OE2  1  
ATOM 1057  H H    . GLU A 1 66 ? 0.998   -6.005  5.150   1.00 0.00 ? 66 GLU A H    1  
ATOM 1058  H HA   . GLU A 1 66 ? 3.401   -7.434  6.181   1.00 0.00 ? 66 GLU A HA   1  
ATOM 1059  H HB2  . GLU A 1 66 ? 1.217   -7.398  7.505   1.00 0.00 ? 66 GLU A HB2  1  
ATOM 1060  H HB3  . GLU A 1 66 ? 0.497   -8.351  6.190   1.00 0.00 ? 66 GLU A HB3  1  
ATOM 1061  H HG2  . GLU A 1 66 ? 2.092   -10.147 6.539   1.00 0.00 ? 66 GLU A HG2  1  
ATOM 1062  H HG3  . GLU A 1 66 ? 3.022   -9.165  7.691   1.00 0.00 ? 66 GLU A HG3  1  
ATOM 1063  N N    . VAL A 1 67 ? 3.683   -8.858  4.153   1.00 0.00 ? 67 VAL A N    1  
ATOM 1064  C CA   . VAL A 1 67 ? 3.884   -9.702  2.985   1.00 0.00 ? 67 VAL A CA   1  
ATOM 1065  C C    . VAL A 1 67 ? 3.446   -11.120 3.338   1.00 0.00 ? 67 VAL A C    1  
ATOM 1066  O O    . VAL A 1 67 ? 3.978   -11.708 4.280   1.00 0.00 ? 67 VAL A O    1  
ATOM 1067  C CB   . VAL A 1 67 ? 5.365   -9.671  2.573   1.00 0.00 ? 67 VAL A CB   1  
ATOM 1068  C CG1  . VAL A 1 67 ? 5.562   -10.501 1.299   1.00 0.00 ? 67 VAL A CG1  1  
ATOM 1069  C CG2  . VAL A 1 67 ? 5.804   -8.227  2.308   1.00 0.00 ? 67 VAL A CG2  1  
ATOM 1070  H H    . VAL A 1 67 ? 4.469   -8.697  4.766   1.00 0.00 ? 67 VAL A H    1  
ATOM 1071  H HA   . VAL A 1 67 ? 3.275   -9.328  2.161   1.00 0.00 ? 67 VAL A HA   1  
ATOM 1072  H HB   . VAL A 1 67 ? 5.974   -10.091 3.374   1.00 0.00 ? 67 VAL A HB   1  
ATOM 1073  H HG11 . VAL A 1 67 ? 5.317   -11.544 1.500   1.00 0.00 ? 67 VAL A HG11 1  
ATOM 1074  H HG12 . VAL A 1 67 ? 6.601   -10.430 0.976   1.00 0.00 ? 67 VAL A HG12 1  
ATOM 1075  H HG13 . VAL A 1 67 ? 4.911   -10.121 0.512   1.00 0.00 ? 67 VAL A HG13 1  
ATOM 1076  H HG21 . VAL A 1 67 ? 6.835   -8.220  1.956   1.00 0.00 ? 67 VAL A HG21 1  
ATOM 1077  H HG22 . VAL A 1 67 ? 5.160   -7.785  1.550   1.00 0.00 ? 67 VAL A HG22 1  
ATOM 1078  H HG23 . VAL A 1 67 ? 5.733   -7.647  3.228   1.00 0.00 ? 67 VAL A HG23 1  
ATOM 1079  N N    . ILE A 1 68 ? 2.474   -11.668 2.592   1.00 0.00 ? 68 ILE A N    1  
ATOM 1080  C CA   . ILE A 1 68 ? 1.960   -13.009 2.861   1.00 0.00 ? 68 ILE A CA   1  
ATOM 1081  C C    . ILE A 1 68 ? 2.275   -13.924 1.671   1.00 0.00 ? 68 ILE A C    1  
ATOM 1082  O O    . ILE A 1 68 ? 3.393   -14.426 1.565   1.00 0.00 ? 68 ILE A O    1  
ATOM 1083  C CB   . ILE A 1 68 ? 0.447   -12.926 3.167   1.00 0.00 ? 68 ILE A CB   1  
ATOM 1084  C CG1  . ILE A 1 68 ? 0.218   -11.938 4.327   1.00 0.00 ? 68 ILE A CG1  1  
ATOM 1085  C CG2  . ILE A 1 68 ? -0.081  -14.314 3.565   1.00 0.00 ? 68 ILE A CG2  1  
ATOM 1086  C CD1  . ILE A 1 68 ? -1.259  -11.921 4.729   1.00 0.00 ? 68 ILE A CD1  1  
ATOM 1087  H H    . ILE A 1 68 ? 2.077   -11.144 1.820   1.00 0.00 ? 68 ILE A H    1  
ATOM 1088  H HA   . ILE A 1 68 ? 2.463   -13.410 3.741   1.00 0.00 ? 68 ILE A HA   1  
ATOM 1089  H HB   . ILE A 1 68 ? -0.086  -12.570 2.286   1.00 0.00 ? 68 ILE A HB   1  
ATOM 1090  H HG12 . ILE A 1 68 ? 0.822   -12.236 5.184   1.00 0.00 ? 68 ILE A HG12 1  
ATOM 1091  H HG13 . ILE A 1 68 ? 0.512   -10.937 4.012   1.00 0.00 ? 68 ILE A HG13 1  
ATOM 1092  H HG21 . ILE A 1 68 ? 0.301   -14.579 4.551   1.00 0.00 ? 68 ILE A HG21 1  
ATOM 1093  H HG22 . ILE A 1 68 ? 0.248   -15.057 2.841   1.00 0.00 ? 68 ILE A HG22 1  
ATOM 1094  H HG23 . ILE A 1 68 ? -1.169  -14.297 3.590   1.00 0.00 ? 68 ILE A HG23 1  
ATOM 1095  H HD11 . ILE A 1 68 ? -1.437  -11.090 5.412   1.00 0.00 ? 68 ILE A HD11 1  
ATOM 1096  H HD12 . ILE A 1 68 ? -1.878  -11.799 3.842   1.00 0.00 ? 68 ILE A HD12 1  
ATOM 1097  H HD13 . ILE A 1 68 ? -1.514  -12.856 5.227   1.00 0.00 ? 68 ILE A HD13 1  
ATOM 1098  N N    . ASP A 1 69 ? 1.300   -14.139 0.776   1.00 0.00 ? 69 ASP A N    1  
ATOM 1099  C CA   . ASP A 1 69 ? 1.485   -14.997 -0.387  1.00 0.00 ? 69 ASP A CA   1  
ATOM 1100  C C    . ASP A 1 69 ? 2.177   -14.203 -1.499  1.00 0.00 ? 69 ASP A C    1  
ATOM 1101  O O    . ASP A 1 69 ? 1.684   -14.138 -2.627  1.00 0.00 ? 69 ASP A O    1  
ATOM 1102  C CB   . ASP A 1 69 ? 0.106   -15.507 -0.831  1.00 0.00 ? 69 ASP A CB   1  
ATOM 1103  C CG   . ASP A 1 69 ? 0.207   -16.419 -2.049  1.00 0.00 ? 69 ASP A CG   1  
ATOM 1104  O OD1  . ASP A 1 69 ? 1.124   -17.266 -2.053  1.00 0.00 ? 69 ASP A OD1  1  
ATOM 1105  O OD2  . ASP A 1 69 ? -0.641  -16.248 -2.954  1.00 0.00 ? 69 ASP A OD2  1  
ATOM 1106  H H    . ASP A 1 69 ? 0.403   -13.701 0.902   1.00 0.00 ? 69 ASP A H    1  
ATOM 1107  H HA   . ASP A 1 69 ? 2.109   -15.849 -0.112  1.00 0.00 ? 69 ASP A HA   1  
ATOM 1108  H HB2  . ASP A 1 69 ? -0.349  -16.063 -0.010  1.00 0.00 ? 69 ASP A HB2  1  
ATOM 1109  H HB3  . ASP A 1 69 ? -0.528  -14.654 -1.076  1.00 0.00 ? 69 ASP A HB3  1  
ATOM 1110  N N    . GLY A 1 70 ? 3.319   -13.578 -1.171  1.00 0.00 ? 70 GLY A N    1  
ATOM 1111  C CA   . GLY A 1 70 ? 4.059   -12.754 -2.121  1.00 0.00 ? 70 GLY A CA   1  
ATOM 1112  C C    . GLY A 1 70 ? 3.375   -11.392 -2.297  1.00 0.00 ? 70 GLY A C    1  
ATOM 1113  O O    . GLY A 1 70 ? 4.041   -10.383 -2.517  1.00 0.00 ? 70 GLY A O    1  
ATOM 1114  H H    . GLY A 1 70 ? 3.686   -13.671 -0.233  1.00 0.00 ? 70 GLY A H    1  
ATOM 1115  H HA2  . GLY A 1 70 ? 5.073   -12.602 -1.750  1.00 0.00 ? 70 GLY A HA2  1  
ATOM 1116  H HA3  . GLY A 1 70 ? 4.103   -13.262 -3.085  1.00 0.00 ? 70 GLY A HA3  1  
ATOM 1117  N N    . LYS A 1 71 ? 2.041   -11.380 -2.199  1.00 0.00 ? 71 LYS A N    1  
ATOM 1118  C CA   . LYS A 1 71 ? 1.245   -10.180 -2.351  1.00 0.00 ? 71 LYS A CA   1  
ATOM 1119  C C    . LYS A 1 71 ? 1.321   -9.350  -1.069  1.00 0.00 ? 71 LYS A C    1  
ATOM 1120  O O    . LYS A 1 71 ? 1.947   -9.772  -0.090  1.00 0.00 ? 71 LYS A O    1  
ATOM 1121  C CB   . LYS A 1 71 ? -0.194  -10.597 -2.659  1.00 0.00 ? 71 LYS A CB   1  
ATOM 1122  C CG   . LYS A 1 71 ? -0.222  -11.486 -3.908  1.00 0.00 ? 71 LYS A CG   1  
ATOM 1123  C CD   . LYS A 1 71 ? -1.593  -12.156 -4.031  1.00 0.00 ? 71 LYS A CD   1  
ATOM 1124  C CE   . LYS A 1 71 ? -1.561  -13.219 -5.136  1.00 0.00 ? 71 LYS A CE   1  
ATOM 1125  N NZ   . LYS A 1 71 ? -0.667  -14.344 -4.783  1.00 0.00 ? 71 LYS A NZ   1  
ATOM 1126  H H    . LYS A 1 71 ? 1.554   -12.238 -2.013  1.00 0.00 ? 71 LYS A H    1  
ATOM 1127  H HA   . LYS A 1 71 ? 1.631   -9.590  -3.185  1.00 0.00 ? 71 LYS A HA   1  
ATOM 1128  H HB2  . LYS A 1 71 ? -0.592  -11.151 -1.819  1.00 0.00 ? 71 LYS A HB2  1  
ATOM 1129  H HB3  . LYS A 1 71 ? -0.801  -9.717  -2.829  1.00 0.00 ? 71 LYS A HB3  1  
ATOM 1130  H HG2  . LYS A 1 71 ? -0.033  -10.875 -4.788  1.00 0.00 ? 71 LYS A HG2  1  
ATOM 1131  H HG3  . LYS A 1 71 ? 0.544   -12.249 -3.832  1.00 0.00 ? 71 LYS A HG3  1  
ATOM 1132  H HD2  . LYS A 1 71 ? -1.854  -12.628 -3.082  1.00 0.00 ? 71 LYS A HD2  1  
ATOM 1133  H HD3  . LYS A 1 71 ? -2.342  -11.400 -4.273  1.00 0.00 ? 71 LYS A HD3  1  
ATOM 1134  H HE2  . LYS A 1 71 ? -2.571  -13.603 -5.290  1.00 0.00 ? 71 LYS A HE2  1  
ATOM 1135  H HE3  . LYS A 1 71 ? -1.211  -12.762 -6.062  1.00 0.00 ? 71 LYS A HE3  1  
ATOM 1136  H HZ1  . LYS A 1 71 ? -0.645  -15.008 -5.544  1.00 0.00 ? 71 LYS A HZ1  1  
ATOM 1137  H HZ2  . LYS A 1 71 ? 0.266   -13.999 -4.614  1.00 0.00 ? 71 LYS A HZ2  1  
ATOM 1138  H HZ3  . LYS A 1 71 ? -1.009  -14.808 -3.946  1.00 0.00 ? 71 LYS A HZ3  1  
ATOM 1139  N N    . TYR A 1 72 ? 0.691   -8.166  -1.077  1.00 0.00 ? 72 TYR A N    1  
ATOM 1140  C CA   . TYR A 1 72 ? 0.746   -7.255  0.055   1.00 0.00 ? 72 TYR A CA   1  
ATOM 1141  C C    . TYR A 1 72 ? -0.601  -7.195  0.765   1.00 0.00 ? 72 TYR A C    1  
ATOM 1142  O O    . TYR A 1 72 ? -1.633  -6.986  0.129   1.00 0.00 ? 72 TYR A O    1  
ATOM 1143  C CB   . TYR A 1 72 ? 1.158   -5.873  -0.452  1.00 0.00 ? 72 TYR A CB   1  
ATOM 1144  C CG   . TYR A 1 72 ? 2.475   -5.898  -1.197  1.00 0.00 ? 72 TYR A CG   1  
ATOM 1145  C CD1  . TYR A 1 72 ? 3.656   -6.229  -0.513  1.00 0.00 ? 72 TYR A CD1  1  
ATOM 1146  C CD2  . TYR A 1 72 ? 2.518   -5.611  -2.574  1.00 0.00 ? 72 TYR A CD2  1  
ATOM 1147  C CE1  . TYR A 1 72 ? 4.879   -6.275  -1.202  1.00 0.00 ? 72 TYR A CE1  1  
ATOM 1148  C CE2  . TYR A 1 72 ? 3.742   -5.655  -3.261  1.00 0.00 ? 72 TYR A CE2  1  
ATOM 1149  C CZ   . TYR A 1 72 ? 4.923   -5.988  -2.574  1.00 0.00 ? 72 TYR A CZ   1  
ATOM 1150  O OH   . TYR A 1 72 ? 6.111   -6.037  -3.238  1.00 0.00 ? 72 TYR A OH   1  
ATOM 1151  H H    . TYR A 1 72 ? 0.163   -7.880  -1.897  1.00 0.00 ? 72 TYR A H    1  
ATOM 1152  H HA   . TYR A 1 72 ? 1.499   -7.605  0.762   1.00 0.00 ? 72 TYR A HA   1  
ATOM 1153  H HB2  . TYR A 1 72 ? 0.382   -5.496  -1.118  1.00 0.00 ? 72 TYR A HB2  1  
ATOM 1154  H HB3  . TYR A 1 72 ? 1.248   -5.198  0.399   1.00 0.00 ? 72 TYR A HB3  1  
ATOM 1155  H HD1  . TYR A 1 72 ? 3.624   -6.452  0.542   1.00 0.00 ? 72 TYR A HD1  1  
ATOM 1156  H HD2  . TYR A 1 72 ? 1.610   -5.360  -3.104  1.00 0.00 ? 72 TYR A HD2  1  
ATOM 1157  H HE1  . TYR A 1 72 ? 5.786   -6.533  -0.675  1.00 0.00 ? 72 TYR A HE1  1  
ATOM 1158  H HE2  . TYR A 1 72 ? 3.776   -5.438  -4.319  1.00 0.00 ? 72 TYR A HE2  1  
ATOM 1159  H HH   . TYR A 1 72 ? 6.025   -5.855  -4.174  1.00 0.00 ? 72 TYR A HH   1  
ATOM 1160  N N    . ALA A 1 73 ? -0.576  -7.376  2.090   1.00 0.00 ? 73 ALA A N    1  
ATOM 1161  C CA   . ALA A 1 73 ? -1.770  -7.324  2.919   1.00 0.00 ? 73 ALA A CA   1  
ATOM 1162  C C    . ALA A 1 73 ? -1.590  -6.250  3.985   1.00 0.00 ? 73 ALA A C    1  
ATOM 1163  O O    . ALA A 1 73 ? -0.503  -5.697  4.133   1.00 0.00 ? 73 ALA A O    1  
ATOM 1164  C CB   . ALA A 1 73 ? -1.989  -8.688  3.575   1.00 0.00 ? 73 ALA A CB   1  
ATOM 1165  H H    . ALA A 1 73 ? 0.309   -7.553  2.549   1.00 0.00 ? 73 ALA A H    1  
ATOM 1166  H HA   . ALA A 1 73 ? -2.635  -7.078  2.304   1.00 0.00 ? 73 ALA A HA   1  
ATOM 1167  H HB1  . ALA A 1 73 ? -2.965  -8.707  4.062   1.00 0.00 ? 73 ALA A HB1  1  
ATOM 1168  H HB2  . ALA A 1 73 ? -1.947  -9.467  2.819   1.00 0.00 ? 73 ALA A HB2  1  
ATOM 1169  H HB3  . ALA A 1 73 ? -1.210  -8.863  4.319   1.00 0.00 ? 73 ALA A HB3  1  
ATOM 1170  N N    . PHE A 1 74 ? -2.656  -5.964  4.731   1.00 0.00 ? 74 PHE A N    1  
ATOM 1171  C CA   . PHE A 1 74 ? -2.610  -4.989  5.810   1.00 0.00 ? 74 PHE A CA   1  
ATOM 1172  C C    . PHE A 1 74 ? -2.400  -5.740  7.129   1.00 0.00 ? 74 PHE A C    1  
ATOM 1173  O O    . PHE A 1 74 ? -2.844  -6.877  7.265   1.00 0.00 ? 74 PHE A O    1  
ATOM 1174  C CB   . PHE A 1 74 ? -3.906  -4.176  5.799   1.00 0.00 ? 74 PHE A CB   1  
ATOM 1175  C CG   . PHE A 1 74 ? -4.113  -3.322  7.028   1.00 0.00 ? 74 PHE A CG   1  
ATOM 1176  C CD1  . PHE A 1 74 ? -4.653  -3.889  8.193   1.00 0.00 ? 74 PHE A CD1  1  
ATOM 1177  C CD2  . PHE A 1 74 ? -3.784  -1.957  7.001   1.00 0.00 ? 74 PHE A CD2  1  
ATOM 1178  C CE1  . PHE A 1 74 ? -4.881  -3.094  9.321   1.00 0.00 ? 74 PHE A CE1  1  
ATOM 1179  C CE2  . PHE A 1 74 ? -4.009  -1.161  8.134   1.00 0.00 ? 74 PHE A CE2  1  
ATOM 1180  C CZ   . PHE A 1 74 ? -4.565  -1.731  9.291   1.00 0.00 ? 74 PHE A CZ   1  
ATOM 1181  H H    . PHE A 1 74 ? -3.529  -6.441  4.558   1.00 0.00 ? 74 PHE A H    1  
ATOM 1182  H HA   . PHE A 1 74 ? -1.769  -4.313  5.648   1.00 0.00 ? 74 PHE A HA   1  
ATOM 1183  H HB2  . PHE A 1 74 ? -3.890  -3.523  4.930   1.00 0.00 ? 74 PHE A HB2  1  
ATOM 1184  H HB3  . PHE A 1 74 ? -4.750  -4.855  5.697   1.00 0.00 ? 74 PHE A HB3  1  
ATOM 1185  H HD1  . PHE A 1 74 ? -4.898  -4.936  8.217   1.00 0.00 ? 74 PHE A HD1  1  
ATOM 1186  H HD2  . PHE A 1 74 ? -3.367  -1.517  6.106   1.00 0.00 ? 74 PHE A HD2  1  
ATOM 1187  H HE1  . PHE A 1 74 ? -5.307  -3.531  10.212  1.00 0.00 ? 74 PHE A HE1  1  
ATOM 1188  H HE2  . PHE A 1 74 ? -3.764  -0.110  8.113   1.00 0.00 ? 74 PHE A HE2  1  
ATOM 1189  H HZ   . PHE A 1 74 ? -4.753  -1.120  10.154  1.00 0.00 ? 74 PHE A HZ   1  
ATOM 1190  N N    . LYS A 1 75 ? -1.703  -5.105  8.085   1.00 0.00 ? 75 LYS A N    1  
ATOM 1191  C CA   . LYS A 1 75 ? -1.350  -5.734  9.358   1.00 0.00 ? 75 LYS A CA   1  
ATOM 1192  C C    . LYS A 1 75 ? -2.235  -5.228  10.510  1.00 0.00 ? 75 LYS A C    1  
ATOM 1193  O O    . LYS A 1 75 ? -2.057  -4.095  10.963  1.00 0.00 ? 75 LYS A O    1  
ATOM 1194  C CB   . LYS A 1 75 ? 0.114   -5.403  9.643   1.00 0.00 ? 75 LYS A CB   1  
ATOM 1195  C CG   . LYS A 1 75 ? 0.594   -6.151  10.887  1.00 0.00 ? 75 LYS A CG   1  
ATOM 1196  C CD   . LYS A 1 75 ? 2.058   -5.800  11.155  1.00 0.00 ? 75 LYS A CD   1  
ATOM 1197  C CE   . LYS A 1 75 ? 2.970   -6.641  10.255  1.00 0.00 ? 75 LYS A CE   1  
ATOM 1198  N NZ   . LYS A 1 75 ? 4.313   -6.051  10.170  1.00 0.00 ? 75 LYS A NZ   1  
ATOM 1199  H H    . LYS A 1 75 ? -1.385  -4.159  7.920   1.00 0.00 ? 75 LYS A H    1  
ATOM 1200  H HA   . LYS A 1 75 ? -1.449  -6.813  9.265   1.00 0.00 ? 75 LYS A HA   1  
ATOM 1201  H HB2  . LYS A 1 75 ? 0.720   -5.692  8.787   1.00 0.00 ? 75 LYS A HB2  1  
ATOM 1202  H HB3  . LYS A 1 75 ? 0.216   -4.330  9.804   1.00 0.00 ? 75 LYS A HB3  1  
ATOM 1203  H HG2  . LYS A 1 75 ? -0.008  -5.855  11.747  1.00 0.00 ? 75 LYS A HG2  1  
ATOM 1204  H HG3  . LYS A 1 75 ? 0.499   -7.226  10.731  1.00 0.00 ? 75 LYS A HG3  1  
ATOM 1205  H HD2  . LYS A 1 75 ? 2.217   -4.741  10.950  1.00 0.00 ? 75 LYS A HD2  1  
ATOM 1206  H HD3  . LYS A 1 75 ? 2.290   -6.001  12.197  1.00 0.00 ? 75 LYS A HD3  1  
ATOM 1207  H HE2  . LYS A 1 75 ? 3.046   -7.650  10.663  1.00 0.00 ? 75 LYS A HE2  1  
ATOM 1208  H HE3  . LYS A 1 75 ? 2.545   -6.694  9.255   1.00 0.00 ? 75 LYS A HE3  1  
ATOM 1209  H HZ1  . LYS A 1 75 ? 4.733   -6.036  11.090  1.00 0.00 ? 75 LYS A HZ1  1  
ATOM 1210  H HZ2  . LYS A 1 75 ? 4.243   -5.104  9.812   1.00 0.00 ? 75 LYS A HZ2  1  
ATOM 1211  H HZ3  . LYS A 1 75 ? 4.886   -6.604  9.548   1.00 0.00 ? 75 LYS A HZ3  1  
ATOM 1212  N N    . PRO A 1 76 ? -3.180  -6.061  11.005  1.00 0.00 ? 76 PRO A N    1  
ATOM 1213  C CA   . PRO A 1 76 ? -4.033  -5.704  12.120  1.00 0.00 ? 76 PRO A CA   1  
ATOM 1214  C C    . PRO A 1 76 ? -3.308  -5.937  13.452  1.00 0.00 ? 76 PRO A C    1  
ATOM 1215  O O    . PRO A 1 76 ? -3.256  -5.055  14.308  1.00 0.00 ? 76 PRO A O    1  
ATOM 1216  C CB   . PRO A 1 76 ? -5.222  -6.655  12.015  1.00 0.00 ? 76 PRO A CB   1  
ATOM 1217  C CG   . PRO A 1 76 ? -4.717  -7.863  11.220  1.00 0.00 ? 76 PRO A CG   1  
ATOM 1218  C CD   . PRO A 1 76 ? -3.459  -7.387  10.483  1.00 0.00 ? 76 PRO A CD   1  
ATOM 1219  H HA   . PRO A 1 76 ? -4.366  -4.671  12.031  1.00 0.00 ? 76 PRO A HA   1  
ATOM 1220  H HB2  . PRO A 1 76 ? -5.553  -6.965  13.008  1.00 0.00 ? 76 PRO A HB2  1  
ATOM 1221  H HB3  . PRO A 1 76 ? -6.039  -6.171  11.483  1.00 0.00 ? 76 PRO A HB3  1  
ATOM 1222  H HG2  . PRO A 1 76 ? -4.466  -8.678  11.899  1.00 0.00 ? 76 PRO A HG2  1  
ATOM 1223  H HG3  . PRO A 1 76 ? -5.474  -8.191  10.511  1.00 0.00 ? 76 PRO A HG3  1  
ATOM 1224  H HD2  . PRO A 1 76 ? -2.625  -8.061  10.688  1.00 0.00 ? 76 PRO A HD2  1  
ATOM 1225  H HD3  . PRO A 1 76 ? -3.652  -7.340  9.416   1.00 0.00 ? 76 PRO A HD3  1  
ATOM 1226  N N    . LYS A 1 77 ? -2.778  -7.161  13.612  1.00 0.00 ? 77 LYS A N    1  
ATOM 1227  C CA   . LYS A 1 77 ? -2.147  -7.627  14.842  1.00 0.00 ? 77 LYS A CA   1  
ATOM 1228  C C    . LYS A 1 77 ? -1.034  -6.690  15.329  1.00 0.00 ? 77 LYS A C    1  
ATOM 1229  O O    . LYS A 1 77 ? -0.395  -5.999  14.536  1.00 0.00 ? 77 LYS A O    1  
ATOM 1230  C CB   . LYS A 1 77 ? -1.602  -9.039  14.591  1.00 0.00 ? 77 LYS A CB   1  
ATOM 1231  C CG   . LYS A 1 77 ? -1.351  -9.762  15.922  1.00 0.00 ? 77 LYS A CG   1  
ATOM 1232  C CD   . LYS A 1 77 ? -1.227  -11.273 15.681  1.00 0.00 ? 77 LYS A CD   1  
ATOM 1233  C CE   . LYS A 1 77 ? -0.081  -11.562 14.702  1.00 0.00 ? 77 LYS A CE   1  
ATOM 1234  N NZ   . LYS A 1 77 ? 0.138   -13.013 14.557  1.00 0.00 ? 77 LYS A NZ   1  
ATOM 1235  H H    . LYS A 1 77 ? -2.833  -7.815  12.845  1.00 0.00 ? 77 LYS A H    1  
ATOM 1236  H HA   . LYS A 1 77 ? -2.915  -7.683  15.615  1.00 0.00 ? 77 LYS A HA   1  
ATOM 1237  H HB2  . LYS A 1 77 ? -2.331  -9.606  14.010  1.00 0.00 ? 77 LYS A HB2  1  
ATOM 1238  H HB3  . LYS A 1 77 ? -0.669  -8.971  14.030  1.00 0.00 ? 77 LYS A HB3  1  
ATOM 1239  H HG2  . LYS A 1 77 ? -0.432  -9.389  16.374  1.00 0.00 ? 77 LYS A HG2  1  
ATOM 1240  H HG3  . LYS A 1 77 ? -2.187  -9.576  16.598  1.00 0.00 ? 77 LYS A HG3  1  
ATOM 1241  H HD2  . LYS A 1 77 ? -1.026  -11.772 16.631  1.00 0.00 ? 77 LYS A HD2  1  
ATOM 1242  H HD3  . LYS A 1 77 ? -2.163  -11.651 15.267  1.00 0.00 ? 77 LYS A HD3  1  
ATOM 1243  H HE2  . LYS A 1 77 ? -0.327  -11.144 13.725  1.00 0.00 ? 77 LYS A HE2  1  
ATOM 1244  H HE3  . LYS A 1 77 ? 0.833   -11.097 15.071  1.00 0.00 ? 77 LYS A HE3  1  
ATOM 1245  H HZ1  . LYS A 1 77 ? 0.880   -13.177 13.891  1.00 0.00 ? 77 LYS A HZ1  1  
ATOM 1246  H HZ2  . LYS A 1 77 ? -0.711  -13.452 14.228  1.00 0.00 ? 77 LYS A HZ2  1  
ATOM 1247  H HZ3  . LYS A 1 77 ? 0.395   -13.407 15.452  1.00 0.00 ? 77 LYS A HZ3  1  
ATOM 1248  N N    . TYR A 1 78 ? -0.830  -6.701  16.664  1.00 0.00 ? 78 TYR A N    1  
ATOM 1249  C CA   . TYR A 1 78 ? 0.170   -5.892  17.369  1.00 0.00 ? 78 TYR A CA   1  
ATOM 1250  C C    . TYR A 1 78 ? 0.333   -4.505  16.734  1.00 0.00 ? 78 TYR A C    1  
ATOM 1251  O O    . TYR A 1 78 ? 1.445   -4.050  16.479  1.00 0.00 ? 78 TYR A O    1  
ATOM 1252  C CB   . TYR A 1 78 ? 1.504   -6.668  17.496  1.00 0.00 ? 78 TYR A CB   1  
ATOM 1253  C CG   . TYR A 1 78 ? 2.376   -6.726  16.249  1.00 0.00 ? 78 TYR A CG   1  
ATOM 1254  C CD1  . TYR A 1 78 ? 2.079   -7.629  15.212  1.00 0.00 ? 78 TYR A CD1  1  
ATOM 1255  C CD2  . TYR A 1 78 ? 3.518   -5.906  16.153  1.00 0.00 ? 78 TYR A CD2  1  
ATOM 1256  C CE1  . TYR A 1 78 ? 2.912   -7.701  14.081  1.00 0.00 ? 78 TYR A CE1  1  
ATOM 1257  C CE2  . TYR A 1 78 ? 4.347   -5.978  15.023  1.00 0.00 ? 78 TYR A CE2  1  
ATOM 1258  C CZ   . TYR A 1 78 ? 4.045   -6.875  13.987  1.00 0.00 ? 78 TYR A CZ   1  
ATOM 1259  O OH   . TYR A 1 78 ? 4.857   -6.945  12.891  1.00 0.00 ? 78 TYR A OH   1  
ATOM 1260  H H    . TYR A 1 78 ? -1.405  -7.308  17.229  1.00 0.00 ? 78 TYR A H    1  
ATOM 1261  H HA   . TYR A 1 78 ? -0.205  -5.735  18.381  1.00 0.00 ? 78 TYR A HA   1  
ATOM 1262  H HB2  . TYR A 1 78 ? 2.088   -6.204  18.293  1.00 0.00 ? 78 TYR A HB2  1  
ATOM 1263  H HB3  . TYR A 1 78 ? 1.275   -7.691  17.798  1.00 0.00 ? 78 TYR A HB3  1  
ATOM 1264  H HD1  . TYR A 1 78 ? 1.217   -8.271  15.286  1.00 0.00 ? 78 TYR A HD1  1  
ATOM 1265  H HD2  . TYR A 1 78 ? 3.759   -5.221  16.953  1.00 0.00 ? 78 TYR A HD2  1  
ATOM 1266  H HE1  . TYR A 1 78 ? 2.683   -8.396  13.285  1.00 0.00 ? 78 TYR A HE1  1  
ATOM 1267  H HE2  . TYR A 1 78 ? 5.220   -5.346  14.954  1.00 0.00 ? 78 TYR A HE2  1  
ATOM 1268  H HH   . TYR A 1 78 ? 5.723   -6.556  13.043  1.00 0.00 ? 78 TYR A HH   1  
ATOM 1269  N N    . ASN A 1 79 ? -0.795  -3.825  16.499  1.00 0.00 ? 79 ASN A N    1  
ATOM 1270  C CA   . ASN A 1 79 ? -0.787  -2.487  15.935  1.00 0.00 ? 79 ASN A CA   1  
ATOM 1271  C C    . ASN A 1 79 ? -2.154  -1.836  16.138  1.00 0.00 ? 79 ASN A C    1  
ATOM 1272  O O    . ASN A 1 79 ? -2.236  -0.707  16.617  1.00 0.00 ? 79 ASN A O    1  
ATOM 1273  C CB   . ASN A 1 79 ? -0.430  -2.548  14.448  1.00 0.00 ? 79 ASN A CB   1  
ATOM 1274  C CG   . ASN A 1 79 ? -0.037  -1.168  13.940  1.00 0.00 ? 79 ASN A CG   1  
ATOM 1275  O OD1  . ASN A 1 79 ? -0.894  -0.382  13.547  1.00 0.00 ? 79 ASN A OD1  1  
ATOM 1276  N ND2  . ASN A 1 79 ? 1.263   -0.873  13.948  1.00 0.00 ? 79 ASN A ND2  1  
ATOM 1277  H H    . ASN A 1 79 ? -1.686  -4.246  16.722  1.00 0.00 ? 79 ASN A H    1  
ATOM 1278  H HA   . ASN A 1 79 ? -0.034  -1.890  16.455  1.00 0.00 ? 79 ASN A HA   1  
ATOM 1279  H HB2  . ASN A 1 79 ? 0.406   -3.233  14.304  1.00 0.00 ? 79 ASN A HB2  1  
ATOM 1280  H HB3  . ASN A 1 79 ? -1.289  -2.910  13.884  1.00 0.00 ? 79 ASN A HB3  1  
ATOM 1281  H HD21 . ASN A 1 79 ? 1.933   -1.554  14.278  1.00 0.00 ? 79 ASN A HD21 1  
ATOM 1282  H HD22 . ASN A 1 79 ? 1.576   0.030   13.624  1.00 0.00 ? 79 ASN A HD22 1  
ATOM 1283  N N    . VAL A 1 80 ? -3.223  -2.557  15.772  1.00 0.00 ? 80 VAL A N    1  
ATOM 1284  C CA   . VAL A 1 80 ? -4.590  -2.067  15.912  1.00 0.00 ? 80 VAL A CA   1  
ATOM 1285  C C    . VAL A 1 80 ? -5.387  -3.041  16.778  1.00 0.00 ? 80 VAL A C    1  
ATOM 1286  O O    . VAL A 1 80 ? -5.091  -4.237  16.801  1.00 0.00 ? 80 VAL A O    1  
ATOM 1287  C CB   . VAL A 1 80 ? -5.222  -1.921  14.516  1.00 0.00 ? 80 VAL A CB   1  
ATOM 1288  C CG1  . VAL A 1 80 ? -6.652  -1.384  14.639  1.00 0.00 ? 80 VAL A CG1  1  
ATOM 1289  C CG2  . VAL A 1 80 ? -4.391  -0.947  13.675  1.00 0.00 ? 80 VAL A CG2  1  
ATOM 1290  H H    . VAL A 1 80 ? -3.091  -3.483  15.382  1.00 0.00 ? 80 VAL A H    1  
ATOM 1291  H HA   . VAL A 1 80 ? -4.577  -1.091  16.400  1.00 0.00 ? 80 VAL A HA   1  
ATOM 1292  H HB   . VAL A 1 80 ? -5.243  -2.894  14.024  1.00 0.00 ? 80 VAL A HB   1  
ATOM 1293  H HG11 . VAL A 1 80 ? -7.296  -2.149  15.074  1.00 0.00 ? 80 VAL A HG11 1  
ATOM 1294  H HG12 . VAL A 1 80 ? -7.028  -1.120  13.650  1.00 0.00 ? 80 VAL A HG12 1  
ATOM 1295  H HG13 . VAL A 1 80 ? -6.658  -0.499  15.276  1.00 0.00 ? 80 VAL A HG13 1  
ATOM 1296  H HG21 . VAL A 1 80 ? -4.312  0.009   14.195  1.00 0.00 ? 80 VAL A HG21 1  
ATOM 1297  H HG22 . VAL A 1 80 ? -4.874  -0.797  12.710  1.00 0.00 ? 80 VAL A HG22 1  
ATOM 1298  H HG23 . VAL A 1 80 ? -3.397  -1.358  13.520  1.00 0.00 ? 80 VAL A HG23 1  
ATOM 1299  N N    . ARG A 1 81 ? -6.398  -2.523  17.487  1.00 0.00 ? 81 ARG A N    1  
ATOM 1300  C CA   . ARG A 1 81 ? -7.254  -3.328  18.347  1.00 0.00 ? 81 ARG A CA   1  
ATOM 1301  C C    . ARG A 1 81 ? -8.712  -3.078  17.976  1.00 0.00 ? 81 ARG A C    1  
ATOM 1302  O O    . ARG A 1 81 ? -9.529  -3.975  18.273  1.00 0.00 ? 81 ARG A O    1  
ATOM 1303  C CB   . ARG A 1 81 ? -7.007  -2.958  19.812  1.00 0.00 ? 81 ARG A CB   1  
ATOM 1304  C CG   . ARG A 1 81 ? -5.580  -3.338  20.217  1.00 0.00 ? 81 ARG A CG   1  
ATOM 1305  C CD   . ARG A 1 81 ? -5.398  -3.108  21.718  1.00 0.00 ? 81 ARG A CD   1  
ATOM 1306  N NE   . ARG A 1 81 ? -4.040  -3.470  22.143  1.00 0.00 ? 81 ARG A NE   1  
ATOM 1307  C CZ   . ARG A 1 81 ? -3.635  -3.416  23.425  1.00 0.00 ? 81 ARG A CZ   1  
ATOM 1308  N NH1  . ARG A 1 81 ? -4.481  -3.013  24.382  1.00 0.00 ? 81 ARG A NH1  1  
ATOM 1309  N NH2  . ARG A 1 81 ? -2.383  -3.766  23.743  1.00 0.00 ? 81 ARG A NH2  1  
ATOM 1310  O OXT  . ARG A 1 81 ? -9.002  -1.927  17.578  1.00 0.00 ? 81 ARG A OXT  1  
ATOM 1311  H H    . ARG A 1 81 ? -6.589  -1.533  17.427  1.00 0.00 ? 81 ARG A H    1  
ATOM 1312  H HA   . ARG A 1 81 ? -7.028  -4.384  18.202  1.00 0.00 ? 81 ARG A HA   1  
ATOM 1313  H HB2  . ARG A 1 81 ? -7.148  -1.884  19.945  1.00 0.00 ? 81 ARG A HB2  1  
ATOM 1314  H HB3  . ARG A 1 81 ? -7.716  -3.495  20.443  1.00 0.00 ? 81 ARG A HB3  1  
ATOM 1315  H HG2  . ARG A 1 81 ? -5.405  -4.390  19.985  1.00 0.00 ? 81 ARG A HG2  1  
ATOM 1316  H HG3  . ARG A 1 81 ? -4.867  -2.723  19.665  1.00 0.00 ? 81 ARG A HG3  1  
ATOM 1317  H HD2  . ARG A 1 81 ? -5.577  -2.056  21.942  1.00 0.00 ? 81 ARG A HD2  1  
ATOM 1318  H HD3  . ARG A 1 81 ? -6.119  -3.719  22.262  1.00 0.00 ? 81 ARG A HD3  1  
ATOM 1319  H HE   . ARG A 1 81 ? -3.390  -3.770  21.430  1.00 0.00 ? 81 ARG A HE   1  
ATOM 1320  H HH11 . ARG A 1 81 ? -5.425  -2.746  24.141  1.00 0.00 ? 81 ARG A HH11 1  
ATOM 1321  H HH12 . ARG A 1 81 ? -4.177  -2.974  25.344  1.00 0.00 ? 81 ARG A HH12 1  
ATOM 1322  H HH21 . ARG A 1 81 ? -1.743  -4.069  23.023  1.00 0.00 ? 81 ARG A HH21 1  
ATOM 1323  H HH22 . ARG A 1 81 ? -2.075  -3.727  24.705  1.00 0.00 ? 81 ARG A HH22 1  
ATOM 1324  N N    . ALA A 1 1  ? 12.938  15.258  13.448  1.00 0.00 ? 1  ALA A N    2  
ATOM 1325  C CA   . ALA A 1 1  ? 12.923  16.723  13.280  1.00 0.00 ? 1  ALA A CA   2  
ATOM 1326  C C    . ALA A 1 1  ? 11.487  17.243  13.313  1.00 0.00 ? 1  ALA A C    2  
ATOM 1327  O O    . ALA A 1 1  ? 11.064  17.822  14.309  1.00 0.00 ? 1  ALA A O    2  
ATOM 1328  C CB   . ALA A 1 1  ? 13.615  17.120  11.972  1.00 0.00 ? 1  ALA A CB   2  
ATOM 1329  H H1   . ALA A 1 1  ? 13.893  14.929  13.448  1.00 0.00 ? 1  ALA A H1   2  
ATOM 1330  H H2   . ALA A 1 1  ? 12.499  15.016  14.325  1.00 0.00 ? 1  ALA A H2   2  
ATOM 1331  H H3   . ALA A 1 1  ? 12.433  14.827  12.688  1.00 0.00 ? 1  ALA A H3   2  
ATOM 1332  H HA   . ALA A 1 1  ? 13.470  17.171  14.110  1.00 0.00 ? 1  ALA A HA   2  
ATOM 1333  H HB1  . ALA A 1 1  ? 13.150  16.598  11.136  1.00 0.00 ? 1  ALA A HB1  2  
ATOM 1334  H HB2  . ALA A 1 1  ? 13.523  18.197  11.825  1.00 0.00 ? 1  ALA A HB2  2  
ATOM 1335  H HB3  . ALA A 1 1  ? 14.671  16.851  12.024  1.00 0.00 ? 1  ALA A HB3  2  
ATOM 1336  N N    . LEU A 1 2  ? 10.739  17.030  12.222  1.00 0.00 ? 2  LEU A N    2  
ATOM 1337  C CA   . LEU A 1 2  ? 9.354   17.469  12.132  1.00 0.00 ? 2  LEU A CA   2  
ATOM 1338  C C    . LEU A 1 2  ? 8.623   16.600  11.110  1.00 0.00 ? 2  LEU A C    2  
ATOM 1339  O O    . LEU A 1 2  ? 7.712   15.860  11.469  1.00 0.00 ? 2  LEU A O    2  
ATOM 1340  C CB   . LEU A 1 2  ? 9.316   18.961  11.746  1.00 0.00 ? 2  LEU A CB   2  
ATOM 1341  C CG   . LEU A 1 2  ? 8.039   19.627  12.285  1.00 0.00 ? 2  LEU A CG   2  
ATOM 1342  C CD1  . LEU A 1 2  ? 8.157   21.145  12.126  1.00 0.00 ? 2  LEU A CD1  2  
ATOM 1343  C CD2  . LEU A 1 2  ? 6.812   19.132  11.513  1.00 0.00 ? 2  LEU A CD2  2  
ATOM 1344  H H    . LEU A 1 2  ? 11.136  16.549  11.429  1.00 0.00 ? 2  LEU A H    2  
ATOM 1345  H HA   . LEU A 1 2  ? 8.879   17.343  13.106  1.00 0.00 ? 2  LEU A HA   2  
ATOM 1346  H HB2  . LEU A 1 2  ? 10.184  19.463  12.174  1.00 0.00 ? 2  LEU A HB2  2  
ATOM 1347  H HB3  . LEU A 1 2  ? 9.348   19.063  10.661  1.00 0.00 ? 2  LEU A HB3  2  
ATOM 1348  H HG   . LEU A 1 2  ? 7.922   19.386  13.343  1.00 0.00 ? 2  LEU A HG   2  
ATOM 1349  H HD11 . LEU A 1 2  ? 9.025   21.502  12.681  1.00 0.00 ? 2  LEU A HD11 2  
ATOM 1350  H HD12 . LEU A 1 2  ? 7.257   21.622  12.517  1.00 0.00 ? 2  LEU A HD12 2  
ATOM 1351  H HD13 . LEU A 1 2  ? 8.272   21.393  11.072  1.00 0.00 ? 2  LEU A HD13 2  
ATOM 1352  H HD21 . LEU A 1 2  ? 6.590   18.106  11.798  1.00 0.00 ? 2  LEU A HD21 2  
ATOM 1353  H HD22 . LEU A 1 2  ? 5.955   19.763  11.749  1.00 0.00 ? 2  LEU A HD22 2  
ATOM 1354  H HD23 . LEU A 1 2  ? 7.011   19.178  10.442  1.00 0.00 ? 2  LEU A HD23 2  
ATOM 1355  N N    . SER A 1 3  ? 9.037   16.691  9.835   1.00 0.00 ? 3  SER A N    2  
ATOM 1356  C CA   . SER A 1 3  ? 8.440   15.911  8.756   1.00 0.00 ? 3  SER A CA   2  
ATOM 1357  C C    . SER A 1 3  ? 6.924   16.113  8.732   1.00 0.00 ? 3  SER A C    2  
ATOM 1358  O O    . SER A 1 3  ? 6.166   15.188  9.024   1.00 0.00 ? 3  SER A O    2  
ATOM 1359  C CB   . SER A 1 3  ? 8.797   14.430  8.938   1.00 0.00 ? 3  SER A CB   2  
ATOM 1360  O OG   . SER A 1 3  ? 10.199  14.294  9.059   1.00 0.00 ? 3  SER A OG   2  
ATOM 1361  H H    . SER A 1 3  ? 9.790   17.319  9.602   1.00 0.00 ? 3  SER A H    2  
ATOM 1362  H HA   . SER A 1 3  ? 8.854   16.255  7.807   1.00 0.00 ? 3  SER A HA   2  
ATOM 1363  H HB2  . SER A 1 3  ? 8.317   14.044  9.837   1.00 0.00 ? 3  SER A HB2  2  
ATOM 1364  H HB3  . SER A 1 3  ? 8.451   13.865  8.072   1.00 0.00 ? 3  SER A HB3  2  
ATOM 1365  H HG   . SER A 1 3  ? 10.412  13.359  9.106   1.00 0.00 ? 3  SER A HG   2  
ATOM 1366  N N    . GLY A 1 4  ? 6.486   17.329  8.379   1.00 0.00 ? 4  GLY A N    2  
ATOM 1367  C CA   . GLY A 1 4  ? 5.067   17.660  8.325   1.00 0.00 ? 4  GLY A CA   2  
ATOM 1368  C C    . GLY A 1 4  ? 4.438   17.128  7.037   1.00 0.00 ? 4  GLY A C    2  
ATOM 1369  O O    . GLY A 1 4  ? 3.864   17.896  6.266   1.00 0.00 ? 4  GLY A O    2  
ATOM 1370  H H    . GLY A 1 4  ? 7.152   18.049  8.143   1.00 0.00 ? 4  GLY A H    2  
ATOM 1371  H HA2  . GLY A 1 4  ? 4.559   17.219  9.183   1.00 0.00 ? 4  GLY A HA2  2  
ATOM 1372  H HA3  . GLY A 1 4  ? 4.952   18.743  8.359   1.00 0.00 ? 4  GLY A HA3  2  
ATOM 1373  N N    . SER A 1 5  ? 4.547   15.809  6.816   1.00 0.00 ? 5  SER A N    2  
ATOM 1374  C CA   . SER A 1 5  ? 3.990   15.152  5.638   1.00 0.00 ? 5  SER A CA   2  
ATOM 1375  C C    . SER A 1 5  ? 4.621   15.704  4.354   1.00 0.00 ? 5  SER A C    2  
ATOM 1376  O O    . SER A 1 5  ? 5.568   16.490  4.401   1.00 0.00 ? 5  SER A O    2  
ATOM 1377  C CB   . SER A 1 5  ? 2.466   15.327  5.622   1.00 0.00 ? 5  SER A CB   2  
ATOM 1378  O OG   . SER A 1 5  ? 1.891   14.398  4.724   1.00 0.00 ? 5  SER A OG   2  
ATOM 1379  H H    . SER A 1 5  ? 5.033   15.235  7.491   1.00 0.00 ? 5  SER A H    2  
ATOM 1380  H HA   . SER A 1 5  ? 4.215   14.086  5.702   1.00 0.00 ? 5  SER A HA   2  
ATOM 1381  H HB2  . SER A 1 5  ? 2.069   15.153  6.623   1.00 0.00 ? 5  SER A HB2  2  
ATOM 1382  H HB3  . SER A 1 5  ? 2.216   16.340  5.304   1.00 0.00 ? 5  SER A HB3  2  
ATOM 1383  H HG   . SER A 1 5  ? 0.936   14.505  4.742   1.00 0.00 ? 5  SER A HG   2  
ATOM 1384  N N    . SER A 1 6  ? 4.082   15.275  3.207   1.00 0.00 ? 6  SER A N    2  
ATOM 1385  C CA   . SER A 1 6  ? 4.556   15.693  1.895   1.00 0.00 ? 6  SER A CA   2  
ATOM 1386  C C    . SER A 1 6  ? 3.658   15.057  0.833   1.00 0.00 ? 6  SER A C    2  
ATOM 1387  O O    . SER A 1 6  ? 3.039   14.023  1.090   1.00 0.00 ? 6  SER A O    2  
ATOM 1388  C CB   . SER A 1 6  ? 6.019   15.267  1.711   1.00 0.00 ? 6  SER A CB   2  
ATOM 1389  O OG   . SER A 1 6  ? 6.395   15.411  0.356   1.00 0.00 ? 6  SER A OG   2  
ATOM 1390  H H    . SER A 1 6  ? 3.303   14.628  3.242   1.00 0.00 ? 6  SER A H    2  
ATOM 1391  H HA   . SER A 1 6  ? 4.487   16.779  1.818   1.00 0.00 ? 6  SER A HA   2  
ATOM 1392  H HB2  . SER A 1 6  ? 6.662   15.893  2.329   1.00 0.00 ? 6  SER A HB2  2  
ATOM 1393  H HB3  . SER A 1 6  ? 6.132   14.226  2.011   1.00 0.00 ? 6  SER A HB3  2  
ATOM 1394  H HG   . SER A 1 6  ? 7.335   15.231  0.280   1.00 0.00 ? 6  SER A HG   2  
ATOM 1395  N N    . GLY A 1 7  ? 3.581   15.674  -0.355  1.00 0.00 ? 7  GLY A N    2  
ATOM 1396  C CA   . GLY A 1 7  ? 2.737   15.176  -1.433  1.00 0.00 ? 7  GLY A CA   2  
ATOM 1397  C C    . GLY A 1 7  ? 3.580   14.739  -2.627  1.00 0.00 ? 7  GLY A C    2  
ATOM 1398  O O    . GLY A 1 7  ? 3.368   15.203  -3.745  1.00 0.00 ? 7  GLY A O    2  
ATOM 1399  H H    . GLY A 1 7  ? 4.119   16.514  -0.516  1.00 0.00 ? 7  GLY A H    2  
ATOM 1400  H HA2  . GLY A 1 7  ? 2.159   14.322  -1.076  1.00 0.00 ? 7  GLY A HA2  2  
ATOM 1401  H HA3  . GLY A 1 7  ? 2.054   15.966  -1.745  1.00 0.00 ? 7  GLY A HA3  2  
ATOM 1402  N N    . TYR A 1 8  ? 4.530   13.835  -2.381  1.00 0.00 ? 8  TYR A N    2  
ATOM 1403  C CA   . TYR A 1 8  ? 5.389   13.292  -3.423  1.00 0.00 ? 8  TYR A CA   2  
ATOM 1404  C C    . TYR A 1 8  ? 5.925   11.955  -2.937  1.00 0.00 ? 8  TYR A C    2  
ATOM 1405  O O    . TYR A 1 8  ? 6.861   11.928  -2.155  1.00 0.00 ? 8  TYR A O    2  
ATOM 1406  C CB   . TYR A 1 8  ? 6.531   14.270  -3.719  1.00 0.00 ? 8  TYR A CB   2  
ATOM 1407  C CG   . TYR A 1 8  ? 7.588   13.691  -4.641  1.00 0.00 ? 8  TYR A CG   2  
ATOM 1408  C CD1  . TYR A 1 8  ? 7.272   13.412  -5.982  1.00 0.00 ? 8  TYR A CD1  2  
ATOM 1409  C CD2  . TYR A 1 8  ? 8.883   13.427  -4.155  1.00 0.00 ? 8  TYR A CD2  2  
ATOM 1410  C CE1  . TYR A 1 8  ? 8.249   12.868  -6.836  1.00 0.00 ? 8  TYR A CE1  2  
ATOM 1411  C CE2  . TYR A 1 8  ? 9.858   12.885  -5.010  1.00 0.00 ? 8  TYR A CE2  2  
ATOM 1412  C CZ   . TYR A 1 8  ? 9.540   12.605  -6.351  1.00 0.00 ? 8  TYR A CZ   2  
ATOM 1413  O OH   . TYR A 1 8  ? 10.484  12.077  -7.181  1.00 0.00 ? 8  TYR A OH   2  
ATOM 1414  H H    . TYR A 1 8  ? 4.663   13.503  -1.437  1.00 0.00 ? 8  TYR A H    2  
ATOM 1415  H HA   . TYR A 1 8  ? 4.804   13.137  -4.331  1.00 0.00 ? 8  TYR A HA   2  
ATOM 1416  H HB2  . TYR A 1 8  ? 6.116   15.165  -4.182  1.00 0.00 ? 8  TYR A HB2  2  
ATOM 1417  H HB3  . TYR A 1 8  ? 7.003   14.552  -2.776  1.00 0.00 ? 8  TYR A HB3  2  
ATOM 1418  H HD1  . TYR A 1 8  ? 6.280   13.612  -6.358  1.00 0.00 ? 8  TYR A HD1  2  
ATOM 1419  H HD2  . TYR A 1 8  ? 9.128   13.639  -3.125  1.00 0.00 ? 8  TYR A HD2  2  
ATOM 1420  H HE1  . TYR A 1 8  ? 8.005   12.652  -7.866  1.00 0.00 ? 8  TYR A HE1  2  
ATOM 1421  H HE2  . TYR A 1 8  ? 10.851  12.682  -4.636  1.00 0.00 ? 8  TYR A HE2  2  
ATOM 1422  H HH   . TYR A 1 8  ? 11.349  12.009  -6.770  1.00 0.00 ? 8  TYR A HH   2  
ATOM 1423  N N    . LYS A 1 9  ? 5.306   10.852  -3.396  1.00 0.00 ? 9  LYS A N    2  
ATOM 1424  C CA   . LYS A 1 9  ? 5.651   9.487   -2.972  1.00 0.00 ? 9  LYS A CA   2  
ATOM 1425  C C    . LYS A 1 9  ? 4.943   9.185   -1.645  1.00 0.00 ? 9  LYS A C    2  
ATOM 1426  O O    . LYS A 1 9  ? 4.314   8.141   -1.502  1.00 0.00 ? 9  LYS A O    2  
ATOM 1427  C CB   . LYS A 1 9  ? 7.195   9.272   -2.941  1.00 0.00 ? 9  LYS A CB   2  
ATOM 1428  C CG   . LYS A 1 9  ? 7.775   9.263   -1.512  1.00 0.00 ? 9  LYS A CG   2  
ATOM 1429  C CD   . LYS A 1 9  ? 9.309   9.335   -1.579  1.00 0.00 ? 9  LYS A CD   2  
ATOM 1430  C CE   . LYS A 1 9  ? 9.886   7.961   -1.935  1.00 0.00 ? 9  LYS A CE   2  
ATOM 1431  N NZ   . LYS A 1 9  ? 11.342  8.034   -2.145  1.00 0.00 ? 9  LYS A NZ   2  
ATOM 1432  H H    . LYS A 1 9  ? 4.552   10.957  -4.058  1.00 0.00 ? 9  LYS A H    2  
ATOM 1433  H HA   . LYS A 1 9  ? 5.251   8.803   -3.711  1.00 0.00 ? 9  LYS A HA   2  
ATOM 1434  H HB2  . LYS A 1 9  ? 7.416   8.313   -3.408  1.00 0.00 ? 9  LYS A HB2  2  
ATOM 1435  H HB3  . LYS A 1 9  ? 7.677   10.059  -3.520  1.00 0.00 ? 9  LYS A HB3  2  
ATOM 1436  H HG2  . LYS A 1 9  ? 7.414   10.117  -0.959  1.00 0.00 ? 9  LYS A HG2  2  
ATOM 1437  H HG3  . LYS A 1 9  ? 7.477   8.354   -0.999  1.00 0.00 ? 9  LYS A HG3  2  
ATOM 1438  H HD2  . LYS A 1 9  ? 9.606   10.063  -2.335  1.00 0.00 ? 9  LYS A HD2  2  
ATOM 1439  H HD3  . LYS A 1 9  ? 9.696   9.644   -0.610  1.00 0.00 ? 9  LYS A HD3  2  
ATOM 1440  H HE2  . LYS A 1 9  ? 9.681   7.270   -1.120  1.00 0.00 ? 9  LYS A HE2  2  
ATOM 1441  H HE3  . LYS A 1 9  ? 9.413   7.594   -2.845  1.00 0.00 ? 9  LYS A HE3  2  
ATOM 1442  H HZ1  . LYS A 1 9  ? 11.696  7.114   -2.373  1.00 0.00 ? 9  LYS A HZ1  2  
ATOM 1443  H HZ2  . LYS A 1 9  ? 11.543  8.669   -2.904  1.00 0.00 ? 9  LYS A HZ2  2  
ATOM 1444  H HZ3  . LYS A 1 9  ? 11.789  8.365   -1.302  1.00 0.00 ? 9  LYS A HZ3  2  
ATOM 1445  N N    . PHE A 1 10 ? 5.024   10.109  -0.688  1.00 0.00 ? 10 PHE A N    2  
ATOM 1446  C CA   . PHE A 1 10 ? 4.374   9.954   0.602   1.00 0.00 ? 10 PHE A CA   2  
ATOM 1447  C C    . PHE A 1 10 ? 2.863   10.045  0.433   1.00 0.00 ? 10 PHE A C    2  
ATOM 1448  O O    . PHE A 1 10 ? 2.125   9.225   0.973   1.00 0.00 ? 10 PHE A O    2  
ATOM 1449  C CB   . PHE A 1 10 ? 4.885   11.043  1.539   1.00 0.00 ? 10 PHE A CB   2  
ATOM 1450  C CG   . PHE A 1 10 ? 6.392   11.123  1.548   1.00 0.00 ? 10 PHE A CG   2  
ATOM 1451  C CD1  . PHE A 1 10 ? 7.146   10.208  2.300   1.00 0.00 ? 10 PHE A CD1  2  
ATOM 1452  C CD2  . PHE A 1 10 ? 7.038   12.087  0.759   1.00 0.00 ? 10 PHE A CD2  2  
ATOM 1453  C CE1  . PHE A 1 10 ? 8.549   10.265  2.267   1.00 0.00 ? 10 PHE A CE1  2  
ATOM 1454  C CE2  . PHE A 1 10 ? 8.435   12.138  0.718   1.00 0.00 ? 10 PHE A CE2  2  
ATOM 1455  C CZ   . PHE A 1 10 ? 9.194   11.231  1.476   1.00 0.00 ? 10 PHE A CZ   2  
ATOM 1456  H H    . PHE A 1 10 ? 5.554   10.953  -0.857  1.00 0.00 ? 10 PHE A H    2  
ATOM 1457  H HA   . PHE A 1 10 ? 4.630   8.977   1.016   1.00 0.00 ? 10 PHE A HA   2  
ATOM 1458  H HB2  . PHE A 1 10 ? 4.484   12.002  1.216   1.00 0.00 ? 10 PHE A HB2  2  
ATOM 1459  H HB3  . PHE A 1 10 ? 4.530   10.840  2.548   1.00 0.00 ? 10 PHE A HB3  2  
ATOM 1460  H HD1  . PHE A 1 10 ? 6.648   9.455   2.897   1.00 0.00 ? 10 PHE A HD1  2  
ATOM 1461  H HD2  . PHE A 1 10 ? 6.457   12.778  0.168   1.00 0.00 ? 10 PHE A HD2  2  
ATOM 1462  H HE1  . PHE A 1 10 ? 9.130   9.560   2.840   1.00 0.00 ? 10 PHE A HE1  2  
ATOM 1463  H HE2  . PHE A 1 10 ? 8.924   12.867  0.093   1.00 0.00 ? 10 PHE A HE2  2  
ATOM 1464  H HZ   . PHE A 1 10 ? 10.274  11.270  1.444   1.00 0.00 ? 10 PHE A HZ   2  
ATOM 1465  N N    . GLY A 1 11 ? 2.409   11.050  -0.325  1.00 0.00 ? 11 GLY A N    2  
ATOM 1466  C CA   . GLY A 1 11 ? 0.995   11.255  -0.569  1.00 0.00 ? 11 GLY A CA   2  
ATOM 1467  C C    . GLY A 1 11 ? 0.372   10.005  -1.184  1.00 0.00 ? 11 GLY A C    2  
ATOM 1468  O O    . GLY A 1 11 ? -0.654  9.534   -0.712  1.00 0.00 ? 11 GLY A O    2  
ATOM 1469  H H    . GLY A 1 11 ? 3.063   11.693  -0.743  1.00 0.00 ? 11 GLY A H    2  
ATOM 1470  H HA2  . GLY A 1 11 ? 0.495   11.482  0.374   1.00 0.00 ? 11 GLY A HA2  2  
ATOM 1471  H HA3  . GLY A 1 11 ? 0.867   12.094  -1.254  1.00 0.00 ? 11 GLY A HA3  2  
ATOM 1472  N N    . VAL A 1 12 ? 0.997   9.471   -2.241  1.00 0.00 ? 12 VAL A N    2  
ATOM 1473  C CA   . VAL A 1 12 ? 0.485   8.293   -2.930  1.00 0.00 ? 12 VAL A CA   2  
ATOM 1474  C C    . VAL A 1 12 ? 0.504   7.079   -1.991  1.00 0.00 ? 12 VAL A C    2  
ATOM 1475  O O    . VAL A 1 12 ? -0.474  6.336   -1.922  1.00 0.00 ? 12 VAL A O    2  
ATOM 1476  C CB   . VAL A 1 12 ? 1.316   8.038   -4.198  1.00 0.00 ? 12 VAL A CB   2  
ATOM 1477  C CG1  . VAL A 1 12 ? 0.735   6.847   -4.963  1.00 0.00 ? 12 VAL A CG1  2  
ATOM 1478  C CG2  . VAL A 1 12 ? 1.263   9.274   -5.103  1.00 0.00 ? 12 VAL A CG2  2  
ATOM 1479  H H    . VAL A 1 12 ? 1.847   9.893   -2.582  1.00 0.00 ? 12 VAL A H    2  
ATOM 1480  H HA   . VAL A 1 12 ? -0.546  8.484   -3.226  1.00 0.00 ? 12 VAL A HA   2  
ATOM 1481  H HB   . VAL A 1 12 ? 2.354   7.830   -3.925  1.00 0.00 ? 12 VAL A HB   2  
ATOM 1482  H HG11 . VAL A 1 12 ? -0.292  7.073   -5.251  1.00 0.00 ? 12 VAL A HG11 2  
ATOM 1483  H HG12 . VAL A 1 12 ? 1.328   6.663   -5.859  1.00 0.00 ? 12 VAL A HG12 2  
ATOM 1484  H HG13 . VAL A 1 12 ? 0.749   5.959   -4.333  1.00 0.00 ? 12 VAL A HG13 2  
ATOM 1485  H HG21 . VAL A 1 12 ? 1.758   10.112  -4.612  1.00 0.00 ? 12 VAL A HG21 2  
ATOM 1486  H HG22 . VAL A 1 12 ? 1.769   9.057   -6.044  1.00 0.00 ? 12 VAL A HG22 2  
ATOM 1487  H HG23 . VAL A 1 12 ? 0.221   9.533   -5.305  1.00 0.00 ? 12 VAL A HG23 2  
ATOM 1488  N N    . LEU A 1 13 ? 1.611   6.880   -1.266  1.00 0.00 ? 13 LEU A N    2  
ATOM 1489  C CA   . LEU A 1 13 ? 1.731   5.763   -0.336  1.00 0.00 ? 13 LEU A CA   2  
ATOM 1490  C C    . LEU A 1 13 ? 0.617   5.838   0.716   1.00 0.00 ? 13 LEU A C    2  
ATOM 1491  O O    . LEU A 1 13 ? 0.069   4.810   1.114   1.00 0.00 ? 13 LEU A O    2  
ATOM 1492  C CB   . LEU A 1 13 ? 3.121   5.801   0.311   1.00 0.00 ? 13 LEU A CB   2  
ATOM 1493  C CG   . LEU A 1 13 ? 3.280   4.688   1.361   1.00 0.00 ? 13 LEU A CG   2  
ATOM 1494  C CD1  . LEU A 1 13 ? 3.103   3.314   0.709   1.00 0.00 ? 13 LEU A CD1  2  
ATOM 1495  C CD2  . LEU A 1 13 ? 4.679   4.774   1.974   1.00 0.00 ? 13 LEU A CD2  2  
ATOM 1496  H H    . LEU A 1 13 ? 2.394   7.516   -1.358  1.00 0.00 ? 13 LEU A H    2  
ATOM 1497  H HA   . LEU A 1 13 ? 1.626   4.834   -0.895  1.00 0.00 ? 13 LEU A HA   2  
ATOM 1498  H HB2  . LEU A 1 13 ? 3.871   5.668   -0.464  1.00 0.00 ? 13 LEU A HB2  2  
ATOM 1499  H HB3  . LEU A 1 13 ? 3.268   6.770   0.789   1.00 0.00 ? 13 LEU A HB3  2  
ATOM 1500  H HG   . LEU A 1 13 ? 2.535   4.816   2.147   1.00 0.00 ? 13 LEU A HG   2  
ATOM 1501  H HD11 . LEU A 1 13 ? 2.058   3.164   0.445   1.00 0.00 ? 13 LEU A HD11 2  
ATOM 1502  H HD12 . LEU A 1 13 ? 3.413   2.539   1.410   1.00 0.00 ? 13 LEU A HD12 2  
ATOM 1503  H HD13 . LEU A 1 13 ? 3.719   3.256   -0.189  1.00 0.00 ? 13 LEU A HD13 2  
ATOM 1504  H HD21 . LEU A 1 13 ? 5.427   4.584   1.203   1.00 0.00 ? 13 LEU A HD21 2  
ATOM 1505  H HD22 . LEU A 1 13 ? 4.778   4.029   2.763   1.00 0.00 ? 13 LEU A HD22 2  
ATOM 1506  H HD23 . LEU A 1 13 ? 4.833   5.767   2.394   1.00 0.00 ? 13 LEU A HD23 2  
ATOM 1507  N N    . ALA A 1 14 ? 0.279   7.057   1.158   1.00 0.00 ? 14 ALA A N    2  
ATOM 1508  C CA   . ALA A 1 14 ? -0.775  7.254   2.141   1.00 0.00 ? 14 ALA A CA   2  
ATOM 1509  C C    . ALA A 1 14 ? -2.107  6.736   1.596   1.00 0.00 ? 14 ALA A C    2  
ATOM 1510  O O    . ALA A 1 14 ? -2.919  6.216   2.359   1.00 0.00 ? 14 ALA A O    2  
ATOM 1511  C CB   . ALA A 1 14 ? -0.875  8.737   2.500   1.00 0.00 ? 14 ALA A CB   2  
ATOM 1512  H H    . ALA A 1 14 ? 0.764   7.872   0.804   1.00 0.00 ? 14 ALA A H    2  
ATOM 1513  H HA   . ALA A 1 14 ? -0.524  6.691   3.045   1.00 0.00 ? 14 ALA A HA   2  
ATOM 1514  H HB1  . ALA A 1 14 ? 0.103   9.104   2.811   1.00 0.00 ? 14 ALA A HB1  2  
ATOM 1515  H HB2  . ALA A 1 14 ? -1.216  9.302   1.634   1.00 0.00 ? 14 ALA A HB2  2  
ATOM 1516  H HB3  . ALA A 1 14 ? -1.586  8.865   3.317   1.00 0.00 ? 14 ALA A HB3  2  
ATOM 1517  N N    . LYS A 1 15 ? -2.336  6.865   0.274   1.00 0.00 ? 15 LYS A N    2  
ATOM 1518  C CA   . LYS A 1 15 ? -3.566  6.375   -0.334  1.00 0.00 ? 15 LYS A CA   2  
ATOM 1519  C C    . LYS A 1 15 ? -3.634  4.874   -0.135  1.00 0.00 ? 15 LYS A C    2  
ATOM 1520  O O    . LYS A 1 15 ? -4.643  4.354   0.321   1.00 0.00 ? 15 LYS A O    2  
ATOM 1521  C CB   . LYS A 1 15 ? -3.622  6.702   -1.837  1.00 0.00 ? 15 LYS A CB   2  
ATOM 1522  C CG   . LYS A 1 15 ? -3.398  8.197   -2.068  1.00 0.00 ? 15 LYS A CG   2  
ATOM 1523  C CD   . LYS A 1 15 ? -3.475  8.537   -3.566  1.00 0.00 ? 15 LYS A CD   2  
ATOM 1524  C CE   . LYS A 1 15 ? -4.848  8.181   -4.152  1.00 0.00 ? 15 LYS A CE   2  
ATOM 1525  N NZ   . LYS A 1 15 ? -5.945  8.760   -3.354  1.00 0.00 ? 15 LYS A NZ   2  
ATOM 1526  H H    . LYS A 1 15 ? -1.645  7.300   -0.319  1.00 0.00 ? 15 LYS A H    2  
ATOM 1527  H HA   . LYS A 1 15 ? -4.419  6.840   0.163   1.00 0.00 ? 15 LYS A HA   2  
ATOM 1528  H HB2  . LYS A 1 15 ? -2.854  6.137   -2.361  1.00 0.00 ? 15 LYS A HB2  2  
ATOM 1529  H HB3  . LYS A 1 15 ? -4.599  6.418   -2.221  1.00 0.00 ? 15 LYS A HB3  2  
ATOM 1530  H HG2  . LYS A 1 15 ? -4.145  8.768   -1.521  1.00 0.00 ? 15 LYS A HG2  2  
ATOM 1531  H HG3  . LYS A 1 15 ? -2.413  8.460   -1.708  1.00 0.00 ? 15 LYS A HG3  2  
ATOM 1532  H HD2  . LYS A 1 15 ? -3.295  9.605   -3.698  1.00 0.00 ? 15 LYS A HD2  2  
ATOM 1533  H HD3  . LYS A 1 15 ? -2.705  7.980   -4.098  1.00 0.00 ? 15 LYS A HD3  2  
ATOM 1534  H HE2  . LYS A 1 15 ? -4.908  8.572   -5.168  1.00 0.00 ? 15 LYS A HE2  2  
ATOM 1535  H HE3  . LYS A 1 15 ? -4.960  7.099   -4.185  1.00 0.00 ? 15 LYS A HE3  2  
ATOM 1536  H HZ1  . LYS A 1 15 ? -5.960  8.334   -2.439  1.00 0.00 ? 15 LYS A HZ1  2  
ATOM 1537  H HZ2  . LYS A 1 15 ? -6.828  8.586   -3.822  1.00 0.00 ? 15 LYS A HZ2  2  
ATOM 1538  H HZ3  . LYS A 1 15 ? -5.806  9.755   -3.261  1.00 0.00 ? 15 LYS A HZ3  2  
ATOM 1539  N N    . ILE A 1 16 ? -2.544  4.183   -0.484  1.00 0.00 ? 16 ILE A N    2  
ATOM 1540  C CA   . ILE A 1 16 ? -2.475  2.739   -0.367  1.00 0.00 ? 16 ILE A CA   2  
ATOM 1541  C C    . ILE A 1 16 ? -2.731  2.314   1.075   1.00 0.00 ? 16 ILE A C    2  
ATOM 1542  O O    . ILE A 1 16 ? -3.622  1.518   1.326   1.00 0.00 ? 16 ILE A O    2  
ATOM 1543  C CB   . ILE A 1 16 ? -1.103  2.244   -0.856  1.00 0.00 ? 16 ILE A CB   2  
ATOM 1544  C CG1  . ILE A 1 16 ? -0.942  2.570   -2.353  1.00 0.00 ? 16 ILE A CG1  2  
ATOM 1545  C CG2  . ILE A 1 16 ? -1.006  0.728   -0.637  1.00 0.00 ? 16 ILE A CG2  2  
ATOM 1546  C CD1  . ILE A 1 16 ? 0.506   2.336   -2.794  1.00 0.00 ? 16 ILE A CD1  2  
ATOM 1547  H H    . ILE A 1 16 ? -1.736  4.674   -0.848  1.00 0.00 ? 16 ILE A H    2  
ATOM 1548  H HA   . ILE A 1 16 ? -3.244  2.304   -0.995  1.00 0.00 ? 16 ILE A HA   2  
ATOM 1549  H HB   . ILE A 1 16 ? -0.315  2.741   -0.291  1.00 0.00 ? 16 ILE A HB   2  
ATOM 1550  H HG12 . ILE A 1 16 ? -1.605  1.935   -2.939  1.00 0.00 ? 16 ILE A HG12 2  
ATOM 1551  H HG13 . ILE A 1 16 ? -1.200  3.615   -2.528  1.00 0.00 ? 16 ILE A HG13 2  
ATOM 1552  H HG21 . ILE A 1 16 ? -1.888  0.242   -1.054  1.00 0.00 ? 16 ILE A HG21 2  
ATOM 1553  H HG22 . ILE A 1 16 ? -0.115  0.343   -1.126  1.00 0.00 ? 16 ILE A HG22 2  
ATOM 1554  H HG23 . ILE A 1 16 ? -0.948  0.516   0.431   1.00 0.00 ? 16 ILE A HG23 2  
ATOM 1555  H HD11 . ILE A 1 16 ? 1.185   2.779   -2.068  1.00 0.00 ? 16 ILE A HD11 2  
ATOM 1556  H HD12 . ILE A 1 16 ? 0.700   1.267   -2.869  1.00 0.00 ? 16 ILE A HD12 2  
ATOM 1557  H HD13 . ILE A 1 16 ? 0.666   2.800   -3.768  1.00 0.00 ? 16 ILE A HD13 2  
ATOM 1558  N N    . VAL A 1 17 ? -1.950  2.841   2.017   1.00 0.00 ? 17 VAL A N    2  
ATOM 1559  C CA   . VAL A 1 17 ? -2.082  2.483   3.423   1.00 0.00 ? 17 VAL A CA   2  
ATOM 1560  C C    . VAL A 1 17 ? -3.511  2.748   3.927   1.00 0.00 ? 17 VAL A C    2  
ATOM 1561  O O    . VAL A 1 17 ? -4.079  1.914   4.632   1.00 0.00 ? 17 VAL A O    2  
ATOM 1562  C CB   . VAL A 1 17 ? -1.037  3.271   4.233   1.00 0.00 ? 17 VAL A CB   2  
ATOM 1563  C CG1  . VAL A 1 17 ? -1.437  3.340   5.711   1.00 0.00 ? 17 VAL A CG1  2  
ATOM 1564  C CG2  . VAL A 1 17 ? 0.322   2.576   4.112   1.00 0.00 ? 17 VAL A CG2  2  
ATOM 1565  H H    . VAL A 1 17 ? -1.232  3.509   1.756   1.00 0.00 ? 17 VAL A H    2  
ATOM 1566  H HA   . VAL A 1 17 ? -1.873  1.418   3.532   1.00 0.00 ? 17 VAL A HA   2  
ATOM 1567  H HB   . VAL A 1 17 ? -0.961  4.285   3.836   1.00 0.00 ? 17 VAL A HB   2  
ATOM 1568  H HG11 . VAL A 1 17 ? -0.606  3.742   6.292   1.00 0.00 ? 17 VAL A HG11 2  
ATOM 1569  H HG12 . VAL A 1 17 ? -2.303  3.991   5.826   1.00 0.00 ? 17 VAL A HG12 2  
ATOM 1570  H HG13 . VAL A 1 17 ? -1.681  2.340   6.071   1.00 0.00 ? 17 VAL A HG13 2  
ATOM 1571  H HG21 . VAL A 1 17 ? 0.275   1.593   4.587   1.00 0.00 ? 17 VAL A HG21 2  
ATOM 1572  H HG22 . VAL A 1 17 ? 0.581   2.458   3.059   1.00 0.00 ? 17 VAL A HG22 2  
ATOM 1573  H HG23 . VAL A 1 17 ? 1.084   3.179   4.605   1.00 0.00 ? 17 VAL A HG23 2  
ATOM 1574  N N    . ASN A 1 18 ? -4.087  3.905   3.577   1.00 0.00 ? 18 ASN A N    2  
ATOM 1575  C CA   . ASN A 1 18 ? -5.423  4.271   4.037   1.00 0.00 ? 18 ASN A CA   2  
ATOM 1576  C C    . ASN A 1 18 ? -6.484  3.331   3.457   1.00 0.00 ? 18 ASN A C    2  
ATOM 1577  O O    . ASN A 1 18 ? -7.291  2.778   4.202   1.00 0.00 ? 18 ASN A O    2  
ATOM 1578  C CB   . ASN A 1 18 ? -5.720  5.718   3.647   1.00 0.00 ? 18 ASN A CB   2  
ATOM 1579  C CG   . ASN A 1 18 ? -7.078  6.150   4.191   1.00 0.00 ? 18 ASN A CG   2  
ATOM 1580  O OD1  . ASN A 1 18 ? -7.255  6.256   5.403   1.00 0.00 ? 18 ASN A OD1  2  
ATOM 1581  N ND2  . ASN A 1 18 ? -8.035  6.394   3.296   1.00 0.00 ? 18 ASN A ND2  2  
ATOM 1582  H H    . ASN A 1 18 ? -3.587  4.556   2.982   1.00 0.00 ? 18 ASN A H    2  
ATOM 1583  H HA   . ASN A 1 18 ? -5.446  4.194   5.123   1.00 0.00 ? 18 ASN A HA   2  
ATOM 1584  H HB2  . ASN A 1 18 ? -4.947  6.367   4.062   1.00 0.00 ? 18 ASN A HB2  2  
ATOM 1585  H HB3  . ASN A 1 18 ? -5.717  5.809   2.560   1.00 0.00 ? 18 ASN A HB3  2  
ATOM 1586  H HD21 . ASN A 1 18 ? -7.842  6.296   2.310   1.00 0.00 ? 18 ASN A HD21 2  
ATOM 1587  H HD22 . ASN A 1 18 ? -8.953  6.678   3.608   1.00 0.00 ? 18 ASN A HD22 2  
ATOM 1588  N N    . TYR A 1 19 ? -6.490  3.153   2.132   1.00 0.00 ? 19 TYR A N    2  
ATOM 1589  C CA   . TYR A 1 19 ? -7.467  2.291   1.480   1.00 0.00 ? 19 TYR A CA   2  
ATOM 1590  C C    . TYR A 1 19 ? -7.308  0.858   1.990   1.00 0.00 ? 19 TYR A C    2  
ATOM 1591  O O    . TYR A 1 19 ? -8.295  0.218   2.338   1.00 0.00 ? 19 TYR A O    2  
ATOM 1592  C CB   . TYR A 1 19 ? -7.295  2.381   -0.048  1.00 0.00 ? 19 TYR A CB   2  
ATOM 1593  C CG   . TYR A 1 19 ? -7.266  1.044   -0.752  1.00 0.00 ? 19 TYR A CG   2  
ATOM 1594  C CD1  . TYR A 1 19 ? -8.464  0.404   -1.103  1.00 0.00 ? 19 TYR A CD1  2  
ATOM 1595  C CD2  . TYR A 1 19 ? -6.034  0.441   -1.058  1.00 0.00 ? 19 TYR A CD2  2  
ATOM 1596  C CE1  . TYR A 1 19 ? -8.430  -0.832  -1.763  1.00 0.00 ? 19 TYR A CE1  2  
ATOM 1597  C CE2  . TYR A 1 19 ? -6.001  -0.795  -1.718  1.00 0.00 ? 19 TYR A CE2  2  
ATOM 1598  C CZ   . TYR A 1 19 ? -7.197  -1.431  -2.073  1.00 0.00 ? 19 TYR A CZ   2  
ATOM 1599  O OH   . TYR A 1 19 ? -7.160  -2.628  -2.717  1.00 0.00 ? 19 TYR A OH   2  
ATOM 1600  H H    . TYR A 1 19 ? -5.804  3.626   1.560   1.00 0.00 ? 19 TYR A H    2  
ATOM 1601  H HA   . TYR A 1 19 ? -8.469  2.640   1.738   1.00 0.00 ? 19 TYR A HA   2  
ATOM 1602  H HB2  . TYR A 1 19 ? -8.120  2.968   -0.454  1.00 0.00 ? 19 TYR A HB2  2  
ATOM 1603  H HB3  . TYR A 1 19 ? -6.368  2.900   -0.266  1.00 0.00 ? 19 TYR A HB3  2  
ATOM 1604  H HD1  . TYR A 1 19 ? -9.413  0.866   -0.868  1.00 0.00 ? 19 TYR A HD1  2  
ATOM 1605  H HD2  . TYR A 1 19 ? -5.113  0.931   -0.789  1.00 0.00 ? 19 TYR A HD2  2  
ATOM 1606  H HE1  . TYR A 1 19 ? -9.348  -1.319  -2.033  1.00 0.00 ? 19 TYR A HE1  2  
ATOM 1607  H HE2  . TYR A 1 19 ? -5.054  -1.256  -1.955  1.00 0.00 ? 19 TYR A HE2  2  
ATOM 1608  H HH   . TYR A 1 19 ? -7.937  -2.786  -3.267  1.00 0.00 ? 19 TYR A HH   2  
ATOM 1609  N N    . MET A 1 20 ? -6.064  0.364   2.041   1.00 0.00 ? 20 MET A N    2  
ATOM 1610  C CA   . MET A 1 20 ? -5.780  -0.976  2.534   1.00 0.00 ? 20 MET A CA   2  
ATOM 1611  C C    . MET A 1 20 ? -6.391  -1.141  3.919   1.00 0.00 ? 20 MET A C    2  
ATOM 1612  O O    . MET A 1 20 ? -7.075  -2.121  4.171   1.00 0.00 ? 20 MET A O    2  
ATOM 1613  C CB   . MET A 1 20 ? -4.263  -1.200  2.574   1.00 0.00 ? 20 MET A CB   2  
ATOM 1614  C CG   . MET A 1 20 ? -3.735  -1.477  1.162   1.00 0.00 ? 20 MET A CG   2  
ATOM 1615  S SD   . MET A 1 20 ? -4.147  -3.124  0.526   1.00 0.00 ? 20 MET A SD   2  
ATOM 1616  C CE   . MET A 1 20 ? -2.801  -4.074  1.276   1.00 0.00 ? 20 MET A CE   2  
ATOM 1617  H H    . MET A 1 20 ? -5.290  0.934   1.735   1.00 0.00 ? 20 MET A H    2  
ATOM 1618  H HA   . MET A 1 20 ? -6.229  -1.711  1.867   1.00 0.00 ? 20 MET A HA   2  
ATOM 1619  H HB2  . MET A 1 20 ? -3.774  -0.315  2.980   1.00 0.00 ? 20 MET A HB2  2  
ATOM 1620  H HB3  . MET A 1 20 ? -4.043  -2.050  3.207   1.00 0.00 ? 20 MET A HB3  2  
ATOM 1621  H HG2  . MET A 1 20 ? -4.149  -0.737  0.485   1.00 0.00 ? 20 MET A HG2  2  
ATOM 1622  H HG3  . MET A 1 20 ? -2.651  -1.371  1.168   1.00 0.00 ? 20 MET A HG3  2  
ATOM 1623  H HE1  . MET A 1 20 ? -1.848  -3.738  0.868   1.00 0.00 ? 20 MET A HE1  2  
ATOM 1624  H HE2  . MET A 1 20 ? -2.806  -3.926  2.354   1.00 0.00 ? 20 MET A HE2  2  
ATOM 1625  H HE3  . MET A 1 20 ? -2.938  -5.132  1.055   1.00 0.00 ? 20 MET A HE3  2  
ATOM 1626  N N    . LYS A 1 21 ? -6.145  -0.171  4.809   1.00 0.00 ? 21 LYS A N    2  
ATOM 1627  C CA   . LYS A 1 21 ? -6.672  -0.202  6.166   1.00 0.00 ? 21 LYS A CA   2  
ATOM 1628  C C    . LYS A 1 21 ? -8.190  -0.359  6.152   1.00 0.00 ? 21 LYS A C    2  
ATOM 1629  O O    . LYS A 1 21 ? -8.709  -1.371  6.598   1.00 0.00 ? 21 LYS A O    2  
ATOM 1630  C CB   . LYS A 1 21 ? -6.272  1.094   6.886   1.00 0.00 ? 21 LYS A CB   2  
ATOM 1631  C CG   . LYS A 1 21 ? -6.945  1.168   8.260   1.00 0.00 ? 21 LYS A CG   2  
ATOM 1632  C CD   . LYS A 1 21 ? -6.407  2.373   9.038   1.00 0.00 ? 21 LYS A CD   2  
ATOM 1633  C CE   . LYS A 1 21 ? -6.510  3.639   8.181   1.00 0.00 ? 21 LYS A CE   2  
ATOM 1634  N NZ   . LYS A 1 21 ? -6.397  4.856   9.004   1.00 0.00 ? 21 LYS A NZ   2  
ATOM 1635  H H    . LYS A 1 21 ? -5.572  0.620   4.539   1.00 0.00 ? 21 LYS A H    2  
ATOM 1636  H HA   . LYS A 1 21 ? -6.239  -1.050  6.693   1.00 0.00 ? 21 LYS A HA   2  
ATOM 1637  H HB2  . LYS A 1 21 ? -5.193  1.122   7.010   1.00 0.00 ? 21 LYS A HB2  2  
ATOM 1638  H HB3  . LYS A 1 21 ? -6.583  1.944   6.287   1.00 0.00 ? 21 LYS A HB3  2  
ATOM 1639  H HG2  . LYS A 1 21 ? -8.023  1.277   8.132   1.00 0.00 ? 21 LYS A HG2  2  
ATOM 1640  H HG3  . LYS A 1 21 ? -6.738  0.254   8.817   1.00 0.00 ? 21 LYS A HG3  2  
ATOM 1641  H HD2  . LYS A 1 21 ? -6.994  2.501   9.947   1.00 0.00 ? 21 LYS A HD2  2  
ATOM 1642  H HD3  . LYS A 1 21 ? -5.364  2.196   9.302   1.00 0.00 ? 21 LYS A HD3  2  
ATOM 1643  H HE2  . LYS A 1 21 ? -5.707  3.634   7.442   1.00 0.00 ? 21 LYS A HE2  2  
ATOM 1644  H HE3  . LYS A 1 21 ? -7.471  3.646   7.666   1.00 0.00 ? 21 LYS A HE3  2  
ATOM 1645  H HZ1  . LYS A 1 21 ? -6.453  5.671   8.408   1.00 0.00 ? 21 LYS A HZ1  2  
ATOM 1646  H HZ2  . LYS A 1 21 ? -5.511  4.853   9.489   1.00 0.00 ? 21 LYS A HZ2  2  
ATOM 1647  H HZ3  . LYS A 1 21 ? -7.149  4.879   9.677   1.00 0.00 ? 21 LYS A HZ3  2  
ATOM 1648  N N    . THR A 1 22 ? -8.894  0.657   5.656   1.00 0.00 ? 22 THR A N    2  
ATOM 1649  C CA   . THR A 1 22 ? -10.352 0.670   5.639   1.00 0.00 ? 22 THR A CA   2  
ATOM 1650  C C    . THR A 1 22 ? -10.931 -0.596  4.991   1.00 0.00 ? 22 THR A C    2  
ATOM 1651  O O    . THR A 1 22 ? -11.875 -1.182  5.520   1.00 0.00 ? 22 THR A O    2  
ATOM 1652  C CB   . THR A 1 22 ? -10.815 1.925   4.888   1.00 0.00 ? 22 THR A CB   2  
ATOM 1653  O OG1  . THR A 1 22 ? -10.220 3.065   5.473   1.00 0.00 ? 22 THR A OG1  2  
ATOM 1654  C CG2  . THR A 1 22 ? -12.338 2.052   4.967   1.00 0.00 ? 22 THR A CG2  2  
ATOM 1655  H H    . THR A 1 22 ? -8.406  1.466   5.286   1.00 0.00 ? 22 THR A H    2  
ATOM 1656  H HA   . THR A 1 22 ? -10.710 0.725   6.670   1.00 0.00 ? 22 THR A HA   2  
ATOM 1657  H HB   . THR A 1 22 ? -10.509 1.856   3.841   1.00 0.00 ? 22 THR A HB   2  
ATOM 1658  H HG1  . THR A 1 22 ? -10.486 3.107   6.395   1.00 0.00 ? 22 THR A HG1  2  
ATOM 1659  H HG21 . THR A 1 22 ? -12.652 2.029   6.012   1.00 0.00 ? 22 THR A HG21 2  
ATOM 1660  H HG22 . THR A 1 22 ? -12.803 1.225   4.431   1.00 0.00 ? 22 THR A HG22 2  
ATOM 1661  H HG23 . THR A 1 22 ? -12.647 2.995   4.516   1.00 0.00 ? 22 THR A HG23 2  
ATOM 1662  N N    . ARG A 1 23 ? -10.387 -1.011  3.844   1.00 0.00 ? 23 ARG A N    2  
ATOM 1663  C CA   . ARG A 1 23 ? -10.919 -2.159  3.117   1.00 0.00 ? 23 ARG A CA   2  
ATOM 1664  C C    . ARG A 1 23 ? -10.568 -3.484  3.836   1.00 0.00 ? 23 ARG A C    2  
ATOM 1665  O O    . ARG A 1 23 ? -11.279 -4.477  3.681   1.00 0.00 ? 23 ARG A O    2  
ATOM 1666  C CB   . ARG A 1 23 ? -10.451 -2.079  1.646   1.00 0.00 ? 23 ARG A CB   2  
ATOM 1667  C CG   . ARG A 1 23 ? -9.282  -3.026  1.346   1.00 0.00 ? 23 ARG A CG   2  
ATOM 1668  C CD   . ARG A 1 23 ? -9.825  -4.416  1.004   1.00 0.00 ? 23 ARG A CD   2  
ATOM 1669  N NE   . ARG A 1 23 ? -9.347  -4.889  -0.305  1.00 0.00 ? 23 ARG A NE   2  
ATOM 1670  C CZ   . ARG A 1 23 ? -9.812  -4.421  -1.483  1.00 0.00 ? 23 ARG A CZ   2  
ATOM 1671  N NH1  . ARG A 1 23 ? -10.713 -3.433  -1.515  1.00 0.00 ? 23 ARG A NH1  2  
ATOM 1672  N NH2  . ARG A 1 23 ? -9.371  -4.945  -2.631  1.00 0.00 ? 23 ARG A NH2  2  
ATOM 1673  H H    . ARG A 1 23 ? -9.595  -0.517  3.454   1.00 0.00 ? 23 ARG A H    2  
ATOM 1674  H HA   . ARG A 1 23 ? -12.004 -2.070  3.116   1.00 0.00 ? 23 ARG A HA   2  
ATOM 1675  H HB2  . ARG A 1 23 ? -11.289 -2.329  1.000   1.00 0.00 ? 23 ARG A HB2  2  
ATOM 1676  H HB3  . ARG A 1 23 ? -10.141 -1.059  1.428   1.00 0.00 ? 23 ARG A HB3  2  
ATOM 1677  H HG2  . ARG A 1 23 ? -8.718  -2.639  0.498   1.00 0.00 ? 23 ARG A HG2  2  
ATOM 1678  H HG3  . ARG A 1 23 ? -8.624  -3.088  2.213   1.00 0.00 ? 23 ARG A HG3  2  
ATOM 1679  H HD2  . ARG A 1 23 ? -9.501  -5.116  1.771   1.00 0.00 ? 23 ARG A HD2  2  
ATOM 1680  H HD3  . ARG A 1 23 ? -10.912 -4.383  0.993   1.00 0.00 ? 23 ARG A HD3  2  
ATOM 1681  H HE   . ARG A 1 23 ? -8.632  -5.602  -0.307  1.00 0.00 ? 23 ARG A HE   2  
ATOM 1682  H HH11 . ARG A 1 23 ? -11.131 -3.106  -0.663  1.00 0.00 ? 23 ARG A HH11 2  
ATOM 1683  H HH12 . ARG A 1 23 ? -10.975 -3.009  -2.404  1.00 0.00 ? 23 ARG A HH12 2  
ATOM 1684  H HH21 . ARG A 1 23 ? -8.831  -5.797  -2.624  1.00 0.00 ? 23 ARG A HH21 2  
ATOM 1685  H HH22 . ARG A 1 23 ? -9.576  -4.480  -3.513  1.00 0.00 ? 23 ARG A HH22 2  
ATOM 1686  N N    . HIS A 1 24 ? -9.492  -3.487  4.639   1.00 0.00 ? 24 HIS A N    2  
ATOM 1687  C CA   . HIS A 1 24 ? -9.106  -4.651  5.445   1.00 0.00 ? 24 HIS A CA   2  
ATOM 1688  C C    . HIS A 1 24 ? -10.004 -4.711  6.679   1.00 0.00 ? 24 HIS A C    2  
ATOM 1689  O O    . HIS A 1 24 ? -10.426 -5.790  7.092   1.00 0.00 ? 24 HIS A O    2  
ATOM 1690  C CB   . HIS A 1 24 ? -7.618  -4.508  5.824   1.00 0.00 ? 24 HIS A CB   2  
ATOM 1691  C CG   . HIS A 1 24 ? -7.211  -5.274  7.053   1.00 0.00 ? 24 HIS A CG   2  
ATOM 1692  N ND1  . HIS A 1 24 ? -6.462  -6.444  7.007   1.00 0.00 ? 24 HIS A ND1  2  
ATOM 1693  C CD2  . HIS A 1 24 ? -7.395  -5.027  8.386   1.00 0.00 ? 24 HIS A CD2  2  
ATOM 1694  C CE1  . HIS A 1 24 ? -6.260  -6.826  8.286   1.00 0.00 ? 24 HIS A CE1  2  
ATOM 1695  N NE2  . HIS A 1 24 ? -6.803  -5.999  9.179   1.00 0.00 ? 24 HIS A NE2  2  
ATOM 1696  H H    . HIS A 1 24 ? -8.925  -2.651  4.714   1.00 0.00 ? 24 HIS A H    2  
ATOM 1697  H HA   . HIS A 1 24 ? -9.247  -5.569  4.865   1.00 0.00 ? 24 HIS A HA   2  
ATOM 1698  H HB2  . HIS A 1 24 ? -7.011  -4.841  4.983   1.00 0.00 ? 24 HIS A HB2  2  
ATOM 1699  H HB3  . HIS A 1 24 ? -7.410  -3.459  6.008   1.00 0.00 ? 24 HIS A HB3  2  
ATOM 1700  H HD1  . HIS A 1 24 ? -6.130  -6.918  6.178   1.00 0.00 ? 24 HIS A HD1  2  
ATOM 1701  H HD2  . HIS A 1 24 ? -7.920  -4.172  8.769   1.00 0.00 ? 24 HIS A HD2  2  
ATOM 1702  H HE1  . HIS A 1 24 ? -5.704  -7.710  8.560   1.00 0.00 ? 24 HIS A HE1  2  
ATOM 1703  N N    . GLN A 1 25 ? -10.302 -3.539  7.255   1.00 0.00 ? 25 GLN A N    2  
ATOM 1704  C CA   . GLN A 1 25 ? -11.172 -3.428  8.413   1.00 0.00 ? 25 GLN A CA   2  
ATOM 1705  C C    . GLN A 1 25 ? -12.566 -3.938  8.052   1.00 0.00 ? 25 GLN A C    2  
ATOM 1706  O O    . GLN A 1 25 ? -13.202 -4.622  8.850   1.00 0.00 ? 25 GLN A O    2  
ATOM 1707  C CB   . GLN A 1 25 ? -11.228 -1.960  8.851   1.00 0.00 ? 25 GLN A CB   2  
ATOM 1708  C CG   . GLN A 1 25 ? -9.939  -1.587  9.592   1.00 0.00 ? 25 GLN A CG   2  
ATOM 1709  C CD   . GLN A 1 25 ? -9.886  -0.088  9.882   1.00 0.00 ? 25 GLN A CD   2  
ATOM 1710  O OE1  . GLN A 1 25 ? -10.716 0.677   9.395   1.00 0.00 ? 25 GLN A OE1  2  
ATOM 1711  N NE2  . GLN A 1 25 ? -8.903  0.335   10.674  1.00 0.00 ? 25 GLN A NE2  2  
ATOM 1712  H H    . GLN A 1 25 ? -9.915  -2.690  6.871   1.00 0.00 ? 25 GLN A H    2  
ATOM 1713  H HA   . GLN A 1 25 ? -10.769 -4.031  9.227   1.00 0.00 ? 25 GLN A HA   2  
ATOM 1714  H HB2  . GLN A 1 25 ? -11.339 -1.326  7.973   1.00 0.00 ? 25 GLN A HB2  2  
ATOM 1715  H HB3  . GLN A 1 25 ? -12.080 -1.809  9.512   1.00 0.00 ? 25 GLN A HB3  2  
ATOM 1716  H HG2  . GLN A 1 25 ? -9.896  -2.135  10.534  1.00 0.00 ? 25 GLN A HG2  2  
ATOM 1717  H HG3  . GLN A 1 25 ? -9.081  -1.862  8.983   1.00 0.00 ? 25 GLN A HG3  2  
ATOM 1718  H HE21 . GLN A 1 25 ? -8.217  -0.324  11.024  1.00 0.00 ? 25 GLN A HE21 2  
ATOM 1719  H HE22 . GLN A 1 25 ? -8.845  1.308   10.924  1.00 0.00 ? 25 GLN A HE22 2  
ATOM 1720  N N    . ARG A 1 26 ? -13.031 -3.603  6.838   1.00 0.00 ? 26 ARG A N    2  
ATOM 1721  C CA   . ARG A 1 26 ? -14.332 -4.039  6.351   1.00 0.00 ? 26 ARG A CA   2  
ATOM 1722  C C    . ARG A 1 26 ? -14.466 -5.555  6.479   1.00 0.00 ? 26 ARG A C    2  
ATOM 1723  O O    . ARG A 1 26 ? -15.424 -6.045  7.073   1.00 0.00 ? 26 ARG A O    2  
ATOM 1724  C CB   . ARG A 1 26 ? -14.486 -3.632  4.883   1.00 0.00 ? 26 ARG A CB   2  
ATOM 1725  C CG   . ARG A 1 26 ? -15.131 -2.246  4.778   1.00 0.00 ? 26 ARG A CG   2  
ATOM 1726  C CD   . ARG A 1 26 ? -15.015 -1.731  3.336   1.00 0.00 ? 26 ARG A CD   2  
ATOM 1727  N NE   . ARG A 1 26 ? -15.084 -2.838  2.365   1.00 0.00 ? 26 ARG A NE   2  
ATOM 1728  C CZ   . ARG A 1 26 ? -16.228 -3.467  2.035   1.00 0.00 ? 26 ARG A CZ   2  
ATOM 1729  N NH1  . ARG A 1 26 ? -17.411 -2.979  2.437   1.00 0.00 ? 26 ARG A NH1  2  
ATOM 1730  N NH2  . ARG A 1 26 ? -16.184 -4.589  1.307   1.00 0.00 ? 26 ARG A NH2  2  
ATOM 1731  H H    . ARG A 1 26 ? -12.462 -3.027  6.230   1.00 0.00 ? 26 ARG A H    2  
ATOM 1732  H HA   . ARG A 1 26 ? -15.116 -3.562  6.941   1.00 0.00 ? 26 ARG A HA   2  
ATOM 1733  H HB2  . ARG A 1 26 ? -13.506 -3.613  4.409   1.00 0.00 ? 26 ARG A HB2  2  
ATOM 1734  H HB3  . ARG A 1 26 ? -15.118 -4.361  4.376   1.00 0.00 ? 26 ARG A HB3  2  
ATOM 1735  H HG2  . ARG A 1 26 ? -16.183 -2.315  5.057   1.00 0.00 ? 26 ARG A HG2  2  
ATOM 1736  H HG3  . ARG A 1 26 ? -14.624 -1.555  5.452   1.00 0.00 ? 26 ARG A HG3  2  
ATOM 1737  H HD2  . ARG A 1 26 ? -15.818 -1.022  3.141   1.00 0.00 ? 26 ARG A HD2  2  
ATOM 1738  H HD3  . ARG A 1 26 ? -14.060 -1.220  3.220   1.00 0.00 ? 26 ARG A HD3  2  
ATOM 1739  H HE   . ARG A 1 26 ? -14.219 -3.135  1.934   1.00 0.00 ? 26 ARG A HE   2  
ATOM 1740  H HH11 . ARG A 1 26 ? -17.446 -2.147  3.005   1.00 0.00 ? 26 ARG A HH11 2  
ATOM 1741  H HH12 . ARG A 1 26 ? -18.267 -3.445  2.173   1.00 0.00 ? 26 ARG A HH12 2  
ATOM 1742  H HH21 . ARG A 1 26 ? -15.287 -5.032  1.107   1.00 0.00 ? 26 ARG A HH21 2  
ATOM 1743  H HH22 . ARG A 1 26 ? -17.035 -4.999  0.956   1.00 0.00 ? 26 ARG A HH22 2  
ATOM 1744  N N    . GLY A 1 27 ? -13.504 -6.296  5.911   1.00 0.00 ? 27 GLY A N    2  
ATOM 1745  C CA   . GLY A 1 27 ? -13.535 -7.750  5.948   1.00 0.00 ? 27 GLY A CA   2  
ATOM 1746  C C    . GLY A 1 27 ? -12.641 -8.348  4.861   1.00 0.00 ? 27 GLY A C    2  
ATOM 1747  O O    . GLY A 1 27 ? -12.216 -9.496  4.978   1.00 0.00 ? 27 GLY A O    2  
ATOM 1748  H H    . GLY A 1 27 ? -12.734 -5.841  5.442   1.00 0.00 ? 27 GLY A H    2  
ATOM 1749  H HA2  . GLY A 1 27 ? -13.186 -8.089  6.924   1.00 0.00 ? 27 GLY A HA2  2  
ATOM 1750  H HA3  . GLY A 1 27 ? -14.559 -8.093  5.794   1.00 0.00 ? 27 GLY A HA3  2  
ATOM 1751  N N    . ASP A 1 28 ? -12.352 -7.578  3.799   1.00 0.00 ? 28 ASP A N    2  
ATOM 1752  C CA   . ASP A 1 28 ? -11.518 -8.053  2.698   1.00 0.00 ? 28 ASP A CA   2  
ATOM 1753  C C    . ASP A 1 28 ? -10.031 -7.911  3.065   1.00 0.00 ? 28 ASP A C    2  
ATOM 1754  O O    . ASP A 1 28 ? -9.229  -7.430  2.267   1.00 0.00 ? 28 ASP A O    2  
ATOM 1755  C CB   . ASP A 1 28 ? -11.852 -7.253  1.436   1.00 0.00 ? 28 ASP A CB   2  
ATOM 1756  C CG   . ASP A 1 28 ? -13.357 -7.182  1.198   1.00 0.00 ? 28 ASP A CG   2  
ATOM 1757  O OD1  . ASP A 1 28 ? -13.948 -8.255  0.960   1.00 0.00 ? 28 ASP A OD1  2  
ATOM 1758  O OD2  . ASP A 1 28 ? -13.888 -6.048  1.259   1.00 0.00 ? 28 ASP A OD2  2  
ATOM 1759  H H    . ASP A 1 28 ? -12.721 -6.640  3.747   1.00 0.00 ? 28 ASP A H    2  
ATOM 1760  H HA   . ASP A 1 28 ? -11.739 -9.106  2.515   1.00 0.00 ? 28 ASP A HA   2  
ATOM 1761  H HB2  . ASP A 1 28 ? -11.472 -6.250  1.551   1.00 0.00 ? 28 ASP A HB2  2  
ATOM 1762  H HB3  . ASP A 1 28 ? -11.374 -7.722  0.575   1.00 0.00 ? 28 ASP A HB3  2  
ATOM 1763  N N    . THR A 1 29 ? -9.679  -8.342  4.282   1.00 0.00 ? 29 THR A N    2  
ATOM 1764  C CA   . THR A 1 29 ? -8.309  -8.266  4.808   1.00 0.00 ? 29 THR A CA   2  
ATOM 1765  C C    . THR A 1 29 ? -7.349  -9.177  4.008   1.00 0.00 ? 29 THR A C    2  
ATOM 1766  O O    . THR A 1 29 ? -6.143  -9.166  4.256   1.00 0.00 ? 29 THR A O    2  
ATOM 1767  C CB   . THR A 1 29 ? -8.330  -8.643  6.312   1.00 0.00 ? 29 THR A CB   2  
ATOM 1768  O OG1  . THR A 1 29 ? -7.083  -9.178  6.711   1.00 0.00 ? 29 THR A OG1  2  
ATOM 1769  C CG2  . THR A 1 29 ? -9.426  -9.662  6.599   1.00 0.00 ? 29 THR A CG2  2  
ATOM 1770  H H    . THR A 1 29 ? -10.388 -8.739  4.878   1.00 0.00 ? 29 THR A H    2  
ATOM 1771  H HA   . THR A 1 29 ? -7.956  -7.236  4.724   1.00 0.00 ? 29 THR A HA   2  
ATOM 1772  H HB   . THR A 1 29 ? -8.536  -7.749  6.897   1.00 0.00 ? 29 THR A HB   2  
ATOM 1773  H HG1  . THR A 1 29 ? -6.873  -9.927  6.146   1.00 0.00 ? 29 THR A HG1  2  
ATOM 1774  H HG21 . THR A 1 29 ? -9.223  -10.155 7.549   1.00 0.00 ? 29 THR A HG21 2  
ATOM 1775  H HG22 . THR A 1 29 ? -10.383 -9.145  6.660   1.00 0.00 ? 29 THR A HG22 2  
ATOM 1776  H HG23 . THR A 1 29 ? -9.458  -10.405 5.803   1.00 0.00 ? 29 THR A HG23 2  
ATOM 1777  N N    . HIS A 1 30 ? -7.879  -9.962  3.059   1.00 0.00 ? 30 HIS A N    2  
ATOM 1778  C CA   . HIS A 1 30 ? -7.070  -10.875 2.255   1.00 0.00 ? 30 HIS A CA   2  
ATOM 1779  C C    . HIS A 1 30 ? -5.913  -10.123 1.556   1.00 0.00 ? 30 HIS A C    2  
ATOM 1780  O O    . HIS A 1 30 ? -6.026  -8.925  1.290   1.00 0.00 ? 30 HIS A O    2  
ATOM 1781  C CB   . HIS A 1 30 ? -7.977  -11.554 1.219   1.00 0.00 ? 30 HIS A CB   2  
ATOM 1782  C CG   . HIS A 1 30 ? -8.225  -10.696 0.003   1.00 0.00 ? 30 HIS A CG   2  
ATOM 1783  N ND1  . HIS A 1 30 ? -8.564  -9.348  0.082   1.00 0.00 ? 30 HIS A ND1  2  
ATOM 1784  C CD2  . HIS A 1 30 ? -8.178  -10.966 -1.342  1.00 0.00 ? 30 HIS A CD2  2  
ATOM 1785  C CE1  . HIS A 1 30 ? -8.696  -8.907  -1.183  1.00 0.00 ? 30 HIS A CE1  2  
ATOM 1786  N NE2  . HIS A 1 30 ? -8.476  -9.848  -2.101  1.00 0.00 ? 30 HIS A NE2  2  
ATOM 1787  H H    . HIS A 1 30 ? -8.871  -9.934  2.887   1.00 0.00 ? 30 HIS A H    2  
ATOM 1788  H HA   . HIS A 1 30 ? -6.659  -11.635 2.914   1.00 0.00 ? 30 HIS A HA   2  
ATOM 1789  H HB2  . HIS A 1 30 ? -7.509  -12.484 0.899   1.00 0.00 ? 30 HIS A HB2  2  
ATOM 1790  H HB3  . HIS A 1 30 ? -8.934  -11.788 1.686   1.00 0.00 ? 30 HIS A HB3  2  
ATOM 1791  H HD1  . HIS A 1 30 ? -8.684  -8.803  0.927   1.00 0.00 ? 30 HIS A HD1  2  
ATOM 1792  H HD2  . HIS A 1 30 ? -7.932  -11.930 -1.759  1.00 0.00 ? 30 HIS A HD2  2  
ATOM 1793  H HE1  . HIS A 1 30 ? -8.946  -7.889  -1.431  1.00 0.00 ? 30 HIS A HE1  2  
ATOM 1794  N N    . PRO A 1 31 ? -4.799  -10.831 1.250   1.00 0.00 ? 31 PRO A N    2  
ATOM 1795  C CA   . PRO A 1 31 ? -3.662  -10.248 0.556   1.00 0.00 ? 31 PRO A CA   2  
ATOM 1796  C C    . PRO A 1 31 ? -4.069  -9.722  -0.822  1.00 0.00 ? 31 PRO A C    2  
ATOM 1797  O O    . PRO A 1 31 ? -5.023  -10.221 -1.416  1.00 0.00 ? 31 PRO A O    2  
ATOM 1798  C CB   . PRO A 1 31 ? -2.632  -11.375 0.419   1.00 0.00 ? 31 PRO A CB   2  
ATOM 1799  C CG   . PRO A 1 31 ? -3.206  -12.599 1.139   1.00 0.00 ? 31 PRO A CG   2  
ATOM 1800  C CD   . PRO A 1 31 ? -4.622  -12.233 1.578   1.00 0.00 ? 31 PRO A CD   2  
ATOM 1801  H HA   . PRO A 1 31 ? -3.246  -9.436  1.152   1.00 0.00 ? 31 PRO A HA   2  
ATOM 1802  H HB2  . PRO A 1 31 ? -2.479  -11.610 -0.633  1.00 0.00 ? 31 PRO A HB2  2  
ATOM 1803  H HB3  . PRO A 1 31 ? -1.687  -11.080 0.875   1.00 0.00 ? 31 PRO A HB3  2  
ATOM 1804  H HG2  . PRO A 1 31 ? -3.233  -13.453 0.461   1.00 0.00 ? 31 PRO A HG2  2  
ATOM 1805  H HG3  . PRO A 1 31 ? -2.597  -12.836 2.012   1.00 0.00 ? 31 PRO A HG3  2  
ATOM 1806  H HD2  . PRO A 1 31 ? -5.347  -12.840 1.039   1.00 0.00 ? 31 PRO A HD2  2  
ATOM 1807  H HD3  . PRO A 1 31 ? -4.726  -12.386 2.653   1.00 0.00 ? 31 PRO A HD3  2  
ATOM 1808  N N    . LEU A 1 32 ? -3.330  -8.719  -1.327  1.00 0.00 ? 32 LEU A N    2  
ATOM 1809  C CA   . LEU A 1 32 ? -3.588  -8.139  -2.642  1.00 0.00 ? 32 LEU A CA   2  
ATOM 1810  C C    . LEU A 1 32 ? -2.287  -8.031  -3.430  1.00 0.00 ? 32 LEU A C    2  
ATOM 1811  O O    . LEU A 1 32 ? -1.242  -7.711  -2.866  1.00 0.00 ? 32 LEU A O    2  
ATOM 1812  C CB   . LEU A 1 32 ? -4.163  -6.728  -2.491  1.00 0.00 ? 32 LEU A CB   2  
ATOM 1813  C CG   . LEU A 1 32 ? -5.650  -6.750  -2.140  1.00 0.00 ? 32 LEU A CG   2  
ATOM 1814  C CD1  . LEU A 1 32 ? -6.166  -5.316  -2.193  1.00 0.00 ? 32 LEU A CD1  2  
ATOM 1815  C CD2  . LEU A 1 32 ? -6.429  -7.596  -3.150  1.00 0.00 ? 32 LEU A CD2  2  
ATOM 1816  H H    . LEU A 1 32 ? -2.559  -8.346  -0.787  1.00 0.00 ? 32 LEU A H    2  
ATOM 1817  H HA   . LEU A 1 32 ? -4.292  -8.768  -3.189  1.00 0.00 ? 32 LEU A HA   2  
ATOM 1818  H HB2  . LEU A 1 32 ? -3.617  -6.201  -1.707  1.00 0.00 ? 32 LEU A HB2  2  
ATOM 1819  H HB3  . LEU A 1 32 ? -4.034  -6.193  -3.432  1.00 0.00 ? 32 LEU A HB3  2  
ATOM 1820  H HG   . LEU A 1 32 ? -5.786  -7.154  -1.136  1.00 0.00 ? 32 LEU A HG   2  
ATOM 1821  H HD11 . LEU A 1 32 ? -6.319  -5.023  -3.238  1.00 0.00 ? 32 LEU A HD11 2  
ATOM 1822  H HD12 . LEU A 1 32 ? -7.104  -5.250  -1.654  1.00 0.00 ? 32 LEU A HD12 2  
ATOM 1823  H HD13 . LEU A 1 32 ? -5.438  -4.649  -1.733  1.00 0.00 ? 32 LEU A HD13 2  
ATOM 1824  H HD21 . LEU A 1 32 ? -6.014  -7.448  -4.142  1.00 0.00 ? 32 LEU A HD21 2  
ATOM 1825  H HD22 . LEU A 1 32 ? -6.360  -8.646  -2.880  1.00 0.00 ? 32 LEU A HD22 2  
ATOM 1826  H HD23 . LEU A 1 32 ? -7.475  -7.293  -3.148  1.00 0.00 ? 32 LEU A HD23 2  
ATOM 1827  N N    . THR A 1 33 ? -2.357  -8.270  -4.740  1.00 0.00 ? 33 THR A N    2  
ATOM 1828  C CA   . THR A 1 33 ? -1.210  -8.099  -5.618  1.00 0.00 ? 33 THR A CA   2  
ATOM 1829  C C    . THR A 1 33 ? -0.939  -6.599  -5.780  1.00 0.00 ? 33 THR A C    2  
ATOM 1830  O O    . THR A 1 33 ? -1.737  -5.767  -5.340  1.00 0.00 ? 33 THR A O    2  
ATOM 1831  C CB   . THR A 1 33 ? -1.507  -8.724  -6.994  1.00 0.00 ? 33 THR A CB   2  
ATOM 1832  O OG1  . THR A 1 33 ? -2.644  -8.105  -7.551  1.00 0.00 ? 33 THR A OG1  2  
ATOM 1833  C CG2  . THR A 1 33 ? -1.763  -10.228 -6.863  1.00 0.00 ? 33 THR A CG2  2  
ATOM 1834  H H    . THR A 1 33 ? -3.237  -8.562  -5.148  1.00 0.00 ? 33 THR A H    2  
ATOM 1835  H HA   . THR A 1 33 ? -0.334  -8.586  -5.175  1.00 0.00 ? 33 THR A HA   2  
ATOM 1836  H HB   . THR A 1 33 ? -0.654  -8.563  -7.654  1.00 0.00 ? 33 THR A HB   2  
ATOM 1837  H HG1  . THR A 1 33 ? -3.423  -8.387  -7.054  1.00 0.00 ? 33 THR A HG1  2  
ATOM 1838  H HG21 . THR A 1 33 ? -2.233  -10.596 -7.775  1.00 0.00 ? 33 THR A HG21 2  
ATOM 1839  H HG22 . THR A 1 33 ? -0.818  -10.742 -6.715  1.00 0.00 ? 33 THR A HG22 2  
ATOM 1840  H HG23 . THR A 1 33 ? -2.418  -10.422 -6.016  1.00 0.00 ? 33 THR A HG23 2  
ATOM 1841  N N    . LEU A 1 34 ? 0.178   -6.250  -6.424  1.00 0.00 ? 34 LEU A N    2  
ATOM 1842  C CA   . LEU A 1 34 ? 0.515   -4.855  -6.668  1.00 0.00 ? 34 LEU A CA   2  
ATOM 1843  C C    . LEU A 1 34 ? -0.577  -4.231  -7.553  1.00 0.00 ? 34 LEU A C    2  
ATOM 1844  O O    . LEU A 1 34 ? -1.092  -3.157  -7.248  1.00 0.00 ? 34 LEU A O    2  
ATOM 1845  C CB   . LEU A 1 34 ? 1.901   -4.788  -7.350  1.00 0.00 ? 34 LEU A CB   2  
ATOM 1846  C CG   . LEU A 1 34 ? 2.665   -3.495  -6.982  1.00 0.00 ? 34 LEU A CG   2  
ATOM 1847  C CD1  . LEU A 1 34 ? 1.767   -2.269  -7.141  1.00 0.00 ? 34 LEU A CD1  2  
ATOM 1848  C CD2  . LEU A 1 34 ? 3.185   -3.569  -5.543  1.00 0.00 ? 34 LEU A CD2  2  
ATOM 1849  H H    . LEU A 1 34 ? 0.808   -6.963  -6.759  1.00 0.00 ? 34 LEU A H    2  
ATOM 1850  H HA   . LEU A 1 34 ? 0.550   -4.329  -5.718  1.00 0.00 ? 34 LEU A HA   2  
ATOM 1851  H HB2  . LEU A 1 34 ? 2.494   -5.648  -7.035  1.00 0.00 ? 34 LEU A HB2  2  
ATOM 1852  H HB3  . LEU A 1 34 ? 1.770   -4.827  -8.432  1.00 0.00 ? 34 LEU A HB3  2  
ATOM 1853  H HG   . LEU A 1 34 ? 3.516   -3.391  -7.654  1.00 0.00 ? 34 LEU A HG   2  
ATOM 1854  H HD11 . LEU A 1 34 ? 1.040   -2.237  -6.332  1.00 0.00 ? 34 LEU A HD11 2  
ATOM 1855  H HD12 . LEU A 1 34 ? 1.251   -2.322  -8.097  1.00 0.00 ? 34 LEU A HD12 2  
ATOM 1856  H HD13 . LEU A 1 34 ? 2.379   -1.368  -7.110  1.00 0.00 ? 34 LEU A HD13 2  
ATOM 1857  H HD21 . LEU A 1 34 ? 3.714   -2.648  -5.301  1.00 0.00 ? 34 LEU A HD21 2  
ATOM 1858  H HD22 . LEU A 1 34 ? 3.868   -4.411  -5.448  1.00 0.00 ? 34 LEU A HD22 2  
ATOM 1859  H HD23 . LEU A 1 34 ? 2.354   -3.698  -4.852  1.00 0.00 ? 34 LEU A HD23 2  
ATOM 1860  N N    . ASP A 1 35 ? -0.922  -4.919  -8.647  1.00 0.00 ? 35 ASP A N    2  
ATOM 1861  C CA   . ASP A 1 35 ? -1.930  -4.451  -9.592  1.00 0.00 ? 35 ASP A CA   2  
ATOM 1862  C C    . ASP A 1 35 ? -3.249  -4.136  -8.877  1.00 0.00 ? 35 ASP A C    2  
ATOM 1863  O O    . ASP A 1 35 ? -3.794  -3.044  -9.038  1.00 0.00 ? 35 ASP A O    2  
ATOM 1864  C CB   . ASP A 1 35 ? -2.142  -5.526  -10.663 1.00 0.00 ? 35 ASP A CB   2  
ATOM 1865  C CG   . ASP A 1 35 ? -0.826  -5.894  -11.338 1.00 0.00 ? 35 ASP A CG   2  
ATOM 1866  O OD1  . ASP A 1 35 ? -0.030  -6.605  -10.680 1.00 0.00 ? 35 ASP A OD1  2  
ATOM 1867  O OD2  . ASP A 1 35 ? -0.636  -5.459  -12.494 1.00 0.00 ? 35 ASP A OD2  2  
ATOM 1868  H H    . ASP A 1 35 ? -0.468  -5.803  -8.843  1.00 0.00 ? 35 ASP A H    2  
ATOM 1869  H HA   . ASP A 1 35 ? -1.565  -3.543  -10.073 1.00 0.00 ? 35 ASP A HA   2  
ATOM 1870  H HB2  . ASP A 1 35 ? -2.566  -6.417  -10.200 1.00 0.00 ? 35 ASP A HB2  2  
ATOM 1871  H HB3  . ASP A 1 35 ? -2.838  -5.149  -11.415 1.00 0.00 ? 35 ASP A HB3  2  
ATOM 1872  N N    . GLU A 1 36 ? -3.761  -5.098  -8.091  1.00 0.00 ? 36 GLU A N    2  
ATOM 1873  C CA   . GLU A 1 36 ? -5.020  -4.932  -7.366  1.00 0.00 ? 36 GLU A CA   2  
ATOM 1874  C C    . GLU A 1 36 ? -5.012  -3.640  -6.553  1.00 0.00 ? 36 GLU A C    2  
ATOM 1875  O O    . GLU A 1 36 ? -6.008  -2.920  -6.526  1.00 0.00 ? 36 GLU A O    2  
ATOM 1876  C CB   . GLU A 1 36 ? -5.246  -6.144  -6.461  1.00 0.00 ? 36 GLU A CB   2  
ATOM 1877  C CG   . GLU A 1 36 ? -5.737  -7.327  -7.305  1.00 0.00 ? 36 GLU A CG   2  
ATOM 1878  C CD   . GLU A 1 36 ? -5.782  -8.608  -6.482  1.00 0.00 ? 36 GLU A CD   2  
ATOM 1879  O OE1  . GLU A 1 36 ? -4.697  -9.023  -6.020  1.00 0.00 ? 36 GLU A OE1  2  
ATOM 1880  O OE2  . GLU A 1 36 ? -6.898  -9.148  -6.331  1.00 0.00 ? 36 GLU A OE2  2  
ATOM 1881  H H    . GLU A 1 36 ? -3.266  -5.976  -7.993  1.00 0.00 ? 36 GLU A H    2  
ATOM 1882  H HA   . GLU A 1 36 ? -5.837  -4.881  -8.080  1.00 0.00 ? 36 GLU A HA   2  
ATOM 1883  H HB2  . GLU A 1 36 ? -4.311  -6.409  -5.966  1.00 0.00 ? 36 GLU A HB2  2  
ATOM 1884  H HB3  . GLU A 1 36 ? -5.997  -5.899  -5.710  1.00 0.00 ? 36 GLU A HB3  2  
ATOM 1885  H HG2  . GLU A 1 36 ? -6.738  -7.107  -7.679  1.00 0.00 ? 36 GLU A HG2  2  
ATOM 1886  H HG3  . GLU A 1 36 ? -5.065  -7.470  -8.150  1.00 0.00 ? 36 GLU A HG3  2  
ATOM 1887  N N    . ILE A 1 37 ? -3.891  -3.342  -5.892  1.00 0.00 ? 37 ILE A N    2  
ATOM 1888  C CA   . ILE A 1 37 ? -3.780  -2.136  -5.093  1.00 0.00 ? 37 ILE A CA   2  
ATOM 1889  C C    . ILE A 1 37 ? -3.883  -0.904  -5.995  1.00 0.00 ? 37 ILE A C    2  
ATOM 1890  O O    . ILE A 1 37 ? -4.757  -0.072  -5.782  1.00 0.00 ? 37 ILE A O    2  
ATOM 1891  C CB   . ILE A 1 37 ? -2.454  -2.158  -4.312  1.00 0.00 ? 37 ILE A CB   2  
ATOM 1892  C CG1  . ILE A 1 37 ? -2.545  -3.209  -3.196  1.00 0.00 ? 37 ILE A CG1  2  
ATOM 1893  C CG2  . ILE A 1 37 ? -2.185  -0.777  -3.699  1.00 0.00 ? 37 ILE A CG2  2  
ATOM 1894  C CD1  . ILE A 1 37 ? -1.148  -3.562  -2.681  1.00 0.00 ? 37 ILE A CD1  2  
ATOM 1895  H H    . ILE A 1 37 ? -3.095  -3.965  -5.943  1.00 0.00 ? 37 ILE A H    2  
ATOM 1896  H HA   . ILE A 1 37 ? -4.608  -2.109  -4.378  1.00 0.00 ? 37 ILE A HA   2  
ATOM 1897  H HB   . ILE A 1 37 ? -1.640  -2.415  -4.987  1.00 0.00 ? 37 ILE A HB   2  
ATOM 1898  H HG12 . ILE A 1 37 ? -3.145  -2.818  -2.375  1.00 0.00 ? 37 ILE A HG12 2  
ATOM 1899  H HG13 . ILE A 1 37 ? -3.017  -4.110  -3.587  1.00 0.00 ? 37 ILE A HG13 2  
ATOM 1900  H HG21 . ILE A 1 37 ? -2.032  -0.046  -4.492  1.00 0.00 ? 37 ILE A HG21 2  
ATOM 1901  H HG22 . ILE A 1 37 ? -1.292  -0.822  -3.080  1.00 0.00 ? 37 ILE A HG22 2  
ATOM 1902  H HG23 . ILE A 1 37 ? -3.036  -0.479  -3.088  1.00 0.00 ? 37 ILE A HG23 2  
ATOM 1903  H HD11 . ILE A 1 37 ? -0.519  -3.877  -3.514  1.00 0.00 ? 37 ILE A HD11 2  
ATOM 1904  H HD12 . ILE A 1 37 ? -0.703  -2.694  -2.198  1.00 0.00 ? 37 ILE A HD12 2  
ATOM 1905  H HD13 . ILE A 1 37 ? -1.226  -4.375  -1.959  1.00 0.00 ? 37 ILE A HD13 2  
ATOM 1906  N N    . LEU A 1 38 ? -2.992  -0.788  -6.996  1.00 0.00 ? 38 LEU A N    2  
ATOM 1907  C CA   . LEU A 1 38 ? -2.967  0.375   -7.892  1.00 0.00 ? 38 LEU A CA   2  
ATOM 1908  C C    . LEU A 1 38 ? -4.348  0.649   -8.491  1.00 0.00 ? 38 LEU A C    2  
ATOM 1909  O O    . LEU A 1 38 ? -4.740  1.805   -8.626  1.00 0.00 ? 38 LEU A O    2  
ATOM 1910  C CB   . LEU A 1 38 ? -1.964  0.155   -9.029  1.00 0.00 ? 38 LEU A CB   2  
ATOM 1911  C CG   . LEU A 1 38 ? -0.534  -0.017  -8.503  1.00 0.00 ? 38 LEU A CG   2  
ATOM 1912  C CD1  . LEU A 1 38 ? 0.394   -0.232  -9.698  1.00 0.00 ? 38 LEU A CD1  2  
ATOM 1913  C CD2  . LEU A 1 38 ? -0.075  1.227   -7.730  1.00 0.00 ? 38 LEU A CD2  2  
ATOM 1914  H H    . LEU A 1 38 ? -2.304  -1.518  -7.139  1.00 0.00 ? 38 LEU A H    2  
ATOM 1915  H HA   . LEU A 1 38 ? -2.664  1.248   -7.324  1.00 0.00 ? 38 LEU A HA   2  
ATOM 1916  H HB2  . LEU A 1 38 ? -2.249  -0.739  -9.587  1.00 0.00 ? 38 LEU A HB2  2  
ATOM 1917  H HB3  . LEU A 1 38 ? -1.995  1.013   -9.694  1.00 0.00 ? 38 LEU A HB3  2  
ATOM 1918  H HG   . LEU A 1 38 ? -0.490  -0.882  -7.852  1.00 0.00 ? 38 LEU A HG   2  
ATOM 1919  H HD11 . LEU A 1 38 ? 1.408   -0.404  -9.345  1.00 0.00 ? 38 LEU A HD11 2  
ATOM 1920  H HD12 . LEU A 1 38 ? 0.375   0.657   -10.337 1.00 0.00 ? 38 LEU A HD12 2  
ATOM 1921  H HD13 . LEU A 1 38 ? 0.058   -1.096  -10.270 1.00 0.00 ? 38 LEU A HD13 2  
ATOM 1922  H HD21 . LEU A 1 38 ? 0.989   1.136   -7.494  1.00 0.00 ? 38 LEU A HD21 2  
ATOM 1923  H HD22 . LEU A 1 38 ? -0.232  2.117   -8.341  1.00 0.00 ? 38 LEU A HD22 2  
ATOM 1924  H HD23 . LEU A 1 38 ? -0.639  1.316   -6.803  1.00 0.00 ? 38 LEU A HD23 2  
ATOM 1925  N N    . ASP A 1 39 ? -5.078  -0.408  -8.863  1.00 0.00 ? 39 ASP A N    2  
ATOM 1926  C CA   . ASP A 1 39 ? -6.389  -0.259  -9.477  1.00 0.00 ? 39 ASP A CA   2  
ATOM 1927  C C    . ASP A 1 39 ? -7.311  0.576   -8.588  1.00 0.00 ? 39 ASP A C    2  
ATOM 1928  O O    . ASP A 1 39 ? -7.898  1.555   -9.049  1.00 0.00 ? 39 ASP A O    2  
ATOM 1929  C CB   . ASP A 1 39 ? -6.988  -1.644  -9.731  1.00 0.00 ? 39 ASP A CB   2  
ATOM 1930  C CG   . ASP A 1 39 ? -8.338  -1.530  -10.430 1.00 0.00 ? 39 ASP A CG   2  
ATOM 1931  O OD1  . ASP A 1 39 ? -8.322  -1.348  -11.667 1.00 0.00 ? 39 ASP A OD1  2  
ATOM 1932  O OD2  . ASP A 1 39 ? -9.358  -1.625  -9.715  1.00 0.00 ? 39 ASP A OD2  2  
ATOM 1933  H H    . ASP A 1 39 ? -4.714  -1.344  -8.725  1.00 0.00 ? 39 ASP A H    2  
ATOM 1934  H HA   . ASP A 1 39 ? -6.271  0.251   -10.431 1.00 0.00 ? 39 ASP A HA   2  
ATOM 1935  H HB2  . ASP A 1 39 ? -6.308  -2.219  -10.359 1.00 0.00 ? 39 ASP A HB2  2  
ATOM 1936  H HB3  . ASP A 1 39 ? -7.120  -2.161  -8.781  1.00 0.00 ? 39 ASP A HB3  2  
ATOM 1937  N N    . GLU A 1 40 ? -7.441  0.187   -7.319  1.00 0.00 ? 40 GLU A N    2  
ATOM 1938  C CA   . GLU A 1 40 ? -8.312  0.880   -6.383  1.00 0.00 ? 40 GLU A CA   2  
ATOM 1939  C C    . GLU A 1 40 ? -7.684  2.206   -5.926  1.00 0.00 ? 40 GLU A C    2  
ATOM 1940  O O    . GLU A 1 40 ? -8.395  3.198   -5.755  1.00 0.00 ? 40 GLU A O    2  
ATOM 1941  C CB   . GLU A 1 40 ? -8.602  -0.054  -5.201  1.00 0.00 ? 40 GLU A CB   2  
ATOM 1942  C CG   . GLU A 1 40 ? -9.741  -1.008  -5.592  1.00 0.00 ? 40 GLU A CG   2  
ATOM 1943  C CD   . GLU A 1 40 ? -9.999  -2.051  -4.512  1.00 0.00 ? 40 GLU A CD   2  
ATOM 1944  O OE1  . GLU A 1 40 ? -9.192  -2.999  -4.434  1.00 0.00 ? 40 GLU A OE1  2  
ATOM 1945  O OE2  . GLU A 1 40 ? -10.998 -1.885  -3.779  1.00 0.00 ? 40 GLU A OE2  2  
ATOM 1946  H H    . GLU A 1 40 ? -6.925  -0.619  -6.990  1.00 0.00 ? 40 GLU A H    2  
ATOM 1947  H HA   . GLU A 1 40 ? -9.254  1.103   -6.885  1.00 0.00 ? 40 GLU A HA   2  
ATOM 1948  H HB2  . GLU A 1 40 ? -7.708  -0.630  -4.961  1.00 0.00 ? 40 GLU A HB2  2  
ATOM 1949  H HB3  . GLU A 1 40 ? -8.897  0.532   -4.332  1.00 0.00 ? 40 GLU A HB3  2  
ATOM 1950  H HG2  . GLU A 1 40 ? -10.653 -0.429  -5.751  1.00 0.00 ? 40 GLU A HG2  2  
ATOM 1951  H HG3  . GLU A 1 40 ? -9.478  -1.517  -6.519  1.00 0.00 ? 40 GLU A HG3  2  
ATOM 1952  N N    . THR A 1 41 ? -6.358  2.231   -5.733  1.00 0.00 ? 41 THR A N    2  
ATOM 1953  C CA   . THR A 1 41 ? -5.658  3.436   -5.309  1.00 0.00 ? 41 THR A CA   2  
ATOM 1954  C C    . THR A 1 41 ? -5.288  4.250   -6.549  1.00 0.00 ? 41 THR A C    2  
ATOM 1955  O O    . THR A 1 41 ? -4.244  4.034   -7.137  1.00 0.00 ? 41 THR A O    2  
ATOM 1956  C CB   . THR A 1 41 ? -4.419  3.062   -4.485  1.00 0.00 ? 41 THR A CB   2  
ATOM 1957  O OG1  . THR A 1 41 ? -3.545  2.271   -5.254  1.00 0.00 ? 41 THR A OG1  2  
ATOM 1958  C CG2  . THR A 1 41 ? -4.838  2.285   -3.242  1.00 0.00 ? 41 THR A CG2  2  
ATOM 1959  H H    . THR A 1 41 ? -5.817  1.397   -5.887  1.00 0.00 ? 41 THR A H    2  
ATOM 1960  H HA   . THR A 1 41 ? -6.323  4.031   -4.682  1.00 0.00 ? 41 THR A HA   2  
ATOM 1961  H HB   . THR A 1 41 ? -3.906  3.970   -4.178  1.00 0.00 ? 41 THR A HB   2  
ATOM 1962  H HG1  . THR A 1 41 ? -3.453  2.675   -6.123  1.00 0.00 ? 41 THR A HG1  2  
ATOM 1963  H HG21 . THR A 1 41 ? -5.631  1.584   -3.494  1.00 0.00 ? 41 THR A HG21 2  
ATOM 1964  H HG22 . THR A 1 41 ? -3.983  1.735   -2.858  1.00 0.00 ? 41 THR A HG22 2  
ATOM 1965  H HG23 . THR A 1 41 ? -5.195  2.981   -2.481  1.00 0.00 ? 41 THR A HG23 2  
ATOM 1966  N N    . GLN A 1 42 ? -6.194  5.168   -6.909  1.00 0.00 ? 42 GLN A N    2  
ATOM 1967  C CA   . GLN A 1 42 ? -6.127  6.056   -8.090  1.00 0.00 ? 42 GLN A CA   2  
ATOM 1968  C C    . GLN A 1 42 ? -4.708  6.374   -8.605  1.00 0.00 ? 42 GLN A C    2  
ATOM 1969  O O    . GLN A 1 42 ? -4.242  7.503   -8.461  1.00 0.00 ? 42 GLN A O    2  
ATOM 1970  C CB   . GLN A 1 42 ? -6.837  7.370   -7.736  1.00 0.00 ? 42 GLN A CB   2  
ATOM 1971  C CG   . GLN A 1 42 ? -8.246  7.085   -7.208  1.00 0.00 ? 42 GLN A CG   2  
ATOM 1972  C CD   . GLN A 1 42 ? -8.291  7.111   -5.680  1.00 0.00 ? 42 GLN A CD   2  
ATOM 1973  O OE1  . GLN A 1 42 ? -8.010  8.138   -5.066  1.00 0.00 ? 42 GLN A OE1  2  
ATOM 1974  N NE2  . GLN A 1 42 ? -8.647  5.981   -5.063  1.00 0.00 ? 42 GLN A NE2  2  
ATOM 1975  H H    . GLN A 1 42 ? -7.010  5.254   -6.331  1.00 0.00 ? 42 GLN A H    2  
ATOM 1976  H HA   . GLN A 1 42 ? -6.679  5.580   -8.901  1.00 0.00 ? 42 GLN A HA   2  
ATOM 1977  H HB2  . GLN A 1 42 ? -6.264  7.899   -6.975  1.00 0.00 ? 42 GLN A HB2  2  
ATOM 1978  H HB3  . GLN A 1 42 ? -6.908  7.991   -8.629  1.00 0.00 ? 42 GLN A HB3  2  
ATOM 1979  H HG2  . GLN A 1 42 ? -8.921  7.846   -7.591  1.00 0.00 ? 42 GLN A HG2  2  
ATOM 1980  H HG3  . GLN A 1 42 ? -8.568  6.109   -7.563  1.00 0.00 ? 42 GLN A HG3  2  
ATOM 1981  H HE21 . GLN A 1 42 ? -8.846  5.145   -5.605  1.00 0.00 ? 42 GLN A HE21 2  
ATOM 1982  H HE22 . GLN A 1 42 ? -8.717  5.959   -4.057  1.00 0.00 ? 42 GLN A HE22 2  
ATOM 1983  N N    . HIS A 1 43 ? -4.048  5.398   -9.237  1.00 0.00 ? 43 HIS A N    2  
ATOM 1984  C CA   . HIS A 1 43 ? -2.741  5.597   -9.858  1.00 0.00 ? 43 HIS A CA   2  
ATOM 1985  C C    . HIS A 1 43 ? -2.293  4.291   -10.519 1.00 0.00 ? 43 HIS A C    2  
ATOM 1986  O O    . HIS A 1 43 ? -1.228  3.757   -10.211 1.00 0.00 ? 43 HIS A O    2  
ATOM 1987  C CB   . HIS A 1 43 ? -1.684  6.150   -8.863  1.00 0.00 ? 43 HIS A CB   2  
ATOM 1988  C CG   . HIS A 1 43 ? -1.872  5.749   -7.417  1.00 0.00 ? 43 HIS A CG   2  
ATOM 1989  N ND1  . HIS A 1 43 ? -1.315  4.599   -6.869  1.00 0.00 ? 43 HIS A ND1  2  
ATOM 1990  C CD2  . HIS A 1 43 ? -2.512  6.360   -6.366  1.00 0.00 ? 43 HIS A CD2  2  
ATOM 1991  C CE1  . HIS A 1 43 ? -1.653  4.594   -5.560  1.00 0.00 ? 43 HIS A CE1  2  
ATOM 1992  N NE2  . HIS A 1 43 ? -2.382  5.643   -5.194  1.00 0.00 ? 43 HIS A NE2  2  
ATOM 1993  H H    . HIS A 1 43 ? -4.469  4.480   -9.303  1.00 0.00 ? 43 HIS A H    2  
ATOM 1994  H HA   . HIS A 1 43 ? -2.856  6.336   -10.649 1.00 0.00 ? 43 HIS A HA   2  
ATOM 1995  H HB2  . HIS A 1 43 ? -0.696  5.823   -9.185  1.00 0.00 ? 43 HIS A HB2  2  
ATOM 1996  H HB3  . HIS A 1 43 ? -1.711  7.238   -8.914  1.00 0.00 ? 43 HIS A HB3  2  
ATOM 1997  H HD1  . HIS A 1 43 ? -0.764  3.906   -7.353  1.00 0.00 ? 43 HIS A HD1  2  
ATOM 1998  H HD2  . HIS A 1 43 ? -3.039  7.297   -6.440  1.00 0.00 ? 43 HIS A HD2  2  
ATOM 1999  H HE1  . HIS A 1 43 ? -1.353  3.823   -4.872  1.00 0.00 ? 43 HIS A HE1  2  
ATOM 2000  N N    . LEU A 1 44 ? -3.119  3.789   -11.457 1.00 0.00 ? 44 LEU A N    2  
ATOM 2001  C CA   . LEU A 1 44 ? -2.803  2.585   -12.218 1.00 0.00 ? 44 LEU A CA   2  
ATOM 2002  C C    . LEU A 1 44 ? -1.954  2.992   -13.427 1.00 0.00 ? 44 LEU A C    2  
ATOM 2003  O O    . LEU A 1 44 ? -2.305  2.728   -14.576 1.00 0.00 ? 44 LEU A O    2  
ATOM 2004  C CB   . LEU A 1 44 ? -4.106  1.877   -12.636 1.00 0.00 ? 44 LEU A CB   2  
ATOM 2005  C CG   . LEU A 1 44 ? -3.923  0.347   -12.604 1.00 0.00 ? 44 LEU A CG   2  
ATOM 2006  C CD1  . LEU A 1 44 ? -5.204  -0.325  -13.106 1.00 0.00 ? 44 LEU A CD1  2  
ATOM 2007  C CD2  . LEU A 1 44 ? -2.754  -0.080  -13.500 1.00 0.00 ? 44 LEU A CD2  2  
ATOM 2008  H H    . LEU A 1 44 ? -3.988  4.263   -11.657 1.00 0.00 ? 44 LEU A H    2  
ATOM 2009  H HA   . LEU A 1 44 ? -2.221  1.914   -11.592 1.00 0.00 ? 44 LEU A HA   2  
ATOM 2010  H HB2  . LEU A 1 44 ? -4.899  2.150   -11.940 1.00 0.00 ? 44 LEU A HB2  2  
ATOM 2011  H HB3  . LEU A 1 44 ? -4.392  2.190   -13.640 1.00 0.00 ? 44 LEU A HB3  2  
ATOM 2012  H HG   . LEU A 1 44 ? -3.726  0.028   -11.579 1.00 0.00 ? 44 LEU A HG   2  
ATOM 2013  H HD11 . LEU A 1 44 ? -6.064  0.091   -12.585 1.00 0.00 ? 44 LEU A HD11 2  
ATOM 2014  H HD12 . LEU A 1 44 ? -5.150  -1.397  -12.919 1.00 0.00 ? 44 LEU A HD12 2  
ATOM 2015  H HD13 . LEU A 1 44 ? -5.312  -0.149  -14.177 1.00 0.00 ? 44 LEU A HD13 2  
ATOM 2016  H HD21 . LEU A 1 44 ? -2.912  0.294   -14.512 1.00 0.00 ? 44 LEU A HD21 2  
ATOM 2017  H HD22 . LEU A 1 44 ? -1.821  0.317   -13.105 1.00 0.00 ? 44 LEU A HD22 2  
ATOM 2018  H HD23 . LEU A 1 44 ? -2.697  -1.169  -13.524 1.00 0.00 ? 44 LEU A HD23 2  
ATOM 2019  N N    . ASP A 1 45 ? -0.833  3.650   -13.142 1.00 0.00 ? 45 ASP A N    2  
ATOM 2020  C CA   . ASP A 1 45 ? 0.088   4.137   -14.157 1.00 0.00 ? 45 ASP A CA   2  
ATOM 2021  C C    . ASP A 1 45 ? 1.424   4.425   -13.486 1.00 0.00 ? 45 ASP A C    2  
ATOM 2022  O O    . ASP A 1 45 ? 2.468   4.041   -14.001 1.00 0.00 ? 45 ASP A O    2  
ATOM 2023  C CB   . ASP A 1 45 ? -0.482  5.404   -14.802 1.00 0.00 ? 45 ASP A CB   2  
ATOM 2024  C CG   . ASP A 1 45 ? 0.542   6.050   -15.726 1.00 0.00 ? 45 ASP A CG   2  
ATOM 2025  O OD1  . ASP A 1 45 ? 0.697   5.531   -16.852 1.00 0.00 ? 45 ASP A OD1  2  
ATOM 2026  O OD2  . ASP A 1 45 ? 1.149   7.051   -15.288 1.00 0.00 ? 45 ASP A OD2  2  
ATOM 2027  H H    . ASP A 1 45 ? -0.603  3.825   -12.173 1.00 0.00 ? 45 ASP A H    2  
ATOM 2028  H HA   . ASP A 1 45 ? 0.226   3.372   -14.922 1.00 0.00 ? 45 ASP A HA   2  
ATOM 2029  H HB2  . ASP A 1 45 ? -1.372  5.145   -15.377 1.00 0.00 ? 45 ASP A HB2  2  
ATOM 2030  H HB3  . ASP A 1 45 ? -0.756  6.113   -14.020 1.00 0.00 ? 45 ASP A HB3  2  
ATOM 2031  N N    . ILE A 1 46 ? 1.351   5.094   -12.316 1.00 0.00 ? 46 ILE A N    2  
ATOM 2032  C CA   . ILE A 1 46 ? 2.500   5.434   -11.474 1.00 0.00 ? 46 ILE A CA   2  
ATOM 2033  C C    . ILE A 1 46 ? 3.707   5.899   -12.297 1.00 0.00 ? 46 ILE A C    2  
ATOM 2034  O O    . ILE A 1 46 ? 3.882   7.092   -12.539 1.00 0.00 ? 46 ILE A O    2  
ATOM 2035  C CB   . ILE A 1 46 ? 2.901   4.240   -10.564 1.00 0.00 ? 46 ILE A CB   2  
ATOM 2036  C CG1  . ILE A 1 46 ? 2.289   2.924   -11.045 1.00 0.00 ? 46 ILE A CG1  2  
ATOM 2037  C CG2  . ILE A 1 46 ? 2.458   4.509   -9.127  1.00 0.00 ? 46 ILE A CG2  2  
ATOM 2038  C CD1  . ILE A 1 46 ? 2.681   1.826   -10.076 1.00 0.00 ? 46 ILE A CD1  2  
ATOM 2039  H H    . ILE A 1 46 ? 0.443   5.380   -11.985 1.00 0.00 ? 46 ILE A H    2  
ATOM 2040  H HA   . ILE A 1 46 ? 2.199   6.251   -10.830 1.00 0.00 ? 46 ILE A HA   2  
ATOM 2041  H HB   . ILE A 1 46 ? 3.981   4.137   -10.565 1.00 0.00 ? 46 ILE A HB   2  
ATOM 2042  H HG12 . ILE A 1 46 ? 1.202   3.003   -11.079 1.00 0.00 ? 46 ILE A HG12 2  
ATOM 2043  H HG13 . ILE A 1 46 ? 2.672   2.679   -12.032 1.00 0.00 ? 46 ILE A HG13 2  
ATOM 2044  H HG21 . ILE A 1 46 ? 1.376   4.390   -9.047  1.00 0.00 ? 46 ILE A HG21 2  
ATOM 2045  H HG22 . ILE A 1 46 ? 2.735   5.523   -8.844  1.00 0.00 ? 46 ILE A HG22 2  
ATOM 2046  H HG23 . ILE A 1 46 ? 2.960   3.800   -8.460  1.00 0.00 ? 46 ILE A HG23 2  
ATOM 2047  H HD11 . ILE A 1 46 ? 2.693   0.868   -10.594 1.00 0.00 ? 46 ILE A HD11 2  
ATOM 2048  H HD12 . ILE A 1 46 ? 1.969   1.794   -9.261  1.00 0.00 ? 46 ILE A HD12 2  
ATOM 2049  H HD13 . ILE A 1 46 ? 3.665   2.036   -9.680  1.00 0.00 ? 46 ILE A HD13 2  
ATOM 2050  N N    . GLY A 1 47 ? 4.546   4.940   -12.687 1.00 0.00 ? 47 GLY A N    2  
ATOM 2051  C CA   . GLY A 1 47 ? 5.785   5.187   -13.379 1.00 0.00 ? 47 GLY A CA   2  
ATOM 2052  C C    . GLY A 1 47 ? 6.817   4.224   -12.810 1.00 0.00 ? 47 GLY A C    2  
ATOM 2053  O O    . GLY A 1 47 ? 6.559   3.576   -11.792 1.00 0.00 ? 47 GLY A O    2  
ATOM 2054  H H    . GLY A 1 47 ? 4.318   3.981   -12.477 1.00 0.00 ? 47 GLY A H    2  
ATOM 2055  H HA2  . GLY A 1 47 ? 5.656   5.005   -14.446 1.00 0.00 ? 47 GLY A HA2  2  
ATOM 2056  H HA3  . GLY A 1 47 ? 6.110   6.215   -13.215 1.00 0.00 ? 47 GLY A HA3  2  
ATOM 2057  N N    . LEU A 1 48 ? 7.977   4.114   -13.450 1.00 0.00 ? 48 LEU A N    2  
ATOM 2058  C CA   . LEU A 1 48 ? 9.007   3.200   -12.988 1.00 0.00 ? 48 LEU A CA   2  
ATOM 2059  C C    . LEU A 1 48 ? 9.404   3.537   -11.553 1.00 0.00 ? 48 LEU A C    2  
ATOM 2060  O O    . LEU A 1 48 ? 9.452   2.652   -10.707 1.00 0.00 ? 48 LEU A O    2  
ATOM 2061  C CB   . LEU A 1 48 ? 10.214  3.275   -13.933 1.00 0.00 ? 48 LEU A CB   2  
ATOM 2062  C CG   . LEU A 1 48 ? 11.247  2.195   -13.563 1.00 0.00 ? 48 LEU A CG   2  
ATOM 2063  C CD1  . LEU A 1 48 ? 11.821  1.580   -14.841 1.00 0.00 ? 48 LEU A CD1  2  
ATOM 2064  C CD2  . LEU A 1 48 ? 12.384  2.816   -12.746 1.00 0.00 ? 48 LEU A CD2  2  
ATOM 2065  H H    . LEU A 1 48 ? 8.153   4.666   -14.276 1.00 0.00 ? 48 LEU A H    2  
ATOM 2066  H HA   . LEU A 1 48 ? 8.602   2.186   -13.007 1.00 0.00 ? 48 LEU A HA   2  
ATOM 2067  H HB2  . LEU A 1 48 ? 9.875   3.114   -14.957 1.00 0.00 ? 48 LEU A HB2  2  
ATOM 2068  H HB3  . LEU A 1 48 ? 10.674  4.261   -13.860 1.00 0.00 ? 48 LEU A HB3  2  
ATOM 2069  H HG   . LEU A 1 48 ? 10.764  1.414   -12.976 1.00 0.00 ? 48 LEU A HG   2  
ATOM 2070  H HD11 . LEU A 1 48 ? 11.021  1.102   -15.408 1.00 0.00 ? 48 LEU A HD11 2  
ATOM 2071  H HD12 . LEU A 1 48 ? 12.574  0.835   -14.580 1.00 0.00 ? 48 LEU A HD12 2  
ATOM 2072  H HD13 . LEU A 1 48 ? 12.281  2.360   -15.448 1.00 0.00 ? 48 LEU A HD13 2  
ATOM 2073  H HD21 . LEU A 1 48 ? 13.118  2.047   -12.502 1.00 0.00 ? 48 LEU A HD21 2  
ATOM 2074  H HD22 . LEU A 1 48 ? 11.988  3.238   -11.824 1.00 0.00 ? 48 LEU A HD22 2  
ATOM 2075  H HD23 . LEU A 1 48 ? 12.866  3.604   -13.327 1.00 0.00 ? 48 LEU A HD23 2  
ATOM 2076  N N    . LYS A 1 49 ? 9.687   4.815   -11.286 1.00 0.00 ? 49 LYS A N    2  
ATOM 2077  C CA   . LYS A 1 49 ? 10.108  5.260   -9.963  1.00 0.00 ? 49 LYS A CA   2  
ATOM 2078  C C    . LYS A 1 49 ? 9.127   4.789   -8.884  1.00 0.00 ? 49 LYS A C    2  
ATOM 2079  O O    . LYS A 1 49 ? 9.534   4.141   -7.923  1.00 0.00 ? 49 LYS A O    2  
ATOM 2080  C CB   . LYS A 1 49 ? 10.209  6.792   -9.952  1.00 0.00 ? 49 LYS A CB   2  
ATOM 2081  C CG   . LYS A 1 49 ? 11.386  7.264   -10.819 1.00 0.00 ? 49 LYS A CG   2  
ATOM 2082  C CD   . LYS A 1 49 ? 12.716  6.905   -10.146 1.00 0.00 ? 49 LYS A CD   2  
ATOM 2083  C CE   . LYS A 1 49 ? 13.843  7.738   -10.762 1.00 0.00 ? 49 LYS A CE   2  
ATOM 2084  N NZ   . LYS A 1 49 ? 15.152  7.359   -10.197 1.00 0.00 ? 49 LYS A NZ   2  
ATOM 2085  H H    . LYS A 1 49 ? 9.616   5.503   -12.021 1.00 0.00 ? 49 LYS A H    2  
ATOM 2086  H HA   . LYS A 1 49 ? 11.088  4.839   -9.747  1.00 0.00 ? 49 LYS A HA   2  
ATOM 2087  H HB2  . LYS A 1 49 ? 9.283   7.217   -10.342 1.00 0.00 ? 49 LYS A HB2  2  
ATOM 2088  H HB3  . LYS A 1 49 ? 10.356  7.136   -8.927  1.00 0.00 ? 49 LYS A HB3  2  
ATOM 2089  H HG2  . LYS A 1 49 ? 11.334  6.788   -11.799 1.00 0.00 ? 49 LYS A HG2  2  
ATOM 2090  H HG3  . LYS A 1 49 ? 11.324  8.346   -10.942 1.00 0.00 ? 49 LYS A HG3  2  
ATOM 2091  H HD2  . LYS A 1 49 ? 12.653  7.116   -9.078  1.00 0.00 ? 49 LYS A HD2  2  
ATOM 2092  H HD3  . LYS A 1 49 ? 12.927  5.846   -10.295 1.00 0.00 ? 49 LYS A HD3  2  
ATOM 2093  H HE2  . LYS A 1 49 ? 13.860  7.578   -11.840 1.00 0.00 ? 49 LYS A HE2  2  
ATOM 2094  H HE3  . LYS A 1 49 ? 13.660  8.796   -10.559 1.00 0.00 ? 49 LYS A HE3  2  
ATOM 2095  H HZ1  . LYS A 1 49 ? 15.143  7.507   -9.197  1.00 0.00 ? 49 LYS A HZ1  2  
ATOM 2096  H HZ2  . LYS A 1 49 ? 15.876  7.926   -10.615 1.00 0.00 ? 49 LYS A HZ2  2  
ATOM 2097  H HZ3  . LYS A 1 49 ? 15.334  6.384   -10.392 1.00 0.00 ? 49 LYS A HZ3  2  
ATOM 2098  N N    . GLN A 1 50 ? 7.843   5.129   -9.037  1.00 0.00 ? 50 GLN A N    2  
ATOM 2099  C CA   . GLN A 1 50 ? 6.832   4.794   -8.042  1.00 0.00 ? 50 GLN A CA   2  
ATOM 2100  C C    . GLN A 1 50 ? 6.609   3.282   -7.964  1.00 0.00 ? 50 GLN A C    2  
ATOM 2101  O O    . GLN A 1 50 ? 6.778   2.703   -6.901  1.00 0.00 ? 50 GLN A O    2  
ATOM 2102  C CB   . GLN A 1 50 ? 5.528   5.517   -8.375  1.00 0.00 ? 50 GLN A CB   2  
ATOM 2103  C CG   . GLN A 1 50 ? 5.676   7.020   -8.127  1.00 0.00 ? 50 GLN A CG   2  
ATOM 2104  C CD   . GLN A 1 50 ? 5.879   7.325   -6.644  1.00 0.00 ? 50 GLN A CD   2  
ATOM 2105  O OE1  . GLN A 1 50 ? 5.153   6.812   -5.796  1.00 0.00 ? 50 GLN A OE1  2  
ATOM 2106  N NE2  . GLN A 1 50 ? 6.867   8.165   -6.334  1.00 0.00 ? 50 GLN A NE2  2  
ATOM 2107  H H    . GLN A 1 50 ? 7.556   5.642   -9.857  1.00 0.00 ? 50 GLN A H    2  
ATOM 2108  H HA   . GLN A 1 50 ? 7.180   5.137   -7.068  1.00 0.00 ? 50 GLN A HA   2  
ATOM 2109  H HB2  . GLN A 1 50 ? 5.281   5.351   -9.421  1.00 0.00 ? 50 GLN A HB2  2  
ATOM 2110  H HB3  . GLN A 1 50 ? 4.728   5.125   -7.747  1.00 0.00 ? 50 GLN A HB3  2  
ATOM 2111  H HG2  . GLN A 1 50 ? 6.531   7.393   -8.689  1.00 0.00 ? 50 GLN A HG2  2  
ATOM 2112  H HG3  . GLN A 1 50 ? 4.776   7.527   -8.471  1.00 0.00 ? 50 GLN A HG3  2  
ATOM 2113  H HE21 . GLN A 1 50 ? 7.440   8.561   -7.064  1.00 0.00 ? 50 GLN A HE21 2  
ATOM 2114  H HE22 . GLN A 1 50 ? 7.040   8.402   -5.370  1.00 0.00 ? 50 GLN A HE22 2  
ATOM 2115  N N    . LYS A 1 51 ? 6.222   2.642   -9.081  1.00 0.00 ? 51 LYS A N    2  
ATOM 2116  C CA   . LYS A 1 51 ? 5.969   1.201   -9.099  1.00 0.00 ? 51 LYS A CA   2  
ATOM 2117  C C    . LYS A 1 51 ? 7.118   0.446   -8.453  1.00 0.00 ? 51 LYS A C    2  
ATOM 2118  O O    . LYS A 1 51 ? 6.899   -0.490  -7.688  1.00 0.00 ? 51 LYS A O    2  
ATOM 2119  C CB   . LYS A 1 51 ? 5.799   0.734   -10.553 1.00 0.00 ? 51 LYS A CB   2  
ATOM 2120  C CG   . LYS A 1 51 ? 5.268   -0.705  -10.575 1.00 0.00 ? 51 LYS A CG   2  
ATOM 2121  C CD   . LYS A 1 51 ? 4.823   -1.088  -11.995 1.00 0.00 ? 51 LYS A CD   2  
ATOM 2122  C CE   . LYS A 1 51 ? 5.976   -0.919  -12.994 1.00 0.00 ? 51 LYS A CE   2  
ATOM 2123  N NZ   . LYS A 1 51 ? 7.180   -1.657  -12.564 1.00 0.00 ? 51 LYS A NZ   2  
ATOM 2124  H H    . LYS A 1 51 ? 6.094   3.159   -9.941  1.00 0.00 ? 51 LYS A H    2  
ATOM 2125  H HA   . LYS A 1 51 ? 5.057   0.992   -8.540  1.00 0.00 ? 51 LYS A HA   2  
ATOM 2126  H HB2  . LYS A 1 51 ? 5.098   1.388   -11.070 1.00 0.00 ? 51 LYS A HB2  2  
ATOM 2127  H HB3  . LYS A 1 51 ? 6.764   0.774   -11.057 1.00 0.00 ? 51 LYS A HB3  2  
ATOM 2128  H HG2  . LYS A 1 51 ? 6.049   -1.388  -10.238 1.00 0.00 ? 51 LYS A HG2  2  
ATOM 2129  H HG3  . LYS A 1 51 ? 4.413   -0.783  -9.902  1.00 0.00 ? 51 LYS A HG3  2  
ATOM 2130  H HD2  . LYS A 1 51 ? 4.492   -2.129  -11.997 1.00 0.00 ? 51 LYS A HD2  2  
ATOM 2131  H HD3  . LYS A 1 51 ? 3.991   -0.450  -12.296 1.00 0.00 ? 51 LYS A HD3  2  
ATOM 2132  H HE2  . LYS A 1 51 ? 5.658   -1.298  -13.966 1.00 0.00 ? 51 LYS A HE2  2  
ATOM 2133  H HE3  . LYS A 1 51 ? 6.217   0.139   -13.091 1.00 0.00 ? 51 LYS A HE3  2  
ATOM 2134  H HZ1  . LYS A 1 51 ? 7.522   -1.269  -11.697 1.00 0.00 ? 51 LYS A HZ1  2  
ATOM 2135  H HZ2  . LYS A 1 51 ? 6.950   -2.631  -12.430 1.00 0.00 ? 51 LYS A HZ2  2  
ATOM 2136  H HZ3  . LYS A 1 51 ? 7.896   -1.575  -13.273 1.00 0.00 ? 51 LYS A HZ3  2  
ATOM 2137  N N    . GLN A 1 52 ? 8.337   0.853   -8.772  1.00 0.00 ? 52 GLN A N    2  
ATOM 2138  C CA   . GLN A 1 52 ? 9.528   0.187   -8.263  1.00 0.00 ? 52 GLN A CA   2  
ATOM 2139  C C    . GLN A 1 52 ? 9.646   0.420   -6.761  1.00 0.00 ? 52 GLN A C    2  
ATOM 2140  O O    . GLN A 1 52 ? 9.710   -0.536  -5.989  1.00 0.00 ? 52 GLN A O    2  
ATOM 2141  C CB   . GLN A 1 52 ? 10.769  0.710   -9.001  1.00 0.00 ? 52 GLN A CB   2  
ATOM 2142  C CG   . GLN A 1 52 ? 12.012  -0.093  -8.592  1.00 0.00 ? 52 GLN A CG   2  
ATOM 2143  C CD   . GLN A 1 52 ? 11.948  -1.530  -9.110  1.00 0.00 ? 52 GLN A CD   2  
ATOM 2144  O OE1  . GLN A 1 52 ? 11.185  -1.835  -10.024 1.00 0.00 ? 52 GLN A OE1  2  
ATOM 2145  N NE2  . GLN A 1 52 ? 12.754  -2.413  -8.524  1.00 0.00 ? 52 GLN A NE2  2  
ATOM 2146  H H    . GLN A 1 52 ? 8.443   1.651   -9.391  1.00 0.00 ? 52 GLN A H    2  
ATOM 2147  H HA   . GLN A 1 52 ? 9.432   -0.883  -8.445  1.00 0.00 ? 52 GLN A HA   2  
ATOM 2148  H HB2  . GLN A 1 52 ? 10.618  0.613   -10.077 1.00 0.00 ? 52 GLN A HB2  2  
ATOM 2149  H HB3  . GLN A 1 52 ? 10.922  1.761   -8.753  1.00 0.00 ? 52 GLN A HB3  2  
ATOM 2150  H HG2  . GLN A 1 52 ? 12.898  0.392   -9.005  1.00 0.00 ? 52 GLN A HG2  2  
ATOM 2151  H HG3  . GLN A 1 52 ? 12.091  -0.107  -7.504  1.00 0.00 ? 52 GLN A HG3  2  
ATOM 2152  H HE21 . GLN A 1 52 ? 13.369  -2.117  -7.780  1.00 0.00 ? 52 GLN A HE21 2  
ATOM 2153  H HE22 . GLN A 1 52 ? 12.750  -3.376  -8.826  1.00 0.00 ? 52 GLN A HE22 2  
ATOM 2154  N N    . TRP A 1 53 ? 9.677   1.692   -6.353  1.00 0.00 ? 53 TRP A N    2  
ATOM 2155  C CA   . TRP A 1 53 ? 9.810   2.053   -4.954  1.00 0.00 ? 53 TRP A CA   2  
ATOM 2156  C C    . TRP A 1 53 ? 8.754   1.337   -4.110  1.00 0.00 ? 53 TRP A C    2  
ATOM 2157  O O    . TRP A 1 53 ? 9.082   0.693   -3.119  1.00 0.00 ? 53 TRP A O    2  
ATOM 2158  C CB   . TRP A 1 53 ? 9.679   3.570   -4.805  1.00 0.00 ? 53 TRP A CB   2  
ATOM 2159  C CG   . TRP A 1 53 ? 9.483   4.023   -3.397  1.00 0.00 ? 53 TRP A CG   2  
ATOM 2160  C CD1  . TRP A 1 53 ? 10.340  3.812   -2.384  1.00 0.00 ? 53 TRP A CD1  2  
ATOM 2161  C CD2  . TRP A 1 53 ? 8.355   4.734   -2.808  1.00 0.00 ? 53 TRP A CD2  2  
ATOM 2162  N NE1  . TRP A 1 53 ? 9.846   4.316   -1.209  1.00 0.00 ? 53 TRP A NE1  2  
ATOM 2163  C CE2  . TRP A 1 53 ? 8.610   4.900   -1.410  1.00 0.00 ? 53 TRP A CE2  2  
ATOM 2164  C CE3  . TRP A 1 53 ? 7.134   5.255   -3.304  1.00 0.00 ? 53 TRP A CE3  2  
ATOM 2165  C CZ2  . TRP A 1 53 ? 7.712   5.537   -0.556  1.00 0.00 ? 53 TRP A CZ2  2  
ATOM 2166  C CZ3  . TRP A 1 53 ? 6.225   5.897   -2.441  1.00 0.00 ? 53 TRP A CZ3  2  
ATOM 2167  C CH2  . TRP A 1 53 ? 6.517   6.038   -1.072  1.00 0.00 ? 53 TRP A CH2  2  
ATOM 2168  H H    . TRP A 1 53 ? 9.611   2.437   -7.035  1.00 0.00 ? 53 TRP A H    2  
ATOM 2169  H HA   . TRP A 1 53 ? 10.796  1.753   -4.610  1.00 0.00 ? 53 TRP A HA   2  
ATOM 2170  H HB2  . TRP A 1 53 ? 10.582  4.038   -5.199  1.00 0.00 ? 53 TRP A HB2  2  
ATOM 2171  H HB3  . TRP A 1 53 ? 8.828   3.906   -5.397  1.00 0.00 ? 53 TRP A HB3  2  
ATOM 2172  H HD1  . TRP A 1 53 ? 11.285  3.301   -2.480  1.00 0.00 ? 53 TRP A HD1  2  
ATOM 2173  H HE1  . TRP A 1 53 ? 10.305  4.273   -0.310  1.00 0.00 ? 53 TRP A HE1  2  
ATOM 2174  H HE3  . TRP A 1 53 ? 6.895   5.161   -4.354  1.00 0.00 ? 53 TRP A HE3  2  
ATOM 2175  H HZ2  . TRP A 1 53 ? 7.939   5.641   0.495   1.00 0.00 ? 53 TRP A HZ2  2  
ATOM 2176  H HZ3  . TRP A 1 53 ? 5.298   6.283   -2.835  1.00 0.00 ? 53 TRP A HZ3  2  
ATOM 2177  H HH2  . TRP A 1 53 ? 5.821   6.541   -0.421  1.00 0.00 ? 53 TRP A HH2  2  
ATOM 2178  N N    . LEU A 1 54 ? 7.487   1.457   -4.499  1.00 0.00 ? 54 LEU A N    2  
ATOM 2179  C CA   . LEU A 1 54 ? 6.391   0.857   -3.760  1.00 0.00 ? 54 LEU A CA   2  
ATOM 2180  C C    . LEU A 1 54 ? 6.593   -0.652  -3.621  1.00 0.00 ? 54 LEU A C    2  
ATOM 2181  O O    . LEU A 1 54 ? 6.474   -1.198  -2.525  1.00 0.00 ? 54 LEU A O    2  
ATOM 2182  C CB   . LEU A 1 54 ? 5.067   1.143   -4.484  1.00 0.00 ? 54 LEU A CB   2  
ATOM 2183  C CG   . LEU A 1 54 ? 4.730   2.642   -4.424  1.00 0.00 ? 54 LEU A CG   2  
ATOM 2184  C CD1  . LEU A 1 54 ? 3.610   2.948   -5.422  1.00 0.00 ? 54 LEU A CD1  2  
ATOM 2185  C CD2  . LEU A 1 54 ? 4.269   3.023   -3.013  1.00 0.00 ? 54 LEU A CD2  2  
ATOM 2186  H H    . LEU A 1 54 ? 7.269   1.985   -5.330  1.00 0.00 ? 54 LEU A H    2  
ATOM 2187  H HA   . LEU A 1 54 ? 6.355   1.296   -2.771  1.00 0.00 ? 54 LEU A HA   2  
ATOM 2188  H HB2  . LEU A 1 54 ? 5.153   0.834   -5.527  1.00 0.00 ? 54 LEU A HB2  2  
ATOM 2189  H HB3  . LEU A 1 54 ? 4.267   0.576   -4.008  1.00 0.00 ? 54 LEU A HB3  2  
ATOM 2190  H HG   . LEU A 1 54 ? 5.611   3.226   -4.685  1.00 0.00 ? 54 LEU A HG   2  
ATOM 2191  H HD11 . LEU A 1 54 ? 2.725   2.368   -5.166  1.00 0.00 ? 54 LEU A HD11 2  
ATOM 2192  H HD12 . LEU A 1 54 ? 3.372   4.011   -5.387  1.00 0.00 ? 54 LEU A HD12 2  
ATOM 2193  H HD13 . LEU A 1 54 ? 3.937   2.684   -6.428  1.00 0.00 ? 54 LEU A HD13 2  
ATOM 2194  H HD21 . LEU A 1 54 ? 5.119   3.006   -2.333  1.00 0.00 ? 54 LEU A HD21 2  
ATOM 2195  H HD22 . LEU A 1 54 ? 3.840   4.025   -3.029  1.00 0.00 ? 54 LEU A HD22 2  
ATOM 2196  H HD23 . LEU A 1 54 ? 3.517   2.312   -2.671  1.00 0.00 ? 54 LEU A HD23 2  
ATOM 2197  N N    . MET A 1 55 ? 6.876   -1.319  -4.739  1.00 0.00 ? 55 MET A N    2  
ATOM 2198  C CA   . MET A 1 55 ? 6.979   -2.766  -4.781  1.00 0.00 ? 55 MET A CA   2  
ATOM 2199  C C    . MET A 1 55 ? 8.101   -3.319  -3.893  1.00 0.00 ? 55 MET A C    2  
ATOM 2200  O O    . MET A 1 55 ? 7.826   -4.160  -3.041  1.00 0.00 ? 55 MET A O    2  
ATOM 2201  C CB   . MET A 1 55 ? 7.180   -3.200  -6.240  1.00 0.00 ? 55 MET A CB   2  
ATOM 2202  C CG   . MET A 1 55 ? 7.170   -4.730  -6.347  1.00 0.00 ? 55 MET A CG   2  
ATOM 2203  S SD   . MET A 1 55 ? 7.451   -5.354  -8.026  1.00 0.00 ? 55 MET A SD   2  
ATOM 2204  C CE   . MET A 1 55 ? 5.906   -4.824  -8.805  1.00 0.00 ? 55 MET A CE   2  
ATOM 2205  H H    . MET A 1 55 ? 7.002   -0.809  -5.605  1.00 0.00 ? 55 MET A H    2  
ATOM 2206  H HA   . MET A 1 55 ? 6.033   -3.181  -4.425  1.00 0.00 ? 55 MET A HA   2  
ATOM 2207  H HB2  . MET A 1 55 ? 6.374   -2.794  -6.847  1.00 0.00 ? 55 MET A HB2  2  
ATOM 2208  H HB3  . MET A 1 55 ? 8.135   -2.819  -6.604  1.00 0.00 ? 55 MET A HB3  2  
ATOM 2209  H HG2  . MET A 1 55 ? 7.950   -5.131  -5.700  1.00 0.00 ? 55 MET A HG2  2  
ATOM 2210  H HG3  . MET A 1 55 ? 6.206   -5.098  -5.999  1.00 0.00 ? 55 MET A HG3  2  
ATOM 2211  H HE1  . MET A 1 55 ? 5.876   -5.185  -9.833  1.00 0.00 ? 55 MET A HE1  2  
ATOM 2212  H HE2  . MET A 1 55 ? 5.849   -3.737  -8.802  1.00 0.00 ? 55 MET A HE2  2  
ATOM 2213  H HE3  . MET A 1 55 ? 5.061   -5.234  -8.253  1.00 0.00 ? 55 MET A HE3  2  
ATOM 2214  N N    . THR A 1 56 ? 9.360   -2.896  -4.107  1.00 0.00 ? 56 THR A N    2  
ATOM 2215  C CA   . THR A 1 56 ? 10.494  -3.516  -3.408  1.00 0.00 ? 56 THR A CA   2  
ATOM 2216  C C    . THR A 1 56 ? 11.149  -2.610  -2.351  1.00 0.00 ? 56 THR A C    2  
ATOM 2217  O O    . THR A 1 56 ? 12.268  -2.905  -1.928  1.00 0.00 ? 56 THR A O    2  
ATOM 2218  C CB   . THR A 1 56 ? 11.526  -3.978  -4.457  1.00 0.00 ? 56 THR A CB   2  
ATOM 2219  O OG1  . THR A 1 56 ? 12.493  -4.800  -3.840  1.00 0.00 ? 56 THR A OG1  2  
ATOM 2220  C CG2  . THR A 1 56 ? 12.222  -2.776  -5.104  1.00 0.00 ? 56 THR A CG2  2  
ATOM 2221  H H    . THR A 1 56 ? 9.543   -2.161  -4.780  1.00 0.00 ? 56 THR A H    2  
ATOM 2222  H HA   . THR A 1 56 ? 10.131  -4.406  -2.895  1.00 0.00 ? 56 THR A HA   2  
ATOM 2223  H HB   . THR A 1 56 ? 11.015  -4.552  -5.231  1.00 0.00 ? 56 THR A HB   2  
ATOM 2224  H HG1  . THR A 1 56 ? 12.868  -4.320  -3.092  1.00 0.00 ? 56 THR A HG1  2  
ATOM 2225  H HG21 . THR A 1 56 ? 12.750  -2.202  -4.347  1.00 0.00 ? 56 THR A HG21 2  
ATOM 2226  H HG22 . THR A 1 56 ? 11.483  -2.144  -5.590  1.00 0.00 ? 56 THR A HG22 2  
ATOM 2227  H HG23 . THR A 1 56 ? 12.935  -3.131  -5.848  1.00 0.00 ? 56 THR A HG23 2  
ATOM 2228  N N    . GLU A 1 57 ? 10.484  -1.531  -1.902  1.00 0.00 ? 57 GLU A N    2  
ATOM 2229  C CA   . GLU A 1 57 ? 11.069  -0.665  -0.867  1.00 0.00 ? 57 GLU A CA   2  
ATOM 2230  C C    . GLU A 1 57 ? 10.029  -0.241  0.147   1.00 0.00 ? 57 GLU A C    2  
ATOM 2231  O O    . GLU A 1 57 ? 10.233  -0.408  1.343   1.00 0.00 ? 57 GLU A O    2  
ATOM 2232  C CB   . GLU A 1 57 ? 11.702  0.588   -1.484  1.00 0.00 ? 57 GLU A CB   2  
ATOM 2233  C CG   . GLU A 1 57 ? 12.359  0.244   -2.807  1.00 0.00 ? 57 GLU A CG   2  
ATOM 2234  C CD   . GLU A 1 57 ? 13.161  1.419   -3.364  1.00 0.00 ? 57 GLU A CD   2  
ATOM 2235  O OE1  . GLU A 1 57 ? 13.596  2.259   -2.545  1.00 0.00 ? 57 GLU A OE1  2  
ATOM 2236  O OE2  . GLU A 1 57 ? 13.325  1.454   -4.604  1.00 0.00 ? 57 GLU A OE2  2  
ATOM 2237  H H    . GLU A 1 57 ? 9.570   -1.304  -2.270  1.00 0.00 ? 57 GLU A H    2  
ATOM 2238  H HA   . GLU A 1 57 ? 11.846  -1.219  -0.344  1.00 0.00 ? 57 GLU A HA   2  
ATOM 2239  H HB2  . GLU A 1 57 ? 10.934  1.337   -1.648  1.00 0.00 ? 57 GLU A HB2  2  
ATOM 2240  H HB3  . GLU A 1 57 ? 12.450  0.985   -0.798  1.00 0.00 ? 57 GLU A HB3  2  
ATOM 2241  H HG2  . GLU A 1 57 ? 13.022  -0.600  -2.658  1.00 0.00 ? 57 GLU A HG2  2  
ATOM 2242  H HG3  . GLU A 1 57 ? 11.581  -0.026  -3.515  1.00 0.00 ? 57 GLU A HG3  2  
ATOM 2243  N N    . ALA A 1 58 ? 8.928   0.340   -0.319  1.00 0.00 ? 58 ALA A N    2  
ATOM 2244  C CA   . ALA A 1 58 ? 7.949   0.890   0.577   1.00 0.00 ? 58 ALA A CA   2  
ATOM 2245  C C    . ALA A 1 58 ? 7.103   -0.201  1.239   1.00 0.00 ? 58 ALA A C    2  
ATOM 2246  O O    . ALA A 1 58 ? 7.142   -0.368  2.455   1.00 0.00 ? 58 ALA A O    2  
ATOM 2247  C CB   . ALA A 1 58 ? 7.057   1.877   -0.179  1.00 0.00 ? 58 ALA A CB   2  
ATOM 2248  H H    . ALA A 1 58 ? 8.779   0.426   -1.315  1.00 0.00 ? 58 ALA A H    2  
ATOM 2249  H HA   . ALA A 1 58 ? 8.492   1.433   1.340   1.00 0.00 ? 58 ALA A HA   2  
ATOM 2250  H HB1  . ALA A 1 58 ? 7.650   2.416   -0.915  1.00 0.00 ? 58 ALA A HB1  2  
ATOM 2251  H HB2  . ALA A 1 58 ? 6.624   2.586   0.526   1.00 0.00 ? 58 ALA A HB2  2  
ATOM 2252  H HB3  . ALA A 1 58 ? 6.257   1.338   -0.681  1.00 0.00 ? 58 ALA A HB3  2  
ATOM 2253  N N    . LEU A 1 59 ? 6.323   -0.926  0.435   1.00 0.00 ? 59 LEU A N    2  
ATOM 2254  C CA   . LEU A 1 59 ? 5.391   -1.926  0.942   1.00 0.00 ? 59 LEU A CA   2  
ATOM 2255  C C    . LEU A 1 59 ? 6.111   -3.056  1.685   1.00 0.00 ? 59 LEU A C    2  
ATOM 2256  O O    . LEU A 1 59 ? 5.539   -3.650  2.595   1.00 0.00 ? 59 LEU A O    2  
ATOM 2257  C CB   . LEU A 1 59 ? 4.578   -2.485  -0.235  1.00 0.00 ? 59 LEU A CB   2  
ATOM 2258  C CG   . LEU A 1 59 ? 3.763   -1.365  -0.912  1.00 0.00 ? 59 LEU A CG   2  
ATOM 2259  C CD1  . LEU A 1 59 ? 3.013   -1.945  -2.112  1.00 0.00 ? 59 LEU A CD1  2  
ATOM 2260  C CD2  . LEU A 1 59 ? 2.751   -0.769  0.071   1.00 0.00 ? 59 LEU A CD2  2  
ATOM 2261  H H    . LEU A 1 59 ? 6.358   -0.771  -0.565  1.00 0.00 ? 59 LEU A H    2  
ATOM 2262  H HA   . LEU A 1 59 ? 4.708   -1.444  1.640   1.00 0.00 ? 59 LEU A HA   2  
ATOM 2263  H HB2  . LEU A 1 59 ? 5.259   -2.924  -0.964  1.00 0.00 ? 59 LEU A HB2  2  
ATOM 2264  H HB3  . LEU A 1 59 ? 3.900   -3.253  0.125   1.00 0.00 ? 59 LEU A HB3  2  
ATOM 2265  H HG   . LEU A 1 59 ? 4.434   -0.580  -1.256  1.00 0.00 ? 59 LEU A HG   2  
ATOM 2266  H HD11 . LEU A 1 59 ? 2.462   -1.150  -2.616  1.00 0.00 ? 59 LEU A HD11 2  
ATOM 2267  H HD12 . LEU A 1 59 ? 2.314   -2.710  -1.769  1.00 0.00 ? 59 LEU A HD12 2  
ATOM 2268  H HD13 . LEU A 1 59 ? 3.725   -2.390  -2.806  1.00 0.00 ? 59 LEU A HD13 2  
ATOM 2269  H HD21 . LEU A 1 59 ? 2.044   -0.144  -0.474  1.00 0.00 ? 59 LEU A HD21 2  
ATOM 2270  H HD22 . LEU A 1 59 ? 2.210   -1.572  0.572   1.00 0.00 ? 59 LEU A HD22 2  
ATOM 2271  H HD23 . LEU A 1 59 ? 3.269   -0.161  0.810   1.00 0.00 ? 59 LEU A HD23 2  
ATOM 2272  N N    . VAL A 1 60 ? 7.354   -3.360  1.303   1.00 0.00 ? 60 VAL A N    2  
ATOM 2273  C CA   . VAL A 1 60 ? 8.105   -4.450  1.924   1.00 0.00 ? 60 VAL A CA   2  
ATOM 2274  C C    . VAL A 1 60 ? 8.466   -4.141  3.383   1.00 0.00 ? 60 VAL A C    2  
ATOM 2275  O O    . VAL A 1 60 ? 8.784   -5.065  4.130   1.00 0.00 ? 60 VAL A O    2  
ATOM 2276  C CB   . VAL A 1 60 ? 9.376   -4.751  1.111   1.00 0.00 ? 60 VAL A CB   2  
ATOM 2277  C CG1  . VAL A 1 60 ? 8.991   -5.404  -0.216  1.00 0.00 ? 60 VAL A CG1  2  
ATOM 2278  C CG2  . VAL A 1 60 ? 10.157  -3.465  0.843   1.00 0.00 ? 60 VAL A CG2  2  
ATOM 2279  H H    . VAL A 1 60 ? 7.790   -2.835  0.561   1.00 0.00 ? 60 VAL A H    2  
ATOM 2280  H HA   . VAL A 1 60 ? 7.478   -5.343  1.915   1.00 0.00 ? 60 VAL A HA   2  
ATOM 2281  H HB   . VAL A 1 60 ? 10.007  -5.437  1.674   1.00 0.00 ? 60 VAL A HB   2  
ATOM 2282  H HG11 . VAL A 1 60 ? 8.317   -4.747  -0.761  1.00 0.00 ? 60 VAL A HG11 2  
ATOM 2283  H HG12 . VAL A 1 60 ? 8.492   -6.355  -0.023  1.00 0.00 ? 60 VAL A HG12 2  
ATOM 2284  H HG13 . VAL A 1 60 ? 9.887   -5.580  -0.810  1.00 0.00 ? 60 VAL A HG13 2  
ATOM 2285  H HG21 . VAL A 1 60 ? 11.127  -3.715  0.415   1.00 0.00 ? 60 VAL A HG21 2  
ATOM 2286  H HG22 . VAL A 1 60 ? 10.303  -2.924  1.776   1.00 0.00 ? 60 VAL A HG22 2  
ATOM 2287  H HG23 . VAL A 1 60 ? 9.604   -2.843  0.144   1.00 0.00 ? 60 VAL A HG23 2  
ATOM 2288  N N    . ASN A 1 61 ? 8.429   -2.860  3.801   1.00 0.00 ? 61 ASN A N    2  
ATOM 2289  C CA   . ASN A 1 61 ? 8.784   -2.501  5.177   1.00 0.00 ? 61 ASN A CA   2  
ATOM 2290  C C    . ASN A 1 61 ? 7.804   -1.482  5.770   1.00 0.00 ? 61 ASN A C    2  
ATOM 2291  O O    . ASN A 1 61 ? 8.103   -0.878  6.800   1.00 0.00 ? 61 ASN A O    2  
ATOM 2292  C CB   . ASN A 1 61 ? 10.226  -1.968  5.215   1.00 0.00 ? 61 ASN A CB   2  
ATOM 2293  C CG   . ASN A 1 61 ? 10.397  -0.694  4.384   1.00 0.00 ? 61 ASN A CG   2  
ATOM 2294  O OD1  . ASN A 1 61 ? 9.452   0.063   4.185   1.00 0.00 ? 61 ASN A OD1  2  
ATOM 2295  N ND2  . ASN A 1 61 ? 11.617  -0.460  3.902   1.00 0.00 ? 61 ASN A ND2  2  
ATOM 2296  H H    . ASN A 1 61 ? 8.157   -2.123  3.161   1.00 0.00 ? 61 ASN A H    2  
ATOM 2297  H HA   . ASN A 1 61 ? 8.740   -3.399  5.793   1.00 0.00 ? 61 ASN A HA   2  
ATOM 2298  H HB2  . ASN A 1 61 ? 10.497  -1.754  6.249   1.00 0.00 ? 61 ASN A HB2  2  
ATOM 2299  H HB3  . ASN A 1 61 ? 10.895  -2.737  4.826   1.00 0.00 ? 61 ASN A HB3  2  
ATOM 2300  H HD21 . ASN A 1 61 ? 12.374  -1.091  4.117   1.00 0.00 ? 61 ASN A HD21 2  
ATOM 2301  H HD22 . ASN A 1 61 ? 11.779  0.347   3.319   1.00 0.00 ? 61 ASN A HD22 2  
ATOM 2302  N N    . ASN A 1 62 ? 6.636   -1.291  5.143   1.00 0.00 ? 62 ASN A N    2  
ATOM 2303  C CA   . ASN A 1 62 ? 5.645   -0.365  5.668   1.00 0.00 ? 62 ASN A CA   2  
ATOM 2304  C C    . ASN A 1 62 ? 5.068   -0.954  6.967   1.00 0.00 ? 62 ASN A C    2  
ATOM 2305  O O    . ASN A 1 62 ? 4.722   -2.135  6.999   1.00 0.00 ? 62 ASN A O    2  
ATOM 2306  C CB   . ASN A 1 62 ? 4.549   -0.133  4.629   1.00 0.00 ? 62 ASN A CB   2  
ATOM 2307  C CG   . ASN A 1 62 ? 3.556   0.916   5.111   1.00 0.00 ? 62 ASN A CG   2  
ATOM 2308  O OD1  . ASN A 1 62 ? 2.646   0.610   5.878   1.00 0.00 ? 62 ASN A OD1  2  
ATOM 2309  N ND2  . ASN A 1 62 ? 3.736   2.159   4.665   1.00 0.00 ? 62 ASN A ND2  2  
ATOM 2310  H H    . ASN A 1 62 ? 6.428   -1.796  4.294   1.00 0.00 ? 62 ASN A H    2  
ATOM 2311  H HA   . ASN A 1 62 ? 6.133   0.582   5.878   1.00 0.00 ? 62 ASN A HA   2  
ATOM 2312  H HB2  . ASN A 1 62 ? 5.002   0.204   3.697   1.00 0.00 ? 62 ASN A HB2  2  
ATOM 2313  H HB3  . ASN A 1 62 ? 4.025   -1.063  4.451   1.00 0.00 ? 62 ASN A HB3  2  
ATOM 2314  H HD21 . ASN A 1 62 ? 4.496   2.362   4.034   1.00 0.00 ? 62 ASN A HD21 2  
ATOM 2315  H HD22 . ASN A 1 62 ? 3.110   2.894   4.957   1.00 0.00 ? 62 ASN A HD22 2  
ATOM 2316  N N    . PRO A 1 63 ? 4.973   -0.143  8.045   1.00 0.00 ? 63 PRO A N    2  
ATOM 2317  C CA   . PRO A 1 63 ? 4.499   -0.605  9.339   1.00 0.00 ? 63 PRO A CA   2  
ATOM 2318  C C    . PRO A 1 63 ? 3.136   -1.304  9.270   1.00 0.00 ? 63 PRO A C    2  
ATOM 2319  O O    . PRO A 1 63 ? 2.845   -2.145  10.122  1.00 0.00 ? 63 PRO A O    2  
ATOM 2320  C CB   . PRO A 1 63 ? 4.434   0.641   10.230  1.00 0.00 ? 63 PRO A CB   2  
ATOM 2321  C CG   . PRO A 1 63 ? 5.012   1.805   9.419   1.00 0.00 ? 63 PRO A CG   2  
ATOM 2322  C CD   . PRO A 1 63 ? 5.351   1.258   8.035   1.00 0.00 ? 63 PRO A CD   2  
ATOM 2323  H HA   . PRO A 1 63 ? 5.231   -1.300  9.755   1.00 0.00 ? 63 PRO A HA   2  
ATOM 2324  H HB2  . PRO A 1 63 ? 3.398   0.855   10.500  1.00 0.00 ? 63 PRO A HB2  2  
ATOM 2325  H HB3  . PRO A 1 63 ? 5.027   0.485   11.132  1.00 0.00 ? 63 PRO A HB3  2  
ATOM 2326  H HG2  . PRO A 1 63 ? 4.274   2.604   9.333   1.00 0.00 ? 63 PRO A HG2  2  
ATOM 2327  H HG3  . PRO A 1 63 ? 5.914   2.183   9.901   1.00 0.00 ? 63 PRO A HG3  2  
ATOM 2328  H HD2  . PRO A 1 63 ? 4.789   1.797   7.273   1.00 0.00 ? 63 PRO A HD2  2  
ATOM 2329  H HD3  . PRO A 1 63 ? 6.422   1.356   7.851   1.00 0.00 ? 63 PRO A HD3  2  
ATOM 2330  N N    . LYS A 1 64 ? 2.294   -0.961  8.278   1.00 0.00 ? 64 LYS A N    2  
ATOM 2331  C CA   . LYS A 1 64 ? 0.961   -1.550  8.170   1.00 0.00 ? 64 LYS A CA   2  
ATOM 2332  C C    . LYS A 1 64 ? 0.838   -2.450  6.935   1.00 0.00 ? 64 LYS A C    2  
ATOM 2333  O O    . LYS A 1 64 ? -0.252  -2.585  6.384   1.00 0.00 ? 64 LYS A O    2  
ATOM 2334  C CB   . LYS A 1 64 ? -0.085  -0.432  8.138   1.00 0.00 ? 64 LYS A CB   2  
ATOM 2335  C CG   . LYS A 1 64 ? 0.105   0.490   9.352   1.00 0.00 ? 64 LYS A CG   2  
ATOM 2336  C CD   . LYS A 1 64 ? -1.255  0.996   9.856   1.00 0.00 ? 64 LYS A CD   2  
ATOM 2337  C CE   . LYS A 1 64 ? -1.692  0.193   11.091  1.00 0.00 ? 64 LYS A CE   2  
ATOM 2338  N NZ   . LYS A 1 64 ? -1.854  -1.240  10.779  1.00 0.00 ? 64 LYS A NZ   2  
ATOM 2339  H H    . LYS A 1 64 ? 2.575   -0.275  7.588   1.00 0.00 ? 64 LYS A H    2  
ATOM 2340  H HA   . LYS A 1 64 ? 0.775   -2.159  9.049   1.00 0.00 ? 64 LYS A HA   2  
ATOM 2341  H HB2  . LYS A 1 64 ? 0.026   0.147   7.220   1.00 0.00 ? 64 LYS A HB2  2  
ATOM 2342  H HB3  . LYS A 1 64 ? -1.080  -0.875  8.166   1.00 0.00 ? 64 LYS A HB3  2  
ATOM 2343  H HG2  . LYS A 1 64 ? 0.606   -0.056  10.151  1.00 0.00 ? 64 LYS A HG2  2  
ATOM 2344  H HG3  . LYS A 1 64 ? 0.720   1.342   9.060   1.00 0.00 ? 64 LYS A HG3  2  
ATOM 2345  H HD2  . LYS A 1 64 ? -1.166  2.049   10.130  1.00 0.00 ? 64 LYS A HD2  2  
ATOM 2346  H HD3  . LYS A 1 64 ? -2.002  0.894   9.069   1.00 0.00 ? 64 LYS A HD3  2  
ATOM 2347  H HE2  . LYS A 1 64 ? -0.940  0.304   11.873  1.00 0.00 ? 64 LYS A HE2  2  
ATOM 2348  H HE3  . LYS A 1 64 ? -2.642  0.587   11.453  1.00 0.00 ? 64 LYS A HE3  2  
ATOM 2349  H HZ1  . LYS A 1 64 ? -0.999  -1.602  10.381  1.00 0.00 ? 64 LYS A HZ1  2  
ATOM 2350  H HZ2  . LYS A 1 64 ? -2.605  -1.359  10.116  1.00 0.00 ? 64 LYS A HZ2  2  
ATOM 2351  H HZ3  . LYS A 1 64 ? -2.071  -1.751  11.629  1.00 0.00 ? 64 LYS A HZ3  2  
ATOM 2352  N N    . ILE A 1 65 ? 1.947   -3.082  6.508   1.00 0.00 ? 65 ILE A N    2  
ATOM 2353  C CA   . ILE A 1 65 ? 1.926   -4.007  5.373   1.00 0.00 ? 65 ILE A CA   2  
ATOM 2354  C C    . ILE A 1 65 ? 2.731   -5.257  5.733   1.00 0.00 ? 65 ILE A C    2  
ATOM 2355  O O    . ILE A 1 65 ? 3.673   -5.186  6.522   1.00 0.00 ? 65 ILE A O    2  
ATOM 2356  C CB   . ILE A 1 65 ? 2.510   -3.336  4.113   1.00 0.00 ? 65 ILE A CB   2  
ATOM 2357  C CG1  . ILE A 1 65 ? 1.718   -2.060  3.744   1.00 0.00 ? 65 ILE A CG1  2  
ATOM 2358  C CG2  . ILE A 1 65 ? 2.478   -4.319  2.935   1.00 0.00 ? 65 ILE A CG2  2  
ATOM 2359  C CD1  . ILE A 1 65 ? 0.350   -2.413  3.144   1.00 0.00 ? 65 ILE A CD1  2  
ATOM 2360  H H    . ILE A 1 65 ? 2.828   -2.930  6.984   1.00 0.00 ? 65 ILE A H    2  
ATOM 2361  H HA   . ILE A 1 65 ? 0.900   -4.304  5.175   1.00 0.00 ? 65 ILE A HA   2  
ATOM 2362  H HB   . ILE A 1 65 ? 3.545   -3.065  4.311   1.00 0.00 ? 65 ILE A HB   2  
ATOM 2363  H HG12 . ILE A 1 65 ? 1.574   -1.450  4.632   1.00 0.00 ? 65 ILE A HG12 2  
ATOM 2364  H HG13 . ILE A 1 65 ? 2.287   -1.489  3.011   1.00 0.00 ? 65 ILE A HG13 2  
ATOM 2365  H HG21 . ILE A 1 65 ? 2.663   -3.780  2.007   1.00 0.00 ? 65 ILE A HG21 2  
ATOM 2366  H HG22 . ILE A 1 65 ? 1.502   -4.801  2.885   1.00 0.00 ? 65 ILE A HG22 2  
ATOM 2367  H HG23 . ILE A 1 65 ? 3.250   -5.077  3.070   1.00 0.00 ? 65 ILE A HG23 2  
ATOM 2368  H HD11 . ILE A 1 65 ? 0.486   -2.881  2.170   1.00 0.00 ? 65 ILE A HD11 2  
ATOM 2369  H HD12 . ILE A 1 65 ? -0.179  -3.094  3.804   1.00 0.00 ? 65 ILE A HD12 2  
ATOM 2370  H HD13 . ILE A 1 65 ? -0.235  -1.501  3.025   1.00 0.00 ? 65 ILE A HD13 2  
ATOM 2371  N N    . GLU A 1 66 ? 2.350   -6.399  5.147   1.00 0.00 ? 66 GLU A N    2  
ATOM 2372  C CA   . GLU A 1 66 ? 3.023   -7.668  5.373   1.00 0.00 ? 66 GLU A CA   2  
ATOM 2373  C C    . GLU A 1 66 ? 3.052   -8.448  4.062   1.00 0.00 ? 66 GLU A C    2  
ATOM 2374  O O    . GLU A 1 66 ? 2.138   -8.322  3.248   1.00 0.00 ? 66 GLU A O    2  
ATOM 2375  C CB   . GLU A 1 66 ? 2.273   -8.451  6.462   1.00 0.00 ? 66 GLU A CB   2  
ATOM 2376  C CG   . GLU A 1 66 ? 3.011   -9.755  6.796   1.00 0.00 ? 66 GLU A CG   2  
ATOM 2377  C CD   . GLU A 1 66 ? 4.449   -9.482  7.221   1.00 0.00 ? 66 GLU A CD   2  
ATOM 2378  O OE1  . GLU A 1 66 ? 4.635   -9.129  8.407   1.00 0.00 ? 66 GLU A OE1  2  
ATOM 2379  O OE2  . GLU A 1 66 ? 5.335   -9.628  6.351   1.00 0.00 ? 66 GLU A OE2  2  
ATOM 2380  H H    . GLU A 1 66 ? 1.563   -6.391  4.513   1.00 0.00 ? 66 GLU A H    2  
ATOM 2381  H HA   . GLU A 1 66 ? 4.045   -7.477  5.700   1.00 0.00 ? 66 GLU A HA   2  
ATOM 2382  H HB2  . GLU A 1 66 ? 2.202   -7.843  7.359   1.00 0.00 ? 66 GLU A HB2  2  
ATOM 2383  H HB3  . GLU A 1 66 ? 1.268   -8.688  6.109   1.00 0.00 ? 66 GLU A HB3  2  
ATOM 2384  H HG2  . GLU A 1 66 ? 2.491   -10.259 7.611   1.00 0.00 ? 66 GLU A HG2  2  
ATOM 2385  H HG3  . GLU A 1 66 ? 3.012   -10.405 5.922   1.00 0.00 ? 66 GLU A HG3  2  
ATOM 2386  N N    . VAL A 1 67 ? 4.099   -9.250  3.858   1.00 0.00 ? 67 VAL A N    2  
ATOM 2387  C CA   . VAL A 1 67 ? 4.243   -10.040 2.647   1.00 0.00 ? 67 VAL A CA   2  
ATOM 2388  C C    . VAL A 1 67 ? 3.642   -11.425 2.879   1.00 0.00 ? 67 VAL A C    2  
ATOM 2389  O O    . VAL A 1 67 ? 4.182   -12.215 3.650   1.00 0.00 ? 67 VAL A O    2  
ATOM 2390  C CB   . VAL A 1 67 ? 5.727   -10.133 2.269   1.00 0.00 ? 67 VAL A CB   2  
ATOM 2391  C CG1  . VAL A 1 67 ? 5.884   -10.941 0.976   1.00 0.00 ? 67 VAL A CG1  2  
ATOM 2392  C CG2  . VAL A 1 67 ? 6.287   -8.723  2.057   1.00 0.00 ? 67 VAL A CG2  2  
ATOM 2393  H H    . VAL A 1 67 ? 4.824   -9.318  4.568   1.00 0.00 ? 67 VAL A H    2  
ATOM 2394  H HA   . VAL A 1 67 ? 3.705   -9.551  1.835   1.00 0.00 ? 67 VAL A HA   2  
ATOM 2395  H HB   . VAL A 1 67 ? 6.278   -10.623 3.073   1.00 0.00 ? 67 VAL A HB   2  
ATOM 2396  H HG11 . VAL A 1 67 ? 6.931   -10.939 0.672   1.00 0.00 ? 67 VAL A HG11 2  
ATOM 2397  H HG12 . VAL A 1 67 ? 5.277   -10.491 0.189   1.00 0.00 ? 67 VAL A HG12 2  
ATOM 2398  H HG13 . VAL A 1 67 ? 5.560   -11.968 1.143   1.00 0.00 ? 67 VAL A HG13 2  
ATOM 2399  H HG21 . VAL A 1 67 ? 7.315   -8.788  1.699   1.00 0.00 ? 67 VAL A HG21 2  
ATOM 2400  H HG22 . VAL A 1 67 ? 6.267   -8.175  3.000   1.00 0.00 ? 67 VAL A HG22 2  
ATOM 2401  H HG23 . VAL A 1 67 ? 5.679   -8.196  1.320   1.00 0.00 ? 67 VAL A HG23 2  
ATOM 2402  N N    . ILE A 1 68 ? 2.516   -11.710 2.209   1.00 0.00 ? 68 ILE A N    2  
ATOM 2403  C CA   . ILE A 1 68 ? 1.828   -12.988 2.344   1.00 0.00 ? 68 ILE A CA   2  
ATOM 2404  C C    . ILE A 1 68 ? 1.560   -13.555 0.954   1.00 0.00 ? 68 ILE A C    2  
ATOM 2405  O O    . ILE A 1 68 ? 0.980   -12.873 0.110   1.00 0.00 ? 68 ILE A O    2  
ATOM 2406  C CB   . ILE A 1 68 ? 0.515   -12.788 3.119   1.00 0.00 ? 68 ILE A CB   2  
ATOM 2407  C CG1  . ILE A 1 68 ? 0.810   -12.105 4.467   1.00 0.00 ? 68 ILE A CG1  2  
ATOM 2408  C CG2  . ILE A 1 68 ? -0.148  -14.152 3.360   1.00 0.00 ? 68 ILE A CG2  2  
ATOM 2409  C CD1  . ILE A 1 68 ? -0.464  -12.017 5.311   1.00 0.00 ? 68 ILE A CD1  2  
ATOM 2410  H H    . ILE A 1 68 ? 2.120   -11.019 1.582   1.00 0.00 ? 68 ILE A H    2  
ATOM 2411  H HA   . ILE A 1 68 ? 2.462   -13.684 2.894   1.00 0.00 ? 68 ILE A HA   2  
ATOM 2412  H HB   . ILE A 1 68 ? -0.157  -12.158 2.536   1.00 0.00 ? 68 ILE A HB   2  
ATOM 2413  H HG12 . ILE A 1 68 ? 1.563   -12.678 5.010   1.00 0.00 ? 68 ILE A HG12 2  
ATOM 2414  H HG13 . ILE A 1 68 ? 1.186   -11.098 4.286   1.00 0.00 ? 68 ILE A HG13 2  
ATOM 2415  H HG21 . ILE A 1 68 ? -0.260  -14.677 2.412   1.00 0.00 ? 68 ILE A HG21 2  
ATOM 2416  H HG22 . ILE A 1 68 ? 0.471   -14.746 4.033   1.00 0.00 ? 68 ILE A HG22 2  
ATOM 2417  H HG23 . ILE A 1 68 ? -1.132  -14.007 3.806   1.00 0.00 ? 68 ILE A HG23 2  
ATOM 2418  H HD11 . ILE A 1 68 ? -0.311  -11.306 6.124   1.00 0.00 ? 68 ILE A HD11 2  
ATOM 2419  H HD12 . ILE A 1 68 ? -0.697  -12.996 5.728   1.00 0.00 ? 68 ILE A HD12 2  
ATOM 2420  H HD13 . ILE A 1 68 ? -1.293  -11.680 4.688   1.00 0.00 ? 68 ILE A HD13 2  
ATOM 2421  N N    . ASP A 1 69 ? 1.992   -14.806 0.719   1.00 0.00 ? 69 ASP A N    2  
ATOM 2422  C CA   . ASP A 1 69 ? 1.816   -15.474 -0.571  1.00 0.00 ? 69 ASP A CA   2  
ATOM 2423  C C    . ASP A 1 69 ? 2.481   -14.648 -1.686  1.00 0.00 ? 69 ASP A C    2  
ATOM 2424  O O    . ASP A 1 69 ? 2.070   -14.707 -2.845  1.00 0.00 ? 69 ASP A O    2  
ATOM 2425  C CB   . ASP A 1 69 ? 0.312   -15.682 -0.831  1.00 0.00 ? 69 ASP A CB   2  
ATOM 2426  C CG   . ASP A 1 69 ? 0.066   -16.481 -2.105  1.00 0.00 ? 69 ASP A CG   2  
ATOM 2427  O OD1  . ASP A 1 69 ? 0.728   -17.528 -2.260  1.00 0.00 ? 69 ASP A OD1  2  
ATOM 2428  O OD2  . ASP A 1 69 ? -0.783  -16.025 -2.904  1.00 0.00 ? 69 ASP A OD2  2  
ATOM 2429  H H    . ASP A 1 69 ? 2.460   -15.315 1.455   1.00 0.00 ? 69 ASP A H    2  
ATOM 2430  H HA   . ASP A 1 69 ? 2.302   -16.450 -0.524  1.00 0.00 ? 69 ASP A HA   2  
ATOM 2431  H HB2  . ASP A 1 69 ? -0.123  -16.220 0.013   1.00 0.00 ? 69 ASP A HB2  2  
ATOM 2432  H HB3  . ASP A 1 69 ? -0.176  -14.713 -0.922  1.00 0.00 ? 69 ASP A HB3  2  
ATOM 2433  N N    . GLY A 1 70 ? 3.513   -13.870 -1.326  1.00 0.00 ? 70 GLY A N    2  
ATOM 2434  C CA   . GLY A 1 70 ? 4.221   -13.030 -2.282  1.00 0.00 ? 70 GLY A CA   2  
ATOM 2435  C C    . GLY A 1 70 ? 3.446   -11.734 -2.550  1.00 0.00 ? 70 GLY A C    2  
ATOM 2436  O O    . GLY A 1 70 ? 3.996   -10.800 -3.131  1.00 0.00 ? 70 GLY A O    2  
ATOM 2437  H H    . GLY A 1 70 ? 3.817   -13.858 -0.364  1.00 0.00 ? 70 GLY A H    2  
ATOM 2438  H HA2  . GLY A 1 70 ? 5.204   -12.782 -1.879  1.00 0.00 ? 70 GLY A HA2  2  
ATOM 2439  H HA3  . GLY A 1 70 ? 4.346   -13.573 -3.219  1.00 0.00 ? 70 GLY A HA3  2  
ATOM 2440  N N    . LYS A 1 71 ? 2.173   -11.677 -2.128  1.00 0.00 ? 71 LYS A N    2  
ATOM 2441  C CA   . LYS A 1 71 ? 1.337   -10.504 -2.331  1.00 0.00 ? 71 LYS A CA   2  
ATOM 2442  C C    . LYS A 1 71 ? 1.472   -9.593  -1.111  1.00 0.00 ? 71 LYS A C    2  
ATOM 2443  O O    . LYS A 1 71 ? 2.119   -9.962  -0.127  1.00 0.00 ? 71 LYS A O    2  
ATOM 2444  C CB   . LYS A 1 71 ? -0.132  -10.917 -2.545  1.00 0.00 ? 71 LYS A CB   2  
ATOM 2445  C CG   . LYS A 1 71 ? -0.241  -12.272 -3.267  1.00 0.00 ? 71 LYS A CG   2  
ATOM 2446  C CD   . LYS A 1 71 ? 0.541   -12.240 -4.588  1.00 0.00 ? 71 LYS A CD   2  
ATOM 2447  C CE   . LYS A 1 71 ? 0.053   -13.360 -5.511  1.00 0.00 ? 71 LYS A CE   2  
ATOM 2448  N NZ   . LYS A 1 71 ? 0.290   -14.688 -4.913  1.00 0.00 ? 71 LYS A NZ   2  
ATOM 2449  H H    . LYS A 1 71 ? 1.769   -12.468 -1.649  1.00 0.00 ? 71 LYS A H    2  
ATOM 2450  H HA   . LYS A 1 71 ? 1.679   -9.963  -3.219  1.00 0.00 ? 71 LYS A HA   2  
ATOM 2451  H HB2  . LYS A 1 71 ? -0.629  -10.986 -1.582  1.00 0.00 ? 71 LYS A HB2  2  
ATOM 2452  H HB3  . LYS A 1 71 ? -0.629  -10.158 -3.144  1.00 0.00 ? 71 LYS A HB3  2  
ATOM 2453  H HG2  . LYS A 1 71 ? 0.150   -13.061 -2.627  1.00 0.00 ? 71 LYS A HG2  2  
ATOM 2454  H HG3  . LYS A 1 71 ? -1.291  -12.475 -3.477  1.00 0.00 ? 71 LYS A HG3  2  
ATOM 2455  H HD2  . LYS A 1 71 ? 0.391   -11.278 -5.072  1.00 0.00 ? 71 LYS A HD2  2  
ATOM 2456  H HD3  . LYS A 1 71 ? 1.602   -12.379 -4.391  1.00 0.00 ? 71 LYS A HD3  2  
ATOM 2457  H HE2  . LYS A 1 71 ? -1.016  -13.236 -5.695  1.00 0.00 ? 71 LYS A HE2  2  
ATOM 2458  H HE3  . LYS A 1 71 ? 0.587   -13.296 -6.460  1.00 0.00 ? 71 LYS A HE3  2  
ATOM 2459  H HZ1  . LYS A 1 71 ? 0.183   -15.401 -5.618  1.00 0.00 ? 71 LYS A HZ1  2  
ATOM 2460  H HZ2  . LYS A 1 71 ? -0.378  -14.853 -4.165  1.00 0.00 ? 71 LYS A HZ2  2  
ATOM 2461  H HZ3  . LYS A 1 71 ? 1.229   -14.727 -4.532  1.00 0.00 ? 71 LYS A HZ3  2  
ATOM 2462  N N    . TYR A 1 72 ? 0.866   -8.406  -1.174  1.00 0.00 ? 72 TYR A N    2  
ATOM 2463  C CA   . TYR A 1 72 ? 0.941   -7.436  -0.095  1.00 0.00 ? 72 TYR A CA   2  
ATOM 2464  C C    . TYR A 1 72 ? -0.382  -7.400  0.664   1.00 0.00 ? 72 TYR A C    2  
ATOM 2465  O O    . TYR A 1 72 ? -1.421  -7.074  0.094   1.00 0.00 ? 72 TYR A O    2  
ATOM 2466  C CB   . TYR A 1 72 ? 1.281   -6.068  -0.683  1.00 0.00 ? 72 TYR A CB   2  
ATOM 2467  C CG   . TYR A 1 72 ? 2.570   -6.083  -1.475  1.00 0.00 ? 72 TYR A CG   2  
ATOM 2468  C CD1  . TYR A 1 72 ? 3.796   -5.839  -0.832  1.00 0.00 ? 72 TYR A CD1  2  
ATOM 2469  C CD2  . TYR A 1 72 ? 2.545   -6.364  -2.854  1.00 0.00 ? 72 TYR A CD2  2  
ATOM 2470  C CE1  . TYR A 1 72 ? 4.994   -5.872  -1.566  1.00 0.00 ? 72 TYR A CE1  2  
ATOM 2471  C CE2  . TYR A 1 72 ? 3.742   -6.402  -3.585  1.00 0.00 ? 72 TYR A CE2  2  
ATOM 2472  C CZ   . TYR A 1 72 ? 4.966   -6.156  -2.942  1.00 0.00 ? 72 TYR A CZ   2  
ATOM 2473  O OH   . TYR A 1 72 ? 6.127   -6.193  -3.654  1.00 0.00 ? 72 TYR A OH   2  
ATOM 2474  H H    . TYR A 1 72 ? 0.337   -8.160  -2.000  1.00 0.00 ? 72 TYR A H    2  
ATOM 2475  H HA   . TYR A 1 72 ? 1.736   -7.725  0.594   1.00 0.00 ? 72 TYR A HA   2  
ATOM 2476  H HB2  . TYR A 1 72 ? 0.469   -5.755  -1.339  1.00 0.00 ? 72 TYR A HB2  2  
ATOM 2477  H HB3  . TYR A 1 72 ? 1.373   -5.347  0.130   1.00 0.00 ? 72 TYR A HB3  2  
ATOM 2478  H HD1  . TYR A 1 72 ? 3.819   -5.631  0.229   1.00 0.00 ? 72 TYR A HD1  2  
ATOM 2479  H HD2  . TYR A 1 72 ? 1.604   -6.557  -3.349  1.00 0.00 ? 72 TYR A HD2  2  
ATOM 2480  H HE1  . TYR A 1 72 ? 5.935   -5.686  -1.071  1.00 0.00 ? 72 TYR A HE1  2  
ATOM 2481  H HE2  . TYR A 1 72 ? 3.722   -6.623  -4.642  1.00 0.00 ? 72 TYR A HE2  2  
ATOM 2482  H HH   . TYR A 1 72 ? 6.864   -5.776  -3.194  1.00 0.00 ? 72 TYR A HH   2  
ATOM 2483  N N    . ALA A 1 73 ? -0.329  -7.740  1.956   1.00 0.00 ? 73 ALA A N    2  
ATOM 2484  C CA   . ALA A 1 73 ? -1.497  -7.748  2.820   1.00 0.00 ? 73 ALA A CA   2  
ATOM 2485  C C    . ALA A 1 73 ? -1.371  -6.633  3.847   1.00 0.00 ? 73 ALA A C    2  
ATOM 2486  O O    . ALA A 1 73 ? -0.265  -6.294  4.255   1.00 0.00 ? 73 ALA A O    2  
ATOM 2487  C CB   . ALA A 1 73 ? -1.585  -9.102  3.523   1.00 0.00 ? 73 ALA A CB   2  
ATOM 2488  H H    . ALA A 1 73 ? 0.560   -8.001  2.362   1.00 0.00 ? 73 ALA A H    2  
ATOM 2489  H HA   . ALA A 1 73 ? -2.397  -7.592  2.226   1.00 0.00 ? 73 ALA A HA   2  
ATOM 2490  H HB1  . ALA A 1 73 ? -2.485  -9.137  4.136   1.00 0.00 ? 73 ALA A HB1  2  
ATOM 2491  H HB2  . ALA A 1 73 ? -1.619  -9.896  2.780   1.00 0.00 ? 73 ALA A HB2  2  
ATOM 2492  H HB3  . ALA A 1 73 ? -0.708  -9.238  4.157   1.00 0.00 ? 73 ALA A HB3  2  
ATOM 2493  N N    . PHE A 1 74 ? -2.499  -6.064  4.273   1.00 0.00 ? 74 PHE A N    2  
ATOM 2494  C CA   . PHE A 1 74 ? -2.486  -5.013  5.273   1.00 0.00 ? 74 PHE A CA   2  
ATOM 2495  C C    . PHE A 1 74 ? -2.220  -5.630  6.641   1.00 0.00 ? 74 PHE A C    2  
ATOM 2496  O O    . PHE A 1 74 ? -2.972  -6.492  7.088   1.00 0.00 ? 74 PHE A O    2  
ATOM 2497  C CB   . PHE A 1 74 ? -3.819  -4.271  5.263   1.00 0.00 ? 74 PHE A CB   2  
ATOM 2498  C CG   . PHE A 1 74 ? -3.941  -3.240  6.367   1.00 0.00 ? 74 PHE A CG   2  
ATOM 2499  C CD1  . PHE A 1 74 ? -3.488  -1.926  6.162   1.00 0.00 ? 74 PHE A CD1  2  
ATOM 2500  C CD2  . PHE A 1 74 ? -4.512  -3.596  7.599   1.00 0.00 ? 74 PHE A CD2  2  
ATOM 2501  C CE1  . PHE A 1 74 ? -3.629  -0.969  7.179   1.00 0.00 ? 74 PHE A CE1  2  
ATOM 2502  C CE2  . PHE A 1 74 ? -4.665  -2.639  8.612   1.00 0.00 ? 74 PHE A CE2  2  
ATOM 2503  C CZ   . PHE A 1 74 ? -4.231  -1.324  8.400   1.00 0.00 ? 74 PHE A CZ   2  
ATOM 2504  H H    . PHE A 1 74 ? -3.388  -6.370  3.903   1.00 0.00 ? 74 PHE A H    2  
ATOM 2505  H HA   . PHE A 1 74 ? -1.690  -4.308  5.039   1.00 0.00 ? 74 PHE A HA   2  
ATOM 2506  H HB2  . PHE A 1 74 ? -3.929  -3.773  4.307   1.00 0.00 ? 74 PHE A HB2  2  
ATOM 2507  H HB3  . PHE A 1 74 ? -4.629  -4.991  5.365   1.00 0.00 ? 74 PHE A HB3  2  
ATOM 2508  H HD1  . PHE A 1 74 ? -3.037  -1.650  5.220   1.00 0.00 ? 74 PHE A HD1  2  
ATOM 2509  H HD2  . PHE A 1 74 ? -4.842  -4.604  7.764   1.00 0.00 ? 74 PHE A HD2  2  
ATOM 2510  H HE1  . PHE A 1 74 ? -3.287  0.042   7.017   1.00 0.00 ? 74 PHE A HE1  2  
ATOM 2511  H HE2  . PHE A 1 74 ? -5.122  -2.915  9.551   1.00 0.00 ? 74 PHE A HE2  2  
ATOM 2512  H HZ   . PHE A 1 74 ? -4.366  -0.586  9.174   1.00 0.00 ? 74 PHE A HZ   2  
ATOM 2513  N N    . LYS A 1 75 ? -1.146  -5.183  7.298   1.00 0.00 ? 75 LYS A N    2  
ATOM 2514  C CA   . LYS A 1 75 ? -0.770  -5.685  8.608   1.00 0.00 ? 75 LYS A CA   2  
ATOM 2515  C C    . LYS A 1 75 ? -1.487  -4.866  9.688   1.00 0.00 ? 75 LYS A C    2  
ATOM 2516  O O    . LYS A 1 75 ? -1.241  -3.665  9.798   1.00 0.00 ? 75 LYS A O    2  
ATOM 2517  C CB   . LYS A 1 75 ? 0.753   -5.573  8.759   1.00 0.00 ? 75 LYS A CB   2  
ATOM 2518  C CG   . LYS A 1 75 ? 1.241   -6.475  9.895   1.00 0.00 ? 75 LYS A CG   2  
ATOM 2519  C CD   . LYS A 1 75 ? 2.772   -6.437  9.951   1.00 0.00 ? 75 LYS A CD   2  
ATOM 2520  C CE   . LYS A 1 75 ? 3.283   -7.500  10.929  1.00 0.00 ? 75 LYS A CE   2  
ATOM 2521  N NZ   . LYS A 1 75 ? 4.720   -7.759  10.723  1.00 0.00 ? 75 LYS A NZ   2  
ATOM 2522  H H    . LYS A 1 75 ? -0.568  -4.467  6.878   1.00 0.00 ? 75 LYS A H    2  
ATOM 2523  H HA   . LYS A 1 75 ? -1.054  -6.732  8.683   1.00 0.00 ? 75 LYS A HA   2  
ATOM 2524  H HB2  . LYS A 1 75 ? 1.225   -5.882  7.829   1.00 0.00 ? 75 LYS A HB2  2  
ATOM 2525  H HB3  . LYS A 1 75 ? 1.024   -4.540  8.973   1.00 0.00 ? 75 LYS A HB3  2  
ATOM 2526  H HG2  . LYS A 1 75 ? 0.831   -6.125  10.843  1.00 0.00 ? 75 LYS A HG2  2  
ATOM 2527  H HG3  . LYS A 1 75 ? 0.909   -7.498  9.711   1.00 0.00 ? 75 LYS A HG3  2  
ATOM 2528  H HD2  . LYS A 1 75 ? 3.176   -6.636  8.957   1.00 0.00 ? 75 LYS A HD2  2  
ATOM 2529  H HD3  . LYS A 1 75 ? 3.099   -5.450  10.281  1.00 0.00 ? 75 LYS A HD3  2  
ATOM 2530  H HE2  . LYS A 1 75 ? 3.122   -7.156  11.951  1.00 0.00 ? 75 LYS A HE2  2  
ATOM 2531  H HE3  . LYS A 1 75 ? 2.731   -8.428  10.773  1.00 0.00 ? 75 LYS A HE3  2  
ATOM 2532  H HZ1  . LYS A 1 75 ? 5.048   -8.413  11.417  1.00 0.00 ? 75 LYS A HZ1  2  
ATOM 2533  H HZ2  . LYS A 1 75 ? 4.861   -8.154  9.796   1.00 0.00 ? 75 LYS A HZ2  2  
ATOM 2534  H HZ3  . LYS A 1 75 ? 5.235   -6.895  10.802  1.00 0.00 ? 75 LYS A HZ3  2  
ATOM 2535  N N    . PRO A 1 76 ? -2.375  -5.493  10.491  1.00 0.00 ? 76 PRO A N    2  
ATOM 2536  C CA   . PRO A 1 76 ? -3.096  -4.795  11.534  1.00 0.00 ? 76 PRO A CA   2  
ATOM 2537  C C    . PRO A 1 76 ? -2.127  -4.319  12.613  1.00 0.00 ? 76 PRO A C    2  
ATOM 2538  O O    . PRO A 1 76 ? -2.063  -3.123  12.903  1.00 0.00 ? 76 PRO A O    2  
ATOM 2539  C CB   . PRO A 1 76 ? -4.104  -5.803  12.093  1.00 0.00 ? 76 PRO A CB   2  
ATOM 2540  C CG   . PRO A 1 76 ? -3.754  -7.163  11.482  1.00 0.00 ? 76 PRO A CG   2  
ATOM 2541  C CD   . PRO A 1 76 ? -2.700  -6.903  10.404  1.00 0.00 ? 76 PRO A CD   2  
ATOM 2542  H HA   . PRO A 1 76 ? -3.625  -3.941  11.110  1.00 0.00 ? 76 PRO A HA   2  
ATOM 2543  H HB2  . PRO A 1 76 ? -4.033  -5.849  13.180  1.00 0.00 ? 76 PRO A HB2  2  
ATOM 2544  H HB3  . PRO A 1 76 ? -5.115  -5.515  11.801  1.00 0.00 ? 76 PRO A HB3  2  
ATOM 2545  H HG2  . PRO A 1 76 ? -3.346  -7.823  12.248  1.00 0.00 ? 76 PRO A HG2  2  
ATOM 2546  H HG3  . PRO A 1 76 ? -4.641  -7.614  11.037  1.00 0.00 ? 76 PRO A HG3  2  
ATOM 2547  H HD2  . PRO A 1 76 ? -1.814  -7.509  10.594  1.00 0.00 ? 76 PRO A HD2  2  
ATOM 2548  H HD3  . PRO A 1 76 ? -3.111  -7.136  9.422   1.00 0.00 ? 76 PRO A HD3  2  
ATOM 2549  N N    . LYS A 1 77 ? -1.378  -5.273  13.197  1.00 0.00 ? 77 LYS A N    2  
ATOM 2550  C CA   . LYS A 1 77 ? -0.407  -5.004  14.255  1.00 0.00 ? 77 LYS A CA   2  
ATOM 2551  C C    . LYS A 1 77 ? -1.141  -4.654  15.554  1.00 0.00 ? 77 LYS A C    2  
ATOM 2552  O O    . LYS A 1 77 ? -1.172  -5.460  16.481  1.00 0.00 ? 77 LYS A O    2  
ATOM 2553  C CB   . LYS A 1 77 ? 0.565   -3.891  13.822  1.00 0.00 ? 77 LYS A CB   2  
ATOM 2554  C CG   . LYS A 1 77 ? 1.804   -3.918  14.720  1.00 0.00 ? 77 LYS A CG   2  
ATOM 2555  C CD   . LYS A 1 77 ? 2.845   -2.908  14.216  1.00 0.00 ? 77 LYS A CD   2  
ATOM 2556  C CE   . LYS A 1 77 ? 2.300   -1.480  14.342  1.00 0.00 ? 77 LYS A CE   2  
ATOM 2557  N NZ   . LYS A 1 77 ? 3.376   -0.486  14.172  1.00 0.00 ? 77 LYS A NZ   2  
ATOM 2558  H H    . LYS A 1 77 ? -1.487  -6.231  12.896  1.00 0.00 ? 77 LYS A H    2  
ATOM 2559  H HA   . LYS A 1 77 ? 0.170   -5.914  14.424  1.00 0.00 ? 77 LYS A HA   2  
ATOM 2560  H HB2  . LYS A 1 77 ? 0.866   -4.057  12.787  1.00 0.00 ? 77 LYS A HB2  2  
ATOM 2561  H HB3  . LYS A 1 77 ? 0.079   -2.922  13.907  1.00 0.00 ? 77 LYS A HB3  2  
ATOM 2562  H HG2  . LYS A 1 77 ? 1.517   -3.666  15.740  1.00 0.00 ? 77 LYS A HG2  2  
ATOM 2563  H HG3  . LYS A 1 77 ? 2.239   -4.917  14.705  1.00 0.00 ? 77 LYS A HG3  2  
ATOM 2564  H HD2  . LYS A 1 77 ? 3.753   -3.003  14.814  1.00 0.00 ? 77 LYS A HD2  2  
ATOM 2565  H HD3  . LYS A 1 77 ? 3.078   -3.118  13.171  1.00 0.00 ? 77 LYS A HD3  2  
ATOM 2566  H HE2  . LYS A 1 77 ? 1.541   -1.315  13.577  1.00 0.00 ? 77 LYS A HE2  2  
ATOM 2567  H HE3  . LYS A 1 77 ? 1.850   -1.352  15.326  1.00 0.00 ? 77 LYS A HE3  2  
ATOM 2568  H HZ1  . LYS A 1 77 ? 3.800   -0.600  13.262  1.00 0.00 ? 77 LYS A HZ1  2  
ATOM 2569  H HZ2  . LYS A 1 77 ? 2.991   0.444   14.251  1.00 0.00 ? 77 LYS A HZ2  2  
ATOM 2570  H HZ3  . LYS A 1 77 ? 4.077   -0.622  14.888  1.00 0.00 ? 77 LYS A HZ3  2  
ATOM 2571  N N    . TYR A 1 78 ? -1.739  -3.458  15.608  1.00 0.00 ? 78 TYR A N    2  
ATOM 2572  C CA   . TYR A 1 78 ? -2.501  -3.005  16.764  1.00 0.00 ? 78 TYR A CA   2  
ATOM 2573  C C    . TYR A 1 78 ? -3.659  -2.139  16.275  1.00 0.00 ? 78 TYR A C    2  
ATOM 2574  O O    . TYR A 1 78 ? -3.906  -1.060  16.809  1.00 0.00 ? 78 TYR A O    2  
ATOM 2575  C CB   . TYR A 1 78 ? -1.589  -2.220  17.720  1.00 0.00 ? 78 TYR A CB   2  
ATOM 2576  C CG   . TYR A 1 78 ? -0.517  -3.069  18.373  1.00 0.00 ? 78 TYR A CG   2  
ATOM 2577  C CD1  . TYR A 1 78 ? -0.880  -4.155  19.191  1.00 0.00 ? 78 TYR A CD1  2  
ATOM 2578  C CD2  . TYR A 1 78 ? 0.843   -2.771  18.168  1.00 0.00 ? 78 TYR A CD2  2  
ATOM 2579  C CE1  . TYR A 1 78 ? 0.113   -4.944  19.796  1.00 0.00 ? 78 TYR A CE1  2  
ATOM 2580  C CE2  . TYR A 1 78 ? 1.834   -3.561  18.774  1.00 0.00 ? 78 TYR A CE2  2  
ATOM 2581  C CZ   . TYR A 1 78 ? 1.469   -4.648  19.586  1.00 0.00 ? 78 TYR A CZ   2  
ATOM 2582  O OH   . TYR A 1 78 ? 2.434   -5.414  20.172  1.00 0.00 ? 78 TYR A OH   2  
ATOM 2583  H H    . TYR A 1 78 ? -1.672  -2.836  14.812  1.00 0.00 ? 78 TYR A H    2  
ATOM 2584  H HA   . TYR A 1 78 ? -2.908  -3.870  17.288  1.00 0.00 ? 78 TYR A HA   2  
ATOM 2585  H HB2  . TYR A 1 78 ? -1.111  -1.413  17.163  1.00 0.00 ? 78 TYR A HB2  2  
ATOM 2586  H HB3  . TYR A 1 78 ? -2.206  -1.781  18.507  1.00 0.00 ? 78 TYR A HB3  2  
ATOM 2587  H HD1  . TYR A 1 78 ? -1.923  -4.384  19.354  1.00 0.00 ? 78 TYR A HD1  2  
ATOM 2588  H HD2  . TYR A 1 78 ? 1.125   -1.936  17.544  1.00 0.00 ? 78 TYR A HD2  2  
ATOM 2589  H HE1  . TYR A 1 78 ? -0.169  -5.778  20.421  1.00 0.00 ? 78 TYR A HE1  2  
ATOM 2590  H HE2  . TYR A 1 78 ? 2.878   -3.334  18.613  1.00 0.00 ? 78 TYR A HE2  2  
ATOM 2591  H HH   . TYR A 1 78 ? 2.075   -6.124  20.708  1.00 0.00 ? 78 TYR A HH   2  
ATOM 2592  N N    . ASN A 1 79 ? -4.364  -2.624  15.245  1.00 0.00 ? 79 ASN A N    2  
ATOM 2593  C CA   . ASN A 1 79 ? -5.490  -1.910  14.663  1.00 0.00 ? 79 ASN A CA   2  
ATOM 2594  C C    . ASN A 1 79 ? -6.606  -2.897  14.337  1.00 0.00 ? 79 ASN A C    2  
ATOM 2595  O O    . ASN A 1 79 ? -6.451  -3.735  13.451  1.00 0.00 ? 79 ASN A O    2  
ATOM 2596  C CB   . ASN A 1 79 ? -5.026  -1.179  13.400  1.00 0.00 ? 79 ASN A CB   2  
ATOM 2597  C CG   . ASN A 1 79 ? -6.204  -0.546  12.666  1.00 0.00 ? 79 ASN A CG   2  
ATOM 2598  O OD1  . ASN A 1 79 ? -6.408  -0.801  11.482  1.00 0.00 ? 79 ASN A OD1  2  
ATOM 2599  N ND2  . ASN A 1 79 ? -6.979  0.282   13.369  1.00 0.00 ? 79 ASN A ND2  2  
ATOM 2600  H H    . ASN A 1 79 ? -4.111  -3.518  14.847  1.00 0.00 ? 79 ASN A H    2  
ATOM 2601  H HA   . ASN A 1 79 ? -5.863  -1.178  15.382  1.00 0.00 ? 79 ASN A HA   2  
ATOM 2602  H HB2  . ASN A 1 79 ? -4.316  -0.399  13.678  1.00 0.00 ? 79 ASN A HB2  2  
ATOM 2603  H HB3  . ASN A 1 79 ? -4.532  -1.890  12.736  1.00 0.00 ? 79 ASN A HB3  2  
ATOM 2604  H HD21 . ASN A 1 79 ? -6.760  0.480   14.334  1.00 0.00 ? 79 ASN A HD21 2  
ATOM 2605  H HD22 . ASN A 1 79 ? -7.783  0.708   12.933  1.00 0.00 ? 79 ASN A HD22 2  
ATOM 2606  N N    . VAL A 1 80 ? -7.729  -2.791  15.061  1.00 0.00 ? 80 VAL A N    2  
ATOM 2607  C CA   . VAL A 1 80 ? -8.881  -3.664  14.863  1.00 0.00 ? 80 VAL A CA   2  
ATOM 2608  C C    . VAL A 1 80 ? -10.168 -2.821  14.845  1.00 0.00 ? 80 VAL A C    2  
ATOM 2609  O O    . VAL A 1 80 ? -11.252 -3.320  15.135  1.00 0.00 ? 80 VAL A O    2  
ATOM 2610  C CB   . VAL A 1 80 ? -8.881  -4.725  15.984  1.00 0.00 ? 80 VAL A CB   2  
ATOM 2611  C CG1  . VAL A 1 80 ? -9.313  -4.103  17.320  1.00 0.00 ? 80 VAL A CG1  2  
ATOM 2612  C CG2  . VAL A 1 80 ? -9.816  -5.889  15.624  1.00 0.00 ? 80 VAL A CG2  2  
ATOM 2613  H H    . VAL A 1 80 ? -7.791  -2.084  15.776  1.00 0.00 ? 80 VAL A H    2  
ATOM 2614  H HA   . VAL A 1 80 ? -8.784  -4.169  13.901  1.00 0.00 ? 80 VAL A HA   2  
ATOM 2615  H HB   . VAL A 1 80 ? -7.868  -5.114  16.093  1.00 0.00 ? 80 VAL A HB   2  
ATOM 2616  H HG11 . VAL A 1 80 ? -9.103  -4.804  18.129  1.00 0.00 ? 80 VAL A HG11 2  
ATOM 2617  H HG12 . VAL A 1 80 ? -8.759  -3.181  17.490  1.00 0.00 ? 80 VAL A HG12 2  
ATOM 2618  H HG13 . VAL A 1 80 ? -10.381 -3.887  17.302  1.00 0.00 ? 80 VAL A HG13 2  
ATOM 2619  H HG21 . VAL A 1 80 ? -10.853 -5.566  15.687  1.00 0.00 ? 80 VAL A HG21 2  
ATOM 2620  H HG22 . VAL A 1 80 ? -9.602  -6.229  14.611  1.00 0.00 ? 80 VAL A HG22 2  
ATOM 2621  H HG23 . VAL A 1 80 ? -9.653  -6.711  16.322  1.00 0.00 ? 80 VAL A HG23 2  
ATOM 2622  N N    . ARG A 1 81 ? -10.038 -1.533  14.495  1.00 0.00 ? 81 ARG A N    2  
ATOM 2623  C CA   . ARG A 1 81 ? -11.175 -0.628  14.441  1.00 0.00 ? 81 ARG A CA   2  
ATOM 2624  C C    . ARG A 1 81 ? -12.085 -1.020  13.278  1.00 0.00 ? 81 ARG A C    2  
ATOM 2625  O O    . ARG A 1 81 ? -11.557 -1.073  12.148  1.00 0.00 ? 81 ARG A O    2  
ATOM 2626  C CB   . ARG A 1 81 ? -10.660 0.812   14.281  1.00 0.00 ? 81 ARG A CB   2  
ATOM 2627  C CG   . ARG A 1 81 ? -11.824 1.792   14.066  1.00 0.00 ? 81 ARG A CG   2  
ATOM 2628  C CD   . ARG A 1 81 ? -12.799 1.734   15.247  1.00 0.00 ? 81 ARG A CD   2  
ATOM 2629  N NE   . ARG A 1 81 ? -13.787 2.815   15.161  1.00 0.00 ? 81 ARG A NE   2  
ATOM 2630  C CZ   . ARG A 1 81 ? -14.881 2.875   15.941  1.00 0.00 ? 81 ARG A CZ   2  
ATOM 2631  N NH1  . ARG A 1 81 ? -15.111 1.922   16.854  1.00 0.00 ? 81 ARG A NH1  2  
ATOM 2632  N NH2  . ARG A 1 81 ? -15.744 3.891   15.804  1.00 0.00 ? 81 ARG A NH2  2  
ATOM 2633  O OXT  . ARG A 1 81 ? -13.313 -1.047  13.508  1.00 0.00 ? 81 ARG A OXT  2  
ATOM 2634  H H    . ARG A 1 81 ? -9.129  -1.170  14.259  1.00 0.00 ? 81 ARG A H    2  
ATOM 2635  H HA   . ARG A 1 81 ? -11.734 -0.706  15.373  1.00 0.00 ? 81 ARG A HA   2  
ATOM 2636  H HB2  . ARG A 1 81 ? -10.109 1.098   15.177  1.00 0.00 ? 81 ARG A HB2  2  
ATOM 2637  H HB3  . ARG A 1 81 ? -9.991  0.860   13.420  1.00 0.00 ? 81 ARG A HB3  2  
ATOM 2638  H HG2  . ARG A 1 81 ? -11.427 2.804   13.978  1.00 0.00 ? 81 ARG A HG2  2  
ATOM 2639  H HG3  . ARG A 1 81 ? -12.354 1.536   13.146  1.00 0.00 ? 81 ARG A HG3  2  
ATOM 2640  H HD2  . ARG A 1 81 ? -13.317 0.776   15.237  1.00 0.00 ? 81 ARG A HD2  2  
ATOM 2641  H HD3  . ARG A 1 81 ? -12.239 1.831   16.180  1.00 0.00 ? 81 ARG A HD3  2  
ATOM 2642  H HE   . ARG A 1 81 ? -13.626 3.543   14.479  1.00 0.00 ? 81 ARG A HE   2  
ATOM 2643  H HH11 . ARG A 1 81 ? -14.463 1.153   16.955  1.00 0.00 ? 81 ARG A HH11 2  
ATOM 2644  H HH12 . ARG A 1 81 ? -15.931 1.970   17.442  1.00 0.00 ? 81 ARG A HH12 2  
ATOM 2645  H HH21 . ARG A 1 81 ? -15.574 4.608   15.114  1.00 0.00 ? 81 ARG A HH21 2  
ATOM 2646  H HH22 . ARG A 1 81 ? -16.566 3.940   16.388  1.00 0.00 ? 81 ARG A HH22 2  
ATOM 2647  N N    . ALA A 1 1  ? 11.823  14.222  -12.307 1.00 0.00 ? 1  ALA A N    3  
ATOM 2648  C CA   . ALA A 1 1  ? 10.981  15.246  -11.665 1.00 0.00 ? 1  ALA A CA   3  
ATOM 2649  C C    . ALA A 1 1  ? 11.343  16.631  -12.199 1.00 0.00 ? 1  ALA A C    3  
ATOM 2650  O O    . ALA A 1 1  ? 12.195  16.749  -13.077 1.00 0.00 ? 1  ALA A O    3  
ATOM 2651  C CB   . ALA A 1 1  ? 11.148  15.193  -10.143 1.00 0.00 ? 1  ALA A CB   3  
ATOM 2652  H H1   . ALA A 1 1  ? 11.556  13.306  -11.975 1.00 0.00 ? 1  ALA A H1   3  
ATOM 2653  H H2   . ALA A 1 1  ? 11.700  14.268  -13.308 1.00 0.00 ? 1  ALA A H2   3  
ATOM 2654  H H3   . ALA A 1 1  ? 12.792  14.395  -12.080 1.00 0.00 ? 1  ALA A H3   3  
ATOM 2655  H HA   . ALA A 1 1  ? 9.938   15.040  -11.907 1.00 0.00 ? 1  ALA A HA   3  
ATOM 2656  H HB1  . ALA A 1 1  ? 12.160  15.500  -9.876  1.00 0.00 ? 1  ALA A HB1  3  
ATOM 2657  H HB2  . ALA A 1 1  ? 10.974  14.174  -9.793  1.00 0.00 ? 1  ALA A HB2  3  
ATOM 2658  H HB3  . ALA A 1 1  ? 10.429  15.863  -9.674  1.00 0.00 ? 1  ALA A HB3  3  
ATOM 2659  N N    . LEU A 1 2  ? 10.691  17.672  -11.668 1.00 0.00 ? 2  LEU A N    3  
ATOM 2660  C CA   . LEU A 1 2  ? 10.937  19.044  -12.088 1.00 0.00 ? 2  LEU A CA   3  
ATOM 2661  C C    . LEU A 1 2  ? 10.856  19.957  -10.867 1.00 0.00 ? 2  LEU A C    3  
ATOM 2662  O O    . LEU A 1 2  ? 9.965   19.795  -10.036 1.00 0.00 ? 2  LEU A O    3  
ATOM 2663  C CB   . LEU A 1 2  ? 9.896   19.437  -13.147 1.00 0.00 ? 2  LEU A CB   3  
ATOM 2664  C CG   . LEU A 1 2  ? 10.140  20.869  -13.654 1.00 0.00 ? 2  LEU A CG   3  
ATOM 2665  C CD1  . LEU A 1 2  ? 11.478  20.948  -14.399 1.00 0.00 ? 2  LEU A CD1  3  
ATOM 2666  C CD2  . LEU A 1 2  ? 9.009   21.265  -14.606 1.00 0.00 ? 2  LEU A CD2  3  
ATOM 2667  H H    . LEU A 1 2  ? 10.001  17.515  -10.947 1.00 0.00 ? 2  LEU A H    3  
ATOM 2668  H HA   . LEU A 1 2  ? 11.935  19.112  -12.520 1.00 0.00 ? 2  LEU A HA   3  
ATOM 2669  H HB2  . LEU A 1 2  ? 9.958   18.743  -13.987 1.00 0.00 ? 2  LEU A HB2  3  
ATOM 2670  H HB3  . LEU A 1 2  ? 8.899   19.377  -12.708 1.00 0.00 ? 2  LEU A HB3  3  
ATOM 2671  H HG   . LEU A 1 2  ? 10.153  21.558  -12.811 1.00 0.00 ? 2  LEU A HG   3  
ATOM 2672  H HD11 . LEU A 1 2  ? 11.548  20.127  -15.114 1.00 0.00 ? 2  LEU A HD11 3  
ATOM 2673  H HD12 . LEU A 1 2  ? 11.541  21.898  -14.931 1.00 0.00 ? 2  LEU A HD12 3  
ATOM 2674  H HD13 . LEU A 1 2  ? 12.299  20.881  -13.687 1.00 0.00 ? 2  LEU A HD13 3  
ATOM 2675  H HD21 . LEU A 1 2  ? 8.055   21.205  -14.082 1.00 0.00 ? 2  LEU A HD21 3  
ATOM 2676  H HD22 . LEU A 1 2  ? 9.167   22.286  -14.955 1.00 0.00 ? 2  LEU A HD22 3  
ATOM 2677  H HD23 . LEU A 1 2  ? 8.998   20.587  -15.460 1.00 0.00 ? 2  LEU A HD23 3  
ATOM 2678  N N    . SER A 1 3  ? 11.797  20.910  -10.761 1.00 0.00 ? 3  SER A N    3  
ATOM 2679  C CA   . SER A 1 3  ? 11.850  21.838  -9.636  1.00 0.00 ? 3  SER A CA   3  
ATOM 2680  C C    . SER A 1 3  ? 11.865  21.055  -8.323  1.00 0.00 ? 3  SER A C    3  
ATOM 2681  O O    . SER A 1 3  ? 11.033  21.286  -7.446  1.00 0.00 ? 3  SER A O    3  
ATOM 2682  C CB   . SER A 1 3  ? 10.653  22.796  -9.698  1.00 0.00 ? 3  SER A CB   3  
ATOM 2683  O OG   . SER A 1 3  ? 10.640  23.457  -10.946 1.00 0.00 ? 3  SER A OG   3  
ATOM 2684  H H    . SER A 1 3  ? 12.501  20.994  -11.479 1.00 0.00 ? 3  SER A H    3  
ATOM 2685  H HA   . SER A 1 3  ? 12.769  22.421  -9.706  1.00 0.00 ? 3  SER A HA   3  
ATOM 2686  H HB2  . SER A 1 3  ? 9.726   22.235  -9.576  1.00 0.00 ? 3  SER A HB2  3  
ATOM 2687  H HB3  . SER A 1 3  ? 10.736  23.533  -8.898  1.00 0.00 ? 3  SER A HB3  3  
ATOM 2688  H HG   . SER A 1 3  ? 11.446  23.973  -11.028 1.00 0.00 ? 3  SER A HG   3  
ATOM 2689  N N    . GLY A 1 4  ? 12.815  20.122  -8.197  1.00 0.00 ? 4  GLY A N    3  
ATOM 2690  C CA   . GLY A 1 4  ? 12.929  19.292  -7.012  1.00 0.00 ? 4  GLY A CA   3  
ATOM 2691  C C    . GLY A 1 4  ? 11.846  18.217  -7.033  1.00 0.00 ? 4  GLY A C    3  
ATOM 2692  O O    . GLY A 1 4  ? 11.597  17.607  -8.072  1.00 0.00 ? 4  GLY A O    3  
ATOM 2693  H H    . GLY A 1 4  ? 13.475  19.979  -8.946  1.00 0.00 ? 4  GLY A H    3  
ATOM 2694  H HA2  . GLY A 1 4  ? 13.910  18.816  -6.998  1.00 0.00 ? 4  GLY A HA2  3  
ATOM 2695  H HA3  . GLY A 1 4  ? 12.814  19.910  -6.122  1.00 0.00 ? 4  GLY A HA3  3  
ATOM 2696  N N    . SER A 1 5  ? 11.203  17.988  -5.883  1.00 0.00 ? 5  SER A N    3  
ATOM 2697  C CA   . SER A 1 5  ? 10.145  16.998  -5.769  1.00 0.00 ? 5  SER A CA   3  
ATOM 2698  C C    . SER A 1 5  ? 9.334   17.275  -4.507  1.00 0.00 ? 5  SER A C    3  
ATOM 2699  O O    . SER A 1 5  ? 9.900   17.406  -3.425  1.00 0.00 ? 5  SER A O    3  
ATOM 2700  C CB   . SER A 1 5  ? 10.759  15.594  -5.721  1.00 0.00 ? 5  SER A CB   3  
ATOM 2701  O OG   . SER A 1 5  ? 9.734   14.629  -5.590  1.00 0.00 ? 5  SER A OG   3  
ATOM 2702  H H    . SER A 1 5  ? 11.450  18.517  -5.059  1.00 0.00 ? 5  SER A H    3  
ATOM 2703  H HA   . SER A 1 5  ? 9.491   17.071  -6.638  1.00 0.00 ? 5  SER A HA   3  
ATOM 2704  H HB2  . SER A 1 5  ? 11.314  15.408  -6.641  1.00 0.00 ? 5  SER A HB2  3  
ATOM 2705  H HB3  . SER A 1 5  ? 11.436  15.521  -4.868  1.00 0.00 ? 5  SER A HB3  3  
ATOM 2706  H HG   . SER A 1 5  ? 9.366   14.693  -4.705  1.00 0.00 ? 5  SER A HG   3  
ATOM 2707  N N    . SER A 1 6  ? 8.008   17.363  -4.651  1.00 0.00 ? 6  SER A N    3  
ATOM 2708  C CA   . SER A 1 6  ? 7.122   17.617  -3.528  1.00 0.00 ? 6  SER A CA   3  
ATOM 2709  C C    . SER A 1 6  ? 7.054   16.374  -2.643  1.00 0.00 ? 6  SER A C    3  
ATOM 2710  O O    . SER A 1 6  ? 7.507   16.393  -1.501  1.00 0.00 ? 6  SER A O    3  
ATOM 2711  C CB   . SER A 1 6  ? 5.735   17.991  -4.058  1.00 0.00 ? 6  SER A CB   3  
ATOM 2712  O OG   . SER A 1 6  ? 5.338   17.061  -5.048  1.00 0.00 ? 6  SER A OG   3  
ATOM 2713  H H    . SER A 1 6  ? 7.595   17.250  -5.566  1.00 0.00 ? 6  SER A H    3  
ATOM 2714  H HA   . SER A 1 6  ? 7.516   18.449  -2.943  1.00 0.00 ? 6  SER A HA   3  
ATOM 2715  H HB2  . SER A 1 6  ? 5.017   17.980  -3.238  1.00 0.00 ? 6  SER A HB2  3  
ATOM 2716  H HB3  . SER A 1 6  ? 5.772   18.990  -4.495  1.00 0.00 ? 6  SER A HB3  3  
ATOM 2717  H HG   . SER A 1 6  ? 4.480   17.327  -5.390  1.00 0.00 ? 6  SER A HG   3  
ATOM 2718  N N    . GLY A 1 7  ? 6.485   15.293  -3.181  1.00 0.00 ? 7  GLY A N    3  
ATOM 2719  C CA   . GLY A 1 7  ? 6.361   14.043  -2.453  1.00 0.00 ? 7  GLY A CA   3  
ATOM 2720  C C    . GLY A 1 7  ? 5.606   13.024  -3.297  1.00 0.00 ? 7  GLY A C    3  
ATOM 2721  O O    . GLY A 1 7  ? 4.595   12.478  -2.854  1.00 0.00 ? 7  GLY A O    3  
ATOM 2722  H H    . GLY A 1 7  ? 6.125   15.338  -4.125  1.00 0.00 ? 7  GLY A H    3  
ATOM 2723  H HA2  . GLY A 1 7  ? 7.354   13.657  -2.224  1.00 0.00 ? 7  GLY A HA2  3  
ATOM 2724  H HA3  . GLY A 1 7  ? 5.817   14.218  -1.524  1.00 0.00 ? 7  GLY A HA3  3  
ATOM 2725  N N    . TYR A 1 8  ? 6.104   12.771  -4.516  1.00 0.00 ? 8  TYR A N    3  
ATOM 2726  C CA   . TYR A 1 8  ? 5.482   11.824  -5.441  1.00 0.00 ? 8  TYR A CA   3  
ATOM 2727  C C    . TYR A 1 8  ? 5.803   10.375  -5.047  1.00 0.00 ? 8  TYR A C    3  
ATOM 2728  O O    . TYR A 1 8  ? 6.230   9.577   -5.883  1.00 0.00 ? 8  TYR A O    3  
ATOM 2729  C CB   . TYR A 1 8  ? 5.936   12.140  -6.880  1.00 0.00 ? 8  TYR A CB   3  
ATOM 2730  C CG   . TYR A 1 8  ? 7.414   11.893  -7.201  1.00 0.00 ? 8  TYR A CG   3  
ATOM 2731  C CD1  . TYR A 1 8  ? 8.370   11.628  -6.188  1.00 0.00 ? 8  TYR A CD1  3  
ATOM 2732  C CD2  . TYR A 1 8  ? 7.830   11.936  -8.546  1.00 0.00 ? 8  TYR A CD2  3  
ATOM 2733  C CE1  . TYR A 1 8  ? 9.716   11.410  -6.529  1.00 0.00 ? 8  TYR A CE1  3  
ATOM 2734  C CE2  . TYR A 1 8  ? 9.177   11.717  -8.880  1.00 0.00 ? 8  TYR A CE2  3  
ATOM 2735  C CZ   . TYR A 1 8  ? 10.118  11.456  -7.874  1.00 0.00 ? 8  TYR A CZ   3  
ATOM 2736  O OH   . TYR A 1 8  ? 11.424  11.245  -8.203  1.00 0.00 ? 8  TYR A OH   3  
ATOM 2737  H H    . TYR A 1 8  ? 6.940   13.250  -4.818  1.00 0.00 ? 8  TYR A H    3  
ATOM 2738  H HA   . TYR A 1 8  ? 4.401   11.959  -5.389  1.00 0.00 ? 8  TYR A HA   3  
ATOM 2739  H HB2  . TYR A 1 8  ? 5.339   11.533  -7.561  1.00 0.00 ? 8  TYR A HB2  3  
ATOM 2740  H HB3  . TYR A 1 8  ? 5.717   13.189  -7.082  1.00 0.00 ? 8  TYR A HB3  3  
ATOM 2741  H HD1  . TYR A 1 8  ? 8.075   11.588  -5.155  1.00 0.00 ? 8  TYR A HD1  3  
ATOM 2742  H HD2  . TYR A 1 8  ? 7.109   12.138  -9.325  1.00 0.00 ? 8  TYR A HD2  3  
ATOM 2743  H HE1  . TYR A 1 8  ? 10.441  11.208  -5.756  1.00 0.00 ? 8  TYR A HE1  3  
ATOM 2744  H HE2  . TYR A 1 8  ? 9.489   11.749  -9.914  1.00 0.00 ? 8  TYR A HE2  3  
ATOM 2745  H HH   . TYR A 1 8  ? 11.986  11.098  -7.439  1.00 0.00 ? 8  TYR A HH   3  
ATOM 2746  N N    . LYS A 1 9  ? 5.587   10.041  -3.770  1.00 0.00 ? 9  LYS A N    3  
ATOM 2747  C CA   . LYS A 1 9  ? 5.832   8.705   -3.255  1.00 0.00 ? 9  LYS A CA   3  
ATOM 2748  C C    . LYS A 1 9  ? 5.176   8.562   -1.879  1.00 0.00 ? 9  LYS A C    3  
ATOM 2749  O O    . LYS A 1 9  ? 4.475   7.587   -1.625  1.00 0.00 ? 9  LYS A O    3  
ATOM 2750  C CB   . LYS A 1 9  ? 7.347   8.407   -3.228  1.00 0.00 ? 9  LYS A CB   3  
ATOM 2751  C CG   . LYS A 1 9  ? 8.114   9.434   -2.392  1.00 0.00 ? 9  LYS A CG   3  
ATOM 2752  C CD   . LYS A 1 9  ? 9.624   9.244   -2.604  1.00 0.00 ? 9  LYS A CD   3  
ATOM 2753  C CE   . LYS A 1 9  ? 10.055  7.862   -2.092  1.00 0.00 ? 9  LYS A CE   3  
ATOM 2754  N NZ   . LYS A 1 9  ? 11.523  7.747   -2.027  1.00 0.00 ? 9  LYS A NZ   3  
ATOM 2755  H H    . LYS A 1 9  ? 5.234   10.738  -3.131  1.00 0.00 ? 9  LYS A H    3  
ATOM 2756  H HA   . LYS A 1 9  ? 5.368   7.987   -3.915  1.00 0.00 ? 9  LYS A HA   3  
ATOM 2757  H HB2  . LYS A 1 9  ? 7.506   7.423   -2.809  1.00 0.00 ? 9  LYS A HB2  3  
ATOM 2758  H HB3  . LYS A 1 9  ? 7.731   8.422   -4.248  1.00 0.00 ? 9  LYS A HB3  3  
ATOM 2759  H HG2  . LYS A 1 9  ? 7.831   10.441  -2.696  1.00 0.00 ? 9  LYS A HG2  3  
ATOM 2760  H HG3  . LYS A 1 9  ? 7.878   9.292   -1.341  1.00 0.00 ? 9  LYS A HG3  3  
ATOM 2761  H HD2  . LYS A 1 9  ? 9.854   9.328   -3.667  1.00 0.00 ? 9  LYS A HD2  3  
ATOM 2762  H HD3  . LYS A 1 9  ? 10.163  10.018  -2.058  1.00 0.00 ? 9  LYS A HD3  3  
ATOM 2763  H HE2  . LYS A 1 9  ? 9.641   7.704   -1.096  1.00 0.00 ? 9  LYS A HE2  3  
ATOM 2764  H HE3  . LYS A 1 9  ? 9.671   7.096   -2.765  1.00 0.00 ? 9  LYS A HE3  3  
ATOM 2765  H HZ1  . LYS A 1 9  ? 11.775  6.824   -1.696  1.00 0.00 ? 9  LYS A HZ1  3  
ATOM 2766  H HZ2  . LYS A 1 9  ? 11.890  8.441   -1.392  1.00 0.00 ? 9  LYS A HZ2  3  
ATOM 2767  H HZ3  . LYS A 1 9  ? 11.915  7.891   -2.947  1.00 0.00 ? 9  LYS A HZ3  3  
ATOM 2768  N N    . PHE A 1 10 ? 5.393   9.538   -0.997  1.00 0.00 ? 10 PHE A N    3  
ATOM 2769  C CA   . PHE A 1 10 ? 4.830   9.508   0.346   1.00 0.00 ? 10 PHE A CA   3  
ATOM 2770  C C    . PHE A 1 10 ? 3.313   9.677   0.291   1.00 0.00 ? 10 PHE A C    3  
ATOM 2771  O O    . PHE A 1 10 ? 2.588   8.984   0.999   1.00 0.00 ? 10 PHE A O    3  
ATOM 2772  C CB   . PHE A 1 10 ? 5.480   10.611  1.181   1.00 0.00 ? 10 PHE A CB   3  
ATOM 2773  C CG   . PHE A 1 10 ? 6.973   10.686  0.964   1.00 0.00 ? 10 PHE A CG   3  
ATOM 2774  C CD1  . PHE A 1 10 ? 7.794   9.623   1.379   1.00 0.00 ? 10 PHE A CD1  3  
ATOM 2775  C CD2  . PHE A 1 10 ? 7.537   11.794  0.309   1.00 0.00 ? 10 PHE A CD2  3  
ATOM 2776  C CE1  . PHE A 1 10 ? 9.176   9.670   1.142   1.00 0.00 ? 10 PHE A CE1  3  
ATOM 2777  C CE2  . PHE A 1 10 ? 8.918   11.840  0.072   1.00 0.00 ? 10 PHE A CE2  3  
ATOM 2778  C CZ   . PHE A 1 10 ? 9.740   10.780  0.492   1.00 0.00 ? 10 PHE A CZ   3  
ATOM 2779  H H    . PHE A 1 10 ? 5.966   10.327  -1.256  1.00 0.00 ? 10 PHE A H    3  
ATOM 2780  H HA   . PHE A 1 10 ? 5.059   8.543   0.801   1.00 0.00 ? 10 PHE A HA   3  
ATOM 2781  H HB2  . PHE A 1 10 ? 5.034   11.569  0.911   1.00 0.00 ? 10 PHE A HB2  3  
ATOM 2782  H HB3  . PHE A 1 10 ? 5.284   10.418  2.236   1.00 0.00 ? 10 PHE A HB3  3  
ATOM 2783  H HD1  . PHE A 1 10 ? 7.361   8.766   1.873   1.00 0.00 ? 10 PHE A HD1  3  
ATOM 2784  H HD2  . PHE A 1 10 ? 6.906   12.606  -0.019  1.00 0.00 ? 10 PHE A HD2  3  
ATOM 2785  H HE1  . PHE A 1 10 ? 9.803   8.849   1.452   1.00 0.00 ? 10 PHE A HE1  3  
ATOM 2786  H HE2  . PHE A 1 10 ? 9.348   12.687  -0.440  1.00 0.00 ? 10 PHE A HE2  3  
ATOM 2787  H HZ   . PHE A 1 10 ? 10.804  10.815  0.307   1.00 0.00 ? 10 PHE A HZ   3  
ATOM 2788  N N    . GLY A 1 11 ? 2.834   10.599  -0.554  1.00 0.00 ? 11 GLY A N    3  
ATOM 2789  C CA   . GLY A 1 11 ? 1.407   10.845  -0.698  1.00 0.00 ? 11 GLY A CA   3  
ATOM 2790  C C    . GLY A 1 11 ? 0.701   9.581   -1.185  1.00 0.00 ? 11 GLY A C    3  
ATOM 2791  O O    . GLY A 1 11 ? -0.303  9.164   -0.607  1.00 0.00 ? 11 GLY A O    3  
ATOM 2792  H H    . GLY A 1 11 ? 3.473   11.145  -1.115  1.00 0.00 ? 11 GLY A H    3  
ATOM 2793  H HA2  . GLY A 1 11 ? 0.993   11.143  0.266   1.00 0.00 ? 11 GLY A HA2  3  
ATOM 2794  H HA3  . GLY A 1 11 ? 1.251   11.647  -1.419  1.00 0.00 ? 11 GLY A HA3  3  
ATOM 2795  N N    . VAL A 1 12 ? 1.231   8.975   -2.252  1.00 0.00 ? 12 VAL A N    3  
ATOM 2796  C CA   . VAL A 1 12 ? 0.656   7.766   -2.822  1.00 0.00 ? 12 VAL A CA   3  
ATOM 2797  C C    . VAL A 1 12 ? 0.692   6.636   -1.790  1.00 0.00 ? 12 VAL A C    3  
ATOM 2798  O O    . VAL A 1 12 ? -0.298  5.933   -1.613  1.00 0.00 ? 12 VAL A O    3  
ATOM 2799  C CB   . VAL A 1 12 ? 1.431   7.385   -4.093  1.00 0.00 ? 12 VAL A CB   3  
ATOM 2800  C CG1  . VAL A 1 12 ? 0.959   6.020   -4.601  1.00 0.00 ? 12 VAL A CG1  3  
ATOM 2801  C CG2  . VAL A 1 12 ? 1.186   8.438   -5.178  1.00 0.00 ? 12 VAL A CG2  3  
ATOM 2802  H H    . VAL A 1 12 ? 2.058   9.359   -2.685  1.00 0.00 ? 12 VAL A H    3  
ATOM 2803  H HA   . VAL A 1 12 ? -0.382  7.963   -3.089  1.00 0.00 ? 12 VAL A HA   3  
ATOM 2804  H HB   . VAL A 1 12 ? 2.498   7.338   -3.869  1.00 0.00 ? 12 VAL A HB   3  
ATOM 2805  H HG11 . VAL A 1 12 ? 1.337   5.237   -3.946  1.00 0.00 ? 12 VAL A HG11 3  
ATOM 2806  H HG12 . VAL A 1 12 ? 1.336   5.857   -5.611  1.00 0.00 ? 12 VAL A HG12 3  
ATOM 2807  H HG13 . VAL A 1 12 ? -0.130  5.991   -4.613  1.00 0.00 ? 12 VAL A HG13 3  
ATOM 2808  H HG21 . VAL A 1 12 ? 1.731   8.165   -6.081  1.00 0.00 ? 12 VAL A HG21 3  
ATOM 2809  H HG22 . VAL A 1 12 ? 1.531   9.412   -4.828  1.00 0.00 ? 12 VAL A HG22 3  
ATOM 2810  H HG23 . VAL A 1 12 ? 0.119   8.491   -5.401  1.00 0.00 ? 12 VAL A HG23 3  
ATOM 2811  N N    . LEU A 1 13 ? 1.832   6.466   -1.109  1.00 0.00 ? 13 LEU A N    3  
ATOM 2812  C CA   . LEU A 1 13 ? 1.982   5.424   -0.100  1.00 0.00 ? 13 LEU A CA   3  
ATOM 2813  C C    . LEU A 1 13 ? 0.933   5.601   0.999   1.00 0.00 ? 13 LEU A C    3  
ATOM 2814  O O    . LEU A 1 13 ? 0.291   4.634   1.401   1.00 0.00 ? 13 LEU A O    3  
ATOM 2815  C CB   . LEU A 1 13 ? 3.401   5.488   0.474   1.00 0.00 ? 13 LEU A CB   3  
ATOM 2816  C CG   . LEU A 1 13 ? 3.587   4.458   1.602   1.00 0.00 ? 13 LEU A CG   3  
ATOM 2817  C CD1  . LEU A 1 13 ? 3.419   3.036   1.055   1.00 0.00 ? 13 LEU A CD1  3  
ATOM 2818  C CD2  . LEU A 1 13 ? 4.989   4.613   2.191   1.00 0.00 ? 13 LEU A CD2  3  
ATOM 2819  H H    . LEU A 1 13 ? 2.621   7.073   -1.292  1.00 0.00 ? 13 LEU A H    3  
ATOM 2820  H HA   . LEU A 1 13 ? 1.836   4.455   -0.576  1.00 0.00 ? 13 LEU A HA   3  
ATOM 2821  H HB2  . LEU A 1 13 ? 4.115   5.279   -0.321  1.00 0.00 ? 13 LEU A HB2  3  
ATOM 2822  H HB3  . LEU A 1 13 ? 3.586   6.487   0.868   1.00 0.00 ? 13 LEU A HB3  3  
ATOM 2823  H HG   . LEU A 1 13 ? 2.849   4.634   2.385   1.00 0.00 ? 13 LEU A HG   3  
ATOM 2824  H HD11 . LEU A 1 13 ? 2.372   2.855   0.817   1.00 0.00 ? 13 LEU A HD11 3  
ATOM 2825  H HD12 . LEU A 1 13 ? 3.748   2.317   1.804   1.00 0.00 ? 13 LEU A HD12 3  
ATOM 2826  H HD13 . LEU A 1 13 ? 4.020   2.919   0.153   1.00 0.00 ? 13 LEU A HD13 3  
ATOM 2827  H HD21 . LEU A 1 13 ? 5.154   3.846   2.948   1.00 0.00 ? 13 LEU A HD21 3  
ATOM 2828  H HD22 . LEU A 1 13 ? 5.730   4.510   1.400   1.00 0.00 ? 13 LEU A HD22 3  
ATOM 2829  H HD23 . LEU A 1 13 ? 5.084   5.598   2.649   1.00 0.00 ? 13 LEU A HD23 3  
ATOM 2830  N N    . ALA A 1 14 ? 0.759   6.835   1.484   1.00 0.00 ? 14 ALA A N    3  
ATOM 2831  C CA   . ALA A 1 14 ? -0.212  7.126   2.529   1.00 0.00 ? 14 ALA A CA   3  
ATOM 2832  C C    . ALA A 1 14 ? -1.622  6.781   2.046   1.00 0.00 ? 14 ALA A C    3  
ATOM 2833  O O    . ALA A 1 14 ? -2.404  6.194   2.793   1.00 0.00 ? 14 ALA A O    3  
ATOM 2834  C CB   . ALA A 1 14 ? -0.118  8.603   2.914   1.00 0.00 ? 14 ALA A CB   3  
ATOM 2835  H H    . ALA A 1 14 ? 1.314   7.600   1.119   1.00 0.00 ? 14 ALA A H    3  
ATOM 2836  H HA   . ALA A 1 14 ? 0.018   6.516   3.408   1.00 0.00 ? 14 ALA A HA   3  
ATOM 2837  H HB1  . ALA A 1 14 ? 0.889   8.821   3.273   1.00 0.00 ? 14 ALA A HB1  3  
ATOM 2838  H HB2  . ALA A 1 14 ? -0.838  8.821   3.701   1.00 0.00 ? 14 ALA A HB2  3  
ATOM 2839  H HB3  . ALA A 1 14 ? -0.333  9.222   2.043   1.00 0.00 ? 14 ALA A HB3  3  
ATOM 2840  N N    . LYS A 1 15 ? -1.944  7.144   0.797   1.00 0.00 ? 15 LYS A N    3  
ATOM 2841  C CA   . LYS A 1 15 ? -3.251  6.863   0.229   1.00 0.00 ? 15 LYS A CA   3  
ATOM 2842  C C    . LYS A 1 15 ? -3.463  5.353   0.160   1.00 0.00 ? 15 LYS A C    3  
ATOM 2843  O O    . LYS A 1 15 ? -4.534  4.863   0.508   1.00 0.00 ? 15 LYS A O    3  
ATOM 2844  C CB   . LYS A 1 15 ? -3.349  7.498   -1.163  1.00 0.00 ? 15 LYS A CB   3  
ATOM 2845  C CG   . LYS A 1 15 ? -4.774  7.348   -1.704  1.00 0.00 ? 15 LYS A CG   3  
ATOM 2846  C CD   . LYS A 1 15 ? -4.882  8.052   -3.060  1.00 0.00 ? 15 LYS A CD   3  
ATOM 2847  C CE   . LYS A 1 15 ? -6.241  7.753   -3.700  1.00 0.00 ? 15 LYS A CE   3  
ATOM 2848  N NZ   . LYS A 1 15 ? -7.346  8.331   -2.915  1.00 0.00 ? 15 LYS A NZ   3  
ATOM 2849  H H    . LYS A 1 15 ? -1.265  7.626   0.221   1.00 0.00 ? 15 LYS A H    3  
ATOM 2850  H HA   . LYS A 1 15 ? -4.017  7.300   0.872   1.00 0.00 ? 15 LYS A HA   3  
ATOM 2851  H HB2  . LYS A 1 15 ? -3.096  8.557   -1.096  1.00 0.00 ? 15 LYS A HB2  3  
ATOM 2852  H HB3  . LYS A 1 15 ? -2.650  7.003   -1.839  1.00 0.00 ? 15 LYS A HB3  3  
ATOM 2853  H HG2  . LYS A 1 15 ? -5.007  6.290   -1.825  1.00 0.00 ? 15 LYS A HG2  3  
ATOM 2854  H HG3  . LYS A 1 15 ? -5.476  7.797   -1.001  1.00 0.00 ? 15 LYS A HG3  3  
ATOM 2855  H HD2  . LYS A 1 15 ? -4.772  9.129   -2.921  1.00 0.00 ? 15 LYS A HD2  3  
ATOM 2856  H HD3  . LYS A 1 15 ? -4.089  7.692   -3.716  1.00 0.00 ? 15 LYS A HD3  3  
ATOM 2857  H HE2  . LYS A 1 15 ? -6.261  8.174   -4.706  1.00 0.00 ? 15 LYS A HE2  3  
ATOM 2858  H HE3  . LYS A 1 15 ? -6.377  6.674   -3.766  1.00 0.00 ? 15 LYS A HE3  3  
ATOM 2859  H HZ1  . LYS A 1 15 ? -7.364  7.911   -1.996  1.00 0.00 ? 15 LYS A HZ1  3  
ATOM 2860  H HZ2  . LYS A 1 15 ? -7.210  9.329   -2.825  1.00 0.00 ? 15 LYS A HZ2  3  
ATOM 2861  H HZ3  . LYS A 1 15 ? -8.223  8.153   -3.383  1.00 0.00 ? 15 LYS A HZ3  3  
ATOM 2862  N N    . ILE A 1 16 ? -2.437  4.619   -0.288  1.00 0.00 ? 16 ILE A N    3  
ATOM 2863  C CA   . ILE A 1 16 ? -2.507  3.172   -0.392  1.00 0.00 ? 16 ILE A CA   3  
ATOM 2864  C C    . ILE A 1 16 ? -2.751  2.569   0.990   1.00 0.00 ? 16 ILE A C    3  
ATOM 2865  O O    . ILE A 1 16 ? -3.661  1.766   1.159   1.00 0.00 ? 16 ILE A O    3  
ATOM 2866  C CB   . ILE A 1 16 ? -1.208  2.636   -1.023  1.00 0.00 ? 16 ILE A CB   3  
ATOM 2867  C CG1  . ILE A 1 16 ? -1.215  2.930   -2.537  1.00 0.00 ? 16 ILE A CG1  3  
ATOM 2868  C CG2  . ILE A 1 16 ? -1.106  1.123   -0.787  1.00 0.00 ? 16 ILE A CG2  3  
ATOM 2869  C CD1  . ILE A 1 16 ? 0.202   2.810   -3.104  1.00 0.00 ? 16 ILE A CD1  3  
ATOM 2870  H H    . ILE A 1 16 ? -1.578  5.077   -0.564  1.00 0.00 ? 16 ILE A H    3  
ATOM 2871  H HA   . ILE A 1 16 ? -3.342  2.908   -1.033  1.00 0.00 ? 16 ILE A HA   3  
ATOM 2872  H HB   . ILE A 1 16 ? -0.350  3.126   -0.564  1.00 0.00 ? 16 ILE A HB   3  
ATOM 2873  H HG12 . ILE A 1 16 ? -1.864  2.217   -3.042  1.00 0.00 ? 16 ILE A HG12 3  
ATOM 2874  H HG13 . ILE A 1 16 ? -1.588  3.943   -2.713  1.00 0.00 ? 16 ILE A HG13 3  
ATOM 2875  H HG21 . ILE A 1 16 ? -0.887  0.932   0.263   1.00 0.00 ? 16 ILE A HG21 3  
ATOM 2876  H HG22 . ILE A 1 16 ? -0.310  0.708   -1.400  1.00 0.00 ? 16 ILE A HG22 3  
ATOM 2877  H HG23 . ILE A 1 16 ? -2.051  0.651   -1.050  1.00 0.00 ? 16 ILE A HG23 3  
ATOM 2878  H HD11 . ILE A 1 16 ? 0.881   3.433   -2.524  1.00 0.00 ? 16 ILE A HD11 3  
ATOM 2879  H HD12 . ILE A 1 16 ? 0.204   3.139   -4.143  1.00 0.00 ? 16 ILE A HD12 3  
ATOM 2880  H HD13 . ILE A 1 16 ? 0.532   1.772   -3.055  1.00 0.00 ? 16 ILE A HD13 3  
ATOM 2881  N N    . VAL A 1 17 ? -1.939  2.962   1.974   1.00 0.00 ? 17 VAL A N    3  
ATOM 2882  C CA   . VAL A 1 17 ? -2.072  2.468   3.338   1.00 0.00 ? 17 VAL A CA   3  
ATOM 2883  C C    . VAL A 1 17 ? -3.496  2.717   3.844   1.00 0.00 ? 17 VAL A C    3  
ATOM 2884  O O    . VAL A 1 17 ? -4.123  1.815   4.399   1.00 0.00 ? 17 VAL A O    3  
ATOM 2885  C CB   . VAL A 1 17 ? -1.027  3.169   4.226   1.00 0.00 ? 17 VAL A CB   3  
ATOM 2886  C CG1  . VAL A 1 17 ? -1.441  3.106   5.699   1.00 0.00 ? 17 VAL A CG1  3  
ATOM 2887  C CG2  . VAL A 1 17 ? 0.329   2.480   4.057   1.00 0.00 ? 17 VAL A CG2  3  
ATOM 2888  H H    . VAL A 1 17 ? -1.203  3.626   1.778   1.00 0.00 ? 17 VAL A H    3  
ATOM 2889  H HA   . VAL A 1 17 ? -1.881  1.394   3.345   1.00 0.00 ? 17 VAL A HA   3  
ATOM 2890  H HB   . VAL A 1 17 ? -0.940  4.214   3.925   1.00 0.00 ? 17 VAL A HB   3  
ATOM 2891  H HG11 . VAL A 1 17 ? -1.692  2.078   5.965   1.00 0.00 ? 17 VAL A HG11 3  
ATOM 2892  H HG12 . VAL A 1 17 ? -2.307  3.747   5.865   1.00 0.00 ? 17 VAL A HG12 3  
ATOM 2893  H HG13 . VAL A 1 17 ? -0.615  3.450   6.321   1.00 0.00 ? 17 VAL A HG13 3  
ATOM 2894  H HG21 . VAL A 1 17 ? 0.278   1.468   4.462   1.00 0.00 ? 17 VAL A HG21 3  
ATOM 2895  H HG22 . VAL A 1 17 ? 0.588   2.436   3.000   1.00 0.00 ? 17 VAL A HG22 3  
ATOM 2896  H HG23 . VAL A 1 17 ? 1.092   3.045   4.592   1.00 0.00 ? 17 VAL A HG23 3  
ATOM 2897  N N    . ASN A 1 18 ? -4.005  3.941   3.652   1.00 0.00 ? 18 ASN A N    3  
ATOM 2898  C CA   . ASN A 1 18 ? -5.340  4.303   4.104   1.00 0.00 ? 18 ASN A CA   3  
ATOM 2899  C C    . ASN A 1 18 ? -6.393  3.413   3.438   1.00 0.00 ? 18 ASN A C    3  
ATOM 2900  O O    . ASN A 1 18 ? -7.266  2.877   4.121   1.00 0.00 ? 18 ASN A O    3  
ATOM 2901  C CB   . ASN A 1 18 ? -5.603  5.777   3.786   1.00 0.00 ? 18 ASN A CB   3  
ATOM 2902  C CG   . ASN A 1 18 ? -6.956  6.214   4.337   1.00 0.00 ? 18 ASN A CG   3  
ATOM 2903  O OD1  . ASN A 1 18 ? -7.976  6.075   3.669   1.00 0.00 ? 18 ASN A OD1  3  
ATOM 2904  N ND2  . ASN A 1 18 ? -6.964  6.743   5.561   1.00 0.00 ? 18 ASN A ND2  3  
ATOM 2905  H H    . ASN A 1 18 ? -3.448  4.646   3.183   1.00 0.00 ? 18 ASN A H    3  
ATOM 2906  H HA   . ASN A 1 18 ? -5.394  4.163   5.185   1.00 0.00 ? 18 ASN A HA   3  
ATOM 2907  H HB2  . ASN A 1 18 ? -4.818  6.387   4.233   1.00 0.00 ? 18 ASN A HB2  3  
ATOM 2908  H HB3  . ASN A 1 18 ? -5.593  5.919   2.705   1.00 0.00 ? 18 ASN A HB3  3  
ATOM 2909  H HD21 . ASN A 1 18 ? -6.102  6.825   6.082   1.00 0.00 ? 18 ASN A HD21 3  
ATOM 2910  H HD22 . ASN A 1 18 ? -7.832  7.067   5.963   1.00 0.00 ? 18 ASN A HD22 3  
ATOM 2911  N N    . TYR A 1 19 ? -6.310  3.262   2.110   1.00 0.00 ? 19 TYR A N    3  
ATOM 2912  C CA   . TYR A 1 19 ? -7.263  2.454   1.358   1.00 0.00 ? 19 TYR A CA   3  
ATOM 2913  C C    . TYR A 1 19 ? -7.240  1.008   1.856   1.00 0.00 ? 19 TYR A C    3  
ATOM 2914  O O    . TYR A 1 19 ? -8.278  0.467   2.233   1.00 0.00 ? 19 TYR A O    3  
ATOM 2915  C CB   . TYR A 1 19 ? -6.926  2.513   -0.144  1.00 0.00 ? 19 TYR A CB   3  
ATOM 2916  C CG   . TYR A 1 19 ? -6.986  1.157   -0.821  1.00 0.00 ? 19 TYR A CG   3  
ATOM 2917  C CD1  . TYR A 1 19 ? -8.225  0.527   -1.028  1.00 0.00 ? 19 TYR A CD1  3  
ATOM 2918  C CD2  . TYR A 1 19 ? -5.797  0.508   -1.198  1.00 0.00 ? 19 TYR A CD2  3  
ATOM 2919  C CE1  . TYR A 1 19 ? -8.273  -0.750  -1.608  1.00 0.00 ? 19 TYR A CE1  3  
ATOM 2920  C CE2  . TYR A 1 19 ? -5.849  -0.767  -1.777  1.00 0.00 ? 19 TYR A CE2  3  
ATOM 2921  C CZ   . TYR A 1 19 ? -7.082  -1.398  -1.982  1.00 0.00 ? 19 TYR A CZ   3  
ATOM 2922  O OH   . TYR A 1 19 ? -7.119  -2.640  -2.538  1.00 0.00 ? 19 TYR A OH   3  
ATOM 2923  H H    . TYR A 1 19 ? -5.566  3.722   1.600   1.00 0.00 ? 19 TYR A H    3  
ATOM 2924  H HA   . TYR A 1 19 ? -8.264  2.860   1.509   1.00 0.00 ? 19 TYR A HA   3  
ATOM 2925  H HB2  . TYR A 1 19 ? -7.632  3.183   -0.636  1.00 0.00 ? 19 TYR A HB2  3  
ATOM 2926  H HB3  . TYR A 1 19 ? -5.922  2.917   -0.265  1.00 0.00 ? 19 TYR A HB3  3  
ATOM 2927  H HD1  . TYR A 1 19 ? -9.139  1.019   -0.731  1.00 0.00 ? 19 TYR A HD1  3  
ATOM 2928  H HD2  . TYR A 1 19 ? -4.844  0.983   -1.031  1.00 0.00 ? 19 TYR A HD2  3  
ATOM 2929  H HE1  . TYR A 1 19 ? -9.224  -1.238  -1.758  1.00 0.00 ? 19 TYR A HE1  3  
ATOM 2930  H HE2  . TYR A 1 19 ? -4.939  -1.266  -2.059  1.00 0.00 ? 19 TYR A HE2  3  
ATOM 2931  H HH   . TYR A 1 19 ? -7.998  -2.887  -2.852  1.00 0.00 ? 19 TYR A HH   3  
ATOM 2932  N N    . MET A 1 20 ? -6.057  0.380   1.842   1.00 0.00 ? 20 MET A N    3  
ATOM 2933  C CA   . MET A 1 20 ? -5.909  -1.009  2.243   1.00 0.00 ? 20 MET A CA   3  
ATOM 2934  C C    . MET A 1 20 ? -6.443  -1.198  3.657   1.00 0.00 ? 20 MET A C    3  
ATOM 2935  O O    . MET A 1 20 ? -7.083  -2.199  3.944   1.00 0.00 ? 20 MET A O    3  
ATOM 2936  C CB   . MET A 1 20 ? -4.431  -1.417  2.146   1.00 0.00 ? 20 MET A CB   3  
ATOM 2937  C CG   . MET A 1 20 ? -4.311  -2.781  1.459   1.00 0.00 ? 20 MET A CG   3  
ATOM 2938  S SD   . MET A 1 20 ? -5.143  -4.132  2.333   1.00 0.00 ? 20 MET A SD   3  
ATOM 2939  C CE   . MET A 1 20 ? -4.952  -5.432  1.092   1.00 0.00 ? 20 MET A CE   3  
ATOM 2940  H H    . MET A 1 20 ? -5.233  0.880   1.534   1.00 0.00 ? 20 MET A H    3  
ATOM 2941  H HA   . MET A 1 20 ? -6.496  -1.633  1.561   1.00 0.00 ? 20 MET A HA   3  
ATOM 2942  H HB2  . MET A 1 20 ? -3.886  -0.678  1.562   1.00 0.00 ? 20 MET A HB2  3  
ATOM 2943  H HB3  . MET A 1 20 ? -4.001  -1.473  3.145   1.00 0.00 ? 20 MET A HB3  3  
ATOM 2944  H HG2  . MET A 1 20 ? -4.736  -2.703  0.458   1.00 0.00 ? 20 MET A HG2  3  
ATOM 2945  H HG3  . MET A 1 20 ? -3.254  -3.030  1.367   1.00 0.00 ? 20 MET A HG3  3  
ATOM 2946  H HE1  . MET A 1 20 ? -5.494  -5.155  0.190   1.00 0.00 ? 20 MET A HE1  3  
ATOM 2947  H HE2  . MET A 1 20 ? -5.349  -6.366  1.484   1.00 0.00 ? 20 MET A HE2  3  
ATOM 2948  H HE3  . MET A 1 20 ? -3.896  -5.557  0.857   1.00 0.00 ? 20 MET A HE3  3  
ATOM 2949  N N    . LYS A 1 21 ? -6.188  -0.226  4.538   1.00 0.00 ? 21 LYS A N    3  
ATOM 2950  C CA   . LYS A 1 21 ? -6.672  -0.283  5.905   1.00 0.00 ? 21 LYS A CA   3  
ATOM 2951  C C    . LYS A 1 21 ? -8.200  -0.302  5.917   1.00 0.00 ? 21 LYS A C    3  
ATOM 2952  O O    . LYS A 1 21 ? -8.800  -1.068  6.660   1.00 0.00 ? 21 LYS A O    3  
ATOM 2953  C CB   . LYS A 1 21 ? -6.141  0.928   6.675   1.00 0.00 ? 21 LYS A CB   3  
ATOM 2954  C CG   . LYS A 1 21 ? -6.638  0.892   8.130   1.00 0.00 ? 21 LYS A CG   3  
ATOM 2955  C CD   . LYS A 1 21 ? -7.857  1.810   8.310   1.00 0.00 ? 21 LYS A CD   3  
ATOM 2956  C CE   . LYS A 1 21 ? -7.460  3.265   8.039   1.00 0.00 ? 21 LYS A CE   3  
ATOM 2957  N NZ   . LYS A 1 21 ? -8.074  3.768   6.786   1.00 0.00 ? 21 LYS A NZ   3  
ATOM 2958  H H    . LYS A 1 21 ? -5.644  0.580   4.253   1.00 0.00 ? 21 LYS A H    3  
ATOM 2959  H HA   . LYS A 1 21 ? -6.301  -1.194  6.375   1.00 0.00 ? 21 LYS A HA   3  
ATOM 2960  H HB2  . LYS A 1 21 ? -5.054  0.909   6.666   1.00 0.00 ? 21 LYS A HB2  3  
ATOM 2961  H HB3  . LYS A 1 21 ? -6.480  1.836   6.194   1.00 0.00 ? 21 LYS A HB3  3  
ATOM 2962  H HG2  . LYS A 1 21 ? -6.913  -0.130  8.396   1.00 0.00 ? 21 LYS A HG2  3  
ATOM 2963  H HG3  . LYS A 1 21 ? -5.838  1.229   8.790   1.00 0.00 ? 21 LYS A HG3  3  
ATOM 2964  H HD2  . LYS A 1 21 ? -8.648  1.511   7.626   1.00 0.00 ? 21 LYS A HD2  3  
ATOM 2965  H HD3  . LYS A 1 21 ? -8.219  1.723   9.336   1.00 0.00 ? 21 LYS A HD3  3  
ATOM 2966  H HE2  . LYS A 1 21 ? -7.795  3.883   8.871   1.00 0.00 ? 21 LYS A HE2  3  
ATOM 2967  H HE3  . LYS A 1 21 ? -6.373  3.331   7.963   1.00 0.00 ? 21 LYS A HE3  3  
ATOM 2968  H HZ1  . LYS A 1 21 ? -9.079  3.683   6.843   1.00 0.00 ? 21 LYS A HZ1  3  
ATOM 2969  H HZ2  . LYS A 1 21 ? -7.737  3.228   5.996   1.00 0.00 ? 21 LYS A HZ2  3  
ATOM 2970  H HZ3  . LYS A 1 21 ? -7.826  4.739   6.657   1.00 0.00 ? 21 LYS A HZ3  3  
ATOM 2971  N N    . THR A 1 22 ? -8.825  0.553   5.100   1.00 0.00 ? 22 THR A N    3  
ATOM 2972  C CA   . THR A 1 22 ? -10.278 0.653   5.047   1.00 0.00 ? 22 THR A CA   3  
ATOM 2973  C C    . THR A 1 22 ? -10.888 -0.642  4.498   1.00 0.00 ? 22 THR A C    3  
ATOM 2974  O O    . THR A 1 22 ? -11.861 -1.147  5.057   1.00 0.00 ? 22 THR A O    3  
ATOM 2975  C CB   . THR A 1 22 ? -10.662 1.861   4.181   1.00 0.00 ? 22 THR A CB   3  
ATOM 2976  O OG1  . THR A 1 22 ? -10.049 3.022   4.705   1.00 0.00 ? 22 THR A OG1  3  
ATOM 2977  C CG2  . THR A 1 22 ? -12.180 2.051   4.184   1.00 0.00 ? 22 THR A CG2  3  
ATOM 2978  H H    . THR A 1 22 ? -8.281  1.161   4.499   1.00 0.00 ? 22 THR A H    3  
ATOM 2979  H HA   . THR A 1 22 ? -10.655 0.814   6.060   1.00 0.00 ? 22 THR A HA   3  
ATOM 2980  H HB   . THR A 1 22 ? -10.320 1.701   3.158   1.00 0.00 ? 22 THR A HB   3  
ATOM 2981  H HG1  . THR A 1 22 ? -10.120 3.726   4.053   1.00 0.00 ? 22 THR A HG1  3  
ATOM 2982  H HG21 . THR A 1 22 ? -12.529 2.178   5.210   1.00 0.00 ? 22 THR A HG21 3  
ATOM 2983  H HG22 . THR A 1 22 ? -12.660 1.179   3.742   1.00 0.00 ? 22 THR A HG22 3  
ATOM 2984  H HG23 . THR A 1 22 ? -12.436 2.937   3.604   1.00 0.00 ? 22 THR A HG23 3  
ATOM 2985  N N    . ARG A 1 23 ? -10.320 -1.180  3.408   1.00 0.00 ? 23 ARG A N    3  
ATOM 2986  C CA   . ARG A 1 23 ? -10.824 -2.413  2.808   1.00 0.00 ? 23 ARG A CA   3  
ATOM 2987  C C    . ARG A 1 23 ? -10.588 -3.588  3.760   1.00 0.00 ? 23 ARG A C    3  
ATOM 2988  O O    . ARG A 1 23 ? -11.454 -4.451  3.914   1.00 0.00 ? 23 ARG A O    3  
ATOM 2989  C CB   . ARG A 1 23 ? -10.139 -2.647  1.455   1.00 0.00 ? 23 ARG A CB   3  
ATOM 2990  C CG   . ARG A 1 23 ? -10.616 -3.983  0.873   1.00 0.00 ? 23 ARG A CG   3  
ATOM 2991  C CD   . ARG A 1 23 ? -10.693 -3.914  -0.655  1.00 0.00 ? 23 ARG A CD   3  
ATOM 2992  N NE   . ARG A 1 23 ? -11.460 -5.061  -1.173  1.00 0.00 ? 23 ARG A NE   3  
ATOM 2993  C CZ   . ARG A 1 23 ? -12.139 -5.044  -2.333  1.00 0.00 ? 23 ARG A CZ   3  
ATOM 2994  N NH1  . ARG A 1 23 ? -11.947 -4.065  -3.220  1.00 0.00 ? 23 ARG A NH1  3  
ATOM 2995  N NH2  . ARG A 1 23 ? -13.014 -6.021  -2.600  1.00 0.00 ? 23 ARG A NH2  3  
ATOM 2996  H H    . ARG A 1 23 ? -9.521  -0.728  2.982   1.00 0.00 ? 23 ARG A H    3  
ATOM 2997  H HA   . ARG A 1 23 ? -11.896 -2.310  2.644   1.00 0.00 ? 23 ARG A HA   3  
ATOM 2998  H HB2  . ARG A 1 23 ? -10.399 -1.836  0.774   1.00 0.00 ? 23 ARG A HB2  3  
ATOM 2999  H HB3  . ARG A 1 23 ? -9.057  -2.674  1.590   1.00 0.00 ? 23 ARG A HB3  3  
ATOM 3000  H HG2  . ARG A 1 23 ? -9.921  -4.770  1.165   1.00 0.00 ? 23 ARG A HG2  3  
ATOM 3001  H HG3  . ARG A 1 23 ? -11.606 -4.212  1.268   1.00 0.00 ? 23 ARG A HG3  3  
ATOM 3002  H HD2  . ARG A 1 23 ? -11.187 -2.987  -0.950  1.00 0.00 ? 23 ARG A HD2  3  
ATOM 3003  H HD3  . ARG A 1 23 ? -9.684  -3.934  -1.070  1.00 0.00 ? 23 ARG A HD3  3  
ATOM 3004  H HE   . ARG A 1 23 ? -11.477 -5.901  -0.611  1.00 0.00 ? 23 ARG A HE   3  
ATOM 3005  H HH11 . ARG A 1 23 ? -11.197 -3.394  -3.080  1.00 0.00 ? 23 ARG A HH11 3  
ATOM 3006  H HH12 . ARG A 1 23 ? -12.543 -3.989  -4.029  1.00 0.00 ? 23 ARG A HH12 3  
ATOM 3007  H HH21 . ARG A 1 23 ? -13.204 -6.735  -1.898  1.00 0.00 ? 23 ARG A HH21 3  
ATOM 3008  H HH22 . ARG A 1 23 ? -13.486 -6.050  -3.490  1.00 0.00 ? 23 ARG A HH22 3  
ATOM 3009  N N    . HIS A 1 24 ? -9.421  -3.611  4.405   1.00 0.00 ? 24 HIS A N    3  
ATOM 3010  C CA   . HIS A 1 24 ? -9.094  -4.637  5.379   1.00 0.00 ? 24 HIS A CA   3  
ATOM 3011  C C    . HIS A 1 24 ? -10.104 -4.555  6.521   1.00 0.00 ? 24 HIS A C    3  
ATOM 3012  O O    . HIS A 1 24 ? -10.638 -5.571  6.960   1.00 0.00 ? 24 HIS A O    3  
ATOM 3013  C CB   . HIS A 1 24 ? -7.660  -4.408  5.870   1.00 0.00 ? 24 HIS A CB   3  
ATOM 3014  C CG   . HIS A 1 24 ? -7.253  -5.314  7.002   1.00 0.00 ? 24 HIS A CG   3  
ATOM 3015  N ND1  . HIS A 1 24 ? -6.513  -6.477  6.811   1.00 0.00 ? 24 HIS A ND1  3  
ATOM 3016  C CD2  . HIS A 1 24 ? -7.428  -5.229  8.358   1.00 0.00 ? 24 HIS A CD2  3  
ATOM 3017  C CE1  . HIS A 1 24 ? -6.304  -7.007  8.034   1.00 0.00 ? 24 HIS A CE1  3  
ATOM 3018  N NE2  . HIS A 1 24 ? -6.837  -6.291  9.022   1.00 0.00 ? 24 HIS A NE2  3  
ATOM 3019  H H    . HIS A 1 24 ? -8.739  -2.890  4.227   1.00 0.00 ? 24 HIS A H    3  
ATOM 3020  H HA   . HIS A 1 24 ? -9.163  -5.616  4.908   1.00 0.00 ? 24 HIS A HA   3  
ATOM 3021  H HB2  . HIS A 1 24 ? -6.979  -4.568  5.035   1.00 0.00 ? 24 HIS A HB2  3  
ATOM 3022  H HB3  . HIS A 1 24 ? -7.566  -3.377  6.205   1.00 0.00 ? 24 HIS A HB3  3  
ATOM 3023  H HD1  . HIS A 1 24 ? -6.191  -6.850  5.929   1.00 0.00 ? 24 HIS A HD1  3  
ATOM 3024  H HD2  . HIS A 1 24 ? -7.941  -4.424  8.851   1.00 0.00 ? 24 HIS A HD2  3  
ATOM 3025  H HE1  . HIS A 1 24 ? -5.750  -7.919  8.198   1.00 0.00 ? 24 HIS A HE1  3  
ATOM 3026  N N    . GLN A 1 25 ? -10.376 -3.332  6.985   1.00 0.00 ? 25 GLN A N    3  
ATOM 3027  C CA   . GLN A 1 25 ? -11.350 -3.091  8.034   1.00 0.00 ? 25 GLN A CA   3  
ATOM 3028  C C    . GLN A 1 25 ? -12.755 -3.128  7.420   1.00 0.00 ? 25 GLN A C    3  
ATOM 3029  O O    . GLN A 1 25 ? -13.493 -2.144  7.474   1.00 0.00 ? 25 GLN A O    3  
ATOM 3030  C CB   . GLN A 1 25 ? -11.047 -1.728  8.682   1.00 0.00 ? 25 GLN A CB   3  
ATOM 3031  C CG   . GLN A 1 25 ? -11.839 -1.560  9.984   1.00 0.00 ? 25 GLN A CG   3  
ATOM 3032  C CD   . GLN A 1 25 ? -11.389 -2.566  11.038  1.00 0.00 ? 25 GLN A CD   3  
ATOM 3033  O OE1  . GLN A 1 25 ? -12.135 -3.473  11.393  1.00 0.00 ? 25 GLN A OE1  3  
ATOM 3034  N NE2  . GLN A 1 25 ? -10.163 -2.403  11.537  1.00 0.00 ? 25 GLN A NE2  3  
ATOM 3035  H H    . GLN A 1 25 ? -9.897  -2.535  6.591   1.00 0.00 ? 25 GLN A H    3  
ATOM 3036  H HA   . GLN A 1 25 ? -11.265 -3.875  8.787   1.00 0.00 ? 25 GLN A HA   3  
ATOM 3037  H HB2  . GLN A 1 25 ? -9.981  -1.664  8.902   1.00 0.00 ? 25 GLN A HB2  3  
ATOM 3038  H HB3  . GLN A 1 25 ? -11.317 -0.930  7.990   1.00 0.00 ? 25 GLN A HB3  3  
ATOM 3039  H HG2  . GLN A 1 25 ? -11.683 -0.551  10.367  1.00 0.00 ? 25 GLN A HG2  3  
ATOM 3040  H HG3  . GLN A 1 25 ? -12.898 -1.701  9.783   1.00 0.00 ? 25 GLN A HG3  3  
ATOM 3041  H HE21 . GLN A 1 25 ? -9.584  -1.642  11.214  1.00 0.00 ? 25 GLN A HE21 3  
ATOM 3042  H HE22 . GLN A 1 25 ? -9.817  -3.042  12.238  1.00 0.00 ? 25 GLN A HE22 3  
ATOM 3043  N N    . ARG A 1 26 ? -13.113 -4.275  6.827   1.00 0.00 ? 26 ARG A N    3  
ATOM 3044  C CA   . ARG A 1 26 ? -14.408 -4.458  6.193   1.00 0.00 ? 26 ARG A CA   3  
ATOM 3045  C C    . ARG A 1 26 ? -14.664 -5.947  5.976   1.00 0.00 ? 26 ARG A C    3  
ATOM 3046  O O    . ARG A 1 26 ? -15.710 -6.458  6.368   1.00 0.00 ? 26 ARG A O    3  
ATOM 3047  C CB   . ARG A 1 26 ? -14.435 -3.698  4.857   1.00 0.00 ? 26 ARG A CB   3  
ATOM 3048  C CG   . ARG A 1 26 ? -15.480 -2.582  4.916   1.00 0.00 ? 26 ARG A CG   3  
ATOM 3049  C CD   . ARG A 1 26 ? -15.185 -1.539  3.833   1.00 0.00 ? 26 ARG A CD   3  
ATOM 3050  N NE   . ARG A 1 26 ? -15.811 -0.250  4.157   1.00 0.00 ? 26 ARG A NE   3  
ATOM 3051  C CZ   . ARG A 1 26 ? -15.365 0.562   5.135   1.00 0.00 ? 26 ARG A CZ   3  
ATOM 3052  N NH1  . ARG A 1 26 ? -14.300 0.215   5.874   1.00 0.00 ? 26 ARG A NH1  3  
ATOM 3053  N NH2  . ARG A 1 26 ? -15.988 1.723   5.370   1.00 0.00 ? 26 ARG A NH2  3  
ATOM 3054  H H    . ARG A 1 26 ? -12.462 -5.048  6.813   1.00 0.00 ? 26 ARG A H    3  
ATOM 3055  H HA   . ARG A 1 26 ? -15.185 -4.063  6.849   1.00 0.00 ? 26 ARG A HA   3  
ATOM 3056  H HB2  . ARG A 1 26 ? -13.456 -3.265  4.668   1.00 0.00 ? 26 ARG A HB2  3  
ATOM 3057  H HB3  . ARG A 1 26 ? -14.687 -4.385  4.048   1.00 0.00 ? 26 ARG A HB3  3  
ATOM 3058  H HG2  . ARG A 1 26 ? -16.472 -3.004  4.754   1.00 0.00 ? 26 ARG A HG2  3  
ATOM 3059  H HG3  . ARG A 1 26 ? -15.448 -2.108  5.895   1.00 0.00 ? 26 ARG A HG3  3  
ATOM 3060  H HD2  . ARG A 1 26 ? -14.107 -1.399  3.748   1.00 0.00 ? 26 ARG A HD2  3  
ATOM 3061  H HD3  . ARG A 1 26 ? -15.573 -1.895  2.878   1.00 0.00 ? 26 ARG A HD3  3  
ATOM 3062  H HE   . ARG A 1 26 ? -16.616 0.027   3.613   1.00 0.00 ? 26 ARG A HE   3  
ATOM 3063  H HH11 . ARG A 1 26 ? -13.806 -0.650  5.682   1.00 0.00 ? 26 ARG A HH11 3  
ATOM 3064  H HH12 . ARG A 1 26 ? -13.986 0.814   6.622   1.00 0.00 ? 26 ARG A HH12 3  
ATOM 3065  H HH21 . ARG A 1 26 ? -16.790 1.988   4.816   1.00 0.00 ? 26 ARG A HH21 3  
ATOM 3066  H HH22 . ARG A 1 26 ? -15.658 2.335   6.102   1.00 0.00 ? 26 ARG A HH22 3  
ATOM 3067  N N    . GLY A 1 27 ? -13.705 -6.645  5.351   1.00 0.00 ? 27 GLY A N    3  
ATOM 3068  C CA   . GLY A 1 27 ? -13.846 -8.069  5.094   1.00 0.00 ? 27 GLY A CA   3  
ATOM 3069  C C    . GLY A 1 27 ? -12.645 -8.602  4.318   1.00 0.00 ? 27 GLY A C    3  
ATOM 3070  O O    . GLY A 1 27 ? -12.084 -9.636  4.679   1.00 0.00 ? 27 GLY A O    3  
ATOM 3071  H H    . GLY A 1 27 ? -12.861 -6.180  5.046   1.00 0.00 ? 27 GLY A H    3  
ATOM 3072  H HA2  . GLY A 1 27 ? -13.923 -8.600  6.044   1.00 0.00 ? 27 GLY A HA2  3  
ATOM 3073  H HA3  . GLY A 1 27 ? -14.752 -8.242  4.513   1.00 0.00 ? 27 GLY A HA3  3  
ATOM 3074  N N    . ASP A 1 28 ? -12.255 -7.901  3.246   1.00 0.00 ? 28 ASP A N    3  
ATOM 3075  C CA   . ASP A 1 28 ? -11.137 -8.322  2.410   1.00 0.00 ? 28 ASP A CA   3  
ATOM 3076  C C    . ASP A 1 28 ? -9.812  -8.005  3.099   1.00 0.00 ? 28 ASP A C    3  
ATOM 3077  O O    . ASP A 1 28 ? -9.101  -7.086  2.695   1.00 0.00 ? 28 ASP A O    3  
ATOM 3078  C CB   . ASP A 1 28 ? -11.222 -7.615  1.055   1.00 0.00 ? 28 ASP A CB   3  
ATOM 3079  C CG   . ASP A 1 28 ? -12.342 -8.186  0.198   1.00 0.00 ? 28 ASP A CG   3  
ATOM 3080  O OD1  . ASP A 1 28 ? -12.355 -9.423  0.026   1.00 0.00 ? 28 ASP A OD1  3  
ATOM 3081  O OD2  . ASP A 1 28 ? -13.164 -7.371  -0.274  1.00 0.00 ? 28 ASP A OD2  3  
ATOM 3082  H H    . ASP A 1 28 ? -12.747 -7.052  2.998   1.00 0.00 ? 28 ASP A H    3  
ATOM 3083  H HA   . ASP A 1 28 ? -11.199 -9.399  2.251   1.00 0.00 ? 28 ASP A HA   3  
ATOM 3084  H HB2  . ASP A 1 28 ? -11.401 -6.556  1.220   1.00 0.00 ? 28 ASP A HB2  3  
ATOM 3085  H HB3  . ASP A 1 28 ? -10.276 -7.739  0.526   1.00 0.00 ? 28 ASP A HB3  3  
ATOM 3086  N N    . THR A 1 29 ? -9.478  -8.778  4.137   1.00 0.00 ? 29 THR A N    3  
ATOM 3087  C CA   . THR A 1 29 ? -8.229  -8.603  4.861   1.00 0.00 ? 29 THR A CA   3  
ATOM 3088  C C    . THR A 1 29 ? -7.087  -9.301  4.109   1.00 0.00 ? 29 THR A C    3  
ATOM 3089  O O    . THR A 1 29 ? -5.918  -9.094  4.432   1.00 0.00 ? 29 THR A O    3  
ATOM 3090  C CB   . THR A 1 29 ? -8.375  -9.181  6.278   1.00 0.00 ? 29 THR A CB   3  
ATOM 3091  O OG1  . THR A 1 29 ? -8.687  -10.557 6.199   1.00 0.00 ? 29 THR A OG1  3  
ATOM 3092  C CG2  . THR A 1 29 ? -9.485  -8.455  7.035   1.00 0.00 ? 29 THR A CG2  3  
ATOM 3093  H H    . THR A 1 29 ? -10.107 -9.513  4.435   1.00 0.00 ? 29 THR A H    3  
ATOM 3094  H HA   . THR A 1 29 ? -8.005  -7.540  4.934   1.00 0.00 ? 29 THR A HA   3  
ATOM 3095  H HB   . THR A 1 29 ? -7.438  -9.050  6.819   1.00 0.00 ? 29 THR A HB   3  
ATOM 3096  H HG1  . THR A 1 29 ? -7.911  -11.030 5.893   1.00 0.00 ? 29 THR A HG1  3  
ATOM 3097  H HG21 . THR A 1 29 ? -9.645  -8.940  7.998   1.00 0.00 ? 29 THR A HG21 3  
ATOM 3098  H HG22 . THR A 1 29 ? -10.408 -8.484  6.458   1.00 0.00 ? 29 THR A HG22 3  
ATOM 3099  H HG23 . THR A 1 29 ? -9.192  -7.422  7.198   1.00 0.00 ? 29 THR A HG23 3  
ATOM 3100  N N    . HIS A 1 30 ? -7.432  -10.135 3.110   1.00 0.00 ? 30 HIS A N    3  
ATOM 3101  C CA   . HIS A 1 30 ? -6.449  -10.883 2.338   1.00 0.00 ? 30 HIS A CA   3  
ATOM 3102  C C    . HIS A 1 30 ? -5.533  -9.923  1.556   1.00 0.00 ? 30 HIS A C    3  
ATOM 3103  O O    . HIS A 1 30 ? -5.936  -8.803  1.247   1.00 0.00 ? 30 HIS A O    3  
ATOM 3104  C CB   . HIS A 1 30 ? -7.185  -11.842 1.387   1.00 0.00 ? 30 HIS A CB   3  
ATOM 3105  C CG   . HIS A 1 30 ? -7.525  -11.217 0.055   1.00 0.00 ? 30 HIS A CG   3  
ATOM 3106  N ND1  . HIS A 1 30 ? -8.185  -9.997  -0.063  1.00 0.00 ? 30 HIS A ND1  3  
ATOM 3107  C CD2  . HIS A 1 30 ? -7.300  -11.620 -1.236  1.00 0.00 ? 30 HIS A CD2  3  
ATOM 3108  C CE1  . HIS A 1 30 ? -8.310  -9.750  -1.382  1.00 0.00 ? 30 HIS A CE1  3  
ATOM 3109  N NE2  . HIS A 1 30 ? -7.790  -10.705 -2.154  1.00 0.00 ? 30 HIS A NE2  3  
ATOM 3110  H H    . HIS A 1 30 ? -8.407  -10.259 2.883   1.00 0.00 ? 30 HIS A H    3  
ATOM 3111  H HA   . HIS A 1 30 ? -5.848  -11.469 3.030   1.00 0.00 ? 30 HIS A HA   3  
ATOM 3112  H HB2  . HIS A 1 30 ? -6.553  -12.712 1.209   1.00 0.00 ? 30 HIS A HB2  3  
ATOM 3113  H HB3  . HIS A 1 30 ? -8.107  -12.175 1.864   1.00 0.00 ? 30 HIS A HB3  3  
ATOM 3114  H HD1  . HIS A 1 30 ? -8.505  -9.410  0.693   1.00 0.00 ? 30 HIS A HD1  3  
ATOM 3115  H HD2  . HIS A 1 30 ? -6.799  -12.538 -1.506  1.00 0.00 ? 30 HIS A HD2  3  
ATOM 3116  H HE1  . HIS A 1 30 ? -8.781  -8.863  -1.776  1.00 0.00 ? 30 HIS A HE1  3  
ATOM 3117  N N    . PRO A 1 31 ? -4.295  -10.358 1.235   1.00 0.00 ? 31 PRO A N    3  
ATOM 3118  C CA   . PRO A 1 31 ? -3.349  -9.544  0.500   1.00 0.00 ? 31 PRO A CA   3  
ATOM 3119  C C    . PRO A 1 31 ? -3.787  -9.355  -0.954  1.00 0.00 ? 31 PRO A C    3  
ATOM 3120  O O    . PRO A 1 31 ? -4.557  -10.156 -1.485  1.00 0.00 ? 31 PRO A O    3  
ATOM 3121  C CB   . PRO A 1 31 ? -2.017  -10.297 0.572   1.00 0.00 ? 31 PRO A CB   3  
ATOM 3122  C CG   . PRO A 1 31 ? -2.324  -11.688 1.134   1.00 0.00 ? 31 PRO A CG   3  
ATOM 3123  C CD   . PRO A 1 31 ? -3.780  -11.664 1.598   1.00 0.00 ? 31 PRO A CD   3  
ATOM 3124  H HA   . PRO A 1 31 ? -3.251  -8.574  0.979   1.00 0.00 ? 31 PRO A HA   3  
ATOM 3125  H HB2  . PRO A 1 31 ? -1.586  -10.381 -0.415  1.00 0.00 ? 31 PRO A HB2  3  
ATOM 3126  H HB3  . PRO A 1 31 ? -1.326  -9.776  1.231   1.00 0.00 ? 31 PRO A HB3  3  
ATOM 3127  H HG2  . PRO A 1 31 ? -2.192  -12.442 0.359   1.00 0.00 ? 31 PRO A HG2  3  
ATOM 3128  H HG3  . PRO A 1 31 ? -1.667  -11.902 1.975   1.00 0.00 ? 31 PRO A HG3  3  
ATOM 3129  H HD2  . PRO A 1 31 ? -4.345  -12.448 1.095   1.00 0.00 ? 31 PRO A HD2  3  
ATOM 3130  H HD3  . PRO A 1 31 ? -3.823  -11.801 2.678   1.00 0.00 ? 31 PRO A HD3  3  
ATOM 3131  N N    . LEU A 1 32 ? -3.274  -8.294  -1.591  1.00 0.00 ? 32 LEU A N    3  
ATOM 3132  C CA   . LEU A 1 32 ? -3.570  -7.983  -2.985  1.00 0.00 ? 32 LEU A CA   3  
ATOM 3133  C C    . LEU A 1 32 ? -2.268  -7.663  -3.720  1.00 0.00 ? 32 LEU A C    3  
ATOM 3134  O O    . LEU A 1 32 ? -1.331  -7.144  -3.114  1.00 0.00 ? 32 LEU A O    3  
ATOM 3135  C CB   . LEU A 1 32 ? -4.494  -6.762  -3.050  1.00 0.00 ? 32 LEU A CB   3  
ATOM 3136  C CG   . LEU A 1 32 ? -5.962  -7.145  -2.796  1.00 0.00 ? 32 LEU A CG   3  
ATOM 3137  C CD1  . LEU A 1 32 ? -6.816  -5.877  -2.851  1.00 0.00 ? 32 LEU A CD1  3  
ATOM 3138  C CD2  . LEU A 1 32 ? -6.460  -8.125  -3.865  1.00 0.00 ? 32 LEU A CD2  3  
ATOM 3139  H H    . LEU A 1 32 ? -2.648  -7.673  -1.094  1.00 0.00 ? 32 LEU A H    3  
ATOM 3140  H HA   . LEU A 1 32 ? -4.050  -8.835  -3.460  1.00 0.00 ? 32 LEU A HA   3  
ATOM 3141  H HB2  . LEU A 1 32 ? -4.179  -6.038  -2.297  1.00 0.00 ? 32 LEU A HB2  3  
ATOM 3142  H HB3  . LEU A 1 32 ? -4.405  -6.308  -4.033  1.00 0.00 ? 32 LEU A HB3  3  
ATOM 3143  H HG   . LEU A 1 32 ? -6.055  -7.603  -1.810  1.00 0.00 ? 32 LEU A HG   3  
ATOM 3144  H HD11 . LEU A 1 32 ? -6.466  -5.170  -2.100  1.00 0.00 ? 32 LEU A HD11 3  
ATOM 3145  H HD12 . LEU A 1 32 ? -6.732  -5.424  -3.844  1.00 0.00 ? 32 LEU A HD12 3  
ATOM 3146  H HD13 . LEU A 1 32 ? -7.858  -6.129  -2.655  1.00 0.00 ? 32 LEU A HD13 3  
ATOM 3147  H HD21 . LEU A 1 32 ? -7.550  -8.148  -3.854  1.00 0.00 ? 32 LEU A HD21 3  
ATOM 3148  H HD22 . LEU A 1 32 ? -6.079  -9.123  -3.658  1.00 0.00 ? 32 LEU A HD22 3  
ATOM 3149  H HD23 . LEU A 1 32 ? -6.117  -7.798  -4.842  1.00 0.00 ? 32 LEU A HD23 3  
ATOM 3150  N N    . THR A 1 33 ? -2.210  -7.958  -5.028  1.00 0.00 ? 33 THR A N    3  
ATOM 3151  C CA   . THR A 1 33 ? -1.034  -7.635  -5.833  1.00 0.00 ? 33 THR A CA   3  
ATOM 3152  C C    . THR A 1 33 ? -0.833  -6.118  -5.842  1.00 0.00 ? 33 THR A C    3  
ATOM 3153  O O    . THR A 1 33 ? -1.726  -5.360  -5.456  1.00 0.00 ? 33 THR A O    3  
ATOM 3154  C CB   . THR A 1 33 ? -1.199  -8.135  -7.280  1.00 0.00 ? 33 THR A CB   3  
ATOM 3155  O OG1  . THR A 1 33 ? -2.307  -7.506  -7.873  1.00 0.00 ? 33 THR A OG1  3  
ATOM 3156  C CG2  . THR A 1 33 ? -1.394  -9.650  -7.318  1.00 0.00 ? 33 THR A CG2  3  
ATOM 3157  H H    . THR A 1 33 ? -3.000  -8.406  -5.478  1.00 0.00 ? 33 THR A H    3  
ATOM 3158  H HA   . THR A 1 33 ? -0.160  -8.111  -5.390  1.00 0.00 ? 33 THR A HA   3  
ATOM 3159  H HB   . THR A 1 33 ? -0.303  -7.881  -7.848  1.00 0.00 ? 33 THR A HB   3  
ATOM 3160  H HG1  . THR A 1 33 ? -3.108  -7.842  -7.452  1.00 0.00 ? 33 THR A HG1  3  
ATOM 3161  H HG21 . THR A 1 33 ? -1.627  -9.959  -8.338  1.00 0.00 ? 33 THR A HG21 3  
ATOM 3162  H HG22 . THR A 1 33 ? -0.480  -10.144 -6.993  1.00 0.00 ? 33 THR A HG22 3  
ATOM 3163  H HG23 . THR A 1 33 ? -2.214  -9.931  -6.663  1.00 0.00 ? 33 THR A HG23 3  
ATOM 3164  N N    . LEU A 1 34 ? 0.341   -5.678  -6.294  1.00 0.00 ? 34 LEU A N    3  
ATOM 3165  C CA   . LEU A 1 34 ? 0.653   -4.263  -6.374  1.00 0.00 ? 34 LEU A CA   3  
ATOM 3166  C C    . LEU A 1 34 ? -0.366  -3.562  -7.283  1.00 0.00 ? 34 LEU A C    3  
ATOM 3167  O O    . LEU A 1 34 ? -0.970  -2.575  -6.886  1.00 0.00 ? 34 LEU A O    3  
ATOM 3168  C CB   . LEU A 1 34 ? 2.087   -4.104  -6.904  1.00 0.00 ? 34 LEU A CB   3  
ATOM 3169  C CG   . LEU A 1 34 ? 2.729   -2.812  -6.370  1.00 0.00 ? 34 LEU A CG   3  
ATOM 3170  C CD1  . LEU A 1 34 ? 4.215   -2.821  -6.705  1.00 0.00 ? 34 LEU A CD1  3  
ATOM 3171  C CD2  . LEU A 1 34 ? 2.071   -1.587  -7.001  1.00 0.00 ? 34 LEU A CD2  3  
ATOM 3172  H H    . LEU A 1 34 ? 1.039   -6.340  -6.597  1.00 0.00 ? 34 LEU A H    3  
ATOM 3173  H HA   . LEU A 1 34 ? 0.593   -3.833  -5.373  1.00 0.00 ? 34 LEU A HA   3  
ATOM 3174  H HB2  . LEU A 1 34 ? 2.683   -4.956  -6.574  1.00 0.00 ? 34 LEU A HB2  3  
ATOM 3175  H HB3  . LEU A 1 34 ? 2.073   -4.081  -7.993  1.00 0.00 ? 34 LEU A HB3  3  
ATOM 3176  H HG   . LEU A 1 34 ? 2.615   -2.762  -5.290  1.00 0.00 ? 34 LEU A HG   3  
ATOM 3177  H HD11 . LEU A 1 34 ? 4.663   -3.739  -6.330  1.00 0.00 ? 34 LEU A HD11 3  
ATOM 3178  H HD12 . LEU A 1 34 ? 4.346   -2.767  -7.786  1.00 0.00 ? 34 LEU A HD12 3  
ATOM 3179  H HD13 . LEU A 1 34 ? 4.696   -1.965  -6.236  1.00 0.00 ? 34 LEU A HD13 3  
ATOM 3180  H HD21 . LEU A 1 34 ? 2.752   -0.738  -6.942  1.00 0.00 ? 34 LEU A HD21 3  
ATOM 3181  H HD22 . LEU A 1 34 ? 1.158   -1.353  -6.459  1.00 0.00 ? 34 LEU A HD22 3  
ATOM 3182  H HD23 . LEU A 1 34 ? 1.836   -1.794  -8.043  1.00 0.00 ? 34 LEU A HD23 3  
ATOM 3183  N N    . ASP A 1 35 ? -0.555  -4.081  -8.503  1.00 0.00 ? 35 ASP A N    3  
ATOM 3184  C CA   . ASP A 1 35 ? -1.480  -3.483  -9.464  1.00 0.00 ? 35 ASP A CA   3  
ATOM 3185  C C    . ASP A 1 35 ? -2.912  -3.455  -8.908  1.00 0.00 ? 35 ASP A C    3  
ATOM 3186  O O    . ASP A 1 35 ? -3.612  -2.462  -9.091  1.00 0.00 ? 35 ASP A O    3  
ATOM 3187  C CB   . ASP A 1 35 ? -1.410  -4.249  -10.792 1.00 0.00 ? 35 ASP A CB   3  
ATOM 3188  C CG   . ASP A 1 35 ? -0.354  -3.648  -11.728 1.00 0.00 ? 35 ASP A CG   3  
ATOM 3189  O OD1  . ASP A 1 35 ? 0.589   -3.003  -11.205 1.00 0.00 ? 35 ASP A OD1  3  
ATOM 3190  O OD2  . ASP A 1 35 ? -0.508  -3.839  -12.952 1.00 0.00 ? 35 ASP A OD2  3  
ATOM 3191  H H    . ASP A 1 35 ? -0.044  -4.904  -8.781  1.00 0.00 ? 35 ASP A H    3  
ATOM 3192  H HA   . ASP A 1 35 ? -1.172  -2.456  -9.643  1.00 0.00 ? 35 ASP A HA   3  
ATOM 3193  H HB2  . ASP A 1 35 ? -1.164  -5.293  -10.596 1.00 0.00 ? 35 ASP A HB2  3  
ATOM 3194  H HB3  . ASP A 1 35 ? -2.382  -4.201  -11.283 1.00 0.00 ? 35 ASP A HB3  3  
ATOM 3195  N N    . GLU A 1 36 ? -3.349  -4.525  -8.225  1.00 0.00 ? 36 GLU A N    3  
ATOM 3196  C CA   . GLU A 1 36 ? -4.686  -4.555  -7.627  1.00 0.00 ? 36 GLU A CA   3  
ATOM 3197  C C    . GLU A 1 36 ? -4.829  -3.386  -6.652  1.00 0.00 ? 36 GLU A C    3  
ATOM 3198  O O    . GLU A 1 36 ? -5.853  -2.705  -6.637  1.00 0.00 ? 36 GLU A O    3  
ATOM 3199  C CB   . GLU A 1 36 ? -4.914  -5.890  -6.915  1.00 0.00 ? 36 GLU A CB   3  
ATOM 3200  C CG   . GLU A 1 36 ? -5.317  -6.960  -7.937  1.00 0.00 ? 36 GLU A CG   3  
ATOM 3201  C CD   . GLU A 1 36 ? -5.378  -8.342  -7.293  1.00 0.00 ? 36 GLU A CD   3  
ATOM 3202  O OE1  . GLU A 1 36 ? -4.399  -8.685  -6.591  1.00 0.00 ? 36 GLU A OE1  3  
ATOM 3203  O OE2  . GLU A 1 36 ? -6.398  -9.028  -7.512  1.00 0.00 ? 36 GLU A OE2  3  
ATOM 3204  H H    . GLU A 1 36 ? -2.748  -5.331  -8.107  1.00 0.00 ? 36 GLU A H    3  
ATOM 3205  H HA   . GLU A 1 36 ? -5.432  -4.445  -8.412  1.00 0.00 ? 36 GLU A HA   3  
ATOM 3206  H HB2  . GLU A 1 36 ? -3.999  -6.192  -6.407  1.00 0.00 ? 36 GLU A HB2  3  
ATOM 3207  H HB3  . GLU A 1 36 ? -5.712  -5.777  -6.181  1.00 0.00 ? 36 GLU A HB3  3  
ATOM 3208  H HG2  . GLU A 1 36 ? -6.299  -6.713  -8.343  1.00 0.00 ? 36 GLU A HG2  3  
ATOM 3209  H HG3  . GLU A 1 36 ? -4.591  -6.976  -8.749  1.00 0.00 ? 36 GLU A HG3  3  
ATOM 3210  N N    . ILE A 1 37 ? -3.792  -3.153  -5.843  1.00 0.00 ? 37 ILE A N    3  
ATOM 3211  C CA   . ILE A 1 37 ? -3.785  -2.059  -4.886  1.00 0.00 ? 37 ILE A CA   3  
ATOM 3212  C C    . ILE A 1 37 ? -3.831  -0.719  -5.629  1.00 0.00 ? 37 ILE A C    3  
ATOM 3213  O O    . ILE A 1 37 ? -4.577  0.179   -5.234  1.00 0.00 ? 37 ILE A O    3  
ATOM 3214  C CB   . ILE A 1 37 ? -2.527  -2.180  -4.004  1.00 0.00 ? 37 ILE A CB   3  
ATOM 3215  C CG1  . ILE A 1 37 ? -2.768  -3.249  -2.927  1.00 0.00 ? 37 ILE A CG1  3  
ATOM 3216  C CG2  . ILE A 1 37 ? -2.208  -0.835  -3.343  1.00 0.00 ? 37 ILE A CG2  3  
ATOM 3217  C CD1  . ILE A 1 37 ? -1.432  -3.763  -2.384  1.00 0.00 ? 37 ILE A CD1  3  
ATOM 3218  H H    . ILE A 1 37 ? -2.975  -3.750  -5.893  1.00 0.00 ? 37 ILE A H    3  
ATOM 3219  H HA   . ILE A 1 37 ? -4.673  -2.136  -4.253  1.00 0.00 ? 37 ILE A HA   3  
ATOM 3220  H HB   . ILE A 1 37 ? -1.683  -2.479  -4.621  1.00 0.00 ? 37 ILE A HB   3  
ATOM 3221  H HG12 . ILE A 1 37 ? -3.349  -2.821  -2.111  1.00 0.00 ? 37 ILE A HG12 3  
ATOM 3222  H HG13 . ILE A 1 37 ? -3.318  -4.081  -3.363  1.00 0.00 ? 37 ILE A HG13 3  
ATOM 3223  H HG21 . ILE A 1 37 ? -1.845  -0.134  -4.096  1.00 0.00 ? 37 ILE A HG21 3  
ATOM 3224  H HG22 . ILE A 1 37 ? -3.104  -0.431  -2.877  1.00 0.00 ? 37 ILE A HG22 3  
ATOM 3225  H HG23 . ILE A 1 37 ? -1.439  -0.976  -2.587  1.00 0.00 ? 37 ILE A HG23 3  
ATOM 3226  H HD11 . ILE A 1 37 ? -0.906  -2.956  -1.876  1.00 0.00 ? 37 ILE A HD11 3  
ATOM 3227  H HD12 . ILE A 1 37 ? -1.619  -4.572  -1.678  1.00 0.00 ? 37 ILE A HD12 3  
ATOM 3228  H HD13 . ILE A 1 37 ? -0.822  -4.135  -3.206  1.00 0.00 ? 37 ILE A HD13 3  
ATOM 3229  N N    . LEU A 1 38 ? -3.034  -0.581  -6.704  1.00 0.00 ? 38 LEU A N    3  
ATOM 3230  C CA   . LEU A 1 38 ? -2.998  0.652   -7.483  1.00 0.00 ? 38 LEU A CA   3  
ATOM 3231  C C    . LEU A 1 38 ? -4.396  0.987   -8.001  1.00 0.00 ? 38 LEU A C    3  
ATOM 3232  O O    . LEU A 1 38 ? -4.871  2.098   -7.807  1.00 0.00 ? 38 LEU A O    3  
ATOM 3233  C CB   . LEU A 1 38 ? -2.018  0.517   -8.664  1.00 0.00 ? 38 LEU A CB   3  
ATOM 3234  C CG   . LEU A 1 38 ? -0.562  0.440   -8.185  1.00 0.00 ? 38 LEU A CG   3  
ATOM 3235  C CD1  . LEU A 1 38 ? 0.349   0.246   -9.395  1.00 0.00 ? 38 LEU A CD1  3  
ATOM 3236  C CD2  . LEU A 1 38 ? -0.138  1.723   -7.457  1.00 0.00 ? 38 LEU A CD2  3  
ATOM 3237  H H    . LEU A 1 38 ? -2.439  -1.349  -6.989  1.00 0.00 ? 38 LEU A H    3  
ATOM 3238  H HA   . LEU A 1 38 ? -2.668  1.461   -6.842  1.00 0.00 ? 38 LEU A HA   3  
ATOM 3239  H HB2  . LEU A 1 38 ? -2.257  -0.386  -9.223  1.00 0.00 ? 38 LEU A HB2  3  
ATOM 3240  H HB3  . LEU A 1 38 ? -2.127  1.371   -9.319  1.00 0.00 ? 38 LEU A HB3  3  
ATOM 3241  H HG   . LEU A 1 38 ? -0.455  -0.402  -7.520  1.00 0.00 ? 38 LEU A HG   3  
ATOM 3242  H HD11 . LEU A 1 38 ? 0.140   -0.714  -9.861  1.00 0.00 ? 38 LEU A HD11 3  
ATOM 3243  H HD12 . LEU A 1 38 ? 1.388   0.274   -9.072  1.00 0.00 ? 38 LEU A HD12 3  
ATOM 3244  H HD13 . LEU A 1 38 ? 0.171   1.045   -10.116 1.00 0.00 ? 38 LEU A HD13 3  
ATOM 3245  H HD21 . LEU A 1 38 ? -0.316  2.583   -8.098  1.00 0.00 ? 38 LEU A HD21 3  
ATOM 3246  H HD22 . LEU A 1 38 ? 0.924   1.667   -7.220  1.00 0.00 ? 38 LEU A HD22 3  
ATOM 3247  H HD23 . LEU A 1 38 ? -0.702  1.831   -6.533  1.00 0.00 ? 38 LEU A HD23 3  
ATOM 3248  N N    . ASP A 1 39 ? -5.045  0.025   -8.667  1.00 0.00 ? 39 ASP A N    3  
ATOM 3249  C CA   . ASP A 1 39 ? -6.367  0.229   -9.253  1.00 0.00 ? 39 ASP A CA   3  
ATOM 3250  C C    . ASP A 1 39 ? -7.305  0.944   -8.272  1.00 0.00 ? 39 ASP A C    3  
ATOM 3251  O O    . ASP A 1 39 ? -7.852  2.001   -8.591  1.00 0.00 ? 39 ASP A O    3  
ATOM 3252  C CB   . ASP A 1 39 ? -6.949  -1.128  -9.656  1.00 0.00 ? 39 ASP A CB   3  
ATOM 3253  C CG   . ASP A 1 39 ? -8.294  -0.957  -10.351 1.00 0.00 ? 39 ASP A CG   3  
ATOM 3254  O OD1  . ASP A 1 39 ? -8.274  -0.762  -11.586 1.00 0.00 ? 39 ASP A OD1  3  
ATOM 3255  O OD2  . ASP A 1 39 ? -9.315  -1.022  -9.634  1.00 0.00 ? 39 ASP A OD2  3  
ATOM 3256  H H    . ASP A 1 39 ? -4.607  -0.881  -8.783  1.00 0.00 ? 39 ASP A H    3  
ATOM 3257  H HA   . ASP A 1 39 ? -6.259  0.843   -10.147 1.00 0.00 ? 39 ASP A HA   3  
ATOM 3258  H HB2  . ASP A 1 39 ? -6.257  -1.628  -10.334 1.00 0.00 ? 39 ASP A HB2  3  
ATOM 3259  H HB3  . ASP A 1 39 ? -7.081  -1.743  -8.766  1.00 0.00 ? 39 ASP A HB3  3  
ATOM 3260  N N    . GLU A 1 40 ? -7.490  0.361   -7.086  1.00 0.00 ? 40 GLU A N    3  
ATOM 3261  C CA   . GLU A 1 40 ? -8.392  0.904   -6.077  1.00 0.00 ? 40 GLU A CA   3  
ATOM 3262  C C    . GLU A 1 40 ? -7.975  2.315   -5.641  1.00 0.00 ? 40 GLU A C    3  
ATOM 3263  O O    . GLU A 1 40 ? -8.832  3.149   -5.350  1.00 0.00 ? 40 GLU A O    3  
ATOM 3264  C CB   . GLU A 1 40 ? -8.419  -0.050  -4.883  1.00 0.00 ? 40 GLU A CB   3  
ATOM 3265  C CG   . GLU A 1 40 ? -9.011  -1.397  -5.319  1.00 0.00 ? 40 GLU A CG   3  
ATOM 3266  C CD   . GLU A 1 40 ? -9.912  -1.976  -4.240  1.00 0.00 ? 40 GLU A CD   3  
ATOM 3267  O OE1  . GLU A 1 40 ? -10.993 -1.391  -4.021  1.00 0.00 ? 40 GLU A OE1  3  
ATOM 3268  O OE2  . GLU A 1 40 ? -9.510  -2.999  -3.645  1.00 0.00 ? 40 GLU A OE2  3  
ATOM 3269  H H    . GLU A 1 40 ? -7.000  -0.498  -6.873  1.00 0.00 ? 40 GLU A H    3  
ATOM 3270  H HA   . GLU A 1 40 ? -9.396  0.959   -6.502  1.00 0.00 ? 40 GLU A HA   3  
ATOM 3271  H HB2  . GLU A 1 40 ? -7.404  -0.200  -4.514  1.00 0.00 ? 40 GLU A HB2  3  
ATOM 3272  H HB3  . GLU A 1 40 ? -9.030  0.378   -4.091  1.00 0.00 ? 40 GLU A HB3  3  
ATOM 3273  H HG2  . GLU A 1 40 ? -9.596  -1.258  -6.228  1.00 0.00 ? 40 GLU A HG2  3  
ATOM 3274  H HG3  . GLU A 1 40 ? -8.199  -2.097  -5.523  1.00 0.00 ? 40 GLU A HG3  3  
ATOM 3275  N N    . THR A 1 41 ? -6.667  2.586   -5.593  1.00 0.00 ? 41 THR A N    3  
ATOM 3276  C CA   . THR A 1 41 ? -6.156  3.896   -5.183  1.00 0.00 ? 41 THR A CA   3  
ATOM 3277  C C    . THR A 1 41 ? -6.160  4.881   -6.356  1.00 0.00 ? 41 THR A C    3  
ATOM 3278  O O    . THR A 1 41 ? -5.634  5.973   -6.228  1.00 0.00 ? 41 THR A O    3  
ATOM 3279  C CB   . THR A 1 41 ? -4.767  3.723   -4.574  1.00 0.00 ? 41 THR A CB   3  
ATOM 3280  O OG1  . THR A 1 41 ? -3.976  2.904   -5.397  1.00 0.00 ? 41 THR A OG1  3  
ATOM 3281  C CG2  . THR A 1 41 ? -4.899  3.074   -3.198  1.00 0.00 ? 41 THR A CG2  3  
ATOM 3282  H H    . THR A 1 41 ? -5.999  1.871   -5.848  1.00 0.00 ? 41 THR A H    3  
ATOM 3283  H HA   . THR A 1 41 ? -6.789  4.309   -4.419  1.00 0.00 ? 41 THR A HA   3  
ATOM 3284  H HB   . THR A 1 41 ? -4.296  4.694   -4.463  1.00 0.00 ? 41 THR A HB   3  
ATOM 3285  H HG1  . THR A 1 41 ? -4.303  2.003   -5.339  1.00 0.00 ? 41 THR A HG1  3  
ATOM 3286  H HG21 . THR A 1 41 ? -5.779  2.433   -3.178  1.00 0.00 ? 41 THR A HG21 3  
ATOM 3287  H HG22 . THR A 1 41 ? -4.997  3.850   -2.438  1.00 0.00 ? 41 THR A HG22 3  
ATOM 3288  H HG23 . THR A 1 41 ? -4.015  2.477   -2.994  1.00 0.00 ? 41 THR A HG23 3  
ATOM 3289  N N    . GLN A 1 42 ? -6.775  4.501   -7.489  1.00 0.00 ? 42 GLN A N    3  
ATOM 3290  C CA   . GLN A 1 42 ? -6.859  5.361   -8.672  1.00 0.00 ? 42 GLN A CA   3  
ATOM 3291  C C    . GLN A 1 42 ? -5.472  5.508   -9.296  1.00 0.00 ? 42 GLN A C    3  
ATOM 3292  O O    . GLN A 1 42 ? -5.103  6.585   -9.766  1.00 0.00 ? 42 GLN A O    3  
ATOM 3293  C CB   . GLN A 1 42 ? -7.457  6.735   -8.315  1.00 0.00 ? 42 GLN A CB   3  
ATOM 3294  C CG   . GLN A 1 42 ? -8.677  6.564   -7.402  1.00 0.00 ? 42 GLN A CG   3  
ATOM 3295  C CD   . GLN A 1 42 ? -9.457  7.868   -7.283  1.00 0.00 ? 42 GLN A CD   3  
ATOM 3296  O OE1  . GLN A 1 42 ? -10.662 7.896   -7.511  1.00 0.00 ? 42 GLN A OE1  3  
ATOM 3297  N NE2  . GLN A 1 42 ? -8.766  8.951   -6.922  1.00 0.00 ? 42 GLN A NE2  3  
ATOM 3298  H H    . GLN A 1 42 ? -7.201  3.585   -7.542  1.00 0.00 ? 42 GLN A H    3  
ATOM 3299  H HA   . GLN A 1 42 ? -7.513  4.879   -9.399  1.00 0.00 ? 42 GLN A HA   3  
ATOM 3300  H HB2  . GLN A 1 42 ? -6.707  7.342   -7.810  1.00 0.00 ? 42 GLN A HB2  3  
ATOM 3301  H HB3  . GLN A 1 42 ? -7.764  7.238   -9.232  1.00 0.00 ? 42 GLN A HB3  3  
ATOM 3302  H HG2  . GLN A 1 42 ? -9.328  5.793   -7.813  1.00 0.00 ? 42 GLN A HG2  3  
ATOM 3303  H HG3  . GLN A 1 42 ? -8.345  6.259   -6.409  1.00 0.00 ? 42 GLN A HG3  3  
ATOM 3304  H HE21 . GLN A 1 42 ? -7.774  8.884   -6.758  1.00 0.00 ? 42 GLN A HE21 3  
ATOM 3305  H HE22 . GLN A 1 42 ? -9.241  9.836   -6.815  1.00 0.00 ? 42 GLN A HE22 3  
ATOM 3306  N N    . HIS A 1 43 ? -4.715  4.410   -9.293  1.00 0.00 ? 43 HIS A N    3  
ATOM 3307  C CA   . HIS A 1 43 ? -3.381  4.355   -9.865  1.00 0.00 ? 43 HIS A CA   3  
ATOM 3308  C C    . HIS A 1 43 ? -3.294  3.104   -10.739 1.00 0.00 ? 43 HIS A C    3  
ATOM 3309  O O    . HIS A 1 43 ? -4.157  2.239   -10.654 1.00 0.00 ? 43 HIS A O    3  
ATOM 3310  C CB   . HIS A 1 43 ? -2.325  4.277   -8.748  1.00 0.00 ? 43 HIS A CB   3  
ATOM 3311  C CG   . HIS A 1 43 ? -2.561  5.196   -7.574  1.00 0.00 ? 43 HIS A CG   3  
ATOM 3312  N ND1  . HIS A 1 43 ? -3.130  6.459   -7.680  1.00 0.00 ? 43 HIS A ND1  3  
ATOM 3313  C CD2  . HIS A 1 43 ? -2.306  5.044   -6.234  1.00 0.00 ? 43 HIS A CD2  3  
ATOM 3314  C CE1  . HIS A 1 43 ? -3.179  6.964   -6.427  1.00 0.00 ? 43 HIS A CE1  3  
ATOM 3315  N NE2  . HIS A 1 43 ? -2.689  6.150   -5.504  1.00 0.00 ? 43 HIS A NE2  3  
ATOM 3316  H H    . HIS A 1 43 ? -5.081  3.563   -8.880  1.00 0.00 ? 43 HIS A H    3  
ATOM 3317  H HA   . HIS A 1 43 ? -3.198  5.238   -10.477 1.00 0.00 ? 43 HIS A HA   3  
ATOM 3318  H HB2  . HIS A 1 43 ? -2.308  3.261   -8.373  1.00 0.00 ? 43 HIS A HB2  3  
ATOM 3319  H HB3  . HIS A 1 43 ? -1.350  4.505   -9.176  1.00 0.00 ? 43 HIS A HB3  3  
ATOM 3320  H HD1  . HIS A 1 43 ? -3.452  6.908   -8.529  1.00 0.00 ? 43 HIS A HD1  3  
ATOM 3321  H HD2  . HIS A 1 43 ? -1.877  4.159   -5.797  1.00 0.00 ? 43 HIS A HD2  3  
ATOM 3322  H HE1  . HIS A 1 43 ? -3.602  7.918   -6.190  1.00 0.00 ? 43 HIS A HE1  3  
ATOM 3323  N N    . LEU A 1 44 ? -2.242  3.011   -11.563 1.00 0.00 ? 44 LEU A N    3  
ATOM 3324  C CA   . LEU A 1 44 ? -1.984  1.847   -12.425 1.00 0.00 ? 44 LEU A CA   3  
ATOM 3325  C C    . LEU A 1 44 ? -0.926  2.235   -13.444 1.00 0.00 ? 44 LEU A C    3  
ATOM 3326  O O    . LEU A 1 44 ? 0.096   1.555   -13.577 1.00 0.00 ? 44 LEU A O    3  
ATOM 3327  C CB   . LEU A 1 44 ? -3.264  1.363   -13.131 1.00 0.00 ? 44 LEU A CB   3  
ATOM 3328  C CG   . LEU A 1 44 ? -3.715  0.019   -12.528 1.00 0.00 ? 44 LEU A CG   3  
ATOM 3329  C CD1  . LEU A 1 44 ? -5.177  -0.238  -12.900 1.00 0.00 ? 44 LEU A CD1  3  
ATOM 3330  C CD2  . LEU A 1 44 ? -2.845  -1.114  -13.080 1.00 0.00 ? 44 LEU A CD2  3  
ATOM 3331  H H    . LEU A 1 44 ? -1.580  3.772   -11.595 1.00 0.00 ? 44 LEU A H    3  
ATOM 3332  H HA   . LEU A 1 44 ? -1.593  1.039   -11.808 1.00 0.00 ? 44 LEU A HA   3  
ATOM 3333  H HB2  . LEU A 1 44 ? -4.055  2.104   -13.016 1.00 0.00 ? 44 LEU A HB2  3  
ATOM 3334  H HB3  . LEU A 1 44 ? -3.061  1.226   -14.194 1.00 0.00 ? 44 LEU A HB3  3  
ATOM 3335  H HG   . LEU A 1 44 ? -3.616  0.050   -11.437 1.00 0.00 ? 44 LEU A HG   3  
ATOM 3336  H HD11 . LEU A 1 44 ? -5.485  -1.208  -12.510 1.00 0.00 ? 44 LEU A HD11 3  
ATOM 3337  H HD12 . LEU A 1 44 ? -5.284  -0.233  -13.984 1.00 0.00 ? 44 LEU A HD12 3  
ATOM 3338  H HD13 . LEU A 1 44 ? -5.805  0.541   -12.469 1.00 0.00 ? 44 LEU A HD13 3  
ATOM 3339  H HD21 . LEU A 1 44 ? -1.801  -0.934  -12.826 1.00 0.00 ? 44 LEU A HD21 3  
ATOM 3340  H HD22 . LEU A 1 44 ? -2.950  -1.160  -14.165 1.00 0.00 ? 44 LEU A HD22 3  
ATOM 3341  H HD23 . LEU A 1 44 ? -3.164  -2.062  -12.646 1.00 0.00 ? 44 LEU A HD23 3  
ATOM 3342  N N    . ASP A 1 45 ? -1.172  3.349   -14.147 1.00 0.00 ? 45 ASP A N    3  
ATOM 3343  C CA   . ASP A 1 45 ? -0.229  3.900   -15.106 1.00 0.00 ? 45 ASP A CA   3  
ATOM 3344  C C    . ASP A 1 45 ? 0.838   4.710   -14.359 1.00 0.00 ? 45 ASP A C    3  
ATOM 3345  O O    . ASP A 1 45 ? 1.656   5.387   -14.979 1.00 0.00 ? 45 ASP A O    3  
ATOM 3346  C CB   . ASP A 1 45 ? -0.986  4.788   -16.100 1.00 0.00 ? 45 ASP A CB   3  
ATOM 3347  C CG   . ASP A 1 45 ? -1.623  5.983   -15.395 1.00 0.00 ? 45 ASP A CG   3  
ATOM 3348  O OD1  . ASP A 1 45 ? -2.452  5.732   -14.490 1.00 0.00 ? 45 ASP A OD1  3  
ATOM 3349  O OD2  . ASP A 1 45 ? -1.268  7.119   -15.769 1.00 0.00 ? 45 ASP A OD2  3  
ATOM 3350  H H    . ASP A 1 45 ? -2.043  3.848   -14.001 1.00 0.00 ? 45 ASP A H    3  
ATOM 3351  H HA   . ASP A 1 45 ? 0.253   3.086   -15.650 1.00 0.00 ? 45 ASP A HA   3  
ATOM 3352  H HB2  . ASP A 1 45 ? -0.292  5.148   -16.860 1.00 0.00 ? 45 ASP A HB2  3  
ATOM 3353  H HB3  . ASP A 1 45 ? -1.768  4.199   -16.582 1.00 0.00 ? 45 ASP A HB3  3  
ATOM 3354  N N    . ILE A 1 46 ? 0.813   4.627   -13.015 1.00 0.00 ? 46 ILE A N    3  
ATOM 3355  C CA   . ILE A 1 46 ? 1.756   5.311   -12.151 1.00 0.00 ? 46 ILE A CA   3  
ATOM 3356  C C    . ILE A 1 46 ? 3.185   5.078   -12.639 1.00 0.00 ? 46 ILE A C    3  
ATOM 3357  O O    . ILE A 1 46 ? 3.498   4.014   -13.178 1.00 0.00 ? 46 ILE A O    3  
ATOM 3358  C CB   . ILE A 1 46 ? 1.562   4.793   -10.717 1.00 0.00 ? 46 ILE A CB   3  
ATOM 3359  C CG1  . ILE A 1 46 ? 2.479   5.549   -9.747  1.00 0.00 ? 46 ILE A CG1  3  
ATOM 3360  C CG2  . ILE A 1 46 ? 1.858   3.288   -10.656 1.00 0.00 ? 46 ILE A CG2  3  
ATOM 3361  C CD1  . ILE A 1 46 ? 2.470   4.865   -8.382  1.00 0.00 ? 46 ILE A CD1  3  
ATOM 3362  H H    . ILE A 1 46 ? 0.110   4.062   -12.574 1.00 0.00 ? 46 ILE A H    3  
ATOM 3363  H HA   . ILE A 1 46 ? 1.544   6.376   -12.168 1.00 0.00 ? 46 ILE A HA   3  
ATOM 3364  H HB   . ILE A 1 46 ? 0.530   4.963   -10.424 1.00 0.00 ? 46 ILE A HB   3  
ATOM 3365  H HG12 . ILE A 1 46 ? 3.494   5.557   -10.131 1.00 0.00 ? 46 ILE A HG12 3  
ATOM 3366  H HG13 . ILE A 1 46 ? 2.125   6.575   -9.641  1.00 0.00 ? 46 ILE A HG13 3  
ATOM 3367  H HG21 . ILE A 1 46 ? 1.318   2.776   -11.451 1.00 0.00 ? 46 ILE A HG21 3  
ATOM 3368  H HG22 . ILE A 1 46 ? 2.927   3.121   -10.777 1.00 0.00 ? 46 ILE A HG22 3  
ATOM 3369  H HG23 . ILE A 1 46 ? 1.535   2.894   -9.694  1.00 0.00 ? 46 ILE A HG23 3  
ATOM 3370  H HD11 . ILE A 1 46 ? 3.105   3.975   -8.418  1.00 0.00 ? 46 ILE A HD11 3  
ATOM 3371  H HD12 . ILE A 1 46 ? 1.452   4.577   -8.123  1.00 0.00 ? 46 ILE A HD12 3  
ATOM 3372  H HD13 . ILE A 1 46 ? 2.852   5.553   -7.630  1.00 0.00 ? 46 ILE A HD13 3  
ATOM 3373  N N    . GLY A 1 47 ? 4.044   6.083   -12.441 1.00 0.00 ? 47 GLY A N    3  
ATOM 3374  C CA   . GLY A 1 47 ? 5.436   6.005   -12.840 1.00 0.00 ? 47 GLY A CA   3  
ATOM 3375  C C    . GLY A 1 47 ? 6.045   4.692   -12.358 1.00 0.00 ? 47 GLY A C    3  
ATOM 3376  O O    . GLY A 1 47 ? 5.860   4.303   -11.203 1.00 0.00 ? 47 GLY A O    3  
ATOM 3377  H H    . GLY A 1 47 ? 3.720   6.928   -11.994 1.00 0.00 ? 47 GLY A H    3  
ATOM 3378  H HA2  . GLY A 1 47 ? 5.503   6.060   -13.927 1.00 0.00 ? 47 GLY A HA2  3  
ATOM 3379  H HA3  . GLY A 1 47 ? 5.985   6.840   -12.403 1.00 0.00 ? 47 GLY A HA3  3  
ATOM 3380  N N    . LEU A 1 48 ? 6.768   4.009   -13.249 1.00 0.00 ? 48 LEU A N    3  
ATOM 3381  C CA   . LEU A 1 48 ? 7.387   2.734   -12.926 1.00 0.00 ? 48 LEU A CA   3  
ATOM 3382  C C    . LEU A 1 48 ? 8.303   2.886   -11.712 1.00 0.00 ? 48 LEU A C    3  
ATOM 3383  O O    . LEU A 1 48 ? 8.457   1.948   -10.940 1.00 0.00 ? 48 LEU A O    3  
ATOM 3384  C CB   . LEU A 1 48 ? 8.166   2.236   -14.156 1.00 0.00 ? 48 LEU A CB   3  
ATOM 3385  C CG   . LEU A 1 48 ? 8.841   0.882   -13.873 1.00 0.00 ? 48 LEU A CG   3  
ATOM 3386  C CD1  . LEU A 1 48 ? 7.784   -0.187  -13.578 1.00 0.00 ? 48 LEU A CD1  3  
ATOM 3387  C CD2  . LEU A 1 48 ? 9.655   0.462   -15.099 1.00 0.00 ? 48 LEU A CD2  3  
ATOM 3388  H H    . LEU A 1 48 ? 6.891   4.377   -14.180 1.00 0.00 ? 48 LEU A H    3  
ATOM 3389  H HA   . LEU A 1 48 ? 6.597   2.021   -12.683 1.00 0.00 ? 48 LEU A HA   3  
ATOM 3390  H HB2  . LEU A 1 48 ? 7.479   2.127   -14.995 1.00 0.00 ? 48 LEU A HB2  3  
ATOM 3391  H HB3  . LEU A 1 48 ? 8.932   2.970   -14.414 1.00 0.00 ? 48 LEU A HB3  3  
ATOM 3392  H HG   . LEU A 1 48 ? 9.509   0.976   -13.018 1.00 0.00 ? 48 LEU A HG   3  
ATOM 3393  H HD11 . LEU A 1 48 ? 7.357   -0.019  -12.592 1.00 0.00 ? 48 LEU A HD11 3  
ATOM 3394  H HD12 . LEU A 1 48 ? 8.247   -1.174  -13.605 1.00 0.00 ? 48 LEU A HD12 3  
ATOM 3395  H HD13 . LEU A 1 48 ? 6.994   -0.138  -14.329 1.00 0.00 ? 48 LEU A HD13 3  
ATOM 3396  H HD21 . LEU A 1 48 ? 8.991   0.347   -15.955 1.00 0.00 ? 48 LEU A HD21 3  
ATOM 3397  H HD22 . LEU A 1 48 ? 10.402  1.225   -15.319 1.00 0.00 ? 48 LEU A HD22 3  
ATOM 3398  H HD23 . LEU A 1 48 ? 10.155  -0.486  -14.897 1.00 0.00 ? 48 LEU A HD23 3  
ATOM 3399  N N    . LYS A 1 49 ? 8.903   4.070   -11.539 1.00 0.00 ? 49 LYS A N    3  
ATOM 3400  C CA   . LYS A 1 49 ? 9.768   4.335   -10.402 1.00 0.00 ? 49 LYS A CA   3  
ATOM 3401  C C    . LYS A 1 49 ? 8.990   4.114   -9.103  1.00 0.00 ? 49 LYS A C    3  
ATOM 3402  O O    . LYS A 1 49 ? 9.493   3.477   -8.182  1.00 0.00 ? 49 LYS A O    3  
ATOM 3403  C CB   . LYS A 1 49 ? 10.291  5.775   -10.478 1.00 0.00 ? 49 LYS A CB   3  
ATOM 3404  C CG   . LYS A 1 49 ? 11.302  5.919   -11.624 1.00 0.00 ? 49 LYS A CG   3  
ATOM 3405  C CD   . LYS A 1 49 ? 12.630  5.251   -11.243 1.00 0.00 ? 49 LYS A CD   3  
ATOM 3406  C CE   . LYS A 1 49 ? 13.715  5.658   -12.243 1.00 0.00 ? 49 LYS A CE   3  
ATOM 3407  N NZ   . LYS A 1 49 ? 14.991  4.983   -11.943 1.00 0.00 ? 49 LYS A NZ   3  
ATOM 3408  H H    . LYS A 1 49 ? 8.749   4.810   -12.208 1.00 0.00 ? 49 LYS A H    3  
ATOM 3409  H HA   . LYS A 1 49 ? 10.609  3.644   -10.428 1.00 0.00 ? 49 LYS A HA   3  
ATOM 3410  H HB2  . LYS A 1 49 ? 9.454   6.453   -10.649 1.00 0.00 ? 49 LYS A HB2  3  
ATOM 3411  H HB3  . LYS A 1 49 ? 10.774  6.034   -9.534  1.00 0.00 ? 49 LYS A HB3  3  
ATOM 3412  H HG2  . LYS A 1 49 ? 10.905  5.452   -12.525 1.00 0.00 ? 49 LYS A HG2  3  
ATOM 3413  H HG3  . LYS A 1 49 ? 11.475  6.980   -11.815 1.00 0.00 ? 49 LYS A HG3  3  
ATOM 3414  H HD2  . LYS A 1 49 ? 12.924  5.569   -10.241 1.00 0.00 ? 49 LYS A HD2  3  
ATOM 3415  H HD3  . LYS A 1 49 ? 12.512  4.168   -11.259 1.00 0.00 ? 49 LYS A HD3  3  
ATOM 3416  H HE2  . LYS A 1 49 ? 13.394  5.387   -13.250 1.00 0.00 ? 49 LYS A HE2  3  
ATOM 3417  H HE3  . LYS A 1 49 ? 13.861  6.739   -12.194 1.00 0.00 ? 49 LYS A HE3  3  
ATOM 3418  H HZ1  . LYS A 1 49 ? 15.689  5.269   -12.615 1.00 0.00 ? 49 LYS A HZ1  3  
ATOM 3419  H HZ2  . LYS A 1 49 ? 14.863  3.982   -11.997 1.00 0.00 ? 49 LYS A HZ2  3  
ATOM 3420  H HZ3  . LYS A 1 49 ? 15.296  5.234   -11.013 1.00 0.00 ? 49 LYS A HZ3  3  
ATOM 3421  N N    . GLN A 1 50 ? 7.761   4.642   -9.037  1.00 0.00 ? 50 GLN A N    3  
ATOM 3422  C CA   . GLN A 1 50 ? 6.924   4.502   -7.858  1.00 0.00 ? 50 GLN A CA   3  
ATOM 3423  C C    . GLN A 1 50 ? 6.490   3.045   -7.696  1.00 0.00 ? 50 GLN A C    3  
ATOM 3424  O O    . GLN A 1 50 ? 6.590   2.499   -6.610  1.00 0.00 ? 50 GLN A O    3  
ATOM 3425  C CB   . GLN A 1 50 ? 5.697   5.415   -7.968  1.00 0.00 ? 50 GLN A CB   3  
ATOM 3426  C CG   . GLN A 1 50 ? 6.060   6.860   -7.592  1.00 0.00 ? 50 GLN A CG   3  
ATOM 3427  C CD   . GLN A 1 50 ? 6.844   7.567   -8.697  1.00 0.00 ? 50 GLN A CD   3  
ATOM 3428  O OE1  . GLN A 1 50 ? 6.894   7.104   -9.836  1.00 0.00 ? 50 GLN A OE1  3  
ATOM 3429  N NE2  . GLN A 1 50 ? 7.456   8.699   -8.357  1.00 0.00 ? 50 GLN A NE2  3  
ATOM 3430  H H    . GLN A 1 50 ? 7.392   5.158   -9.827  1.00 0.00 ? 50 GLN A H    3  
ATOM 3431  H HA   . GLN A 1 50 ? 7.501   4.793   -6.980  1.00 0.00 ? 50 GLN A HA   3  
ATOM 3432  H HB2  . GLN A 1 50 ? 5.305   5.388   -8.984  1.00 0.00 ? 50 GLN A HB2  3  
ATOM 3433  H HB3  . GLN A 1 50 ? 4.934   5.057   -7.280  1.00 0.00 ? 50 GLN A HB3  3  
ATOM 3434  H HG2  . GLN A 1 50 ? 5.141   7.416   -7.405  1.00 0.00 ? 50 GLN A HG2  3  
ATOM 3435  H HG3  . GLN A 1 50 ? 6.658   6.852   -6.680  1.00 0.00 ? 50 GLN A HG3  3  
ATOM 3436  H HE21 . GLN A 1 50 ? 7.354   9.065   -7.416  1.00 0.00 ? 50 GLN A HE21 3  
ATOM 3437  H HE22 . GLN A 1 50 ? 8.019   9.193   -9.034  1.00 0.00 ? 50 GLN A HE22 3  
ATOM 3438  N N    . LYS A 1 51 ? 6.005   2.416   -8.779  1.00 0.00 ? 51 LYS A N    3  
ATOM 3439  C CA   . LYS A 1 51 ? 5.567   1.019   -8.733  1.00 0.00 ? 51 LYS A CA   3  
ATOM 3440  C C    . LYS A 1 51 ? 6.706   0.133   -8.215  1.00 0.00 ? 51 LYS A C    3  
ATOM 3441  O O    . LYS A 1 51 ? 6.486   -0.741  -7.381  1.00 0.00 ? 51 LYS A O    3  
ATOM 3442  C CB   . LYS A 1 51 ? 5.124   0.583   -10.138 1.00 0.00 ? 51 LYS A CB   3  
ATOM 3443  C CG   . LYS A 1 51 ? 4.398   -0.767  -10.059 1.00 0.00 ? 51 LYS A CG   3  
ATOM 3444  C CD   . LYS A 1 51 ? 3.850   -1.167  -11.439 1.00 0.00 ? 51 LYS A CD   3  
ATOM 3445  C CE   . LYS A 1 51 ? 2.783   -0.164  -11.903 1.00 0.00 ? 51 LYS A CE   3  
ATOM 3446  N NZ   . LYS A 1 51 ? 1.671   -0.844  -12.601 1.00 0.00 ? 51 LYS A NZ   3  
ATOM 3447  H H    . LYS A 1 51 ? 5.939   2.914   -9.659  1.00 0.00 ? 51 LYS A H    3  
ATOM 3448  H HA   . LYS A 1 51 ? 4.716   0.930   -8.050  1.00 0.00 ? 51 LYS A HA   3  
ATOM 3449  H HB2  . LYS A 1 51 ? 4.452   1.333   -10.552 1.00 0.00 ? 51 LYS A HB2  3  
ATOM 3450  H HB3  . LYS A 1 51 ? 5.998   0.488   -10.782 1.00 0.00 ? 51 LYS A HB3  3  
ATOM 3451  H HG2  . LYS A 1 51 ? 5.097   -1.531  -9.718  1.00 0.00 ? 51 LYS A HG2  3  
ATOM 3452  H HG3  . LYS A 1 51 ? 3.573   -0.694  -9.352  1.00 0.00 ? 51 LYS A HG3  3  
ATOM 3453  H HD2  . LYS A 1 51 ? 4.667   -1.187  -12.163 1.00 0.00 ? 51 LYS A HD2  3  
ATOM 3454  H HD3  . LYS A 1 51 ? 3.406   -2.162  -11.371 1.00 0.00 ? 51 LYS A HD3  3  
ATOM 3455  H HE2  . LYS A 1 51 ? 2.386   0.364   -11.040 1.00 0.00 ? 51 LYS A HE2  3  
ATOM 3456  H HE3  . LYS A 1 51 ? 3.241   0.559   -12.581 1.00 0.00 ? 51 LYS A HE3  3  
ATOM 3457  H HZ1  . LYS A 1 51 ? 2.024   -1.318  -13.418 1.00 0.00 ? 51 LYS A HZ1  3  
ATOM 3458  H HZ2  . LYS A 1 51 ? 0.979   -0.159  -12.881 1.00 0.00 ? 51 LYS A HZ2  3  
ATOM 3459  H HZ3  . LYS A 1 51 ? 1.241   -1.525  -11.976 1.00 0.00 ? 51 LYS A HZ3  3  
ATOM 3460  N N    . GLN A 1 52 ? 7.923   0.367   -8.710  1.00 0.00 ? 52 GLN A N    3  
ATOM 3461  C CA   . GLN A 1 52 ? 9.089   -0.398  -8.301  1.00 0.00 ? 52 GLN A CA   3  
ATOM 3462  C C    . GLN A 1 52 ? 9.405   -0.115  -6.833  1.00 0.00 ? 52 GLN A C    3  
ATOM 3463  O O    . GLN A 1 52 ? 9.569   -1.042  -6.048  1.00 0.00 ? 52 GLN A O    3  
ATOM 3464  C CB   . GLN A 1 52 ? 10.273  -0.025  -9.201  1.00 0.00 ? 52 GLN A CB   3  
ATOM 3465  C CG   . GLN A 1 52 ? 11.501  -0.859  -8.825  1.00 0.00 ? 52 GLN A CG   3  
ATOM 3466  C CD   . GLN A 1 52 ? 12.641  -0.611  -9.807  1.00 0.00 ? 52 GLN A CD   3  
ATOM 3467  O OE1  . GLN A 1 52 ? 13.528  0.194   -9.542  1.00 0.00 ? 52 GLN A OE1  3  
ATOM 3468  N NE2  . GLN A 1 52 ? 12.614  -1.306  -10.945 1.00 0.00 ? 52 GLN A NE2  3  
ATOM 3469  H H    . GLN A 1 52 ? 8.049   1.099   -9.393  1.00 0.00 ? 52 GLN A H    3  
ATOM 3470  H HA   . GLN A 1 52 ? 8.875   -1.462  -8.420  1.00 0.00 ? 52 GLN A HA   3  
ATOM 3471  H HB2  . GLN A 1 52 ? 10.009  -0.220  -10.241 1.00 0.00 ? 52 GLN A HB2  3  
ATOM 3472  H HB3  . GLN A 1 52 ? 10.504  1.032   -9.079  1.00 0.00 ? 52 GLN A HB3  3  
ATOM 3473  H HG2  . GLN A 1 52 ? 11.829  -0.587  -7.822  1.00 0.00 ? 52 GLN A HG2  3  
ATOM 3474  H HG3  . GLN A 1 52 ? 11.238  -1.917  -8.840  1.00 0.00 ? 52 GLN A HG3  3  
ATOM 3475  H HE21 . GLN A 1 52 ? 11.860  -1.954  -11.123 1.00 0.00 ? 52 GLN A HE21 3  
ATOM 3476  H HE22 . GLN A 1 52 ? 13.347  -1.182  -11.627 1.00 0.00 ? 52 GLN A HE22 3  
ATOM 3477  N N    . TRP A 1 53 ? 9.489   1.170   -6.471  1.00 0.00 ? 53 TRP A N    3  
ATOM 3478  C CA   . TRP A 1 53 ? 9.789   1.580   -5.104  1.00 0.00 ? 53 TRP A CA   3  
ATOM 3479  C C    . TRP A 1 53 ? 8.796   0.949   -4.127  1.00 0.00 ? 53 TRP A C    3  
ATOM 3480  O O    . TRP A 1 53 ? 9.192   0.435   -3.086  1.00 0.00 ? 53 TRP A O    3  
ATOM 3481  C CB   . TRP A 1 53 ? 9.733   3.104   -5.015  1.00 0.00 ? 53 TRP A CB   3  
ATOM 3482  C CG   . TRP A 1 53 ? 9.672   3.641   -3.622  1.00 0.00 ? 53 TRP A CG   3  
ATOM 3483  C CD1  . TRP A 1 53 ? 10.666  3.597   -2.724  1.00 0.00 ? 53 TRP A CD1  3  
ATOM 3484  C CD2  . TRP A 1 53 ? 8.560   4.287   -2.934  1.00 0.00 ? 53 TRP A CD2  3  
ATOM 3485  N NE1  . TRP A 1 53 ? 10.284  4.168   -1.536  1.00 0.00 ? 53 TRP A NE1  3  
ATOM 3486  C CE2  . TRP A 1 53 ? 8.980   4.619   -1.607  1.00 0.00 ? 53 TRP A CE2  3  
ATOM 3487  C CE3  . TRP A 1 53 ? 7.235   4.627   -3.289  1.00 0.00 ? 53 TRP A CE3  3  
ATOM 3488  C CZ2  . TRP A 1 53 ? 8.137   5.258   -0.694  1.00 0.00 ? 53 TRP A CZ2  3  
ATOM 3489  C CZ3  . TRP A 1 53 ? 6.379   5.261   -2.369  1.00 0.00 ? 53 TRP A CZ3  3  
ATOM 3490  C CH2  . TRP A 1 53 ? 6.833   5.587   -1.080  1.00 0.00 ? 53 TRP A CH2  3  
ATOM 3491  H H    . TRP A 1 53 ? 9.342   1.893   -7.162  1.00 0.00 ? 53 TRP A H    3  
ATOM 3492  H HA   . TRP A 1 53 ? 10.796  1.247   -4.848  1.00 0.00 ? 53 TRP A HA   3  
ATOM 3493  H HB2  . TRP A 1 53 ? 10.617  3.512   -5.506  1.00 0.00 ? 53 TRP A HB2  3  
ATOM 3494  H HB3  . TRP A 1 53 ? 8.850   3.449   -5.552  1.00 0.00 ? 53 TRP A HB3  3  
ATOM 3495  H HD1  . TRP A 1 53 ? 11.638  3.156   -2.905  1.00 0.00 ? 53 TRP A HD1  3  
ATOM 3496  H HE1  . TRP A 1 53 ? 10.867  4.253   -0.708  1.00 0.00 ? 53 TRP A HE1  3  
ATOM 3497  H HE3  . TRP A 1 53 ? 6.873   4.396   -4.275  1.00 0.00 ? 53 TRP A HE3  3  
ATOM 3498  H HZ2  . TRP A 1 53 ? 8.490   5.496   0.299   1.00 0.00 ? 53 TRP A HZ2  3  
ATOM 3499  H HZ3  . TRP A 1 53 ? 5.369   5.504   -2.660  1.00 0.00 ? 53 TRP A HZ3  3  
ATOM 3500  H HH2  . TRP A 1 53 ? 6.179   6.098   -0.393  1.00 0.00 ? 53 TRP A HH2  3  
ATOM 3501  N N    . LEU A 1 54 ? 7.505   0.994   -4.463  1.00 0.00 ? 54 LEU A N    3  
ATOM 3502  C CA   . LEU A 1 54 ? 6.471   0.427   -3.619  1.00 0.00 ? 54 LEU A CA   3  
ATOM 3503  C C    . LEU A 1 54 ? 6.774   -1.045  -3.357  1.00 0.00 ? 54 LEU A C    3  
ATOM 3504  O O    . LEU A 1 54 ? 6.633   -1.521  -2.234  1.00 0.00 ? 54 LEU A O    3  
ATOM 3505  C CB   . LEU A 1 54 ? 5.100   0.571   -4.304  1.00 0.00 ? 54 LEU A CB   3  
ATOM 3506  C CG   . LEU A 1 54 ? 4.594   2.021   -4.214  1.00 0.00 ? 54 LEU A CG   3  
ATOM 3507  C CD1  . LEU A 1 54 ? 3.485   2.238   -5.246  1.00 0.00 ? 54 LEU A CD1  3  
ATOM 3508  C CD2  . LEU A 1 54 ? 4.037   2.302   -2.815  1.00 0.00 ? 54 LEU A CD2  3  
ATOM 3509  H H    . LEU A 1 54 ? 7.231   1.430   -5.328  1.00 0.00 ? 54 LEU A H    3  
ATOM 3510  H HA   . LEU A 1 54 ? 6.455   0.956   -2.676  1.00 0.00 ? 54 LEU A HA   3  
ATOM 3511  H HB2  . LEU A 1 54 ? 5.192   0.287   -5.352  1.00 0.00 ? 54 LEU A HB2  3  
ATOM 3512  H HB3  . LEU A 1 54 ? 4.383   -0.091  -3.818  1.00 0.00 ? 54 LEU A HB3  3  
ATOM 3513  H HG   . LEU A 1 54 ? 5.413   2.706   -4.418  1.00 0.00 ? 54 LEU A HG   3  
ATOM 3514  H HD11 . LEU A 1 54 ? 3.110   3.259   -5.169  1.00 0.00 ? 54 LEU A HD11 3  
ATOM 3515  H HD12 . LEU A 1 54 ? 2.671   1.537   -5.059  1.00 0.00 ? 54 LEU A HD12 3  
ATOM 3516  H HD13 . LEU A 1 54 ? 3.881   2.075   -6.247  1.00 0.00 ? 54 LEU A HD13 3  
ATOM 3517  H HD21 . LEU A 1 54 ? 4.849   2.323   -2.096  1.00 0.00 ? 54 LEU A HD21 3  
ATOM 3518  H HD22 . LEU A 1 54 ? 3.530   3.268   -2.813  1.00 0.00 ? 54 LEU A HD22 3  
ATOM 3519  H HD23 . LEU A 1 54 ? 3.326   1.522   -2.540  1.00 0.00 ? 54 LEU A HD23 3  
ATOM 3520  N N    . MET A 1 55 ? 7.182   -1.759  -4.407  1.00 0.00 ? 55 MET A N    3  
ATOM 3521  C CA   . MET A 1 55 ? 7.436   -3.184  -4.330  1.00 0.00 ? 55 MET A CA   3  
ATOM 3522  C C    . MET A 1 55 ? 8.710   -3.507  -3.537  1.00 0.00 ? 55 MET A C    3  
ATOM 3523  O O    . MET A 1 55 ? 8.677   -4.366  -2.659  1.00 0.00 ? 55 MET A O    3  
ATOM 3524  C CB   . MET A 1 55 ? 7.555   -3.734  -5.758  1.00 0.00 ? 55 MET A CB   3  
ATOM 3525  C CG   . MET A 1 55 ? 7.347   -5.250  -5.756  1.00 0.00 ? 55 MET A CG   3  
ATOM 3526  S SD   . MET A 1 55 ? 7.713   -6.047  -7.342  1.00 0.00 ? 55 MET A SD   3  
ATOM 3527  C CE   . MET A 1 55 ? 6.429   -5.285  -8.367  1.00 0.00 ? 55 MET A CE   3  
ATOM 3528  H H    . MET A 1 55 ? 7.306   -1.303  -5.302  1.00 0.00 ? 55 MET A H    3  
ATOM 3529  H HA   . MET A 1 55 ? 6.587   -3.659  -3.837  1.00 0.00 ? 55 MET A HA   3  
ATOM 3530  H HB2  . MET A 1 55 ? 6.802   -3.266  -6.387  1.00 0.00 ? 55 MET A HB2  3  
ATOM 3531  H HB3  . MET A 1 55 ? 8.543   -3.505  -6.155  1.00 0.00 ? 55 MET A HB3  3  
ATOM 3532  H HG2  . MET A 1 55 ? 7.992   -5.689  -4.996  1.00 0.00 ? 55 MET A HG2  3  
ATOM 3533  H HG3  . MET A 1 55 ? 6.310   -5.460  -5.495  1.00 0.00 ? 55 MET A HG3  3  
ATOM 3534  H HE1  . MET A 1 55 ? 5.452   -5.475  -7.924  1.00 0.00 ? 55 MET A HE1  3  
ATOM 3535  H HE2  . MET A 1 55 ? 6.601   -4.211  -8.427  1.00 0.00 ? 55 MET A HE2  3  
ATOM 3536  H HE3  . MET A 1 55 ? 6.465   -5.714  -9.368  1.00 0.00 ? 55 MET A HE3  3  
ATOM 3537  N N    . THR A 1 56 ? 9.833   -2.851  -3.870  1.00 0.00 ? 56 THR A N    3  
ATOM 3538  C CA   . THR A 1 56 ? 11.131  -3.190  -3.285  1.00 0.00 ? 56 THR A CA   3  
ATOM 3539  C C    . THR A 1 56 ? 11.606  -2.179  -2.232  1.00 0.00 ? 56 THR A C    3  
ATOM 3540  O O    . THR A 1 56 ? 12.808  -2.098  -1.984  1.00 0.00 ? 56 THR A O    3  
ATOM 3541  C CB   . THR A 1 56 ? 12.164  -3.290  -4.419  1.00 0.00 ? 56 THR A CB   3  
ATOM 3542  O OG1  . THR A 1 56 ? 12.274  -2.043  -5.074  1.00 0.00 ? 56 THR A OG1  3  
ATOM 3543  C CG2  . THR A 1 56 ? 11.729  -4.355  -5.431  1.00 0.00 ? 56 THR A CG2  3  
ATOM 3544  H H    . THR A 1 56 ? 9.800   -2.119  -4.569  1.00 0.00 ? 56 THR A H    3  
ATOM 3545  H HA   . THR A 1 56 ? 11.055  -4.166  -2.807  1.00 0.00 ? 56 THR A HA   3  
ATOM 3546  H HB   . THR A 1 56 ? 13.134  -3.566  -4.003  1.00 0.00 ? 56 THR A HB   3  
ATOM 3547  H HG1  . THR A 1 56 ? 12.644  -1.406  -4.457  1.00 0.00 ? 56 THR A HG1  3  
ATOM 3548  H HG21 . THR A 1 56 ? 11.525  -5.290  -4.910  1.00 0.00 ? 56 THR A HG21 3  
ATOM 3549  H HG22 . THR A 1 56 ? 12.527  -4.512  -6.157  1.00 0.00 ? 56 THR A HG22 3  
ATOM 3550  H HG23 . THR A 1 56 ? 10.830  -4.023  -5.949  1.00 0.00 ? 56 THR A HG23 3  
ATOM 3551  N N    . GLU A 1 57 ? 10.702  -1.419  -1.600  1.00 0.00 ? 57 GLU A N    3  
ATOM 3552  C CA   . GLU A 1 57 ? 11.118  -0.481  -0.558  1.00 0.00 ? 57 GLU A CA   3  
ATOM 3553  C C    . GLU A 1 57 ? 9.947   -0.087  0.344   1.00 0.00 ? 57 GLU A C    3  
ATOM 3554  O O    . GLU A 1 57 ? 9.927   -0.440  1.517   1.00 0.00 ? 57 GLU A O    3  
ATOM 3555  C CB   . GLU A 1 57 ? 11.758  0.763   -1.186  1.00 0.00 ? 57 GLU A CB   3  
ATOM 3556  C CG   . GLU A 1 57 ? 12.425  1.604   -0.086  1.00 0.00 ? 57 GLU A CG   3  
ATOM 3557  C CD   . GLU A 1 57 ? 13.035  2.880   -0.654  1.00 0.00 ? 57 GLU A CD   3  
ATOM 3558  O OE1  . GLU A 1 57 ? 13.896  2.751   -1.550  1.00 0.00 ? 57 GLU A OE1  3  
ATOM 3559  O OE2  . GLU A 1 57 ? 12.624  3.966   -0.181  1.00 0.00 ? 57 GLU A OE2  3  
ATOM 3560  H H    . GLU A 1 57 ? 9.720   -1.490  -1.832  1.00 0.00 ? 57 GLU A H    3  
ATOM 3561  H HA   . GLU A 1 57 ? 11.869  -0.965  0.057   1.00 0.00 ? 57 GLU A HA   3  
ATOM 3562  H HB2  . GLU A 1 57 ? 12.511  0.459   -1.914  1.00 0.00 ? 57 GLU A HB2  3  
ATOM 3563  H HB3  . GLU A 1 57 ? 10.996  1.352   -1.681  1.00 0.00 ? 57 GLU A HB3  3  
ATOM 3564  H HG2  . GLU A 1 57 ? 11.681  1.870   0.665   1.00 0.00 ? 57 GLU A HG2  3  
ATOM 3565  H HG3  . GLU A 1 57 ? 13.212  1.014   0.387   1.00 0.00 ? 57 GLU A HG3  3  
ATOM 3566  N N    . ALA A 1 58 ? 8.989   0.667   -0.195  1.00 0.00 ? 58 ALA A N    3  
ATOM 3567  C CA   . ALA A 1 58 ? 7.889   1.204   0.596   1.00 0.00 ? 58 ALA A CA   3  
ATOM 3568  C C    . ALA A 1 58 ? 7.122   0.110   1.343   1.00 0.00 ? 58 ALA A C    3  
ATOM 3569  O O    . ALA A 1 58 ? 7.134   0.078   2.569   1.00 0.00 ? 58 ALA A O    3  
ATOM 3570  C CB   . ALA A 1 58 ? 6.944   1.987   -0.314  1.00 0.00 ? 58 ALA A CB   3  
ATOM 3571  H H    . ALA A 1 58 ? 9.029   0.897   -1.180  1.00 0.00 ? 58 ALA A H    3  
ATOM 3572  H HA   . ALA A 1 58 ? 8.305   1.894   1.331   1.00 0.00 ? 58 ALA A HA   3  
ATOM 3573  H HB1  . ALA A 1 58 ? 6.147   1.333   -0.659  1.00 0.00 ? 58 ALA A HB1  3  
ATOM 3574  H HB2  . ALA A 1 58 ? 7.496   2.372   -1.170  1.00 0.00 ? 58 ALA A HB2  3  
ATOM 3575  H HB3  . ALA A 1 58 ? 6.513   2.816   0.241   1.00 0.00 ? 58 ALA A HB3  3  
ATOM 3576  N N    . LEU A 1 59 ? 6.433   -0.765  0.607   1.00 0.00 ? 59 LEU A N    3  
ATOM 3577  C CA   . LEU A 1 59 ? 5.576   -1.778  1.208   1.00 0.00 ? 59 LEU A CA   3  
ATOM 3578  C C    . LEU A 1 59 ? 6.380   -2.758  2.067   1.00 0.00 ? 59 LEU A C    3  
ATOM 3579  O O    . LEU A 1 59 ? 5.933   -3.129  3.150   1.00 0.00 ? 59 LEU A O    3  
ATOM 3580  C CB   . LEU A 1 59 ? 4.809   -2.514  0.102   1.00 0.00 ? 59 LEU A CB   3  
ATOM 3581  C CG   . LEU A 1 59 ? 3.913   -1.528  -0.680  1.00 0.00 ? 59 LEU A CG   3  
ATOM 3582  C CD1  . LEU A 1 59 ? 3.254   -2.260  -1.848  1.00 0.00 ? 59 LEU A CD1  3  
ATOM 3583  C CD2  . LEU A 1 59 ? 2.822   -0.957  0.231   1.00 0.00 ? 59 LEU A CD2  3  
ATOM 3584  H H    . LEU A 1 59 ? 6.485   -0.722  -0.403  1.00 0.00 ? 59 LEU A H    3  
ATOM 3585  H HA   . LEU A 1 59 ? 4.857   -1.279  1.855   1.00 0.00 ? 59 LEU A HA   3  
ATOM 3586  H HB2  . LEU A 1 59 ? 5.519   -2.978  -0.581  1.00 0.00 ? 59 LEU A HB2  3  
ATOM 3587  H HB3  . LEU A 1 59 ? 4.188   -3.285  0.547   1.00 0.00 ? 59 LEU A HB3  3  
ATOM 3588  H HG   . LEU A 1 59 ? 4.520   -0.711  -1.069  1.00 0.00 ? 59 LEU A HG   3  
ATOM 3589  H HD11 . LEU A 1 59 ? 4.021   -2.682  -2.496  1.00 0.00 ? 59 LEU A HD11 3  
ATOM 3590  H HD12 . LEU A 1 59 ? 2.620   -3.060  -1.466  1.00 0.00 ? 59 LEU A HD12 3  
ATOM 3591  H HD13 . LEU A 1 59 ? 2.644   -1.557  -2.419  1.00 0.00 ? 59 LEU A HD13 3  
ATOM 3592  H HD21 . LEU A 1 59 ? 3.261   -0.251  0.933   1.00 0.00 ? 59 LEU A HD21 3  
ATOM 3593  H HD22 . LEU A 1 59 ? 2.076   -0.442  -0.375  1.00 0.00 ? 59 LEU A HD22 3  
ATOM 3594  H HD23 . LEU A 1 59 ? 2.343   -1.768  0.780   1.00 0.00 ? 59 LEU A HD23 3  
ATOM 3595  N N    . VAL A 1 60 ? 7.557   -3.180  1.596   1.00 0.00 ? 60 VAL A N    3  
ATOM 3596  C CA   . VAL A 1 60 ? 8.380   -4.128  2.345   1.00 0.00 ? 60 VAL A CA   3  
ATOM 3597  C C    . VAL A 1 60 ? 8.866   -3.501  3.657   1.00 0.00 ? 60 VAL A C    3  
ATOM 3598  O O    . VAL A 1 60 ? 8.925   -4.187  4.677   1.00 0.00 ? 60 VAL A O    3  
ATOM 3599  C CB   . VAL A 1 60 ? 9.561   -4.624  1.486   1.00 0.00 ? 60 VAL A CB   3  
ATOM 3600  C CG1  . VAL A 1 60 ? 9.026   -5.474  0.335   1.00 0.00 ? 60 VAL A CG1  3  
ATOM 3601  C CG2  . VAL A 1 60 ? 10.361  -3.450  0.919   1.00 0.00 ? 60 VAL A CG2  3  
ATOM 3602  H H    . VAL A 1 60 ? 7.890   -2.847  0.705   1.00 0.00 ? 60 VAL A H    3  
ATOM 3603  H HA   . VAL A 1 60 ? 7.760   -4.991  2.594   1.00 0.00 ? 60 VAL A HA   3  
ATOM 3604  H HB   . VAL A 1 60 ? 10.218  -5.235  2.104   1.00 0.00 ? 60 VAL A HB   3  
ATOM 3605  H HG11 . VAL A 1 60 ? 9.853   -5.781  -0.306  1.00 0.00 ? 60 VAL A HG11 3  
ATOM 3606  H HG12 . VAL A 1 60 ? 8.313   -4.892  -0.247  1.00 0.00 ? 60 VAL A HG12 3  
ATOM 3607  H HG13 . VAL A 1 60 ? 8.531   -6.358  0.735   1.00 0.00 ? 60 VAL A HG13 3  
ATOM 3608  H HG21 . VAL A 1 60 ? 10.769  -2.858  1.733   1.00 0.00 ? 60 VAL A HG21 3  
ATOM 3609  H HG22 . VAL A 1 60 ? 11.180  -3.832  0.309   1.00 0.00 ? 60 VAL A HG22 3  
ATOM 3610  H HG23 . VAL A 1 60 ? 9.716   -2.829  0.304   1.00 0.00 ? 60 VAL A HG23 3  
ATOM 3611  N N    . ASN A 1 61 ? 9.208   -2.203  3.639   1.00 0.00 ? 61 ASN A N    3  
ATOM 3612  C CA   . ASN A 1 61 ? 9.680   -1.510  4.835   1.00 0.00 ? 61 ASN A CA   3  
ATOM 3613  C C    . ASN A 1 61 ? 8.551   -0.664  5.421   1.00 0.00 ? 61 ASN A C    3  
ATOM 3614  O O    . ASN A 1 61 ? 8.688   0.550   5.565   1.00 0.00 ? 61 ASN A O    3  
ATOM 3615  C CB   . ASN A 1 61 ? 10.893  -0.636  4.484   1.00 0.00 ? 61 ASN A CB   3  
ATOM 3616  C CG   . ASN A 1 61 ? 12.024  -1.464  3.877   1.00 0.00 ? 61 ASN A CG   3  
ATOM 3617  O OD1  . ASN A 1 61 ? 12.539  -1.129  2.814   1.00 0.00 ? 61 ASN A OD1  3  
ATOM 3618  N ND2  . ASN A 1 61 ? 12.414  -2.545  4.555   1.00 0.00 ? 61 ASN A ND2  3  
ATOM 3619  H H    . ASN A 1 61 ? 9.141   -1.677  2.775   1.00 0.00 ? 61 ASN A H    3  
ATOM 3620  H HA   . ASN A 1 61 ? 9.984   -2.246  5.579   1.00 0.00 ? 61 ASN A HA   3  
ATOM 3621  H HB2  . ASN A 1 61 ? 10.590  0.130   3.773   1.00 0.00 ? 61 ASN A HB2  3  
ATOM 3622  H HB3  . ASN A 1 61 ? 11.257  -0.153  5.391   1.00 0.00 ? 61 ASN A HB3  3  
ATOM 3623  H HD21 . ASN A 1 61 ? 11.967  -2.783  5.427   1.00 0.00 ? 61 ASN A HD21 3  
ATOM 3624  H HD22 . ASN A 1 61 ? 13.156  -3.125  4.192   1.00 0.00 ? 61 ASN A HD22 3  
ATOM 3625  N N    . ASN A 1 62 ? 7.432   -1.315  5.764   1.00 0.00 ? 62 ASN A N    3  
ATOM 3626  C CA   . ASN A 1 62 ? 6.285   -0.639  6.354   1.00 0.00 ? 62 ASN A CA   3  
ATOM 3627  C C    . ASN A 1 62 ? 5.578   -1.606  7.312   1.00 0.00 ? 62 ASN A C    3  
ATOM 3628  O O    . ASN A 1 62 ? 5.013   -2.598  6.862   1.00 0.00 ? 62 ASN A O    3  
ATOM 3629  C CB   . ASN A 1 62 ? 5.339   -0.179  5.238   1.00 0.00 ? 62 ASN A CB   3  
ATOM 3630  C CG   . ASN A 1 62 ? 4.130   0.569   5.796   1.00 0.00 ? 62 ASN A CG   3  
ATOM 3631  O OD1  . ASN A 1 62 ? 3.966   0.690   7.008   1.00 0.00 ? 62 ASN A OD1  3  
ATOM 3632  N ND2  . ASN A 1 62 ? 3.281   1.073   4.903   1.00 0.00 ? 62 ASN A ND2  3  
ATOM 3633  H H    . ASN A 1 62 ? 7.373   -2.313  5.617   1.00 0.00 ? 62 ASN A H    3  
ATOM 3634  H HA   . ASN A 1 62 ? 6.630   0.235   6.900   1.00 0.00 ? 62 ASN A HA   3  
ATOM 3635  H HB2  . ASN A 1 62 ? 5.881   0.485   4.568   1.00 0.00 ? 62 ASN A HB2  3  
ATOM 3636  H HB3  . ASN A 1 62 ? 4.995   -1.048  4.677   1.00 0.00 ? 62 ASN A HB3  3  
ATOM 3637  H HD21 . ASN A 1 62 ? 3.456   0.951   3.916   1.00 0.00 ? 62 ASN A HD21 3  
ATOM 3638  H HD22 . ASN A 1 62 ? 2.465   1.576   5.214   1.00 0.00 ? 62 ASN A HD22 3  
ATOM 3639  N N    . PRO A 1 63 ? 5.608   -1.329  8.636   1.00 0.00 ? 63 PRO A N    3  
ATOM 3640  C CA   . PRO A 1 63 ? 4.984   -2.188  9.628   1.00 0.00 ? 63 PRO A CA   3  
ATOM 3641  C C    . PRO A 1 63 ? 3.484   -2.363  9.367   1.00 0.00 ? 63 PRO A C    3  
ATOM 3642  O O    . PRO A 1 63 ? 2.914   -3.382  9.742   1.00 0.00 ? 63 PRO A O    3  
ATOM 3643  C CB   . PRO A 1 63 ? 5.236   -1.518  10.983  1.00 0.00 ? 63 PRO A CB   3  
ATOM 3644  C CG   . PRO A 1 63 ? 6.090   -0.273  10.717  1.00 0.00 ? 63 PRO A CG   3  
ATOM 3645  C CD   . PRO A 1 63 ? 6.265   -0.168  9.203   1.00 0.00 ? 63 PRO A CD   3  
ATOM 3646  H HA   . PRO A 1 63 ? 5.469   -3.165  9.613   1.00 0.00 ? 63 PRO A HA   3  
ATOM 3647  H HB2  . PRO A 1 63 ? 4.289   -1.228  11.439  1.00 0.00 ? 63 PRO A HB2  3  
ATOM 3648  H HB3  . PRO A 1 63 ? 5.771   -2.202  11.643  1.00 0.00 ? 63 PRO A HB3  3  
ATOM 3649  H HG2  . PRO A 1 63 ? 5.584   0.615   11.097  1.00 0.00 ? 63 PRO A HG2  3  
ATOM 3650  H HG3  . PRO A 1 63 ? 7.063   -0.380  11.198  1.00 0.00 ? 63 PRO A HG3  3  
ATOM 3651  H HD2  . PRO A 1 63 ? 5.797   0.747   8.838   1.00 0.00 ? 63 PRO A HD2  3  
ATOM 3652  H HD3  . PRO A 1 63 ? 7.327   -0.174  8.949   1.00 0.00 ? 63 PRO A HD3  3  
ATOM 3653  N N    . LYS A 1 64 ? 2.843   -1.372  8.729   1.00 0.00 ? 64 LYS A N    3  
ATOM 3654  C CA   . LYS A 1 64 ? 1.413   -1.436  8.446   1.00 0.00 ? 64 LYS A CA   3  
ATOM 3655  C C    . LYS A 1 64 ? 1.126   -2.401  7.292   1.00 0.00 ? 64 LYS A C    3  
ATOM 3656  O O    . LYS A 1 64 ? -0.038  -2.647  6.981   1.00 0.00 ? 64 LYS A O    3  
ATOM 3657  C CB   . LYS A 1 64 ? 0.894   -0.036  8.104   1.00 0.00 ? 64 LYS A CB   3  
ATOM 3658  C CG   . LYS A 1 64 ? 1.062   0.893   9.308   1.00 0.00 ? 64 LYS A CG   3  
ATOM 3659  C CD   . LYS A 1 64 ? 0.424   2.250   8.995   1.00 0.00 ? 64 LYS A CD   3  
ATOM 3660  C CE   . LYS A 1 64 ? 0.389   3.116   10.259  1.00 0.00 ? 64 LYS A CE   3  
ATOM 3661  N NZ   . LYS A 1 64 ? 1.750   3.446   10.721  1.00 0.00 ? 64 LYS A NZ   3  
ATOM 3662  H H    . LYS A 1 64 ? 3.356   -0.551  8.432   1.00 0.00 ? 64 LYS A H    3  
ATOM 3663  H HA   . LYS A 1 64 ? 0.893   -1.793  9.332   1.00 0.00 ? 64 LYS A HA   3  
ATOM 3664  H HB2  . LYS A 1 64 ? 1.450   0.363   7.255   1.00 0.00 ? 64 LYS A HB2  3  
ATOM 3665  H HB3  . LYS A 1 64 ? -0.163  -0.099  7.842   1.00 0.00 ? 64 LYS A HB3  3  
ATOM 3666  H HG2  . LYS A 1 64 ? 0.571   0.450   10.177  1.00 0.00 ? 64 LYS A HG2  3  
ATOM 3667  H HG3  . LYS A 1 64 ? 2.123   1.027   9.519   1.00 0.00 ? 64 LYS A HG3  3  
ATOM 3668  H HD2  . LYS A 1 64 ? 1.005   2.756   8.223   1.00 0.00 ? 64 LYS A HD2  3  
ATOM 3669  H HD3  . LYS A 1 64 ? -0.595  2.097   8.638   1.00 0.00 ? 64 LYS A HD3  3  
ATOM 3670  H HE2  . LYS A 1 64 ? -0.148  4.040   10.042  1.00 0.00 ? 64 LYS A HE2  3  
ATOM 3671  H HE3  . LYS A 1 64 ? -0.138  2.576   11.049  1.00 0.00 ? 64 LYS A HE3  3  
ATOM 3672  H HZ1  . LYS A 1 64 ? 1.695   4.046   11.533  1.00 0.00 ? 64 LYS A HZ1  3  
ATOM 3673  H HZ2  . LYS A 1 64 ? 2.250   3.924   9.984   1.00 0.00 ? 64 LYS A HZ2  3  
ATOM 3674  H HZ3  . LYS A 1 64 ? 2.240   2.598   10.964  1.00 0.00 ? 64 LYS A HZ3  3  
ATOM 3675  N N    . ILE A 1 65 ? 2.176   -2.943  6.658   1.00 0.00 ? 65 ILE A N    3  
ATOM 3676  C CA   . ILE A 1 65 ? 2.020   -3.859  5.539   1.00 0.00 ? 65 ILE A CA   3  
ATOM 3677  C C    . ILE A 1 65 ? 2.671   -5.200  5.875   1.00 0.00 ? 65 ILE A C    3  
ATOM 3678  O O    . ILE A 1 65 ? 3.761   -5.244  6.444   1.00 0.00 ? 65 ILE A O    3  
ATOM 3679  C CB   . ILE A 1 65 ? 2.661   -3.244  4.284   1.00 0.00 ? 65 ILE A CB   3  
ATOM 3680  C CG1  . ILE A 1 65 ? 1.978   -1.906  3.924   1.00 0.00 ? 65 ILE A CG1  3  
ATOM 3681  C CG2  . ILE A 1 65 ? 2.548   -4.224  3.111   1.00 0.00 ? 65 ILE A CG2  3  
ATOM 3682  C CD1  . ILE A 1 65 ? 0.559   -2.130  3.385   1.00 0.00 ? 65 ILE A CD1  3  
ATOM 3683  H H    . ILE A 1 65 ? 3.115   -2.713  6.955   1.00 0.00 ? 65 ILE A H    3  
ATOM 3684  H HA   . ILE A 1 65 ? 0.963   -4.024  5.356   1.00 0.00 ? 65 ILE A HA   3  
ATOM 3685  H HB   . ILE A 1 65 ? 3.715   -3.057  4.484   1.00 0.00 ? 65 ILE A HB   3  
ATOM 3686  H HG12 . ILE A 1 65 ? 1.928   -1.275  4.810   1.00 0.00 ? 65 ILE A HG12 3  
ATOM 3687  H HG13 . ILE A 1 65 ? 2.571   -1.398  3.163   1.00 0.00 ? 65 ILE A HG13 3  
ATOM 3688  H HG21 . ILE A 1 65 ? 3.266   -5.035  3.243   1.00 0.00 ? 65 ILE A HG21 3  
ATOM 3689  H HG22 . ILE A 1 65 ? 2.763   -3.702  2.180   1.00 0.00 ? 65 ILE A HG22 3  
ATOM 3690  H HG23 . ILE A 1 65 ? 1.542   -4.637  3.071   1.00 0.00 ? 65 ILE A HG23 3  
ATOM 3691  H HD11 . ILE A 1 65 ? 0.601   -2.714  2.467   1.00 0.00 ? 65 ILE A HD11 3  
ATOM 3692  H HD12 . ILE A 1 65 ? 0.098   -1.164  3.174   1.00 0.00 ? 65 ILE A HD12 3  
ATOM 3693  H HD13 . ILE A 1 65 ? -0.039  -2.657  4.124   1.00 0.00 ? 65 ILE A HD13 3  
ATOM 3694  N N    . GLU A 1 66 ? 1.989   -6.289  5.509   1.00 0.00 ? 66 GLU A N    3  
ATOM 3695  C CA   . GLU A 1 66 ? 2.475   -7.640  5.724   1.00 0.00 ? 66 GLU A CA   3  
ATOM 3696  C C    . GLU A 1 66 ? 2.448   -8.395  4.395   1.00 0.00 ? 66 GLU A C    3  
ATOM 3697  O O    . GLU A 1 66 ? 1.387   -8.554  3.791   1.00 0.00 ? 66 GLU A O    3  
ATOM 3698  C CB   . GLU A 1 66 ? 1.582   -8.327  6.763   1.00 0.00 ? 66 GLU A CB   3  
ATOM 3699  C CG   . GLU A 1 66 ? 2.171   -9.687  7.145   1.00 0.00 ? 66 GLU A CG   3  
ATOM 3700  C CD   . GLU A 1 66 ? 1.366   -10.321 8.272   1.00 0.00 ? 66 GLU A CD   3  
ATOM 3701  O OE1  . GLU A 1 66 ? 1.337   -9.704  9.362   1.00 0.00 ? 66 GLU A OE1  3  
ATOM 3702  O OE2  . GLU A 1 66 ? 0.797   -11.404 8.027   1.00 0.00 ? 66 GLU A OE2  3  
ATOM 3703  H H    . GLU A 1 66 ? 1.093   -6.178  5.059   1.00 0.00 ? 66 GLU A H    3  
ATOM 3704  H HA   . GLU A 1 66 ? 3.498   -7.605  6.098   1.00 0.00 ? 66 GLU A HA   3  
ATOM 3705  H HB2  . GLU A 1 66 ? 1.519   -7.701  7.651   1.00 0.00 ? 66 GLU A HB2  3  
ATOM 3706  H HB3  . GLU A 1 66 ? 0.583   -8.467  6.349   1.00 0.00 ? 66 GLU A HB3  3  
ATOM 3707  H HG2  . GLU A 1 66 ? 2.152   -10.346 6.277   1.00 0.00 ? 66 GLU A HG2  3  
ATOM 3708  H HG3  . GLU A 1 66 ? 3.201   -9.555  7.473   1.00 0.00 ? 66 GLU A HG3  3  
ATOM 3709  N N    . VAL A 1 67 ? 3.619   -8.858  3.940   1.00 0.00 ? 67 VAL A N    3  
ATOM 3710  C CA   . VAL A 1 67 ? 3.728   -9.603  2.691   1.00 0.00 ? 67 VAL A CA   3  
ATOM 3711  C C    . VAL A 1 67 ? 3.538   -11.087 2.986   1.00 0.00 ? 67 VAL A C    3  
ATOM 3712  O O    . VAL A 1 67 ? 4.053   -11.581 3.990   1.00 0.00 ? 67 VAL A O    3  
ATOM 3713  C CB   . VAL A 1 67 ? 5.104   -9.349  2.052   1.00 0.00 ? 67 VAL A CB   3  
ATOM 3714  C CG1  . VAL A 1 67 ? 5.061   -9.741  0.571   1.00 0.00 ? 67 VAL A CG1  3  
ATOM 3715  C CG2  . VAL A 1 67 ? 5.476   -7.867  2.174   1.00 0.00 ? 67 VAL A CG2  3  
ATOM 3716  H H    . VAL A 1 67 ? 4.460   -8.698  4.473   1.00 0.00 ? 67 VAL A H    3  
ATOM 3717  H HA   . VAL A 1 67 ? 2.948   -9.270  2.005   1.00 0.00 ? 67 VAL A HA   3  
ATOM 3718  H HB   . VAL A 1 67 ? 5.857   -9.951  2.562   1.00 0.00 ? 67 VAL A HB   3  
ATOM 3719  H HG11 . VAL A 1 67 ? 4.320   -9.131  0.053   1.00 0.00 ? 67 VAL A HG11 3  
ATOM 3720  H HG12 . VAL A 1 67 ? 4.794   -10.793 0.478   1.00 0.00 ? 67 VAL A HG12 3  
ATOM 3721  H HG13 . VAL A 1 67 ? 6.042   -9.577  0.123   1.00 0.00 ? 67 VAL A HG13 3  
ATOM 3722  H HG21 . VAL A 1 67 ? 6.307   -7.644  1.505   1.00 0.00 ? 67 VAL A HG21 3  
ATOM 3723  H HG22 . VAL A 1 67 ? 4.620   -7.254  1.904   1.00 0.00 ? 67 VAL A HG22 3  
ATOM 3724  H HG23 . VAL A 1 67 ? 5.772   -7.648  3.200   1.00 0.00 ? 67 VAL A HG23 3  
ATOM 3725  N N    . ILE A 1 68 ? 2.801   -11.802 2.120   1.00 0.00 ? 68 ILE A N    3  
ATOM 3726  C CA   . ILE A 1 68 ? 2.556   -13.227 2.316   1.00 0.00 ? 68 ILE A CA   3  
ATOM 3727  C C    . ILE A 1 68 ? 2.838   -13.973 1.008   1.00 0.00 ? 68 ILE A C    3  
ATOM 3728  O O    . ILE A 1 68 ? 3.991   -14.294 0.722   1.00 0.00 ? 68 ILE A O    3  
ATOM 3729  C CB   . ILE A 1 68 ? 1.112   -13.442 2.823   1.00 0.00 ? 68 ILE A CB   3  
ATOM 3730  C CG1  . ILE A 1 68 ? 0.899   -12.622 4.111   1.00 0.00 ? 68 ILE A CG1  3  
ATOM 3731  C CG2  . ILE A 1 68 ? 0.881   -14.933 3.118   1.00 0.00 ? 68 ILE A CG2  3  
ATOM 3732  C CD1  . ILE A 1 68 ? -0.458  -12.951 4.738   1.00 0.00 ? 68 ILE A CD1  3  
ATOM 3733  H H    . ILE A 1 68 ? 2.398   -11.350 1.303   1.00 0.00 ? 68 ILE A H    3  
ATOM 3734  H HA   . ILE A 1 68 ? 3.245   -13.602 3.074   1.00 0.00 ? 68 ILE A HA   3  
ATOM 3735  H HB   . ILE A 1 68 ? 0.404   -13.106 2.068   1.00 0.00 ? 68 ILE A HB   3  
ATOM 3736  H HG12 . ILE A 1 68 ? 1.690   -12.854 4.824   1.00 0.00 ? 68 ILE A HG12 3  
ATOM 3737  H HG13 . ILE A 1 68 ? 0.932   -11.559 3.871   1.00 0.00 ? 68 ILE A HG13 3  
ATOM 3738  H HG21 . ILE A 1 68 ? 1.174   -15.530 2.256   1.00 0.00 ? 68 ILE A HG21 3  
ATOM 3739  H HG22 . ILE A 1 68 ? -0.175  -15.105 3.327   1.00 0.00 ? 68 ILE A HG22 3  
ATOM 3740  H HG23 . ILE A 1 68 ? 1.474   -15.231 3.982   1.00 0.00 ? 68 ILE A HG23 3  
ATOM 3741  H HD11 . ILE A 1 68 ? -1.228  -12.950 3.968   1.00 0.00 ? 68 ILE A HD11 3  
ATOM 3742  H HD12 . ILE A 1 68 ? -0.698  -12.201 5.492   1.00 0.00 ? 68 ILE A HD12 3  
ATOM 3743  H HD13 . ILE A 1 68 ? -0.416  -13.933 5.209   1.00 0.00 ? 68 ILE A HD13 3  
ATOM 3744  N N    . ASP A 1 69 ? 1.797   -14.246 0.212   1.00 0.00 ? 69 ASP A N    3  
ATOM 3745  C CA   . ASP A 1 69 ? 1.947   -14.959 -1.047  1.00 0.00 ? 69 ASP A CA   3  
ATOM 3746  C C    . ASP A 1 69 ? 2.352   -13.971 -2.143  1.00 0.00 ? 69 ASP A C    3  
ATOM 3747  O O    . ASP A 1 69 ? 1.684   -13.861 -3.170  1.00 0.00 ? 69 ASP A O    3  
ATOM 3748  C CB   . ASP A 1 69 ? 0.618   -15.651 -1.375  1.00 0.00 ? 69 ASP A CB   3  
ATOM 3749  C CG   . ASP A 1 69 ? 0.702   -16.442 -2.676  1.00 0.00 ? 69 ASP A CG   3  
ATOM 3750  O OD1  . ASP A 1 69 ? 1.734   -17.120 -2.865  1.00 0.00 ? 69 ASP A OD1  3  
ATOM 3751  O OD2  . ASP A 1 69 ? -0.271  -16.352 -3.457  1.00 0.00 ? 69 ASP A OD2  3  
ATOM 3752  H H    . ASP A 1 69 ? 0.872   -13.958 0.485   1.00 0.00 ? 69 ASP A H    3  
ATOM 3753  H HA   . ASP A 1 69 ? 2.726   -15.715 -0.942  1.00 0.00 ? 69 ASP A HA   3  
ATOM 3754  H HB2  . ASP A 1 69 ? 0.363   -16.334 -0.563  1.00 0.00 ? 69 ASP A HB2  3  
ATOM 3755  H HB3  . ASP A 1 69 ? -0.166  -14.898 -1.463  1.00 0.00 ? 69 ASP A HB3  3  
ATOM 3756  N N    . GLY A 1 70 ? 3.451   -13.234 -1.914  1.00 0.00 ? 70 GLY A N    3  
ATOM 3757  C CA   . GLY A 1 70 ? 3.934   -12.237 -2.863  1.00 0.00 ? 70 GLY A CA   3  
ATOM 3758  C C    . GLY A 1 70 ? 3.078   -10.969 -2.796  1.00 0.00 ? 70 GLY A C    3  
ATOM 3759  O O    . GLY A 1 70 ? 3.600   -9.859  -2.888  1.00 0.00 ? 70 GLY A O    3  
ATOM 3760  H H    . GLY A 1 70 ? 3.967   -13.365 -1.054  1.00 0.00 ? 70 GLY A H    3  
ATOM 3761  H HA2  . GLY A 1 70 ? 4.968   -11.986 -2.624  1.00 0.00 ? 70 GLY A HA2  3  
ATOM 3762  H HA3  . GLY A 1 70 ? 3.890   -12.648 -3.872  1.00 0.00 ? 70 GLY A HA3  3  
ATOM 3763  N N    . LYS A 1 71 ? 1.760   -11.141 -2.637  1.00 0.00 ? 71 LYS A N    3  
ATOM 3764  C CA   . LYS A 1 71 ? 0.825   -10.038 -2.565  1.00 0.00 ? 71 LYS A CA   3  
ATOM 3765  C C    . LYS A 1 71 ? 0.985   -9.318  -1.222  1.00 0.00 ? 71 LYS A C    3  
ATOM 3766  O O    . LYS A 1 71 ? 1.563   -9.874  -0.281  1.00 0.00 ? 71 LYS A O    3  
ATOM 3767  C CB   . LYS A 1 71 ? -0.590  -10.593 -2.757  1.00 0.00 ? 71 LYS A CB   3  
ATOM 3768  C CG   . LYS A 1 71 ? -0.717  -11.196 -4.156  1.00 0.00 ? 71 LYS A CG   3  
ATOM 3769  C CD   . LYS A 1 71 ? -2.181  -11.551 -4.462  1.00 0.00 ? 71 LYS A CD   3  
ATOM 3770  C CE   . LYS A 1 71 ? -2.630  -12.767 -3.637  1.00 0.00 ? 71 LYS A CE   3  
ATOM 3771  N NZ   . LYS A 1 71 ? -3.241  -12.362 -2.358  1.00 0.00 ? 71 LYS A NZ   3  
ATOM 3772  H H    . LYS A 1 71 ? 1.391   -12.074 -2.561  1.00 0.00 ? 71 LYS A H    3  
ATOM 3773  H HA   . LYS A 1 71 ? 1.042   -9.335  -3.371  1.00 0.00 ? 71 LYS A HA   3  
ATOM 3774  H HB2  . LYS A 1 71 ? -0.776  -11.363 -2.022  1.00 0.00 ? 71 LYS A HB2  3  
ATOM 3775  H HB3  . LYS A 1 71 ? -1.314  -9.792  -2.636  1.00 0.00 ? 71 LYS A HB3  3  
ATOM 3776  H HG2  . LYS A 1 71 ? -0.367  -10.471 -4.886  1.00 0.00 ? 71 LYS A HG2  3  
ATOM 3777  H HG3  . LYS A 1 71 ? -0.104  -12.095 -4.225  1.00 0.00 ? 71 LYS A HG3  3  
ATOM 3778  H HD2  . LYS A 1 71 ? -2.818  -10.695 -4.236  1.00 0.00 ? 71 LYS A HD2  3  
ATOM 3779  H HD3  . LYS A 1 71 ? -2.271  -11.793 -5.521  1.00 0.00 ? 71 LYS A HD3  3  
ATOM 3780  H HE2  . LYS A 1 71 ? -3.365  -13.331 -4.213  1.00 0.00 ? 71 LYS A HE2  3  
ATOM 3781  H HE3  . LYS A 1 71 ? -1.770  -13.408 -3.437  1.00 0.00 ? 71 LYS A HE3  3  
ATOM 3782  H HZ1  . LYS A 1 71 ? -3.641  -13.171 -1.905  1.00 0.00 ? 71 LYS A HZ1  3  
ATOM 3783  H HZ2  . LYS A 1 71 ? -3.970  -11.677 -2.529  1.00 0.00 ? 71 LYS A HZ2  3  
ATOM 3784  H HZ3  . LYS A 1 71 ? -2.539  -11.957 -1.761  1.00 0.00 ? 71 LYS A HZ3  3  
ATOM 3785  N N    . TYR A 1 72 ? 0.488   -8.073  -1.142  1.00 0.00 ? 72 TYR A N    3  
ATOM 3786  C CA   . TYR A 1 72 ? 0.652   -7.243  0.048   1.00 0.00 ? 72 TYR A CA   3  
ATOM 3787  C C    . TYR A 1 72 ? -0.672  -7.093  0.793   1.00 0.00 ? 72 TYR A C    3  
ATOM 3788  O O    . TYR A 1 72 ? -1.680  -6.721  0.197   1.00 0.00 ? 72 TYR A O    3  
ATOM 3789  C CB   . TYR A 1 72 ? 1.176   -5.869  -0.384  1.00 0.00 ? 72 TYR A CB   3  
ATOM 3790  C CG   . TYR A 1 72 ? 2.533   -5.924  -1.056  1.00 0.00 ? 72 TYR A CG   3  
ATOM 3791  C CD1  . TYR A 1 72 ? 2.628   -6.100  -2.451  1.00 0.00 ? 72 TYR A CD1  3  
ATOM 3792  C CD2  . TYR A 1 72 ? 3.700   -5.794  -0.286  1.00 0.00 ? 72 TYR A CD2  3  
ATOM 3793  C CE1  . TYR A 1 72 ? 3.892   -6.149  -3.067  1.00 0.00 ? 72 TYR A CE1  3  
ATOM 3794  C CE2  . TYR A 1 72 ? 4.962   -5.841  -0.902  1.00 0.00 ? 72 TYR A CE2  3  
ATOM 3795  C CZ   . TYR A 1 72 ? 5.058   -6.019  -2.293  1.00 0.00 ? 72 TYR A CZ   3  
ATOM 3796  O OH   . TYR A 1 72 ? 6.282   -6.064  -2.893  1.00 0.00 ? 72 TYR A OH   3  
ATOM 3797  H H    . TYR A 1 72 ? -0.010  -7.678  -1.936  1.00 0.00 ? 72 TYR A H    3  
ATOM 3798  H HA   . TYR A 1 72 ? 1.383   -7.703  0.712   1.00 0.00 ? 72 TYR A HA   3  
ATOM 3799  H HB2  . TYR A 1 72 ? 0.461   -5.425  -1.077  1.00 0.00 ? 72 TYR A HB2  3  
ATOM 3800  H HB3  . TYR A 1 72 ? 1.247   -5.231  0.497   1.00 0.00 ? 72 TYR A HB3  3  
ATOM 3801  H HD1  . TYR A 1 72 ? 1.732   -6.199  -3.047  1.00 0.00 ? 72 TYR A HD1  3  
ATOM 3802  H HD2  . TYR A 1 72 ? 3.628   -5.655  0.781   1.00 0.00 ? 72 TYR A HD2  3  
ATOM 3803  H HE1  . TYR A 1 72 ? 3.965   -6.285  -4.135  1.00 0.00 ? 72 TYR A HE1  3  
ATOM 3804  H HE2  . TYR A 1 72 ? 5.858   -5.739  -0.308  1.00 0.00 ? 72 TYR A HE2  3  
ATOM 3805  H HH   . TYR A 1 72 ? 6.994   -5.747  -2.327  1.00 0.00 ? 72 TYR A HH   3  
ATOM 3806  N N    . ALA A 1 73 ? -0.655  -7.373  2.107   1.00 0.00 ? 73 ALA A N    3  
ATOM 3807  C CA   . ALA A 1 73 ? -1.829  -7.233  2.965   1.00 0.00 ? 73 ALA A CA   3  
ATOM 3808  C C    . ALA A 1 73 ? -1.579  -6.131  3.979   1.00 0.00 ? 73 ALA A C    3  
ATOM 3809  O O    . ALA A 1 73 ? -0.440  -5.742  4.204   1.00 0.00 ? 73 ALA A O    3  
ATOM 3810  C CB   . ALA A 1 73 ? -2.103  -8.553  3.695   1.00 0.00 ? 73 ALA A CB   3  
ATOM 3811  H H    . ALA A 1 73 ? 0.208   -7.687  2.537   1.00 0.00 ? 73 ALA A H    3  
ATOM 3812  H HA   . ALA A 1 73 ? -2.697  -6.972  2.361   1.00 0.00 ? 73 ALA A HA   3  
ATOM 3813  H HB1  . ALA A 1 73 ? -2.894  -8.403  4.431   1.00 0.00 ? 73 ALA A HB1  3  
ATOM 3814  H HB2  . ALA A 1 73 ? -1.197  -8.884  4.202   1.00 0.00 ? 73 ALA A HB2  3  
ATOM 3815  H HB3  . ALA A 1 73 ? -2.417  -9.310  2.985   1.00 0.00 ? 73 ALA A HB3  3  
ATOM 3816  N N    . PHE A 1 74 ? -2.649  -5.638  4.599   1.00 0.00 ? 74 PHE A N    3  
ATOM 3817  C CA   . PHE A 1 74 ? -2.541  -4.622  5.630   1.00 0.00 ? 74 PHE A CA   3  
ATOM 3818  C C    . PHE A 1 74 ? -2.470  -5.319  6.984   1.00 0.00 ? 74 PHE A C    3  
ATOM 3819  O O    . PHE A 1 74 ? -3.340  -6.126  7.310   1.00 0.00 ? 74 PHE A O    3  
ATOM 3820  C CB   . PHE A 1 74 ? -3.746  -3.688  5.543   1.00 0.00 ? 74 PHE A CB   3  
ATOM 3821  C CG   . PHE A 1 74 ? -3.964  -2.842  6.780   1.00 0.00 ? 74 PHE A CG   3  
ATOM 3822  C CD1  . PHE A 1 74 ? -4.722  -3.352  7.844   1.00 0.00 ? 74 PHE A CD1  3  
ATOM 3823  C CD2  . PHE A 1 74 ? -3.433  -1.543  6.860   1.00 0.00 ? 74 PHE A CD2  3  
ATOM 3824  C CE1  . PHE A 1 74 ? -4.976  -2.567  8.973   1.00 0.00 ? 74 PHE A CE1  3  
ATOM 3825  C CE2  . PHE A 1 74 ? -3.678  -0.757  8.000   1.00 0.00 ? 74 PHE A CE2  3  
ATOM 3826  C CZ   . PHE A 1 74 ? -4.463  -1.268  9.050   1.00 0.00 ? 74 PHE A CZ   3  
ATOM 3827  H H    . PHE A 1 74 ? -3.567  -5.982  4.363   1.00 0.00 ? 74 PHE A H    3  
ATOM 3828  H HA   . PHE A 1 74 ? -1.632  -4.042  5.476   1.00 0.00 ? 74 PHE A HA   3  
ATOM 3829  H HB2  . PHE A 1 74 ? -3.610  -3.027  4.690   1.00 0.00 ? 74 PHE A HB2  3  
ATOM 3830  H HB3  . PHE A 1 74 ? -4.640  -4.288  5.376   1.00 0.00 ? 74 PHE A HB3  3  
ATOM 3831  H HD1  . PHE A 1 74 ? -5.115  -4.348  7.787   1.00 0.00 ? 74 PHE A HD1  3  
ATOM 3832  H HD2  . PHE A 1 74 ? -2.846  -1.147  6.044   1.00 0.00 ? 74 PHE A HD2  3  
ATOM 3833  H HE1  . PHE A 1 74 ? -5.573  -2.960  9.781   1.00 0.00 ? 74 PHE A HE1  3  
ATOM 3834  H HE2  . PHE A 1 74 ? -3.278  0.245   8.061   1.00 0.00 ? 74 PHE A HE2  3  
ATOM 3835  H HZ   . PHE A 1 74 ? -4.677  -0.659  9.912   1.00 0.00 ? 74 PHE A HZ   3  
ATOM 3836  N N    . LYS A 1 75 ? -1.433  -5.014  7.763   1.00 0.00 ? 75 LYS A N    3  
ATOM 3837  C CA   . LYS A 1 75 ? -1.244  -5.619  9.068   1.00 0.00 ? 75 LYS A CA   3  
ATOM 3838  C C    . LYS A 1 75 ? -2.168  -4.934  10.085  1.00 0.00 ? 75 LYS A C    3  
ATOM 3839  O O    . LYS A 1 75 ? -2.080  -3.717  10.255  1.00 0.00 ? 75 LYS A O    3  
ATOM 3840  C CB   . LYS A 1 75 ? 0.225   -5.468  9.474   1.00 0.00 ? 75 LYS A CB   3  
ATOM 3841  C CG   . LYS A 1 75 ? 0.524   -6.368  10.682  1.00 0.00 ? 75 LYS A CG   3  
ATOM 3842  C CD   . LYS A 1 75 ? 1.904   -6.034  11.272  1.00 0.00 ? 75 LYS A CD   3  
ATOM 3843  C CE   . LYS A 1 75 ? 3.027   -6.448  10.306  1.00 0.00 ? 75 LYS A CE   3  
ATOM 3844  N NZ   . LYS A 1 75 ? 3.125   -7.915  10.189  1.00 0.00 ? 75 LYS A NZ   3  
ATOM 3845  H H    . LYS A 1 75 ? -0.750  -4.339  7.445   1.00 0.00 ? 75 LYS A H    3  
ATOM 3846  H HA   . LYS A 1 75 ? -1.480  -6.678  9.003   1.00 0.00 ? 75 LYS A HA   3  
ATOM 3847  H HB2  . LYS A 1 75 ? 0.858   -5.757  8.638   1.00 0.00 ? 75 LYS A HB2  3  
ATOM 3848  H HB3  . LYS A 1 75 ? 0.425   -4.430  9.730   1.00 0.00 ? 75 LYS A HB3  3  
ATOM 3849  H HG2  . LYS A 1 75 ? -0.234  -6.206  11.448  1.00 0.00 ? 75 LYS A HG2  3  
ATOM 3850  H HG3  . LYS A 1 75 ? 0.500   -7.412  10.373  1.00 0.00 ? 75 LYS A HG3  3  
ATOM 3851  H HD2  . LYS A 1 75 ? 1.965   -4.961  11.456  1.00 0.00 ? 75 LYS A HD2  3  
ATOM 3852  H HD3  . LYS A 1 75 ? 2.028   -6.565  12.216  1.00 0.00 ? 75 LYS A HD3  3  
ATOM 3853  H HE2  . LYS A 1 75 ? 2.837   -6.021  9.323   1.00 0.00 ? 75 LYS A HE2  3  
ATOM 3854  H HE3  . LYS A 1 75 ? 3.974   -6.060  10.682  1.00 0.00 ? 75 LYS A HE3  3  
ATOM 3855  H HZ1  . LYS A 1 75 ? 2.253   -8.291  9.826   1.00 0.00 ? 75 LYS A HZ1  3  
ATOM 3856  H HZ2  . LYS A 1 75 ? 3.308   -8.315  11.097  1.00 0.00 ? 75 LYS A HZ2  3  
ATOM 3857  H HZ3  . LYS A 1 75 ? 3.877   -8.153  9.559   1.00 0.00 ? 75 LYS A HZ3  3  
ATOM 3858  N N    . PRO A 1 76 ? -3.056  -5.698  10.769  1.00 0.00 ? 76 PRO A N    3  
ATOM 3859  C CA   . PRO A 1 76 ? -3.969  -5.150  11.760  1.00 0.00 ? 76 PRO A CA   3  
ATOM 3860  C C    . PRO A 1 76 ? -3.227  -4.822  13.072  1.00 0.00 ? 76 PRO A C    3  
ATOM 3861  O O    . PRO A 1 76 ? -3.657  -5.233  14.145  1.00 0.00 ? 76 PRO A O    3  
ATOM 3862  C CB   . PRO A 1 76 ? -5.026  -6.244  11.966  1.00 0.00 ? 76 PRO A CB   3  
ATOM 3863  C CG   . PRO A 1 76 ? -4.409  -7.542  11.433  1.00 0.00 ? 76 PRO A CG   3  
ATOM 3864  C CD   . PRO A 1 76 ? -3.207  -7.130  10.581  1.00 0.00 ? 76 PRO A CD   3  
ATOM 3865  H HA   . PRO A 1 76 ? -4.443  -4.251  11.368  1.00 0.00 ? 76 PRO A HA   3  
ATOM 3866  H HB2  . PRO A 1 76 ? -5.279  -6.351  13.018  1.00 0.00 ? 76 PRO A HB2  3  
ATOM 3867  H HB3  . PRO A 1 76 ? -5.921  -6.001  11.396  1.00 0.00 ? 76 PRO A HB3  3  
ATOM 3868  H HG2  . PRO A 1 76 ? -4.080  -8.166  12.264  1.00 0.00 ? 76 PRO A HG2  3  
ATOM 3869  H HG3  . PRO A 1 76 ? -5.135  -8.082  10.825  1.00 0.00 ? 76 PRO A HG3  3  
ATOM 3870  H HD2  . PRO A 1 76 ? -2.311  -7.654  10.918  1.00 0.00 ? 76 PRO A HD2  3  
ATOM 3871  H HD3  . PRO A 1 76 ? -3.405  -7.356  9.533   1.00 0.00 ? 76 PRO A HD3  3  
ATOM 3872  N N    . LYS A 1 77 ? -2.113  -4.079  12.980  1.00 0.00 ? 77 LYS A N    3  
ATOM 3873  C CA   . LYS A 1 77 ? -1.309  -3.706  14.142  1.00 0.00 ? 77 LYS A CA   3  
ATOM 3874  C C    . LYS A 1 77 ? -0.883  -4.965  14.914  1.00 0.00 ? 77 LYS A C    3  
ATOM 3875  O O    . LYS A 1 77 ? 0.026   -5.670  14.479  1.00 0.00 ? 77 LYS A O    3  
ATOM 3876  C CB   . LYS A 1 77 ? -2.094  -2.728  15.033  1.00 0.00 ? 77 LYS A CB   3  
ATOM 3877  C CG   . LYS A 1 77 ? -2.323  -1.410  14.282  1.00 0.00 ? 77 LYS A CG   3  
ATOM 3878  C CD   . LYS A 1 77 ? -3.312  -0.527  15.054  1.00 0.00 ? 77 LYS A CD   3  
ATOM 3879  C CE   . LYS A 1 77 ? -2.718  -0.123  16.409  1.00 0.00 ? 77 LYS A CE   3  
ATOM 3880  N NZ   . LYS A 1 77 ? -3.558  0.891   17.074  1.00 0.00 ? 77 LYS A NZ   3  
ATOM 3881  H H    . LYS A 1 77 ? -1.806  -3.758  12.073  1.00 0.00 ? 77 LYS A H    3  
ATOM 3882  H HA   . LYS A 1 77 ? -0.409  -3.202  13.790  1.00 0.00 ? 77 LYS A HA   3  
ATOM 3883  H HB2  . LYS A 1 77 ? -3.057  -3.162  15.301  1.00 0.00 ? 77 LYS A HB2  3  
ATOM 3884  H HB3  . LYS A 1 77 ? -1.522  -2.531  15.939  1.00 0.00 ? 77 LYS A HB3  3  
ATOM 3885  H HG2  . LYS A 1 77 ? -1.372  -0.885  14.173  1.00 0.00 ? 77 LYS A HG2  3  
ATOM 3886  H HG3  . LYS A 1 77 ? -2.731  -1.623  13.294  1.00 0.00 ? 77 LYS A HG3  3  
ATOM 3887  H HD2  . LYS A 1 77 ? -3.521  0.370   14.469  1.00 0.00 ? 77 LYS A HD2  3  
ATOM 3888  H HD3  . LYS A 1 77 ? -4.241  -1.077  15.213  1.00 0.00 ? 77 LYS A HD3  3  
ATOM 3889  H HE2  . LYS A 1 77 ? -2.652  -1.003  17.050  1.00 0.00 ? 77 LYS A HE2  3  
ATOM 3890  H HE3  . LYS A 1 77 ? -1.718  0.285   16.256  1.00 0.00 ? 77 LYS A HE3  3  
ATOM 3891  H HZ1  . LYS A 1 77 ? -4.484  0.518   17.221  1.00 0.00 ? 77 LYS A HZ1  3  
ATOM 3892  H HZ2  . LYS A 1 77 ? -3.614  1.715   16.492  1.00 0.00 ? 77 LYS A HZ2  3  
ATOM 3893  H HZ3  . LYS A 1 77 ? -3.148  1.135   17.965  1.00 0.00 ? 77 LYS A HZ3  3  
ATOM 3894  N N    . TYR A 1 78 ? -1.540  -5.242  16.055  1.00 0.00 ? 78 TYR A N    3  
ATOM 3895  C CA   . TYR A 1 78 ? -1.227  -6.406  16.882  1.00 0.00 ? 78 TYR A CA   3  
ATOM 3896  C C    . TYR A 1 78 ? -2.427  -7.360  16.917  1.00 0.00 ? 78 TYR A C    3  
ATOM 3897  O O    . TYR A 1 78 ? -2.621  -8.079  17.894  1.00 0.00 ? 78 TYR A O    3  
ATOM 3898  C CB   . TYR A 1 78 ? -0.847  -5.937  18.298  1.00 0.00 ? 78 TYR A CB   3  
ATOM 3899  C CG   . TYR A 1 78 ? -2.009  -5.371  19.098  1.00 0.00 ? 78 TYR A CG   3  
ATOM 3900  C CD1  . TYR A 1 78 ? -2.489  -4.075  18.831  1.00 0.00 ? 78 TYR A CD1  3  
ATOM 3901  C CD2  . TYR A 1 78 ? -2.604  -6.141  20.118  1.00 0.00 ? 78 TYR A CD2  3  
ATOM 3902  C CE1  . TYR A 1 78 ? -3.562  -3.554  19.575  1.00 0.00 ? 78 TYR A CE1  3  
ATOM 3903  C CE2  . TYR A 1 78 ? -3.675  -5.617  20.861  1.00 0.00 ? 78 TYR A CE2  3  
ATOM 3904  C CZ   . TYR A 1 78 ? -4.155  -4.327  20.589  1.00 0.00 ? 78 TYR A CZ   3  
ATOM 3905  O OH   . TYR A 1 78 ? -5.196  -3.824  21.313  1.00 0.00 ? 78 TYR A OH   3  
ATOM 3906  H H    . TYR A 1 78 ? -2.281  -4.632  16.361  1.00 0.00 ? 78 TYR A H    3  
ATOM 3907  H HA   . TYR A 1 78 ? -0.376  -6.934  16.451  1.00 0.00 ? 78 TYR A HA   3  
ATOM 3908  H HB2  . TYR A 1 78 ? -0.430  -6.785  18.842  1.00 0.00 ? 78 TYR A HB2  3  
ATOM 3909  H HB3  . TYR A 1 78 ? -0.077  -5.169  18.214  1.00 0.00 ? 78 TYR A HB3  3  
ATOM 3910  H HD1  . TYR A 1 78 ? -2.033  -3.478  18.056  1.00 0.00 ? 78 TYR A HD1  3  
ATOM 3911  H HD2  . TYR A 1 78 ? -2.236  -7.134  20.330  1.00 0.00 ? 78 TYR A HD2  3  
ATOM 3912  H HE1  . TYR A 1 78 ? -3.931  -2.560  19.368  1.00 0.00 ? 78 TYR A HE1  3  
ATOM 3913  H HE2  . TYR A 1 78 ? -4.128  -6.208  21.640  1.00 0.00 ? 78 TYR A HE2  3  
ATOM 3914  H HH   . TYR A 1 78 ? -5.461  -2.946  21.030  1.00 0.00 ? 78 TYR A HH   3  
ATOM 3915  N N    . ASN A 1 79 ? -3.226  -7.354  15.839  1.00 0.00 ? 79 ASN A N    3  
ATOM 3916  C CA   . ASN A 1 79 ? -4.417  -8.190  15.724  1.00 0.00 ? 79 ASN A CA   3  
ATOM 3917  C C    . ASN A 1 79 ? -5.531  -7.630  16.615  1.00 0.00 ? 79 ASN A C    3  
ATOM 3918  O O    . ASN A 1 79 ? -5.312  -6.682  17.374  1.00 0.00 ? 79 ASN A O    3  
ATOM 3919  C CB   . ASN A 1 79 ? -4.089  -9.646  16.088  1.00 0.00 ? 79 ASN A CB   3  
ATOM 3920  C CG   . ASN A 1 79 ? -4.964  -10.615 15.297  1.00 0.00 ? 79 ASN A CG   3  
ATOM 3921  O OD1  . ASN A 1 79 ? -6.138  -10.792 15.609  1.00 0.00 ? 79 ASN A OD1  3  
ATOM 3922  N ND2  . ASN A 1 79 ? -4.390  -11.241 14.269  1.00 0.00 ? 79 ASN A ND2  3  
ATOM 3923  H H    . ASN A 1 79 ? -3.005  -6.742  15.066  1.00 0.00 ? 79 ASN A H    3  
ATOM 3924  H HA   . ASN A 1 79 ? -4.757  -8.159  14.688  1.00 0.00 ? 79 ASN A HA   3  
ATOM 3925  H HB2  . ASN A 1 79 ? -3.041  -9.847  15.860  1.00 0.00 ? 79 ASN A HB2  3  
ATOM 3926  H HB3  . ASN A 1 79 ? -4.258  -9.800  17.154  1.00 0.00 ? 79 ASN A HB3  3  
ATOM 3927  H HD21 . ASN A 1 79 ? -3.422  -11.063 14.047  1.00 0.00 ? 79 ASN A HD21 3  
ATOM 3928  H HD22 . ASN A 1 79 ? -4.927  -11.893 13.715  1.00 0.00 ? 79 ASN A HD22 3  
ATOM 3929  N N    . VAL A 1 80 ? -6.729  -8.216  16.518  1.00 0.00 ? 80 VAL A N    3  
ATOM 3930  C CA   . VAL A 1 80 ? -7.872  -7.777  17.299  1.00 0.00 ? 80 VAL A CA   3  
ATOM 3931  C C    . VAL A 1 80 ? -7.783  -8.382  18.700  1.00 0.00 ? 80 VAL A C    3  
ATOM 3932  O O    . VAL A 1 80 ? -8.491  -9.335  19.010  1.00 0.00 ? 80 VAL A O    3  
ATOM 3933  C CB   . VAL A 1 80 ? -9.173  -8.190  16.585  1.00 0.00 ? 80 VAL A CB   3  
ATOM 3934  C CG1  . VAL A 1 80 ? -10.377 -7.564  17.298  1.00 0.00 ? 80 VAL A CG1  3  
ATOM 3935  C CG2  . VAL A 1 80 ? -9.145  -7.702  15.131  1.00 0.00 ? 80 VAL A CG2  3  
ATOM 3936  H H    . VAL A 1 80 ? -6.854  -8.995  15.883  1.00 0.00 ? 80 VAL A H    3  
ATOM 3937  H HA   . VAL A 1 80 ? -7.848  -6.689  17.381  1.00 0.00 ? 80 VAL A HA   3  
ATOM 3938  H HB   . VAL A 1 80 ? -9.268  -9.276  16.599  1.00 0.00 ? 80 VAL A HB   3  
ATOM 3939  H HG11 . VAL A 1 80 ? -10.438 -7.941  18.319  1.00 0.00 ? 80 VAL A HG11 3  
ATOM 3940  H HG12 . VAL A 1 80 ? -10.266 -6.479  17.320  1.00 0.00 ? 80 VAL A HG12 3  
ATOM 3941  H HG13 . VAL A 1 80 ? -11.291 -7.823  16.765  1.00 0.00 ? 80 VAL A HG13 3  
ATOM 3942  H HG21 . VAL A 1 80 ? -8.930  -6.633  15.109  1.00 0.00 ? 80 VAL A HG21 3  
ATOM 3943  H HG22 . VAL A 1 80 ? -8.374  -8.239  14.578  1.00 0.00 ? 80 VAL A HG22 3  
ATOM 3944  H HG23 . VAL A 1 80 ? -10.114 -7.886  14.667  1.00 0.00 ? 80 VAL A HG23 3  
ATOM 3945  N N    . ARG A 1 81 ? -6.896  -7.808  19.532  1.00 0.00 ? 81 ARG A N    3  
ATOM 3946  C CA   . ARG A 1 81 ? -6.671  -8.253  20.907  1.00 0.00 ? 81 ARG A CA   3  
ATOM 3947  C C    . ARG A 1 81 ? -6.115  -9.682  20.919  1.00 0.00 ? 81 ARG A C    3  
ATOM 3948  O O    . ARG A 1 81 ? -4.923  -9.803  21.289  1.00 0.00 ? 81 ARG A O    3  
ATOM 3949  C CB   . ARG A 1 81 ? -7.972  -8.131  21.728  1.00 0.00 ? 81 ARG A CB   3  
ATOM 3950  C CG   . ARG A 1 81 ? -7.758  -8.598  23.183  1.00 0.00 ? 81 ARG A CG   3  
ATOM 3951  C CD   . ARG A 1 81 ? -6.641  -7.792  23.862  1.00 0.00 ? 81 ARG A CD   3  
ATOM 3952  N NE   . ARG A 1 81 ? -5.322  -8.367  23.566  1.00 0.00 ? 81 ARG A NE   3  
ATOM 3953  C CZ   . ARG A 1 81 ? -4.172  -7.853  24.019  1.00 0.00 ? 81 ARG A CZ   3  
ATOM 3954  N NH1  . ARG A 1 81 ? -4.181  -6.811  24.862  1.00 0.00 ? 81 ARG A NH1  3  
ATOM 3955  N NH2  . ARG A 1 81 ? -3.010  -8.384  23.621  1.00 0.00 ? 81 ARG A NH2  3  
ATOM 3956  O OXT  . ARG A 1 81 ? -6.951  -10.611 20.899  1.00 0.00 ? 81 ARG A OXT  3  
ATOM 3957  H H    . ARG A 1 81 ? -6.347  -7.029  19.197  1.00 0.00 ? 81 ARG A H    3  
ATOM 3958  H HA   . ARG A 1 81 ? -5.927  -7.593  21.346  1.00 0.00 ? 81 ARG A HA   3  
ATOM 3959  H HB2  . ARG A 1 81 ? -8.296  -7.090  21.733  1.00 0.00 ? 81 ARG A HB2  3  
ATOM 3960  H HB3  . ARG A 1 81 ? -8.749  -8.744  21.275  1.00 0.00 ? 81 ARG A HB3  3  
ATOM 3961  H HG2  . ARG A 1 81 ? -8.685  -8.457  23.738  1.00 0.00 ? 81 ARG A HG2  3  
ATOM 3962  H HG3  . ARG A 1 81 ? -7.497  -9.658  23.192  1.00 0.00 ? 81 ARG A HG3  3  
ATOM 3963  H HD2  . ARG A 1 81 ? -6.675  -6.761  23.506  1.00 0.00 ? 81 ARG A HD2  3  
ATOM 3964  H HD3  . ARG A 1 81 ? -6.801  -7.804  24.940  1.00 0.00 ? 81 ARG A HD3  3  
ATOM 3965  H HE   . ARG A 1 81 ? -5.293  -9.198  22.983  1.00 0.00 ? 81 ARG A HE   3  
ATOM 3966  H HH11 . ARG A 1 81 ? -5.059  -6.410  25.156  1.00 0.00 ? 81 ARG A HH11 3  
ATOM 3967  H HH12 . ARG A 1 81 ? -3.313  -6.429  25.204  1.00 0.00 ? 81 ARG A HH12 3  
ATOM 3968  H HH21 . ARG A 1 81 ? -3.008  -9.147  22.953  1.00 0.00 ? 81 ARG A HH21 3  
ATOM 3969  H HH22 . ARG A 1 81 ? -2.139  -8.027  23.980  1.00 0.00 ? 81 ARG A HH22 3  
ATOM 3970  N N    . ALA A 1 1  ? 10.488  7.695   4.822   1.00 0.00 ? 1  ALA A N    4  
ATOM 3971  C CA   . ALA A 1 1  ? 11.042  9.003   4.432   1.00 0.00 ? 1  ALA A CA   4  
ATOM 3972  C C    . ALA A 1 1  ? 9.930   9.910   3.910   1.00 0.00 ? 1  ALA A C    4  
ATOM 3973  O O    . ALA A 1 1  ? 8.790   9.474   3.773   1.00 0.00 ? 1  ALA A O    4  
ATOM 3974  C CB   . ALA A 1 1  ? 12.130  8.824   3.370   1.00 0.00 ? 1  ALA A CB   4  
ATOM 3975  H H1   . ALA A 1 1  ? 10.063  7.256   4.017   1.00 0.00 ? 1  ALA A H1   4  
ATOM 3976  H H2   . ALA A 1 1  ? 9.789   7.826   5.540   1.00 0.00 ? 1  ALA A H2   4  
ATOM 3977  H H3   . ALA A 1 1  ? 11.228  7.105   5.175   1.00 0.00 ? 1  ALA A H3   4  
ATOM 3978  H HA   . ALA A 1 1  ? 11.487  9.469   5.312   1.00 0.00 ? 1  ALA A HA   4  
ATOM 3979  H HB1  . ALA A 1 1  ? 12.565  9.793   3.126   1.00 0.00 ? 1  ALA A HB1  4  
ATOM 3980  H HB2  . ALA A 1 1  ? 11.694  8.386   2.472   1.00 0.00 ? 1  ALA A HB2  4  
ATOM 3981  H HB3  . ALA A 1 1  ? 12.908  8.165   3.754   1.00 0.00 ? 1  ALA A HB3  4  
ATOM 3982  N N    . LEU A 1 2  ? 10.268  11.174  3.621   1.00 0.00 ? 2  LEU A N    4  
ATOM 3983  C CA   . LEU A 1 2  ? 9.306   12.140  3.109   1.00 0.00 ? 2  LEU A CA   4  
ATOM 3984  C C    . LEU A 1 2  ? 10.063  13.305  2.476   1.00 0.00 ? 2  LEU A C    4  
ATOM 3985  O O    . LEU A 1 2  ? 11.010  13.823  3.067   1.00 0.00 ? 2  LEU A O    4  
ATOM 3986  C CB   . LEU A 1 2  ? 8.405   12.629  4.257   1.00 0.00 ? 2  LEU A CB   4  
ATOM 3987  C CG   . LEU A 1 2  ? 6.925   12.466  3.877   1.00 0.00 ? 2  LEU A CG   4  
ATOM 3988  C CD1  . LEU A 1 2  ? 6.055   12.736  5.105   1.00 0.00 ? 2  LEU A CD1  4  
ATOM 3989  C CD2  . LEU A 1 2  ? 6.555   13.453  2.765   1.00 0.00 ? 2  LEU A CD2  4  
ATOM 3990  H H    . LEU A 1 2  ? 11.222  11.480  3.757   1.00 0.00 ? 2  LEU A H    4  
ATOM 3991  H HA   . LEU A 1 2  ? 8.694   11.658  2.348   1.00 0.00 ? 2  LEU A HA   4  
ATOM 3992  H HB2  . LEU A 1 2  ? 8.610   12.042  5.153   1.00 0.00 ? 2  LEU A HB2  4  
ATOM 3993  H HB3  . LEU A 1 2  ? 8.613   13.679  4.462   1.00 0.00 ? 2  LEU A HB3  4  
ATOM 3994  H HG   . LEU A 1 2  ? 6.749   11.446  3.530   1.00 0.00 ? 2  LEU A HG   4  
ATOM 3995  H HD11 . LEU A 1 2  ? 5.004   12.619  4.840   1.00 0.00 ? 2  LEU A HD11 4  
ATOM 3996  H HD12 . LEU A 1 2  ? 6.310   12.029  5.894   1.00 0.00 ? 2  LEU A HD12 4  
ATOM 3997  H HD13 . LEU A 1 2  ? 6.229   13.753  5.459   1.00 0.00 ? 2  LEU A HD13 4  
ATOM 3998  H HD21 . LEU A 1 2  ? 6.848   14.462  3.061   1.00 0.00 ? 2  LEU A HD21 4  
ATOM 3999  H HD22 . LEU A 1 2  ? 7.070   13.181  1.846   1.00 0.00 ? 2  LEU A HD22 4  
ATOM 4000  H HD23 . LEU A 1 2  ? 5.479   13.424  2.598   1.00 0.00 ? 2  LEU A HD23 4  
ATOM 4001  N N    . SER A 1 3  ? 9.647   13.712  1.270   1.00 0.00 ? 3  SER A N    4  
ATOM 4002  C CA   . SER A 1 3  ? 10.290  14.810  0.553   1.00 0.00 ? 3  SER A CA   4  
ATOM 4003  C C    . SER A 1 3  ? 9.298   15.472  -0.405  1.00 0.00 ? 3  SER A C    4  
ATOM 4004  O O    . SER A 1 3  ? 9.330   16.686  -0.589  1.00 0.00 ? 3  SER A O    4  
ATOM 4005  C CB   . SER A 1 3  ? 11.503  14.278  -0.220  1.00 0.00 ? 3  SER A CB   4  
ATOM 4006  O OG   . SER A 1 3  ? 12.349  13.553  0.648   1.00 0.00 ? 3  SER A OG   4  
ATOM 4007  H H    . SER A 1 3  ? 8.866   13.249  0.833   1.00 0.00 ? 3  SER A H    4  
ATOM 4008  H HA   . SER A 1 3  ? 10.631  15.554  1.275   1.00 0.00 ? 3  SER A HA   4  
ATOM 4009  H HB2  . SER A 1 3  ? 11.164  13.623  -1.024  1.00 0.00 ? 3  SER A HB2  4  
ATOM 4010  H HB3  . SER A 1 3  ? 12.055  15.116  -0.648  1.00 0.00 ? 3  SER A HB3  4  
ATOM 4011  H HG   . SER A 1 3  ? 12.297  13.947  1.526   1.00 0.00 ? 3  SER A HG   4  
ATOM 4012  N N    . GLY A 1 4  ? 8.422   14.666  -1.018  1.00 0.00 ? 4  GLY A N    4  
ATOM 4013  C CA   . GLY A 1 4  ? 7.437   15.161  -1.962  1.00 0.00 ? 4  GLY A CA   4  
ATOM 4014  C C    . GLY A 1 4  ? 6.375   15.982  -1.240  1.00 0.00 ? 4  GLY A C    4  
ATOM 4015  O O    . GLY A 1 4  ? 5.409   15.428  -0.719  1.00 0.00 ? 4  GLY A O    4  
ATOM 4016  H H    . GLY A 1 4  ? 8.437   13.680  -0.825  1.00 0.00 ? 4  GLY A H    4  
ATOM 4017  H HA2  . GLY A 1 4  ? 7.932   15.784  -2.709  1.00 0.00 ? 4  GLY A HA2  4  
ATOM 4018  H HA3  . GLY A 1 4  ? 6.961   14.317  -2.461  1.00 0.00 ? 4  GLY A HA3  4  
ATOM 4019  N N    . SER A 1 5  ? 6.559   17.307  -1.215  1.00 0.00 ? 5  SER A N    4  
ATOM 4020  C CA   . SER A 1 5  ? 5.619   18.212  -0.571  1.00 0.00 ? 5  SER A CA   4  
ATOM 4021  C C    . SER A 1 5  ? 4.228   18.044  -1.185  1.00 0.00 ? 5  SER A C    4  
ATOM 4022  O O    . SER A 1 5  ? 3.230   18.048  -0.469  1.00 0.00 ? 5  SER A O    4  
ATOM 4023  C CB   . SER A 1 5  ? 6.116   19.651  -0.730  1.00 0.00 ? 5  SER A CB   4  
ATOM 4024  O OG   . SER A 1 5  ? 5.242   20.533  -0.059  1.00 0.00 ? 5  SER A OG   4  
ATOM 4025  H H    . SER A 1 5  ? 7.378   17.703  -1.657  1.00 0.00 ? 5  SER A H    4  
ATOM 4026  H HA   . SER A 1 5  ? 5.569   17.970  0.492   1.00 0.00 ? 5  SER A HA   4  
ATOM 4027  H HB2  . SER A 1 5  ? 7.117   19.740  -0.304  1.00 0.00 ? 5  SER A HB2  4  
ATOM 4028  H HB3  . SER A 1 5  ? 6.149   19.911  -1.789  1.00 0.00 ? 5  SER A HB3  4  
ATOM 4029  H HG   . SER A 1 5  ? 5.210   20.286  0.870   1.00 0.00 ? 5  SER A HG   4  
ATOM 4030  N N    . SER A 1 6  ? 4.168   17.888  -2.517  1.00 0.00 ? 6  SER A N    4  
ATOM 4031  C CA   . SER A 1 6  ? 2.904   17.718  -3.224  1.00 0.00 ? 6  SER A CA   4  
ATOM 4032  C C    . SER A 1 6  ? 2.463   16.247  -3.187  1.00 0.00 ? 6  SER A C    4  
ATOM 4033  O O    . SER A 1 6  ? 1.859   15.756  -4.143  1.00 0.00 ? 6  SER A O    4  
ATOM 4034  C CB   . SER A 1 6  ? 3.072   18.204  -4.667  1.00 0.00 ? 6  SER A CB   4  
ATOM 4035  O OG   . SER A 1 6  ? 1.817   18.215  -5.315  1.00 0.00 ? 6  SER A OG   4  
ATOM 4036  H H    . SER A 1 6  ? 5.020   17.887  -3.057  1.00 0.00 ? 6  SER A H    4  
ATOM 4037  H HA   . SER A 1 6  ? 2.141   18.327  -2.735  1.00 0.00 ? 6  SER A HA   4  
ATOM 4038  H HB2  . SER A 1 6  ? 3.485   19.214  -4.665  1.00 0.00 ? 6  SER A HB2  4  
ATOM 4039  H HB3  . SER A 1 6  ? 3.750   17.537  -5.201  1.00 0.00 ? 6  SER A HB3  4  
ATOM 4040  H HG   . SER A 1 6  ? 1.446   17.327  -5.274  1.00 0.00 ? 6  SER A HG   4  
ATOM 4041  N N    . GLY A 1 7  ? 2.759   15.546  -2.084  1.00 0.00 ? 7  GLY A N    4  
ATOM 4042  C CA   . GLY A 1 7  ? 2.380   14.154  -1.922  1.00 0.00 ? 7  GLY A CA   4  
ATOM 4043  C C    . GLY A 1 7  ? 3.264   13.250  -2.774  1.00 0.00 ? 7  GLY A C    4  
ATOM 4044  O O    . GLY A 1 7  ? 4.190   12.622  -2.257  1.00 0.00 ? 7  GLY A O    4  
ATOM 4045  H H    . GLY A 1 7  ? 3.261   15.992  -1.329  1.00 0.00 ? 7  GLY A H    4  
ATOM 4046  H HA2  . GLY A 1 7  ? 2.489   13.875  -0.873  1.00 0.00 ? 7  GLY A HA2  4  
ATOM 4047  H HA3  . GLY A 1 7  ? 1.339   14.026  -2.219  1.00 0.00 ? 7  GLY A HA3  4  
ATOM 4048  N N    . TYR A 1 8  ? 2.970   13.179  -4.082  1.00 0.00 ? 8  TYR A N    4  
ATOM 4049  C CA   . TYR A 1 8  ? 3.717   12.336  -5.011  1.00 0.00 ? 8  TYR A CA   4  
ATOM 4050  C C    . TYR A 1 8  ? 3.786   10.905  -4.459  1.00 0.00 ? 8  TYR A C    4  
ATOM 4051  O O    . TYR A 1 8  ? 2.758   10.317  -4.131  1.00 0.00 ? 8  TYR A O    4  
ATOM 4052  C CB   . TYR A 1 8  ? 5.112   12.961  -5.249  1.00 0.00 ? 8  TYR A CB   4  
ATOM 4053  C CG   . TYR A 1 8  ? 5.952   12.254  -6.309  1.00 0.00 ? 8  TYR A CG   4  
ATOM 4054  C CD1  . TYR A 1 8  ? 5.394   11.920  -7.559  1.00 0.00 ? 8  TYR A CD1  4  
ATOM 4055  C CD2  . TYR A 1 8  ? 7.296   11.927  -6.033  1.00 0.00 ? 8  TYR A CD2  4  
ATOM 4056  C CE1  . TYR A 1 8  ? 6.175   11.256  -8.522  1.00 0.00 ? 8  TYR A CE1  4  
ATOM 4057  C CE2  . TYR A 1 8  ? 8.073   11.263  -6.997  1.00 0.00 ? 8  TYR A CE2  4  
ATOM 4058  C CZ   . TYR A 1 8  ? 7.513   10.927  -8.241  1.00 0.00 ? 8  TYR A CZ   4  
ATOM 4059  O OH   . TYR A 1 8  ? 8.268   10.280  -9.174  1.00 0.00 ? 8  TYR A OH   4  
ATOM 4060  H H    . TYR A 1 8  ? 2.201   13.725  -4.447  1.00 0.00 ? 8  TYR A H    4  
ATOM 4061  H HA   . TYR A 1 8  ? 3.189   12.308  -5.954  1.00 0.00 ? 8  TYR A HA   4  
ATOM 4062  H HB2  . TYR A 1 8  ? 4.974   13.997  -5.560  1.00 0.00 ? 8  TYR A HB2  4  
ATOM 4063  H HB3  . TYR A 1 8  ? 5.662   12.955  -4.308  1.00 0.00 ? 8  TYR A HB3  4  
ATOM 4064  H HD1  . TYR A 1 8  ? 4.368   12.169  -7.778  1.00 0.00 ? 8  TYR A HD1  4  
ATOM 4065  H HD2  . TYR A 1 8  ? 7.728   12.182  -5.076  1.00 0.00 ? 8  TYR A HD2  4  
ATOM 4066  H HE1  . TYR A 1 8  ? 5.746   10.997  -9.478  1.00 0.00 ? 8  TYR A HE1  4  
ATOM 4067  H HE2  . TYR A 1 8  ? 9.102   11.010  -6.781  1.00 0.00 ? 8  TYR A HE2  4  
ATOM 4068  H HH   . TYR A 1 8  ? 7.804   10.147  -10.004 1.00 0.00 ? 8  TYR A HH   4  
ATOM 4069  N N    . LYS A 1 9  ? 4.993   10.364  -4.361  1.00 0.00 ? 9  LYS A N    4  
ATOM 4070  C CA   . LYS A 1 9  ? 5.234   9.023   -3.856  1.00 0.00 ? 9  LYS A CA   4  
ATOM 4071  C C    . LYS A 1 9  ? 4.581   8.829   -2.503  1.00 0.00 ? 9  LYS A C    4  
ATOM 4072  O O    . LYS A 1 9  ? 3.708   7.979   -2.336  1.00 0.00 ? 9  LYS A O    4  
ATOM 4073  C CB   . LYS A 1 9  ? 6.750   8.834   -3.727  1.00 0.00 ? 9  LYS A CB   4  
ATOM 4074  C CG   . LYS A 1 9  ? 7.305   8.301   -5.038  1.00 0.00 ? 9  LYS A CG   4  
ATOM 4075  C CD   . LYS A 1 9  ? 8.835   8.422   -5.056  1.00 0.00 ? 9  LYS A CD   4  
ATOM 4076  C CE   . LYS A 1 9  ? 9.456   7.310   -4.207  1.00 0.00 ? 9  LYS A CE   4  
ATOM 4077  N NZ   . LYS A 1 9  ? 10.918  7.468   -4.107  1.00 0.00 ? 9  LYS A NZ   4  
ATOM 4078  H H    . LYS A 1 9  ? 5.783   10.902  -4.648  1.00 0.00 ? 9  LYS A H    4  
ATOM 4079  H HA   . LYS A 1 9  ? 4.833   8.287   -4.553  1.00 0.00 ? 9  LYS A HA   4  
ATOM 4080  H HB2  . LYS A 1 9  ? 7.218   9.791   -3.493  1.00 0.00 ? 9  LYS A HB2  4  
ATOM 4081  H HB3  . LYS A 1 9  ? 6.964   8.126   -2.930  1.00 0.00 ? 9  LYS A HB3  4  
ATOM 4082  H HG2  . LYS A 1 9  ? 7.015   7.257   -5.144  1.00 0.00 ? 9  LYS A HG2  4  
ATOM 4083  H HG3  . LYS A 1 9  ? 6.888   8.878   -5.859  1.00 0.00 ? 9  LYS A HG3  4  
ATOM 4084  H HD2  . LYS A 1 9  ? 9.190   8.332   -6.083  1.00 0.00 ? 9  LYS A HD2  4  
ATOM 4085  H HD3  . LYS A 1 9  ? 9.128   9.394   -4.657  1.00 0.00 ? 9  LYS A HD3  4  
ATOM 4086  H HE2  . LYS A 1 9  ? 9.028   7.338   -3.206  1.00 0.00 ? 9  LYS A HE2  4  
ATOM 4087  H HE3  . LYS A 1 9  ? 9.235   6.348   -4.666  1.00 0.00 ? 9  LYS A HE3  4  
ATOM 4088  H HZ1  . LYS A 1 9  ? 11.324  7.437   -5.031  1.00 0.00 ? 9  LYS A HZ1  4  
ATOM 4089  H HZ2  . LYS A 1 9  ? 11.132  8.355   -3.675  1.00 0.00 ? 9  LYS A HZ2  4  
ATOM 4090  H HZ3  . LYS A 1 9  ? 11.299  6.719   -3.546  1.00 0.00 ? 9  LYS A HZ3  4  
ATOM 4091  N N    . PHE A 1 10 ? 5.033   9.610   -1.538  1.00 0.00 ? 10 PHE A N    4  
ATOM 4092  C CA   . PHE A 1 10 ? 4.593   9.487   -0.170  1.00 0.00 ? 10 PHE A CA   4  
ATOM 4093  C C    . PHE A 1 10 ? 3.084   9.723   -0.056  1.00 0.00 ? 10 PHE A C    4  
ATOM 4094  O O    . PHE A 1 10 ? 2.413   9.059   0.733   1.00 0.00 ? 10 PHE A O    4  
ATOM 4095  C CB   . PHE A 1 10 ? 5.395   10.472  0.682   1.00 0.00 ? 10 PHE A CB   4  
ATOM 4096  C CG   . PHE A 1 10 ? 6.871   10.459  0.327   1.00 0.00 ? 10 PHE A CG   4  
ATOM 4097  C CD1  . PHE A 1 10 ? 7.717   9.476   0.871   1.00 0.00 ? 10 PHE A CD1  4  
ATOM 4098  C CD2  . PHE A 1 10 ? 7.385   11.398  -0.587  1.00 0.00 ? 10 PHE A CD2  4  
ATOM 4099  C CE1  . PHE A 1 10 ? 9.074   9.433   0.503   1.00 0.00 ? 10 PHE A CE1  4  
ATOM 4100  C CE2  . PHE A 1 10 ? 8.740   11.350  -0.957  1.00 0.00 ? 10 PHE A CE2  4  
ATOM 4101  C CZ   . PHE A 1 10 ? 9.584   10.370  -0.411  1.00 0.00 ? 10 PHE A CZ   4  
ATOM 4102  H H    . PHE A 1 10 ? 5.726   10.308  -1.753  1.00 0.00 ? 10 PHE A H    4  
ATOM 4103  H HA   . PHE A 1 10 ? 4.819   8.474   0.157   1.00 0.00 ? 10 PHE A HA   4  
ATOM 4104  H HB2  . PHE A 1 10 ? 5.002   11.478  0.527   1.00 0.00 ? 10 PHE A HB2  4  
ATOM 4105  H HB3  . PHE A 1 10 ? 5.278   10.208  1.734   1.00 0.00 ? 10 PHE A HB3  4  
ATOM 4106  H HD1  . PHE A 1 10 ? 7.322   8.746   1.564   1.00 0.00 ? 10 PHE A HD1  4  
ATOM 4107  H HD2  . PHE A 1 10 ? 6.735   12.146  -1.017  1.00 0.00 ? 10 PHE A HD2  4  
ATOM 4108  H HE1  . PHE A 1 10 ? 9.721   8.675   0.918   1.00 0.00 ? 10 PHE A HE1  4  
ATOM 4109  H HE2  . PHE A 1 10 ? 9.132   12.062  -1.667  1.00 0.00 ? 10 PHE A HE2  4  
ATOM 4110  H HZ   . PHE A 1 10 ? 10.624  10.332  -0.700  1.00 0.00 ? 10 PHE A HZ   4  
ATOM 4111  N N    . GLY A 1 11 ? 2.553   10.660  -0.848  1.00 0.00 ? 11 GLY A N    4  
ATOM 4112  C CA   . GLY A 1 11 ? 1.128   10.951  -0.847  1.00 0.00 ? 11 GLY A CA   4  
ATOM 4113  C C    . GLY A 1 11 ? 0.343   9.725   -1.310  1.00 0.00 ? 11 GLY A C    4  
ATOM 4114  O O    . GLY A 1 11 ? -0.614  9.312   -0.655  1.00 0.00 ? 11 GLY A O    4  
ATOM 4115  H H    . GLY A 1 11 ? 3.150   11.182  -1.475  1.00 0.00 ? 11 GLY A H    4  
ATOM 4116  H HA2  . GLY A 1 11 ? 0.813   11.225  0.162   1.00 0.00 ? 11 GLY A HA2  4  
ATOM 4117  H HA3  . GLY A 1 11 ? 0.928   11.782  -1.523  1.00 0.00 ? 11 GLY A HA3  4  
ATOM 4118  N N    . VAL A 1 12 ? 0.759   9.144   -2.442  1.00 0.00 ? 12 VAL A N    4  
ATOM 4119  C CA   . VAL A 1 12 ? 0.115   7.963   -2.994  1.00 0.00 ? 12 VAL A CA   4  
ATOM 4120  C C    . VAL A 1 12 ? 0.194   6.812   -1.982  1.00 0.00 ? 12 VAL A C    4  
ATOM 4121  O O    . VAL A 1 12 ? -0.781  6.087   -1.790  1.00 0.00 ? 12 VAL A O    4  
ATOM 4122  C CB   . VAL A 1 12 ? 0.792   7.599   -4.329  1.00 0.00 ? 12 VAL A CB   4  
ATOM 4123  C CG1  . VAL A 1 12 ? 0.530   6.133   -4.677  1.00 0.00 ? 12 VAL A CG1  4  
ATOM 4124  C CG2  . VAL A 1 12 ? 0.227   8.487   -5.444  1.00 0.00 ? 12 VAL A CG2  4  
ATOM 4125  H H    . VAL A 1 12 ? 1.552   9.531   -2.939  1.00 0.00 ? 12 VAL A H    4  
ATOM 4126  H HA   . VAL A 1 12 ? -0.933  8.190   -3.184  1.00 0.00 ? 12 VAL A HA   4  
ATOM 4127  H HB   . VAL A 1 12 ? 1.869   7.762   -4.249  1.00 0.00 ? 12 VAL A HB   4  
ATOM 4128  H HG11 . VAL A 1 12 ? 1.184   5.496   -4.085  1.00 0.00 ? 12 VAL A HG11 4  
ATOM 4129  H HG12 . VAL A 1 12 ? 0.728   5.969   -5.737  1.00 0.00 ? 12 VAL A HG12 4  
ATOM 4130  H HG13 . VAL A 1 12 ? -0.507  5.890   -4.461  1.00 0.00 ? 12 VAL A HG13 4  
ATOM 4131  H HG21 . VAL A 1 12 ? -0.833  8.268   -5.585  1.00 0.00 ? 12 VAL A HG21 4  
ATOM 4132  H HG22 . VAL A 1 12 ? 0.762   8.291   -6.374  1.00 0.00 ? 12 VAL A HG22 4  
ATOM 4133  H HG23 . VAL A 1 12 ? 0.347   9.537   -5.173  1.00 0.00 ? 12 VAL A HG23 4  
ATOM 4134  N N    . LEU A 1 13 ? 1.349   6.650   -1.332  1.00 0.00 ? 13 LEU A N    4  
ATOM 4135  C CA   . LEU A 1 13 ? 1.539   5.594   -0.348  1.00 0.00 ? 13 LEU A CA   4  
ATOM 4136  C C    . LEU A 1 13 ? 0.560   5.768   0.817   1.00 0.00 ? 13 LEU A C    4  
ATOM 4137  O O    . LEU A 1 13 ? -0.026  4.795   1.278   1.00 0.00 ? 13 LEU A O    4  
ATOM 4138  C CB   . LEU A 1 13 ? 2.989   5.623   0.147   1.00 0.00 ? 13 LEU A CB   4  
ATOM 4139  C CG   . LEU A 1 13 ? 3.199   4.602   1.278   1.00 0.00 ? 13 LEU A CG   4  
ATOM 4140  C CD1  . LEU A 1 13 ? 2.986   3.180   0.746   1.00 0.00 ? 13 LEU A CD1  4  
ATOM 4141  C CD2  . LEU A 1 13 ? 4.620   4.746   1.828   1.00 0.00 ? 13 LEU A CD2  4  
ATOM 4142  H H    . LEU A 1 13 ? 2.124   7.273   -1.524  1.00 0.00 ? 13 LEU A H    4  
ATOM 4143  H HA   . LEU A 1 13 ? 1.350   4.634   -0.826  1.00 0.00 ? 13 LEU A HA   4  
ATOM 4144  H HB2  . LEU A 1 13 ? 3.655   5.382   -0.685  1.00 0.00 ? 13 LEU A HB2  4  
ATOM 4145  H HB3  . LEU A 1 13 ? 3.224   6.620   0.517   1.00 0.00 ? 13 LEU A HB3  4  
ATOM 4146  H HG   . LEU A 1 13 ? 2.489   4.794   2.083   1.00 0.00 ? 13 LEU A HG   4  
ATOM 4147  H HD11 . LEU A 1 13 ? 1.923   3.002   0.592   1.00 0.00 ? 13 LEU A HD11 4  
ATOM 4148  H HD12 . LEU A 1 13 ? 3.369   2.459   1.468   1.00 0.00 ? 13 LEU A HD12 4  
ATOM 4149  H HD13 . LEU A 1 13 ? 3.513   3.060   -0.200  1.00 0.00 ? 13 LEU A HD13 4  
ATOM 4150  H HD21 . LEU A 1 13 ? 4.866   3.877   2.442   1.00 0.00 ? 13 LEU A HD21 4  
ATOM 4151  H HD22 . LEU A 1 13 ? 5.326   4.819   1.003   1.00 0.00 ? 13 LEU A HD22 4  
ATOM 4152  H HD23 . LEU A 1 13 ? 4.684   5.647   2.438   1.00 0.00 ? 13 LEU A HD23 4  
ATOM 4153  N N    . ALA A 1 14 ? 0.391   7.004   1.298   1.00 0.00 ? 14 ALA A N    4  
ATOM 4154  C CA   . ALA A 1 14 ? -0.491  7.281   2.427   1.00 0.00 ? 14 ALA A CA   4  
ATOM 4155  C C    . ALA A 1 14 ? -1.927  6.845   2.124   1.00 0.00 ? 14 ALA A C    4  
ATOM 4156  O O    . ALA A 1 14 ? -2.546  6.165   2.942   1.00 0.00 ? 14 ALA A O    4  
ATOM 4157  C CB   . ALA A 1 14 ? -0.438  8.775   2.754   1.00 0.00 ? 14 ALA A CB   4  
ATOM 4158  H H    . ALA A 1 14 ? 0.893   7.779   0.880   1.00 0.00 ? 14 ALA A H    4  
ATOM 4159  H HA   . ALA A 1 14 ? -0.136  6.718   3.299   1.00 0.00 ? 14 ALA A HA   4  
ATOM 4160  H HB1  . ALA A 1 14 ? -1.062  8.978   3.625   1.00 0.00 ? 14 ALA A HB1  4  
ATOM 4161  H HB2  . ALA A 1 14 ? -0.806  9.349   1.904   1.00 0.00 ? 14 ALA A HB2  4  
ATOM 4162  H HB3  . ALA A 1 14 ? 0.590   9.064   2.970   1.00 0.00 ? 14 ALA A HB3  4  
ATOM 4163  N N    . LYS A 1 15 ? -2.470  7.229   0.957   1.00 0.00 ? 15 LYS A N    4  
ATOM 4164  C CA   . LYS A 1 15 ? -3.839  6.865   0.620   1.00 0.00 ? 15 LYS A CA   4  
ATOM 4165  C C    . LYS A 1 15 ? -3.928  5.365   0.345   1.00 0.00 ? 15 LYS A C    4  
ATOM 4166  O O    . LYS A 1 15 ? -4.961  4.761   0.612   1.00 0.00 ? 15 LYS A O    4  
ATOM 4167  C CB   . LYS A 1 15 ? -4.373  7.698   -0.554  1.00 0.00 ? 15 LYS A CB   4  
ATOM 4168  C CG   . LYS A 1 15 ? -3.477  7.586   -1.787  1.00 0.00 ? 15 LYS A CG   4  
ATOM 4169  C CD   . LYS A 1 15 ? -3.930  8.598   -2.850  1.00 0.00 ? 15 LYS A CD   4  
ATOM 4170  C CE   . LYS A 1 15 ? -5.356  8.274   -3.328  1.00 0.00 ? 15 LYS A CE   4  
ATOM 4171  N NZ   . LYS A 1 15 ? -6.367  9.042   -2.576  1.00 0.00 ? 15 LYS A NZ   4  
ATOM 4172  H H    . LYS A 1 15 ? -1.933  7.776   0.301   1.00 0.00 ? 15 LYS A H    4  
ATOM 4173  H HA   . LYS A 1 15 ? -4.464  7.081   1.486   1.00 0.00 ? 15 LYS A HA   4  
ATOM 4174  H HB2  . LYS A 1 15 ? -5.371  7.342   -0.807  1.00 0.00 ? 15 LYS A HB2  4  
ATOM 4175  H HB3  . LYS A 1 15 ? -4.431  8.742   -0.250  1.00 0.00 ? 15 LYS A HB3  4  
ATOM 4176  H HG2  . LYS A 1 15 ? -2.452  7.803   -1.510  1.00 0.00 ? 15 LYS A HG2  4  
ATOM 4177  H HG3  . LYS A 1 15 ? -3.535  6.575   -2.196  1.00 0.00 ? 15 LYS A HG3  4  
ATOM 4178  H HD2  . LYS A 1 15 ? -3.906  9.604   -2.426  1.00 0.00 ? 15 LYS A HD2  4  
ATOM 4179  H HD3  . LYS A 1 15 ? -3.249  8.554   -3.697  1.00 0.00 ? 15 LYS A HD3  4  
ATOM 4180  H HE2  . LYS A 1 15 ? -5.442  8.526   -4.384  1.00 0.00 ? 15 LYS A HE2  4  
ATOM 4181  H HE3  . LYS A 1 15 ? -5.545  7.207   -3.202  1.00 0.00 ? 15 LYS A HE3  4  
ATOM 4182  H HZ1  . LYS A 1 15 ? -6.277  8.846   -1.589  1.00 0.00 ? 15 LYS A HZ1  4  
ATOM 4183  H HZ2  . LYS A 1 15 ? -6.228  10.030  -2.735  1.00 0.00 ? 15 LYS A HZ2  4  
ATOM 4184  H HZ3  . LYS A 1 15 ? -7.290  8.778   -2.887  1.00 0.00 ? 15 LYS A HZ3  4  
ATOM 4185  N N    . ILE A 1 16 ? -2.849  4.755   -0.165  1.00 0.00 ? 16 ILE A N    4  
ATOM 4186  C CA   . ILE A 1 16 ? -2.830  3.317   -0.384  1.00 0.00 ? 16 ILE A CA   4  
ATOM 4187  C C    . ILE A 1 16 ? -2.932  2.619   0.972   1.00 0.00 ? 16 ILE A C    4  
ATOM 4188  O O    . ILE A 1 16 ? -3.713  1.690   1.135   1.00 0.00 ? 16 ILE A O    4  
ATOM 4189  C CB   . ILE A 1 16 ? -1.553  2.908   -1.140  1.00 0.00 ? 16 ILE A CB   4  
ATOM 4190  C CG1  . ILE A 1 16 ? -1.730  3.216   -2.638  1.00 0.00 ? 16 ILE A CG1  4  
ATOM 4191  C CG2  . ILE A 1 16 ? -1.293  1.406   -0.949  1.00 0.00 ? 16 ILE A CG2  4  
ATOM 4192  C CD1  . ILE A 1 16 ? -0.377  3.152   -3.348  1.00 0.00 ? 16 ILE A CD1  4  
ATOM 4193  H H    . ILE A 1 16 ? -2.021  5.293   -0.394  1.00 0.00 ? 16 ILE A H    4  
ATOM 4194  H HA   . ILE A 1 16 ? -3.693  3.041   -0.979  1.00 0.00 ? 16 ILE A HA   4  
ATOM 4195  H HB   . ILE A 1 16 ? -0.708  3.471   -0.752  1.00 0.00 ? 16 ILE A HB   4  
ATOM 4196  H HG12 . ILE A 1 16 ? -2.406  2.485   -3.082  1.00 0.00 ? 16 ILE A HG12 4  
ATOM 4197  H HG13 . ILE A 1 16 ? -2.152  4.215   -2.758  1.00 0.00 ? 16 ILE A HG13 4  
ATOM 4198  H HG21 . ILE A 1 16 ? -0.462  1.095   -1.579  1.00 0.00 ? 16 ILE A HG21 4  
ATOM 4199  H HG22 . ILE A 1 16 ? -2.185  0.843   -1.223  1.00 0.00 ? 16 ILE A HG22 4  
ATOM 4200  H HG23 . ILE A 1 16 ? -1.043  1.206   0.092   1.00 0.00 ? 16 ILE A HG23 4  
ATOM 4201  H HD11 . ILE A 1 16 ? 0.343   3.770   -2.816  1.00 0.00 ? 16 ILE A HD11 4  
ATOM 4202  H HD12 . ILE A 1 16 ? -0.023  2.123   -3.375  1.00 0.00 ? 16 ILE A HD12 4  
ATOM 4203  H HD13 . ILE A 1 16 ? -0.486  3.519   -4.368  1.00 0.00 ? 16 ILE A HD13 4  
ATOM 4204  N N    . VAL A 1 17 ? -2.146  3.083   1.945   1.00 0.00 ? 17 VAL A N    4  
ATOM 4205  C CA   . VAL A 1 17 ? -2.168  2.536   3.291   1.00 0.00 ? 17 VAL A CA   4  
ATOM 4206  C C    . VAL A 1 17 ? -3.577  2.674   3.874   1.00 0.00 ? 17 VAL A C    4  
ATOM 4207  O O    . VAL A 1 17 ? -4.075  1.753   4.520   1.00 0.00 ? 17 VAL A O    4  
ATOM 4208  C CB   . VAL A 1 17 ? -1.125  3.283   4.144   1.00 0.00 ? 17 VAL A CB   4  
ATOM 4209  C CG1  . VAL A 1 17 ? -1.487  3.221   5.632   1.00 0.00 ? 17 VAL A CG1  4  
ATOM 4210  C CG2  . VAL A 1 17 ? 0.250   2.647   3.935   1.00 0.00 ? 17 VAL A CG2  4  
ATOM 4211  H H    . VAL A 1 17 ? -1.515  3.847   1.752   1.00 0.00 ? 17 VAL A H    4  
ATOM 4212  H HA   . VAL A 1 17 ? -1.905  1.478   3.251   1.00 0.00 ? 17 VAL A HA   4  
ATOM 4213  H HB   . VAL A 1 17 ? -1.085  4.326   3.834   1.00 0.00 ? 17 VAL A HB   4  
ATOM 4214  H HG11 . VAL A 1 17 ? -1.680  2.186   5.924   1.00 0.00 ? 17 VAL A HG11 4  
ATOM 4215  H HG12 . VAL A 1 17 ? -2.374  3.825   5.818   1.00 0.00 ? 17 VAL A HG12 4  
ATOM 4216  H HG13 . VAL A 1 17 ? -0.658  3.615   6.219   1.00 0.00 ? 17 VAL A HG13 4  
ATOM 4217  H HG21 . VAL A 1 17 ? 0.477   2.611   2.869   1.00 0.00 ? 17 VAL A HG21 4  
ATOM 4218  H HG22 . VAL A 1 17 ? 0.250   1.634   4.340   1.00 0.00 ? 17 VAL A HG22 4  
ATOM 4219  H HG23 . VAL A 1 17 ? 1.006   3.243   4.446   1.00 0.00 ? 17 VAL A HG23 4  
ATOM 4220  N N    . ASN A 1 18 ? -4.219  3.826   3.643   1.00 0.00 ? 18 ASN A N    4  
ATOM 4221  C CA   . ASN A 1 18 ? -5.555  4.080   4.157   1.00 0.00 ? 18 ASN A CA   4  
ATOM 4222  C C    . ASN A 1 18 ? -6.562  3.118   3.527   1.00 0.00 ? 18 ASN A C    4  
ATOM 4223  O O    . ASN A 1 18 ? -7.368  2.520   4.234   1.00 0.00 ? 18 ASN A O    4  
ATOM 4224  C CB   . ASN A 1 18 ? -5.947  5.531   3.868   1.00 0.00 ? 18 ASN A CB   4  
ATOM 4225  C CG   . ASN A 1 18 ? -7.342  5.831   4.405   1.00 0.00 ? 18 ASN A CG   4  
ATOM 4226  O OD1  . ASN A 1 18 ? -8.322  5.739   3.673   1.00 0.00 ? 18 ASN A OD1  4  
ATOM 4227  N ND2  . ASN A 1 18 ? -7.430  6.192   5.685   1.00 0.00 ? 18 ASN A ND2  4  
ATOM 4228  H H    . ASN A 1 18 ? -3.768  4.551   3.094   1.00 0.00 ? 18 ASN A H    4  
ATOM 4229  H HA   . ASN A 1 18 ? -5.551  3.927   5.238   1.00 0.00 ? 18 ASN A HA   4  
ATOM 4230  H HB2  . ASN A 1 18 ? -5.227  6.199   4.342   1.00 0.00 ? 18 ASN A HB2  4  
ATOM 4231  H HB3  . ASN A 1 18 ? -5.935  5.700   2.793   1.00 0.00 ? 18 ASN A HB3  4  
ATOM 4232  H HD21 . ASN A 1 18 ? -6.597  6.252   6.251   1.00 0.00 ? 18 ASN A HD21 4  
ATOM 4233  H HD22 . ASN A 1 18 ? -8.332  6.403   6.086   1.00 0.00 ? 18 ASN A HD22 4  
ATOM 4234  N N    . TYR A 1 19 ? -6.518  2.973   2.198   1.00 0.00 ? 19 TYR A N    4  
ATOM 4235  C CA   . TYR A 1 19 ? -7.436  2.098   1.479   1.00 0.00 ? 19 TYR A CA   4  
ATOM 4236  C C    . TYR A 1 19 ? -7.222  0.643   1.910   1.00 0.00 ? 19 TYR A C    4  
ATOM 4237  O O    . TYR A 1 19 ? -8.191  -0.082  2.149   1.00 0.00 ? 19 TYR A O    4  
ATOM 4238  C CB   . TYR A 1 19 ? -7.236  2.291   -0.038  1.00 0.00 ? 19 TYR A CB   4  
ATOM 4239  C CG   . TYR A 1 19 ? -7.020  1.009   -0.818  1.00 0.00 ? 19 TYR A CG   4  
ATOM 4240  C CD1  . TYR A 1 19 ? -8.110  0.187   -1.142  1.00 0.00 ? 19 TYR A CD1  4  
ATOM 4241  C CD2  . TYR A 1 19 ? -5.728  0.651   -1.237  1.00 0.00 ? 19 TYR A CD2  4  
ATOM 4242  C CE1  . TYR A 1 19 ? -7.903  -0.988  -1.883  1.00 0.00 ? 19 TYR A CE1  4  
ATOM 4243  C CE2  . TYR A 1 19 ? -5.527  -0.524  -1.973  1.00 0.00 ? 19 TYR A CE2  4  
ATOM 4244  C CZ   . TYR A 1 19 ? -6.613  -1.342  -2.297  1.00 0.00 ? 19 TYR A CZ   4  
ATOM 4245  O OH   . TYR A 1 19 ? -6.419  -2.479  -3.020  1.00 0.00 ? 19 TYR A OH   4  
ATOM 4246  H H    . TYR A 1 19 ? -5.830  3.488   1.664   1.00 0.00 ? 19 TYR A H    4  
ATOM 4247  H HA   . TYR A 1 19 ? -8.459  2.386   1.731   1.00 0.00 ? 19 TYR A HA   4  
ATOM 4248  H HB2  . TYR A 1 19 ? -8.117  2.792   -0.441  1.00 0.00 ? 19 TYR A HB2  4  
ATOM 4249  H HB3  . TYR A 1 19 ? -6.374  2.935   -0.198  1.00 0.00 ? 19 TYR A HB3  4  
ATOM 4250  H HD1  . TYR A 1 19 ? -9.106  0.460   -0.827  1.00 0.00 ? 19 TYR A HD1  4  
ATOM 4251  H HD2  . TYR A 1 19 ? -4.891  1.280   -0.997  1.00 0.00 ? 19 TYR A HD2  4  
ATOM 4252  H HE1  . TYR A 1 19 ? -8.737  -1.613  -2.141  1.00 0.00 ? 19 TYR A HE1  4  
ATOM 4253  H HE2  . TYR A 1 19 ? -4.535  -0.795  -2.293  1.00 0.00 ? 19 TYR A HE2  4  
ATOM 4254  H HH   . TYR A 1 19 ? -7.237  -2.871  -3.331  1.00 0.00 ? 19 TYR A HH   4  
ATOM 4255  N N    . MET A 1 20 ? -5.956  0.221   2.012   1.00 0.00 ? 20 MET A N    4  
ATOM 4256  C CA   . MET A 1 20 ? -5.623  -1.137  2.415   1.00 0.00 ? 20 MET A CA   4  
ATOM 4257  C C    . MET A 1 20 ? -6.126  -1.394  3.835   1.00 0.00 ? 20 MET A C    4  
ATOM 4258  O O    . MET A 1 20 ? -6.587  -2.488  4.139   1.00 0.00 ? 20 MET A O    4  
ATOM 4259  C CB   . MET A 1 20 ? -4.106  -1.350  2.330   1.00 0.00 ? 20 MET A CB   4  
ATOM 4260  C CG   . MET A 1 20 ? -3.668  -1.511  0.870   1.00 0.00 ? 20 MET A CG   4  
ATOM 4261  S SD   . MET A 1 20 ? -4.314  -2.998  0.051   1.00 0.00 ? 20 MET A SD   4  
ATOM 4262  C CE   . MET A 1 20 ? -3.421  -4.271  0.979   1.00 0.00 ? 20 MET A CE   4  
ATOM 4263  H H    . MET A 1 20 ? -5.199  0.857   1.809   1.00 0.00 ? 20 MET A H    4  
ATOM 4264  H HA   . MET A 1 20 ? -6.118  -1.835  1.739   1.00 0.00 ? 20 MET A HA   4  
ATOM 4265  H HB2  . MET A 1 20 ? -3.595  -0.491  2.769   1.00 0.00 ? 20 MET A HB2  4  
ATOM 4266  H HB3  . MET A 1 20 ? -3.837  -2.244  2.879   1.00 0.00 ? 20 MET A HB3  4  
ATOM 4267  H HG2  . MET A 1 20 ? -4.001  -0.641  0.311   1.00 0.00 ? 20 MET A HG2  4  
ATOM 4268  H HG3  . MET A 1 20 ? -2.580  -1.546  0.837   1.00 0.00 ? 20 MET A HG3  4  
ATOM 4269  H HE1  . MET A 1 20 ? -2.350  -4.066  0.941   1.00 0.00 ? 20 MET A HE1  4  
ATOM 4270  H HE2  . MET A 1 20 ? -3.619  -5.246  0.535   1.00 0.00 ? 20 MET A HE2  4  
ATOM 4271  H HE3  . MET A 1 20 ? -3.756  -4.270  2.014   1.00 0.00 ? 20 MET A HE3  4  
ATOM 4272  N N    . LYS A 1 21 ? -6.042  -0.382  4.706   1.00 0.00 ? 21 LYS A N    4  
ATOM 4273  C CA   . LYS A 1 21 ? -6.509  -0.516  6.074   1.00 0.00 ? 21 LYS A CA   4  
ATOM 4274  C C    . LYS A 1 21 ? -8.029  -0.620  6.091   1.00 0.00 ? 21 LYS A C    4  
ATOM 4275  O O    . LYS A 1 21 ? -8.576  -1.543  6.677   1.00 0.00 ? 21 LYS A O    4  
ATOM 4276  C CB   . LYS A 1 21 ? -6.044  0.688   6.905   1.00 0.00 ? 21 LYS A CB   4  
ATOM 4277  C CG   . LYS A 1 21 ? -6.322  0.435   8.401   1.00 0.00 ? 21 LYS A CG   4  
ATOM 4278  C CD   . LYS A 1 21 ? -7.707  0.963   8.807   1.00 0.00 ? 21 LYS A CD   4  
ATOM 4279  C CE   . LYS A 1 21 ? -7.646  2.466   9.067   1.00 0.00 ? 21 LYS A CE   4  
ATOM 4280  N NZ   . LYS A 1 21 ? -9.004  3.042   9.098   1.00 0.00 ? 21 LYS A NZ   4  
ATOM 4281  H H    . LYS A 1 21 ? -5.645  0.504   4.415   1.00 0.00 ? 21 LYS A H    4  
ATOM 4282  H HA   . LYS A 1 21 ? -6.087  -1.426  6.502   1.00 0.00 ? 21 LYS A HA   4  
ATOM 4283  H HB2  . LYS A 1 21 ? -4.974  0.829   6.761   1.00 0.00 ? 21 LYS A HB2  4  
ATOM 4284  H HB3  . LYS A 1 21 ? -6.570  1.584   6.577   1.00 0.00 ? 21 LYS A HB3  4  
ATOM 4285  H HG2  . LYS A 1 21 ? -6.282  -0.636  8.595   1.00 0.00 ? 21 LYS A HG2  4  
ATOM 4286  H HG3  . LYS A 1 21 ? -5.559  0.936   8.997   1.00 0.00 ? 21 LYS A HG3  4  
ATOM 4287  H HD2  . LYS A 1 21 ? -8.425  0.765   8.019   1.00 0.00 ? 21 LYS A HD2  4  
ATOM 4288  H HD3  . LYS A 1 21 ? -8.028  0.455   9.717   1.00 0.00 ? 21 LYS A HD3  4  
ATOM 4289  H HE2  . LYS A 1 21 ? -7.156  2.642   10.027  1.00 0.00 ? 21 LYS A HE2  4  
ATOM 4290  H HE3  . LYS A 1 21 ? -7.070  2.949   8.278   1.00 0.00 ? 21 LYS A HE3  4  
ATOM 4291  H HZ1  . LYS A 1 21 ? -8.963  3.988   9.448   1.00 0.00 ? 21 LYS A HZ1  4  
ATOM 4292  H HZ2  . LYS A 1 21 ? -9.390  3.044   8.164   1.00 0.00 ? 21 LYS A HZ2  4  
ATOM 4293  H HZ3  . LYS A 1 21 ? -9.596  2.482   9.703   1.00 0.00 ? 21 LYS A HZ3  4  
ATOM 4294  N N    . THR A 1 22 ? -8.705  0.346   5.462   1.00 0.00 ? 22 THR A N    4  
ATOM 4295  C CA   . THR A 1 22 ? -10.160 0.409   5.464   1.00 0.00 ? 22 THR A CA   4  
ATOM 4296  C C    . THR A 1 22 ? -10.765 -0.903  4.974   1.00 0.00 ? 22 THR A C    4  
ATOM 4297  O O    . THR A 1 22 ? -11.659 -1.440  5.623   1.00 0.00 ? 22 THR A O    4  
ATOM 4298  C CB   . THR A 1 22 ? -10.615 1.588   4.594   1.00 0.00 ? 22 THR A CB   4  
ATOM 4299  O OG1  . THR A 1 22 ? -10.030 2.780   5.077   1.00 0.00 ? 22 THR A OG1  4  
ATOM 4300  C CG2  . THR A 1 22 ? -12.139 1.720   4.648   1.00 0.00 ? 22 THR A CG2  4  
ATOM 4301  H H    . THR A 1 22 ? -8.198  1.071   4.976   1.00 0.00 ? 22 THR A H    4  
ATOM 4302  H HA   . THR A 1 22 ? -10.497 0.581   6.491   1.00 0.00 ? 22 THR A HA   4  
ATOM 4303  H HB   . THR A 1 22 ? -10.302 1.424   3.561   1.00 0.00 ? 22 THR A HB   4  
ATOM 4304  H HG1  . THR A 1 22 ? -9.119  2.821   4.767   1.00 0.00 ? 22 THR A HG1  4  
ATOM 4305  H HG21 . THR A 1 22 ? -12.600 0.847   4.187   1.00 0.00 ? 22 THR A HG21 4  
ATOM 4306  H HG22 . THR A 1 22 ? -12.461 1.794   5.688   1.00 0.00 ? 22 THR A HG22 4  
ATOM 4307  H HG23 . THR A 1 22 ? -12.445 2.617   4.110   1.00 0.00 ? 22 THR A HG23 4  
ATOM 4308  N N    . ARG A 1 23 ? -10.292 -1.433  3.839   1.00 0.00 ? 23 ARG A N    4  
ATOM 4309  C CA   . ARG A 1 23 ? -10.824 -2.686  3.324   1.00 0.00 ? 23 ARG A CA   4  
ATOM 4310  C C    . ARG A 1 23 ? -10.504 -3.815  4.314   1.00 0.00 ? 23 ARG A C    4  
ATOM 4311  O O    . ARG A 1 23 ? -11.340 -4.674  4.569   1.00 0.00 ? 23 ARG A O    4  
ATOM 4312  C CB   . ARG A 1 23 ? -10.282 -2.959  1.910   1.00 0.00 ? 23 ARG A CB   4  
ATOM 4313  C CG   . ARG A 1 23 ? -8.850  -3.501  1.962   1.00 0.00 ? 23 ARG A CG   4  
ATOM 4314  C CD   . ARG A 1 23 ? -8.341  -3.764  0.545   1.00 0.00 ? 23 ARG A CD   4  
ATOM 4315  N NE   . ARG A 1 23 ? -9.168  -4.772  -0.143  1.00 0.00 ? 23 ARG A NE   4  
ATOM 4316  C CZ   . ARG A 1 23 ? -9.997  -4.485  -1.165  1.00 0.00 ? 23 ARG A CZ   4  
ATOM 4317  N NH1  . ARG A 1 23 ? -10.362 -3.222  -1.409  1.00 0.00 ? 23 ARG A NH1  4  
ATOM 4318  N NH2  . ARG A 1 23 ? -10.461 -5.471  -1.941  1.00 0.00 ? 23 ARG A NH2  4  
ATOM 4319  H H    . ARG A 1 23 ? -9.554  -0.965  3.325   1.00 0.00 ? 23 ARG A H    4  
ATOM 4320  H HA   . ARG A 1 23 ? -11.908 -2.591  3.257   1.00 0.00 ? 23 ARG A HA   4  
ATOM 4321  H HB2  . ARG A 1 23 ? -10.926 -3.685  1.419   1.00 0.00 ? 23 ARG A HB2  4  
ATOM 4322  H HB3  . ARG A 1 23 ? -10.294 -2.031  1.339   1.00 0.00 ? 23 ARG A HB3  4  
ATOM 4323  H HG2  . ARG A 1 23 ? -8.208  -2.771  2.443   1.00 0.00 ? 23 ARG A HG2  4  
ATOM 4324  H HG3  . ARG A 1 23 ? -8.826  -4.432  2.523   1.00 0.00 ? 23 ARG A HG3  4  
ATOM 4325  H HD2  . ARG A 1 23 ? -8.349  -2.833  -0.017  1.00 0.00 ? 23 ARG A HD2  4  
ATOM 4326  H HD3  . ARG A 1 23 ? -7.315  -4.130  0.602   1.00 0.00 ? 23 ARG A HD3  4  
ATOM 4327  H HE   . ARG A 1 23 ? -9.097  -5.734  0.176   1.00 0.00 ? 23 ARG A HE   4  
ATOM 4328  H HH11 . ARG A 1 23 ? -10.164 -2.503  -0.732  1.00 0.00 ? 23 ARG A HH11 4  
ATOM 4329  H HH12 . ARG A 1 23 ? -10.835 -2.982  -2.279  1.00 0.00 ? 23 ARG A HH12 4  
ATOM 4330  H HH21 . ARG A 1 23 ? -10.294 -6.437  -1.679  1.00 0.00 ? 23 ARG A HH21 4  
ATOM 4331  H HH22 . ARG A 1 23 ? -10.975 -5.257  -2.782  1.00 0.00 ? 23 ARG A HH22 4  
ATOM 4332  N N    . HIS A 1 24 ? -9.298  -3.799  4.891   1.00 0.00 ? 24 HIS A N    4  
ATOM 4333  C CA   . HIS A 1 24 ? -8.905  -4.790  5.882   1.00 0.00 ? 24 HIS A CA   4  
ATOM 4334  C C    . HIS A 1 24 ? -9.785  -4.637  7.137   1.00 0.00 ? 24 HIS A C    4  
ATOM 4335  O O    . HIS A 1 24 ? -9.892  -5.561  7.938   1.00 0.00 ? 24 HIS A O    4  
ATOM 4336  C CB   . HIS A 1 24 ? -7.415  -4.594  6.200   1.00 0.00 ? 24 HIS A CB   4  
ATOM 4337  C CG   . HIS A 1 24 ? -6.858  -5.601  7.170   1.00 0.00 ? 24 HIS A CG   4  
ATOM 4338  N ND1  . HIS A 1 24 ? -6.126  -6.713  6.767   1.00 0.00 ? 24 HIS A ND1  4  
ATOM 4339  C CD2  . HIS A 1 24 ? -6.875  -5.673  8.539   1.00 0.00 ? 24 HIS A CD2  4  
ATOM 4340  C CE1  . HIS A 1 24 ? -5.769  -7.371  7.886   1.00 0.00 ? 24 HIS A CE1  4  
ATOM 4341  N NE2  . HIS A 1 24 ? -6.194  -6.787  9.005   1.00 0.00 ? 24 HIS A NE2  4  
ATOM 4342  H H    . HIS A 1 24 ? -8.633  -3.076  4.646   1.00 0.00 ? 24 HIS A H    4  
ATOM 4343  H HA   . HIS A 1 24 ? -9.050  -5.786  5.466   1.00 0.00 ? 24 HIS A HA   4  
ATOM 4344  H HB2  . HIS A 1 24 ? -6.850  -4.667  5.270   1.00 0.00 ? 24 HIS A HB2  4  
ATOM 4345  H HB3  . HIS A 1 24 ? -7.272  -3.599  6.616   1.00 0.00 ? 24 HIS A HB3  4  
ATOM 4346  H HD1  . HIS A 1 24 ? -5.903  -6.975  5.817   1.00 0.00 ? 24 HIS A HD1  4  
ATOM 4347  H HD2  . HIS A 1 24 ? -7.342  -4.941  9.174   1.00 0.00 ? 24 HIS A HD2  4  
ATOM 4348  H HE1  . HIS A 1 24 ? -5.188  -8.282  7.878   1.00 0.00 ? 24 HIS A HE1  4  
ATOM 4349  N N    . GLN A 1 25 ? -10.417 -3.464  7.297   1.00 0.00 ? 25 GLN A N    4  
ATOM 4350  C CA   . GLN A 1 25 ? -11.275 -3.184  8.437   1.00 0.00 ? 25 GLN A CA   4  
ATOM 4351  C C    . GLN A 1 25 ? -12.717 -3.627  8.152   1.00 0.00 ? 25 GLN A C    4  
ATOM 4352  O O    . GLN A 1 25 ? -13.383 -4.152  9.041   1.00 0.00 ? 25 GLN A O    4  
ATOM 4353  C CB   . GLN A 1 25 ? -11.211 -1.677  8.750   1.00 0.00 ? 25 GLN A CB   4  
ATOM 4354  C CG   . GLN A 1 25 ? -11.177 -1.461  10.264  1.00 0.00 ? 25 GLN A CG   4  
ATOM 4355  C CD   . GLN A 1 25 ? -10.711 -0.050  10.620  1.00 0.00 ? 25 GLN A CD   4  
ATOM 4356  O OE1  . GLN A 1 25 ? -10.826 0.877   9.817   1.00 0.00 ? 25 GLN A OE1  4  
ATOM 4357  N NE2  . GLN A 1 25 ? -10.177 0.112   11.831  1.00 0.00 ? 25 GLN A NE2  4  
ATOM 4358  H H    . GLN A 1 25 ? -10.296 -2.736  6.606   1.00 0.00 ? 25 GLN A H    4  
ATOM 4359  H HA   . GLN A 1 25 ? -10.903 -3.740  9.299   1.00 0.00 ? 25 GLN A HA   4  
ATOM 4360  H HB2  . GLN A 1 25 ? -10.310 -1.255  8.311   1.00 0.00 ? 25 GLN A HB2  4  
ATOM 4361  H HB3  . GLN A 1 25 ? -12.085 -1.178  8.329   1.00 0.00 ? 25 GLN A HB3  4  
ATOM 4362  H HG2  . GLN A 1 25 ? -12.175 -1.623  10.671  1.00 0.00 ? 25 GLN A HG2  4  
ATOM 4363  H HG3  . GLN A 1 25 ? -10.489 -2.176  10.706  1.00 0.00 ? 25 GLN A HG3  4  
ATOM 4364  H HE21 . GLN A 1 25 ? -10.064 -0.688  12.445  1.00 0.00 ? 25 GLN A HE21 4  
ATOM 4365  H HE22 . GLN A 1 25 ? -9.886  1.029   12.136  1.00 0.00 ? 25 GLN A HE22 4  
ATOM 4366  N N    . ARG A 1 26 ? -13.203 -3.410  6.916   1.00 0.00 ? 26 ARG A N    4  
ATOM 4367  C CA   . ARG A 1 26 ? -14.575 -3.768  6.553   1.00 0.00 ? 26 ARG A CA   4  
ATOM 4368  C C    . ARG A 1 26 ? -14.738 -5.293  6.497   1.00 0.00 ? 26 ARG A C    4  
ATOM 4369  O O    . ARG A 1 26 ? -15.782 -5.814  6.882   1.00 0.00 ? 26 ARG A O    4  
ATOM 4370  C CB   . ARG A 1 26 ? -14.955 -3.105  5.207   1.00 0.00 ? 26 ARG A CB   4  
ATOM 4371  C CG   . ARG A 1 26 ? -14.597 -4.018  4.024   1.00 0.00 ? 26 ARG A CG   4  
ATOM 4372  C CD   . ARG A 1 26 ? -14.776 -3.270  2.703   1.00 0.00 ? 26 ARG A CD   4  
ATOM 4373  N NE   . ARG A 1 26 ? -14.271 -4.083  1.585   1.00 0.00 ? 26 ARG A NE   4  
ATOM 4374  C CZ   . ARG A 1 26 ? -14.085 -3.601  0.345   1.00 0.00 ? 26 ARG A CZ   4  
ATOM 4375  N NH1  . ARG A 1 26 ? -14.475 -2.356  0.038   1.00 0.00 ? 26 ARG A NH1  4  
ATOM 4376  N NH2  . ARG A 1 26 ? -13.508 -4.370  -0.590  1.00 0.00 ? 26 ARG A NH2  4  
ATOM 4377  H H    . ARG A 1 26 ? -12.613 -2.982  6.214   1.00 0.00 ? 26 ARG A H    4  
ATOM 4378  H HA   . ARG A 1 26 ? -15.243 -3.379  7.322   1.00 0.00 ? 26 ARG A HA   4  
ATOM 4379  H HB2  . ARG A 1 26 ? -16.029 -2.914  5.195   1.00 0.00 ? 26 ARG A HB2  4  
ATOM 4380  H HB3  . ARG A 1 26 ? -14.423 -2.159  5.109   1.00 0.00 ? 26 ARG A HB3  4  
ATOM 4381  H HG2  . ARG A 1 26 ? -13.565 -4.333  4.113   1.00 0.00 ? 26 ARG A HG2  4  
ATOM 4382  H HG3  . ARG A 1 26 ? -15.245 -4.894  4.029   1.00 0.00 ? 26 ARG A HG3  4  
ATOM 4383  H HD2  . ARG A 1 26 ? -15.835 -3.061  2.548   1.00 0.00 ? 26 ARG A HD2  4  
ATOM 4384  H HD3  . ARG A 1 26 ? -14.225 -2.330  2.744   1.00 0.00 ? 26 ARG A HD3  4  
ATOM 4385  H HE   . ARG A 1 26 ? -14.055 -5.052  1.774   1.00 0.00 ? 26 ARG A HE   4  
ATOM 4386  H HH11 . ARG A 1 26 ? -14.922 -1.781  0.737   1.00 0.00 ? 26 ARG A HH11 4  
ATOM 4387  H HH12 . ARG A 1 26 ? -14.324 -1.993  -0.892  1.00 0.00 ? 26 ARG A HH12 4  
ATOM 4388  H HH21 . ARG A 1 26 ? -13.183 -5.307  -0.352  1.00 0.00 ? 26 ARG A HH21 4  
ATOM 4389  H HH22 . ARG A 1 26 ? -13.397 -4.024  -1.531  1.00 0.00 ? 26 ARG A HH22 4  
ATOM 4390  N N    . GLY A 1 27 ? -13.706 -6.001  6.013   1.00 0.00 ? 27 GLY A N    4  
ATOM 4391  C CA   . GLY A 1 27 ? -13.741 -7.456  5.890   1.00 0.00 ? 27 GLY A CA   4  
ATOM 4392  C C    . GLY A 1 27 ? -13.107 -7.878  4.568   1.00 0.00 ? 27 GLY A C    4  
ATOM 4393  O O    . GLY A 1 27 ? -13.679 -8.672  3.825   1.00 0.00 ? 27 GLY A O    4  
ATOM 4394  H H    . GLY A 1 27 ? -12.867 -5.518  5.715   1.00 0.00 ? 27 GLY A H    4  
ATOM 4395  H HA2  . GLY A 1 27 ? -13.185 -7.901  6.716   1.00 0.00 ? 27 GLY A HA2  4  
ATOM 4396  H HA3  . GLY A 1 27 ? -14.774 -7.803  5.921   1.00 0.00 ? 27 GLY A HA3  4  
ATOM 4397  N N    . ASP A 1 28 ? -11.923 -7.330  4.285   1.00 0.00 ? 28 ASP A N    4  
ATOM 4398  C CA   . ASP A 1 28 ? -11.184 -7.611  3.063   1.00 0.00 ? 28 ASP A CA   4  
ATOM 4399  C C    . ASP A 1 28 ? -9.703  -7.714  3.424   1.00 0.00 ? 28 ASP A C    4  
ATOM 4400  O O    . ASP A 1 28 ? -8.858  -7.020  2.861   1.00 0.00 ? 28 ASP A O    4  
ATOM 4401  C CB   . ASP A 1 28 ? -11.452 -6.471  2.073   1.00 0.00 ? 28 ASP A CB   4  
ATOM 4402  C CG   . ASP A 1 28 ? -11.305 -6.926  0.633   1.00 0.00 ? 28 ASP A CG   4  
ATOM 4403  O OD1  . ASP A 1 28 ? -10.187 -7.355  0.281   1.00 0.00 ? 28 ASP A OD1  4  
ATOM 4404  O OD2  . ASP A 1 28 ? -12.315 -6.821  -0.097  1.00 0.00 ? 28 ASP A OD2  4  
ATOM 4405  H H    . ASP A 1 28 ? -11.509 -6.683  4.943   1.00 0.00 ? 28 ASP A H    4  
ATOM 4406  H HA   . ASP A 1 28 ? -11.520 -8.555  2.631   1.00 0.00 ? 28 ASP A HA   4  
ATOM 4407  H HB2  . ASP A 1 28 ? -12.465 -6.105  2.223   1.00 0.00 ? 28 ASP A HB2  4  
ATOM 4408  H HB3  . ASP A 1 28 ? -10.754 -5.662  2.263   1.00 0.00 ? 28 ASP A HB3  4  
ATOM 4409  N N    . THR A 1 29 ? -9.403  -8.580  4.396   1.00 0.00 ? 29 THR A N    4  
ATOM 4410  C CA   . THR A 1 29 ? -8.057  -8.738  4.921   1.00 0.00 ? 29 THR A CA   4  
ATOM 4411  C C    . THR A 1 29 ? -7.184  -9.593  3.994   1.00 0.00 ? 29 THR A C    4  
ATOM 4412  O O    . THR A 1 29 ? -5.974  -9.676  4.202   1.00 0.00 ? 29 THR A O    4  
ATOM 4413  C CB   . THR A 1 29 ? -8.138  -9.380  6.315   1.00 0.00 ? 29 THR A CB   4  
ATOM 4414  O OG1  . THR A 1 29 ? -8.611  -10.706 6.199   1.00 0.00 ? 29 THR A OG1  4  
ATOM 4415  C CG2  . THR A 1 29 ? -9.090  -8.584  7.208   1.00 0.00 ? 29 THR A CG2  4  
ATOM 4416  H H    . THR A 1 29 ? -10.138 -9.143  4.803   1.00 0.00 ? 29 THR A H    4  
ATOM 4417  H HA   . THR A 1 29 ? -7.603  -7.752  5.017   1.00 0.00 ? 29 THR A HA   4  
ATOM 4418  H HB   . THR A 1 29 ? -7.147  -9.384  6.768   1.00 0.00 ? 29 THR A HB   4  
ATOM 4419  H HG1  . THR A 1 29 ? -8.622  -11.104 7.073   1.00 0.00 ? 29 THR A HG1  4  
ATOM 4420  H HG21 . THR A 1 29 ? -9.031  -8.960  8.229   1.00 0.00 ? 29 THR A HG21 4  
ATOM 4421  H HG22 . THR A 1 29 ? -10.112 -8.687  6.844   1.00 0.00 ? 29 THR A HG22 4  
ATOM 4422  H HG23 . THR A 1 29 ? -8.805  -7.537  7.194   1.00 0.00 ? 29 THR A HG23 4  
ATOM 4423  N N    . HIS A 1 30 ? -7.788  -10.235 2.983   1.00 0.00 ? 30 HIS A N    4  
ATOM 4424  C CA   . HIS A 1 30 ? -7.047  -11.106 2.080   1.00 0.00 ? 30 HIS A CA   4  
ATOM 4425  C C    . HIS A 1 30 ? -5.971  -10.301 1.324   1.00 0.00 ? 30 HIS A C    4  
ATOM 4426  O O    . HIS A 1 30 ? -6.169  -9.118  1.042   1.00 0.00 ? 30 HIS A O    4  
ATOM 4427  C CB   . HIS A 1 30 ? -8.022  -11.799 1.114   1.00 0.00 ? 30 HIS A CB   4  
ATOM 4428  C CG   . HIS A 1 30 ? -8.248  -11.035 -0.165  1.00 0.00 ? 30 HIS A CG   4  
ATOM 4429  N ND1  . HIS A 1 30 ? -8.775  -9.749  -0.199  1.00 0.00 ? 30 HIS A ND1  4  
ATOM 4430  C CD2  . HIS A 1 30 ? -8.029  -11.359 -1.481  1.00 0.00 ? 30 HIS A CD2  4  
ATOM 4431  C CE1  . HIS A 1 30 ? -8.836  -9.390  -1.496  1.00 0.00 ? 30 HIS A CE1  4  
ATOM 4432  N NE2  . HIS A 1 30 ? -8.398  -10.331 -2.331  1.00 0.00 ? 30 HIS A NE2  4  
ATOM 4433  H H    . HIS A 1 30 ? -8.780  -10.128 2.839   1.00 0.00 ? 30 HIS A H    4  
ATOM 4434  H HA   . HIS A 1 30 ? -6.561  -11.870 2.681   1.00 0.00 ? 30 HIS A HA   4  
ATOM 4435  H HB2  . HIS A 1 30 ? -7.622  -12.781 0.864   1.00 0.00 ? 30 HIS A HB2  4  
ATOM 4436  H HB3  . HIS A 1 30 ? -8.980  -11.933 1.617   1.00 0.00 ? 30 HIS A HB3  4  
ATOM 4437  H HD1  . HIS A 1 30 ? -9.057  -9.188  0.594   1.00 0.00 ? 30 HIS A HD1  4  
ATOM 4438  H HD2  . HIS A 1 30 ? -7.617  -12.300 -1.814  1.00 0.00 ? 30 HIS A HD2  4  
ATOM 4439  H HE1  . HIS A 1 30 ? -9.205  -8.433  -1.825  1.00 0.00 ? 30 HIS A HE1  4  
ATOM 4440  N N    . PRO A 1 31 ? -4.824  -10.941 1.000   1.00 0.00 ? 31 PRO A N    4  
ATOM 4441  C CA   . PRO A 1 31 ? -3.732  -10.293 0.294   1.00 0.00 ? 31 PRO A CA   4  
ATOM 4442  C C    . PRO A 1 31 ? -4.175  -9.772  -1.074  1.00 0.00 ? 31 PRO A C    4  
ATOM 4443  O O    . PRO A 1 31 ? -5.085  -10.328 -1.687  1.00 0.00 ? 31 PRO A O    4  
ATOM 4444  C CB   . PRO A 1 31 ? -2.642  -11.359 0.143   1.00 0.00 ? 31 PRO A CB   4  
ATOM 4445  C CG   . PRO A 1 31 ? -3.156  -12.633 0.822   1.00 0.00 ? 31 PRO A CG   4  
ATOM 4446  C CD   . PRO A 1 31 ? -4.563  -12.328 1.331   1.00 0.00 ? 31 PRO A CD   4  
ATOM 4447  H HA   . PRO A 1 31 ? -3.355  -9.465  0.892   1.00 0.00 ? 31 PRO A HA   4  
ATOM 4448  H HB2  . PRO A 1 31 ? -2.460  -11.557 -0.912  1.00 0.00 ? 31 PRO A HB2  4  
ATOM 4449  H HB3  . PRO A 1 31 ? -1.722  -11.025 0.624   1.00 0.00 ? 31 PRO A HB3  4  
ATOM 4450  H HG2  . PRO A 1 31 ? -3.189  -13.452 0.104   1.00 0.00 ? 31 PRO A HG2  4  
ATOM 4451  H HG3  . PRO A 1 31 ? -2.508  -12.896 1.658   1.00 0.00 ? 31 PRO A HG3  4  
ATOM 4452  H HD2  . PRO A 1 31 ? -5.288  -12.977 0.838   1.00 0.00 ? 31 PRO A HD2  4  
ATOM 4453  H HD3  . PRO A 1 31 ? -4.600  -12.473 2.410   1.00 0.00 ? 31 PRO A HD3  4  
ATOM 4454  N N    . LEU A 1 32 ? -3.511  -8.705  -1.547  1.00 0.00 ? 32 LEU A N    4  
ATOM 4455  C CA   . LEU A 1 32 ? -3.796  -8.107  -2.846  1.00 0.00 ? 32 LEU A CA   4  
ATOM 4456  C C    . LEU A 1 32 ? -2.493  -7.906  -3.615  1.00 0.00 ? 32 LEU A C    4  
ATOM 4457  O O    . LEU A 1 32 ? -1.470  -7.549  -3.030  1.00 0.00 ? 32 LEU A O    4  
ATOM 4458  C CB   . LEU A 1 32 ? -4.477  -6.743  -2.658  1.00 0.00 ? 32 LEU A CB   4  
ATOM 4459  C CG   . LEU A 1 32 ? -5.983  -6.889  -2.380  1.00 0.00 ? 32 LEU A CG   4  
ATOM 4460  C CD1  . LEU A 1 32 ? -6.614  -5.498  -2.396  1.00 0.00 ? 32 LEU A CD1  4  
ATOM 4461  C CD2  . LEU A 1 32 ? -6.656  -7.740  -3.457  1.00 0.00 ? 32 LEU A CD2  4  
ATOM 4462  H H    . LEU A 1 32 ? -2.775  -8.290  -0.989  1.00 0.00 ? 32 LEU A H    4  
ATOM 4463  H HA   . LEU A 1 32 ? -4.445  -8.767  -3.416  1.00 0.00 ? 32 LEU A HA   4  
ATOM 4464  H HB2  . LEU A 1 32 ? -4.008  -6.222  -1.823  1.00 0.00 ? 32 LEU A HB2  4  
ATOM 4465  H HB3  . LEU A 1 32 ? -4.339  -6.154  -3.564  1.00 0.00 ? 32 LEU A HB3  4  
ATOM 4466  H HG   . LEU A 1 32 ? -6.133  -7.348  -1.402  1.00 0.00 ? 32 LEU A HG   4  
ATOM 4467  H HD11 . LEU A 1 32 ? -6.481  -5.051  -3.386  1.00 0.00 ? 32 LEU A HD11 4  
ATOM 4468  H HD12 . LEU A 1 32 ? -7.676  -5.580  -2.177  1.00 0.00 ? 32 LEU A HD12 4  
ATOM 4469  H HD13 . LEU A 1 32 ? -6.135  -4.870  -1.645  1.00 0.00 ? 32 LEU A HD13 4  
ATOM 4470  H HD21 . LEU A 1 32 ? -7.727  -7.539  -3.463  1.00 0.00 ? 32 LEU A HD21 4  
ATOM 4471  H HD22 . LEU A 1 32 ? -6.238  -7.489  -4.426  1.00 0.00 ? 32 LEU A HD22 4  
ATOM 4472  H HD23 . LEU A 1 32 ? -6.491  -8.796  -3.252  1.00 0.00 ? 32 LEU A HD23 4  
ATOM 4473  N N    . THR A 1 33 ? -2.534  -8.124  -4.931  1.00 0.00 ? 33 THR A N    4  
ATOM 4474  C CA   . THR A 1 33 ? -1.376  -7.923  -5.792  1.00 0.00 ? 33 THR A CA   4  
ATOM 4475  C C    . THR A 1 33 ? -1.083  -6.424  -5.916  1.00 0.00 ? 33 THR A C    4  
ATOM 4476  O O    . THR A 1 33 ? -1.884  -5.588  -5.489  1.00 0.00 ? 33 THR A O    4  
ATOM 4477  C CB   . THR A 1 33 ? -1.660  -8.510  -7.187  1.00 0.00 ? 33 THR A CB   4  
ATOM 4478  O OG1  . THR A 1 33 ? -2.773  -7.852  -7.753  1.00 0.00 ? 33 THR A OG1  4  
ATOM 4479  C CG2  . THR A 1 33 ? -1.949  -10.012 -7.099  1.00 0.00 ? 33 THR A CG2  4  
ATOM 4480  H H    . THR A 1 33 ? -3.401  -8.431  -5.358  1.00 0.00 ? 33 THR A H    4  
ATOM 4481  H HA   . THR A 1 33 ? -0.507  -8.428  -5.355  1.00 0.00 ? 33 THR A HA   4  
ATOM 4482  H HB   . THR A 1 33 ? -0.792  -8.351  -7.828  1.00 0.00 ? 33 THR A HB   4  
ATOM 4483  H HG1  . THR A 1 33 ? -3.565  -8.127  -7.274  1.00 0.00 ? 33 THR A HG1  4  
ATOM 4484  H HG21 . THR A 1 33 ? -2.392  -10.350 -8.036  1.00 0.00 ? 33 THR A HG21 4  
ATOM 4485  H HG22 . THR A 1 33 ? -1.021  -10.548 -6.928  1.00 0.00 ? 33 THR A HG22 4  
ATOM 4486  H HG23 . THR A 1 33 ? -2.641  -10.210 -6.281  1.00 0.00 ? 33 THR A HG23 4  
ATOM 4487  N N    . LEU A 1 34 ? 0.061   -6.086  -6.519  1.00 0.00 ? 34 LEU A N    4  
ATOM 4488  C CA   . LEU A 1 34 ? 0.436   -4.698  -6.743  1.00 0.00 ? 34 LEU A CA   4  
ATOM 4489  C C    . LEU A 1 34 ? -0.618  -4.043  -7.645  1.00 0.00 ? 34 LEU A C    4  
ATOM 4490  O O    . LEU A 1 34 ? -1.085  -2.944  -7.366  1.00 0.00 ? 34 LEU A O    4  
ATOM 4491  C CB   . LEU A 1 34 ? 1.836   -4.658  -7.396  1.00 0.00 ? 34 LEU A CB   4  
ATOM 4492  C CG   . LEU A 1 34 ? 2.630   -3.396  -6.989  1.00 0.00 ? 34 LEU A CG   4  
ATOM 4493  C CD1  . LEU A 1 34 ? 1.790   -2.132  -7.185  1.00 0.00 ? 34 LEU A CD1  4  
ATOM 4494  C CD2  . LEU A 1 34 ? 3.081   -3.494  -5.527  1.00 0.00 ? 34 LEU A CD2  4  
ATOM 4495  H H    . LEU A 1 34 ? 0.689   -6.809  -6.843  1.00 0.00 ? 34 LEU A H    4  
ATOM 4496  H HA   . LEU A 1 34 ? 0.463   -4.181  -5.788  1.00 0.00 ? 34 LEU A HA   4  
ATOM 4497  H HB2  . LEU A 1 34 ? 2.398   -5.540  -7.089  1.00 0.00 ? 34 LEU A HB2  4  
ATOM 4498  H HB3  . LEU A 1 34 ? 1.723   -4.672  -8.481  1.00 0.00 ? 34 LEU A HB3  4  
ATOM 4499  H HG   . LEU A 1 34 ? 3.516   -3.327  -7.621  1.00 0.00 ? 34 LEU A HG   4  
ATOM 4500  H HD11 . LEU A 1 34 ? 1.319   -2.157  -8.167  1.00 0.00 ? 34 LEU A HD11 4  
ATOM 4501  H HD12 . LEU A 1 34 ? 2.434   -1.255  -7.117  1.00 0.00 ? 34 LEU A HD12 4  
ATOM 4502  H HD13 . LEU A 1 34 ? 1.024   -2.075  -6.413  1.00 0.00 ? 34 LEU A HD13 4  
ATOM 4503  H HD21 . LEU A 1 34 ? 3.701   -2.633  -5.282  1.00 0.00 ? 34 LEU A HD21 4  
ATOM 4504  H HD22 . LEU A 1 34 ? 3.661   -4.405  -5.389  1.00 0.00 ? 34 LEU A HD22 4  
ATOM 4505  H HD23 . LEU A 1 34 ? 2.214   -3.514  -4.870  1.00 0.00 ? 34 LEU A HD23 4  
ATOM 4506  N N    . ASP A 1 35 ? -0.990  -4.736  -8.725  1.00 0.00 ? 35 ASP A N    4  
ATOM 4507  C CA   . ASP A 1 35 ? -1.977  -4.242  -9.671  1.00 0.00 ? 35 ASP A CA   4  
ATOM 4508  C C    . ASP A 1 35 ? -3.276  -3.877  -8.947  1.00 0.00 ? 35 ASP A C    4  
ATOM 4509  O O    . ASP A 1 35 ? -3.757  -2.755  -9.075  1.00 0.00 ? 35 ASP A O    4  
ATOM 4510  C CB   . ASP A 1 35 ? -2.231  -5.315  -10.735 1.00 0.00 ? 35 ASP A CB   4  
ATOM 4511  C CG   . ASP A 1 35 ? -0.926  -5.749  -11.395 1.00 0.00 ? 35 ASP A CG   4  
ATOM 4512  O OD1  . ASP A 1 35 ? -0.177  -6.502  -10.730 1.00 0.00 ? 35 ASP A OD1  4  
ATOM 4513  O OD2  . ASP A 1 35 ? -0.701  -5.322  -12.548 1.00 0.00 ? 35 ASP A OD2  4  
ATOM 4514  H H    . ASP A 1 35 ? -0.572  -5.642  -8.907  1.00 0.00 ? 35 ASP A H    4  
ATOM 4515  H HA   . ASP A 1 35 ? -1.582  -3.350  -10.159 1.00 0.00 ? 35 ASP A HA   4  
ATOM 4516  H HB2  . ASP A 1 35 ? -2.698  -6.183  -10.267 1.00 0.00 ? 35 ASP A HB2  4  
ATOM 4517  H HB3  . ASP A 1 35 ? -2.903  -4.915  -11.496 1.00 0.00 ? 35 ASP A HB3  4  
ATOM 4518  N N    . GLU A 1 36 ? -3.837  -4.831  -8.189  1.00 0.00 ? 36 GLU A N    4  
ATOM 4519  C CA   . GLU A 1 36 ? -5.088  -4.624  -7.460  1.00 0.00 ? 36 GLU A CA   4  
ATOM 4520  C C    . GLU A 1 36 ? -5.021  -3.358  -6.596  1.00 0.00 ? 36 GLU A C    4  
ATOM 4521  O O    . GLU A 1 36 ? -6.024  -2.653  -6.457  1.00 0.00 ? 36 GLU A O    4  
ATOM 4522  C CB   . GLU A 1 36 ? -5.385  -5.863  -6.612  1.00 0.00 ? 36 GLU A CB   4  
ATOM 4523  C CG   . GLU A 1 36 ? -5.869  -6.996  -7.528  1.00 0.00 ? 36 GLU A CG   4  
ATOM 4524  C CD   . GLU A 1 36 ? -5.942  -8.322  -6.782  1.00 0.00 ? 36 GLU A CD   4  
ATOM 4525  O OE1  . GLU A 1 36 ? -4.874  -8.763  -6.303  1.00 0.00 ? 36 GLU A OE1  4  
ATOM 4526  O OE2  . GLU A 1 36 ? -7.063  -8.868  -6.703  1.00 0.00 ? 36 GLU A OE2  4  
ATOM 4527  H H    . GLU A 1 36 ? -3.387  -5.735  -8.114  1.00 0.00 ? 36 GLU A H    4  
ATOM 4528  H HA   . GLU A 1 36 ? -5.896  -4.503  -8.177  1.00 0.00 ? 36 GLU A HA   4  
ATOM 4529  H HB2  . GLU A 1 36 ? -4.479  -6.174  -6.090  1.00 0.00 ? 36 GLU A HB2  4  
ATOM 4530  H HB3  . GLU A 1 36 ? -6.162  -5.629  -5.884  1.00 0.00 ? 36 GLU A HB3  4  
ATOM 4531  H HG2  . GLU A 1 36 ? -6.859  -6.747  -7.911  1.00 0.00 ? 36 GLU A HG2  4  
ATOM 4532  H HG3  . GLU A 1 36 ? -5.182  -7.100  -8.367  1.00 0.00 ? 36 GLU A HG3  4  
ATOM 4533  N N    . ILE A 1 37 ? -3.851  -3.059  -6.022  1.00 0.00 ? 37 ILE A N    4  
ATOM 4534  C CA   . ILE A 1 37 ? -3.686  -1.865  -5.205  1.00 0.00 ? 37 ILE A CA   4  
ATOM 4535  C C    . ILE A 1 37 ? -3.804  -0.616  -6.085  1.00 0.00 ? 37 ILE A C    4  
ATOM 4536  O O    . ILE A 1 37 ? -4.542  0.310   -5.743  1.00 0.00 ? 37 ILE A O    4  
ATOM 4537  C CB   . ILE A 1 37 ? -2.331  -1.920  -4.473  1.00 0.00 ? 37 ILE A CB   4  
ATOM 4538  C CG1  . ILE A 1 37 ? -2.438  -2.888  -3.286  1.00 0.00 ? 37 ILE A CG1  4  
ATOM 4539  C CG2  . ILE A 1 37 ? -1.945  -0.521  -3.971  1.00 0.00 ? 37 ILE A CG2  4  
ATOM 4540  C CD1  . ILE A 1 37 ? -1.048  -3.373  -2.869  1.00 0.00 ? 37 ILE A CD1  4  
ATOM 4541  H H    . ILE A 1 37 ? -3.053  -3.669  -6.155  1.00 0.00 ? 37 ILE A H    4  
ATOM 4542  H HA   . ILE A 1 37 ? -4.486  -1.835  -4.461  1.00 0.00 ? 37 ILE A HA   4  
ATOM 4543  H HB   . ILE A 1 37 ? -1.564  -2.275  -5.157  1.00 0.00 ? 37 ILE A HB   4  
ATOM 4544  H HG12 . ILE A 1 37 ? -2.909  -2.380  -2.446  1.00 0.00 ? 37 ILE A HG12 4  
ATOM 4545  H HG13 . ILE A 1 37 ? -3.045  -3.748  -3.572  1.00 0.00 ? 37 ILE A HG13 4  
ATOM 4546  H HG21 . ILE A 1 37 ? -1.672  0.109   -4.818  1.00 0.00 ? 37 ILE A HG21 4  
ATOM 4547  H HG22 . ILE A 1 37 ? -2.789  -0.075  -3.446  1.00 0.00 ? 37 ILE A HG22 4  
ATOM 4548  H HG23 . ILE A 1 37 ? -1.098  -0.596  -3.294  1.00 0.00 ? 37 ILE A HG23 4  
ATOM 4549  H HD11 . ILE A 1 37 ? -0.570  -3.875  -3.709  1.00 0.00 ? 37 ILE A HD11 4  
ATOM 4550  H HD12 . ILE A 1 37 ? -1.144  -4.072  -2.039  1.00 0.00 ? 37 ILE A HD12 4  
ATOM 4551  H HD13 . ILE A 1 37 ? -0.439  -2.526  -2.559  1.00 0.00 ? 37 ILE A HD13 4  
ATOM 4552  N N    . LEU A 1 38 ? -3.082  -0.586  -7.219  1.00 0.00 ? 38 LEU A N    4  
ATOM 4553  C CA   . LEU A 1 38 ? -3.122  0.561   -8.126  1.00 0.00 ? 38 LEU A CA   4  
ATOM 4554  C C    . LEU A 1 38 ? -4.552  0.785   -8.620  1.00 0.00 ? 38 LEU A C    4  
ATOM 4555  O O    . LEU A 1 38 ? -5.012  1.919   -8.674  1.00 0.00 ? 38 LEU A O    4  
ATOM 4556  C CB   . LEU A 1 38 ? -2.189  0.338   -9.330  1.00 0.00 ? 38 LEU A CB   4  
ATOM 4557  C CG   . LEU A 1 38 ? -0.734  0.125   -8.887  1.00 0.00 ? 38 LEU A CG   4  
ATOM 4558  C CD1  . LEU A 1 38 ? 0.124   -0.166  -10.119 1.00 0.00 ? 38 LEU A CD1  4  
ATOM 4559  C CD2  . LEU A 1 38 ? -0.189  1.374   -8.182  1.00 0.00 ? 38 LEU A CD2  4  
ATOM 4560  H H    . LEU A 1 38 ? -2.493  -1.374  -7.461  1.00 0.00 ? 38 LEU A H    4  
ATOM 4561  H HA   . LEU A 1 38 ? -2.798  1.448   -7.585  1.00 0.00 ? 38 LEU A HA   4  
ATOM 4562  H HB2  . LEU A 1 38 ? -2.525  -0.540  -9.882  1.00 0.00 ? 38 LEU A HB2  4  
ATOM 4563  H HB3  . LEU A 1 38 ? -2.239  1.208   -9.983  1.00 0.00 ? 38 LEU A HB3  4  
ATOM 4564  H HG   . LEU A 1 38 ? -0.686  -0.719  -8.212  1.00 0.00 ? 38 LEU A HG   4  
ATOM 4565  H HD11 . LEU A 1 38 ? 0.071   0.677   -10.809 1.00 0.00 ? 38 LEU A HD11 4  
ATOM 4566  H HD12 . LEU A 1 38 ? 1.161   -0.320  -9.814  1.00 0.00 ? 38 LEU A HD12 4  
ATOM 4567  H HD13 . LEU A 1 38 ? -0.243  -1.065  -10.615 1.00 0.00 ? 38 LEU A HD13 4  
ATOM 4568  H HD21 . LEU A 1 38 ? 0.892   1.275   -8.052  1.00 0.00 ? 38 LEU A HD21 4  
ATOM 4569  H HD22 . LEU A 1 38 ? -0.660  1.478   -7.205  1.00 0.00 ? 38 LEU A HD22 4  
ATOM 4570  H HD23 . LEU A 1 38 ? -0.400  2.254   -8.784  1.00 0.00 ? 38 LEU A HD23 4  
ATOM 4571  N N    . ASP A 1 39 ? -5.244  -0.300  -8.989  1.00 0.00 ? 39 ASP A N    4  
ATOM 4572  C CA   . ASP A 1 39 ? -6.605  -0.223  -9.509  1.00 0.00 ? 39 ASP A CA   4  
ATOM 4573  C C    . ASP A 1 39 ? -7.509  0.580   -8.573  1.00 0.00 ? 39 ASP A C    4  
ATOM 4574  O O    . ASP A 1 39 ? -8.050  1.612   -8.968  1.00 0.00 ? 39 ASP A O    4  
ATOM 4575  C CB   . ASP A 1 39 ? -7.165  -1.643  -9.686  1.00 0.00 ? 39 ASP A CB   4  
ATOM 4576  C CG   . ASP A 1 39 ? -6.829  -2.205  -11.061 1.00 0.00 ? 39 ASP A CG   4  
ATOM 4577  O OD1  . ASP A 1 39 ? -5.739  -2.801  -11.184 1.00 0.00 ? 39 ASP A OD1  4  
ATOM 4578  O OD2  . ASP A 1 39 ? -7.673  -2.027  -11.966 1.00 0.00 ? 39 ASP A OD2  4  
ATOM 4579  H H    . ASP A 1 39 ? -4.814  -1.214  -8.915  1.00 0.00 ? 39 ASP A H    4  
ATOM 4580  H HA   . ASP A 1 39 ? -6.582  0.271   -10.481 1.00 0.00 ? 39 ASP A HA   4  
ATOM 4581  H HB2  . ASP A 1 39 ? -6.745  -2.295  -8.921  1.00 0.00 ? 39 ASP A HB2  4  
ATOM 4582  H HB3  . ASP A 1 39 ? -8.249  -1.617  -9.573  1.00 0.00 ? 39 ASP A HB3  4  
ATOM 4583  N N    . GLU A 1 40 ? -7.685  0.093   -7.339  1.00 0.00 ? 40 GLU A N    4  
ATOM 4584  C CA   . GLU A 1 40 ? -8.587  0.718   -6.377  1.00 0.00 ? 40 GLU A CA   4  
ATOM 4585  C C    . GLU A 1 40 ? -8.234  2.195   -6.148  1.00 0.00 ? 40 GLU A C    4  
ATOM 4586  O O    . GLU A 1 40 ? -9.109  3.055   -6.220  1.00 0.00 ? 40 GLU A O    4  
ATOM 4587  C CB   . GLU A 1 40 ? -8.540  -0.060  -5.057  1.00 0.00 ? 40 GLU A CB   4  
ATOM 4588  C CG   . GLU A 1 40 ? -9.878  0.097   -4.320  1.00 0.00 ? 40 GLU A CG   4  
ATOM 4589  C CD   . GLU A 1 40 ? -10.805 -1.084  -4.596  1.00 0.00 ? 40 GLU A CD   4  
ATOM 4590  O OE1  . GLU A 1 40 ? -11.348 -1.129  -5.719  1.00 0.00 ? 40 GLU A OE1  4  
ATOM 4591  O OE2  . GLU A 1 40 ? -10.952 -1.921  -3.673  1.00 0.00 ? 40 GLU A OE2  4  
ATOM 4592  H H    . GLU A 1 40 ? -7.194  -0.746  -7.060  1.00 0.00 ? 40 GLU A H    4  
ATOM 4593  H HA   . GLU A 1 40 ? -9.600  0.663   -6.777  1.00 0.00 ? 40 GLU A HA   4  
ATOM 4594  H HB2  . GLU A 1 40 ? -8.359  -1.118  -5.260  1.00 0.00 ? 40 GLU A HB2  4  
ATOM 4595  H HB3  . GLU A 1 40 ? -7.734  0.330   -4.435  1.00 0.00 ? 40 GLU A HB3  4  
ATOM 4596  H HG2  . GLU A 1 40 ? -9.691  0.160   -3.254  1.00 0.00 ? 40 GLU A HG2  4  
ATOM 4597  H HG3  . GLU A 1 40 ? -10.363 1.016   -4.647  1.00 0.00 ? 40 GLU A HG3  4  
ATOM 4598  N N    . THR A 1 41 ? -6.958  2.489   -5.862  1.00 0.00 ? 41 THR A N    4  
ATOM 4599  C CA   . THR A 1 41 ? -6.523  3.861   -5.590  1.00 0.00 ? 41 THR A CA   4  
ATOM 4600  C C    . THR A 1 41 ? -6.404  4.682   -6.881  1.00 0.00 ? 41 THR A C    4  
ATOM 4601  O O    . THR A 1 41 ? -6.078  5.863   -6.817  1.00 0.00 ? 41 THR A O    4  
ATOM 4602  C CB   . THR A 1 41 ? -5.197  3.837   -4.834  1.00 0.00 ? 41 THR A CB   4  
ATOM 4603  O OG1  . THR A 1 41 ? -4.256  3.047   -5.528  1.00 0.00 ? 41 THR A OG1  4  
ATOM 4604  C CG2  . THR A 1 41 ? -5.406  3.278   -3.428  1.00 0.00 ? 41 THR A CG2  4  
ATOM 4605  H H    . THR A 1 41 ? -6.270  1.750   -5.825  1.00 0.00 ? 41 THR A H    4  
ATOM 4606  H HA   . THR A 1 41 ? -7.253  4.349   -4.957  1.00 0.00 ? 41 THR A HA   4  
ATOM 4607  H HB   . THR A 1 41 ? -4.827  4.849   -4.750  1.00 0.00 ? 41 THR A HB   4  
ATOM 4608  H HG1  . THR A 1 41 ? -4.519  2.124   -5.464  1.00 0.00 ? 41 THR A HG1  4  
ATOM 4609  H HG21 . THR A 1 41 ? -4.514  3.462   -2.834  1.00 0.00 ? 41 THR A HG21 4  
ATOM 4610  H HG22 . THR A 1 41 ? -5.594  2.206   -3.483  1.00 0.00 ? 41 THR A HG22 4  
ATOM 4611  H HG23 . THR A 1 41 ? -6.257  3.773   -2.958  1.00 0.00 ? 41 THR A HG23 4  
ATOM 4612  N N    . GLN A 1 42 ? -6.672  4.067   -8.043  1.00 0.00 ? 42 GLN A N    4  
ATOM 4613  C CA   . GLN A 1 42 ? -6.592  4.755   -9.327  1.00 0.00 ? 42 GLN A CA   4  
ATOM 4614  C C    . GLN A 1 42 ? -5.191  5.345   -9.507  1.00 0.00 ? 42 GLN A C    4  
ATOM 4615  O O    . GLN A 1 42 ? -5.034  6.561   -9.654  1.00 0.00 ? 42 GLN A O    4  
ATOM 4616  C CB   . GLN A 1 42 ? -7.671  5.845   -9.400  1.00 0.00 ? 42 GLN A CB   4  
ATOM 4617  C CG   . GLN A 1 42 ? -7.720  6.434   -10.815 1.00 0.00 ? 42 GLN A CG   4  
ATOM 4618  C CD   . GLN A 1 42 ? -7.932  7.942   -10.772 1.00 0.00 ? 42 GLN A CD   4  
ATOM 4619  O OE1  . GLN A 1 42 ? -9.002  8.433   -11.117 1.00 0.00 ? 42 GLN A OE1  4  
ATOM 4620  N NE2  . GLN A 1 42 ? -6.903  8.674   -10.345 1.00 0.00 ? 42 GLN A NE2  4  
ATOM 4621  H H    . GLN A 1 42 ? -6.939  3.091   -8.045  1.00 0.00 ? 42 GLN A H    4  
ATOM 4622  H HA   . GLN A 1 42 ? -6.772  4.030   -10.121 1.00 0.00 ? 42 GLN A HA   4  
ATOM 4623  H HB2  . GLN A 1 42 ? -8.642  5.411   -9.157  1.00 0.00 ? 42 GLN A HB2  4  
ATOM 4624  H HB3  . GLN A 1 42 ? -7.442  6.635   -8.685  1.00 0.00 ? 42 GLN A HB3  4  
ATOM 4625  H HG2  . GLN A 1 42 ? -6.781  6.224   -11.329 1.00 0.00 ? 42 GLN A HG2  4  
ATOM 4626  H HG3  . GLN A 1 42 ? -8.538  5.972   -11.367 1.00 0.00 ? 42 GLN A HG3  4  
ATOM 4627  H HE21 . GLN A 1 42 ? -6.044  8.218   -10.061 1.00 0.00 ? 42 GLN A HE21 4  
ATOM 4628  H HE22 . GLN A 1 42 ? -6.982  9.679   -10.307 1.00 0.00 ? 42 GLN A HE22 4  
ATOM 4629  N N    . HIS A 1 43 ? -4.179  4.475   -9.498  1.00 0.00 ? 43 HIS A N    4  
ATOM 4630  C CA   . HIS A 1 43 ? -2.794  4.885   -9.666  1.00 0.00 ? 43 HIS A CA   4  
ATOM 4631  C C    . HIS A 1 43 ? -2.135  4.039   -10.750 1.00 0.00 ? 43 HIS A C    4  
ATOM 4632  O O    . HIS A 1 43 ? -0.935  3.789   -10.689 1.00 0.00 ? 43 HIS A O    4  
ATOM 4633  C CB   . HIS A 1 43 ? -2.051  4.729   -8.334  1.00 0.00 ? 43 HIS A CB   4  
ATOM 4634  C CG   . HIS A 1 43 ? -2.612  5.599   -7.241  1.00 0.00 ? 43 HIS A CG   4  
ATOM 4635  N ND1  . HIS A 1 43 ? -3.276  6.793   -7.489  1.00 0.00 ? 43 HIS A ND1  4  
ATOM 4636  C CD2  . HIS A 1 43 ? -2.629  5.468   -5.880  1.00 0.00 ? 43 HIS A CD2  4  
ATOM 4637  C CE1  . HIS A 1 43 ? -3.636  7.290   -6.291  1.00 0.00 ? 43 HIS A CE1  4  
ATOM 4638  N NE2  . HIS A 1 43 ? -3.267  6.531   -5.267  1.00 0.00 ? 43 HIS A NE2  4  
ATOM 4639  H H    . HIS A 1 43 ? -4.372  3.492   -9.369  1.00 0.00 ? 43 HIS A H    4  
ATOM 4640  H HA   . HIS A 1 43 ? -2.758  5.930   -9.973  1.00 0.00 ? 43 HIS A HA   4  
ATOM 4641  H HB2  . HIS A 1 43 ? -2.111  3.689   -8.017  1.00 0.00 ? 43 HIS A HB2  4  
ATOM 4642  H HB3  . HIS A 1 43 ? -1.003  4.992   -8.482  1.00 0.00 ? 43 HIS A HB3  4  
ATOM 4643  H HD1  . HIS A 1 43 ? -3.459  7.207   -8.394  1.00 0.00 ? 43 HIS A HD1  4  
ATOM 4644  H HD2  . HIS A 1 43 ? -2.209  4.632   -5.348  1.00 0.00 ? 43 HIS A HD2  4  
ATOM 4645  H HE1  . HIS A 1 43 ? -4.183  8.206   -6.174  1.00 0.00 ? 43 HIS A HE1  4  
ATOM 4646  N N    . LEU A 1 44 ? -2.918  3.604   -11.751 1.00 0.00 ? 44 LEU A N    4  
ATOM 4647  C CA   . LEU A 1 44 ? -2.392  2.817   -12.859 1.00 0.00 ? 44 LEU A CA   4  
ATOM 4648  C C    . LEU A 1 44 ? -1.661  3.752   -13.822 1.00 0.00 ? 44 LEU A C    4  
ATOM 4649  O O    . LEU A 1 44 ? -2.100  3.977   -14.948 1.00 0.00 ? 44 LEU A O    4  
ATOM 4650  C CB   . LEU A 1 44 ? -3.538  2.076   -13.555 1.00 0.00 ? 44 LEU A CB   4  
ATOM 4651  C CG   . LEU A 1 44 ? -3.956  0.852   -12.724 1.00 0.00 ? 44 LEU A CG   4  
ATOM 4652  C CD1  . LEU A 1 44 ? -5.387  0.463   -13.096 1.00 0.00 ? 44 LEU A CD1  4  
ATOM 4653  C CD2  . LEU A 1 44 ? -3.020  -0.324  -13.018 1.00 0.00 ? 44 LEU A CD2  4  
ATOM 4654  H H    . LEU A 1 44 ? -3.902  3.830   -11.749 1.00 0.00 ? 44 LEU A H    4  
ATOM 4655  H HA   . LEU A 1 44 ? -1.681  2.088   -12.472 1.00 0.00 ? 44 LEU A HA   4  
ATOM 4656  H HB2  . LEU A 1 44 ? -4.389  2.749   -13.666 1.00 0.00 ? 44 LEU A HB2  4  
ATOM 4657  H HB3  . LEU A 1 44 ? -3.210  1.744   -14.542 1.00 0.00 ? 44 LEU A HB3  4  
ATOM 4658  H HG   . LEU A 1 44 ? -3.910  1.093   -11.658 1.00 0.00 ? 44 LEU A HG   4  
ATOM 4659  H HD11 . LEU A 1 44 ? -5.647  -0.469  -12.602 1.00 0.00 ? 44 LEU A HD11 4  
ATOM 4660  H HD12 . LEU A 1 44 ? -6.073  1.247   -12.777 1.00 0.00 ? 44 LEU A HD12 4  
ATOM 4661  H HD13 . LEU A 1 44 ? -5.460  0.333   -14.176 1.00 0.00 ? 44 LEU A HD13 4  
ATOM 4662  H HD21 . LEU A 1 44 ? -3.335  -1.192  -12.437 1.00 0.00 ? 44 LEU A HD21 4  
ATOM 4663  H HD22 . LEU A 1 44 ? -3.061  -0.567  -14.080 1.00 0.00 ? 44 LEU A HD22 4  
ATOM 4664  H HD23 . LEU A 1 44 ? -2.000  -0.059  -12.746 1.00 0.00 ? 44 LEU A HD23 4  
ATOM 4665  N N    . ASP A 1 45 ? -0.543  4.292   -13.345 1.00 0.00 ? 45 ASP A N    4  
ATOM 4666  C CA   . ASP A 1 45 ? 0.286   5.225   -14.088 1.00 0.00 ? 45 ASP A CA   4  
ATOM 4667  C C    . ASP A 1 45 ? 1.651   5.298   -13.406 1.00 0.00 ? 45 ASP A C    4  
ATOM 4668  O O    . ASP A 1 45 ? 2.674   5.329   -14.083 1.00 0.00 ? 45 ASP A O    4  
ATOM 4669  C CB   . ASP A 1 45 ? -0.387  6.600   -14.109 1.00 0.00 ? 45 ASP A CB   4  
ATOM 4670  C CG   . ASP A 1 45 ? 0.541   7.649   -14.708 1.00 0.00 ? 45 ASP A CG   4  
ATOM 4671  O OD1  . ASP A 1 45 ? 0.640   7.676   -15.952 1.00 0.00 ? 45 ASP A OD1  4  
ATOM 4672  O OD2  . ASP A 1 45 ? 1.132   8.405   -13.907 1.00 0.00 ? 45 ASP A OD2  4  
ATOM 4673  H H    . ASP A 1 45 ? -0.250  4.046   -12.412 1.00 0.00 ? 45 ASP A H    4  
ATOM 4674  H HA   . ASP A 1 45 ? 0.412   4.866   -15.110 1.00 0.00 ? 45 ASP A HA   4  
ATOM 4675  H HB2  . ASP A 1 45 ? -1.297  6.546   -14.707 1.00 0.00 ? 45 ASP A HB2  4  
ATOM 4676  H HB3  . ASP A 1 45 ? -0.645  6.890   -13.091 1.00 0.00 ? 45 ASP A HB3  4  
ATOM 4677  N N    . ILE A 1 46 ? 1.623   5.310   -12.049 1.00 0.00 ? 46 ILE A N    4  
ATOM 4678  C CA   . ILE A 1 46 ? 2.803   5.339   -11.172 1.00 0.00 ? 46 ILE A CA   4  
ATOM 4679  C C    . ILE A 1 46 ? 4.075   5.797   -11.902 1.00 0.00 ? 46 ILE A C    4  
ATOM 4680  O O    . ILE A 1 46 ? 4.407   6.981   -11.898 1.00 0.00 ? 46 ILE A O    4  
ATOM 4681  C CB   . ILE A 1 46 ? 3.029   3.948   -10.481 1.00 0.00 ? 46 ILE A CB   4  
ATOM 4682  C CG1  . ILE A 1 46 ? 2.242   2.799   -11.146 1.00 0.00 ? 46 ILE A CG1  4  
ATOM 4683  C CG2  . ILE A 1 46 ? 2.611   4.033   -9.012  1.00 0.00 ? 46 ILE A CG2  4  
ATOM 4684  C CD1  . ILE A 1 46 ? 2.983   2.296   -12.382 1.00 0.00 ? 46 ILE A CD1  4  
ATOM 4685  H H    . ILE A 1 46 ? 0.723   5.295   -11.592 1.00 0.00 ? 46 ILE A H    4  
ATOM 4686  H HA   . ILE A 1 46 ? 2.602   6.066   -10.387 1.00 0.00 ? 46 ILE A HA   4  
ATOM 4687  H HB   . ILE A 1 46 ? 4.086   3.700   -10.513 1.00 0.00 ? 46 ILE A HB   4  
ATOM 4688  H HG12 . ILE A 1 46 ? 2.155   1.976   -10.436 1.00 0.00 ? 46 ILE A HG12 4  
ATOM 4689  H HG13 . ILE A 1 46 ? 1.249   3.127   -11.423 1.00 0.00 ? 46 ILE A HG13 4  
ATOM 4690  H HG21 . ILE A 1 46 ? 1.526   4.099   -8.943  1.00 0.00 ? 46 ILE A HG21 4  
ATOM 4691  H HG22 . ILE A 1 46 ? 2.957   3.138   -8.490  1.00 0.00 ? 46 ILE A HG22 4  
ATOM 4692  H HG23 . ILE A 1 46 ? 3.059   4.912   -8.554  1.00 0.00 ? 46 ILE A HG23 4  
ATOM 4693  H HD11 . ILE A 1 46 ? 2.568   1.338   -12.689 1.00 0.00 ? 46 ILE A HD11 4  
ATOM 4694  H HD12 . ILE A 1 46 ? 2.874   3.012   -13.191 1.00 0.00 ? 46 ILE A HD12 4  
ATOM 4695  H HD13 . ILE A 1 46 ? 4.036   2.174   -12.146 1.00 0.00 ? 46 ILE A HD13 4  
ATOM 4696  N N    . GLY A 1 47 ? 4.786   4.844   -12.500 1.00 0.00 ? 47 GLY A N    4  
ATOM 4697  C CA   . GLY A 1 47 ? 6.048   5.079   -13.161 1.00 0.00 ? 47 GLY A CA   4  
ATOM 4698  C C    . GLY A 1 47 ? 7.015   4.007   -12.686 1.00 0.00 ? 47 GLY A C    4  
ATOM 4699  O O    . GLY A 1 47 ? 6.782   3.389   -11.647 1.00 0.00 ? 47 GLY A O    4  
ATOM 4700  H H    . GLY A 1 47 ? 4.445   3.904   -12.483 1.00 0.00 ? 47 GLY A H    4  
ATOM 4701  H HA2  . GLY A 1 47 ? 5.916   5.008   -14.242 1.00 0.00 ? 47 GLY A HA2  4  
ATOM 4702  H HA3  . GLY A 1 47 ? 6.433   6.064   -12.899 1.00 0.00 ? 47 GLY A HA3  4  
ATOM 4703  N N    . LEU A 1 48 ? 8.093   3.771   -13.430 1.00 0.00 ? 48 LEU A N    4  
ATOM 4704  C CA   . LEU A 1 48 ? 9.062   2.756   -13.050 1.00 0.00 ? 48 LEU A CA   4  
ATOM 4705  C C    . LEU A 1 48 ? 9.564   3.030   -11.632 1.00 0.00 ? 48 LEU A C    4  
ATOM 4706  O O    . LEU A 1 48 ? 9.672   2.111   -10.823 1.00 0.00 ? 48 LEU A O    4  
ATOM 4707  C CB   . LEU A 1 48 ? 10.220  2.754   -14.056 1.00 0.00 ? 48 LEU A CB   4  
ATOM 4708  C CG   . LEU A 1 48 ? 11.043  1.464   -13.913 1.00 0.00 ? 48 LEU A CG   4  
ATOM 4709  C CD1  . LEU A 1 48 ? 10.363  0.325   -14.683 1.00 0.00 ? 48 LEU A CD1  4  
ATOM 4710  C CD2  . LEU A 1 48 ? 12.445  1.689   -14.480 1.00 0.00 ? 48 LEU A CD2  4  
ATOM 4711  H H    . LEU A 1 48 ? 8.250   4.300   -14.276 1.00 0.00 ? 48 LEU A H    4  
ATOM 4712  H HA   . LEU A 1 48 ? 8.570   1.784   -13.065 1.00 0.00 ? 48 LEU A HA   4  
ATOM 4713  H HB2  . LEU A 1 48 ? 9.821   2.817   -15.069 1.00 0.00 ? 48 LEU A HB2  4  
ATOM 4714  H HB3  . LEU A 1 48 ? 10.861  3.615   -13.869 1.00 0.00 ? 48 LEU A HB3  4  
ATOM 4715  H HG   . LEU A 1 48 ? 11.120  1.193   -12.859 1.00 0.00 ? 48 LEU A HG   4  
ATOM 4716  H HD11 . LEU A 1 48 ? 10.291  0.591   -15.737 1.00 0.00 ? 48 LEU A HD11 4  
ATOM 4717  H HD12 . LEU A 1 48 ? 9.364   0.156   -14.283 1.00 0.00 ? 48 LEU A HD12 4  
ATOM 4718  H HD13 . LEU A 1 48 ? 10.953  -0.586  -14.579 1.00 0.00 ? 48 LEU A HD13 4  
ATOM 4719  H HD21 . LEU A 1 48 ? 12.373  1.993   -15.523 1.00 0.00 ? 48 LEU A HD21 4  
ATOM 4720  H HD22 . LEU A 1 48 ? 12.948  2.469   -13.908 1.00 0.00 ? 48 LEU A HD22 4  
ATOM 4721  H HD23 . LEU A 1 48 ? 13.019  0.764   -14.410 1.00 0.00 ? 48 LEU A HD23 4  
ATOM 4722  N N    . LYS A 1 49 ? 9.861   4.300   -11.338 1.00 0.00 ? 49 LYS A N    4  
ATOM 4723  C CA   . LYS A 1 49 ? 10.348  4.706   -10.030 1.00 0.00 ? 49 LYS A CA   4  
ATOM 4724  C C    . LYS A 1 49 ? 9.333   4.349   -8.942  1.00 0.00 ? 49 LYS A C    4  
ATOM 4725  O O    . LYS A 1 49 ? 9.684   3.701   -7.957  1.00 0.00 ? 49 LYS A O    4  
ATOM 4726  C CB   . LYS A 1 49 ? 10.594  6.222   -10.032 1.00 0.00 ? 49 LYS A CB   4  
ATOM 4727  C CG   . LYS A 1 49 ? 11.791  6.577   -10.923 1.00 0.00 ? 49 LYS A CG   4  
ATOM 4728  C CD   . LYS A 1 49 ? 13.097  6.131   -10.256 1.00 0.00 ? 49 LYS A CD   4  
ATOM 4729  C CE   . LYS A 1 49 ? 14.258  6.972   -10.796 1.00 0.00 ? 49 LYS A CE   4  
ATOM 4730  N NZ   . LYS A 1 49 ? 15.549  6.497   -10.268 1.00 0.00 ? 49 LYS A NZ   4  
ATOM 4731  H H    . LYS A 1 49 ? 9.745   5.011   -12.044 1.00 0.00 ? 49 LYS A H    4  
ATOM 4732  H HA   . LYS A 1 49 ? 11.285  4.191   -9.823  1.00 0.00 ? 49 LYS A HA   4  
ATOM 4733  H HB2  . LYS A 1 49 ? 9.705   6.729   -10.408 1.00 0.00 ? 49 LYS A HB2  4  
ATOM 4734  H HB3  . LYS A 1 49 ? 10.791  6.556   -9.013  1.00 0.00 ? 49 LYS A HB3  4  
ATOM 4735  H HG2  . LYS A 1 49 ? 11.689  6.084   -11.890 1.00 0.00 ? 49 LYS A HG2  4  
ATOM 4736  H HG3  . LYS A 1 49 ? 11.814  7.657   -11.072 1.00 0.00 ? 49 LYS A HG3  4  
ATOM 4737  H HD2  . LYS A 1 49 ? 13.023  6.270   -9.177  1.00 0.00 ? 49 LYS A HD2  4  
ATOM 4738  H HD3  . LYS A 1 49 ? 13.278  5.078   -10.475 1.00 0.00 ? 49 LYS A HD3  4  
ATOM 4739  H HE2  . LYS A 1 49 ? 14.271  6.907   -11.884 1.00 0.00 ? 49 LYS A HE2  4  
ATOM 4740  H HE3  . LYS A 1 49 ? 14.111  8.013   -10.502 1.00 0.00 ? 49 LYS A HE3  4  
ATOM 4741  H HZ1  . LYS A 1 49 ? 16.296  7.070   -10.637 1.00 0.00 ? 49 LYS A HZ1  4  
ATOM 4742  H HZ2  . LYS A 1 49 ? 15.695  5.537   -10.544 1.00 0.00 ? 49 LYS A HZ2  4  
ATOM 4743  H HZ3  . LYS A 1 49 ? 15.546  6.561   -9.259  1.00 0.00 ? 49 LYS A HZ3  4  
ATOM 4744  N N    . GLN A 1 50 ? 8.080   4.788   -9.116  1.00 0.00 ? 50 GLN A N    4  
ATOM 4745  C CA   . GLN A 1 50 ? 7.041   4.580   -8.116  1.00 0.00 ? 50 GLN A CA   4  
ATOM 4746  C C    . GLN A 1 50 ? 6.730   3.092   -7.947  1.00 0.00 ? 50 GLN A C    4  
ATOM 4747  O O    . GLN A 1 50 ? 6.840   2.572   -6.846  1.00 0.00 ? 50 GLN A O    4  
ATOM 4748  C CB   . GLN A 1 50 ? 5.779   5.355   -8.506  1.00 0.00 ? 50 GLN A CB   4  
ATOM 4749  C CG   . GLN A 1 50 ? 6.131   6.796   -8.878  1.00 0.00 ? 50 GLN A CG   4  
ATOM 4750  C CD   . GLN A 1 50 ? 5.036   7.761   -8.427  1.00 0.00 ? 50 GLN A CD   4  
ATOM 4751  O OE1  . GLN A 1 50 ? 4.922   8.059   -7.242  1.00 0.00 ? 50 GLN A OE1  4  
ATOM 4752  N NE2  . GLN A 1 50 ? 4.232   8.248   -9.369  1.00 0.00 ? 50 GLN A NE2  4  
ATOM 4753  H H    . GLN A 1 50 ? 7.841   5.294   -9.955  1.00 0.00 ? 50 GLN A H    4  
ATOM 4754  H HA   . GLN A 1 50 ? 7.400   4.968   -7.161  1.00 0.00 ? 50 GLN A HA   4  
ATOM 4755  H HB2  . GLN A 1 50 ? 5.311   4.875   -9.356  1.00 0.00 ? 50 GLN A HB2  4  
ATOM 4756  H HB3  . GLN A 1 50 ? 5.087   5.355   -7.664  1.00 0.00 ? 50 GLN A HB3  4  
ATOM 4757  H HG2  . GLN A 1 50 ? 7.068   7.076   -8.397  1.00 0.00 ? 50 GLN A HG2  4  
ATOM 4758  H HG3  . GLN A 1 50 ? 6.249   6.862   -9.962  1.00 0.00 ? 50 GLN A HG3  4  
ATOM 4759  H HE21 . GLN A 1 50 ? 4.359   7.975   -10.336 1.00 0.00 ? 50 GLN A HE21 4  
ATOM 4760  H HE22 . GLN A 1 50 ? 3.495   8.890   -9.119  1.00 0.00 ? 50 GLN A HE22 4  
ATOM 4761  N N    . LYS A 1 51 ? 6.337   2.408   -9.035  1.00 0.00 ? 51 LYS A N    4  
ATOM 4762  C CA   . LYS A 1 51 ? 6.002   0.987   -8.980  1.00 0.00 ? 51 LYS A CA   4  
ATOM 4763  C C    . LYS A 1 51 ? 7.094   0.211   -8.248  1.00 0.00 ? 51 LYS A C    4  
ATOM 4764  O O    . LYS A 1 51 ? 6.806   -0.588  -7.358  1.00 0.00 ? 51 LYS A O    4  
ATOM 4765  C CB   . LYS A 1 51 ? 5.839   0.446   -10.400 1.00 0.00 ? 51 LYS A CB   4  
ATOM 4766  C CG   . LYS A 1 51 ? 5.482   -1.046  -10.350 1.00 0.00 ? 51 LYS A CG   4  
ATOM 4767  C CD   . LYS A 1 51 ? 4.958   -1.511  -11.717 1.00 0.00 ? 51 LYS A CD   4  
ATOM 4768  C CE   . LYS A 1 51 ? 6.013   -1.289  -12.812 1.00 0.00 ? 51 LYS A CE   4  
ATOM 4769  N NZ   . LYS A 1 51 ? 7.281   -1.968  -12.486 1.00 0.00 ? 51 LYS A NZ   4  
ATOM 4770  H H    . LYS A 1 51 ? 6.264   2.882   -9.927  1.00 0.00 ? 51 LYS A H    4  
ATOM 4771  H HA   . LYS A 1 51 ? 5.055   0.870   -8.452  1.00 0.00 ? 51 LYS A HA   4  
ATOM 4772  H HB2  . LYS A 1 51 ? 5.045   0.986   -10.895 1.00 0.00 ? 51 LYS A HB2  4  
ATOM 4773  H HB3  . LYS A 1 51 ? 6.770   0.583   -10.949 1.00 0.00 ? 51 LYS A HB3  4  
ATOM 4774  H HG2  . LYS A 1 51 ? 6.365   -1.625  -10.078 1.00 0.00 ? 51 LYS A HG2  4  
ATOM 4775  H HG3  . LYS A 1 51 ? 4.706   -1.204  -9.599  1.00 0.00 ? 51 LYS A HG3  4  
ATOM 4776  H HD2  . LYS A 1 51 ? 4.712   -2.573  -11.665 1.00 0.00 ? 51 LYS A HD2  4  
ATOM 4777  H HD3  . LYS A 1 51 ? 4.058   -0.948  -11.968 1.00 0.00 ? 51 LYS A HD3  4  
ATOM 4778  H HE2  . LYS A 1 51 ? 5.633   -1.684  -13.755 1.00 0.00 ? 51 LYS A HE2  4  
ATOM 4779  H HE3  . LYS A 1 51 ? 6.197   -0.220  -12.925 1.00 0.00 ? 51 LYS A HE3  4  
ATOM 4780  H HZ1  . LYS A 1 51 ? 7.928   -1.859  -13.255 1.00 0.00 ? 51 LYS A HZ1  4  
ATOM 4781  H HZ2  . LYS A 1 51 ? 7.680   -1.559  -11.653 1.00 0.00 ? 51 LYS A HZ2  4  
ATOM 4782  H HZ3  . LYS A 1 51 ? 7.108   -2.951  -12.329 1.00 0.00 ? 51 LYS A HZ3  4  
ATOM 4783  N N    . GLN A 1 52 ? 8.348   0.450   -8.639  1.00 0.00 ? 52 GLN A N    4  
ATOM 4784  C CA   . GLN A 1 52 ? 9.488   -0.245  -8.059  1.00 0.00 ? 52 GLN A CA   4  
ATOM 4785  C C    . GLN A 1 52 ? 9.597   0.070   -6.570  1.00 0.00 ? 52 GLN A C    4  
ATOM 4786  O O    . GLN A 1 52 ? 9.666   -0.842  -5.751  1.00 0.00 ? 52 GLN A O    4  
ATOM 4787  C CB   . GLN A 1 52 ? 10.767  0.169   -8.800  1.00 0.00 ? 52 GLN A CB   4  
ATOM 4788  C CG   . GLN A 1 52 ? 11.952  -0.681  -8.327  1.00 0.00 ? 52 GLN A CG   4  
ATOM 4789  C CD   . GLN A 1 52 ? 11.797  -2.132  -8.768  1.00 0.00 ? 52 GLN A CD   4  
ATOM 4790  O OE1  . GLN A 1 52 ? 11.469  -2.997  -7.961  1.00 0.00 ? 52 GLN A OE1  4  
ATOM 4791  N NE2  . GLN A 1 52 ? 12.031  -2.398  -10.053 1.00 0.00 ? 52 GLN A NE2  4  
ATOM 4792  H H    . GLN A 1 52 ? 8.517   1.134   -9.367  1.00 0.00 ? 52 GLN A H    4  
ATOM 4793  H HA   . GLN A 1 52 ? 9.340   -1.319  -8.182  1.00 0.00 ? 52 GLN A HA   4  
ATOM 4794  H HB2  . GLN A 1 52 ? 10.628  0.022   -9.871  1.00 0.00 ? 52 GLN A HB2  4  
ATOM 4795  H HB3  . GLN A 1 52 ? 10.977  1.222   -8.604  1.00 0.00 ? 52 GLN A HB3  4  
ATOM 4796  H HG2  . GLN A 1 52 ? 12.873  -0.277  -8.751  1.00 0.00 ? 52 GLN A HG2  4  
ATOM 4797  H HG3  . GLN A 1 52 ? 12.016  -0.640  -7.239  1.00 0.00 ? 52 GLN A HG3  4  
ATOM 4798  H HE21 . GLN A 1 52 ? 12.292  -1.654  -10.682 1.00 0.00 ? 52 GLN A HE21 4  
ATOM 4799  H HE22 . GLN A 1 52 ? 11.946  -3.344  -10.394 1.00 0.00 ? 52 GLN A HE22 4  
ATOM 4800  N N    . TRP A 1 53 ? 9.615   1.360   -6.224  1.00 0.00 ? 53 TRP A N    4  
ATOM 4801  C CA   . TRP A 1 53 ? 9.735   1.792   -4.839  1.00 0.00 ? 53 TRP A CA   4  
ATOM 4802  C C    . TRP A 1 53 ? 8.649   1.151   -3.979  1.00 0.00 ? 53 TRP A C    4  
ATOM 4803  O O    . TRP A 1 53 ? 8.941   0.605   -2.923  1.00 0.00 ? 53 TRP A O    4  
ATOM 4804  C CB   . TRP A 1 53 ? 9.631   3.314   -4.785  1.00 0.00 ? 53 TRP A CB   4  
ATOM 4805  C CG   . TRP A 1 53 ? 9.347   3.871   -3.428  1.00 0.00 ? 53 TRP A CG   4  
ATOM 4806  C CD1  . TRP A 1 53 ? 10.160  3.796   -2.361  1.00 0.00 ? 53 TRP A CD1  4  
ATOM 4807  C CD2  . TRP A 1 53 ? 8.166   4.590   -2.964  1.00 0.00 ? 53 TRP A CD2  4  
ATOM 4808  N NE1  . TRP A 1 53 ? 9.600   4.419   -1.275  1.00 0.00 ? 53 TRP A NE1  4  
ATOM 4809  C CE2  . TRP A 1 53 ? 8.359   4.935   -1.590  1.00 0.00 ? 53 TRP A CE2  4  
ATOM 4810  C CE3  . TRP A 1 53 ? 6.947   4.993   -3.559  1.00 0.00 ? 53 TRP A CE3  4  
ATOM 4811  C CZ2  . TRP A 1 53 ? 7.406   5.643   -0.856  1.00 0.00 ? 53 TRP A CZ2  4  
ATOM 4812  C CZ3  . TRP A 1 53 ? 5.982   5.701   -2.821  1.00 0.00 ? 53 TRP A CZ3  4  
ATOM 4813  C CH2  . TRP A 1 53 ? 6.214   6.032   -1.477  1.00 0.00 ? 53 TRP A CH2  4  
ATOM 4814  H H    . TRP A 1 53 ? 9.549   2.070   -6.943  1.00 0.00 ? 53 TRP A H    4  
ATOM 4815  H HA   . TRP A 1 53 ? 10.711  1.490   -4.457  1.00 0.00 ? 53 TRP A HA   4  
ATOM 4816  H HB2  . TRP A 1 53 ? 10.570  3.737   -5.144  1.00 0.00 ? 53 TRP A HB2  4  
ATOM 4817  H HB3  . TRP A 1 53 ? 8.833   3.628   -5.456  1.00 0.00 ? 53 TRP A HB3  4  
ATOM 4818  H HD1  . TRP A 1 53 ? 11.125  3.305   -2.354  1.00 0.00 ? 53 TRP A HD1  4  
ATOM 4819  H HE1  . TRP A 1 53 ? 10.025  4.497   -0.355  1.00 0.00 ? 53 TRP A HE1  4  
ATOM 4820  H HE3  . TRP A 1 53 ? 6.753   4.754   -4.590  1.00 0.00 ? 53 TRP A HE3  4  
ATOM 4821  H HZ2  . TRP A 1 53 ? 7.586   5.888   0.180   1.00 0.00 ? 53 TRP A HZ2  4  
ATOM 4822  H HZ3  . TRP A 1 53 ? 5.058   5.997   -3.295  1.00 0.00 ? 53 TRP A HZ3  4  
ATOM 4823  H HH2  . TRP A 1 53 ? 5.477   6.592   -0.927  1.00 0.00 ? 53 TRP A HH2  4  
ATOM 4824  N N    . LEU A 1 54 ? 7.396   1.221   -4.428  1.00 0.00 ? 54 LEU A N    4  
ATOM 4825  C CA   . LEU A 1 54 ? 6.289   0.651   -3.683  1.00 0.00 ? 54 LEU A CA   4  
ATOM 4826  C C    . LEU A 1 54 ? 6.551   -0.829  -3.425  1.00 0.00 ? 54 LEU A C    4  
ATOM 4827  O O    . LEU A 1 54 ? 6.471   -1.293  -2.290  1.00 0.00 ? 54 LEU A O    4  
ATOM 4828  C CB   . LEU A 1 54 ? 4.981   0.823   -4.469  1.00 0.00 ? 54 LEU A CB   4  
ATOM 4829  C CG   . LEU A 1 54 ? 4.584   2.306   -4.559  1.00 0.00 ? 54 LEU A CG   4  
ATOM 4830  C CD1  . LEU A 1 54 ? 3.507   2.472   -5.634  1.00 0.00 ? 54 LEU A CD1  4  
ATOM 4831  C CD2  . LEU A 1 54 ? 4.034   2.794   -3.216  1.00 0.00 ? 54 LEU A CD2  4  
ATOM 4832  H H    . LEU A 1 54 ? 7.201   1.679   -5.306  1.00 0.00 ? 54 LEU A H    4  
ATOM 4833  H HA   . LEU A 1 54 ? 6.205   1.163   -2.737  1.00 0.00 ? 54 LEU A HA   4  
ATOM 4834  H HB2  . LEU A 1 54 ? 5.113   0.425   -5.474  1.00 0.00 ? 54 LEU A HB2  4  
ATOM 4835  H HB3  . LEU A 1 54 ? 4.187   0.268   -3.970  1.00 0.00 ? 54 LEU A HB3  4  
ATOM 4836  H HG   . LEU A 1 54 ? 5.452   2.900   -4.829  1.00 0.00 ? 54 LEU A HG   4  
ATOM 4837  H HD11 . LEU A 1 54 ? 3.889   2.109   -6.588  1.00 0.00 ? 54 LEU A HD11 4  
ATOM 4838  H HD12 . LEU A 1 54 ? 3.244   3.526   -5.726  1.00 0.00 ? 54 LEU A HD12 4  
ATOM 4839  H HD13 . LEU A 1 54 ? 2.622   1.899   -5.355  1.00 0.00 ? 54 LEU A HD13 4  
ATOM 4840  H HD21 . LEU A 1 54 ? 3.534   3.753   -3.354  1.00 0.00 ? 54 LEU A HD21 4  
ATOM 4841  H HD22 . LEU A 1 54 ? 3.321   2.067   -2.825  1.00 0.00 ? 54 LEU A HD22 4  
ATOM 4842  H HD23 . LEU A 1 54 ? 4.851   2.915   -2.510  1.00 0.00 ? 54 LEU A HD23 4  
ATOM 4843  N N    . MET A 1 55 ? 6.854   -1.561  -4.492  1.00 0.00 ? 55 MET A N    4  
ATOM 4844  C CA   . MET A 1 55 ? 7.050   -2.996  -4.431  1.00 0.00 ? 55 MET A CA   4  
ATOM 4845  C C    . MET A 1 55 ? 8.245   -3.392  -3.548  1.00 0.00 ? 55 MET A C    4  
ATOM 4846  O O    . MET A 1 55 ? 8.156   -4.380  -2.819  1.00 0.00 ? 55 MET A O    4  
ATOM 4847  C CB   . MET A 1 55 ? 7.245   -3.506  -5.867  1.00 0.00 ? 55 MET A CB   4  
ATOM 4848  C CG   . MET A 1 55 ? 7.143   -5.033  -5.909  1.00 0.00 ? 55 MET A CG   4  
ATOM 4849  S SD   . MET A 1 55 ? 7.201   -5.732  -7.580  1.00 0.00 ? 55 MET A SD   4  
ATOM 4850  C CE   . MET A 1 55 ? 8.865   -5.212  -8.069  1.00 0.00 ? 55 MET A CE   4  
ATOM 4851  H H    . MET A 1 55 ? 6.937   -1.110  -5.397  1.00 0.00 ? 55 MET A H    4  
ATOM 4852  H HA   . MET A 1 55 ? 6.148   -3.446  -4.017  1.00 0.00 ? 55 MET A HA   4  
ATOM 4853  H HB2  . MET A 1 55 ? 6.471   -3.081  -6.508  1.00 0.00 ? 55 MET A HB2  4  
ATOM 4854  H HB3  . MET A 1 55 ? 8.223   -3.197  -6.229  1.00 0.00 ? 55 MET A HB3  4  
ATOM 4855  H HG2  . MET A 1 55 ? 7.961   -5.456  -5.327  1.00 0.00 ? 55 MET A HG2  4  
ATOM 4856  H HG3  . MET A 1 55 ? 6.200   -5.328  -5.450  1.00 0.00 ? 55 MET A HG3  4  
ATOM 4857  H HE1  . MET A 1 55 ? 8.903   -4.126  -8.137  1.00 0.00 ? 55 MET A HE1  4  
ATOM 4858  H HE2  . MET A 1 55 ? 9.109   -5.643  -9.039  1.00 0.00 ? 55 MET A HE2  4  
ATOM 4859  H HE3  . MET A 1 55 ? 9.587   -5.555  -7.328  1.00 0.00 ? 55 MET A HE3  4  
ATOM 4860  N N    . THR A 1 56 ? 9.366   -2.653  -3.624  1.00 0.00 ? 56 THR A N    4  
ATOM 4861  C CA   . THR A 1 56 ? 10.591  -3.032  -2.909  1.00 0.00 ? 56 THR A CA   4  
ATOM 4862  C C    . THR A 1 56 ? 10.982  -2.031  -1.813  1.00 0.00 ? 56 THR A C    4  
ATOM 4863  O O    . THR A 1 56 ? 12.163  -1.927  -1.485  1.00 0.00 ? 56 THR A O    4  
ATOM 4864  C CB   . THR A 1 56 ? 11.732  -3.175  -3.927  1.00 0.00 ? 56 THR A CB   4  
ATOM 4865  O OG1  . THR A 1 56 ? 11.945  -1.943  -4.585  1.00 0.00 ? 56 THR A OG1  4  
ATOM 4866  C CG2  . THR A 1 56 ? 11.376  -4.247  -4.961  1.00 0.00 ? 56 THR A CG2  4  
ATOM 4867  H H    . THR A 1 56 ? 9.385   -1.825  -4.204  1.00 0.00 ? 56 THR A H    4  
ATOM 4868  H HA   . THR A 1 56 ? 10.435  -4.001  -2.438  1.00 0.00 ? 56 THR A HA   4  
ATOM 4869  H HB   . THR A 1 56 ? 12.645  -3.467  -3.408  1.00 0.00 ? 56 THR A HB   4  
ATOM 4870  H HG1  . THR A 1 56 ? 11.156  -1.726  -5.091  1.00 0.00 ? 56 THR A HG1  4  
ATOM 4871  H HG21 . THR A 1 56 ? 10.519  -3.919  -5.549  1.00 0.00 ? 56 THR A HG21 4  
ATOM 4872  H HG22 . THR A 1 56 ? 11.132  -5.178  -4.450  1.00 0.00 ? 56 THR A HG22 4  
ATOM 4873  H HG23 . THR A 1 56 ? 12.227  -4.409  -5.624  1.00 0.00 ? 56 THR A HG23 4  
ATOM 4874  N N    . GLU A 1 57 ? 10.019  -1.306  -1.227  1.00 0.00 ? 57 GLU A N    4  
ATOM 4875  C CA   . GLU A 1 57 ? 10.335  -0.376  -0.143  1.00 0.00 ? 57 GLU A CA   4  
ATOM 4876  C C    . GLU A 1 57 ? 9.074   -0.008  0.640   1.00 0.00 ? 57 GLU A C    4  
ATOM 4877  O O    . GLU A 1 57 ? 8.946   -0.352  1.820   1.00 0.00 ? 57 GLU A O    4  
ATOM 4878  C CB   . GLU A 1 57 ? 11.019  0.882   -0.710  1.00 0.00 ? 57 GLU A CB   4  
ATOM 4879  C CG   . GLU A 1 57 ? 11.783  1.622   0.404   1.00 0.00 ? 57 GLU A CG   4  
ATOM 4880  C CD   . GLU A 1 57 ? 10.985  2.809   0.939   1.00 0.00 ? 57 GLU A CD   4  
ATOM 4881  O OE1  . GLU A 1 57 ? 9.940   2.558   1.570   1.00 0.00 ? 57 GLU A OE1  4  
ATOM 4882  O OE2  . GLU A 1 57 ? 11.437  3.951   0.703   1.00 0.00 ? 57 GLU A OE2  4  
ATOM 4883  H H    . GLU A 1 57 ? 9.058   -1.401  -1.526  1.00 0.00 ? 57 GLU A H    4  
ATOM 4884  H HA   . GLU A 1 57 ? 11.030  -0.861  0.533   1.00 0.00 ? 57 GLU A HA   4  
ATOM 4885  H HB2  . GLU A 1 57 ? 11.722  0.589   -1.489  1.00 0.00 ? 57 GLU A HB2  4  
ATOM 4886  H HB3  . GLU A 1 57 ? 10.272  1.543   -1.134  1.00 0.00 ? 57 GLU A HB3  4  
ATOM 4887  H HG2  . GLU A 1 57 ? 11.990  0.934   1.223   1.00 0.00 ? 57 GLU A HG2  4  
ATOM 4888  H HG3  . GLU A 1 57 ? 12.728  1.985   0.001   1.00 0.00 ? 57 GLU A HG3  4  
ATOM 4889  N N    . ALA A 1 58 ? 8.155   0.706   -0.011  1.00 0.00 ? 58 ALA A N    4  
ATOM 4890  C CA   . ALA A 1 58 ? 6.961   1.225   0.641   1.00 0.00 ? 58 ALA A CA   4  
ATOM 4891  C C    . ALA A 1 58 ? 6.032   0.121   1.142   1.00 0.00 ? 58 ALA A C    4  
ATOM 4892  O O    . ALA A 1 58 ? 5.195   0.384   1.998   1.00 0.00 ? 58 ALA A O    4  
ATOM 4893  C CB   . ALA A 1 58 ? 6.212   2.112   -0.343  1.00 0.00 ? 58 ALA A CB   4  
ATOM 4894  H H    . ALA A 1 58 ? 8.297   0.920   -0.990  1.00 0.00 ? 58 ALA A H    4  
ATOM 4895  H HA   . ALA A 1 58 ? 7.268   1.834   1.491   1.00 0.00 ? 58 ALA A HA   4  
ATOM 4896  H HB1  . ALA A 1 58 ? 5.728   2.915   0.197   1.00 0.00 ? 58 ALA A HB1  4  
ATOM 4897  H HB2  . ALA A 1 58 ? 6.910   2.530   -1.068  1.00 0.00 ? 58 ALA A HB2  4  
ATOM 4898  H HB3  . ALA A 1 58 ? 5.458   1.519   -0.860  1.00 0.00 ? 58 ALA A HB3  4  
ATOM 4899  N N    . LEU A 1 59 ? 6.156   -1.100  0.609   1.00 0.00 ? 59 LEU A N    4  
ATOM 4900  C CA   . LEU A 1 59 ? 5.274   -2.198  0.996   1.00 0.00 ? 59 LEU A CA   4  
ATOM 4901  C C    . LEU A 1 59 ? 6.069   -3.376  1.566   1.00 0.00 ? 59 LEU A C    4  
ATOM 4902  O O    . LEU A 1 59 ? 5.573   -4.499  1.578   1.00 0.00 ? 59 LEU A O    4  
ATOM 4903  C CB   . LEU A 1 59 ? 4.456   -2.636  -0.224  1.00 0.00 ? 59 LEU A CB   4  
ATOM 4904  C CG   . LEU A 1 59 ? 3.700   -1.440  -0.832  1.00 0.00 ? 59 LEU A CG   4  
ATOM 4905  C CD1  . LEU A 1 59 ? 3.025   -1.887  -2.119  1.00 0.00 ? 59 LEU A CD1  4  
ATOM 4906  C CD2  . LEU A 1 59 ? 2.631   -0.926  0.135   1.00 0.00 ? 59 LEU A CD2  4  
ATOM 4907  H H    . LEU A 1 59 ? 6.864   -1.275  -0.091  1.00 0.00 ? 59 LEU A H    4  
ATOM 4908  H HA   . LEU A 1 59 ? 4.588   -1.852  1.766   1.00 0.00 ? 59 LEU A HA   4  
ATOM 4909  H HB2  . LEU A 1 59 ? 5.127   -3.056  -0.974  1.00 0.00 ? 59 LEU A HB2  4  
ATOM 4910  H HB3  . LEU A 1 59 ? 3.738   -3.396  0.076   1.00 0.00 ? 59 LEU A HB3  4  
ATOM 4911  H HG   . LEU A 1 59 ? 4.398   -0.637  -1.057  1.00 0.00 ? 59 LEU A HG   4  
ATOM 4912  H HD11 . LEU A 1 59 ? 2.321   -2.687  -1.897  1.00 0.00 ? 59 LEU A HD11 4  
ATOM 4913  H HD12 . LEU A 1 59 ? 3.779   -2.249  -2.816  1.00 0.00 ? 59 LEU A HD12 4  
ATOM 4914  H HD13 . LEU A 1 59 ? 2.494   -1.045  -2.561  1.00 0.00 ? 59 LEU A HD13 4  
ATOM 4915  H HD21 . LEU A 1 59 ? 3.105   -0.455  0.989   1.00 0.00 ? 59 LEU A HD21 4  
ATOM 4916  H HD22 . LEU A 1 59 ? 2.003   -0.195  -0.377  1.00 0.00 ? 59 LEU A HD22 4  
ATOM 4917  H HD23 . LEU A 1 59 ? 2.014   -1.758  0.473   1.00 0.00 ? 59 LEU A HD23 4  
ATOM 4918  N N    . VAL A 1 60 ? 7.295   -3.123  2.050   1.00 0.00 ? 60 VAL A N    4  
ATOM 4919  C CA   . VAL A 1 60 ? 8.118   -4.170  2.659   1.00 0.00 ? 60 VAL A CA   4  
ATOM 4920  C C    . VAL A 1 60 ? 8.706   -3.658  3.974   1.00 0.00 ? 60 VAL A C    4  
ATOM 4921  O O    . VAL A 1 60 ? 8.729   -4.388  4.962   1.00 0.00 ? 60 VAL A O    4  
ATOM 4922  C CB   . VAL A 1 60 ? 9.221   -4.637  1.687   1.00 0.00 ? 60 VAL A CB   4  
ATOM 4923  C CG1  . VAL A 1 60 ? 8.583   -5.287  0.457   1.00 0.00 ? 60 VAL A CG1  4  
ATOM 4924  C CG2  . VAL A 1 60 ? 10.089  -3.462  1.240   1.00 0.00 ? 60 VAL A CG2  4  
ATOM 4925  H H    . VAL A 1 60 ? 7.667   -2.184  2.006   1.00 0.00 ? 60 VAL A H    4  
ATOM 4926  H HA   . VAL A 1 60 ? 7.482   -5.025  2.887   1.00 0.00 ? 60 VAL A HA   4  
ATOM 4927  H HB   . VAL A 1 60 ? 9.850   -5.372  2.191   1.00 0.00 ? 60 VAL A HB   4  
ATOM 4928  H HG11 . VAL A 1 60 ? 9.365   -5.694  -0.185  1.00 0.00 ? 60 VAL A HG11 4  
ATOM 4929  H HG12 . VAL A 1 60 ? 8.014   -4.541  -0.098  1.00 0.00 ? 60 VAL A HG12 4  
ATOM 4930  H HG13 . VAL A 1 60 ? 7.919   -6.091  0.772   1.00 0.00 ? 60 VAL A HG13 4  
ATOM 4931  H HG21 . VAL A 1 60 ? 10.783  -3.797  0.469   1.00 0.00 ? 60 VAL A HG21 4  
ATOM 4932  H HG22 . VAL A 1 60 ? 10.654  -3.075  2.087   1.00 0.00 ? 60 VAL A HG22 4  
ATOM 4933  H HG23 . VAL A 1 60 ? 9.455   -2.679  0.836   1.00 0.00 ? 60 VAL A HG23 4  
ATOM 4934  N N    . ASN A 1 61 ? 9.169   -2.400  3.991   1.00 0.00 ? 61 ASN A N    4  
ATOM 4935  C CA   . ASN A 1 61 ? 9.716   -1.800  5.202   1.00 0.00 ? 61 ASN A CA   4  
ATOM 4936  C C    . ASN A 1 61 ? 8.570   -1.219  6.032   1.00 0.00 ? 61 ASN A C    4  
ATOM 4937  O O    . ASN A 1 61 ? 8.650   -1.178  7.257   1.00 0.00 ? 61 ASN A O    4  
ATOM 4938  C CB   . ASN A 1 61 ? 10.754  -0.722  4.829   1.00 0.00 ? 61 ASN A CB   4  
ATOM 4939  C CG   . ASN A 1 61 ? 10.229  0.691   5.085   1.00 0.00 ? 61 ASN A CG   4  
ATOM 4940  O OD1  . ASN A 1 61 ? 10.428  1.243   6.164   1.00 0.00 ? 61 ASN A OD1  4  
ATOM 4941  N ND2  . ASN A 1 61 ? 9.562   1.275   4.093   1.00 0.00 ? 61 ASN A ND2  4  
ATOM 4942  H H    . ASN A 1 61 ? 9.138   -1.840  3.149   1.00 0.00 ? 61 ASN A H    4  
ATOM 4943  H HA   . ASN A 1 61 ? 10.215  -2.574  5.786   1.00 0.00 ? 61 ASN A HA   4  
ATOM 4944  H HB2  . ASN A 1 61 ? 11.651  -0.877  5.427   1.00 0.00 ? 61 ASN A HB2  4  
ATOM 4945  H HB3  . ASN A 1 61 ? 11.013  -0.820  3.774   1.00 0.00 ? 61 ASN A HB3  4  
ATOM 4946  H HD21 . ASN A 1 61 ? 9.437   0.791   3.210   1.00 0.00 ? 61 ASN A HD21 4  
ATOM 4947  H HD22 . ASN A 1 61 ? 9.185   2.202   4.217   1.00 0.00 ? 61 ASN A HD22 4  
ATOM 4948  N N    . ASN A 1 62 ? 7.506   -0.771  5.348   1.00 0.00 ? 62 ASN A N    4  
ATOM 4949  C CA   . ASN A 1 62 ? 6.339   -0.189  5.991   1.00 0.00 ? 62 ASN A CA   4  
ATOM 4950  C C    . ASN A 1 62 ? 5.737   -1.190  6.992   1.00 0.00 ? 62 ASN A C    4  
ATOM 4951  O O    . ASN A 1 62 ? 5.255   -2.243  6.583   1.00 0.00 ? 62 ASN A O    4  
ATOM 4952  C CB   . ASN A 1 62 ? 5.329   0.182   4.898   1.00 0.00 ? 62 ASN A CB   4  
ATOM 4953  C CG   . ASN A 1 62 ? 4.096   0.871   5.471   1.00 0.00 ? 62 ASN A CG   4  
ATOM 4954  O OD1  . ASN A 1 62 ? 3.939   0.980   6.684   1.00 0.00 ? 62 ASN A OD1  4  
ATOM 4955  N ND2  . ASN A 1 62 ? 3.220   1.341   4.588   1.00 0.00 ? 62 ASN A ND2  4  
ATOM 4956  H H    . ASN A 1 62 ? 7.506   -0.836  4.341   1.00 0.00 ? 62 ASN A H    4  
ATOM 4957  H HA   . ASN A 1 62 ? 6.641   0.718   6.508   1.00 0.00 ? 62 ASN A HA   4  
ATOM 4958  H HB2  . ASN A 1 62 ? 5.811   0.858   4.193   1.00 0.00 ? 62 ASN A HB2  4  
ATOM 4959  H HB3  . ASN A 1 62 ? 5.020   -0.723  4.365   1.00 0.00 ? 62 ASN A HB3  4  
ATOM 4960  H HD21 . ASN A 1 62 ? 3.393   1.231   3.598   1.00 0.00 ? 62 ASN A HD21 4  
ATOM 4961  H HD22 . ASN A 1 62 ? 2.384   1.806   4.908   1.00 0.00 ? 62 ASN A HD22 4  
ATOM 4962  N N    . PRO A 1 63 ? 5.761   -0.869  8.311   1.00 0.00 ? 63 PRO A N    4  
ATOM 4963  C CA   . PRO A 1 63 ? 5.242   -1.754  9.340   1.00 0.00 ? 63 PRO A CA   4  
ATOM 4964  C C    . PRO A 1 63 ? 3.738   -1.995  9.177   1.00 0.00 ? 63 PRO A C    4  
ATOM 4965  O O    . PRO A 1 63 ? 3.217   -2.984  9.684   1.00 0.00 ? 63 PRO A O    4  
ATOM 4966  C CB   . PRO A 1 63 ? 5.546   -1.070  10.677  1.00 0.00 ? 63 PRO A CB   4  
ATOM 4967  C CG   . PRO A 1 63 ? 6.166   0.295   10.353  1.00 0.00 ? 63 PRO A CG   4  
ATOM 4968  C CD   . PRO A 1 63 ? 6.309   0.371   8.833   1.00 0.00 ? 63 PRO A CD   4  
ATOM 4969  H HA   . PRO A 1 63 ? 5.768   -2.710  9.295   1.00 0.00 ? 63 PRO A HA   4  
ATOM 4970  H HB2  . PRO A 1 63 ? 4.627   -0.935  11.248  1.00 0.00 ? 63 PRO A HB2  4  
ATOM 4971  H HB3  . PRO A 1 63 ? 6.254   -1.672  11.248  1.00 0.00 ? 63 PRO A HB3  4  
ATOM 4972  H HG2  . PRO A 1 63 ? 5.513   1.094   10.706  1.00 0.00 ? 63 PRO A HG2  4  
ATOM 4973  H HG3  . PRO A 1 63 ? 7.146   0.381   10.824  1.00 0.00 ? 63 PRO A HG3  4  
ATOM 4974  H HD2  . PRO A 1 63 ? 5.747   1.223   8.451   1.00 0.00 ? 63 PRO A HD2  4  
ATOM 4975  H HD3  . PRO A 1 63 ? 7.360   0.463   8.565   1.00 0.00 ? 63 PRO A HD3  4  
ATOM 4976  N N    . LYS A 1 64 ? 3.040   -1.090  8.474   1.00 0.00 ? 64 LYS A N    4  
ATOM 4977  C CA   . LYS A 1 64 ? 1.603   -1.219  8.264   1.00 0.00 ? 64 LYS A CA   4  
ATOM 4978  C C    . LYS A 1 64 ? 1.308   -2.194  7.120   1.00 0.00 ? 64 LYS A C    4  
ATOM 4979  O O    . LYS A 1 64 ? 0.143   -2.410  6.793   1.00 0.00 ? 64 LYS A O    4  
ATOM 4980  C CB   . LYS A 1 64 ? 1.000   0.159   7.948   1.00 0.00 ? 64 LYS A CB   4  
ATOM 4981  C CG   . LYS A 1 64 ? 1.342   1.168   9.052   1.00 0.00 ? 64 LYS A CG   4  
ATOM 4982  C CD   . LYS A 1 64 ? 0.840   0.657   10.407  1.00 0.00 ? 64 LYS A CD   4  
ATOM 4983  C CE   . LYS A 1 64 ? 0.771   1.819   11.399  1.00 0.00 ? 64 LYS A CE   4  
ATOM 4984  N NZ   . LYS A 1 64 ? 0.475   1.338   12.759  1.00 0.00 ? 64 LYS A NZ   4  
ATOM 4985  H H    . LYS A 1 64 ? 3.513   -0.290  8.074   1.00 0.00 ? 64 LYS A H    4  
ATOM 4986  H HA   . LYS A 1 64 ? 1.143   -1.604  9.172   1.00 0.00 ? 64 LYS A HA   4  
ATOM 4987  H HB2  . LYS A 1 64 ? 1.400   0.517   6.999   1.00 0.00 ? 64 LYS A HB2  4  
ATOM 4988  H HB3  . LYS A 1 64 ? -0.083  0.067   7.868   1.00 0.00 ? 64 LYS A HB3  4  
ATOM 4989  H HG2  . LYS A 1 64 ? 2.420   1.316   9.096   1.00 0.00 ? 64 LYS A HG2  4  
ATOM 4990  H HG3  . LYS A 1 64 ? 0.859   2.120   8.826   1.00 0.00 ? 64 LYS A HG3  4  
ATOM 4991  H HD2  . LYS A 1 64 ? -0.154  0.222   10.288  1.00 0.00 ? 64 LYS A HD2  4  
ATOM 4992  H HD3  . LYS A 1 64 ? 1.526   -0.102  10.785  1.00 0.00 ? 64 LYS A HD3  4  
ATOM 4993  H HE2  . LYS A 1 64 ? 1.728   2.343   11.406  1.00 0.00 ? 64 LYS A HE2  4  
ATOM 4994  H HE3  . LYS A 1 64 ? -0.013  2.511   11.086  1.00 0.00 ? 64 LYS A HE3  4  
ATOM 4995  H HZ1  . LYS A 1 64 ? 1.207   0.710   13.060  1.00 0.00 ? 64 LYS A HZ1  4  
ATOM 4996  H HZ2  . LYS A 1 64 ? 0.425   2.124   13.391  1.00 0.00 ? 64 LYS A HZ2  4  
ATOM 4997  H HZ3  . LYS A 1 64 ? -0.410  0.850   12.759  1.00 0.00 ? 64 LYS A HZ3  4  
ATOM 4998  N N    . ILE A 1 65 ? 2.355   -2.776  6.510   1.00 0.00 ? 65 ILE A N    4  
ATOM 4999  C CA   . ILE A 1 65 ? 2.189   -3.705  5.399   1.00 0.00 ? 65 ILE A CA   4  
ATOM 5000  C C    . ILE A 1 65 ? 2.949   -4.998  5.689   1.00 0.00 ? 65 ILE A C    4  
ATOM 5001  O O    . ILE A 1 65 ? 3.990   -4.979  6.343   1.00 0.00 ? 65 ILE A O    4  
ATOM 5002  C CB   . ILE A 1 65 ? 2.708   -3.054  4.104   1.00 0.00 ? 65 ILE A CB   4  
ATOM 5003  C CG1  . ILE A 1 65 ? 1.989   -1.712  3.835   1.00 0.00 ? 65 ILE A CG1  4  
ATOM 5004  C CG2  . ILE A 1 65 ? 2.491   -4.008  2.922   1.00 0.00 ? 65 ILE A CG2  4  
ATOM 5005  C CD1  . ILE A 1 65 ? 0.537   -1.938  3.396   1.00 0.00 ? 65 ILE A CD1  4  
ATOM 5006  H H    . ILE A 1 65 ? 3.296   -2.570  6.818   1.00 0.00 ? 65 ILE A H    4  
ATOM 5007  H HA   . ILE A 1 65 ? 1.134   -3.940  5.282   1.00 0.00 ? 65 ILE A HA   4  
ATOM 5008  H HB   . ILE A 1 65 ? 3.777   -2.862  4.209   1.00 0.00 ? 65 ILE A HB   4  
ATOM 5009  H HG12 . ILE A 1 65 ? 1.999   -1.107  4.739   1.00 0.00 ? 65 ILE A HG12 4  
ATOM 5010  H HG13 . ILE A 1 65 ? 2.517   -1.178  3.048   1.00 0.00 ? 65 ILE A HG13 4  
ATOM 5011  H HG21 . ILE A 1 65 ? 2.622   -3.465  1.990   1.00 0.00 ? 65 ILE A HG21 4  
ATOM 5012  H HG22 . ILE A 1 65 ? 3.217   -4.819  2.970   1.00 0.00 ? 65 ILE A HG22 4  
ATOM 5013  H HG23 . ILE A 1 65 ? 1.484   -4.421  2.962   1.00 0.00 ? 65 ILE A HG23 4  
ATOM 5014  H HD11 . ILE A 1 65 ? 0.017   -2.538  4.136   1.00 0.00 ? 65 ILE A HD11 4  
ATOM 5015  H HD12 . ILE A 1 65 ? 0.037   -0.973  3.300   1.00 0.00 ? 65 ILE A HD12 4  
ATOM 5016  H HD13 . ILE A 1 65 ? 0.518   -2.448  2.434   1.00 0.00 ? 65 ILE A HD13 4  
ATOM 5017  N N    . GLU A 1 66 ? 2.415   -6.115  5.187   1.00 0.00 ? 66 GLU A N    4  
ATOM 5018  C CA   . GLU A 1 66 ? 3.021   -7.427  5.340   1.00 0.00 ? 66 GLU A CA   4  
ATOM 5019  C C    . GLU A 1 66 ? 2.939   -8.153  3.996   1.00 0.00 ? 66 GLU A C    4  
ATOM 5020  O O    . GLU A 1 66 ? 2.011   -7.913  3.220   1.00 0.00 ? 66 GLU A O    4  
ATOM 5021  C CB   . GLU A 1 66 ? 2.281   -8.197  6.444   1.00 0.00 ? 66 GLU A CB   4  
ATOM 5022  C CG   . GLU A 1 66 ? 2.933   -9.568  6.678   1.00 0.00 ? 66 GLU A CG   4  
ATOM 5023  C CD   . GLU A 1 66 ? 4.404   -9.426  7.048   1.00 0.00 ? 66 GLU A CD   4  
ATOM 5024  O OE1  . GLU A 1 66 ? 4.666   -9.188  8.247   1.00 0.00 ? 66 GLU A OE1  4  
ATOM 5025  O OE2  . GLU A 1 66 ? 5.238   -9.555  6.124   1.00 0.00 ? 66 GLU A OE2  4  
ATOM 5026  H H    . GLU A 1 66 ? 1.551   -6.057  4.669   1.00 0.00 ? 66 GLU A H    4  
ATOM 5027  H HA   . GLU A 1 66 ? 4.068   -7.307  5.618   1.00 0.00 ? 66 GLU A HA   4  
ATOM 5028  H HB2  . GLU A 1 66 ? 2.320   -7.623  7.369   1.00 0.00 ? 66 GLU A HB2  4  
ATOM 5029  H HB3  . GLU A 1 66 ? 1.241   -8.338  6.152   1.00 0.00 ? 66 GLU A HB3  4  
ATOM 5030  H HG2  . GLU A 1 66 ? 2.410   -10.075 7.490   1.00 0.00 ? 66 GLU A HG2  4  
ATOM 5031  H HG3  . GLU A 1 66 ? 2.847   -10.169 5.774   1.00 0.00 ? 66 GLU A HG3  4  
ATOM 5032  N N    . VAL A 1 67 ? 3.911   -9.030  3.720   1.00 0.00 ? 67 VAL A N    4  
ATOM 5033  C CA   . VAL A 1 67 ? 3.965   -9.760  2.460   1.00 0.00 ? 67 VAL A CA   4  
ATOM 5034  C C    . VAL A 1 67 ? 3.482   -11.195 2.670   1.00 0.00 ? 67 VAL A C    4  
ATOM 5035  O O    . VAL A 1 67 ? 4.103   -11.957 3.408   1.00 0.00 ? 67 VAL A O    4  
ATOM 5036  C CB   . VAL A 1 67 ? 5.404   -9.739  1.923   1.00 0.00 ? 67 VAL A CB   4  
ATOM 5037  C CG1  . VAL A 1 67 ? 5.456   -10.414 0.547   1.00 0.00 ? 67 VAL A CG1  4  
ATOM 5038  C CG2  . VAL A 1 67 ? 5.882   -8.289  1.793   1.00 0.00 ? 67 VAL A CG2  4  
ATOM 5039  H H    . VAL A 1 67 ? 4.643   -9.198  4.405   1.00 0.00 ? 67 VAL A H    4  
ATOM 5040  H HA   . VAL A 1 67 ? 3.316   -9.270  1.736   1.00 0.00 ? 67 VAL A HA   4  
ATOM 5041  H HB   . VAL A 1 67 ? 6.059   -10.273 2.613   1.00 0.00 ? 67 VAL A HB   4  
ATOM 5042  H HG11 . VAL A 1 67 ? 6.474   -10.376 0.162   1.00 0.00 ? 67 VAL A HG11 4  
ATOM 5043  H HG12 . VAL A 1 67 ? 5.143   -11.454 0.637   1.00 0.00 ? 67 VAL A HG12 4  
ATOM 5044  H HG13 . VAL A 1 67 ? 4.790   -9.893  -0.140  1.00 0.00 ? 67 VAL A HG13 4  
ATOM 5045  H HG21 . VAL A 1 67 ? 5.157   -7.718  1.214   1.00 0.00 ? 67 VAL A HG21 4  
ATOM 5046  H HG22 . VAL A 1 67 ? 5.984   -7.846  2.783   1.00 0.00 ? 67 VAL A HG22 4  
ATOM 5047  H HG23 . VAL A 1 67 ? 6.846   -8.268  1.287   1.00 0.00 ? 67 VAL A HG23 4  
ATOM 5048  N N    . ILE A 1 68 ? 2.372   -11.559 2.008   1.00 0.00 ? 68 ILE A N    4  
ATOM 5049  C CA   . ILE A 1 68 ? 1.805   -12.901 2.097   1.00 0.00 ? 68 ILE A CA   4  
ATOM 5050  C C    . ILE A 1 68 ? 1.548   -13.419 0.686   1.00 0.00 ? 68 ILE A C    4  
ATOM 5051  O O    . ILE A 1 68 ? 0.976   -12.705 -0.139  1.00 0.00 ? 68 ILE A O    4  
ATOM 5052  C CB   . ILE A 1 68 ? 0.498   -12.869 2.910   1.00 0.00 ? 68 ILE A CB   4  
ATOM 5053  C CG1  . ILE A 1 68 ? 0.785   -12.426 4.354   1.00 0.00 ? 68 ILE A CG1  4  
ATOM 5054  C CG2  . ILE A 1 68 ? -0.134  -14.266 2.929   1.00 0.00 ? 68 ILE A CG2  4  
ATOM 5055  C CD1  . ILE A 1 68 ? 0.272   -11.002 4.568   1.00 0.00 ? 68 ILE A CD1  4  
ATOM 5056  H H    . ILE A 1 68 ? 1.903   -10.884 1.416   1.00 0.00 ? 68 ILE A H    4  
ATOM 5057  H HA   . ILE A 1 68 ? 2.516   -13.563 2.593   1.00 0.00 ? 68 ILE A HA   4  
ATOM 5058  H HB   . ILE A 1 68 ? -0.198  -12.168 2.447   1.00 0.00 ? 68 ILE A HB   4  
ATOM 5059  H HG12 . ILE A 1 68 ? 0.277   -13.095 5.049   1.00 0.00 ? 68 ILE A HG12 4  
ATOM 5060  H HG13 . ILE A 1 68 ? 1.856   -12.457 4.545   1.00 0.00 ? 68 ILE A HG13 4  
ATOM 5061  H HG21 . ILE A 1 68 ? 0.588   -14.988 3.313   1.00 0.00 ? 68 ILE A HG21 4  
ATOM 5062  H HG22 . ILE A 1 68 ? -0.429  -14.549 1.919   1.00 0.00 ? 68 ILE A HG22 4  
ATOM 5063  H HG23 . ILE A 1 68 ? -1.015  -14.258 3.571   1.00 0.00 ? 68 ILE A HG23 4  
ATOM 5064  H HD11 . ILE A 1 68 ? 0.479   -10.692 5.592   1.00 0.00 ? 68 ILE A HD11 4  
ATOM 5065  H HD12 . ILE A 1 68 ? 0.770   -10.326 3.875   1.00 0.00 ? 68 ILE A HD12 4  
ATOM 5066  H HD13 . ILE A 1 68 ? -0.804  -10.976 4.393   1.00 0.00 ? 68 ILE A HD13 4  
ATOM 5067  N N    . ASP A 1 69 ? 1.975   -14.663 0.412   1.00 0.00 ? 69 ASP A N    4  
ATOM 5068  C CA   . ASP A 1 69 ? 1.800   -15.288 -0.899  1.00 0.00 ? 69 ASP A CA   4  
ATOM 5069  C C    . ASP A 1 69 ? 2.453   -14.423 -1.989  1.00 0.00 ? 69 ASP A C    4  
ATOM 5070  O O    . ASP A 1 69 ? 2.039   -14.451 -3.149  1.00 0.00 ? 69 ASP A O    4  
ATOM 5071  C CB   . ASP A 1 69 ? 0.297   -15.499 -1.160  1.00 0.00 ? 69 ASP A CB   4  
ATOM 5072  C CG   . ASP A 1 69 ? 0.053   -16.253 -2.462  1.00 0.00 ? 69 ASP A CG   4  
ATOM 5073  O OD1  . ASP A 1 69 ? 0.706   -17.301 -2.645  1.00 0.00 ? 69 ASP A OD1  4  
ATOM 5074  O OD2  . ASP A 1 69 ? -0.785  -15.760 -3.252  1.00 0.00 ? 69 ASP A OD2  4  
ATOM 5075  H H    . ASP A 1 69 ? 2.437   -15.197 1.134   1.00 0.00 ? 69 ASP A H    4  
ATOM 5076  H HA   . ASP A 1 69 ? 2.292   -16.260 -0.886  1.00 0.00 ? 69 ASP A HA   4  
ATOM 5077  H HB2  . ASP A 1 69 ? -0.130  -16.071 -0.336  1.00 0.00 ? 69 ASP A HB2  4  
ATOM 5078  H HB3  . ASP A 1 69 ? -0.200  -14.531 -1.213  1.00 0.00 ? 69 ASP A HB3  4  
ATOM 5079  N N    . GLY A 1 70 ? 3.478   -13.646 -1.612  1.00 0.00 ? 70 GLY A N    4  
ATOM 5080  C CA   . GLY A 1 70 ? 4.175   -12.774 -2.545  1.00 0.00 ? 70 GLY A CA   4  
ATOM 5081  C C    . GLY A 1 70 ? 3.393   -11.474 -2.769  1.00 0.00 ? 70 GLY A C    4  
ATOM 5082  O O    . GLY A 1 70 ? 3.956   -10.495 -3.256  1.00 0.00 ? 70 GLY A O    4  
ATOM 5083  H H    . GLY A 1 70 ? 3.784   -13.658 -0.651  1.00 0.00 ? 70 GLY A H    4  
ATOM 5084  H HA2  . GLY A 1 70 ? 5.159   -12.534 -2.141  1.00 0.00 ? 70 GLY A HA2  4  
ATOM 5085  H HA3  . GLY A 1 70 ? 4.297   -13.288 -3.500  1.00 0.00 ? 70 GLY A HA3  4  
ATOM 5086  N N    . LYS A 1 71 ? 2.098   -11.463 -2.417  1.00 0.00 ? 71 LYS A N    4  
ATOM 5087  C CA   . LYS A 1 71 ? 1.257   -10.288 -2.587  1.00 0.00 ? 71 LYS A CA   4  
ATOM 5088  C C    . LYS A 1 71 ? 1.404   -9.407  -1.346  1.00 0.00 ? 71 LYS A C    4  
ATOM 5089  O O    . LYS A 1 71 ? 2.158   -9.750  -0.433  1.00 0.00 ? 71 LYS A O    4  
ATOM 5090  C CB   . LYS A 1 71 ? -0.209  -10.702 -2.804  1.00 0.00 ? 71 LYS A CB   4  
ATOM 5091  C CG   . LYS A 1 71 ? -0.313  -12.027 -3.583  1.00 0.00 ? 71 LYS A CG   4  
ATOM 5092  C CD   . LYS A 1 71 ? 0.487   -11.947 -4.890  1.00 0.00 ? 71 LYS A CD   4  
ATOM 5093  C CE   . LYS A 1 71 ? 0.047   -13.065 -5.841  1.00 0.00 ? 71 LYS A CE   4  
ATOM 5094  N NZ   . LYS A 1 71 ? 0.276   -14.396 -5.246  1.00 0.00 ? 71 LYS A NZ   4  
ATOM 5095  H H    . LYS A 1 71 ? 1.681   -12.288 -2.014  1.00 0.00 ? 71 LYS A H    4  
ATOM 5096  H HA   . LYS A 1 71 ? 1.594   -9.727  -3.464  1.00 0.00 ? 71 LYS A HA   4  
ATOM 5097  H HB2  . LYS A 1 71 ? -0.696  -10.816 -1.842  1.00 0.00 ? 71 LYS A HB2  4  
ATOM 5098  H HB3  . LYS A 1 71 ? -0.718  -9.923  -3.366  1.00 0.00 ? 71 LYS A HB3  4  
ATOM 5099  H HG2  . LYS A 1 71 ? 0.066   -12.843 -2.969  1.00 0.00 ? 71 LYS A HG2  4  
ATOM 5100  H HG3  . LYS A 1 71 ? -1.362  -12.217 -3.815  1.00 0.00 ? 71 LYS A HG3  4  
ATOM 5101  H HD2  . LYS A 1 71 ? 0.315   -10.981 -5.360  1.00 0.00 ? 71 LYS A HD2  4  
ATOM 5102  H HD3  . LYS A 1 71 ? 1.549   -12.058 -4.681  1.00 0.00 ? 71 LYS A HD3  4  
ATOM 5103  H HE2  . LYS A 1 71 ? -1.013  -12.951 -6.066  1.00 0.00 ? 71 LYS A HE2  4  
ATOM 5104  H HE3  . LYS A 1 71 ? 0.619   -12.987 -6.767  1.00 0.00 ? 71 LYS A HE3  4  
ATOM 5105  H HZ1  . LYS A 1 71 ? 0.186   -15.107 -5.957  1.00 0.00 ? 71 LYS A HZ1  4  
ATOM 5106  H HZ2  . LYS A 1 71 ? -0.407  -14.568 -4.513  1.00 0.00 ? 71 LYS A HZ2  4  
ATOM 5107  H HZ3  . LYS A 1 71 ? 1.207   -14.435 -4.845  1.00 0.00 ? 71 LYS A HZ3  4  
ATOM 5108  N N    . TYR A 1 72 ? 0.696   -8.273  -1.310  1.00 0.00 ? 72 TYR A N    4  
ATOM 5109  C CA   . TYR A 1 72 ? 0.801   -7.336  -0.200  1.00 0.00 ? 72 TYR A CA   4  
ATOM 5110  C C    . TYR A 1 72 ? -0.527  -7.229  0.536   1.00 0.00 ? 72 TYR A C    4  
ATOM 5111  O O    . TYR A 1 72 ? -1.585  -7.169  -0.086  1.00 0.00 ? 72 TYR A O    4  
ATOM 5112  C CB   . TYR A 1 72 ? 1.249   -5.982  -0.745  1.00 0.00 ? 72 TYR A CB   4  
ATOM 5113  C CG   . TYR A 1 72 ? 2.606   -6.057  -1.411  1.00 0.00 ? 72 TYR A CG   4  
ATOM 5114  C CD1  . TYR A 1 72 ? 3.772   -5.981  -0.632  1.00 0.00 ? 72 TYR A CD1  4  
ATOM 5115  C CD2  . TYR A 1 72 ? 2.701   -6.238  -2.802  1.00 0.00 ? 72 TYR A CD2  4  
ATOM 5116  C CE1  . TYR A 1 72 ? 5.032   -6.080  -1.241  1.00 0.00 ? 72 TYR A CE1  4  
ATOM 5117  C CE2  . TYR A 1 72 ? 3.964   -6.342  -3.410  1.00 0.00 ? 72 TYR A CE2  4  
ATOM 5118  C CZ   . TYR A 1 72 ? 5.129   -6.263  -2.629  1.00 0.00 ? 72 TYR A CZ   4  
ATOM 5119  O OH   . TYR A 1 72 ? 6.352   -6.369  -3.219  1.00 0.00 ? 72 TYR A OH   4  
ATOM 5120  H H    . TYR A 1 72 ? 0.069   -8.044  -2.073  1.00 0.00 ? 72 TYR A H    4  
ATOM 5121  H HA   . TYR A 1 72 ? 1.557   -7.694  0.500   1.00 0.00 ? 72 TYR A HA   4  
ATOM 5122  H HB2  . TYR A 1 72 ? 0.515   -5.633  -1.472  1.00 0.00 ? 72 TYR A HB2  4  
ATOM 5123  H HB3  . TYR A 1 72 ? 1.298   -5.268  0.078   1.00 0.00 ? 72 TYR A HB3  4  
ATOM 5124  H HD1  . TYR A 1 72 ? 3.698   -5.850  0.438   1.00 0.00 ? 72 TYR A HD1  4  
ATOM 5125  H HD2  . TYR A 1 72 ? 1.806   -6.305  -3.402  1.00 0.00 ? 72 TYR A HD2  4  
ATOM 5126  H HE1  . TYR A 1 72 ? 5.928   -6.022  -0.641  1.00 0.00 ? 72 TYR A HE1  4  
ATOM 5127  H HE2  . TYR A 1 72 ? 4.038   -6.486  -4.478  1.00 0.00 ? 72 TYR A HE2  4  
ATOM 5128  H HH   . TYR A 1 72 ? 7.056   -5.958  -2.704  1.00 0.00 ? 72 TYR A HH   4  
ATOM 5129  N N    . ALA A 1 73 ? -0.459  -7.207  1.871   1.00 0.00 ? 73 ALA A N    4  
ATOM 5130  C CA   . ALA A 1 73 ? -1.636  -7.112  2.717   1.00 0.00 ? 73 ALA A CA   4  
ATOM 5131  C C    . ALA A 1 73 ? -1.364  -6.135  3.851   1.00 0.00 ? 73 ALA A C    4  
ATOM 5132  O O    . ALA A 1 73 ? -0.224  -5.979  4.274   1.00 0.00 ? 73 ALA A O    4  
ATOM 5133  C CB   . ALA A 1 73 ? -1.961  -8.493  3.280   1.00 0.00 ? 73 ALA A CB   4  
ATOM 5134  H H    . ALA A 1 73 ? 0.447   -7.258  2.325   1.00 0.00 ? 73 ALA A H    4  
ATOM 5135  H HA   . ALA A 1 73 ? -2.482  -6.755  2.128   1.00 0.00 ? 73 ALA A HA   4  
ATOM 5136  H HB1  . ALA A 1 73 ? -1.886  -9.238  2.488   1.00 0.00 ? 73 ALA A HB1  4  
ATOM 5137  H HB2  . ALA A 1 73 ? -1.252  -8.736  4.072   1.00 0.00 ? 73 ALA A HB2  4  
ATOM 5138  H HB3  . ALA A 1 73 ? -2.973  -8.494  3.686   1.00 0.00 ? 73 ALA A HB3  4  
ATOM 5139  N N    . PHE A 1 74 ? -2.412  -5.484  4.352   1.00 0.00 ? 74 PHE A N    4  
ATOM 5140  C CA   . PHE A 1 74 ? -2.275  -4.553  5.456   1.00 0.00 ? 74 PHE A CA   4  
ATOM 5141  C C    . PHE A 1 74 ? -1.993  -5.337  6.733   1.00 0.00 ? 74 PHE A C    4  
ATOM 5142  O O    . PHE A 1 74 ? -2.740  -6.253  7.072   1.00 0.00 ? 74 PHE A O    4  
ATOM 5143  C CB   . PHE A 1 74 ? -3.559  -3.735  5.584   1.00 0.00 ? 74 PHE A CB   4  
ATOM 5144  C CG   . PHE A 1 74 ? -3.691  -2.997  6.898   1.00 0.00 ? 74 PHE A CG   4  
ATOM 5145  C CD1  . PHE A 1 74 ? -4.306  -3.629  7.986   1.00 0.00 ? 74 PHE A CD1  4  
ATOM 5146  C CD2  . PHE A 1 74 ? -3.225  -1.677  7.024   1.00 0.00 ? 74 PHE A CD2  4  
ATOM 5147  C CE1  . PHE A 1 74 ? -4.477  -2.945  9.193   1.00 0.00 ? 74 PHE A CE1  4  
ATOM 5148  C CE2  . PHE A 1 74 ? -3.386  -0.994  8.241   1.00 0.00 ? 74 PHE A CE2  4  
ATOM 5149  C CZ   . PHE A 1 74 ? -4.020  -1.630  9.323   1.00 0.00 ? 74 PHE A CZ   4  
ATOM 5150  H H    . PHE A 1 74 ? -3.331  -5.638  3.964   1.00 0.00 ? 74 PHE A H    4  
ATOM 5151  H HA   . PHE A 1 74 ? -1.443  -3.879  5.258   1.00 0.00 ? 74 PHE A HA   4  
ATOM 5152  H HB2  . PHE A 1 74 ? -3.589  -3.010  4.779   1.00 0.00 ? 74 PHE A HB2  4  
ATOM 5153  H HB3  . PHE A 1 74 ? -4.411  -4.406  5.478   1.00 0.00 ? 74 PHE A HB3  4  
ATOM 5154  H HD1  . PHE A 1 74 ? -4.653  -4.639  7.890   1.00 0.00 ? 74 PHE A HD1  4  
ATOM 5155  H HD2  . PHE A 1 74 ? -2.751  -1.186  6.186   1.00 0.00 ? 74 PHE A HD2  4  
ATOM 5156  H HE1  . PHE A 1 74 ? -4.967  -3.431  10.023  1.00 0.00 ? 74 PHE A HE1  4  
ATOM 5157  H HE2  . PHE A 1 74 ? -3.034  0.022   8.341   1.00 0.00 ? 74 PHE A HE2  4  
ATOM 5158  H HZ   . PHE A 1 74 ? -4.166  -1.107  10.250  1.00 0.00 ? 74 PHE A HZ   4  
ATOM 5159  N N    . LYS A 1 75 ? -0.914  -4.978  7.435   1.00 0.00 ? 75 LYS A N    4  
ATOM 5160  C CA   . LYS A 1 75 ? -0.534  -5.644  8.668   1.00 0.00 ? 75 LYS A CA   4  
ATOM 5161  C C    . LYS A 1 75 ? -1.438  -5.138  9.804   1.00 0.00 ? 75 LYS A C    4  
ATOM 5162  O O    . LYS A 1 75 ? -1.412  -3.948  10.119  1.00 0.00 ? 75 LYS A O    4  
ATOM 5163  C CB   . LYS A 1 75 ? 0.947   -5.345  8.954   1.00 0.00 ? 75 LYS A CB   4  
ATOM 5164  C CG   . LYS A 1 75 ? 1.515   -6.357  9.961   1.00 0.00 ? 75 LYS A CG   4  
ATOM 5165  C CD   . LYS A 1 75 ? 1.339   -5.836  11.392  1.00 0.00 ? 75 LYS A CD   4  
ATOM 5166  C CE   . LYS A 1 75 ? 1.604   -6.968  12.388  1.00 0.00 ? 75 LYS A CE   4  
ATOM 5167  N NZ   . LYS A 1 75 ? 1.153   -6.596  13.740  1.00 0.00 ? 75 LYS A NZ   4  
ATOM 5168  H H    . LYS A 1 75 ? -0.337  -4.215  7.105   1.00 0.00 ? 75 LYS A H    4  
ATOM 5169  H HA   . LYS A 1 75 ? -0.658  -6.715  8.541   1.00 0.00 ? 75 LYS A HA   4  
ATOM 5170  H HB2  . LYS A 1 75 ? 1.509   -5.419  8.024   1.00 0.00 ? 75 LYS A HB2  4  
ATOM 5171  H HB3  . LYS A 1 75 ? 1.047   -4.337  9.351   1.00 0.00 ? 75 LYS A HB3  4  
ATOM 5172  H HG2  . LYS A 1 75 ? 0.998   -7.309  9.851   1.00 0.00 ? 75 LYS A HG2  4  
ATOM 5173  H HG3  . LYS A 1 75 ? 2.579   -6.501  9.763   1.00 0.00 ? 75 LYS A HG3  4  
ATOM 5174  H HD2  . LYS A 1 75 ? 2.042   -5.021  11.571  1.00 0.00 ? 75 LYS A HD2  4  
ATOM 5175  H HD3  . LYS A 1 75 ? 0.325   -5.472  11.526  1.00 0.00 ? 75 LYS A HD3  4  
ATOM 5176  H HE2  . LYS A 1 75 ? 1.065   -7.861  12.068  1.00 0.00 ? 75 LYS A HE2  4  
ATOM 5177  H HE3  . LYS A 1 75 ? 2.672   -7.185  12.412  1.00 0.00 ? 75 LYS A HE3  4  
ATOM 5178  H HZ1  . LYS A 1 75 ? 1.653   -5.776  14.049  1.00 0.00 ? 75 LYS A HZ1  4  
ATOM 5179  H HZ2  . LYS A 1 75 ? 1.331   -7.359  14.378  1.00 0.00 ? 75 LYS A HZ2  4  
ATOM 5180  H HZ3  . LYS A 1 75 ? 0.157   -6.397  13.720  1.00 0.00 ? 75 LYS A HZ3  4  
ATOM 5181  N N    . PRO A 1 76 ? -2.246  -6.027  10.426  1.00 0.00 ? 76 PRO A N    4  
ATOM 5182  C CA   . PRO A 1 76 ? -3.152  -5.637  11.485  1.00 0.00 ? 76 PRO A CA   4  
ATOM 5183  C C    . PRO A 1 76 ? -2.396  -5.272  12.759  1.00 0.00 ? 76 PRO A C    4  
ATOM 5184  O O    . PRO A 1 76 ? -1.529  -6.024  13.210  1.00 0.00 ? 76 PRO A O    4  
ATOM 5185  C CB   . PRO A 1 76 ? -4.055  -6.847  11.724  1.00 0.00 ? 76 PRO A CB   4  
ATOM 5186  C CG   . PRO A 1 76 ? -3.419  -8.024  10.977  1.00 0.00 ? 76 PRO A CG   4  
ATOM 5187  C CD   . PRO A 1 76 ? -2.310  -7.440  10.102  1.00 0.00 ? 76 PRO A CD   4  
ATOM 5188  H HA   . PRO A 1 76 ? -3.753  -4.792  11.161  1.00 0.00 ? 76 PRO A HA   4  
ATOM 5189  H HB2  . PRO A 1 76 ? -4.119  -7.067  12.790  1.00 0.00 ? 76 PRO A HB2  4  
ATOM 5190  H HB3  . PRO A 1 76 ? -5.050  -6.647  11.327  1.00 0.00 ? 76 PRO A HB3  4  
ATOM 5191  H HG2  . PRO A 1 76 ? -2.996  -8.732  11.691  1.00 0.00 ? 76 PRO A HG2  4  
ATOM 5192  H HG3  . PRO A 1 76 ? -4.164  -8.522  10.357  1.00 0.00 ? 76 PRO A HG3  4  
ATOM 5193  H HD2  . PRO A 1 76 ? -1.358  -7.923  10.332  1.00 0.00 ? 76 PRO A HD2  4  
ATOM 5194  H HD3  . PRO A 1 76 ? -2.557  -7.579  9.052   1.00 0.00 ? 76 PRO A HD3  4  
ATOM 5195  N N    . LYS A 1 77 ? -2.744  -4.123  13.351  1.00 0.00 ? 77 LYS A N    4  
ATOM 5196  C CA   . LYS A 1 77 ? -2.161  -3.700  14.611  1.00 0.00 ? 77 LYS A CA   4  
ATOM 5197  C C    . LYS A 1 77 ? -2.779  -4.541  15.721  1.00 0.00 ? 77 LYS A C    4  
ATOM 5198  O O    . LYS A 1 77 ? -2.076  -5.261  16.426  1.00 0.00 ? 77 LYS A O    4  
ATOM 5199  C CB   . LYS A 1 77 ? -2.443  -2.207  14.836  1.00 0.00 ? 77 LYS A CB   4  
ATOM 5200  C CG   . LYS A 1 77 ? -2.125  -1.827  16.289  1.00 0.00 ? 77 LYS A CG   4  
ATOM 5201  C CD   . LYS A 1 77 ? -2.316  -0.319  16.480  1.00 0.00 ? 77 LYS A CD   4  
ATOM 5202  C CE   . LYS A 1 77 ? -1.948  0.082   17.914  1.00 0.00 ? 77 LYS A CE   4  
ATOM 5203  N NZ   . LYS A 1 77 ? -2.885  -0.499  18.894  1.00 0.00 ? 77 LYS A NZ   4  
ATOM 5204  H H    . LYS A 1 77 ? -3.443  -3.534  12.924  1.00 0.00 ? 77 LYS A H    4  
ATOM 5205  H HA   . LYS A 1 77 ? -1.084  -3.865  14.589  1.00 0.00 ? 77 LYS A HA   4  
ATOM 5206  H HB2  . LYS A 1 77 ? -1.821  -1.618  14.161  1.00 0.00 ? 77 LYS A HB2  4  
ATOM 5207  H HB3  . LYS A 1 77 ? -3.494  -2.001  14.630  1.00 0.00 ? 77 LYS A HB3  4  
ATOM 5208  H HG2  . LYS A 1 77 ? -2.797  -2.365  16.962  1.00 0.00 ? 77 LYS A HG2  4  
ATOM 5209  H HG3  . LYS A 1 77 ? -1.093  -2.096  16.516  1.00 0.00 ? 77 LYS A HG3  4  
ATOM 5210  H HD2  . LYS A 1 77 ? -1.673  0.218   15.780  1.00 0.00 ? 77 LYS A HD2  4  
ATOM 5211  H HD3  . LYS A 1 77 ? -3.357  -0.055  16.285  1.00 0.00 ? 77 LYS A HD3  4  
ATOM 5212  H HE2  . LYS A 1 77 ? -0.937  -0.267  18.136  1.00 0.00 ? 77 LYS A HE2  4  
ATOM 5213  H HE3  . LYS A 1 77 ? -1.974  1.169   17.998  1.00 0.00 ? 77 LYS A HE3  4  
ATOM 5214  H HZ1  . LYS A 1 77 ? -3.827  -0.207  18.674  1.00 0.00 ? 77 LYS A HZ1  4  
ATOM 5215  H HZ2  . LYS A 1 77 ? -2.643  -0.180  19.822  1.00 0.00 ? 77 LYS A HZ2  4  
ATOM 5216  H HZ3  . LYS A 1 77 ? -2.829  -1.507  18.861  1.00 0.00 ? 77 LYS A HZ3  4  
ATOM 5217  N N    . TYR A 1 78 ? -4.105  -4.441  15.859  1.00 0.00 ? 78 TYR A N    4  
ATOM 5218  C CA   . TYR A 1 78 ? -4.846  -5.195  16.850  1.00 0.00 ? 78 TYR A CA   4  
ATOM 5219  C C    . TYR A 1 78 ? -5.338  -6.491  16.217  1.00 0.00 ? 78 TYR A C    4  
ATOM 5220  O O    . TYR A 1 78 ? -5.804  -6.489  15.078  1.00 0.00 ? 78 TYR A O    4  
ATOM 5221  C CB   . TYR A 1 78 ? -6.019  -4.352  17.371  1.00 0.00 ? 78 TYR A CB   4  
ATOM 5222  C CG   . TYR A 1 78 ? -6.940  -3.833  16.280  1.00 0.00 ? 78 TYR A CG   4  
ATOM 5223  C CD1  . TYR A 1 78 ? -8.047  -4.598  15.868  1.00 0.00 ? 78 TYR A CD1  4  
ATOM 5224  C CD2  . TYR A 1 78 ? -6.693  -2.581  15.685  1.00 0.00 ? 78 TYR A CD2  4  
ATOM 5225  C CE1  . TYR A 1 78 ? -8.901  -4.114  14.862  1.00 0.00 ? 78 TYR A CE1  4  
ATOM 5226  C CE2  . TYR A 1 78 ? -7.548  -2.098  14.679  1.00 0.00 ? 78 TYR A CE2  4  
ATOM 5227  C CZ   . TYR A 1 78 ? -8.652  -2.865  14.268  1.00 0.00 ? 78 TYR A CZ   4  
ATOM 5228  O OH   . TYR A 1 78 ? -9.483  -2.393  13.292  1.00 0.00 ? 78 TYR A OH   4  
ATOM 5229  H H    . TYR A 1 78 ? -4.622  -3.827  15.249  1.00 0.00 ? 78 TYR A H    4  
ATOM 5230  H HA   . TYR A 1 78 ? -4.186  -5.434  17.687  1.00 0.00 ? 78 TYR A HA   4  
ATOM 5231  H HB2  . TYR A 1 78 ? -6.605  -4.961  18.061  1.00 0.00 ? 78 TYR A HB2  4  
ATOM 5232  H HB3  . TYR A 1 78 ? -5.616  -3.500  17.920  1.00 0.00 ? 78 TYR A HB3  4  
ATOM 5233  H HD1  . TYR A 1 78 ? -8.241  -5.557  16.324  1.00 0.00 ? 78 TYR A HD1  4  
ATOM 5234  H HD2  . TYR A 1 78 ? -5.846  -1.990  16.001  1.00 0.00 ? 78 TYR A HD2  4  
ATOM 5235  H HE1  . TYR A 1 78 ? -9.751  -4.703  14.546  1.00 0.00 ? 78 TYR A HE1  4  
ATOM 5236  H HE2  . TYR A 1 78 ? -7.358  -1.138  14.222  1.00 0.00 ? 78 TYR A HE2  4  
ATOM 5237  H HH   . TYR A 1 78 ? -10.188 -3.008  13.072  1.00 0.00 ? 78 TYR A HH   4  
ATOM 5238  N N    . ASN A 1 79 ? -5.228  -7.596  16.953  1.00 0.00 ? 79 ASN A N    4  
ATOM 5239  C CA   . ASN A 1 79 ? -5.666  -8.892  16.456  1.00 0.00 ? 79 ASN A CA   4  
ATOM 5240  C C    . ASN A 1 79 ? -7.190  -8.920  16.361  1.00 0.00 ? 79 ASN A C    4  
ATOM 5241  O O    . ASN A 1 79 ? -7.873  -8.220  17.110  1.00 0.00 ? 79 ASN A O    4  
ATOM 5242  C CB   . ASN A 1 79 ? -5.157  -10.002 17.383  1.00 0.00 ? 79 ASN A CB   4  
ATOM 5243  C CG   . ASN A 1 79 ? -5.933  -10.031 18.699  1.00 0.00 ? 79 ASN A CG   4  
ATOM 5244  O OD1  . ASN A 1 79 ? -5.591  -9.322  19.641  1.00 0.00 ? 79 ASN A OD1  4  
ATOM 5245  N ND2  . ASN A 1 79 ? -6.980  -10.857 18.762  1.00 0.00 ? 79 ASN A ND2  4  
ATOM 5246  H H    . ASN A 1 79 ? -4.833  -7.542  17.881  1.00 0.00 ? 79 ASN A H    4  
ATOM 5247  H HA   . ASN A 1 79 ? -5.247  -9.046  15.460  1.00 0.00 ? 79 ASN A HA   4  
ATOM 5248  H HB2  . ASN A 1 79 ? -5.269  -10.964 16.881  1.00 0.00 ? 79 ASN A HB2  4  
ATOM 5249  H HB3  . ASN A 1 79 ? -4.100  -9.834  17.595  1.00 0.00 ? 79 ASN A HB3  4  
ATOM 5250  H HD21 . ASN A 1 79 ? -7.270  -11.375 17.940  1.00 0.00 ? 79 ASN A HD21 4  
ATOM 5251  H HD22 . ASN A 1 79 ? -7.483  -10.964 19.628  1.00 0.00 ? 79 ASN A HD22 4  
ATOM 5252  N N    . VAL A 1 80 ? -7.719  -9.732  15.443  1.00 0.00 ? 80 VAL A N    4  
ATOM 5253  C CA   . VAL A 1 80 ? -9.157  -9.864  15.269  1.00 0.00 ? 80 VAL A CA   4  
ATOM 5254  C C    . VAL A 1 80 ? -9.739  -10.578 16.488  1.00 0.00 ? 80 VAL A C    4  
ATOM 5255  O O    . VAL A 1 80 ? -9.129  -11.518 17.003  1.00 0.00 ? 80 VAL A O    4  
ATOM 5256  C CB   . VAL A 1 80 ? -9.448  -10.644 13.977  1.00 0.00 ? 80 VAL A CB   4  
ATOM 5257  C CG1  . VAL A 1 80 ? -10.961 -10.810 13.797  1.00 0.00 ? 80 VAL A CG1  4  
ATOM 5258  C CG2  . VAL A 1 80 ? -8.877  -9.884  12.774  1.00 0.00 ? 80 VAL A CG2  4  
ATOM 5259  H H    . VAL A 1 80 ? -7.114  -10.279 14.850  1.00 0.00 ? 80 VAL A H    4  
ATOM 5260  H HA   . VAL A 1 80 ? -9.599  -8.869  15.192  1.00 0.00 ? 80 VAL A HA   4  
ATOM 5261  H HB   . VAL A 1 80 ? -8.982  -11.629 14.035  1.00 0.00 ? 80 VAL A HB   4  
ATOM 5262  H HG11 . VAL A 1 80 ? -11.445 -9.834  13.859  1.00 0.00 ? 80 VAL A HG11 4  
ATOM 5263  H HG12 . VAL A 1 80 ? -11.354 -11.460 14.579  1.00 0.00 ? 80 VAL A HG12 4  
ATOM 5264  H HG13 . VAL A 1 80 ? -11.165 -11.254 12.823  1.00 0.00 ? 80 VAL A HG13 4  
ATOM 5265  H HG21 . VAL A 1 80 ? -7.792  -9.826  12.858  1.00 0.00 ? 80 VAL A HG21 4  
ATOM 5266  H HG22 . VAL A 1 80 ? -9.140  -10.407 11.855  1.00 0.00 ? 80 VAL A HG22 4  
ATOM 5267  H HG23 . VAL A 1 80 ? -9.294  -8.876  12.749  1.00 0.00 ? 80 VAL A HG23 4  
ATOM 5268  N N    . ARG A 1 81 ? -10.913 -10.124 16.947  1.00 0.00 ? 81 ARG A N    4  
ATOM 5269  C CA   . ARG A 1 81 ? -11.577 -10.701 18.108  1.00 0.00 ? 81 ARG A CA   4  
ATOM 5270  C C    . ARG A 1 81 ? -13.000 -11.100 17.733  1.00 0.00 ? 81 ARG A C    4  
ATOM 5271  O O    . ARG A 1 81 ? -13.541 -11.975 18.440  1.00 0.00 ? 81 ARG A O    4  
ATOM 5272  C CB   . ARG A 1 81 ? -11.590 -9.681  19.252  1.00 0.00 ? 81 ARG A CB   4  
ATOM 5273  C CG   . ARG A 1 81 ? -10.185 -9.101  19.456  1.00 0.00 ? 81 ARG A CG   4  
ATOM 5274  C CD   . ARG A 1 81 ? -10.118 -8.358  20.792  1.00 0.00 ? 81 ARG A CD   4  
ATOM 5275  N NE   . ARG A 1 81 ? -10.063 -9.299  21.920  1.00 0.00 ? 81 ARG A NE   4  
ATOM 5276  C CZ   . ARG A 1 81 ? -8.931  -9.911  22.319  1.00 0.00 ? 81 ARG A CZ   4  
ATOM 5277  N NH1  . ARG A 1 81 ? -7.774  -9.683  21.682  1.00 0.00 ? 81 ARG A NH1  4  
ATOM 5278  N NH2  . ARG A 1 81 ? -8.963  -10.754 23.360  1.00 0.00 ? 81 ARG A NH2  4  
ATOM 5279  O OXT  . ARG A 1 81 ? -13.582 -10.377 16.892  1.00 0.00 ? 81 ARG A OXT  4  
ATOM 5280  H H    . ARG A 1 81 ? -11.367 -9.353  16.480  1.00 0.00 ? 81 ARG A H    4  
ATOM 5281  H HA   . ARG A 1 81 ? -11.035 -11.590 18.432  1.00 0.00 ? 81 ARG A HA   4  
ATOM 5282  H HB2  . ARG A 1 81 ? -12.282 -8.873  19.011  1.00 0.00 ? 81 ARG A HB2  4  
ATOM 5283  H HB3  . ARG A 1 81 ? -11.916 -10.175 20.168  1.00 0.00 ? 81 ARG A HB3  4  
ATOM 5284  H HG2  . ARG A 1 81 ? -9.454  -9.908  19.451  1.00 0.00 ? 81 ARG A HG2  4  
ATOM 5285  H HG3  . ARG A 1 81 ? -9.961  -8.405  18.646  1.00 0.00 ? 81 ARG A HG3  4  
ATOM 5286  H HD2  . ARG A 1 81 ? -9.232  -7.722  20.807  1.00 0.00 ? 81 ARG A HD2  4  
ATOM 5287  H HD3  . ARG A 1 81 ? -11.004 -7.730  20.896  1.00 0.00 ? 81 ARG A HD3  4  
ATOM 5288  H HE   . ARG A 1 81 ? -10.926 -9.490  22.411  1.00 0.00 ? 81 ARG A HE   4  
ATOM 5289  H HH11 . ARG A 1 81 ? -7.750  -9.067  20.881  1.00 0.00 ? 81 ARG A HH11 4  
ATOM 5290  H HH12 . ARG A 1 81 ? -6.924  -10.125 22.001  1.00 0.00 ? 81 ARG A HH12 4  
ATOM 5291  H HH21 . ARG A 1 81 ? -9.834  -10.931 23.841  1.00 0.00 ? 81 ARG A HH21 4  
ATOM 5292  H HH22 . ARG A 1 81 ? -8.117  -11.213 23.666  1.00 0.00 ? 81 ARG A HH22 4  
ATOM 5293  N N    . ALA A 1 1  ? 2.835   20.274  -1.976  1.00 0.00 ? 1  ALA A N    5  
ATOM 5294  C CA   . ALA A 1 1  ? 2.546   21.111  -0.803  1.00 0.00 ? 1  ALA A CA   5  
ATOM 5295  C C    . ALA A 1 1  ? 1.821   22.377  -1.242  1.00 0.00 ? 1  ALA A C    5  
ATOM 5296  O O    . ALA A 1 1  ? 2.053   22.856  -2.348  1.00 0.00 ? 1  ALA A O    5  
ATOM 5297  C CB   . ALA A 1 1  ? 3.838   21.465  -0.065  1.00 0.00 ? 1  ALA A CB   5  
ATOM 5298  H H1   . ALA A 1 1  ? 1.965   20.053  -2.453  1.00 0.00 ? 1  ALA A H1   5  
ATOM 5299  H H2   . ALA A 1 1  ? 3.445   20.775  -2.606  1.00 0.00 ? 1  ALA A H2   5  
ATOM 5300  H H3   . ALA A 1 1  ? 3.280   19.417  -1.681  1.00 0.00 ? 1  ALA A H3   5  
ATOM 5301  H HA   . ALA A 1 1  ? 1.898   20.552  -0.127  1.00 0.00 ? 1  ALA A HA   5  
ATOM 5302  H HB1  . ALA A 1 1  ? 4.489   22.041  -0.722  1.00 0.00 ? 1  ALA A HB1  5  
ATOM 5303  H HB2  . ALA A 1 1  ? 3.601   22.057  0.821   1.00 0.00 ? 1  ALA A HB2  5  
ATOM 5304  H HB3  . ALA A 1 1  ? 4.346   20.549  0.240   1.00 0.00 ? 1  ALA A HB3  5  
ATOM 5305  N N    . LEU A 1 2  ? 0.945   22.902  -0.367  1.00 0.00 ? 2  LEU A N    5  
ATOM 5306  C CA   . LEU A 1 2  ? 0.153   24.103  -0.643  1.00 0.00 ? 2  LEU A CA   5  
ATOM 5307  C C    . LEU A 1 2  ? -0.767  23.853  -1.843  1.00 0.00 ? 2  LEU A C    5  
ATOM 5308  O O    . LEU A 1 2  ? -1.945  23.546  -1.662  1.00 0.00 ? 2  LEU A O    5  
ATOM 5309  C CB   . LEU A 1 2  ? 1.070   25.323  -0.882  1.00 0.00 ? 2  LEU A CB   5  
ATOM 5310  C CG   . LEU A 1 2  ? 1.469   25.965  0.458   1.00 0.00 ? 2  LEU A CG   5  
ATOM 5311  C CD1  . LEU A 1 2  ? 2.364   25.014  1.260   1.00 0.00 ? 2  LEU A CD1  5  
ATOM 5312  C CD2  . LEU A 1 2  ? 2.228   27.265  0.186   1.00 0.00 ? 2  LEU A CD2  5  
ATOM 5313  H H    . LEU A 1 2  ? 0.815   22.452  0.527   1.00 0.00 ? 2  LEU A H    5  
ATOM 5314  H HA   . LEU A 1 2  ? -0.471  24.308  0.227   1.00 0.00 ? 2  LEU A HA   5  
ATOM 5315  H HB2  . LEU A 1 2  ? 1.967   25.018  -1.416  1.00 0.00 ? 2  LEU A HB2  5  
ATOM 5316  H HB3  . LEU A 1 2  ? 0.532   26.060  -1.479  1.00 0.00 ? 2  LEU A HB3  5  
ATOM 5317  H HG   . LEU A 1 2  ? 0.571   26.189  1.035   1.00 0.00 ? 2  LEU A HG   5  
ATOM 5318  H HD11 . LEU A 1 2  ? 2.814   25.556  2.092   1.00 0.00 ? 2  LEU A HD11 5  
ATOM 5319  H HD12 . LEU A 1 2  ? 1.768   24.190  1.648   1.00 0.00 ? 2  LEU A HD12 5  
ATOM 5320  H HD13 . LEU A 1 2  ? 3.152   24.622  0.615   1.00 0.00 ? 2  LEU A HD13 5  
ATOM 5321  H HD21 . LEU A 1 2  ? 2.501   27.732  1.133   1.00 0.00 ? 2  LEU A HD21 5  
ATOM 5322  H HD22 . LEU A 1 2  ? 3.132   27.048  -0.384  1.00 0.00 ? 2  LEU A HD22 5  
ATOM 5323  H HD23 . LEU A 1 2  ? 1.594   27.945  -0.383  1.00 0.00 ? 2  LEU A HD23 5  
ATOM 5324  N N    . SER A 1 3  ? -0.232  23.982  -3.061  1.00 0.00 ? 3  SER A N    5  
ATOM 5325  C CA   . SER A 1 3  ? -1.000  23.767  -4.275  1.00 0.00 ? 3  SER A CA   5  
ATOM 5326  C C    . SER A 1 3  ? -1.103  22.266  -4.561  1.00 0.00 ? 3  SER A C    5  
ATOM 5327  O O    . SER A 1 3  ? -0.560  21.779  -5.553  1.00 0.00 ? 3  SER A O    5  
ATOM 5328  C CB   . SER A 1 3  ? -0.320  24.505  -5.432  1.00 0.00 ? 3  SER A CB   5  
ATOM 5329  O OG   . SER A 1 3  ? 1.026   24.091  -5.531  1.00 0.00 ? 3  SER A OG   5  
ATOM 5330  H H    . SER A 1 3  ? 0.744   24.232  -3.154  1.00 0.00 ? 3  SER A H    5  
ATOM 5331  H HA   . SER A 1 3  ? -2.005  24.172  -4.141  1.00 0.00 ? 3  SER A HA   5  
ATOM 5332  H HB2  . SER A 1 3  ? -0.840  24.281  -6.364  1.00 0.00 ? 3  SER A HB2  5  
ATOM 5333  H HB3  . SER A 1 3  ? -0.354  25.579  -5.247  1.00 0.00 ? 3  SER A HB3  5  
ATOM 5334  H HG   . SER A 1 3  ? 1.040   23.144  -5.707  1.00 0.00 ? 3  SER A HG   5  
ATOM 5335  N N    . GLY A 1 4  ? -1.804  21.536  -3.686  1.00 0.00 ? 4  GLY A N    5  
ATOM 5336  C CA   . GLY A 1 4  ? -1.992  20.102  -3.843  1.00 0.00 ? 4  GLY A CA   5  
ATOM 5337  C C    . GLY A 1 4  ? -0.671  19.357  -3.641  1.00 0.00 ? 4  GLY A C    5  
ATOM 5338  O O    . GLY A 1 4  ? 0.266   19.893  -3.044  1.00 0.00 ? 4  GLY A O    5  
ATOM 5339  H H    . GLY A 1 4  ? -2.224  21.990  -2.884  1.00 0.00 ? 4  GLY A H    5  
ATOM 5340  H HA2  . GLY A 1 4  ? -2.716  19.753  -3.107  1.00 0.00 ? 4  GLY A HA2  5  
ATOM 5341  H HA3  . GLY A 1 4  ? -2.372  19.897  -4.845  1.00 0.00 ? 4  GLY A HA3  5  
ATOM 5342  N N    . SER A 1 5  ? -0.611  18.111  -4.144  1.00 0.00 ? 5  SER A N    5  
ATOM 5343  C CA   . SER A 1 5  ? 0.572   17.263  -4.031  1.00 0.00 ? 5  SER A CA   5  
ATOM 5344  C C    . SER A 1 5  ? 0.952   17.090  -2.558  1.00 0.00 ? 5  SER A C    5  
ATOM 5345  O O    . SER A 1 5  ? 1.848   17.770  -2.056  1.00 0.00 ? 5  SER A O    5  
ATOM 5346  C CB   . SER A 1 5  ? 1.727   17.870  -4.841  1.00 0.00 ? 5  SER A CB   5  
ATOM 5347  O OG   . SER A 1 5  ? 2.827   16.984  -4.834  1.00 0.00 ? 5  SER A OG   5  
ATOM 5348  H H    . SER A 1 5  ? -1.415  17.734  -4.624  1.00 0.00 ? 5  SER A H    5  
ATOM 5349  H HA   . SER A 1 5  ? 0.337   16.283  -4.447  1.00 0.00 ? 5  SER A HA   5  
ATOM 5350  H HB2  . SER A 1 5  ? 1.401   18.031  -5.870  1.00 0.00 ? 5  SER A HB2  5  
ATOM 5351  H HB3  . SER A 1 5  ? 2.025   18.822  -4.405  1.00 0.00 ? 5  SER A HB3  5  
ATOM 5352  H HG   . SER A 1 5  ? 3.505   17.335  -5.417  1.00 0.00 ? 5  SER A HG   5  
ATOM 5353  N N    . SER A 1 6  ? 0.264   16.173  -1.867  1.00 0.00 ? 6  SER A N    5  
ATOM 5354  C CA   . SER A 1 6  ? 0.510   15.915  -0.456  1.00 0.00 ? 6  SER A CA   5  
ATOM 5355  C C    . SER A 1 6  ? 1.752   15.035  -0.286  1.00 0.00 ? 6  SER A C    5  
ATOM 5356  O O    . SER A 1 6  ? 1.669   13.940  0.268   1.00 0.00 ? 6  SER A O    5  
ATOM 5357  C CB   . SER A 1 6  ? -0.726  15.241  0.148   1.00 0.00 ? 6  SER A CB   5  
ATOM 5358  O OG   . SER A 1 6  ? -1.024  14.064  -0.573  1.00 0.00 ? 6  SER A OG   5  
ATOM 5359  H H    . SER A 1 6  ? -0.458  15.638  -2.328  1.00 0.00 ? 6  SER A H    5  
ATOM 5360  H HA   . SER A 1 6  ? 0.677   16.863  0.057   1.00 0.00 ? 6  SER A HA   5  
ATOM 5361  H HB2  . SER A 1 6  ? -0.532  14.989  1.192   1.00 0.00 ? 6  SER A HB2  5  
ATOM 5362  H HB3  . SER A 1 6  ? -1.575  15.923  0.093   1.00 0.00 ? 6  SER A HB3  5  
ATOM 5363  H HG   . SER A 1 6  ? -0.290  13.449  -0.467  1.00 0.00 ? 6  SER A HG   5  
ATOM 5364  N N    . GLY A 1 7  ? 2.904   15.523  -0.763  1.00 0.00 ? 7  GLY A N    5  
ATOM 5365  C CA   . GLY A 1 7  ? 4.159   14.802  -0.653  1.00 0.00 ? 7  GLY A CA   5  
ATOM 5366  C C    . GLY A 1 7  ? 4.273   13.750  -1.756  1.00 0.00 ? 7  GLY A C    5  
ATOM 5367  O O    . GLY A 1 7  ? 3.528   12.774  -1.766  1.00 0.00 ? 7  GLY A O    5  
ATOM 5368  H H    . GLY A 1 7  ? 2.911   16.427  -1.216  1.00 0.00 ? 7  GLY A H    5  
ATOM 5369  H HA2  . GLY A 1 7  ? 4.985   15.508  -0.740  1.00 0.00 ? 7  GLY A HA2  5  
ATOM 5370  H HA3  . GLY A 1 7  ? 4.210   14.310  0.319   1.00 0.00 ? 7  GLY A HA3  5  
ATOM 5371  N N    . TYR A 1 8  ? 5.219   13.950  -2.677  1.00 0.00 ? 8  TYR A N    5  
ATOM 5372  C CA   . TYR A 1 8  ? 5.463   13.004  -3.757  1.00 0.00 ? 8  TYR A CA   5  
ATOM 5373  C C    . TYR A 1 8  ? 5.877   11.659  -3.156  1.00 0.00 ? 8  TYR A C    5  
ATOM 5374  O O    . TYR A 1 8  ? 6.602   11.637  -2.165  1.00 0.00 ? 8  TYR A O    5  
ATOM 5375  C CB   . TYR A 1 8  ? 6.561   13.570  -4.664  1.00 0.00 ? 8  TYR A CB   5  
ATOM 5376  C CG   . TYR A 1 8  ? 7.153   12.555  -5.620  1.00 0.00 ? 8  TYR A CG   5  
ATOM 5377  C CD1  . TYR A 1 8  ? 6.400   12.091  -6.713  1.00 0.00 ? 8  TYR A CD1  5  
ATOM 5378  C CD2  . TYR A 1 8  ? 8.464   12.083  -5.419  1.00 0.00 ? 8  TYR A CD2  5  
ATOM 5379  C CE1  . TYR A 1 8  ? 6.957   11.156  -7.603  1.00 0.00 ? 8  TYR A CE1  5  
ATOM 5380  C CE2  . TYR A 1 8  ? 9.018   11.149  -6.308  1.00 0.00 ? 8  TYR A CE2  5  
ATOM 5381  C CZ   . TYR A 1 8  ? 8.265   10.685  -7.401  1.00 0.00 ? 8  TYR A CZ   5  
ATOM 5382  O OH   . TYR A 1 8  ? 8.803   9.776   -8.264  1.00 0.00 ? 8  TYR A OH   5  
ATOM 5383  H H    . TYR A 1 8  ? 5.796   14.776  -2.629  1.00 0.00 ? 8  TYR A H    5  
ATOM 5384  H HA   . TYR A 1 8  ? 4.547   12.875  -4.336  1.00 0.00 ? 8  TYR A HA   5  
ATOM 5385  H HB2  . TYR A 1 8  ? 6.143   14.393  -5.245  1.00 0.00 ? 8  TYR A HB2  5  
ATOM 5386  H HB3  . TYR A 1 8  ? 7.362   13.962  -4.036  1.00 0.00 ? 8  TYR A HB3  5  
ATOM 5387  H HD1  . TYR A 1 8  ? 5.395   12.453  -6.870  1.00 0.00 ? 8  TYR A HD1  5  
ATOM 5388  H HD2  . TYR A 1 8  ? 9.044   12.441  -4.582  1.00 0.00 ? 8  TYR A HD2  5  
ATOM 5389  H HE1  . TYR A 1 8  ? 6.379   10.801  -8.443  1.00 0.00 ? 8  TYR A HE1  5  
ATOM 5390  H HE2  . TYR A 1 8  ? 10.026  10.789  -6.152  1.00 0.00 ? 8  TYR A HE2  5  
ATOM 5391  H HH   . TYR A 1 8  ? 9.723   9.581   -8.078  1.00 0.00 ? 8  TYR A HH   5  
ATOM 5392  N N    . LYS A 1 9  ? 5.407   10.547  -3.762  1.00 0.00 ? 9  LYS A N    5  
ATOM 5393  C CA   . LYS A 1 9  ? 5.702   9.182   -3.298  1.00 0.00 ? 9  LYS A CA   5  
ATOM 5394  C C    . LYS A 1 9  ? 4.999   8.898   -1.970  1.00 0.00 ? 9  LYS A C    5  
ATOM 5395  O O    . LYS A 1 9  ? 4.095   8.067   -1.913  1.00 0.00 ? 9  LYS A O    5  
ATOM 5396  C CB   . LYS A 1 9  ? 7.226   8.961   -3.161  1.00 0.00 ? 9  LYS A CB   5  
ATOM 5397  C CG   . LYS A 1 9  ? 7.747   8.189   -4.369  1.00 0.00 ? 9  LYS A CG   5  
ATOM 5398  C CD   . LYS A 1 9  ? 9.156   7.642   -4.088  1.00 0.00 ? 9  LYS A CD   5  
ATOM 5399  C CE   . LYS A 1 9  ? 10.121  8.777   -3.717  1.00 0.00 ? 9  LYS A CE   5  
ATOM 5400  N NZ   . LYS A 1 9  ? 10.179  8.977   -2.256  1.00 0.00 ? 9  LYS A NZ   5  
ATOM 5401  H H    . LYS A 1 9  ? 4.818   10.645  -4.577  1.00 0.00 ? 9  LYS A H    5  
ATOM 5402  H HA   . LYS A 1 9  ? 5.317   8.477   -4.035  1.00 0.00 ? 9  LYS A HA   5  
ATOM 5403  H HB2  . LYS A 1 9  ? 7.739   9.914   -3.102  1.00 0.00 ? 9  LYS A HB2  5  
ATOM 5404  H HB3  . LYS A 1 9  ? 7.426   8.386   -2.257  1.00 0.00 ? 9  LYS A HB3  5  
ATOM 5405  H HG2  . LYS A 1 9  ? 7.078   7.356   -4.577  1.00 0.00 ? 9  LYS A HG2  5  
ATOM 5406  H HG3  . LYS A 1 9  ? 7.777   8.849   -5.233  1.00 0.00 ? 9  LYS A HG3  5  
ATOM 5407  H HD2  . LYS A 1 9  ? 9.110   6.931   -3.268  1.00 0.00 ? 9  LYS A HD2  5  
ATOM 5408  H HD3  . LYS A 1 9  ? 9.526   7.135   -4.980  1.00 0.00 ? 9  LYS A HD3  5  
ATOM 5409  H HE2  . LYS A 1 9  ? 11.119  8.525   -4.078  1.00 0.00 ? 9  LYS A HE2  5  
ATOM 5410  H HE3  . LYS A 1 9  ? 9.794   9.699   -4.192  1.00 0.00 ? 9  LYS A HE3  5  
ATOM 5411  H HZ1  . LYS A 1 9  ? 10.473  8.120   -1.810  1.00 0.00 ? 9  LYS A HZ1  5  
ATOM 5412  H HZ2  . LYS A 1 9  ? 10.841  9.710   -2.044  1.00 0.00 ? 9  LYS A HZ2  5  
ATOM 5413  H HZ3  . LYS A 1 9  ? 9.267   9.241   -1.913  1.00 0.00 ? 9  LYS A HZ3  5  
ATOM 5414  N N    . PHE A 1 10 ? 5.429   9.574   -0.910  1.00 0.00 ? 10 PHE A N    5  
ATOM 5415  C CA   . PHE A 1 10 ? 4.898   9.359   0.424   1.00 0.00 ? 10 PHE A CA   5  
ATOM 5416  C C    . PHE A 1 10 ? 3.376   9.525   0.441   1.00 0.00 ? 10 PHE A C    5  
ATOM 5417  O O    . PHE A 1 10 ? 2.679   8.756   1.098   1.00 0.00 ? 10 PHE A O    5  
ATOM 5418  C CB   . PHE A 1 10 ? 5.577   10.338  1.393   1.00 0.00 ? 10 PHE A CB   5  
ATOM 5419  C CG   . PHE A 1 10 ? 7.041   10.570  1.068   1.00 0.00 ? 10 PHE A CG   5  
ATOM 5420  C CD1  . PHE A 1 10 ? 7.954   9.501   1.130   1.00 0.00 ? 10 PHE A CD1  5  
ATOM 5421  C CD2  . PHE A 1 10 ? 7.482   11.847  0.671   1.00 0.00 ? 10 PHE A CD2  5  
ATOM 5422  C CE1  . PHE A 1 10 ? 9.304   9.708   0.795   1.00 0.00 ? 10 PHE A CE1  5  
ATOM 5423  C CE2  . PHE A 1 10 ? 8.831   12.051  0.333   1.00 0.00 ? 10 PHE A CE2  5  
ATOM 5424  C CZ   . PHE A 1 10 ? 9.742   10.982  0.392   1.00 0.00 ? 10 PHE A CZ   5  
ATOM 5425  H H    . PHE A 1 10 ? 6.163   10.259  -1.025  1.00 0.00 ? 10 PHE A H    5  
ATOM 5426  H HA   . PHE A 1 10 ? 5.144   8.341   0.725   1.00 0.00 ? 10 PHE A HA   5  
ATOM 5427  H HB2  . PHE A 1 10 ? 5.051   11.293  1.351   1.00 0.00 ? 10 PHE A HB2  5  
ATOM 5428  H HB3  . PHE A 1 10 ? 5.499   9.940   2.405   1.00 0.00 ? 10 PHE A HB3  5  
ATOM 5429  H HD1  . PHE A 1 10 ? 7.618   8.519   1.430   1.00 0.00 ? 10 PHE A HD1  5  
ATOM 5430  H HD2  . PHE A 1 10 ? 6.783   12.668  0.616   1.00 0.00 ? 10 PHE A HD2  5  
ATOM 5431  H HE1  . PHE A 1 10 ? 10.004  8.886   0.843   1.00 0.00 ? 10 PHE A HE1  5  
ATOM 5432  H HE2  . PHE A 1 10 ? 9.168   13.030  0.024   1.00 0.00 ? 10 PHE A HE2  5  
ATOM 5433  H HZ   . PHE A 1 10 ? 10.777  11.140  0.125   1.00 0.00 ? 10 PHE A HZ   5  
ATOM 5434  N N    . GLY A 1 11 ? 2.860   10.526  -0.283  1.00 0.00 ? 11 GLY A N    5  
ATOM 5435  C CA   . GLY A 1 11 ? 1.427   10.773  -0.354  1.00 0.00 ? 11 GLY A CA   5  
ATOM 5436  C C    . GLY A 1 11 ? 0.717   9.586   -1.001  1.00 0.00 ? 11 GLY A C    5  
ATOM 5437  O O    . GLY A 1 11 ? -0.317  9.133   -0.511  1.00 0.00 ? 11 GLY A O    5  
ATOM 5438  H H    . GLY A 1 11 ? 3.477   11.136  -0.804  1.00 0.00 ? 11 GLY A H    5  
ATOM 5439  H HA2  . GLY A 1 11 ? 1.035   10.926  0.652   1.00 0.00 ? 11 GLY A HA2  5  
ATOM 5440  H HA3  . GLY A 1 11 ? 1.245   11.667  -0.950  1.00 0.00 ? 11 GLY A HA3  5  
ATOM 5441  N N    . VAL A 1 12 ? 1.279   9.080   -2.106  1.00 0.00 ? 12 VAL A N    5  
ATOM 5442  C CA   . VAL A 1 12 ? 0.709   7.944   -2.812  1.00 0.00 ? 12 VAL A CA   5  
ATOM 5443  C C    . VAL A 1 12 ? 0.676   6.737   -1.871  1.00 0.00 ? 12 VAL A C    5  
ATOM 5444  O O    . VAL A 1 12 ? -0.330  6.033   -1.789  1.00 0.00 ? 12 VAL A O    5  
ATOM 5445  C CB   . VAL A 1 12 ? 1.545   7.644   -4.072  1.00 0.00 ? 12 VAL A CB   5  
ATOM 5446  C CG1  . VAL A 1 12 ? 0.852   6.564   -4.908  1.00 0.00 ? 12 VAL A CG1  5  
ATOM 5447  C CG2  . VAL A 1 12 ? 1.686   8.914   -4.921  1.00 0.00 ? 12 VAL A CG2  5  
ATOM 5448  H H    . VAL A 1 12 ? 2.128   9.491   -2.465  1.00 0.00 ? 12 VAL A H    5  
ATOM 5449  H HA   . VAL A 1 12 ? -0.312  8.187   -3.112  1.00 0.00 ? 12 VAL A HA   5  
ATOM 5450  H HB   . VAL A 1 12 ? 2.535   7.295   -3.780  1.00 0.00 ? 12 VAL A HB   5  
ATOM 5451  H HG11 . VAL A 1 12 ? -0.113  6.935   -5.252  1.00 0.00 ? 12 VAL A HG11 5  
ATOM 5452  H HG12 . VAL A 1 12 ? 1.472   6.319   -5.772  1.00 0.00 ? 12 VAL A HG12 5  
ATOM 5453  H HG13 . VAL A 1 12 ? 0.704   5.670   -4.304  1.00 0.00 ? 12 VAL A HG13 5  
ATOM 5454  H HG21 . VAL A 1 12 ? 0.702   9.354   -5.086  1.00 0.00 ? 12 VAL A HG21 5  
ATOM 5455  H HG22 . VAL A 1 12 ? 2.134   8.661   -5.882  1.00 0.00 ? 12 VAL A HG22 5  
ATOM 5456  H HG23 . VAL A 1 12 ? 2.323   9.631   -4.406  1.00 0.00 ? 12 VAL A HG23 5  
ATOM 5457  N N    . LEU A 1 13 ? 1.784   6.512   -1.154  1.00 0.00 ? 13 LEU A N    5  
ATOM 5458  C CA   . LEU A 1 13 ? 1.891   5.412   -0.210  1.00 0.00 ? 13 LEU A CA   5  
ATOM 5459  C C    . LEU A 1 13 ? 0.843   5.564   0.893   1.00 0.00 ? 13 LEU A C    5  
ATOM 5460  O O    . LEU A 1 13 ? 0.212   4.588   1.278   1.00 0.00 ? 13 LEU A O    5  
ATOM 5461  C CB   . LEU A 1 13 ? 3.310   5.394   0.369   1.00 0.00 ? 13 LEU A CB   5  
ATOM 5462  C CG   . LEU A 1 13 ? 3.453   4.310   1.449   1.00 0.00 ? 13 LEU A CG   5  
ATOM 5463  C CD1  . LEU A 1 13 ? 3.179   2.926   0.850   1.00 0.00 ? 13 LEU A CD1  5  
ATOM 5464  C CD2  . LEU A 1 13 ? 4.877   4.352   2.006   1.00 0.00 ? 13 LEU A CD2  5  
ATOM 5465  H H    . LEU A 1 13 ? 2.581   7.126   -1.266  1.00 0.00 ? 13 LEU A H    5  
ATOM 5466  H HA   . LEU A 1 13 ? 1.715   4.479   -0.740  1.00 0.00 ? 13 LEU A HA   5  
ATOM 5467  H HB2  . LEU A 1 13 ? 4.019   5.195   -0.434  1.00 0.00 ? 13 LEU A HB2  5  
ATOM 5468  H HB3  . LEU A 1 13 ? 3.532   6.367   0.808   1.00 0.00 ? 13 LEU A HB3  5  
ATOM 5469  H HG   . LEU A 1 13 ? 2.747   4.502   2.257   1.00 0.00 ? 13 LEU A HG   5  
ATOM 5470  H HD11 . LEU A 1 13 ? 2.116   2.823   0.632   1.00 0.00 ? 13 LEU A HD11 5  
ATOM 5471  H HD12 . LEU A 1 13 ? 3.750   2.807   -0.070  1.00 0.00 ? 13 LEU A HD12 5  
ATOM 5472  H HD13 . LEU A 1 13 ? 3.474   2.156   1.562   1.00 0.00 ? 13 LEU A HD13 5  
ATOM 5473  H HD21 . LEU A 1 13 ? 5.039   5.303   2.515   1.00 0.00 ? 13 LEU A HD21 5  
ATOM 5474  H HD22 . LEU A 1 13 ? 5.591   4.254   1.188   1.00 0.00 ? 13 LEU A HD22 5  
ATOM 5475  H HD23 . LEU A 1 13 ? 5.017   3.535   2.712   1.00 0.00 ? 13 LEU A HD23 5  
ATOM 5476  N N    . ALA A 1 14 ? 0.657   6.787   1.400   1.00 0.00 ? 14 ALA A N    5  
ATOM 5477  C CA   . ALA A 1 14 ? -0.319  7.045   2.452   1.00 0.00 ? 14 ALA A CA   5  
ATOM 5478  C C    . ALA A 1 14 ? -1.725  6.684   1.968   1.00 0.00 ? 14 ALA A C    5  
ATOM 5479  O O    . ALA A 1 14 ? -2.519  6.137   2.733   1.00 0.00 ? 14 ALA A O    5  
ATOM 5480  C CB   . ALA A 1 14 ? -0.249  8.516   2.862   1.00 0.00 ? 14 ALA A CB   5  
ATOM 5481  H H    . ALA A 1 14 ? 1.204   7.564   1.051   1.00 0.00 ? 14 ALA A H    5  
ATOM 5482  H HA   . ALA A 1 14 ? -0.076  6.425   3.319   1.00 0.00 ? 14 ALA A HA   5  
ATOM 5483  H HB1  . ALA A 1 14 ? -0.516  9.146   2.015   1.00 0.00 ? 14 ALA A HB1  5  
ATOM 5484  H HB2  . ALA A 1 14 ? 0.764   8.757   3.187   1.00 0.00 ? 14 ALA A HB2  5  
ATOM 5485  H HB3  . ALA A 1 14 ? -0.945  8.699   3.682   1.00 0.00 ? 14 ALA A HB3  5  
ATOM 5486  N N    . LYS A 1 15 ? -2.034  6.982   0.697   1.00 0.00 ? 15 LYS A N    5  
ATOM 5487  C CA   . LYS A 1 15 ? -3.337  6.679   0.134   1.00 0.00 ? 15 LYS A CA   5  
ATOM 5488  C C    . LYS A 1 15 ? -3.496  5.165   0.023   1.00 0.00 ? 15 LYS A C    5  
ATOM 5489  O O    . LYS A 1 15 ? -4.558  4.630   0.326   1.00 0.00 ? 15 LYS A O    5  
ATOM 5490  C CB   . LYS A 1 15 ? -3.472  7.358   -1.232  1.00 0.00 ? 15 LYS A CB   5  
ATOM 5491  C CG   . LYS A 1 15 ? -4.922  7.266   -1.719  1.00 0.00 ? 15 LYS A CG   5  
ATOM 5492  C CD   . LYS A 1 15 ? -5.122  8.219   -2.903  1.00 0.00 ? 15 LYS A CD   5  
ATOM 5493  C CE   . LYS A 1 15 ? -6.569  8.146   -3.405  1.00 0.00 ? 15 LYS A CE   5  
ATOM 5494  N NZ   . LYS A 1 15 ? -6.851  6.850   -4.050  1.00 0.00 ? 15 LYS A NZ   5  
ATOM 5495  H H    . LYS A 1 15 ? -1.349  7.429   0.103   1.00 0.00 ? 15 LYS A H    5  
ATOM 5496  H HA   . LYS A 1 15 ? -4.107  7.068   0.801   1.00 0.00 ? 15 LYS A HA   5  
ATOM 5497  H HB2  . LYS A 1 15 ? -3.189  8.408   -1.141  1.00 0.00 ? 15 LYS A HB2  5  
ATOM 5498  H HB3  . LYS A 1 15 ? -2.816  6.869   -1.951  1.00 0.00 ? 15 LYS A HB3  5  
ATOM 5499  H HG2  . LYS A 1 15 ? -5.136  6.244   -2.029  1.00 0.00 ? 15 LYS A HG2  5  
ATOM 5500  H HG3  . LYS A 1 15 ? -5.597  7.548   -0.909  1.00 0.00 ? 15 LYS A HG3  5  
ATOM 5501  H HD2  . LYS A 1 15 ? -4.904  9.239   -2.583  1.00 0.00 ? 15 LYS A HD2  5  
ATOM 5502  H HD3  . LYS A 1 15 ? -4.444  7.943   -3.707  1.00 0.00 ? 15 LYS A HD3  5  
ATOM 5503  H HE2  . LYS A 1 15 ? -7.248  8.281   -2.561  1.00 0.00 ? 15 LYS A HE2  5  
ATOM 5504  H HE3  . LYS A 1 15 ? -6.735  8.946   -4.127  1.00 0.00 ? 15 LYS A HE3  5  
ATOM 5505  H HZ1  . LYS A 1 15 ? -6.227  6.720   -4.840  1.00 0.00 ? 15 LYS A HZ1  5  
ATOM 5506  H HZ2  . LYS A 1 15 ? -6.711  6.104   -3.385  1.00 0.00 ? 15 LYS A HZ2  5  
ATOM 5507  H HZ3  . LYS A 1 15 ? -7.808  6.836   -4.373  1.00 0.00 ? 15 LYS A HZ3  5  
ATOM 5508  N N    . ILE A 1 16 ? -2.429  4.477   -0.406  1.00 0.00 ? 16 ILE A N    5  
ATOM 5509  C CA   . ILE A 1 16 ? -2.438  3.026   -0.526  1.00 0.00 ? 16 ILE A CA   5  
ATOM 5510  C C    . ILE A 1 16 ? -2.661  2.399   0.852   1.00 0.00 ? 16 ILE A C    5  
ATOM 5511  O O    . ILE A 1 16 ? -3.475  1.488   0.996   1.00 0.00 ? 16 ILE A O    5  
ATOM 5512  C CB   . ILE A 1 16 ? -1.107  2.561   -1.146  1.00 0.00 ? 16 ILE A CB   5  
ATOM 5513  C CG1  . ILE A 1 16 ? -1.106  2.876   -2.652  1.00 0.00 ? 16 ILE A CG1  5  
ATOM 5514  C CG2  . ILE A 1 16 ? -0.936  1.052   -0.931  1.00 0.00 ? 16 ILE A CG2  5  
ATOM 5515  C CD1  . ILE A 1 16 ? 0.330   2.930   -3.181  1.00 0.00 ? 16 ILE A CD1  5  
ATOM 5516  H H    . ILE A 1 16 ? -1.581  4.973   -0.652  1.00 0.00 ? 16 ILE A H    5  
ATOM 5517  H HA   . ILE A 1 16 ? -3.253  2.730   -1.178  1.00 0.00 ? 16 ILE A HA   5  
ATOM 5518  H HB   . ILE A 1 16 ? -0.283  3.086   -0.667  1.00 0.00 ? 16 ILE A HB   5  
ATOM 5519  H HG12 . ILE A 1 16 ? -1.654  2.101   -3.186  1.00 0.00 ? 16 ILE A HG12 5  
ATOM 5520  H HG13 . ILE A 1 16 ? -1.588  3.842   -2.825  1.00 0.00 ? 16 ILE A HG13 5  
ATOM 5521  H HG21 . ILE A 1 16 ? -0.707  0.856   0.117   1.00 0.00 ? 16 ILE A HG21 5  
ATOM 5522  H HG22 . ILE A 1 16 ? -1.859  0.538   -1.201  1.00 0.00 ? 16 ILE A HG22 5  
ATOM 5523  H HG23 . ILE A 1 16 ? -0.122  0.682   -1.551  1.00 0.00 ? 16 ILE A HG23 5  
ATOM 5524  H HD11 . ILE A 1 16 ? 0.824   1.977   -3.001  1.00 0.00 ? 16 ILE A HD11 5  
ATOM 5525  H HD12 . ILE A 1 16 ? 0.314   3.132   -4.252  1.00 0.00 ? 16 ILE A HD12 5  
ATOM 5526  H HD13 . ILE A 1 16 ? 0.875   3.723   -2.674  1.00 0.00 ? 16 ILE A HD13 5  
ATOM 5527  N N    . VAL A 1 17 ? -1.940  2.896   1.860   1.00 0.00 ? 17 VAL A N    5  
ATOM 5528  C CA   . VAL A 1 17 ? -2.058  2.406   3.223   1.00 0.00 ? 17 VAL A CA   5  
ATOM 5529  C C    . VAL A 1 17 ? -3.493  2.589   3.712   1.00 0.00 ? 17 VAL A C    5  
ATOM 5530  O O    . VAL A 1 17 ? -4.094  1.651   4.228   1.00 0.00 ? 17 VAL A O    5  
ATOM 5531  C CB   . VAL A 1 17 ? -1.065  3.170   4.113   1.00 0.00 ? 17 VAL A CB   5  
ATOM 5532  C CG1  . VAL A 1 17 ? -1.419  2.986   5.592   1.00 0.00 ? 17 VAL A CG1  5  
ATOM 5533  C CG2  . VAL A 1 17 ? 0.349   2.644   3.866   1.00 0.00 ? 17 VAL A CG2  5  
ATOM 5534  H H    . VAL A 1 17 ? -1.286  3.643   1.679   1.00 0.00 ? 17 VAL A H    5  
ATOM 5535  H HA   . VAL A 1 17 ? -1.810  1.343   3.243   1.00 0.00 ? 17 VAL A HA   5  
ATOM 5536  H HB   . VAL A 1 17 ? -1.101  4.231   3.866   1.00 0.00 ? 17 VAL A HB   5  
ATOM 5537  H HG11 . VAL A 1 17 ? -2.339  3.524   5.819   1.00 0.00 ? 17 VAL A HG11 5  
ATOM 5538  H HG12 . VAL A 1 17 ? -0.611  3.381   6.208   1.00 0.00 ? 17 VAL A HG12 5  
ATOM 5539  H HG13 . VAL A 1 17 ? -1.553  1.925   5.808   1.00 0.00 ? 17 VAL A HG13 5  
ATOM 5540  H HG21 . VAL A 1 17 ? 0.459   1.664   4.334   1.00 0.00 ? 17 VAL A HG21 5  
ATOM 5541  H HG22 . VAL A 1 17 ? 0.527   2.555   2.796   1.00 0.00 ? 17 VAL A HG22 5  
ATOM 5542  H HG23 . VAL A 1 17 ? 1.071   3.336   4.298   1.00 0.00 ? 17 VAL A HG23 5  
ATOM 5543  N N    . ASN A 1 18 ? -4.036  3.800   3.548   1.00 0.00 ? 18 ASN A N    5  
ATOM 5544  C CA   . ASN A 1 18 ? -5.394  4.103   3.975   1.00 0.00 ? 18 ASN A CA   5  
ATOM 5545  C C    . ASN A 1 18 ? -6.388  3.174   3.273   1.00 0.00 ? 18 ASN A C    5  
ATOM 5546  O O    . ASN A 1 18 ? -7.306  2.664   3.906   1.00 0.00 ? 18 ASN A O    5  
ATOM 5547  C CB   . ASN A 1 18 ? -5.710  5.566   3.661   1.00 0.00 ? 18 ASN A CB   5  
ATOM 5548  C CG   . ASN A 1 18 ? -7.170  5.884   3.968   1.00 0.00 ? 18 ASN A CG   5  
ATOM 5549  O OD1  . ASN A 1 18 ? -7.972  6.062   3.056   1.00 0.00 ? 18 ASN A OD1  5  
ATOM 5550  N ND2  . ASN A 1 18 ? -7.513  5.953   5.254   1.00 0.00 ? 18 ASN A ND2  5  
ATOM 5551  H H    . ASN A 1 18 ? -3.494  4.538   3.114   1.00 0.00 ? 18 ASN A H    5  
ATOM 5552  H HA   . ASN A 1 18 ? -5.466  3.947   5.056   1.00 0.00 ? 18 ASN A HA   5  
ATOM 5553  H HB2  . ASN A 1 18 ? -5.068  6.210   4.263   1.00 0.00 ? 18 ASN A HB2  5  
ATOM 5554  H HB3  . ASN A 1 18 ? -5.518  5.756   2.604   1.00 0.00 ? 18 ASN A HB3  5  
ATOM 5555  H HD21 . ASN A 1 18 ? -6.815  5.815   5.970   1.00 0.00 ? 18 ASN A HD21 5  
ATOM 5556  H HD22 . ASN A 1 18 ? -8.471  6.142   5.508   1.00 0.00 ? 18 ASN A HD22 5  
ATOM 5557  N N    . TYR A 1 19 ? -6.202  2.962   1.966   1.00 0.00 ? 19 TYR A N    5  
ATOM 5558  C CA   . TYR A 1 19 ? -7.081  2.097   1.188   1.00 0.00 ? 19 TYR A CA   5  
ATOM 5559  C C    . TYR A 1 19 ? -7.055  0.677   1.763   1.00 0.00 ? 19 TYR A C    5  
ATOM 5560  O O    . TYR A 1 19 ? -8.098  0.150   2.150   1.00 0.00 ? 19 TYR A O    5  
ATOM 5561  C CB   . TYR A 1 19 ? -6.640  2.113   -0.286  1.00 0.00 ? 19 TYR A CB   5  
ATOM 5562  C CG   . TYR A 1 19 ? -6.734  0.763   -0.965  1.00 0.00 ? 19 TYR A CG   5  
ATOM 5563  C CD1  . TYR A 1 19 ? -7.979  0.129   -1.107  1.00 0.00 ? 19 TYR A CD1  5  
ATOM 5564  C CD2  . TYR A 1 19 ? -5.571  0.133   -1.438  1.00 0.00 ? 19 TYR A CD2  5  
ATOM 5565  C CE1  . TYR A 1 19 ? -8.056  -1.134  -1.716  1.00 0.00 ? 19 TYR A CE1  5  
ATOM 5566  C CE2  . TYR A 1 19 ? -5.655  -1.126  -2.048  1.00 0.00 ? 19 TYR A CE2  5  
ATOM 5567  C CZ   . TYR A 1 19 ? -6.894  -1.760  -2.186  1.00 0.00 ? 19 TYR A CZ   5  
ATOM 5568  O OH   . TYR A 1 19 ? -6.968  -2.984  -2.778  1.00 0.00 ? 19 TYR A OH   5  
ATOM 5569  H H    . TYR A 1 19 ? -5.429  3.411   1.491   1.00 0.00 ? 19 TYR A H    5  
ATOM 5570  H HA   . TYR A 1 19 ? -8.100  2.482   1.252   1.00 0.00 ? 19 TYR A HA   5  
ATOM 5571  H HB2  . TYR A 1 19 ? -7.265  2.822   -0.830  1.00 0.00 ? 19 TYR A HB2  5  
ATOM 5572  H HB3  . TYR A 1 19 ? -5.606  2.451   -0.338  1.00 0.00 ? 19 TYR A HB3  5  
ATOM 5573  H HD1  . TYR A 1 19 ? -8.876  0.609   -0.743  1.00 0.00 ? 19 TYR A HD1  5  
ATOM 5574  H HD2  . TYR A 1 19 ? -4.612  0.615   -1.327  1.00 0.00 ? 19 TYR A HD2  5  
ATOM 5575  H HE1  . TYR A 1 19 ? -9.008  -1.620  -1.823  1.00 0.00 ? 19 TYR A HE1  5  
ATOM 5576  H HE2  . TYR A 1 19 ? -4.764  -1.609  -2.405  1.00 0.00 ? 19 TYR A HE2  5  
ATOM 5577  H HH   . TYR A 1 19 ? -7.865  -3.321  -2.834  1.00 0.00 ? 19 TYR A HH   5  
ATOM 5578  N N    . MET A 1 20 ? -5.864  0.062   1.813   1.00 0.00 ? 20 MET A N    5  
ATOM 5579  C CA   . MET A 1 20 ? -5.709  -1.294  2.327   1.00 0.00 ? 20 MET A CA   5  
ATOM 5580  C C    . MET A 1 20 ? -6.300  -1.390  3.730   1.00 0.00 ? 20 MET A C    5  
ATOM 5581  O O    . MET A 1 20 ? -6.976  -2.362  4.055   1.00 0.00 ? 20 MET A O    5  
ATOM 5582  C CB   . MET A 1 20 ? -4.220  -1.666  2.344   1.00 0.00 ? 20 MET A CB   5  
ATOM 5583  C CG   . MET A 1 20 ? -3.718  -1.939  0.922   1.00 0.00 ? 20 MET A CG   5  
ATOM 5584  S SD   . MET A 1 20 ? -4.470  -3.384  0.122   1.00 0.00 ? 20 MET A SD   5  
ATOM 5585  C CE   . MET A 1 20 ? -3.848  -4.694  1.204   1.00 0.00 ? 20 MET A CE   5  
ATOM 5586  H H    . MET A 1 20 ? -5.040  0.545   1.483   1.00 0.00 ? 20 MET A H    5  
ATOM 5587  H HA   . MET A 1 20 ? -6.242  -1.987  1.679   1.00 0.00 ? 20 MET A HA   5  
ATOM 5588  H HB2  . MET A 1 20 ? -3.647  -0.845  2.779   1.00 0.00 ? 20 MET A HB2  5  
ATOM 5589  H HB3  . MET A 1 20 ? -4.079  -2.556  2.946   1.00 0.00 ? 20 MET A HB3  5  
ATOM 5590  H HG2  . MET A 1 20 ? -3.919  -1.063  0.311   1.00 0.00 ? 20 MET A HG2  5  
ATOM 5591  H HG3  . MET A 1 20 ? -2.639  -2.091  0.960   1.00 0.00 ? 20 MET A HG3  5  
ATOM 5592  H HE1  . MET A 1 20 ? -2.764  -4.608  1.294   1.00 0.00 ? 20 MET A HE1  5  
ATOM 5593  H HE2  . MET A 1 20 ? -4.303  -4.602  2.188   1.00 0.00 ? 20 MET A HE2  5  
ATOM 5594  H HE3  . MET A 1 20 ? -4.100  -5.666  0.778   1.00 0.00 ? 20 MET A HE3  5  
ATOM 5595  N N    . LYS A 1 21 ? -6.043  -0.377  4.559   1.00 0.00 ? 21 LYS A N    5  
ATOM 5596  C CA   . LYS A 1 21 ? -6.537  -0.342  5.922   1.00 0.00 ? 21 LYS A CA   5  
ATOM 5597  C C    . LYS A 1 21 ? -8.064  -0.353  5.938   1.00 0.00 ? 21 LYS A C    5  
ATOM 5598  O O    . LYS A 1 21 ? -8.662  -1.151  6.648   1.00 0.00 ? 21 LYS A O    5  
ATOM 5599  C CB   . LYS A 1 21 ? -5.983  0.908   6.614   1.00 0.00 ? 21 LYS A CB   5  
ATOM 5600  C CG   . LYS A 1 21 ? -6.430  0.952   8.082   1.00 0.00 ? 21 LYS A CG   5  
ATOM 5601  C CD   . LYS A 1 21 ? -7.760  1.710   8.213   1.00 0.00 ? 21 LYS A CD   5  
ATOM 5602  C CE   . LYS A 1 21 ? -7.753  2.547   9.493   1.00 0.00 ? 21 LYS A CE   5  
ATOM 5603  N NZ   . LYS A 1 21 ? -7.923  1.699   10.686  1.00 0.00 ? 21 LYS A NZ   5  
ATOM 5604  H H    . LYS A 1 21 ? -5.482  0.401   4.234   1.00 0.00 ? 21 LYS A H    5  
ATOM 5605  H HA   . LYS A 1 21 ? -6.175  -1.225  6.448   1.00 0.00 ? 21 LYS A HA   5  
ATOM 5606  H HB2  . LYS A 1 21 ? -4.895  0.884   6.574   1.00 0.00 ? 21 LYS A HB2  5  
ATOM 5607  H HB3  . LYS A 1 21 ? -6.335  1.798   6.095   1.00 0.00 ? 21 LYS A HB3  5  
ATOM 5608  H HG2  . LYS A 1 21 ? -6.554  -0.065  8.455   1.00 0.00 ? 21 LYS A HG2  5  
ATOM 5609  H HG3  . LYS A 1 21 ? -5.664  1.458   8.669   1.00 0.00 ? 21 LYS A HG3  5  
ATOM 5610  H HD2  . LYS A 1 21 ? -7.894  2.369   7.358   1.00 0.00 ? 21 LYS A HD2  5  
ATOM 5611  H HD3  . LYS A 1 21 ? -8.583  0.996   8.251   1.00 0.00 ? 21 LYS A HD3  5  
ATOM 5612  H HE2  . LYS A 1 21 ? -6.806  3.086   9.564   1.00 0.00 ? 21 LYS A HE2  5  
ATOM 5613  H HE3  . LYS A 1 21 ? -8.569  3.268   9.449   1.00 0.00 ? 21 LYS A HE3  5  
ATOM 5614  H HZ1  . LYS A 1 21 ? -7.832  2.265   11.518  1.00 0.00 ? 21 LYS A HZ1  5  
ATOM 5615  H HZ2  . LYS A 1 21 ? -7.218  0.977   10.690  1.00 0.00 ? 21 LYS A HZ2  5  
ATOM 5616  H HZ3  . LYS A 1 21 ? -8.843  1.272   10.669  1.00 0.00 ? 21 LYS A HZ3  5  
ATOM 5617  N N    . THR A 1 22 ? -8.694  0.536   5.164   1.00 0.00 ? 22 THR A N    5  
ATOM 5618  C CA   . THR A 1 22 ? -10.147 0.642   5.128   1.00 0.00 ? 22 THR A CA   5  
ATOM 5619  C C    . THR A 1 22 ? -10.764 -0.666  4.628   1.00 0.00 ? 22 THR A C    5  
ATOM 5620  O O    . THR A 1 22 ? -11.686 -1.187  5.250   1.00 0.00 ? 22 THR A O    5  
ATOM 5621  C CB   . THR A 1 22 ? -10.547 1.820   4.228   1.00 0.00 ? 22 THR A CB   5  
ATOM 5622  O OG1  . THR A 1 22 ? -9.963  3.006   4.724   1.00 0.00 ? 22 THR A OG1  5  
ATOM 5623  C CG2  . THR A 1 22 ? -12.069 1.977   4.219   1.00 0.00 ? 22 THR A CG2  5  
ATOM 5624  H H    . THR A 1 22 ? -8.153  1.166   4.586   1.00 0.00 ? 22 THR A H    5  
ATOM 5625  H HA   . THR A 1 22 ? -10.509 0.832   6.142   1.00 0.00 ? 22 THR A HA   5  
ATOM 5626  H HB   . THR A 1 22 ? -10.194 1.640   3.212   1.00 0.00 ? 22 THR A HB   5  
ATOM 5627  H HG1  . THR A 1 22 ? -9.022  2.993   4.519   1.00 0.00 ? 22 THR A HG1  5  
ATOM 5628  H HG21 . THR A 1 22 ? -12.523 1.114   3.731   1.00 0.00 ? 22 THR A HG21 5  
ATOM 5629  H HG22 . THR A 1 22 ? -12.435 2.049   5.243   1.00 0.00 ? 22 THR A HG22 5  
ATOM 5630  H HG23 . THR A 1 22 ? -12.336 2.882   3.674   1.00 0.00 ? 22 THR A HG23 5  
ATOM 5631  N N    . ARG A 1 23 ? -10.259 -1.198  3.507   1.00 0.00 ? 23 ARG A N    5  
ATOM 5632  C CA   . ARG A 1 23 ? -10.767 -2.447  2.953   1.00 0.00 ? 23 ARG A CA   5  
ATOM 5633  C C    . ARG A 1 23 ? -10.630 -3.559  3.995   1.00 0.00 ? 23 ARG A C    5  
ATOM 5634  O O    . ARG A 1 23 ? -11.565 -4.331  4.210   1.00 0.00 ? 23 ARG A O    5  
ATOM 5635  C CB   . ARG A 1 23 ? -9.993  -2.797  1.672   1.00 0.00 ? 23 ARG A CB   5  
ATOM 5636  C CG   . ARG A 1 23 ? -10.730 -2.256  0.433   1.00 0.00 ? 23 ARG A CG   5  
ATOM 5637  C CD   . ARG A 1 23 ? -10.745 -3.334  -0.655  1.00 0.00 ? 23 ARG A CD   5  
ATOM 5638  N NE   . ARG A 1 23 ? -11.331 -2.831  -1.907  1.00 0.00 ? 23 ARG A NE   5  
ATOM 5639  C CZ   . ARG A 1 23 ? -11.788 -3.646  -2.879  1.00 0.00 ? 23 ARG A CZ   5  
ATOM 5640  N NH1  . ARG A 1 23 ? -11.596 -4.968  -2.795  1.00 0.00 ? 23 ARG A NH1  5  
ATOM 5641  N NH2  . ARG A 1 23 ? -12.435 -3.137  -3.937  1.00 0.00 ? 23 ARG A NH2  5  
ATOM 5642  H H    . ARG A 1 23 ? -9.501  -0.730  3.026   1.00 0.00 ? 23 ARG A H    5  
ATOM 5643  H HA   . ARG A 1 23 ? -11.822 -2.326  2.715   1.00 0.00 ? 23 ARG A HA   5  
ATOM 5644  H HB2  . ARG A 1 23 ? -8.994  -2.360  1.719   1.00 0.00 ? 23 ARG A HB2  5  
ATOM 5645  H HB3  . ARG A 1 23 ? -9.902  -3.877  1.594   1.00 0.00 ? 23 ARG A HB3  5  
ATOM 5646  H HG2  . ARG A 1 23 ? -11.755 -1.996  0.693   1.00 0.00 ? 23 ARG A HG2  5  
ATOM 5647  H HG3  . ARG A 1 23 ? -10.217 -1.369  0.066   1.00 0.00 ? 23 ARG A HG3  5  
ATOM 5648  H HD2  . ARG A 1 23 ? -9.723  -3.665  -0.846  1.00 0.00 ? 23 ARG A HD2  5  
ATOM 5649  H HD3  . ARG A 1 23 ? -11.334 -4.179  -0.302  1.00 0.00 ? 23 ARG A HD3  5  
ATOM 5650  H HE   . ARG A 1 23 ? -11.386 -1.823  -2.034  1.00 0.00 ? 23 ARG A HE   5  
ATOM 5651  H HH11 . ARG A 1 23 ? -11.073 -5.360  -2.014  1.00 0.00 ? 23 ARG A HH11 5  
ATOM 5652  H HH12 . ARG A 1 23 ? -11.966 -5.580  -3.506  1.00 0.00 ? 23 ARG A HH12 5  
ATOM 5653  H HH21 . ARG A 1 23 ? -12.521 -2.128  -4.046  1.00 0.00 ? 23 ARG A HH21 5  
ATOM 5654  H HH22 . ARG A 1 23 ? -12.835 -3.752  -4.628  1.00 0.00 ? 23 ARG A HH22 5  
ATOM 5655  N N    . HIS A 1 24 ? -9.466  -3.627  4.649   1.00 0.00 ? 24 HIS A N    5  
ATOM 5656  C CA   . HIS A 1 24 ? -9.213  -4.608  5.694   1.00 0.00 ? 24 HIS A CA   5  
ATOM 5657  C C    . HIS A 1 24 ? -10.191 -4.385  6.856   1.00 0.00 ? 24 HIS A C    5  
ATOM 5658  O O    . HIS A 1 24 ? -10.625 -5.336  7.498   1.00 0.00 ? 24 HIS A O    5  
ATOM 5659  C CB   . HIS A 1 24 ? -7.751  -4.465  6.141   1.00 0.00 ? 24 HIS A CB   5  
ATOM 5660  C CG   . HIS A 1 24 ? -7.346  -5.435  7.218   1.00 0.00 ? 24 HIS A CG   5  
ATOM 5661  N ND1  . HIS A 1 24 ? -6.611  -6.588  6.958   1.00 0.00 ? 24 HIS A ND1  5  
ATOM 5662  C CD2  . HIS A 1 24 ? -7.525  -5.433  8.575   1.00 0.00 ? 24 HIS A CD2  5  
ATOM 5663  C CE1  . HIS A 1 24 ? -6.408  -7.195  8.146   1.00 0.00 ? 24 HIS A CE1  5  
ATOM 5664  N NE2  . HIS A 1 24 ? -6.940  -6.538  9.175   1.00 0.00 ? 24 HIS A NE2  5  
ATOM 5665  H H    . HIS A 1 24 ? -8.729  -2.972  4.422   1.00 0.00 ? 24 HIS A H    5  
ATOM 5666  H HA   . HIS A 1 24 ? -9.366  -5.607  5.289   1.00 0.00 ? 24 HIS A HA   5  
ATOM 5667  H HB2  . HIS A 1 24 ? -7.107  -4.620  5.276   1.00 0.00 ? 24 HIS A HB2  5  
ATOM 5668  H HB3  . HIS A 1 24 ? -7.597  -3.453  6.513   1.00 0.00 ? 24 HIS A HB3  5  
ATOM 5669  H HD1  . HIS A 1 24 ? -6.289  -6.909  6.056   1.00 0.00 ? 24 HIS A HD1  5  
ATOM 5670  H HD2  . HIS A 1 24 ? -8.042  -4.658  9.111   1.00 0.00 ? 24 HIS A HD2  5  
ATOM 5671  H HE1  . HIS A 1 24 ? -5.861  -8.119  8.254   1.00 0.00 ? 24 HIS A HE1  5  
ATOM 5672  N N    . GLN A 1 25 ? -10.541 -3.120  7.114   1.00 0.00 ? 25 GLN A N    5  
ATOM 5673  C CA   . GLN A 1 25 ? -11.474 -2.767  8.175   1.00 0.00 ? 25 GLN A CA   5  
ATOM 5674  C C    . GLN A 1 25 ? -12.909 -3.150  7.781   1.00 0.00 ? 25 GLN A C    5  
ATOM 5675  O O    . GLN A 1 25 ? -13.784 -3.217  8.643   1.00 0.00 ? 25 GLN A O    5  
ATOM 5676  C CB   . GLN A 1 25 ? -11.370 -1.257  8.438   1.00 0.00 ? 25 GLN A CB   5  
ATOM 5677  C CG   . GLN A 1 25 ? -11.821 -0.935  9.860   1.00 0.00 ? 25 GLN A CG   5  
ATOM 5678  C CD   . GLN A 1 25 ? -11.678 0.556   10.142  1.00 0.00 ? 25 GLN A CD   5  
ATOM 5679  O OE1  . GLN A 1 25 ? -10.615 1.010   10.564  1.00 0.00 ? 25 GLN A OE1  5  
ATOM 5680  N NE2  . GLN A 1 25 ? -12.746 1.320   9.908   1.00 0.00 ? 25 GLN A NE2  5  
ATOM 5681  H H    . GLN A 1 25 ? -10.150 -2.372  6.554   1.00 0.00 ? 25 GLN A H    5  
ATOM 5682  H HA   . GLN A 1 25 ? -11.198 -3.306  9.080   1.00 0.00 ? 25 GLN A HA   5  
ATOM 5683  H HB2  . GLN A 1 25 ? -10.337 -0.940  8.318   1.00 0.00 ? 25 GLN A HB2  5  
ATOM 5684  H HB3  . GLN A 1 25 ? -11.996 -0.718  7.728   1.00 0.00 ? 25 GLN A HB3  5  
ATOM 5685  H HG2  . GLN A 1 25 ? -12.862 -1.229  9.988   1.00 0.00 ? 25 GLN A HG2  5  
ATOM 5686  H HG3  . GLN A 1 25 ? -11.203 -1.488  10.561  1.00 0.00 ? 25 GLN A HG3  5  
ATOM 5687  H HE21 . GLN A 1 25 ? -13.596 0.904   9.561   1.00 0.00 ? 25 GLN A HE21 5  
ATOM 5688  H HE22 . GLN A 1 25 ? -12.700 2.314   10.080  1.00 0.00 ? 25 GLN A HE22 5  
ATOM 5689  N N    . ARG A 1 26 ? -13.150 -3.392  6.480   1.00 0.00 ? 26 ARG A N    5  
ATOM 5690  C CA   . ARG A 1 26 ? -14.475 -3.750  5.981   1.00 0.00 ? 26 ARG A CA   5  
ATOM 5691  C C    . ARG A 1 26 ? -14.636 -5.271  5.956   1.00 0.00 ? 26 ARG A C    5  
ATOM 5692  O O    . ARG A 1 26 ? -15.611 -5.795  6.490   1.00 0.00 ? 26 ARG A O    5  
ATOM 5693  C CB   . ARG A 1 26 ? -14.668 -3.162  4.569   1.00 0.00 ? 26 ARG A CB   5  
ATOM 5694  C CG   . ARG A 1 26 ? -15.702 -2.022  4.586   1.00 0.00 ? 26 ARG A CG   5  
ATOM 5695  C CD   . ARG A 1 26 ? -15.088 -0.748  5.183   1.00 0.00 ? 26 ARG A CD   5  
ATOM 5696  N NE   . ARG A 1 26 ? -14.898 -0.875  6.633   1.00 0.00 ? 26 ARG A NE   5  
ATOM 5697  C CZ   . ARG A 1 26 ? -15.907 -0.805  7.523   1.00 0.00 ? 26 ARG A CZ   5  
ATOM 5698  N NH1  . ARG A 1 26 ? -17.104 -0.326  7.155   1.00 0.00 ? 26 ARG A NH1  5  
ATOM 5699  N NH2  . ARG A 1 26 ? -15.712 -1.220  8.779   1.00 0.00 ? 26 ARG A NH2  5  
ATOM 5700  H H    . ARG A 1 26 ? -12.393 -3.323  5.812   1.00 0.00 ? 26 ARG A H    5  
ATOM 5701  H HA   . ARG A 1 26 ? -15.232 -3.336  6.644   1.00 0.00 ? 26 ARG A HA   5  
ATOM 5702  H HB2  . ARG A 1 26 ? -13.717 -2.781  4.198   1.00 0.00 ? 26 ARG A HB2  5  
ATOM 5703  H HB3  . ARG A 1 26 ? -15.020 -3.948  3.898   1.00 0.00 ? 26 ARG A HB3  5  
ATOM 5704  H HG2  . ARG A 1 26 ? -16.020 -1.818  3.563   1.00 0.00 ? 26 ARG A HG2  5  
ATOM 5705  H HG3  . ARG A 1 26 ? -16.568 -2.324  5.176   1.00 0.00 ? 26 ARG A HG3  5  
ATOM 5706  H HD2  . ARG A 1 26 ? -14.121 -0.565  4.713   1.00 0.00 ? 26 ARG A HD2  5  
ATOM 5707  H HD3  . ARG A 1 26 ? -15.743 0.097   4.976   1.00 0.00 ? 26 ARG A HD3  5  
ATOM 5708  H HE   . ARG A 1 26 ? -13.958 -1.030  6.967   1.00 0.00 ? 26 ARG A HE   5  
ATOM 5709  H HH11 . ARG A 1 26 ? -17.257 -0.021  6.206   1.00 0.00 ? 26 ARG A HH11 5  
ATOM 5710  H HH12 . ARG A 1 26 ? -17.855 -0.271  7.828   1.00 0.00 ? 26 ARG A HH12 5  
ATOM 5711  H HH21 . ARG A 1 26 ? -14.863 -1.719  9.022   1.00 0.00 ? 26 ARG A HH21 5  
ATOM 5712  H HH22 . ARG A 1 26 ? -16.411 -1.043  9.485   1.00 0.00 ? 26 ARG A HH22 5  
ATOM 5713  N N    . GLY A 1 27 ? -13.688 -5.975  5.331   1.00 0.00 ? 27 GLY A N    5  
ATOM 5714  C CA   . GLY A 1 27 ? -13.756 -7.427  5.223   1.00 0.00 ? 27 GLY A CA   5  
ATOM 5715  C C    . GLY A 1 27 ? -12.652 -7.958  4.309   1.00 0.00 ? 27 GLY A C    5  
ATOM 5716  O O    . GLY A 1 27 ? -12.172 -9.074  4.505   1.00 0.00 ? 27 GLY A O    5  
ATOM 5717  H H    . GLY A 1 27 ? -12.898 -5.496  4.915   1.00 0.00 ? 27 GLY A H    5  
ATOM 5718  H HA2  . GLY A 1 27 ? -13.642 -7.866  6.215   1.00 0.00 ? 27 GLY A HA2  5  
ATOM 5719  H HA3  . GLY A 1 27 ? -14.725 -7.712  4.814   1.00 0.00 ? 27 GLY A HA3  5  
ATOM 5720  N N    . ASP A 1 28 ? -12.251 -7.159  3.313   1.00 0.00 ? 28 ASP A N    5  
ATOM 5721  C CA   . ASP A 1 28 ? -11.195 -7.539  2.388   1.00 0.00 ? 28 ASP A CA   5  
ATOM 5722  C C    . ASP A 1 28 ? -9.842  -7.408  3.097   1.00 0.00 ? 28 ASP A C    5  
ATOM 5723  O O    . ASP A 1 28 ? -9.118  -6.432  2.898   1.00 0.00 ? 28 ASP A O    5  
ATOM 5724  C CB   . ASP A 1 28 ? -11.277 -6.637  1.153   1.00 0.00 ? 28 ASP A CB   5  
ATOM 5725  C CG   . ASP A 1 28 ? -10.217 -7.006  0.123   1.00 0.00 ? 28 ASP A CG   5  
ATOM 5726  O OD1  . ASP A 1 28 ? -9.491  -7.985  0.377   1.00 0.00 ? 28 ASP A OD1  5  
ATOM 5727  O OD2  . ASP A 1 28 ? -10.155 -6.298  -0.905  1.00 0.00 ? 28 ASP A OD2  5  
ATOM 5728  H H    . ASP A 1 28 ? -12.684 -6.255  3.194   1.00 0.00 ? 28 ASP A H    5  
ATOM 5729  H HA   . ASP A 1 28 ? -11.338 -8.577  2.078   1.00 0.00 ? 28 ASP A HA   5  
ATOM 5730  H HB2  . ASP A 1 28 ? -12.262 -6.744  0.700   1.00 0.00 ? 28 ASP A HB2  5  
ATOM 5731  H HB3  . ASP A 1 28 ? -11.138 -5.605  1.457   1.00 0.00 ? 28 ASP A HB3  5  
ATOM 5732  N N    . THR A 1 29 ? -9.517  -8.399  3.937   1.00 0.00 ? 29 THR A N    5  
ATOM 5733  C CA   . THR A 1 29 ? -8.286  -8.401  4.714   1.00 0.00 ? 29 THR A CA   5  
ATOM 5734  C C    . THR A 1 29 ? -7.173  -9.168  3.988   1.00 0.00 ? 29 THR A C    5  
ATOM 5735  O O    . THR A 1 29 ? -6.003  -9.027  4.343   1.00 0.00 ? 29 THR A O    5  
ATOM 5736  C CB   . THR A 1 29 ? -8.564  -9.055  6.079   1.00 0.00 ? 29 THR A CB   5  
ATOM 5737  O OG1  . THR A 1 29 ? -9.013  -10.380 5.886   1.00 0.00 ? 29 THR A OG1  5  
ATOM 5738  C CG2  . THR A 1 29 ? -9.631  -8.268  6.839   1.00 0.00 ? 29 THR A CG2  5  
ATOM 5739  H H    . THR A 1 29 ? -10.154 -9.178  4.053   1.00 0.00 ? 29 THR A H    5  
ATOM 5740  H HA   . THR A 1 29 ? -7.961  -7.373  4.877   1.00 0.00 ? 29 THR A HA   5  
ATOM 5741  H HB   . THR A 1 29 ? -7.646  -9.065  6.668   1.00 0.00 ? 29 THR A HB   5  
ATOM 5742  H HG1  . THR A 1 29 ? -8.287  -10.903 5.539   1.00 0.00 ? 29 THR A HG1  5  
ATOM 5743  H HG21 . THR A 1 29 ? -9.279  -7.257  7.009   1.00 0.00 ? 29 THR A HG21 5  
ATOM 5744  H HG22 . THR A 1 29 ? -9.823  -8.751  7.797   1.00 0.00 ? 29 THR A HG22 5  
ATOM 5745  H HG23 . THR A 1 29 ? -10.551 -8.240  6.259   1.00 0.00 ? 29 THR A HG23 5  
ATOM 5746  N N    . HIS A 1 30 ? -7.534  -9.993  2.990   1.00 0.00 ? 30 HIS A N    5  
ATOM 5747  C CA   . HIS A 1 30 ? -6.561  -10.829 2.290   1.00 0.00 ? 30 HIS A CA   5  
ATOM 5748  C C    . HIS A 1 30 ? -5.564  -9.966  1.491   1.00 0.00 ? 30 HIS A C    5  
ATOM 5749  O O    . HIS A 1 30 ? -5.884  -8.840  1.110   1.00 0.00 ? 30 HIS A O    5  
ATOM 5750  C CB   . HIS A 1 30 ? -7.301  -11.827 1.381   1.00 0.00 ? 30 HIS A CB   5  
ATOM 5751  C CG   . HIS A 1 30 ? -7.506  -11.321 -0.023  1.00 0.00 ? 30 HIS A CG   5  
ATOM 5752  N ND1  . HIS A 1 30 ? -8.196  -10.152 -0.305  1.00 0.00 ? 30 HIS A ND1  5  
ATOM 5753  C CD2  . HIS A 1 30 ? -7.123  -11.806 -1.248  1.00 0.00 ? 30 HIS A CD2  5  
ATOM 5754  C CE1  . HIS A 1 30 ? -8.190  -10.008 -1.640  1.00 0.00 ? 30 HIS A CE1  5  
ATOM 5755  N NE2  . HIS A 1 30 ? -7.551  -10.987 -2.281  1.00 0.00 ? 30 HIS A NE2  5  
ATOM 5756  H H    . HIS A 1 30 ? -8.503  -10.056 2.717   1.00 0.00 ? 30 HIS A H    5  
ATOM 5757  H HA   . HIS A 1 30 ? -6.014  -11.394 3.040   1.00 0.00 ? 30 HIS A HA   5  
ATOM 5758  H HB2  . HIS A 1 30 ? -6.726  -12.751 1.335   1.00 0.00 ? 30 HIS A HB2  5  
ATOM 5759  H HB3  . HIS A 1 30 ? -8.274  -12.048 1.819   1.00 0.00 ? 30 HIS A HB3  5  
ATOM 5760  H HD1  . HIS A 1 30 ? -8.623  -9.523  0.365   1.00 0.00 ? 30 HIS A HD1  5  
ATOM 5761  H HD2  . HIS A 1 30 ? -6.556  -12.713 -1.391  1.00 0.00 ? 30 HIS A HD2  5  
ATOM 5762  H HE1  . HIS A 1 30 ? -8.657  -9.176  -2.144  1.00 0.00 ? 30 HIS A HE1  5  
ATOM 5763  N N    . PRO A 1 31 ? -4.345  -10.499 1.242   1.00 0.00 ? 31 PRO A N    5  
ATOM 5764  C CA   . PRO A 1 31 ? -3.308  -9.797  0.504   1.00 0.00 ? 31 PRO A CA   5  
ATOM 5765  C C    . PRO A 1 31 ? -3.706  -9.570  -0.958  1.00 0.00 ? 31 PRO A C    5  
ATOM 5766  O O    . PRO A 1 31 ? -4.532  -10.299 -1.499  1.00 0.00 ? 31 PRO A O    5  
ATOM 5767  C CB   . PRO A 1 31 ? -2.064  -10.689 0.592   1.00 0.00 ? 31 PRO A CB   5  
ATOM 5768  C CG   . PRO A 1 31 ? -2.476  -11.971 1.317   1.00 0.00 ? 31 PRO A CG   5  
ATOM 5769  C CD   . PRO A 1 31 ? -3.945  -11.817 1.694   1.00 0.00 ? 31 PRO A CD   5  
ATOM 5770  H HA   . PRO A 1 31 ? -3.109  -8.840  0.978   1.00 0.00 ? 31 PRO A HA   5  
ATOM 5771  H HB2  . PRO A 1 31 ? -1.714  -10.933 -0.401  1.00 0.00 ? 31 PRO A HB2  5  
ATOM 5772  H HB3  . PRO A 1 31 ? -1.276  -10.181 1.147   1.00 0.00 ? 31 PRO A HB3  5  
ATOM 5773  H HG2  . PRO A 1 31 ? -2.348  -12.831 0.659   1.00 0.00 ? 31 PRO A HG2  5  
ATOM 5774  H HG3  . PRO A 1 31 ? -1.876  -12.100 2.216   1.00 0.00 ? 31 PRO A HG3  5  
ATOM 5775  H HD2  . PRO A 1 31 ? -4.538  -12.583 1.195   1.00 0.00 ? 31 PRO A HD2  5  
ATOM 5776  H HD3  . PRO A 1 31 ? -4.055  -11.898 2.774   1.00 0.00 ? 31 PRO A HD3  5  
ATOM 5777  N N    . LEU A 1 32 ? -3.094  -8.552  -1.590  1.00 0.00 ? 32 LEU A N    5  
ATOM 5778  C CA   . LEU A 1 32 ? -3.346  -8.221  -2.990  1.00 0.00 ? 32 LEU A CA   5  
ATOM 5779  C C    . LEU A 1 32 ? -2.023  -7.890  -3.691  1.00 0.00 ? 32 LEU A C    5  
ATOM 5780  O O    . LEU A 1 32 ? -1.112  -7.343  -3.069  1.00 0.00 ? 32 LEU A O    5  
ATOM 5781  C CB   . LEU A 1 32 ? -4.274  -7.002  -3.069  1.00 0.00 ? 32 LEU A CB   5  
ATOM 5782  C CG   . LEU A 1 32 ? -5.741  -7.392  -2.828  1.00 0.00 ? 32 LEU A CG   5  
ATOM 5783  C CD1  . LEU A 1 32 ? -6.598  -6.124  -2.870  1.00 0.00 ? 32 LEU A CD1  5  
ATOM 5784  C CD2  . LEU A 1 32 ? -6.229  -8.354  -3.915  1.00 0.00 ? 32 LEU A CD2  5  
ATOM 5785  H H    . LEU A 1 32 ? -2.425  -7.984  -1.084  1.00 0.00 ? 32 LEU A H    5  
ATOM 5786  H HA   . LEU A 1 32 ? -3.812  -9.071  -3.487  1.00 0.00 ? 32 LEU A HA   5  
ATOM 5787  H HB2  . LEU A 1 32 ? -3.968  -6.273  -2.317  1.00 0.00 ? 32 LEU A HB2  5  
ATOM 5788  H HB3  . LEU A 1 32 ? -4.179  -6.551  -4.055  1.00 0.00 ? 32 LEU A HB3  5  
ATOM 5789  H HG   . LEU A 1 32 ? -5.841  -7.864  -1.850  1.00 0.00 ? 32 LEU A HG   5  
ATOM 5790  H HD11 . LEU A 1 32 ? -6.255  -5.429  -2.104  1.00 0.00 ? 32 LEU A HD11 5  
ATOM 5791  H HD12 . LEU A 1 32 ? -7.640  -6.382  -2.686  1.00 0.00 ? 32 LEU A HD12 5  
ATOM 5792  H HD13 . LEU A 1 32 ? -6.507  -5.656  -3.855  1.00 0.00 ? 32 LEU A HD13 5  
ATOM 5793  H HD21 . LEU A 1 32 ? -7.319  -8.378  -3.917  1.00 0.00 ? 32 LEU A HD21 5  
ATOM 5794  H HD22 . LEU A 1 32 ? -5.876  -8.015  -4.884  1.00 0.00 ? 32 LEU A HD22 5  
ATOM 5795  H HD23 . LEU A 1 32 ? -5.850  -9.355  -3.720  1.00 0.00 ? 32 LEU A HD23 5  
ATOM 5796  N N    . THR A 1 33 ? -1.924  -8.208  -4.992  1.00 0.00 ? 33 THR A N    5  
ATOM 5797  C CA   . THR A 1 33 ? -0.734  -7.889  -5.787  1.00 0.00 ? 33 THR A CA   5  
ATOM 5798  C C    . THR A 1 33 ? -0.556  -6.369  -5.874  1.00 0.00 ? 33 THR A C    5  
ATOM 5799  O O    . THR A 1 33 ? -1.436  -5.604  -5.475  1.00 0.00 ? 33 THR A O    5  
ATOM 5800  C CB   . THR A 1 33 ? -0.864  -8.465  -7.210  1.00 0.00 ? 33 THR A CB   5  
ATOM 5801  O OG1  . THR A 1 33 ? -1.990  -7.907  -7.843  1.00 0.00 ? 33 THR A OG1  5  
ATOM 5802  C CG2  . THR A 1 33 ? -0.999  -9.987  -7.173  1.00 0.00 ? 33 THR A CG2  5  
ATOM 5803  H H    . THR A 1 33 ? -2.695  -8.681  -5.448  1.00 0.00 ? 33 THR A H    5  
ATOM 5804  H HA   . THR A 1 33 ? 0.146   -8.324  -5.310  1.00 0.00 ? 33 THR A HA   5  
ATOM 5805  H HB   . THR A 1 33 ? 0.027   -8.204  -7.783  1.00 0.00 ? 33 THR A HB   5  
ATOM 5806  H HG1  . THR A 1 33 ? -2.782  -8.240  -7.403  1.00 0.00 ? 33 THR A HG1  5  
ATOM 5807  H HG21 . THR A 1 33 ? -1.211  -10.356 -8.177  1.00 0.00 ? 33 THR A HG21 5  
ATOM 5808  H HG22 . THR A 1 33 ? -1.811  -10.271 -6.505  1.00 0.00 ? 33 THR A HG22 5  
ATOM 5809  H HG23 . THR A 1 33 ? -0.066  -10.423 -6.820  1.00 0.00 ? 33 THR A HG23 5  
ATOM 5810  N N    . LEU A 1 34 ? 0.589   -5.941  -6.410  1.00 0.00 ? 34 LEU A N    5  
ATOM 5811  C CA   . LEU A 1 34 ? 0.891   -4.531  -6.584  1.00 0.00 ? 34 LEU A CA   5  
ATOM 5812  C C    . LEU A 1 34 ? -0.176  -3.892  -7.482  1.00 0.00 ? 34 LEU A C    5  
ATOM 5813  O O    . LEU A 1 34 ? -0.811  -2.919  -7.096  1.00 0.00 ? 34 LEU A O    5  
ATOM 5814  C CB   . LEU A 1 34 ? 2.301   -4.411  -7.202  1.00 0.00 ? 34 LEU A CB   5  
ATOM 5815  C CG   . LEU A 1 34 ? 2.957   -3.043  -6.914  1.00 0.00 ? 34 LEU A CG   5  
ATOM 5816  C CD1  . LEU A 1 34 ? 2.077   -1.894  -7.415  1.00 0.00 ? 34 LEU A CD1  5  
ATOM 5817  C CD2  . LEU A 1 34 ? 3.217   -2.877  -5.414  1.00 0.00 ? 34 LEU A CD2  5  
ATOM 5818  H H    . LEU A 1 34 ? 1.277   -6.615  -6.716  1.00 0.00 ? 34 LEU A H    5  
ATOM 5819  H HA   . LEU A 1 34 ? 0.878   -4.047  -5.611  1.00 0.00 ? 34 LEU A HA   5  
ATOM 5820  H HB2  . LEU A 1 34 ? 2.935   -5.196  -6.788  1.00 0.00 ? 34 LEU A HB2  5  
ATOM 5821  H HB3  . LEU A 1 34 ? 2.231   -4.552  -8.279  1.00 0.00 ? 34 LEU A HB3  5  
ATOM 5822  H HG   . LEU A 1 34 ? 3.912   -3.003  -7.438  1.00 0.00 ? 34 LEU A HG   5  
ATOM 5823  H HD11 . LEU A 1 34 ? 1.256   -1.729  -6.721  1.00 0.00 ? 34 LEU A HD11 5  
ATOM 5824  H HD12 . LEU A 1 34 ? 2.676   -0.985  -7.484  1.00 0.00 ? 34 LEU A HD12 5  
ATOM 5825  H HD13 . LEU A 1 34 ? 1.681   -2.139  -8.400  1.00 0.00 ? 34 LEU A HD13 5  
ATOM 5826  H HD21 . LEU A 1 34 ? 2.282   -2.672  -4.896  1.00 0.00 ? 34 LEU A HD21 5  
ATOM 5827  H HD22 . LEU A 1 34 ? 3.661   -3.789  -5.017  1.00 0.00 ? 34 LEU A HD22 5  
ATOM 5828  H HD23 . LEU A 1 34 ? 3.903   -2.044  -5.258  1.00 0.00 ? 34 LEU A HD23 5  
ATOM 5829  N N    . ASP A 1 35 ? -0.366  -4.444  -8.684  1.00 0.00 ? 35 ASP A N    5  
ATOM 5830  C CA   . ASP A 1 35 ? -1.324  -3.909  -9.644  1.00 0.00 ? 35 ASP A CA   5  
ATOM 5831  C C    . ASP A 1 35 ? -2.737  -3.845  -9.044  1.00 0.00 ? 35 ASP A C    5  
ATOM 5832  O O    . ASP A 1 35 ? -3.441  -2.853  -9.240  1.00 0.00 ? 35 ASP A O    5  
ATOM 5833  C CB   . ASP A 1 35 ? -1.294  -4.768  -10.907 1.00 0.00 ? 35 ASP A CB   5  
ATOM 5834  C CG   . ASP A 1 35 ? 0.082   -4.705  -11.562 1.00 0.00 ? 35 ASP A CG   5  
ATOM 5835  O OD1  . ASP A 1 35 ? 0.930   -5.541  -11.183 1.00 0.00 ? 35 ASP A OD1  5  
ATOM 5836  O OD2  . ASP A 1 35 ? 0.266   -3.815  -12.424 1.00 0.00 ? 35 ASP A OD2  5  
ATOM 5837  H H    . ASP A 1 35 ? 0.174   -5.255  -8.952  1.00 0.00 ? 35 ASP A H    5  
ATOM 5838  H HA   . ASP A 1 35 ? -1.018  -2.897  -9.910  1.00 0.00 ? 35 ASP A HA   5  
ATOM 5839  H HB2  . ASP A 1 35 ? -1.524  -5.802  -10.648 1.00 0.00 ? 35 ASP A HB2  5  
ATOM 5840  H HB3  . ASP A 1 35 ? -2.043  -4.401  -11.610 1.00 0.00 ? 35 ASP A HB3  5  
ATOM 5841  N N    . GLU A 1 36 ? -3.154  -4.889  -8.312  1.00 0.00 ? 36 GLU A N    5  
ATOM 5842  C CA   . GLU A 1 36 ? -4.477  -4.915  -7.688  1.00 0.00 ? 36 GLU A CA   5  
ATOM 5843  C C    . GLU A 1 36 ? -4.644  -3.714  -6.751  1.00 0.00 ? 36 GLU A C    5  
ATOM 5844  O O    . GLU A 1 36 ? -5.738  -3.164  -6.639  1.00 0.00 ? 36 GLU A O    5  
ATOM 5845  C CB   . GLU A 1 36 ? -4.667  -6.233  -6.933  1.00 0.00 ? 36 GLU A CB   5  
ATOM 5846  C CG   . GLU A 1 36 ? -5.025  -7.345  -7.929  1.00 0.00 ? 36 GLU A CG   5  
ATOM 5847  C CD   . GLU A 1 36 ? -5.065  -8.709  -7.246  1.00 0.00 ? 36 GLU A CD   5  
ATOM 5848  O OE1  . GLU A 1 36 ? -4.081  -9.020  -6.536  1.00 0.00 ? 36 GLU A OE1  5  
ATOM 5849  O OE2  . GLU A 1 36 ? -6.076  -9.415  -7.445  1.00 0.00 ? 36 GLU A OE2  5  
ATOM 5850  H H    . GLU A 1 36 ? -2.544  -5.687  -8.180  1.00 0.00 ? 36 GLU A H    5  
ATOM 5851  H HA   . GLU A 1 36 ? -5.236  -4.850  -8.466  1.00 0.00 ? 36 GLU A HA   5  
ATOM 5852  H HB2  . GLU A 1 36 ? -3.747  -6.489  -6.410  1.00 0.00 ? 36 GLU A HB2  5  
ATOM 5853  H HB3  . GLU A 1 36 ? -5.476  -6.123  -6.211  1.00 0.00 ? 36 GLU A HB3  5  
ATOM 5854  H HG2  . GLU A 1 36 ? -6.004  -7.135  -8.361  1.00 0.00 ? 36 GLU A HG2  5  
ATOM 5855  H HG3  . GLU A 1 36 ? -4.284  -7.368  -8.726  1.00 0.00 ? 36 GLU A HG3  5  
ATOM 5856  N N    . ILE A 1 37 ? -3.561  -3.303  -6.082  1.00 0.00 ? 37 ILE A N    5  
ATOM 5857  C CA   . ILE A 1 37 ? -3.603  -2.159  -5.182  1.00 0.00 ? 37 ILE A CA   5  
ATOM 5858  C C    . ILE A 1 37 ? -3.779  -0.867  -5.990  1.00 0.00 ? 37 ILE A C    5  
ATOM 5859  O O    . ILE A 1 37 ? -4.539  0.015   -5.581  1.00 0.00 ? 37 ILE A O    5  
ATOM 5860  C CB   . ILE A 1 37 ? -2.313  -2.129  -4.338  1.00 0.00 ? 37 ILE A CB   5  
ATOM 5861  C CG1  . ILE A 1 37 ? -2.396  -3.208  -3.247  1.00 0.00 ? 37 ILE A CG1  5  
ATOM 5862  C CG2  . ILE A 1 37 ? -2.131  -0.750  -3.694  1.00 0.00 ? 37 ILE A CG2  5  
ATOM 5863  C CD1  . ILE A 1 37 ? -0.994  -3.568  -2.751  1.00 0.00 ? 37 ILE A CD1  5  
ATOM 5864  H H    . ILE A 1 37 ? -2.681  -3.791  -6.200  1.00 0.00 ? 37 ILE A H    5  
ATOM 5865  H HA   . ILE A 1 37 ? -4.459  -2.268  -4.514  1.00 0.00 ? 37 ILE A HA   5  
ATOM 5866  H HB   . ILE A 1 37 ? -1.460  -2.333  -4.976  1.00 0.00 ? 37 ILE A HB   5  
ATOM 5867  H HG12 . ILE A 1 37 ? -2.988  -2.838  -2.413  1.00 0.00 ? 37 ILE A HG12 5  
ATOM 5868  H HG13 . ILE A 1 37 ? -2.869  -4.101  -3.655  1.00 0.00 ? 37 ILE A HG13 5  
ATOM 5869  H HG21 . ILE A 1 37 ? -3.041  -0.466  -3.171  1.00 0.00 ? 37 ILE A HG21 5  
ATOM 5870  H HG22 . ILE A 1 37 ? -1.911  -0.013  -4.467  1.00 0.00 ? 37 ILE A HG22 5  
ATOM 5871  H HG23 . ILE A 1 37 ? -1.304  -0.785  -2.991  1.00 0.00 ? 37 ILE A HG23 5  
ATOM 5872  H HD11 . ILE A 1 37 ? -0.384  -3.900  -3.590  1.00 0.00 ? 37 ILE A HD11 5  
ATOM 5873  H HD12 . ILE A 1 37 ? -0.533  -2.698  -2.287  1.00 0.00 ? 37 ILE A HD12 5  
ATOM 5874  H HD13 . ILE A 1 37 ? -1.069  -4.371  -2.019  1.00 0.00 ? 37 ILE A HD13 5  
ATOM 5875  N N    . LEU A 1 38 ? -3.082  -0.752  -7.135  1.00 0.00 ? 38 LEU A N    5  
ATOM 5876  C CA   . LEU A 1 38 ? -3.172  0.444   -7.975  1.00 0.00 ? 38 LEU A CA   5  
ATOM 5877  C C    . LEU A 1 38 ? -4.618  0.689   -8.392  1.00 0.00 ? 38 LEU A C    5  
ATOM 5878  O O    . LEU A 1 38 ? -5.068  1.826   -8.395  1.00 0.00 ? 38 LEU A O    5  
ATOM 5879  C CB   . LEU A 1 38 ? -2.307  0.300   -9.236  1.00 0.00 ? 38 LEU A CB   5  
ATOM 5880  C CG   . LEU A 1 38 ? -0.846  -0.012  -8.894  1.00 0.00 ? 38 LEU A CG   5  
ATOM 5881  C CD1  . LEU A 1 38 ? -0.031  -0.047  -10.180 1.00 0.00 ? 38 LEU A CD1  5  
ATOM 5882  C CD2  . LEU A 1 38 ? -0.248  1.049   -7.957  1.00 0.00 ? 38 LEU A CD2  5  
ATOM 5883  H H    . LEU A 1 38 ? -2.475  -1.506  -7.431  1.00 0.00 ? 38 LEU A H    5  
ATOM 5884  H HA   . LEU A 1 38 ? -2.825  1.301   -7.404  1.00 0.00 ? 38 LEU A HA   5  
ATOM 5885  H HB2  . LEU A 1 38 ? -2.706  -0.504  -9.852  1.00 0.00 ? 38 LEU A HB2  5  
ATOM 5886  H HB3  . LEU A 1 38 ? -2.349  1.226   -9.797  1.00 0.00 ? 38 LEU A HB3  5  
ATOM 5887  H HG   . LEU A 1 38 ? -0.798  -0.979  -8.421  1.00 0.00 ? 38 LEU A HG   5  
ATOM 5888  H HD11 . LEU A 1 38 ? -0.084  0.922   -10.675 1.00 0.00 ? 38 LEU A HD11 5  
ATOM 5889  H HD12 . LEU A 1 38 ? -0.428  -0.815  -10.844 1.00 0.00 ? 38 LEU A HD12 5  
ATOM 5890  H HD13 . LEU A 1 38 ? 1.004   -0.273  -9.941  1.00 0.00 ? 38 LEU A HD13 5  
ATOM 5891  H HD21 . LEU A 1 38 ? 0.822   0.862   -7.835  1.00 0.00 ? 38 LEU A HD21 5  
ATOM 5892  H HD22 . LEU A 1 38 ? -0.390  2.037   -8.389  1.00 0.00 ? 38 LEU A HD22 5  
ATOM 5893  H HD23 . LEU A 1 38 ? -0.734  0.999   -6.985  1.00 0.00 ? 38 LEU A HD23 5  
ATOM 5894  N N    . ASP A 1 39 ? -5.337  -0.380  -8.755  1.00 0.00 ? 39 ASP A N    5  
ATOM 5895  C CA   . ASP A 1 39 ? -6.716  -0.269  -9.215  1.00 0.00 ? 39 ASP A CA   5  
ATOM 5896  C C    . ASP A 1 39 ? -7.554  0.566   -8.242  1.00 0.00 ? 39 ASP A C    5  
ATOM 5897  O O    . ASP A 1 39 ? -8.069  1.623   -8.610  1.00 0.00 ? 39 ASP A O    5  
ATOM 5898  C CB   . ASP A 1 39 ? -7.308  -1.672  -9.378  1.00 0.00 ? 39 ASP A CB   5  
ATOM 5899  C CG   . ASP A 1 39 ? -8.722  -1.599  -9.940  1.00 0.00 ? 39 ASP A CG   5  
ATOM 5900  O OD1  . ASP A 1 39 ? -8.835  -1.336  -11.156 1.00 0.00 ? 39 ASP A OD1  5  
ATOM 5901  O OD2  . ASP A 1 39 ? -9.661  -1.808  -9.143  1.00 0.00 ? 39 ASP A OD2  5  
ATOM 5902  H H    . ASP A 1 39 ? -4.916  -1.300  -8.723  1.00 0.00 ? 39 ASP A H    5  
ATOM 5903  H HA   . ASP A 1 39 ? -6.719  0.219   -10.184 1.00 0.00 ? 39 ASP A HA   5  
ATOM 5904  H HB2  . ASP A 1 39 ? -6.682  -2.248  -10.059 1.00 0.00 ? 39 ASP A HB2  5  
ATOM 5905  H HB3  . ASP A 1 39 ? -7.332  -2.169  -8.409  1.00 0.00 ? 39 ASP A HB3  5  
ATOM 5906  N N    . GLU A 1 40 ? -7.688  0.086   -7.007  1.00 0.00 ? 40 GLU A N    5  
ATOM 5907  C CA   . GLU A 1 40 ? -8.485  0.750   -5.983  1.00 0.00 ? 40 GLU A CA   5  
ATOM 5908  C C    . GLU A 1 40 ? -7.993  2.177   -5.720  1.00 0.00 ? 40 GLU A C    5  
ATOM 5909  O O    . GLU A 1 40 ? -8.798  3.104   -5.639  1.00 0.00 ? 40 GLU A O    5  
ATOM 5910  C CB   . GLU A 1 40 ? -8.414  -0.083  -4.702  1.00 0.00 ? 40 GLU A CB   5  
ATOM 5911  C CG   . GLU A 1 40 ? -9.501  -1.164  -4.727  1.00 0.00 ? 40 GLU A CG   5  
ATOM 5912  C CD   . GLU A 1 40 ? -10.814 -0.640  -4.151  1.00 0.00 ? 40 GLU A CD   5  
ATOM 5913  O OE1  . GLU A 1 40 ? -10.810 -0.281  -2.953  1.00 0.00 ? 40 GLU A OE1  5  
ATOM 5914  O OE2  . GLU A 1 40 ? -11.804 -0.623  -4.912  1.00 0.00 ? 40 GLU A OE2  5  
ATOM 5915  H H    . GLU A 1 40 ? -7.227  -0.780  -6.761  1.00 0.00 ? 40 GLU A H    5  
ATOM 5916  H HA   . GLU A 1 40 ? -9.523  0.796   -6.318  1.00 0.00 ? 40 GLU A HA   5  
ATOM 5917  H HB2  . GLU A 1 40 ? -7.434  -0.555  -4.632  1.00 0.00 ? 40 GLU A HB2  5  
ATOM 5918  H HB3  . GLU A 1 40 ? -8.562  0.562   -3.838  1.00 0.00 ? 40 GLU A HB3  5  
ATOM 5919  H HG2  . GLU A 1 40 ? -9.663  -1.488  -5.756  1.00 0.00 ? 40 GLU A HG2  5  
ATOM 5920  H HG3  . GLU A 1 40 ? -9.171  -2.015  -4.136  1.00 0.00 ? 40 GLU A HG3  5  
ATOM 5921  N N    . THR A 1 41 ? -6.678  2.355   -5.573  1.00 0.00 ? 41 THR A N    5  
ATOM 5922  C CA   . THR A 1 41 ? -6.103  3.664   -5.266  1.00 0.00 ? 41 THR A CA   5  
ATOM 5923  C C    . THR A 1 41 ? -6.089  4.578   -6.496  1.00 0.00 ? 41 THR A C    5  
ATOM 5924  O O    . THR A 1 41 ? -5.753  5.753   -6.367  1.00 0.00 ? 41 THR A O    5  
ATOM 5925  C CB   . THR A 1 41 ? -4.692  3.477   -4.715  1.00 0.00 ? 41 THR A CB   5  
ATOM 5926  O OG1  . THR A 1 41 ? -3.913  2.735   -5.627  1.00 0.00 ? 41 THR A OG1  5  
ATOM 5927  C CG2  . THR A 1 41 ? -4.751  2.750   -3.374  1.00 0.00 ? 41 THR A CG2  5  
ATOM 5928  H H    . THR A 1 41 ? -6.052  1.564   -5.664  1.00 0.00 ? 41 THR A H    5  
ATOM 5929  H HA   . THR A 1 41 ? -6.699  4.141   -4.498  1.00 0.00 ? 41 THR A HA   5  
ATOM 5930  H HB   . THR A 1 41 ? -4.240  4.450   -4.564  1.00 0.00 ? 41 THR A HB   5  
ATOM 5931  H HG1  . THR A 1 41 ? -4.217  1.824   -5.618  1.00 0.00 ? 41 THR A HG1  5  
ATOM 5932  H HG21 . THR A 1 41 ? -3.799  2.263   -3.187  1.00 0.00 ? 41 THR A HG21 5  
ATOM 5933  H HG22 . THR A 1 41 ? -5.541  2.002   -3.395  1.00 0.00 ? 41 THR A HG22 5  
ATOM 5934  H HG23 . THR A 1 41 ? -4.952  3.471   -2.578  1.00 0.00 ? 41 THR A HG23 5  
ATOM 5935  N N    . GLN A 1 42 ? -6.452  4.049   -7.675  1.00 0.00 ? 42 GLN A N    5  
ATOM 5936  C CA   . GLN A 1 42 ? -6.454  4.816   -8.915  1.00 0.00 ? 42 GLN A CA   5  
ATOM 5937  C C    . GLN A 1 42 ? -5.027  5.300   -9.204  1.00 0.00 ? 42 GLN A C    5  
ATOM 5938  O O    . GLN A 1 42 ? -4.788  6.487   -9.417  1.00 0.00 ? 42 GLN A O    5  
ATOM 5939  C CB   . GLN A 1 42 ? -7.469  5.979   -8.815  1.00 0.00 ? 42 GLN A CB   5  
ATOM 5940  C CG   . GLN A 1 42 ? -7.556  6.772   -10.135 1.00 0.00 ? 42 GLN A CG   5  
ATOM 5941  C CD   . GLN A 1 42 ? -7.472  5.864   -11.360 1.00 0.00 ? 42 GLN A CD   5  
ATOM 5942  O OE1  . GLN A 1 42 ? -8.459  5.250   -11.750 1.00 0.00 ? 42 GLN A OE1  5  
ATOM 5943  N NE2  . GLN A 1 42 ? -6.285  5.783   -11.966 1.00 0.00 ? 42 GLN A NE2  5  
ATOM 5944  H H    . GLN A 1 42 ? -6.731  3.077   -7.720  1.00 0.00 ? 42 GLN A H    5  
ATOM 5945  H HA   . GLN A 1 42 ? -6.763  4.151   -9.720  1.00 0.00 ? 42 GLN A HA   5  
ATOM 5946  H HB2  . GLN A 1 42 ? -8.454  5.569   -8.584  1.00 0.00 ? 42 GLN A HB2  5  
ATOM 5947  H HB3  . GLN A 1 42 ? -7.172  6.656   -8.018  1.00 0.00 ? 42 GLN A HB3  5  
ATOM 5948  H HG2  . GLN A 1 42 ? -8.506  7.307   -10.160 1.00 0.00 ? 42 GLN A HG2  5  
ATOM 5949  H HG3  . GLN A 1 42 ? -6.746  7.499   -10.172 1.00 0.00 ? 42 GLN A HG3  5  
ATOM 5950  H HE21 . GLN A 1 42 ? -5.495  6.296   -11.596 1.00 0.00 ? 42 GLN A HE21 5  
ATOM 5951  H HE22 . GLN A 1 42 ? -6.179  5.211   -12.790 1.00 0.00 ? 42 GLN A HE22 5  
ATOM 5952  N N    . HIS A 1 43 ? -4.080  4.355   -9.206  1.00 0.00 ? 43 HIS A N    5  
ATOM 5953  C CA   . HIS A 1 43 ? -2.677  4.638   -9.472  1.00 0.00 ? 43 HIS A CA   5  
ATOM 5954  C C    . HIS A 1 43 ? -2.163  3.685   -10.548 1.00 0.00 ? 43 HIS A C    5  
ATOM 5955  O O    . HIS A 1 43 ? -1.023  3.250   -10.491 1.00 0.00 ? 43 HIS A O    5  
ATOM 5956  C CB   . HIS A 1 43 ? -1.867  4.466   -8.179  1.00 0.00 ? 43 HIS A CB   5  
ATOM 5957  C CG   . HIS A 1 43 ? -2.312  5.369   -7.057  1.00 0.00 ? 43 HIS A CG   5  
ATOM 5958  N ND1  . HIS A 1 43 ? -2.996  6.559   -7.262  1.00 0.00 ? 43 HIS A ND1  5  
ATOM 5959  C CD2  . HIS A 1 43 ? -2.184  5.270   -5.697  1.00 0.00 ? 43 HIS A CD2  5  
ATOM 5960  C CE1  . HIS A 1 43 ? -3.229  7.087   -6.045  1.00 0.00 ? 43 HIS A CE1  5  
ATOM 5961  N NE2  . HIS A 1 43 ? -2.758  6.348   -5.045  1.00 0.00 ? 43 HIS A NE2  5  
ATOM 5962  H H    . HIS A 1 43 ? -4.341  3.396   -9.018  1.00 0.00 ? 43 HIS A H    5  
ATOM 5963  H HA   . HIS A 1 43 ? -2.566  5.660   -9.831  1.00 0.00 ? 43 HIS A HA   5  
ATOM 5964  H HB2  . HIS A 1 43 ? -1.960  3.435   -7.845  1.00 0.00 ? 43 HIS A HB2  5  
ATOM 5965  H HB3  . HIS A 1 43 ? -0.818  4.672   -8.392  1.00 0.00 ? 43 HIS A HB3  5  
ATOM 5966  H HD1  . HIS A 1 43 ? -3.270  6.952   -8.153  1.00 0.00 ? 43 HIS A HD1  5  
ATOM 5967  H HD2  . HIS A 1 43 ? -1.705  4.446   -5.192  1.00 0.00 ? 43 HIS A HD2  5  
ATOM 5968  H HE1  . HIS A 1 43 ? -3.759  8.008   -5.893  1.00 0.00 ? 43 HIS A HE1  5  
ATOM 5969  N N    . LEU A 1 44 ? -3.004  3.353   -11.531 1.00 0.00 ? 44 LEU A N    5  
ATOM 5970  C CA   . LEU A 1 44 ? -2.603  2.453   -12.602 1.00 0.00 ? 44 LEU A CA   5  
ATOM 5971  C C    . LEU A 1 44 ? -1.575  3.156   -13.481 1.00 0.00 ? 44 LEU A C    5  
ATOM 5972  O O    . LEU A 1 44 ? -0.544  2.576   -13.817 1.00 0.00 ? 44 LEU A O    5  
ATOM 5973  C CB   . LEU A 1 44 ? -3.825  2.024   -13.414 1.00 0.00 ? 44 LEU A CB   5  
ATOM 5974  C CG   . LEU A 1 44 ? -4.811  1.260   -12.510 1.00 0.00 ? 44 LEU A CG   5  
ATOM 5975  C CD1  . LEU A 1 44 ? -5.943  2.198   -12.067 1.00 0.00 ? 44 LEU A CD1  5  
ATOM 5976  C CD2  . LEU A 1 44 ? -5.407  0.084   -13.288 1.00 0.00 ? 44 LEU A CD2  5  
ATOM 5977  H H    . LEU A 1 44 ? -3.939  3.732   -11.542 1.00 0.00 ? 44 LEU A H    5  
ATOM 5978  H HA   . LEU A 1 44 ? -2.143  1.566   -12.166 1.00 0.00 ? 44 LEU A HA   5  
ATOM 5979  H HB2  . LEU A 1 44 ? -4.313  2.904   -13.831 1.00 0.00 ? 44 LEU A HB2  5  
ATOM 5980  H HB3  . LEU A 1 44 ? -3.502  1.373   -14.227 1.00 0.00 ? 44 LEU A HB3  5  
ATOM 5981  H HG   . LEU A 1 44 ? -4.281  0.877   -11.625 1.00 0.00 ? 44 LEU A HG   5  
ATOM 5982  H HD11 . LEU A 1 44 ? -6.800  1.611   -11.744 1.00 0.00 ? 44 LEU A HD11 5  
ATOM 5983  H HD12 . LEU A 1 44 ? -6.242  2.833   -12.900 1.00 0.00 ? 44 LEU A HD12 5  
ATOM 5984  H HD13 . LEU A 1 44 ? -5.602  2.819   -11.242 1.00 0.00 ? 44 LEU A HD13 5  
ATOM 5985  H HD21 . LEU A 1 44 ? -5.932  0.456   -14.167 1.00 0.00 ? 44 LEU A HD21 5  
ATOM 5986  H HD22 . LEU A 1 44 ? -4.607  -0.589  -13.601 1.00 0.00 ? 44 LEU A HD22 5  
ATOM 5987  H HD23 . LEU A 1 44 ? -6.106  -0.458  -12.650 1.00 0.00 ? 44 LEU A HD23 5  
ATOM 5988  N N    . ASP A 1 45 ? -1.853  4.417   -13.837 1.00 0.00 ? 45 ASP A N    5  
ATOM 5989  C CA   . ASP A 1 45 ? -0.931  5.221   -14.619 1.00 0.00 ? 45 ASP A CA   5  
ATOM 5990  C C    . ASP A 1 45 ? 0.099   5.832   -13.667 1.00 0.00 ? 45 ASP A C    5  
ATOM 5991  O O    . ASP A 1 45 ? 0.187   7.051   -13.525 1.00 0.00 ? 45 ASP A O    5  
ATOM 5992  C CB   . ASP A 1 45 ? -1.713  6.305   -15.373 1.00 0.00 ? 45 ASP A CB   5  
ATOM 5993  C CG   . ASP A 1 45 ? -0.794  7.131   -16.269 1.00 0.00 ? 45 ASP A CG   5  
ATOM 5994  O OD1  . ASP A 1 45 ? 0.201   6.553   -16.758 1.00 0.00 ? 45 ASP A OD1  5  
ATOM 5995  O OD2  . ASP A 1 45 ? -1.108  8.329   -16.449 1.00 0.00 ? 45 ASP A OD2  5  
ATOM 5996  H H    . ASP A 1 45 ? -2.723  4.836   -13.547 1.00 0.00 ? 45 ASP A H    5  
ATOM 5997  H HA   . ASP A 1 45 ? -0.419  4.583   -15.341 1.00 0.00 ? 45 ASP A HA   5  
ATOM 5998  H HB2  . ASP A 1 45 ? -2.476  5.829   -15.990 1.00 0.00 ? 45 ASP A HB2  5  
ATOM 5999  H HB3  . ASP A 1 45 ? -2.199  6.963   -14.652 1.00 0.00 ? 45 ASP A HB3  5  
ATOM 6000  N N    . ILE A 1 46 ? 0.869   4.963   -13.003 1.00 0.00 ? 46 ILE A N    5  
ATOM 6001  C CA   . ILE A 1 46 ? 1.872   5.377   -12.033 1.00 0.00 ? 46 ILE A CA   5  
ATOM 6002  C C    . ILE A 1 46 ? 3.259   5.314   -12.664 1.00 0.00 ? 46 ILE A C    5  
ATOM 6003  O O    . ILE A 1 46 ? 3.527   4.453   -13.501 1.00 0.00 ? 46 ILE A O    5  
ATOM 6004  C CB   . ILE A 1 46 ? 1.783   4.477   -10.783 1.00 0.00 ? 46 ILE A CB   5  
ATOM 6005  C CG1  . ILE A 1 46 ? 2.889   4.851   -9.790  1.00 0.00 ? 46 ILE A CG1  5  
ATOM 6006  C CG2  . ILE A 1 46 ? 1.920   3.000   -11.173 1.00 0.00 ? 46 ILE A CG2  5  
ATOM 6007  C CD1  . ILE A 1 46 ? 2.682   4.107   -8.470  1.00 0.00 ? 46 ILE A CD1  5  
ATOM 6008  H H    . ILE A 1 46 ? 0.753   3.974   -13.174 1.00 0.00 ? 46 ILE A H    5  
ATOM 6009  H HA   . ILE A 1 46 ? 1.668   6.403   -11.730 1.00 0.00 ? 46 ILE A HA   5  
ATOM 6010  H HB   . ILE A 1 46 ? 0.821   4.631   -10.308 1.00 0.00 ? 46 ILE A HB   5  
ATOM 6011  H HG12 . ILE A 1 46 ? 3.854   4.580   -10.204 1.00 0.00 ? 46 ILE A HG12 5  
ATOM 6012  H HG13 . ILE A 1 46 ? 2.861   5.926   -9.605  1.00 0.00 ? 46 ILE A HG13 5  
ATOM 6013  H HG21 . ILE A 1 46 ? 1.850   2.382   -10.281 1.00 0.00 ? 46 ILE A HG21 5  
ATOM 6014  H HG22 . ILE A 1 46 ? 2.883   2.835   -11.652 1.00 0.00 ? 46 ILE A HG22 5  
ATOM 6015  H HG23 . ILE A 1 46 ? 1.122   2.726   -11.858 1.00 0.00 ? 46 ILE A HG23 5  
ATOM 6016  H HD11 . ILE A 1 46 ? 1.631   4.152   -8.183  1.00 0.00 ? 46 ILE A HD11 5  
ATOM 6017  H HD12 . ILE A 1 46 ? 2.984   3.066   -8.588  1.00 0.00 ? 46 ILE A HD12 5  
ATOM 6018  H HD13 . ILE A 1 46 ? 3.287   4.570   -7.694  1.00 0.00 ? 46 ILE A HD13 5  
ATOM 6019  N N    . GLY A 1 47 ? 4.143   6.230   -12.253 1.00 0.00 ? 47 GLY A N    5  
ATOM 6020  C CA   . GLY A 1 47 ? 5.506   6.258   -12.747 1.00 0.00 ? 47 GLY A CA   5  
ATOM 6021  C C    . GLY A 1 47 ? 6.201   4.950   -12.385 1.00 0.00 ? 47 GLY A C    5  
ATOM 6022  O O    . GLY A 1 47 ? 6.064   4.467   -11.263 1.00 0.00 ? 47 GLY A O    5  
ATOM 6023  H H    . GLY A 1 47 ? 3.865   6.921   -11.572 1.00 0.00 ? 47 GLY A H    5  
ATOM 6024  H HA2  . GLY A 1 47 ? 5.497   6.381   -13.832 1.00 0.00 ? 47 GLY A HA2  5  
ATOM 6025  H HA3  . GLY A 1 47 ? 6.040   7.092   -12.293 1.00 0.00 ? 47 GLY A HA3  5  
ATOM 6026  N N    . LEU A 1 48 ? 6.942   4.375   -13.336 1.00 0.00 ? 48 LEU A N    5  
ATOM 6027  C CA   . LEU A 1 48 ? 7.629   3.108   -13.124 1.00 0.00 ? 48 LEU A CA   5  
ATOM 6028  C C    . LEU A 1 48 ? 8.478   3.161   -11.852 1.00 0.00 ? 48 LEU A C    5  
ATOM 6029  O O    . LEU A 1 48 ? 8.538   2.184   -11.111 1.00 0.00 ? 48 LEU A O    5  
ATOM 6030  C CB   . LEU A 1 48 ? 8.496   2.800   -14.354 1.00 0.00 ? 48 LEU A CB   5  
ATOM 6031  C CG   . LEU A 1 48 ? 9.252   1.472   -14.174 1.00 0.00 ? 48 LEU A CG   5  
ATOM 6032  C CD1  . LEU A 1 48 ? 8.261   0.314   -14.011 1.00 0.00 ? 48 LEU A CD1  5  
ATOM 6033  C CD2  . LEU A 1 48 ? 10.125  1.219   -15.405 1.00 0.00 ? 48 LEU A CD2  5  
ATOM 6034  H H    . LEU A 1 48 ? 7.029   4.820   -14.239 1.00 0.00 ? 48 LEU A H    5  
ATOM 6035  H HA   . LEU A 1 48 ? 6.878   2.325   -13.010 1.00 0.00 ? 48 LEU A HA   5  
ATOM 6036  H HB2  . LEU A 1 48 ? 7.857   2.734   -15.235 1.00 0.00 ? 48 LEU A HB2  5  
ATOM 6037  H HB3  . LEU A 1 48 ? 9.217   3.606   -14.495 1.00 0.00 ? 48 LEU A HB3  5  
ATOM 6038  H HG   . LEU A 1 48 ? 9.889   1.529   -13.292 1.00 0.00 ? 48 LEU A HG   5  
ATOM 6039  H HD11 . LEU A 1 48 ? 7.802   0.360   -13.024 1.00 0.00 ? 48 LEU A HD11 5  
ATOM 6040  H HD12 . LEU A 1 48 ? 8.788   -0.634  -14.118 1.00 0.00 ? 48 LEU A HD12 5  
ATOM 6041  H HD13 . LEU A 1 48 ? 7.485   0.385   -14.775 1.00 0.00 ? 48 LEU A HD13 5  
ATOM 6042  H HD21 . LEU A 1 48 ? 10.822  2.047   -15.533 1.00 0.00 ? 48 LEU A HD21 5  
ATOM 6043  H HD22 . LEU A 1 48 ? 9.492   1.138   -16.290 1.00 0.00 ? 48 LEU A HD22 5  
ATOM 6044  H HD23 . LEU A 1 48 ? 10.684  0.292   -15.271 1.00 0.00 ? 48 LEU A HD23 5  
ATOM 6045  N N    . LYS A 1 49 ? 9.134   4.299   -11.597 1.00 0.00 ? 49 LYS A N    5  
ATOM 6046  C CA   . LYS A 1 49 ? 9.975   4.454   -10.418 1.00 0.00 ? 49 LYS A CA   5  
ATOM 6047  C C    . LYS A 1 49 ? 9.140   4.333   -9.143  1.00 0.00 ? 49 LYS A C    5  
ATOM 6048  O O    . LYS A 1 49 ? 9.589   3.724   -8.175  1.00 0.00 ? 49 LYS A O    5  
ATOM 6049  C CB   . LYS A 1 49 ? 10.693  5.810   -10.469 1.00 0.00 ? 49 LYS A CB   5  
ATOM 6050  C CG   . LYS A 1 49 ? 11.738  5.838   -11.603 1.00 0.00 ? 49 LYS A CG   5  
ATOM 6051  C CD   . LYS A 1 49 ? 12.760  4.688   -11.472 1.00 0.00 ? 49 LYS A CD   5  
ATOM 6052  C CE   . LYS A 1 49 ? 13.330  4.621   -10.046 1.00 0.00 ? 49 LYS A CE   5  
ATOM 6053  N NZ   . LYS A 1 49 ? 14.365  3.576   -9.941  1.00 0.00 ? 49 LYS A NZ   5  
ATOM 6054  H H    . LYS A 1 49 ? 9.051   5.078   -12.233 1.00 0.00 ? 49 LYS A H    5  
ATOM 6055  H HA   . LYS A 1 49 ? 10.714  3.658   -10.412 1.00 0.00 ? 49 LYS A HA   5  
ATOM 6056  H HB2  . LYS A 1 49 ? 9.958   6.596   -10.643 1.00 0.00 ? 49 LYS A HB2  5  
ATOM 6057  H HB3  . LYS A 1 49 ? 11.188  5.996   -9.515  1.00 0.00 ? 49 LYS A HB3  5  
ATOM 6058  H HG2  . LYS A 1 49 ? 11.226  5.751   -12.563 1.00 0.00 ? 49 LYS A HG2  5  
ATOM 6059  H HG3  . LYS A 1 49 ? 12.268  6.790   -11.571 1.00 0.00 ? 49 LYS A HG3  5  
ATOM 6060  H HD2  . LYS A 1 49 ? 12.281  3.742   -11.720 1.00 0.00 ? 49 LYS A HD2  5  
ATOM 6061  H HD3  . LYS A 1 49 ? 13.576  4.864   -12.174 1.00 0.00 ? 49 LYS A HD3  5  
ATOM 6062  H HE2  . LYS A 1 49 ? 13.768  5.586   -9.789  1.00 0.00 ? 49 LYS A HE2  5  
ATOM 6063  H HE3  . LYS A 1 49 ? 12.532  4.392   -9.343  1.00 0.00 ? 49 LYS A HE3  5  
ATOM 6064  H HZ1  . LYS A 1 49 ? 15.071  3.726   -10.649 1.00 0.00 ? 49 LYS A HZ1  5  
ATOM 6065  H HZ2  . LYS A 1 49 ? 13.940  2.664   -10.072 1.00 0.00 ? 49 LYS A HZ2  5  
ATOM 6066  H HZ3  . LYS A 1 49 ? 14.793  3.618   -9.027  1.00 0.00 ? 49 LYS A HZ3  5  
ATOM 6067  N N    . GLN A 1 50 ? 7.930   4.905   -9.133  1.00 0.00 ? 50 GLN A N    5  
ATOM 6068  C CA   . GLN A 1 50 ? 7.063   4.830   -7.967  1.00 0.00 ? 50 GLN A CA   5  
ATOM 6069  C C    . GLN A 1 50 ? 6.559   3.396   -7.803  1.00 0.00 ? 50 GLN A C    5  
ATOM 6070  O O    . GLN A 1 50 ? 6.663   2.829   -6.722  1.00 0.00 ? 50 GLN A O    5  
ATOM 6071  C CB   . GLN A 1 50 ? 5.899   5.812   -8.110  1.00 0.00 ? 50 GLN A CB   5  
ATOM 6072  C CG   . GLN A 1 50 ? 6.423   7.248   -8.089  1.00 0.00 ? 50 GLN A CG   5  
ATOM 6073  C CD   . GLN A 1 50 ? 5.288   8.235   -7.843  1.00 0.00 ? 50 GLN A CD   5  
ATOM 6074  O OE1  . GLN A 1 50 ? 5.112   8.717   -6.727  1.00 0.00 ? 50 GLN A OE1  5  
ATOM 6075  N NE2  . GLN A 1 50 ? 4.518   8.534   -8.889  1.00 0.00 ? 50 GLN A NE2  5  
ATOM 6076  H H    . GLN A 1 50 ? 7.599   5.397   -9.951  1.00 0.00 ? 50 GLN A H    5  
ATOM 6077  H HA   . GLN A 1 50 ? 7.640   5.100   -7.082  1.00 0.00 ? 50 GLN A HA   5  
ATOM 6078  H HB2  . GLN A 1 50 ? 5.381   5.631   -9.048  1.00 0.00 ? 50 GLN A HB2  5  
ATOM 6079  H HB3  . GLN A 1 50 ? 5.207   5.670   -7.279  1.00 0.00 ? 50 GLN A HB3  5  
ATOM 6080  H HG2  . GLN A 1 50 ? 7.161   7.349   -7.293  1.00 0.00 ? 50 GLN A HG2  5  
ATOM 6081  H HG3  . GLN A 1 50 ? 6.896   7.473   -9.046  1.00 0.00 ? 50 GLN A HG3  5  
ATOM 6082  H HE21 . GLN A 1 50 ? 4.705   8.119   -9.787  1.00 0.00 ? 50 GLN A HE21 5  
ATOM 6083  H HE22 . GLN A 1 50 ? 3.748   9.179   -8.777  1.00 0.00 ? 50 GLN A HE22 5  
ATOM 6084  N N    . LYS A 1 51 ? 6.022   2.808   -8.885  1.00 0.00 ? 51 LYS A N    5  
ATOM 6085  C CA   . LYS A 1 51 ? 5.550   1.427   -8.868  1.00 0.00 ? 51 LYS A CA   5  
ATOM 6086  C C    . LYS A 1 51 ? 6.647   0.515   -8.314  1.00 0.00 ? 51 LYS A C    5  
ATOM 6087  O O    . LYS A 1 51 ? 6.391   -0.323  -7.450  1.00 0.00 ? 51 LYS A O    5  
ATOM 6088  C CB   . LYS A 1 51 ? 5.172   1.007   -10.295 1.00 0.00 ? 51 LYS A CB   5  
ATOM 6089  C CG   . LYS A 1 51 ? 4.136   -0.117  -10.249 1.00 0.00 ? 51 LYS A CG   5  
ATOM 6090  C CD   . LYS A 1 51 ? 3.972   -0.733  -11.645 1.00 0.00 ? 51 LYS A CD   5  
ATOM 6091  C CE   . LYS A 1 51 ? 2.604   -1.419  -11.744 1.00 0.00 ? 51 LYS A CE   5  
ATOM 6092  N NZ   . LYS A 1 51 ? 2.573   -2.411  -12.835 1.00 0.00 ? 51 LYS A NZ   5  
ATOM 6093  H H    . LYS A 1 51 ? 5.942   3.328   -9.747  1.00 0.00 ? 51 LYS A H    5  
ATOM 6094  H HA   . LYS A 1 51 ? 4.670   1.359   -8.229  1.00 0.00 ? 51 LYS A HA   5  
ATOM 6095  H HB2  . LYS A 1 51 ? 4.753   1.861   -10.826 1.00 0.00 ? 51 LYS A HB2  5  
ATOM 6096  H HB3  . LYS A 1 51 ? 6.063   0.660   -10.820 1.00 0.00 ? 51 LYS A HB3  5  
ATOM 6097  H HG2  . LYS A 1 51 ? 4.465   -0.889  -9.550  1.00 0.00 ? 51 LYS A HG2  5  
ATOM 6098  H HG3  . LYS A 1 51 ? 3.182   0.289   -9.915  1.00 0.00 ? 51 LYS A HG3  5  
ATOM 6099  H HD2  . LYS A 1 51 ? 4.038   0.053   -12.399 1.00 0.00 ? 51 LYS A HD2  5  
ATOM 6100  H HD3  . LYS A 1 51 ? 4.763   -1.465  -11.812 1.00 0.00 ? 51 LYS A HD3  5  
ATOM 6101  H HE2  . LYS A 1 51 ? 2.388   -1.922  -10.802 1.00 0.00 ? 51 LYS A HE2  5  
ATOM 6102  H HE3  . LYS A 1 51 ? 1.841   -0.662  -11.930 1.00 0.00 ? 51 LYS A HE3  5  
ATOM 6103  H HZ1  . LYS A 1 51 ? 3.305   -3.091  -12.694 1.00 0.00 ? 51 LYS A HZ1  5  
ATOM 6104  H HZ2  . LYS A 1 51 ? 1.671   -2.883  -12.834 1.00 0.00 ? 51 LYS A HZ2  5  
ATOM 6105  H HZ3  . LYS A 1 51 ? 2.708   -1.946  -13.720 1.00 0.00 ? 51 LYS A HZ3  5  
ATOM 6106  N N    . GLN A 1 52 ? 7.872   0.694   -8.820  1.00 0.00 ? 52 GLN A N    5  
ATOM 6107  C CA   . GLN A 1 52 ? 9.018   -0.083  -8.391  1.00 0.00 ? 52 GLN A CA   5  
ATOM 6108  C C    . GLN A 1 52 ? 9.258   0.136   -6.900  1.00 0.00 ? 52 GLN A C    5  
ATOM 6109  O O    . GLN A 1 52 ? 9.282   -0.819  -6.139  1.00 0.00 ? 52 GLN A O    5  
ATOM 6110  C CB   . GLN A 1 52 ? 10.241  0.343   -9.217  1.00 0.00 ? 52 GLN A CB   5  
ATOM 6111  C CG   . GLN A 1 52 ? 11.489  -0.414  -8.753  1.00 0.00 ? 52 GLN A CG   5  
ATOM 6112  C CD   . GLN A 1 52 ? 12.686  -0.072  -9.637  1.00 0.00 ? 52 GLN A CD   5  
ATOM 6113  O OE1  . GLN A 1 52 ? 13.121  1.080   -9.684  1.00 0.00 ? 52 GLN A OE1  5  
ATOM 6114  N NE2  . GLN A 1 52 ? 13.220  -1.071  -10.340 1.00 0.00 ? 52 GLN A NE2  5  
ATOM 6115  H H    . GLN A 1 52 ? 8.015   1.399   -9.531  1.00 0.00 ? 52 GLN A H    5  
ATOM 6116  H HA   . GLN A 1 52 ? 8.818   -1.141  -8.570  1.00 0.00 ? 52 GLN A HA   5  
ATOM 6117  H HB2  . GLN A 1 52 ? 10.059  0.122   -10.270 1.00 0.00 ? 52 GLN A HB2  5  
ATOM 6118  H HB3  . GLN A 1 52 ? 10.405  1.414   -9.099  1.00 0.00 ? 52 GLN A HB3  5  
ATOM 6119  H HG2  . GLN A 1 52 ? 11.718  -0.136  -7.724  1.00 0.00 ? 52 GLN A HG2  5  
ATOM 6120  H HG3  . GLN A 1 52 ? 11.298  -1.486  -8.800  1.00 0.00 ? 52 GLN A HG3  5  
ATOM 6121  H HE21 . GLN A 1 52 ? 12.826  -1.998  -10.278 1.00 0.00 ? 52 GLN A HE21 5  
ATOM 6122  H HE22 . GLN A 1 52 ? 14.018  -0.898  -10.934 1.00 0.00 ? 52 GLN A HE22 5  
ATOM 6123  N N    . TRP A 1 53 ? 9.436   1.400   -6.496  1.00 0.00 ? 53 TRP A N    5  
ATOM 6124  C CA   . TRP A 1 53 ? 9.695   1.756   -5.105  1.00 0.00 ? 53 TRP A CA   5  
ATOM 6125  C C    . TRP A 1 53 ? 8.673   1.111   -4.170  1.00 0.00 ? 53 TRP A C    5  
ATOM 6126  O O    . TRP A 1 53 ? 9.044   0.546   -3.145  1.00 0.00 ? 53 TRP A O    5  
ATOM 6127  C CB   . TRP A 1 53 ? 9.656   3.278   -4.966  1.00 0.00 ? 53 TRP A CB   5  
ATOM 6128  C CG   . TRP A 1 53 ? 9.502   3.775   -3.562  1.00 0.00 ? 53 TRP A CG   5  
ATOM 6129  C CD1  . TRP A 1 53 ? 10.406  3.635   -2.579  1.00 0.00 ? 53 TRP A CD1  5  
ATOM 6130  C CD2  . TRP A 1 53 ? 8.381   4.490   -2.958  1.00 0.00 ? 53 TRP A CD2  5  
ATOM 6131  N NE1  . TRP A 1 53 ? 9.958   4.208   -1.415  1.00 0.00 ? 53 TRP A NE1  5  
ATOM 6132  C CE2  . TRP A 1 53 ? 8.703   4.761   -1.589  1.00 0.00 ? 53 TRP A CE2  5  
ATOM 6133  C CE3  . TRP A 1 53 ? 7.124   4.947   -3.419  1.00 0.00 ? 53 TRP A CE3  5  
ATOM 6134  C CZ2  . TRP A 1 53 ? 7.836   5.449   -0.738  1.00 0.00 ? 53 TRP A CZ2  5  
ATOM 6135  C CZ3  . TRP A 1 53 ? 6.245   5.638   -2.562  1.00 0.00 ? 53 TRP A CZ3  5  
ATOM 6136  C CH2  . TRP A 1 53 ? 6.603   5.895   -1.228  1.00 0.00 ? 53 TRP A CH2  5  
ATOM 6137  H H    . TRP A 1 53 ? 9.395   2.148   -7.176  1.00 0.00 ? 53 TRP A H    5  
ATOM 6138  H HA   . TRP A 1 53 ? 10.692  1.405   -4.831  1.00 0.00 ? 53 TRP A HA   5  
ATOM 6139  H HB2  . TRP A 1 53 ? 10.578  3.687   -5.379  1.00 0.00 ? 53 TRP A HB2  5  
ATOM 6140  H HB3  . TRP A 1 53 ? 8.820   3.655   -5.553  1.00 0.00 ? 53 TRP A HB3  5  
ATOM 6141  H HD1  . TRP A 1 53 ? 11.360  3.136   -2.687  1.00 0.00 ? 53 TRP A HD1  5  
ATOM 6142  H HE1  . TRP A 1 53 ? 10.467  4.232   -0.534  1.00 0.00 ? 53 TRP A HE1  5  
ATOM 6143  H HE3  . TRP A 1 53 ? 6.833   4.766   -4.441  1.00 0.00 ? 53 TRP A HE3  5  
ATOM 6144  H HZ2  . TRP A 1 53 ? 8.113   5.636   0.289   1.00 0.00 ? 53 TRP A HZ2  5  
ATOM 6145  H HZ3  . TRP A 1 53 ? 5.289   5.976   -2.934  1.00 0.00 ? 53 TRP A HZ3  5  
ATOM 6146  H HH2  . TRP A 1 53 ? 5.930   6.440   -0.586  1.00 0.00 ? 53 TRP A HH2  5  
ATOM 6147  N N    . LEU A 1 54 ? 7.387   1.199   -4.511  1.00 0.00 ? 54 LEU A N    5  
ATOM 6148  C CA   . LEU A 1 54 ? 6.339   0.635   -3.680  1.00 0.00 ? 54 LEU A CA   5  
ATOM 6149  C C    . LEU A 1 54 ? 6.585   -0.858  -3.466  1.00 0.00 ? 54 LEU A C    5  
ATOM 6150  O O    . LEU A 1 54 ? 6.455   -1.356  -2.351  1.00 0.00 ? 54 LEU A O    5  
ATOM 6151  C CB   . LEU A 1 54 ? 4.970   0.854   -4.343  1.00 0.00 ? 54 LEU A CB   5  
ATOM 6152  C CG   . LEU A 1 54 ? 4.567   2.336   -4.285  1.00 0.00 ? 54 LEU A CG   5  
ATOM 6153  C CD1  . LEU A 1 54 ? 3.394   2.576   -5.241  1.00 0.00 ? 54 LEU A CD1  5  
ATOM 6154  C CD2  . LEU A 1 54 ? 4.144   2.716   -2.863  1.00 0.00 ? 54 LEU A CD2  5  
ATOM 6155  H H    . LEU A 1 54 ? 7.126   1.671   -5.366  1.00 0.00 ? 54 LEU A H    5  
ATOM 6156  H HA   . LEU A 1 54 ? 6.352   1.133   -2.717  1.00 0.00 ? 54 LEU A HA   5  
ATOM 6157  H HB2  . LEU A 1 54 ? 5.021   0.535   -5.382  1.00 0.00 ? 54 LEU A HB2  5  
ATOM 6158  H HB3  . LEU A 1 54 ? 4.219   0.259   -3.823  1.00 0.00 ? 54 LEU A HB3  5  
ATOM 6159  H HG   . LEU A 1 54 ? 5.406   2.956   -4.590  1.00 0.00 ? 54 LEU A HG   5  
ATOM 6160  H HD11 . LEU A 1 54 ? 2.557   1.938   -4.956  1.00 0.00 ? 54 LEU A HD11 5  
ATOM 6161  H HD12 . LEU A 1 54 ? 3.701   2.339   -6.259  1.00 0.00 ? 54 LEU A HD12 5  
ATOM 6162  H HD13 . LEU A 1 54 ? 3.089   3.621   -5.188  1.00 0.00 ? 54 LEU A HD13 5  
ATOM 6163  H HD21 . LEU A 1 54 ? 5.016   2.731   -2.213  1.00 0.00 ? 54 LEU A HD21 5  
ATOM 6164  H HD22 . LEU A 1 54 ? 3.686   3.705   -2.872  1.00 0.00 ? 54 LEU A HD22 5  
ATOM 6165  H HD23 . LEU A 1 54 ? 3.425   1.988   -2.488  1.00 0.00 ? 54 LEU A HD23 5  
ATOM 6166  N N    . MET A 1 55 ? 6.927   -1.567  -4.541  1.00 0.00 ? 55 MET A N    5  
ATOM 6167  C CA   . MET A 1 55 ? 7.112   -3.008  -4.502  1.00 0.00 ? 55 MET A CA   5  
ATOM 6168  C C    . MET A 1 55 ? 8.453   -3.413  -3.865  1.00 0.00 ? 55 MET A C    5  
ATOM 6169  O O    . MET A 1 55 ? 8.526   -4.454  -3.219  1.00 0.00 ? 55 MET A O    5  
ATOM 6170  C CB   . MET A 1 55 ? 7.023   -3.535  -5.940  1.00 0.00 ? 55 MET A CB   5  
ATOM 6171  C CG   . MET A 1 55 ? 6.779   -5.044  -5.934  1.00 0.00 ? 55 MET A CG   5  
ATOM 6172  S SD   . MET A 1 55 ? 6.604   -5.761  -7.587  1.00 0.00 ? 55 MET A SD   5  
ATOM 6173  C CE   . MET A 1 55 ? 6.312   -7.484  -7.121  1.00 0.00 ? 55 MET A CE   5  
ATOM 6174  H H    . MET A 1 55 ? 7.050   -1.096  -5.429  1.00 0.00 ? 55 MET A H    5  
ATOM 6175  H HA   . MET A 1 55 ? 6.301   -3.448  -3.918  1.00 0.00 ? 55 MET A HA   5  
ATOM 6176  H HB2  . MET A 1 55 ? 6.198   -3.042  -6.455  1.00 0.00 ? 55 MET A HB2  5  
ATOM 6177  H HB3  . MET A 1 55 ? 7.955   -3.321  -6.465  1.00 0.00 ? 55 MET A HB3  5  
ATOM 6178  H HG2  . MET A 1 55 ? 7.614   -5.533  -5.432  1.00 0.00 ? 55 MET A HG2  5  
ATOM 6179  H HG3  . MET A 1 55 ? 5.868   -5.245  -5.374  1.00 0.00 ? 55 MET A HG3  5  
ATOM 6180  H HE1  . MET A 1 55 ? 7.168   -7.859  -6.560  1.00 0.00 ? 55 MET A HE1  5  
ATOM 6181  H HE2  . MET A 1 55 ? 6.176   -8.085  -8.020  1.00 0.00 ? 55 MET A HE2  5  
ATOM 6182  H HE3  . MET A 1 55 ? 5.416   -7.547  -6.504  1.00 0.00 ? 55 MET A HE3  5  
ATOM 6183  N N    . THR A 1 56 ? 9.513   -2.616  -4.065  1.00 0.00 ? 56 THR A N    5  
ATOM 6184  C CA   . THR A 1 56 ? 10.855  -2.983  -3.604  1.00 0.00 ? 56 THR A CA   5  
ATOM 6185  C C    . THR A 1 56 ? 11.261  -2.269  -2.310  1.00 0.00 ? 56 THR A C    5  
ATOM 6186  O O    . THR A 1 56 ? 12.337  -2.556  -1.786  1.00 0.00 ? 56 THR A O    5  
ATOM 6187  C CB   . THR A 1 56 ? 11.865  -2.662  -4.714  1.00 0.00 ? 56 THR A CB   5  
ATOM 6188  O OG1  . THR A 1 56 ? 11.825  -1.281  -5.007  1.00 0.00 ? 56 THR A OG1  5  
ATOM 6189  C CG2  . THR A 1 56 ? 11.529  -3.463  -5.974  1.00 0.00 ? 56 THR A CG2  5  
ATOM 6190  H H    . THR A 1 56 ? 9.402   -1.748  -4.570  1.00 0.00 ? 56 THR A H    5  
ATOM 6191  H HA   . THR A 1 56 ? 10.880  -4.058  -3.422  1.00 0.00 ? 56 THR A HA   5  
ATOM 6192  H HB   . THR A 1 56 ? 12.867  -2.929  -4.375  1.00 0.00 ? 56 THR A HB   5  
ATOM 6193  H HG1  . THR A 1 56 ? 12.518  -1.083  -5.640  1.00 0.00 ? 56 THR A HG1  5  
ATOM 6194  H HG21 . THR A 1 56 ? 10.564  -3.143  -6.367  1.00 0.00 ? 56 THR A HG21 5  
ATOM 6195  H HG22 . THR A 1 56 ? 11.488  -4.525  -5.731  1.00 0.00 ? 56 THR A HG22 5  
ATOM 6196  H HG23 . THR A 1 56 ? 12.299  -3.293  -6.727  1.00 0.00 ? 56 THR A HG23 5  
ATOM 6197  N N    . GLU A 1 57 ? 10.437  -1.347  -1.789  1.00 0.00 ? 57 GLU A N    5  
ATOM 6198  C CA   . GLU A 1 57 ? 10.795  -0.619  -0.572  1.00 0.00 ? 57 GLU A CA   5  
ATOM 6199  C C    . GLU A 1 57 ? 9.594   -0.464  0.365   1.00 0.00 ? 57 GLU A C    5  
ATOM 6200  O O    . GLU A 1 57 ? 9.526   -1.122  1.396   1.00 0.00 ? 57 GLU A O    5  
ATOM 6201  C CB   . GLU A 1 57 ? 11.372  0.750   -0.954  1.00 0.00 ? 57 GLU A CB   5  
ATOM 6202  C CG   . GLU A 1 57 ? 11.881  1.470   0.300   1.00 0.00 ? 57 GLU A CG   5  
ATOM 6203  C CD   . GLU A 1 57 ? 12.492  2.820   -0.054  1.00 0.00 ? 57 GLU A CD   5  
ATOM 6204  O OE1  . GLU A 1 57 ? 13.494  2.813   -0.799  1.00 0.00 ? 57 GLU A OE1  5  
ATOM 6205  O OE2  . GLU A 1 57 ? 11.940  3.836   0.427   1.00 0.00 ? 57 GLU A OE2  5  
ATOM 6206  H H    . GLU A 1 57 ? 9.556   -1.136  -2.240  1.00 0.00 ? 57 GLU A H    5  
ATOM 6207  H HA   . GLU A 1 57 ? 11.566  -1.173  -0.046  1.00 0.00 ? 57 GLU A HA   5  
ATOM 6208  H HB2  . GLU A 1 57 ? 12.200  0.611   -1.651  1.00 0.00 ? 57 GLU A HB2  5  
ATOM 6209  H HB3  . GLU A 1 57 ? 10.602  1.350   -1.427  1.00 0.00 ? 57 GLU A HB3  5  
ATOM 6210  H HG2  . GLU A 1 57 ? 11.049  1.628   0.986   1.00 0.00 ? 57 GLU A HG2  5  
ATOM 6211  H HG3  . GLU A 1 57 ? 12.636  0.854   0.788   1.00 0.00 ? 57 GLU A HG3  5  
ATOM 6212  N N    . ALA A 1 58 ? 8.664   0.425   0.020   1.00 0.00 ? 58 ALA A N    5  
ATOM 6213  C CA   . ALA A 1 58 ? 7.541   0.746   0.890   1.00 0.00 ? 58 ALA A CA   5  
ATOM 6214  C C    . ALA A 1 58 ? 6.819   -0.506  1.400   1.00 0.00 ? 58 ALA A C    5  
ATOM 6215  O O    . ALA A 1 58 ? 6.779   -0.750  2.600   1.00 0.00 ? 58 ALA A O    5  
ATOM 6216  C CB   . ALA A 1 58 ? 6.566   1.649   0.142   1.00 0.00 ? 58 ALA A CB   5  
ATOM 6217  H H    . ALA A 1 58 ? 8.742   0.913   -0.861  1.00 0.00 ? 58 ALA A H    5  
ATOM 6218  H HA   . ALA A 1 58 ? 7.924   1.296   1.752   1.00 0.00 ? 58 ALA A HA   5  
ATOM 6219  H HB1  . ALA A 1 58 ? 7.106   2.487   -0.298  1.00 0.00 ? 58 ALA A HB1  5  
ATOM 6220  H HB2  . ALA A 1 58 ? 5.819   2.025   0.837   1.00 0.00 ? 58 ALA A HB2  5  
ATOM 6221  H HB3  . ALA A 1 58 ? 6.072   1.082   -0.642  1.00 0.00 ? 58 ALA A HB3  5  
ATOM 6222  N N    . LEU A 1 59 ? 6.227   -1.282  0.496   1.00 0.00 ? 59 LEU A N    5  
ATOM 6223  C CA   . LEU A 1 59 ? 5.397   -2.420  0.879   1.00 0.00 ? 59 LEU A CA   5  
ATOM 6224  C C    . LEU A 1 59 ? 6.218   -3.606  1.409   1.00 0.00 ? 59 LEU A C    5  
ATOM 6225  O O    . LEU A 1 59 ? 5.637   -4.648  1.702   1.00 0.00 ? 59 LEU A O    5  
ATOM 6226  C CB   . LEU A 1 59 ? 4.550   -2.849  -0.324  1.00 0.00 ? 59 LEU A CB   5  
ATOM 6227  C CG   . LEU A 1 59 ? 3.731   -1.660  -0.862  1.00 0.00 ? 59 LEU A CG   5  
ATOM 6228  C CD1  . LEU A 1 59 ? 3.109   -2.048  -2.196  1.00 0.00 ? 59 LEU A CD1  5  
ATOM 6229  C CD2  . LEU A 1 59 ? 2.617   -1.293  0.119   1.00 0.00 ? 59 LEU A CD2  5  
ATOM 6230  H H    . LEU A 1 59 ? 6.327   -1.072  -0.488  1.00 0.00 ? 59 LEU A H    5  
ATOM 6231  H HA   . LEU A 1 59 ? 4.724   -2.098  1.675   1.00 0.00 ? 59 LEU A HA   5  
ATOM 6232  H HB2  . LEU A 1 59 ? 5.206   -3.222  -1.110  1.00 0.00 ? 59 LEU A HB2  5  
ATOM 6233  H HB3  . LEU A 1 59 ? 3.869   -3.644  -0.020  1.00 0.00 ? 59 LEU A HB3  5  
ATOM 6234  H HG   . LEU A 1 59 ? 4.381   -0.800  -1.008  1.00 0.00 ? 59 LEU A HG   5  
ATOM 6235  H HD11 . LEU A 1 59 ? 2.442   -2.898  -2.052  1.00 0.00 ? 59 LEU A HD11 5  
ATOM 6236  H HD12 . LEU A 1 59 ? 2.543   -1.204  -2.590  1.00 0.00 ? 59 LEU A HD12 5  
ATOM 6237  H HD13 . LEU A 1 59 ? 3.896   -2.316  -2.897  1.00 0.00 ? 59 LEU A HD13 5  
ATOM 6238  H HD21 . LEU A 1 59 ? 3.049   -0.939  1.053   1.00 0.00 ? 59 LEU A HD21 5  
ATOM 6239  H HD22 . LEU A 1 59 ? 2.000   -0.504  -0.314  1.00 0.00 ? 59 LEU A HD22 5  
ATOM 6240  H HD23 . LEU A 1 59 ? 2.000   -2.170  0.310   1.00 0.00 ? 59 LEU A HD23 5  
ATOM 6241  N N    . VAL A 1 60 ? 7.549   -3.464  1.546   1.00 0.00 ? 60 VAL A N    5  
ATOM 6242  C CA   . VAL A 1 60 ? 8.383   -4.547  2.076   1.00 0.00 ? 60 VAL A CA   5  
ATOM 6243  C C    . VAL A 1 60 ? 9.048   -4.124  3.394   1.00 0.00 ? 60 VAL A C    5  
ATOM 6244  O O    . VAL A 1 60 ? 9.864   -4.868  3.932   1.00 0.00 ? 60 VAL A O    5  
ATOM 6245  C CB   . VAL A 1 60 ? 9.429   -4.989  1.034   1.00 0.00 ? 60 VAL A CB   5  
ATOM 6246  C CG1  . VAL A 1 60 ? 8.722   -5.640  -0.156  1.00 0.00 ? 60 VAL A CG1  5  
ATOM 6247  C CG2  . VAL A 1 60 ? 10.240  -3.795  0.543   1.00 0.00 ? 60 VAL A CG2  5  
ATOM 6248  H H    . VAL A 1 60 ? 7.996   -2.594  1.289   1.00 0.00 ? 60 VAL A H    5  
ATOM 6249  H HA   . VAL A 1 60 ? 7.745   -5.404  2.290   1.00 0.00 ? 60 VAL A HA   5  
ATOM 6250  H HB   . VAL A 1 60 ? 10.103  -5.713  1.488   1.00 0.00 ? 60 VAL A HB   5  
ATOM 6251  H HG11 . VAL A 1 60 ? 8.179   -6.522  0.183   1.00 0.00 ? 60 VAL A HG11 5  
ATOM 6252  H HG12 . VAL A 1 60 ? 8.025   -4.931  -0.601  1.00 0.00 ? 60 VAL A HG12 5  
ATOM 6253  H HG13 . VAL A 1 60 ? 9.462   -5.934  -0.900  1.00 0.00 ? 60 VAL A HG13 5  
ATOM 6254  H HG21 . VAL A 1 60 ? 11.045  -4.147  -0.101  1.00 0.00 ? 60 VAL A HG21 5  
ATOM 6255  H HG22 . VAL A 1 60 ? 9.593   -3.126  -0.021  1.00 0.00 ? 60 VAL A HG22 5  
ATOM 6256  H HG23 . VAL A 1 60 ? 10.665  -3.266  1.395   1.00 0.00 ? 60 VAL A HG23 5  
ATOM 6257  N N    . ASN A 1 61 ? 8.689   -2.938  3.924   1.00 0.00 ? 61 ASN A N    5  
ATOM 6258  C CA   . ASN A 1 61 ? 9.224   -2.476  5.207   1.00 0.00 ? 61 ASN A CA   5  
ATOM 6259  C C    . ASN A 1 61 ? 8.182   -1.661  5.991   1.00 0.00 ? 61 ASN A C    5  
ATOM 6260  O O    . ASN A 1 61 ? 8.352   -1.454  7.189   1.00 0.00 ? 61 ASN A O    5  
ATOM 6261  C CB   . ASN A 1 61 ? 10.520  -1.674  4.990   1.00 0.00 ? 61 ASN A CB   5  
ATOM 6262  C CG   . ASN A 1 61 ? 10.307  -0.424  4.135   1.00 0.00 ? 61 ASN A CG   5  
ATOM 6263  O OD1  . ASN A 1 61 ? 9.269   0.226   4.209   1.00 0.00 ? 61 ASN A OD1  5  
ATOM 6264  N ND2  . ASN A 1 61 ? 11.307  -0.087  3.323   1.00 0.00 ? 61 ASN A ND2  5  
ATOM 6265  H H    . ASN A 1 61 ? 8.031   -2.350  3.435   1.00 0.00 ? 61 ASN A H    5  
ATOM 6266  H HA   . ASN A 1 61 ? 9.473   -3.353  5.806   1.00 0.00 ? 61 ASN A HA   5  
ATOM 6267  H HB2  . ASN A 1 61 ? 10.913  -1.372  5.961   1.00 0.00 ? 61 ASN A HB2  5  
ATOM 6268  H HB3  . ASN A 1 61 ? 11.252  -2.316  4.499   1.00 0.00 ? 61 ASN A HB3  5  
ATOM 6269  H HD21 . ASN A 1 61 ? 12.139  -0.657  3.283   1.00 0.00 ? 61 ASN A HD21 5  
ATOM 6270  H HD22 . ASN A 1 61 ? 11.231  0.737   2.747   1.00 0.00 ? 61 ASN A HD22 5  
ATOM 6271  N N    . ASN A 1 62 ? 7.106   -1.204  5.328   1.00 0.00 ? 62 ASN A N    5  
ATOM 6272  C CA   . ASN A 1 62 ? 6.054   -0.439  5.985   1.00 0.00 ? 62 ASN A CA   5  
ATOM 6273  C C    . ASN A 1 62 ? 5.370   -1.329  7.036   1.00 0.00 ? 62 ASN A C    5  
ATOM 6274  O O    . ASN A 1 62 ? 4.791   -2.350  6.677   1.00 0.00 ? 62 ASN A O    5  
ATOM 6275  C CB   . ASN A 1 62 ? 5.052   0.042   4.922   1.00 0.00 ? 62 ASN A CB   5  
ATOM 6276  C CG   . ASN A 1 62 ? 3.960   0.921   5.527   1.00 0.00 ? 62 ASN A CG   5  
ATOM 6277  O OD1  . ASN A 1 62 ? 3.732   0.908   6.732   1.00 0.00 ? 62 ASN A OD1  5  
ATOM 6278  N ND2  . ASN A 1 62 ? 3.282   1.690   4.681   1.00 0.00 ? 62 ASN A ND2  5  
ATOM 6279  H H    . ASN A 1 62 ? 7.008   -1.389  4.342   1.00 0.00 ? 62 ASN A H    5  
ATOM 6280  H HA   . ASN A 1 62 ? 6.500   0.428   6.464   1.00 0.00 ? 62 ASN A HA   5  
ATOM 6281  H HB2  . ASN A 1 62 ? 5.586   0.621   4.170   1.00 0.00 ? 62 ASN A HB2  5  
ATOM 6282  H HB3  . ASN A 1 62 ? 4.592   -0.822  4.442   1.00 0.00 ? 62 ASN A HB3  5  
ATOM 6283  H HD21 . ASN A 1 62 ? 3.496   1.664   3.694   1.00 0.00 ? 62 ASN A HD21 5  
ATOM 6284  H HD22 . ASN A 1 62 ? 2.558   2.298   5.027   1.00 0.00 ? 62 ASN A HD22 5  
ATOM 6285  N N    . PRO A 1 63 ? 5.435   -0.953  8.337   1.00 0.00 ? 63 PRO A N    5  
ATOM 6286  C CA   . PRO A 1 63 ? 4.859   -1.747  9.411   1.00 0.00 ? 63 PRO A CA   5  
ATOM 6287  C C    . PRO A 1 63 ? 3.350   -1.954  9.238   1.00 0.00 ? 63 PRO A C    5  
ATOM 6288  O O    . PRO A 1 63 ? 2.806   -2.927  9.753   1.00 0.00 ? 63 PRO A O    5  
ATOM 6289  C CB   . PRO A 1 63 ? 5.165   -0.987  10.706  1.00 0.00 ? 63 PRO A CB   5  
ATOM 6290  C CG   . PRO A 1 63 ? 5.937   0.278   10.317  1.00 0.00 ? 63 PRO A CG   5  
ATOM 6291  C CD   . PRO A 1 63 ? 6.093   0.256   8.798   1.00 0.00 ? 63 PRO A CD   5  
ATOM 6292  H HA   . PRO A 1 63 ? 5.352   -2.721  9.441   1.00 0.00 ? 63 PRO A HA   5  
ATOM 6293  H HB2  . PRO A 1 63 ? 4.236   -0.716  11.211  1.00 0.00 ? 63 PRO A HB2  5  
ATOM 6294  H HB3  . PRO A 1 63 ? 5.775   -1.607  11.365  1.00 0.00 ? 63 PRO A HB3  5  
ATOM 6295  H HG2  . PRO A 1 63 ? 5.379   1.163   10.623  1.00 0.00 ? 63 PRO A HG2  5  
ATOM 6296  H HG3  . PRO A 1 63 ? 6.919   0.275   10.792  1.00 0.00 ? 63 PRO A HG3  5  
ATOM 6297  H HD2  . PRO A 1 63 ? 5.614   1.135   8.364   1.00 0.00 ? 63 PRO A HD2  5  
ATOM 6298  H HD3  . PRO A 1 63 ? 7.149   0.236   8.535   1.00 0.00 ? 63 PRO A HD3  5  
ATOM 6299  N N    . LYS A 1 64 ? 2.669   -1.043  8.526   1.00 0.00 ? 64 LYS A N    5  
ATOM 6300  C CA   . LYS A 1 64 ? 1.227   -1.150  8.330   1.00 0.00 ? 64 LYS A CA   5  
ATOM 6301  C C    . LYS A 1 64 ? 0.894   -2.211  7.280   1.00 0.00 ? 64 LYS A C    5  
ATOM 6302  O O    . LYS A 1 64 ? -0.267  -2.593  7.157   1.00 0.00 ? 64 LYS A O    5  
ATOM 6303  C CB   . LYS A 1 64 ? 0.653   0.211   7.913   1.00 0.00 ? 64 LYS A CB   5  
ATOM 6304  C CG   . LYS A 1 64 ? 0.801   1.227   9.057   1.00 0.00 ? 64 LYS A CG   5  
ATOM 6305  C CD   . LYS A 1 64 ? -0.557  1.464   9.744   1.00 0.00 ? 64 LYS A CD   5  
ATOM 6306  C CE   . LYS A 1 64 ? -1.057  0.186   10.436  1.00 0.00 ? 64 LYS A CE   5  
ATOM 6307  N NZ   . LYS A 1 64 ? -0.128  -0.259  11.493  1.00 0.00 ? 64 LYS A NZ   5  
ATOM 6308  H H    . LYS A 1 64 ? 3.156   -0.257  8.114   1.00 0.00 ? 64 LYS A H    5  
ATOM 6309  H HA   . LYS A 1 64 ? 0.771   -1.447  9.269   1.00 0.00 ? 64 LYS A HA   5  
ATOM 6310  H HB2  . LYS A 1 64 ? 1.188   0.574   7.035   1.00 0.00 ? 64 LYS A HB2  5  
ATOM 6311  H HB3  . LYS A 1 64 ? -0.405  0.097   7.664   1.00 0.00 ? 64 LYS A HB3  5  
ATOM 6312  H HG2  . LYS A 1 64 ? 1.524   0.863   9.784   1.00 0.00 ? 64 LYS A HG2  5  
ATOM 6313  H HG3  . LYS A 1 64 ? 1.156   2.174   8.645   1.00 0.00 ? 64 LYS A HG3  5  
ATOM 6314  H HD2  . LYS A 1 64 ? -0.448  2.254   10.488  1.00 0.00 ? 64 LYS A HD2  5  
ATOM 6315  H HD3  . LYS A 1 64 ? -1.288  1.776   8.998   1.00 0.00 ? 64 LYS A HD3  5  
ATOM 6316  H HE2  . LYS A 1 64 ? -2.030  0.387   10.886  1.00 0.00 ? 64 LYS A HE2  5  
ATOM 6317  H HE3  . LYS A 1 64 ? -1.168  -0.607  9.697   1.00 0.00 ? 64 LYS A HE3  5  
ATOM 6318  H HZ1  . LYS A 1 64 ? 0.769   -0.477  11.085  1.00 0.00 ? 64 LYS A HZ1  5  
ATOM 6319  H HZ2  . LYS A 1 64 ? -0.017  0.475   12.177  1.00 0.00 ? 64 LYS A HZ2  5  
ATOM 6320  H HZ3  . LYS A 1 64 ? -0.501  -1.084  11.942  1.00 0.00 ? 64 LYS A HZ3  5  
ATOM 6321  N N    . ILE A 1 65 ? 1.900   -2.685  6.526   1.00 0.00 ? 65 ILE A N    5  
ATOM 6322  C CA   . ILE A 1 65 ? 1.692   -3.697  5.493   1.00 0.00 ? 65 ILE A CA   5  
ATOM 6323  C C    . ILE A 1 65 ? 2.439   -4.978  5.880   1.00 0.00 ? 65 ILE A C    5  
ATOM 6324  O O    . ILE A 1 65 ? 3.517   -4.919  6.467   1.00 0.00 ? 65 ILE A O    5  
ATOM 6325  C CB   . ILE A 1 65 ? 2.179   -3.145  4.131   1.00 0.00 ? 65 ILE A CB   5  
ATOM 6326  C CG1  . ILE A 1 65 ? 1.010   -2.476  3.386   1.00 0.00 ? 65 ILE A CG1  5  
ATOM 6327  C CG2  . ILE A 1 65 ? 2.733   -4.276  3.252   1.00 0.00 ? 65 ILE A CG2  5  
ATOM 6328  C CD1  . ILE A 1 65 ? 0.521   -1.241  4.142   1.00 0.00 ? 65 ILE A CD1  5  
ATOM 6329  H H    . ILE A 1 65 ? 2.840   -2.339  6.668   1.00 0.00 ? 65 ILE A H    5  
ATOM 6330  H HA   . ILE A 1 65 ? 0.631   -3.923  5.420   1.00 0.00 ? 65 ILE A HA   5  
ATOM 6331  H HB   . ILE A 1 65 ? 2.966   -2.410  4.299   1.00 0.00 ? 65 ILE A HB   5  
ATOM 6332  H HG12 . ILE A 1 65 ? 1.346   -2.173  2.397   1.00 0.00 ? 65 ILE A HG12 5  
ATOM 6333  H HG13 . ILE A 1 65 ? 0.189   -3.186  3.282   1.00 0.00 ? 65 ILE A HG13 5  
ATOM 6334  H HG21 . ILE A 1 65 ? 2.964   -3.884  2.263   1.00 0.00 ? 65 ILE A HG21 5  
ATOM 6335  H HG22 . ILE A 1 65 ? 1.989   -5.067  3.160   1.00 0.00 ? 65 ILE A HG22 5  
ATOM 6336  H HG23 . ILE A 1 65 ? 3.642   -4.679  3.699   1.00 0.00 ? 65 ILE A HG23 5  
ATOM 6337  H HD11 . ILE A 1 65 ? -0.008  -0.583  3.454   1.00 0.00 ? 65 ILE A HD11 5  
ATOM 6338  H HD12 . ILE A 1 65 ? 1.371   -0.712  4.570   1.00 0.00 ? 65 ILE A HD12 5  
ATOM 6339  H HD13 . ILE A 1 65 ? -0.157  -1.546  4.936   1.00 0.00 ? 65 ILE A HD13 5  
ATOM 6340  N N    . GLU A 1 66 ? 1.848   -6.134  5.544   1.00 0.00 ? 66 GLU A N    5  
ATOM 6341  C CA   . GLU A 1 66 ? 2.434   -7.435  5.829   1.00 0.00 ? 66 GLU A CA   5  
ATOM 6342  C C    . GLU A 1 66 ? 2.553   -8.228  4.528   1.00 0.00 ? 66 GLU A C    5  
ATOM 6343  O O    . GLU A 1 66 ? 1.582   -8.335  3.776   1.00 0.00 ? 66 GLU A O    5  
ATOM 6344  C CB   . GLU A 1 66 ? 1.543   -8.172  6.837   1.00 0.00 ? 66 GLU A CB   5  
ATOM 6345  C CG   . GLU A 1 66 ? 2.277   -9.391  7.411   1.00 0.00 ? 66 GLU A CG   5  
ATOM 6346  C CD   . GLU A 1 66 ? 3.392   -8.968  8.362   1.00 0.00 ? 66 GLU A CD   5  
ATOM 6347  O OE1  . GLU A 1 66 ? 3.067   -8.729  9.549   1.00 0.00 ? 66 GLU A OE1  5  
ATOM 6348  O OE2  . GLU A 1 66 ? 4.544   -8.892  7.889   1.00 0.00 ? 66 GLU A OE2  5  
ATOM 6349  H H    . GLU A 1 66 ? 0.957   -6.113  5.069   1.00 0.00 ? 66 GLU A H    5  
ATOM 6350  H HA   . GLU A 1 66 ? 3.427   -7.299  6.258   1.00 0.00 ? 66 GLU A HA   5  
ATOM 6351  H HB2  . GLU A 1 66 ? 1.282   -7.496  7.647   1.00 0.00 ? 66 GLU A HB2  5  
ATOM 6352  H HB3  . GLU A 1 66 ? 0.631   -8.502  6.338   1.00 0.00 ? 66 GLU A HB3  5  
ATOM 6353  H HG2  . GLU A 1 66 ? 1.564   -10.011 7.955   1.00 0.00 ? 66 GLU A HG2  5  
ATOM 6354  H HG3  . GLU A 1 66 ? 2.703   -9.974  6.595   1.00 0.00 ? 66 GLU A HG3  5  
ATOM 6355  N N    . VAL A 1 67 ? 3.741   -8.786  4.265   1.00 0.00 ? 67 VAL A N    5  
ATOM 6356  C CA   . VAL A 1 67 ? 3.981   -9.577  3.065   1.00 0.00 ? 67 VAL A CA   5  
ATOM 6357  C C    . VAL A 1 67 ? 3.637   -11.035 3.361   1.00 0.00 ? 67 VAL A C    5  
ATOM 6358  O O    . VAL A 1 67 ? 4.156   -11.600 4.322   1.00 0.00 ? 67 VAL A O    5  
ATOM 6359  C CB   . VAL A 1 67 ? 5.452   -9.441  2.642   1.00 0.00 ? 67 VAL A CB   5  
ATOM 6360  C CG1  . VAL A 1 67 ? 5.636   -10.022 1.237   1.00 0.00 ? 67 VAL A CG1  5  
ATOM 6361  C CG2  . VAL A 1 67 ? 5.863   -7.965  2.640   1.00 0.00 ? 67 VAL A CG2  5  
ATOM 6362  H H    . VAL A 1 67 ? 4.502   -8.665  4.918   1.00 0.00 ? 67 VAL A H    5  
ATOM 6363  H HA   . VAL A 1 67 ? 3.342   -9.212  2.259   1.00 0.00 ? 67 VAL A HA   5  
ATOM 6364  H HB   . VAL A 1 67 ? 6.084   -9.988  3.344   1.00 0.00 ? 67 VAL A HB   5  
ATOM 6365  H HG11 . VAL A 1 67 ? 5.364   -11.078 1.239   1.00 0.00 ? 67 VAL A HG11 5  
ATOM 6366  H HG12 . VAL A 1 67 ? 6.678   -9.919  0.934   1.00 0.00 ? 67 VAL A HG12 5  
ATOM 6367  H HG13 . VAL A 1 67 ? 5.000   -9.484  0.533   1.00 0.00 ? 67 VAL A HG13 5  
ATOM 6368  H HG21 . VAL A 1 67 ? 6.837   -7.859  2.162   1.00 0.00 ? 67 VAL A HG21 5  
ATOM 6369  H HG22 . VAL A 1 67 ? 5.125   -7.383  2.091   1.00 0.00 ? 67 VAL A HG22 5  
ATOM 6370  H HG23 . VAL A 1 67 ? 5.924   -7.600  3.665   1.00 0.00 ? 67 VAL A HG23 5  
ATOM 6371  N N    . ILE A 1 68 ? 2.760   -11.642 2.543   1.00 0.00 ? 68 ILE A N    5  
ATOM 6372  C CA   . ILE A 1 68 ? 2.339   -13.025 2.752   1.00 0.00 ? 68 ILE A CA   5  
ATOM 6373  C C    . ILE A 1 68 ? 2.783   -13.874 1.551   1.00 0.00 ? 68 ILE A C    5  
ATOM 6374  O O    . ILE A 1 68 ? 3.974   -14.137 1.398   1.00 0.00 ? 68 ILE A O    5  
ATOM 6375  C CB   . ILE A 1 68 ? 0.807   -13.068 2.979   1.00 0.00 ? 68 ILE A CB   5  
ATOM 6376  C CG1  . ILE A 1 68 ? 0.391   -12.077 4.092   1.00 0.00 ? 68 ILE A CG1  5  
ATOM 6377  C CG2  . ILE A 1 68 ? 0.372   -14.490 3.372   1.00 0.00 ? 68 ILE A CG2  5  
ATOM 6378  C CD1  . ILE A 1 68 ? 0.973   -12.491 5.450   1.00 0.00 ? 68 ILE A CD1  5  
ATOM 6379  H H    . ILE A 1 68 ? 2.369   -11.135 1.754   1.00 0.00 ? 68 ILE A H    5  
ATOM 6380  H HA   . ILE A 1 68 ? 2.831   -13.416 3.640   1.00 0.00 ? 68 ILE A HA   5  
ATOM 6381  H HB   . ILE A 1 68 ? 0.301   -12.781 2.057   1.00 0.00 ? 68 ILE A HB   5  
ATOM 6382  H HG12 . ILE A 1 68 ? 0.744   -11.077 3.840   1.00 0.00 ? 68 ILE A HG12 5  
ATOM 6383  H HG13 . ILE A 1 68 ? -0.696  -12.060 4.165   1.00 0.00 ? 68 ILE A HG13 5  
ATOM 6384  H HG21 . ILE A 1 68 ? 0.339   -15.124 2.488   1.00 0.00 ? 68 ILE A HG21 5  
ATOM 6385  H HG22 . ILE A 1 68 ? -0.619  -14.454 3.824   1.00 0.00 ? 68 ILE A HG22 5  
ATOM 6386  H HG23 . ILE A 1 68 ? 1.082   -14.906 4.087   1.00 0.00 ? 68 ILE A HG23 5  
ATOM 6387  H HD11 . ILE A 1 68 ? 0.603   -13.478 5.724   1.00 0.00 ? 68 ILE A HD11 5  
ATOM 6388  H HD12 . ILE A 1 68 ? 0.664   -11.770 6.207   1.00 0.00 ? 68 ILE A HD12 5  
ATOM 6389  H HD13 . ILE A 1 68 ? 2.058   -12.511 5.398   1.00 0.00 ? 68 ILE A HD13 5  
ATOM 6390  N N    . ASP A 1 69 ? 1.839   -14.301 0.698   1.00 0.00 ? 69 ASP A N    5  
ATOM 6391  C CA   . ASP A 1 69 ? 2.152   -15.122 -0.463  1.00 0.00 ? 69 ASP A CA   5  
ATOM 6392  C C    . ASP A 1 69 ? 2.621   -14.226 -1.611  1.00 0.00 ? 69 ASP A C    5  
ATOM 6393  O O    . ASP A 1 69 ? 2.051   -14.250 -2.701  1.00 0.00 ? 69 ASP A O    5  
ATOM 6394  C CB   . ASP A 1 69 ? 0.898   -15.922 -0.851  1.00 0.00 ? 69 ASP A CB   5  
ATOM 6395  C CG   . ASP A 1 69 ? 1.161   -16.836 -2.044  1.00 0.00 ? 69 ASP A CG   5  
ATOM 6396  O OD1  . ASP A 1 69 ? 2.252   -17.441 -2.070  1.00 0.00 ? 69 ASP A OD1  5  
ATOM 6397  O OD2  . ASP A 1 69 ? 0.259   -16.908 -2.910  1.00 0.00 ? 69 ASP A OD2  5  
ATOM 6398  H H    . ASP A 1 69 ? 0.876   -14.056 0.856   1.00 0.00 ? 69 ASP A H    5  
ATOM 6399  H HA   . ASP A 1 69 ? 2.951   -15.819 -0.205  1.00 0.00 ? 69 ASP A HA   5  
ATOM 6400  H HB2  . ASP A 1 69 ? 0.588   -16.531 -0.001  1.00 0.00 ? 69 ASP A HB2  5  
ATOM 6401  H HB3  . ASP A 1 69 ? 0.095   -15.228 -1.103  1.00 0.00 ? 69 ASP A HB3  5  
ATOM 6402  N N    . GLY A 1 70 ? 3.659   -13.420 -1.363  1.00 0.00 ? 70 GLY A N    5  
ATOM 6403  C CA   . GLY A 1 70 ? 4.187   -12.507 -2.366  1.00 0.00 ? 70 GLY A CA   5  
ATOM 6404  C C    . GLY A 1 70 ? 3.323   -11.246 -2.459  1.00 0.00 ? 70 GLY A C    5  
ATOM 6405  O O    . GLY A 1 70 ? 3.842   -10.159 -2.705  1.00 0.00 ? 70 GLY A O    5  
ATOM 6406  H H    . GLY A 1 70 ? 4.097   -13.438 -0.450  1.00 0.00 ? 70 GLY A H    5  
ATOM 6407  H HA2  . GLY A 1 70 ? 5.205   -12.226 -2.091  1.00 0.00 ? 70 GLY A HA2  5  
ATOM 6408  H HA3  . GLY A 1 70 ? 4.204   -13.005 -3.336  1.00 0.00 ? 70 GLY A HA3  5  
ATOM 6409  N N    . LYS A 1 71 ? 2.002   -11.392 -2.265  1.00 0.00 ? 71 LYS A N    5  
ATOM 6410  C CA   . LYS A 1 71 ? 1.083   -10.271 -2.330  1.00 0.00 ? 71 LYS A CA   5  
ATOM 6411  C C    . LYS A 1 71 ? 1.198   -9.466  -1.034  1.00 0.00 ? 71 LYS A C    5  
ATOM 6412  O O    . LYS A 1 71 ? 1.795   -9.936  -0.059  1.00 0.00 ? 71 LYS A O    5  
ATOM 6413  C CB   . LYS A 1 71 ? -0.356  -10.779 -2.545  1.00 0.00 ? 71 LYS A CB   5  
ATOM 6414  C CG   . LYS A 1 71 ? -0.641  -11.032 -4.034  1.00 0.00 ? 71 LYS A CG   5  
ATOM 6415  C CD   . LYS A 1 71 ? 0.057   -12.298 -4.549  1.00 0.00 ? 71 LYS A CD   5  
ATOM 6416  C CE   . LYS A 1 71 ? -0.628  -13.557 -3.998  1.00 0.00 ? 71 LYS A CE   5  
ATOM 6417  N NZ   . LYS A 1 71 ? 0.072   -14.773 -4.448  1.00 0.00 ? 71 LYS A NZ   5  
ATOM 6418  H H    . LYS A 1 71 ? 1.626   -12.304 -2.061  1.00 0.00 ? 71 LYS A H    5  
ATOM 6419  H HA   . LYS A 1 71 ? 1.362   -9.630  -3.168  1.00 0.00 ? 71 LYS A HA   5  
ATOM 6420  H HB2  . LYS A 1 71 ? -0.508  -11.690 -1.988  1.00 0.00 ? 71 LYS A HB2  5  
ATOM 6421  H HB3  . LYS A 1 71 ? -1.047  -10.023 -2.186  1.00 0.00 ? 71 LYS A HB3  5  
ATOM 6422  H HG2  . LYS A 1 71 ? -1.718  -11.133 -4.177  1.00 0.00 ? 71 LYS A HG2  5  
ATOM 6423  H HG3  . LYS A 1 71 ? -0.290  -10.185 -4.603  1.00 0.00 ? 71 LYS A HG3  5  
ATOM 6424  H HD2  . LYS A 1 71 ? -0.001  -12.310 -5.636  1.00 0.00 ? 71 LYS A HD2  5  
ATOM 6425  H HD3  . LYS A 1 71 ? 1.099   -12.287 -4.253  1.00 0.00 ? 71 LYS A HD3  5  
ATOM 6426  H HE2  . LYS A 1 71 ? -0.619  -13.531 -2.910  1.00 0.00 ? 71 LYS A HE2  5  
ATOM 6427  H HE3  . LYS A 1 71 ? -1.661  -13.588 -4.346  1.00 0.00 ? 71 LYS A HE3  5  
ATOM 6428  H HZ1  . LYS A 1 71 ? -0.005  -14.860 -5.450  1.00 0.00 ? 71 LYS A HZ1  5  
ATOM 6429  H HZ2  . LYS A 1 71 ? 1.050   -14.713 -4.187  1.00 0.00 ? 71 LYS A HZ2  5  
ATOM 6430  H HZ3  . LYS A 1 71 ? -0.340  -15.590 -4.003  1.00 0.00 ? 71 LYS A HZ3  5  
ATOM 6431  N N    . TYR A 1 72 ? 0.639   -8.250  -1.028  1.00 0.00 ? 72 TYR A N    5  
ATOM 6432  C CA   . TYR A 1 72 ? 0.744   -7.353  0.113   1.00 0.00 ? 72 TYR A CA   5  
ATOM 6433  C C    . TYR A 1 72 ? -0.602  -7.207  0.812   1.00 0.00 ? 72 TYR A C    5  
ATOM 6434  O O    . TYR A 1 72 ? -1.596  -6.846  0.184   1.00 0.00 ? 72 TYR A O    5  
ATOM 6435  C CB   . TYR A 1 72 ? 1.257   -6.001  -0.381  1.00 0.00 ? 72 TYR A CB   5  
ATOM 6436  C CG   . TYR A 1 72 ? 2.595   -6.111  -1.078  1.00 0.00 ? 72 TYR A CG   5  
ATOM 6437  C CD1  . TYR A 1 72 ? 3.753   -6.329  -0.319  1.00 0.00 ? 72 TYR A CD1  5  
ATOM 6438  C CD2  . TYR A 1 72 ? 2.679   -6.022  -2.481  1.00 0.00 ? 72 TYR A CD2  5  
ATOM 6439  C CE1  . TYR A 1 72 ? 4.997   -6.461  -0.954  1.00 0.00 ? 72 TYR A CE1  5  
ATOM 6440  C CE2  . TYR A 1 72 ? 3.924   -6.155  -3.118  1.00 0.00 ? 72 TYR A CE2  5  
ATOM 6441  C CZ   . TYR A 1 72 ? 5.084   -6.376  -2.352  1.00 0.00 ? 72 TYR A CZ   5  
ATOM 6442  O OH   . TYR A 1 72 ? 6.293   -6.515  -2.964  1.00 0.00 ? 72 TYR A OH   5  
ATOM 6443  H H    . TYR A 1 72 ? 0.135   -7.925  -1.847  1.00 0.00 ? 72 TYR A H    5  
ATOM 6444  H HA   . TYR A 1 72 ? 1.465   -7.759  0.823   1.00 0.00 ? 72 TYR A HA   5  
ATOM 6445  H HB2  . TYR A 1 72 ? 0.530   -5.580  -1.075  1.00 0.00 ? 72 TYR A HB2  5  
ATOM 6446  H HB3  . TYR A 1 72 ? 1.357   -5.328  0.472   1.00 0.00 ? 72 TYR A HB3  5  
ATOM 6447  H HD1  . TYR A 1 72 ? 3.686   -6.400  0.755   1.00 0.00 ? 72 TYR A HD1  5  
ATOM 6448  H HD2  . TYR A 1 72 ? 1.786   -5.859  -3.071  1.00 0.00 ? 72 TYR A HD2  5  
ATOM 6449  H HE1  . TYR A 1 72 ? 5.887   -6.632  -0.368  1.00 0.00 ? 72 TYR A HE1  5  
ATOM 6450  H HE2  . TYR A 1 72 ? 3.990   -6.092  -4.194  1.00 0.00 ? 72 TYR A HE2  5  
ATOM 6451  H HH   . TYR A 1 72 ? 6.226   -6.585  -3.916  1.00 0.00 ? 72 TYR A HH   5  
ATOM 6452  N N    . ALA A 1 73 ? -0.616  -7.483  2.124   1.00 0.00 ? 73 ALA A N    5  
ATOM 6453  C CA   . ALA A 1 73 ? -1.810  -7.357  2.949   1.00 0.00 ? 73 ALA A CA   5  
ATOM 6454  C C    . ALA A 1 73 ? -1.607  -6.223  3.943   1.00 0.00 ? 73 ALA A C    5  
ATOM 6455  O O    . ALA A 1 73 ? -0.509  -5.685  4.055   1.00 0.00 ? 73 ALA A O    5  
ATOM 6456  C CB   . ALA A 1 73 ? -2.055  -8.672  3.698   1.00 0.00 ? 73 ALA A CB   5  
ATOM 6457  H H    . ALA A 1 73 ? 0.238   -7.785  2.575   1.00 0.00 ? 73 ALA A H    5  
ATOM 6458  H HA   . ALA A 1 73 ? -2.672  -7.133  2.322   1.00 0.00 ? 73 ALA A HA   5  
ATOM 6459  H HB1  . ALA A 1 73 ? -2.948  -8.576  4.317   1.00 0.00 ? 73 ALA A HB1  5  
ATOM 6460  H HB2  . ALA A 1 73 ? -1.196  -8.895  4.332   1.00 0.00 ? 73 ALA A HB2  5  
ATOM 6461  H HB3  . ALA A 1 73 ? -2.197  -9.478  2.986   1.00 0.00 ? 73 ALA A HB3  5  
ATOM 6462  N N    . PHE A 1 74 ? -2.665  -5.871  4.674   1.00 0.00 ? 74 PHE A N    5  
ATOM 6463  C CA   . PHE A 1 74 ? -2.588  -4.839  5.691   1.00 0.00 ? 74 PHE A CA   5  
ATOM 6464  C C    . PHE A 1 74 ? -2.331  -5.501  7.041   1.00 0.00 ? 74 PHE A C    5  
ATOM 6465  O O    . PHE A 1 74 ? -3.101  -6.355  7.469   1.00 0.00 ? 74 PHE A O    5  
ATOM 6466  C CB   . PHE A 1 74 ? -3.888  -4.036  5.702   1.00 0.00 ? 74 PHE A CB   5  
ATOM 6467  C CG   . PHE A 1 74 ? -4.071  -3.189  6.942   1.00 0.00 ? 74 PHE A CG   5  
ATOM 6468  C CD1  . PHE A 1 74 ? -4.717  -3.726  8.066   1.00 0.00 ? 74 PHE A CD1  5  
ATOM 6469  C CD2  . PHE A 1 74 ? -3.609  -1.860  6.968   1.00 0.00 ? 74 PHE A CD2  5  
ATOM 6470  C CE1  . PHE A 1 74 ? -4.928  -2.937  9.203   1.00 0.00 ? 74 PHE A CE1  5  
ATOM 6471  C CE2  . PHE A 1 74 ? -3.813  -1.072  8.114   1.00 0.00 ? 74 PHE A CE2  5  
ATOM 6472  C CZ   . PHE A 1 74 ? -4.483  -1.611  9.226   1.00 0.00 ? 74 PHE A CZ   5  
ATOM 6473  H H    . PHE A 1 74 ? -3.548  -6.337  4.532   1.00 0.00 ? 74 PHE A H    5  
ATOM 6474  H HA   . PHE A 1 74 ? -1.763  -4.165  5.460   1.00 0.00 ? 74 PHE A HA   5  
ATOM 6475  H HB2  . PHE A 1 74 ? -3.895  -3.383  4.836   1.00 0.00 ? 74 PHE A HB2  5  
ATOM 6476  H HB3  . PHE A 1 74 ? -4.728  -4.724  5.621   1.00 0.00 ? 74 PHE A HB3  5  
ATOM 6477  H HD1  . PHE A 1 74 ? -5.057  -4.743  8.052   1.00 0.00 ? 74 PHE A HD1  5  
ATOM 6478  H HD2  . PHE A 1 74 ? -3.107  -1.443  6.107   1.00 0.00 ? 74 PHE A HD2  5  
ATOM 6479  H HE1  . PHE A 1 74 ? -5.438  -3.351  10.059  1.00 0.00 ? 74 PHE A HE1  5  
ATOM 6480  H HE2  . PHE A 1 74 ? -3.464  -0.051  8.135   1.00 0.00 ? 74 PHE A HE2  5  
ATOM 6481  H HZ   . PHE A 1 74 ? -4.660  -1.004  10.096  1.00 0.00 ? 74 PHE A HZ   5  
ATOM 6482  N N    . LYS A 1 75 ? -1.240  -5.101  7.696   1.00 0.00 ? 75 LYS A N    5  
ATOM 6483  C CA   . LYS A 1 75 ? -0.846  -5.638  8.987   1.00 0.00 ? 75 LYS A CA   5  
ATOM 6484  C C    . LYS A 1 75 ? -1.776  -5.077  10.076  1.00 0.00 ? 75 LYS A C    5  
ATOM 6485  O O    . LYS A 1 75 ? -1.770  -3.868  10.314  1.00 0.00 ? 75 LYS A O    5  
ATOM 6486  C CB   . LYS A 1 75 ? 0.614   -5.228  9.238   1.00 0.00 ? 75 LYS A CB   5  
ATOM 6487  C CG   . LYS A 1 75 ? 1.330   -6.259  10.115  1.00 0.00 ? 75 LYS A CG   5  
ATOM 6488  C CD   . LYS A 1 75 ? 0.995   -6.033  11.591  1.00 0.00 ? 75 LYS A CD   5  
ATOM 6489  C CE   . LYS A 1 75 ? 2.042   -6.730  12.465  1.00 0.00 ? 75 LYS A CE   5  
ATOM 6490  N NZ   . LYS A 1 75 ? 2.241   -8.133  12.051  1.00 0.00 ? 75 LYS A NZ   5  
ATOM 6491  H H    . LYS A 1 75 ? -0.653  -4.390  7.283   1.00 0.00 ? 75 LYS A H    5  
ATOM 6492  H HA   . LYS A 1 75 ? -0.914  -6.723  8.957   1.00 0.00 ? 75 LYS A HA   5  
ATOM 6493  H HB2  . LYS A 1 75 ? 1.133   -5.165  8.282   1.00 0.00 ? 75 LYS A HB2  5  
ATOM 6494  H HB3  . LYS A 1 75 ? 0.641   -4.254  9.719   1.00 0.00 ? 75 LYS A HB3  5  
ATOM 6495  H HG2  . LYS A 1 75 ? 1.025   -7.262  9.823   1.00 0.00 ? 75 LYS A HG2  5  
ATOM 6496  H HG3  . LYS A 1 75 ? 2.407   -6.154  9.973   1.00 0.00 ? 75 LYS A HG3  5  
ATOM 6497  H HD2  . LYS A 1 75 ? 0.998   -4.963  11.808  1.00 0.00 ? 75 LYS A HD2  5  
ATOM 6498  H HD3  . LYS A 1 75 ? 0.008   -6.442  11.808  1.00 0.00 ? 75 LYS A HD3  5  
ATOM 6499  H HE2  . LYS A 1 75 ? 2.991   -6.197  12.380  1.00 0.00 ? 75 LYS A HE2  5  
ATOM 6500  H HE3  . LYS A 1 75 ? 1.712   -6.705  13.502  1.00 0.00 ? 75 LYS A HE3  5  
ATOM 6501  H HZ1  . LYS A 1 75 ? 1.347   -8.583  11.941  1.00 0.00 ? 75 LYS A HZ1  5  
ATOM 6502  H HZ2  . LYS A 1 75 ? 2.741   -8.162  11.164  1.00 0.00 ? 75 LYS A HZ2  5  
ATOM 6503  H HZ3  . LYS A 1 75 ? 2.780   -8.622  12.757  1.00 0.00 ? 75 LYS A HZ3  5  
ATOM 6504  N N    . PRO A 1 76 ? -2.587  -5.936  10.740  1.00 0.00 ? 76 PRO A N    5  
ATOM 6505  C CA   . PRO A 1 76 ? -3.521  -5.492  11.752  1.00 0.00 ? 76 PRO A CA   5  
ATOM 6506  C C    . PRO A 1 76 ? -2.789  -5.110  13.042  1.00 0.00 ? 76 PRO A C    5  
ATOM 6507  O O    . PRO A 1 76 ? -2.538  -3.930  13.284  1.00 0.00 ? 76 PRO A O    5  
ATOM 6508  C CB   . PRO A 1 76 ? -4.474  -6.671  11.967  1.00 0.00 ? 76 PRO A CB   5  
ATOM 6509  C CG   . PRO A 1 76 ? -3.772  -7.899  11.381  1.00 0.00 ? 76 PRO A CG   5  
ATOM 6510  C CD   . PRO A 1 76 ? -2.630  -7.371  10.509  1.00 0.00 ? 76 PRO A CD   5  
ATOM 6511  H HA   . PRO A 1 76 ? -4.082  -4.635  11.384  1.00 0.00 ? 76 PRO A HA   5  
ATOM 6512  H HB2  . PRO A 1 76 ? -4.675  -6.817  13.029  1.00 0.00 ? 76 PRO A HB2  5  
ATOM 6513  H HB3  . PRO A 1 76 ? -5.408  -6.489  11.435  1.00 0.00 ? 76 PRO A HB3  5  
ATOM 6514  H HG2  . PRO A 1 76 ? -3.372  -8.514  12.183  1.00 0.00 ? 76 PRO A HG2  5  
ATOM 6515  H HG3  . PRO A 1 76 ? -4.471  -8.479  10.775  1.00 0.00 ? 76 PRO A HG3  5  
ATOM 6516  H HD2  . PRO A 1 76 ? -1.687  -7.830  10.808  1.00 0.00 ? 76 PRO A HD2  5  
ATOM 6517  H HD3  . PRO A 1 76 ? -2.836  -7.582  9.463   1.00 0.00 ? 76 PRO A HD3  5  
ATOM 6518  N N    . LYS A 1 77 ? -2.454  -6.109  13.877  1.00 0.00 ? 77 LYS A N    5  
ATOM 6519  C CA   . LYS A 1 77 ? -1.793  -5.865  15.152  1.00 0.00 ? 77 LYS A CA   5  
ATOM 6520  C C    . LYS A 1 77 ? -1.132  -7.156  15.658  1.00 0.00 ? 77 LYS A C    5  
ATOM 6521  O O    . LYS A 1 77 ? -1.184  -7.462  16.848  1.00 0.00 ? 77 LYS A O    5  
ATOM 6522  C CB   . LYS A 1 77 ? -2.843  -5.344  16.153  1.00 0.00 ? 77 LYS A CB   5  
ATOM 6523  C CG   . LYS A 1 77 ? -2.172  -4.893  17.461  1.00 0.00 ? 77 LYS A CG   5  
ATOM 6524  C CD   . LYS A 1 77 ? -2.843  -5.594  18.651  1.00 0.00 ? 77 LYS A CD   5  
ATOM 6525  C CE   . LYS A 1 77 ? -1.937  -5.525  19.883  1.00 0.00 ? 77 LYS A CE   5  
ATOM 6526  N NZ   . LYS A 1 77 ? -1.714  -4.131  20.308  1.00 0.00 ? 77 LYS A NZ   5  
ATOM 6527  H H    . LYS A 1 77 ? -2.672  -7.063  13.626  1.00 0.00 ? 77 LYS A H    5  
ATOM 6528  H HA   . LYS A 1 77 ? -1.023  -5.103  15.015  1.00 0.00 ? 77 LYS A HA   5  
ATOM 6529  H HB2  . LYS A 1 77 ? -3.370  -4.497  15.714  1.00 0.00 ? 77 LYS A HB2  5  
ATOM 6530  H HB3  . LYS A 1 77 ? -3.561  -6.138  16.364  1.00 0.00 ? 77 LYS A HB3  5  
ATOM 6531  H HG2  . LYS A 1 77 ? -1.112  -5.144  17.438  1.00 0.00 ? 77 LYS A HG2  5  
ATOM 6532  H HG3  . LYS A 1 77 ? -2.282  -3.813  17.567  1.00 0.00 ? 77 LYS A HG3  5  
ATOM 6533  H HD2  . LYS A 1 77 ? -3.796  -5.110  18.870  1.00 0.00 ? 77 LYS A HD2  5  
ATOM 6534  H HD3  . LYS A 1 77 ? -3.023  -6.641  18.402  1.00 0.00 ? 77 LYS A HD3  5  
ATOM 6535  H HE2  . LYS A 1 77 ? -2.406  -6.077  20.698  1.00 0.00 ? 77 LYS A HE2  5  
ATOM 6536  H HE3  . LYS A 1 77 ? -0.977  -5.987  19.647  1.00 0.00 ? 77 LYS A HE3  5  
ATOM 6537  H HZ1  . LYS A 1 77 ? -1.148  -4.121  21.145  1.00 0.00 ? 77 LYS A HZ1  5  
ATOM 6538  H HZ2  . LYS A 1 77 ? -1.238  -3.627  19.574  1.00 0.00 ? 77 LYS A HZ2  5  
ATOM 6539  H HZ3  . LYS A 1 77 ? -2.603  -3.690  20.499  1.00 0.00 ? 77 LYS A HZ3  5  
ATOM 6540  N N    . TYR A 1 78 ? -0.503  -7.914  14.751  1.00 0.00 ? 78 TYR A N    5  
ATOM 6541  C CA   . TYR A 1 78 ? 0.173   -9.153  15.118  1.00 0.00 ? 78 TYR A CA   5  
ATOM 6542  C C    . TYR A 1 78 ? 1.663   -8.879  15.303  1.00 0.00 ? 78 TYR A C    5  
ATOM 6543  O O    . TYR A 1 78 ? 2.494   -9.358  14.531  1.00 0.00 ? 78 TYR A O    5  
ATOM 6544  C CB   . TYR A 1 78 ? -0.075  -10.218 14.040  1.00 0.00 ? 78 TYR A CB   5  
ATOM 6545  C CG   . TYR A 1 78 ? -1.546  -10.502 13.770  1.00 0.00 ? 78 TYR A CG   5  
ATOM 6546  C CD1  . TYR A 1 78 ? -2.514  -10.322 14.783  1.00 0.00 ? 78 TYR A CD1  5  
ATOM 6547  C CD2  . TYR A 1 78 ? -1.945  -10.954 12.499  1.00 0.00 ? 78 TYR A CD2  5  
ATOM 6548  C CE1  . TYR A 1 78 ? -3.867  -10.588 14.520  1.00 0.00 ? 78 TYR A CE1  5  
ATOM 6549  C CE2  . TYR A 1 78 ? -3.301  -11.223 12.239  1.00 0.00 ? 78 TYR A CE2  5  
ATOM 6550  C CZ   . TYR A 1 78 ? -4.262  -11.039 13.249  1.00 0.00 ? 78 TYR A CZ   5  
ATOM 6551  O OH   . TYR A 1 78 ? -5.576  -11.297 12.997  1.00 0.00 ? 78 TYR A OH   5  
ATOM 6552  H H    . TYR A 1 78 ? -0.489  -7.628  13.785  1.00 0.00 ? 78 TYR A H    5  
ATOM 6553  H HA   . TYR A 1 78 ? -0.226  -9.515  16.064  1.00 0.00 ? 78 TYR A HA   5  
ATOM 6554  H HB2  . TYR A 1 78 ? 0.387   -9.886  13.111  1.00 0.00 ? 78 TYR A HB2  5  
ATOM 6555  H HB3  . TYR A 1 78 ? 0.403   -11.147 14.353  1.00 0.00 ? 78 TYR A HB3  5  
ATOM 6556  H HD1  . TYR A 1 78 ? -2.221  -9.981  15.761  1.00 0.00 ? 78 TYR A HD1  5  
ATOM 6557  H HD2  . TYR A 1 78 ? -1.210  -11.096 11.720  1.00 0.00 ? 78 TYR A HD2  5  
ATOM 6558  H HE1  . TYR A 1 78 ? -4.604  -10.446 15.297  1.00 0.00 ? 78 TYR A HE1  5  
ATOM 6559  H HE2  . TYR A 1 78 ? -3.604  -11.570 11.262  1.00 0.00 ? 78 TYR A HE2  5  
ATOM 6560  H HH   . TYR A 1 78 ? -5.733  -11.608 12.102  1.00 0.00 ? 78 TYR A HH   5  
ATOM 6561  N N    . ASN A 1 79 ? 1.991   -8.098  16.340  1.00 0.00 ? 79 ASN A N    5  
ATOM 6562  C CA   . ASN A 1 79 ? 3.366   -7.748  16.663  1.00 0.00 ? 79 ASN A CA   5  
ATOM 6563  C C    . ASN A 1 79 ? 3.399   -7.121  18.055  1.00 0.00 ? 79 ASN A C    5  
ATOM 6564  O O    . ASN A 1 79 ? 2.993   -5.971  18.223  1.00 0.00 ? 79 ASN A O    5  
ATOM 6565  C CB   . ASN A 1 79 ? 3.917   -6.773  15.614  1.00 0.00 ? 79 ASN A CB   5  
ATOM 6566  C CG   . ASN A 1 79 ? 5.349   -6.361  15.947  1.00 0.00 ? 79 ASN A CG   5  
ATOM 6567  O OD1  . ASN A 1 79 ? 6.297   -6.913  15.400  1.00 0.00 ? 79 ASN A OD1  5  
ATOM 6568  N ND2  . ASN A 1 79 ? 5.503   -5.388  16.846  1.00 0.00 ? 79 ASN A ND2  5  
ATOM 6569  H H    . ASN A 1 79 ? 1.257   -7.732  16.933  1.00 0.00 ? 79 ASN A H    5  
ATOM 6570  H HA   . ASN A 1 79 ? 3.975   -8.654  16.663  1.00 0.00 ? 79 ASN A HA   5  
ATOM 6571  H HB2  . ASN A 1 79 ? 3.906   -7.253  14.637  1.00 0.00 ? 79 ASN A HB2  5  
ATOM 6572  H HB3  . ASN A 1 79 ? 3.285   -5.884  15.582  1.00 0.00 ? 79 ASN A HB3  5  
ATOM 6573  H HD21 . ASN A 1 79 ? 4.691   -4.980  17.292  1.00 0.00 ? 79 ASN A HD21 5  
ATOM 6574  H HD22 . ASN A 1 79 ? 6.429   -5.062  17.080  1.00 0.00 ? 79 ASN A HD22 5  
ATOM 6575  N N    . VAL A 1 80 ? 3.882   -7.879  19.047  1.00 0.00 ? 80 VAL A N    5  
ATOM 6576  C CA   . VAL A 1 80 ? 3.962   -7.409  20.423  1.00 0.00 ? 80 VAL A CA   5  
ATOM 6577  C C    . VAL A 1 80 ? 5.357   -7.699  20.972  1.00 0.00 ? 80 VAL A C    5  
ATOM 6578  O O    . VAL A 1 80 ? 5.925   -8.755  20.692  1.00 0.00 ? 80 VAL A O    5  
ATOM 6579  C CB   . VAL A 1 80 ? 2.882   -8.107  21.267  1.00 0.00 ? 80 VAL A CB   5  
ATOM 6580  C CG1  . VAL A 1 80 ? 2.946   -7.607  22.715  1.00 0.00 ? 80 VAL A CG1  5  
ATOM 6581  C CG2  . VAL A 1 80 ? 1.495   -7.805  20.690  1.00 0.00 ? 80 VAL A CG2  5  
ATOM 6582  H H    . VAL A 1 80 ? 4.204   -8.815  18.847  1.00 0.00 ? 80 VAL A H    5  
ATOM 6583  H HA   . VAL A 1 80 ? 3.791   -6.332  20.448  1.00 0.00 ? 80 VAL A HA   5  
ATOM 6584  H HB   . VAL A 1 80 ? 3.052   -9.185  21.252  1.00 0.00 ? 80 VAL A HB   5  
ATOM 6585  H HG11 . VAL A 1 80 ? 3.885   -7.922  23.170  1.00 0.00 ? 80 VAL A HG11 5  
ATOM 6586  H HG12 . VAL A 1 80 ? 2.883   -6.519  22.728  1.00 0.00 ? 80 VAL A HG12 5  
ATOM 6587  H HG13 . VAL A 1 80 ? 2.114   -8.025  23.281  1.00 0.00 ? 80 VAL A HG13 5  
ATOM 6588  H HG21 . VAL A 1 80 ? 1.364   -6.726  20.603  1.00 0.00 ? 80 VAL A HG21 5  
ATOM 6589  H HG22 . VAL A 1 80 ? 0.730   -8.212  21.350  1.00 0.00 ? 80 VAL A HG22 5  
ATOM 6590  H HG23 . VAL A 1 80 ? 1.400   -8.262  19.705  1.00 0.00 ? 80 VAL A HG23 5  
ATOM 6591  N N    . ARG A 1 81 ? 5.899   -6.754  21.754  1.00 0.00 ? 81 ARG A N    5  
ATOM 6592  C CA   . ARG A 1 81 ? 7.219   -6.890  22.355  1.00 0.00 ? 81 ARG A CA   5  
ATOM 6593  C C    . ARG A 1 81 ? 7.108   -6.688  23.861  1.00 0.00 ? 81 ARG A C    5  
ATOM 6594  O O    . ARG A 1 81 ? 6.255   -5.862  24.257  1.00 0.00 ? 81 ARG A O    5  
ATOM 6595  C CB   . ARG A 1 81 ? 8.171   -5.849  21.748  1.00 0.00 ? 81 ARG A CB   5  
ATOM 6596  C CG   . ARG A 1 81 ? 8.491   -6.186  20.279  1.00 0.00 ? 81 ARG A CG   5  
ATOM 6597  C CD   . ARG A 1 81 ? 9.135   -7.576  20.162  1.00 0.00 ? 81 ARG A CD   5  
ATOM 6598  N NE   . ARG A 1 81 ? 10.127  -7.798  21.227  1.00 0.00 ? 81 ARG A NE   5  
ATOM 6599  C CZ   . ARG A 1 81 ? 10.350  -8.997  21.799  1.00 0.00 ? 81 ARG A CZ   5  
ATOM 6600  N NH1  . ARG A 1 81 ? 9.783   -10.106 21.300  1.00 0.00 ? 81 ARG A NH1  5  
ATOM 6601  N NH2  . ARG A 1 81 ? 11.147  -9.082  22.871  1.00 0.00 ? 81 ARG A NH2  5  
ATOM 6602  O OXT  . ARG A 1 81 ? 8.011   -7.195  24.561  1.00 0.00 ? 81 ARG A OXT  5  
ATOM 6603  H H    . ARG A 1 81 ? 5.381   -5.910  21.945  1.00 0.00 ? 81 ARG A H    5  
ATOM 6604  H HA   . ARG A 1 81 ? 7.604   -7.889  22.168  1.00 0.00 ? 81 ARG A HA   5  
ATOM 6605  H HB2  . ARG A 1 81 ? 7.701   -4.866  21.795  1.00 0.00 ? 81 ARG A HB2  5  
ATOM 6606  H HB3  . ARG A 1 81 ? 9.096   -5.827  22.325  1.00 0.00 ? 81 ARG A HB3  5  
ATOM 6607  H HG2  . ARG A 1 81 ? 7.571   -6.164  19.695  1.00 0.00 ? 81 ARG A HG2  5  
ATOM 6608  H HG3  . ARG A 1 81 ? 9.181   -5.439  19.887  1.00 0.00 ? 81 ARG A HG3  5  
ATOM 6609  H HD2  . ARG A 1 81 ? 8.355   -8.332  20.225  1.00 0.00 ? 81 ARG A HD2  5  
ATOM 6610  H HD3  . ARG A 1 81 ? 9.628   -7.658  19.193  1.00 0.00 ? 81 ARG A HD3  5  
ATOM 6611  H HE   . ARG A 1 81 ? 10.659  -6.999  21.539  1.00 0.00 ? 81 ARG A HE   5  
ATOM 6612  H HH11 . ARG A 1 81 ? 9.205   -10.051 20.474  1.00 0.00 ? 81 ARG A HH11 5  
ATOM 6613  H HH12 . ARG A 1 81 ? 9.933   -10.997 21.750  1.00 0.00 ? 81 ARG A HH12 5  
ATOM 6614  H HH21 . ARG A 1 81 ? 11.559  -8.247  23.261  1.00 0.00 ? 81 ARG A HH21 5  
ATOM 6615  H HH22 . ARG A 1 81 ? 11.334  -9.980  23.293  1.00 0.00 ? 81 ARG A HH22 5  
ATOM 6616  N N    . ALA A 1 1  ? 16.738  18.951  -10.708 1.00 0.00 ? 1  ALA A N    6  
ATOM 6617  C CA   . ALA A 1 1  ? 16.114  17.615  -10.715 1.00 0.00 ? 1  ALA A CA   6  
ATOM 6618  C C    . ALA A 1 1  ? 14.605  17.741  -10.525 1.00 0.00 ? 1  ALA A C    6  
ATOM 6619  O O    . ALA A 1 1  ? 14.103  18.835  -10.274 1.00 0.00 ? 1  ALA A O    6  
ATOM 6620  C CB   . ALA A 1 1  ? 16.720  16.743  -9.614  1.00 0.00 ? 1  ALA A CB   6  
ATOM 6621  H H1   . ALA A 1 1  ? 16.558  19.399  -9.820  1.00 0.00 ? 1  ALA A H1   6  
ATOM 6622  H H2   . ALA A 1 1  ? 17.735  18.858  -10.845 1.00 0.00 ? 1  ALA A H2   6  
ATOM 6623  H H3   . ALA A 1 1  ? 16.346  19.509  -11.451 1.00 0.00 ? 1  ALA A H3   6  
ATOM 6624  H HA   . ALA A 1 1  ? 16.306  17.145  -11.679 1.00 0.00 ? 1  ALA A HA   6  
ATOM 6625  H HB1  . ALA A 1 1  ? 17.801  16.685  -9.749  1.00 0.00 ? 1  ALA A HB1  6  
ATOM 6626  H HB2  . ALA A 1 1  ? 16.498  17.179  -8.640  1.00 0.00 ? 1  ALA A HB2  6  
ATOM 6627  H HB3  . ALA A 1 1  ? 16.294  15.740  -9.668  1.00 0.00 ? 1  ALA A HB3  6  
ATOM 6628  N N    . LEU A 1 2  ? 13.884  16.619  -10.644 1.00 0.00 ? 2  LEU A N    6  
ATOM 6629  C CA   . LEU A 1 2  ? 12.440  16.609  -10.481 1.00 0.00 ? 2  LEU A CA   6  
ATOM 6630  C C    . LEU A 1 2  ? 12.099  16.728  -8.996  1.00 0.00 ? 2  LEU A C    6  
ATOM 6631  O O    . LEU A 1 2  ? 12.079  15.728  -8.277  1.00 0.00 ? 2  LEU A O    6  
ATOM 6632  C CB   . LEU A 1 2  ? 11.871  15.315  -11.082 1.00 0.00 ? 2  LEU A CB   6  
ATOM 6633  C CG   . LEU A 1 2  ? 10.339  15.267  -10.926 1.00 0.00 ? 2  LEU A CG   6  
ATOM 6634  C CD1  . LEU A 1 2  ? 9.689   16.415  -11.704 1.00 0.00 ? 2  LEU A CD1  6  
ATOM 6635  C CD2  . LEU A 1 2  ? 9.821   13.934  -11.469 1.00 0.00 ? 2  LEU A CD2  6  
ATOM 6636  H H    . LEU A 1 2  ? 14.347  15.747  -10.853 1.00 0.00 ? 2  LEU A H    6  
ATOM 6637  H HA   . LEU A 1 2  ? 12.021  17.464  -11.013 1.00 0.00 ? 2  LEU A HA   6  
ATOM 6638  H HB2  . LEU A 1 2  ? 12.125  15.270  -12.142 1.00 0.00 ? 2  LEU A HB2  6  
ATOM 6639  H HB3  . LEU A 1 2  ? 12.311  14.458  -10.573 1.00 0.00 ? 2  LEU A HB3  6  
ATOM 6640  H HG   . LEU A 1 2  ? 10.075  15.349  -9.872  1.00 0.00 ? 2  LEU A HG   6  
ATOM 6641  H HD11 . LEU A 1 2  ? 9.869   17.357  -11.187 1.00 0.00 ? 2  LEU A HD11 6  
ATOM 6642  H HD12 . LEU A 1 2  ? 8.614   16.243  -11.774 1.00 0.00 ? 2  LEU A HD12 6  
ATOM 6643  H HD13 . LEU A 1 2  ? 10.112  16.464  -12.708 1.00 0.00 ? 2  LEU A HD13 6  
ATOM 6644  H HD21 . LEU A 1 2  ? 10.068  13.853  -12.528 1.00 0.00 ? 2  LEU A HD21 6  
ATOM 6645  H HD22 . LEU A 1 2  ? 10.285  13.112  -10.923 1.00 0.00 ? 2  LEU A HD22 6  
ATOM 6646  H HD23 . LEU A 1 2  ? 8.738   13.886  -11.345 1.00 0.00 ? 2  LEU A HD23 6  
ATOM 6647  N N    . SER A 1 3  ? 11.831  17.957  -8.540  1.00 0.00 ? 3  SER A N    6  
ATOM 6648  C CA   . SER A 1 3  ? 11.484  18.211  -7.150  1.00 0.00 ? 3  SER A CA   6  
ATOM 6649  C C    . SER A 1 3  ? 10.034  17.799  -6.899  1.00 0.00 ? 3  SER A C    6  
ATOM 6650  O O    . SER A 1 3  ? 9.155   18.651  -6.771  1.00 0.00 ? 3  SER A O    6  
ATOM 6651  C CB   . SER A 1 3  ? 11.692  19.696  -6.844  1.00 0.00 ? 3  SER A CB   6  
ATOM 6652  O OG   . SER A 1 3  ? 13.035  20.049  -7.108  1.00 0.00 ? 3  SER A OG   6  
ATOM 6653  H H    . SER A 1 3  ? 11.869  18.743  -9.173  1.00 0.00 ? 3  SER A H    6  
ATOM 6654  H HA   . SER A 1 3  ? 12.137  17.623  -6.504  1.00 0.00 ? 3  SER A HA   6  
ATOM 6655  H HB2  . SER A 1 3  ? 11.030  20.296  -7.469  1.00 0.00 ? 3  SER A HB2  6  
ATOM 6656  H HB3  . SER A 1 3  ? 11.467  19.886  -5.793  1.00 0.00 ? 3  SER A HB3  6  
ATOM 6657  H HG   . SER A 1 3  ? 13.151  20.981  -6.902  1.00 0.00 ? 3  SER A HG   6  
ATOM 6658  N N    . GLY A 1 4  ? 9.791   16.484  -6.832  1.00 0.00 ? 4  GLY A N    6  
ATOM 6659  C CA   . GLY A 1 4  ? 8.458   15.948  -6.604  1.00 0.00 ? 4  GLY A CA   6  
ATOM 6660  C C    . GLY A 1 4  ? 8.065   16.099  -5.136  1.00 0.00 ? 4  GLY A C    6  
ATOM 6661  O O    . GLY A 1 4  ? 7.952   15.110  -4.417  1.00 0.00 ? 4  GLY A O    6  
ATOM 6662  H H    . GLY A 1 4  ? 10.556  15.832  -6.946  1.00 0.00 ? 4  GLY A H    6  
ATOM 6663  H HA2  . GLY A 1 4  ? 7.741   16.482  -7.228  1.00 0.00 ? 4  GLY A HA2  6  
ATOM 6664  H HA3  . GLY A 1 4  ? 8.449   14.892  -6.872  1.00 0.00 ? 4  GLY A HA3  6  
ATOM 6665  N N    . SER A 1 5  ? 7.852   17.344  -4.697  1.00 0.00 ? 5  SER A N    6  
ATOM 6666  C CA   . SER A 1 5  ? 7.456   17.624  -3.325  1.00 0.00 ? 5  SER A CA   6  
ATOM 6667  C C    . SER A 1 5  ? 5.971   17.301  -3.136  1.00 0.00 ? 5  SER A C    6  
ATOM 6668  O O    . SER A 1 5  ? 5.547   16.964  -2.031  1.00 0.00 ? 5  SER A O    6  
ATOM 6669  C CB   . SER A 1 5  ? 7.733   19.096  -3.009  1.00 0.00 ? 5  SER A CB   6  
ATOM 6670  O OG   . SER A 1 5  ? 7.534   19.331  -1.631  1.00 0.00 ? 5  SER A OG   6  
ATOM 6671  H H    . SER A 1 5  ? 7.966   18.123  -5.332  1.00 0.00 ? 5  SER A H    6  
ATOM 6672  H HA   . SER A 1 5  ? 8.043   17.000  -2.650  1.00 0.00 ? 5  SER A HA   6  
ATOM 6673  H HB2  . SER A 1 5  ? 8.765   19.335  -3.271  1.00 0.00 ? 5  SER A HB2  6  
ATOM 6674  H HB3  . SER A 1 5  ? 7.057   19.727  -3.589  1.00 0.00 ? 5  SER A HB3  6  
ATOM 6675  H HG   . SER A 1 5  ? 6.673   18.982  -1.381  1.00 0.00 ? 5  SER A HG   6  
ATOM 6676  N N    . SER A 1 6  ? 5.185   17.409  -4.218  1.00 0.00 ? 6  SER A N    6  
ATOM 6677  C CA   . SER A 1 6  ? 3.755   17.136  -4.173  1.00 0.00 ? 6  SER A CA   6  
ATOM 6678  C C    . SER A 1 6  ? 3.517   15.624  -4.181  1.00 0.00 ? 6  SER A C    6  
ATOM 6679  O O    . SER A 1 6  ? 2.986   15.080  -5.150  1.00 0.00 ? 6  SER A O    6  
ATOM 6680  C CB   . SER A 1 6  ? 3.079   17.808  -5.372  1.00 0.00 ? 6  SER A CB   6  
ATOM 6681  O OG   . SER A 1 6  ? 1.689   17.563  -5.334  1.00 0.00 ? 6  SER A OG   6  
ATOM 6682  H H    . SER A 1 6  ? 5.587   17.689  -5.099  1.00 0.00 ? 6  SER A H    6  
ATOM 6683  H HA   . SER A 1 6  ? 3.341   17.556  -3.255  1.00 0.00 ? 6  SER A HA   6  
ATOM 6684  H HB2  . SER A 1 6  ? 3.257   18.882  -5.335  1.00 0.00 ? 6  SER A HB2  6  
ATOM 6685  H HB3  . SER A 1 6  ? 3.492   17.404  -6.299  1.00 0.00 ? 6  SER A HB3  6  
ATOM 6686  H HG   . SER A 1 6  ? 1.543   16.617  -5.446  1.00 0.00 ? 6  SER A HG   6  
ATOM 6687  N N    . GLY A 1 7  ? 3.905   14.950  -3.095  1.00 0.00 ? 7  GLY A N    6  
ATOM 6688  C CA   . GLY A 1 7  ? 3.732   13.516  -2.970  1.00 0.00 ? 7  GLY A CA   6  
ATOM 6689  C C    . GLY A 1 7  ? 4.755   12.785  -3.832  1.00 0.00 ? 7  GLY A C    6  
ATOM 6690  O O    . GLY A 1 7  ? 5.887   12.574  -3.401  1.00 0.00 ? 7  GLY A O    6  
ATOM 6691  H H    . GLY A 1 7  ? 4.341   15.450  -2.328  1.00 0.00 ? 7  GLY A H    6  
ATOM 6692  H HA2  . GLY A 1 7  ? 3.868   13.228  -1.928  1.00 0.00 ? 7  GLY A HA2  6  
ATOM 6693  H HA3  . GLY A 1 7  ? 2.725   13.242  -3.288  1.00 0.00 ? 7  GLY A HA3  6  
ATOM 6694  N N    . TYR A 1 8  ? 4.345   12.392  -5.055  1.00 0.00 ? 8  TYR A N    6  
ATOM 6695  C CA   . TYR A 1 8  ? 5.211   11.677  -6.001  1.00 0.00 ? 8  TYR A CA   6  
ATOM 6696  C C    . TYR A 1 8  ? 5.686   10.328  -5.407  1.00 0.00 ? 8  TYR A C    6  
ATOM 6697  O O    . TYR A 1 8  ? 6.492   9.623   -6.011  1.00 0.00 ? 8  TYR A O    6  
ATOM 6698  C CB   . TYR A 1 8  ? 6.370   12.620  -6.420  1.00 0.00 ? 8  TYR A CB   6  
ATOM 6699  C CG   . TYR A 1 8  ? 7.680   11.940  -6.767  1.00 0.00 ? 8  TYR A CG   6  
ATOM 6700  C CD1  . TYR A 1 8  ? 7.827   11.253  -7.988  1.00 0.00 ? 8  TYR A CD1  6  
ATOM 6701  C CD2  . TYR A 1 8  ? 8.763   12.014  -5.871  1.00 0.00 ? 8  TYR A CD2  6  
ATOM 6702  C CE1  . TYR A 1 8  ? 9.051   10.637  -8.305  1.00 0.00 ? 8  TYR A CE1  6  
ATOM 6703  C CE2  . TYR A 1 8  ? 9.983   11.399  -6.189  1.00 0.00 ? 8  TYR A CE2  6  
ATOM 6704  C CZ   . TYR A 1 8  ? 10.128  10.711  -7.404  1.00 0.00 ? 8  TYR A CZ   6  
ATOM 6705  O OH   . TYR A 1 8  ? 11.320  10.115  -7.707  1.00 0.00 ? 8  TYR A OH   6  
ATOM 6706  H H    . TYR A 1 8  ? 3.399   12.597  -5.345  1.00 0.00 ? 8  TYR A H    6  
ATOM 6707  H HA   . TYR A 1 8  ? 4.621   11.450  -6.882  1.00 0.00 ? 8  TYR A HA   6  
ATOM 6708  H HB2  . TYR A 1 8  ? 6.043   13.190  -7.291  1.00 0.00 ? 8  TYR A HB2  6  
ATOM 6709  H HB3  . TYR A 1 8  ? 6.558   13.320  -5.611  1.00 0.00 ? 8  TYR A HB3  6  
ATOM 6710  H HD1  . TYR A 1 8  ? 6.999   11.199  -8.680  1.00 0.00 ? 8  TYR A HD1  6  
ATOM 6711  H HD2  . TYR A 1 8  ? 8.655   12.545  -4.937  1.00 0.00 ? 8  TYR A HD2  6  
ATOM 6712  H HE1  . TYR A 1 8  ? 9.164   10.109  -9.240  1.00 0.00 ? 8  TYR A HE1  6  
ATOM 6713  H HE2  . TYR A 1 8  ? 10.811  11.457  -5.498  1.00 0.00 ? 8  TYR A HE2  6  
ATOM 6714  H HH   . TYR A 1 8  ? 11.967  10.203  -7.004  1.00 0.00 ? 8  TYR A HH   6  
ATOM 6715  N N    . LYS A 1 9  ? 5.158   9.974   -4.230  1.00 0.00 ? 9  LYS A N    6  
ATOM 6716  C CA   . LYS A 1 9  ? 5.477   8.723   -3.546  1.00 0.00 ? 9  LYS A CA   6  
ATOM 6717  C C    . LYS A 1 9  ? 4.790   8.697   -2.178  1.00 0.00 ? 9  LYS A C    6  
ATOM 6718  O O    . LYS A 1 9  ? 4.160   7.704   -1.820  1.00 0.00 ? 9  LYS A O    6  
ATOM 6719  C CB   . LYS A 1 9  ? 7.005   8.516   -3.403  1.00 0.00 ? 9  LYS A CB   6  
ATOM 6720  C CG   . LYS A 1 9  ? 7.749   9.831   -3.150  1.00 0.00 ? 9  LYS A CG   6  
ATOM 6721  C CD   . LYS A 1 9  ? 9.178   9.538   -2.663  1.00 0.00 ? 9  LYS A CD   6  
ATOM 6722  C CE   . LYS A 1 9  ? 9.937   8.681   -3.689  1.00 0.00 ? 9  LYS A CE   6  
ATOM 6723  N NZ   . LYS A 1 9  ? 9.811   7.243   -3.386  1.00 0.00 ? 9  LYS A NZ   6  
ATOM 6724  H H    . LYS A 1 9  ? 4.500   10.590  -3.792  1.00 0.00 ? 9  LYS A H    6  
ATOM 6725  H HA   . LYS A 1 9  ? 5.083   7.902   -4.135  1.00 0.00 ? 9  LYS A HA   6  
ATOM 6726  H HB2  . LYS A 1 9  ? 7.191   7.848   -2.569  1.00 0.00 ? 9  LYS A HB2  6  
ATOM 6727  H HB3  . LYS A 1 9  ? 7.387   8.058   -4.315  1.00 0.00 ? 9  LYS A HB3  6  
ATOM 6728  H HG2  . LYS A 1 9  ? 7.798   10.405  -4.066  1.00 0.00 ? 9  LYS A HG2  6  
ATOM 6729  H HG3  . LYS A 1 9  ? 7.227   10.405  -2.391  1.00 0.00 ? 9  LYS A HG3  6  
ATOM 6730  H HD2  . LYS A 1 9  ? 9.707   10.483  -2.529  1.00 0.00 ? 9  LYS A HD2  6  
ATOM 6731  H HD3  . LYS A 1 9  ? 9.137   9.013   -1.708  1.00 0.00 ? 9  LYS A HD3  6  
ATOM 6732  H HE2  . LYS A 1 9  ? 9.541   8.874   -4.686  1.00 0.00 ? 9  LYS A HE2  6  
ATOM 6733  H HE3  . LYS A 1 9  ? 10.993  8.953   -3.666  1.00 0.00 ? 9  LYS A HE3  6  
ATOM 6734  H HZ1  . LYS A 1 9  ? 10.317  6.707   -4.078  1.00 0.00 ? 9  LYS A HZ1  6  
ATOM 6735  H HZ2  . LYS A 1 9  ? 8.838   6.978   -3.403  1.00 0.00 ? 9  LYS A HZ2  6  
ATOM 6736  H HZ3  . LYS A 1 9  ? 10.195  7.055   -2.470  1.00 0.00 ? 9  LYS A HZ3  6  
ATOM 6737  N N    . PHE A 1 10 ? 4.911   9.787   -1.418  1.00 0.00 ? 10 PHE A N    6  
ATOM 6738  C CA   . PHE A 1 10 ? 4.343   9.870   -0.078  1.00 0.00 ? 10 PHE A CA   6  
ATOM 6739  C C    . PHE A 1 10 ? 2.817   9.865   -0.136  1.00 0.00 ? 10 PHE A C    6  
ATOM 6740  O O    . PHE A 1 10 ? 2.174   9.101   0.578   1.00 0.00 ? 10 PHE A O    6  
ATOM 6741  C CB   . PHE A 1 10 ? 4.860   11.138  0.607   1.00 0.00 ? 10 PHE A CB   6  
ATOM 6742  C CG   . PHE A 1 10 ? 6.326   11.395  0.331   1.00 0.00 ? 10 PHE A CG   6  
ATOM 6743  C CD1  . PHE A 1 10 ? 7.288   10.453  0.731   1.00 0.00 ? 10 PHE A CD1  6  
ATOM 6744  C CD2  . PHE A 1 10 ? 6.723   12.561  -0.349  1.00 0.00 ? 10 PHE A CD2  6  
ATOM 6745  C CE1  . PHE A 1 10 ? 8.646   10.674  0.452   1.00 0.00 ? 10 PHE A CE1  6  
ATOM 6746  C CE2  . PHE A 1 10 ? 8.082   12.782  -0.627  1.00 0.00 ? 10 PHE A CE2  6  
ATOM 6747  C CZ   . PHE A 1 10 ? 9.044   11.839  -0.225  1.00 0.00 ? 10 PHE A CZ   6  
ATOM 6748  H H    . PHE A 1 10 ? 5.422   10.584  -1.768  1.00 0.00 ? 10 PHE A H    6  
ATOM 6749  H HA   . PHE A 1 10 ? 4.674   9.002   0.496   1.00 0.00 ? 10 PHE A HA   6  
ATOM 6750  H HB2  . PHE A 1 10 ? 4.281   11.992  0.253   1.00 0.00 ? 10 PHE A HB2  6  
ATOM 6751  H HB3  . PHE A 1 10 ? 4.715   11.041  1.683   1.00 0.00 ? 10 PHE A HB3  6  
ATOM 6752  H HD1  . PHE A 1 10 ? 6.983   9.554   1.246   1.00 0.00 ? 10 PHE A HD1  6  
ATOM 6753  H HD2  . PHE A 1 10 ? 5.986   13.285  -0.662  1.00 0.00 ? 10 PHE A HD2  6  
ATOM 6754  H HE1  . PHE A 1 10 ? 9.382   9.945   0.753   1.00 0.00 ? 10 PHE A HE1  6  
ATOM 6755  H HE2  . PHE A 1 10 ? 8.386   13.673  -1.153  1.00 0.00 ? 10 PHE A HE2  6  
ATOM 6756  H HZ   . PHE A 1 10 ? 10.089  12.009  -0.440  1.00 0.00 ? 10 PHE A HZ   6  
ATOM 6757  N N    . GLY A 1 11 ? 2.240   10.723  -0.985  1.00 0.00 ? 11 GLY A N    6  
ATOM 6758  C CA   . GLY A 1 11 ? 0.794   10.825  -1.119  1.00 0.00 ? 11 GLY A CA   6  
ATOM 6759  C C    . GLY A 1 11 ? 0.191   9.478   -1.511  1.00 0.00 ? 11 GLY A C    6  
ATOM 6760  O O    . GLY A 1 11 ? -0.794  9.037   -0.916  1.00 0.00 ? 11 GLY A O    6  
ATOM 6761  H H    . GLY A 1 11 ? 2.816   11.324  -1.553  1.00 0.00 ? 11 GLY A H    6  
ATOM 6762  H HA2  . GLY A 1 11 ? 0.366   11.148  -0.169  1.00 0.00 ? 11 GLY A HA2  6  
ATOM 6763  H HA3  . GLY A 1 11 ? 0.556   11.561  -1.887  1.00 0.00 ? 11 GLY A HA3  6  
ATOM 6764  N N    . VAL A 1 12 ? 0.782   8.825   -2.516  1.00 0.00 ? 12 VAL A N    6  
ATOM 6765  C CA   . VAL A 1 12 ? 0.297   7.540   -2.992  1.00 0.00 ? 12 VAL A CA   6  
ATOM 6766  C C    . VAL A 1 12 ? 0.428   6.486   -1.889  1.00 0.00 ? 12 VAL A C    6  
ATOM 6767  O O    . VAL A 1 12 ? -0.529  5.771   -1.609  1.00 0.00 ? 12 VAL A O    6  
ATOM 6768  C CB   . VAL A 1 12 ? 1.071   7.143   -4.265  1.00 0.00 ? 12 VAL A CB   6  
ATOM 6769  C CG1  . VAL A 1 12 ? 1.130   5.617   -4.405  1.00 0.00 ? 12 VAL A CG1  6  
ATOM 6770  C CG2  . VAL A 1 12 ? 0.361   7.736   -5.490  1.00 0.00 ? 12 VAL A CG2  6  
ATOM 6771  H H    . VAL A 1 12 ? 1.591   9.227   -2.967  1.00 0.00 ? 12 VAL A H    6  
ATOM 6772  H HA   . VAL A 1 12 ? -0.758  7.643   -3.245  1.00 0.00 ? 12 VAL A HA   6  
ATOM 6773  H HB   . VAL A 1 12 ? 2.087   7.537   -4.211  1.00 0.00 ? 12 VAL A HB   6  
ATOM 6774  H HG11 . VAL A 1 12 ? 1.320   5.353   -5.446  1.00 0.00 ? 12 VAL A HG11 6  
ATOM 6775  H HG12 . VAL A 1 12 ? 1.932   5.225   -3.781  1.00 0.00 ? 12 VAL A HG12 6  
ATOM 6776  H HG13 . VAL A 1 12 ? 0.186   5.184   -4.090  1.00 0.00 ? 12 VAL A HG13 6  
ATOM 6777  H HG21 . VAL A 1 12 ? -0.643  7.320   -5.568  1.00 0.00 ? 12 VAL A HG21 6  
ATOM 6778  H HG22 . VAL A 1 12 ? 0.297   8.818   -5.385  1.00 0.00 ? 12 VAL A HG22 6  
ATOM 6779  H HG23 . VAL A 1 12 ? 0.923   7.492   -6.390  1.00 0.00 ? 12 VAL A HG23 6  
ATOM 6780  N N    . LEU A 1 13 ? 1.606   6.386   -1.265  1.00 0.00 ? 13 LEU A N    6  
ATOM 6781  C CA   . LEU A 1 13 ? 1.839   5.404   -0.213  1.00 0.00 ? 13 LEU A CA   6  
ATOM 6782  C C    . LEU A 1 13 ? 0.818   5.582   0.917   1.00 0.00 ? 13 LEU A C    6  
ATOM 6783  O O    . LEU A 1 13 ? 0.217   4.611   1.366   1.00 0.00 ? 13 LEU A O    6  
ATOM 6784  C CB   . LEU A 1 13 ? 3.275   5.555   0.305   1.00 0.00 ? 13 LEU A CB   6  
ATOM 6785  C CG   . LEU A 1 13 ? 3.544   4.586   1.469   1.00 0.00 ? 13 LEU A CG   6  
ATOM 6786  C CD1  . LEU A 1 13 ? 3.360   3.136   1.006   1.00 0.00 ? 13 LEU A CD1  6  
ATOM 6787  C CD2  . LEU A 1 13 ? 4.978   4.780   1.964   1.00 0.00 ? 13 LEU A CD2  6  
ATOM 6788  H H    . LEU A 1 13 ? 2.368   7.002   -1.524  1.00 0.00 ? 13 LEU A H    6  
ATOM 6789  H HA   . LEU A 1 13 ? 1.722   4.408   -0.639  1.00 0.00 ? 13 LEU A HA   6  
ATOM 6790  H HB2  . LEU A 1 13 ? 3.970   5.342   -0.507  1.00 0.00 ? 13 LEU A HB2  6  
ATOM 6791  H HB3  . LEU A 1 13 ? 3.428   6.579   0.649   1.00 0.00 ? 13 LEU A HB3  6  
ATOM 6792  H HG   . LEU A 1 13 ? 2.852   4.794   2.287   1.00 0.00 ? 13 LEU A HG   6  
ATOM 6793  H HD11 . LEU A 1 13 ? 3.746   2.460   1.768   1.00 0.00 ? 13 LEU A HD11 6  
ATOM 6794  H HD12 . LEU A 1 13 ? 3.904   2.979   0.074   1.00 0.00 ? 13 LEU A HD12 6  
ATOM 6795  H HD13 . LEU A 1 13 ? 2.302   2.933   0.847   1.00 0.00 ? 13 LEU A HD13 6  
ATOM 6796  H HD21 . LEU A 1 13 ? 5.113   5.810   2.295   1.00 0.00 ? 13 LEU A HD21 6  
ATOM 6797  H HD22 . LEU A 1 13 ? 5.171   4.105   2.798   1.00 0.00 ? 13 LEU A HD22 6  
ATOM 6798  H HD23 . LEU A 1 13 ? 5.675   4.565   1.154   1.00 0.00 ? 13 LEU A HD23 6  
ATOM 6799  N N    . ALA A 1 14 ? 0.627   6.823   1.375   1.00 0.00 ? 14 ALA A N    6  
ATOM 6800  C CA   . ALA A 1 14 ? -0.304  7.116   2.457   1.00 0.00 ? 14 ALA A CA   6  
ATOM 6801  C C    . ALA A 1 14 ? -1.732  6.733   2.061   1.00 0.00 ? 14 ALA A C    6  
ATOM 6802  O O    . ALA A 1 14 ? -2.464  6.158   2.869   1.00 0.00 ? 14 ALA A O    6  
ATOM 6803  C CB   . ALA A 1 14 ? -0.222  8.605   2.798   1.00 0.00 ? 14 ALA A CB   6  
ATOM 6804  H H    . ALA A 1 14 ? 1.143   7.591   0.967   1.00 0.00 ? 14 ALA A H    6  
ATOM 6805  H HA   . ALA A 1 14 ? -0.018  6.536   3.339   1.00 0.00 ? 14 ALA A HA   6  
ATOM 6806  H HB1  . ALA A 1 14 ? 0.795   8.852   3.105   1.00 0.00 ? 14 ALA A HB1  6  
ATOM 6807  H HB2  . ALA A 1 14 ? -0.911  8.831   3.612   1.00 0.00 ? 14 ALA A HB2  6  
ATOM 6808  H HB3  . ALA A 1 14 ? -0.489  9.197   1.921   1.00 0.00 ? 14 ALA A HB3  6  
ATOM 6809  N N    . LYS A 1 15 ? -2.136  7.047   0.821   1.00 0.00 ? 15 LYS A N    6  
ATOM 6810  C CA   . LYS A 1 15 ? -3.472  6.734   0.357   1.00 0.00 ? 15 LYS A CA   6  
ATOM 6811  C C    . LYS A 1 15 ? -3.646  5.217   0.308   1.00 0.00 ? 15 LYS A C    6  
ATOM 6812  O O    . LYS A 1 15 ? -4.682  4.708   0.714   1.00 0.00 ? 15 LYS A O    6  
ATOM 6813  C CB   . LYS A 1 15 ? -3.701  7.382   -1.014  1.00 0.00 ? 15 LYS A CB   6  
ATOM 6814  C CG   . LYS A 1 15 ? -5.123  7.066   -1.516  1.00 0.00 ? 15 LYS A CG   6  
ATOM 6815  C CD   . LYS A 1 15 ? -5.828  8.350   -1.984  1.00 0.00 ? 15 LYS A CD   6  
ATOM 6816  C CE   . LYS A 1 15 ? -5.467  8.670   -3.442  1.00 0.00 ? 15 LYS A CE   6  
ATOM 6817  N NZ   . LYS A 1 15 ? -4.027  8.940   -3.599  1.00 0.00 ? 15 LYS A NZ   6  
ATOM 6818  H H    . LYS A 1 15 ? -1.505  7.510   0.183   1.00 0.00 ? 15 LYS A H    6  
ATOM 6819  H HA   . LYS A 1 15 ? -4.194  7.148   1.063   1.00 0.00 ? 15 LYS A HA   6  
ATOM 6820  H HB2  . LYS A 1 15 ? -3.575  8.460   -0.922  1.00 0.00 ? 15 LYS A HB2  6  
ATOM 6821  H HB3  . LYS A 1 15 ? -2.972  6.998   -1.720  1.00 0.00 ? 15 LYS A HB3  6  
ATOM 6822  H HG2  . LYS A 1 15 ? -5.067  6.358   -2.344  1.00 0.00 ? 15 LYS A HG2  6  
ATOM 6823  H HG3  . LYS A 1 15 ? -5.701  6.621   -0.706  1.00 0.00 ? 15 LYS A HG3  6  
ATOM 6824  H HD2  . LYS A 1 15 ? -6.908  8.208   -1.911  1.00 0.00 ? 15 LYS A HD2  6  
ATOM 6825  H HD3  . LYS A 1 15 ? -5.538  9.184   -1.343  1.00 0.00 ? 15 LYS A HD3  6  
ATOM 6826  H HE2  . LYS A 1 15 ? -5.743  7.826   -4.074  1.00 0.00 ? 15 LYS A HE2  6  
ATOM 6827  H HE3  . LYS A 1 15 ? -6.029  9.550   -3.759  1.00 0.00 ? 15 LYS A HE3  6  
ATOM 6828  H HZ1  . LYS A 1 15 ? -3.715  9.558   -2.864  1.00 0.00 ? 15 LYS A HZ1  6  
ATOM 6829  H HZ2  . LYS A 1 15 ? -3.864  9.374   -4.497  1.00 0.00 ? 15 LYS A HZ2  6  
ATOM 6830  H HZ3  . LYS A 1 15 ? -3.514  8.069   -3.552  1.00 0.00 ? 15 LYS A HZ3  6  
ATOM 6831  N N    . ILE A 1 16 ? -2.622  4.499   -0.177  1.00 0.00 ? 16 ILE A N    6  
ATOM 6832  C CA   . ILE A 1 16 ? -2.658  3.043   -0.239  1.00 0.00 ? 16 ILE A CA   6  
ATOM 6833  C C    . ILE A 1 16 ? -2.825  2.479   1.170   1.00 0.00 ? 16 ILE A C    6  
ATOM 6834  O O    . ILE A 1 16 ? -3.693  1.645   1.403   1.00 0.00 ? 16 ILE A O    6  
ATOM 6835  C CB   . ILE A 1 16 ? -1.369  2.516   -0.904  1.00 0.00 ? 16 ILE A CB   6  
ATOM 6836  C CG1  . ILE A 1 16 ? -1.459  2.718   -2.430  1.00 0.00 ? 16 ILE A CG1  6  
ATOM 6837  C CG2  . ILE A 1 16 ? -1.198  1.022   -0.585  1.00 0.00 ? 16 ILE A CG2  6  
ATOM 6838  C CD1  . ILE A 1 16 ? -0.094  2.458   -3.081  1.00 0.00 ? 16 ILE A CD1  6  
ATOM 6839  H H    . ILE A 1 16 ? -1.790  4.972   -0.507  1.00 0.00 ? 16 ILE A H    6  
ATOM 6840  H HA   . ILE A 1 16 ? -3.510  2.737   -0.836  1.00 0.00 ? 16 ILE A HA   6  
ATOM 6841  H HB   . ILE A 1 16 ? -0.512  3.065   -0.516  1.00 0.00 ? 16 ILE A HB   6  
ATOM 6842  H HG12 . ILE A 1 16 ? -2.196  2.033   -2.848  1.00 0.00 ? 16 ILE A HG12 6  
ATOM 6843  H HG13 . ILE A 1 16 ? -1.764  3.743   -2.643  1.00 0.00 ? 16 ILE A HG13 6  
ATOM 6844  H HG21 . ILE A 1 16 ? -0.369  0.617   -1.158  1.00 0.00 ? 16 ILE A HG21 6  
ATOM 6845  H HG22 . ILE A 1 16 ? -2.113  0.489   -0.843  1.00 0.00 ? 16 ILE A HG22 6  
ATOM 6846  H HG23 . ILE A 1 16 ? -0.992  0.895   0.477   1.00 0.00 ? 16 ILE A HG23 6  
ATOM 6847  H HD11 . ILE A 1 16 ? -0.129  2.756   -4.127  1.00 0.00 ? 16 ILE A HD11 6  
ATOM 6848  H HD12 . ILE A 1 16 ? 0.147   1.399   -3.020  1.00 0.00 ? 16 ILE A HD12 6  
ATOM 6849  H HD13 . ILE A 1 16 ? 0.672   3.036   -2.566  1.00 0.00 ? 16 ILE A HD13 6  
ATOM 6850  N N    . VAL A 1 17 ? -1.993  2.940   2.107   1.00 0.00 ? 17 VAL A N    6  
ATOM 6851  C CA   . VAL A 1 17 ? -2.045  2.485   3.489   1.00 0.00 ? 17 VAL A CA   6  
ATOM 6852  C C    . VAL A 1 17 ? -3.456  2.668   4.055   1.00 0.00 ? 17 VAL A C    6  
ATOM 6853  O O    . VAL A 1 17 ? -3.976  1.771   4.713   1.00 0.00 ? 17 VAL A O    6  
ATOM 6854  C CB   . VAL A 1 17 ? -1.002  3.268   4.309   1.00 0.00 ? 17 VAL A CB   6  
ATOM 6855  C CG1  . VAL A 1 17 ? -1.315  3.178   5.807   1.00 0.00 ? 17 VAL A CG1  6  
ATOM 6856  C CG2  . VAL A 1 17 ? 0.390   2.684   4.053   1.00 0.00 ? 17 VAL A CG2  6  
ATOM 6857  H H    . VAL A 1 17 ? -1.296  3.631   1.858   1.00 0.00 ? 17 VAL A H    6  
ATOM 6858  H HA   . VAL A 1 17 ? -1.791  1.425   3.519   1.00 0.00 ? 17 VAL A HA   6  
ATOM 6859  H HB   . VAL A 1 17 ? -1.014  4.315   4.005   1.00 0.00 ? 17 VAL A HB   6  
ATOM 6860  H HG11 . VAL A 1 17 ? -2.219  3.745   6.028   1.00 0.00 ? 17 VAL A HG11 6  
ATOM 6861  H HG12 . VAL A 1 17 ? -0.483  3.597   6.375   1.00 0.00 ? 17 VAL A HG12 6  
ATOM 6862  H HG13 . VAL A 1 17 ? -1.459  2.135   6.091   1.00 0.00 ? 17 VAL A HG13 6  
ATOM 6863  H HG21 . VAL A 1 17 ? 0.446   1.680   4.474   1.00 0.00 ? 17 VAL A HG21 6  
ATOM 6864  H HG22 . VAL A 1 17 ? 0.576   2.637   2.980   1.00 0.00 ? 17 VAL A HG22 6  
ATOM 6865  H HG23 . VAL A 1 17 ? 1.143   3.317   4.523   1.00 0.00 ? 17 VAL A HG23 6  
ATOM 6866  N N    . ASN A 1 18 ? -4.073  3.829   3.804   1.00 0.00 ? 18 ASN A N    6  
ATOM 6867  C CA   . ASN A 1 18 ? -5.401  4.121   4.330   1.00 0.00 ? 18 ASN A CA   6  
ATOM 6868  C C    . ASN A 1 18 ? -6.465  3.272   3.627   1.00 0.00 ? 18 ASN A C    6  
ATOM 6869  O O    . ASN A 1 18 ? -7.409  2.805   4.265   1.00 0.00 ? 18 ASN A O    6  
ATOM 6870  C CB   . ASN A 1 18 ? -5.703  5.611   4.157   1.00 0.00 ? 18 ASN A CB   6  
ATOM 6871  C CG   . ASN A 1 18 ? -7.033  5.972   4.817   1.00 0.00 ? 18 ASN A CG   6  
ATOM 6872  O OD1  . ASN A 1 18 ? -7.359  5.456   5.886   1.00 0.00 ? 18 ASN A OD1  6  
ATOM 6873  N ND2  . ASN A 1 18 ? -7.800  6.857   4.180   1.00 0.00 ? 18 ASN A ND2  6  
ATOM 6874  H H    . ASN A 1 18 ? -3.610  4.535   3.240   1.00 0.00 ? 18 ASN A H    6  
ATOM 6875  H HA   . ASN A 1 18 ? -5.412  3.884   5.394   1.00 0.00 ? 18 ASN A HA   6  
ATOM 6876  H HB2  . ASN A 1 18 ? -4.906  6.195   4.618   1.00 0.00 ? 18 ASN A HB2  6  
ATOM 6877  H HB3  . ASN A 1 18 ? -5.751  5.846   3.093   1.00 0.00 ? 18 ASN A HB3  6  
ATOM 6878  H HD21 . ASN A 1 18 ? -7.492  7.256   3.305   1.00 0.00 ? 18 ASN A HD21 6  
ATOM 6879  H HD22 . ASN A 1 18 ? -8.689  7.129   4.575   1.00 0.00 ? 18 ASN A HD22 6  
ATOM 6880  N N    . TYR A 1 19 ? -6.315  3.079   2.314   1.00 0.00 ? 19 TYR A N    6  
ATOM 6881  C CA   . TYR A 1 19 ? -7.261  2.300   1.530   1.00 0.00 ? 19 TYR A CA   6  
ATOM 6882  C C    . TYR A 1 19 ? -7.253  0.844   2.006   1.00 0.00 ? 19 TYR A C    6  
ATOM 6883  O O    . TYR A 1 19 ? -8.304  0.300   2.327   1.00 0.00 ? 19 TYR A O    6  
ATOM 6884  C CB   . TYR A 1 19 ? -6.904  2.429   0.036   1.00 0.00 ? 19 TYR A CB   6  
ATOM 6885  C CG   . TYR A 1 19 ? -6.980  1.136   -0.743  1.00 0.00 ? 19 TYR A CG   6  
ATOM 6886  C CD1  . TYR A 1 19 ? -8.222  0.601   -1.113  1.00 0.00 ? 19 TYR A CD1  6  
ATOM 6887  C CD2  . TYR A 1 19 ? -5.798  0.468   -1.100  1.00 0.00 ? 19 TYR A CD2  6  
ATOM 6888  C CE1  . TYR A 1 19 ? -8.278  -0.603  -1.831  1.00 0.00 ? 19 TYR A CE1  6  
ATOM 6889  C CE2  . TYR A 1 19 ? -5.857  -0.737  -1.811  1.00 0.00 ? 19 TYR A CE2  6  
ATOM 6890  C CZ   . TYR A 1 19 ? -7.095  -1.275  -2.177  1.00 0.00 ? 19 TYR A CZ   6  
ATOM 6891  O OH   . TYR A 1 19 ? -7.143  -2.448  -2.868  1.00 0.00 ? 19 TYR A OH   6  
ATOM 6892  H H    . TYR A 1 19 ? -5.520  3.486   1.838   1.00 0.00 ? 19 TYR A H    6  
ATOM 6893  H HA   . TYR A 1 19 ? -8.263  2.707   1.687   1.00 0.00 ? 19 TYR A HA   6  
ATOM 6894  H HB2  . TYR A 1 19 ? -7.584  3.150   -0.422  1.00 0.00 ? 19 TYR A HB2  6  
ATOM 6895  H HB3  . TYR A 1 19 ? -5.891  2.814   -0.048  1.00 0.00 ? 19 TYR A HB3  6  
ATOM 6896  H HD1  . TYR A 1 19 ? -9.135  1.113   -0.842  1.00 0.00 ? 19 TYR A HD1  6  
ATOM 6897  H HD2  . TYR A 1 19 ? -4.842  0.881   -0.823  1.00 0.00 ? 19 TYR A HD2  6  
ATOM 6898  H HE1  . TYR A 1 19 ? -9.228  -1.015  -2.109  1.00 0.00 ? 19 TYR A HE1  6  
ATOM 6899  H HE2  . TYR A 1 19 ? -4.951  -1.251  -2.073  1.00 0.00 ? 19 TYR A HE2  6  
ATOM 6900  H HH   . TYR A 1 19 ? -8.014  -2.627  -3.251  1.00 0.00 ? 19 TYR A HH   6  
ATOM 6901  N N    . MET A 1 20 ? -6.068  0.217   2.062   1.00 0.00 ? 20 MET A N    6  
ATOM 6902  C CA   . MET A 1 20 ? -5.946  -1.167  2.513   1.00 0.00 ? 20 MET A CA   6  
ATOM 6903  C C    . MET A 1 20 ? -6.423  -1.284  3.963   1.00 0.00 ? 20 MET A C    6  
ATOM 6904  O O    . MET A 1 20 ? -6.948  -2.319  4.351   1.00 0.00 ? 20 MET A O    6  
ATOM 6905  C CB   . MET A 1 20 ? -4.488  -1.631  2.399   1.00 0.00 ? 20 MET A CB   6  
ATOM 6906  C CG   . MET A 1 20 ? -4.050  -1.678  0.933   1.00 0.00 ? 20 MET A CG   6  
ATOM 6907  S SD   . MET A 1 20 ? -2.349  -2.258  0.687   1.00 0.00 ? 20 MET A SD   6  
ATOM 6908  C CE   . MET A 1 20 ? -2.541  -3.989  1.183   1.00 0.00 ? 20 MET A CE   6  
ATOM 6909  H H    . MET A 1 20 ? -5.229  0.708   1.787   1.00 0.00 ? 20 MET A H    6  
ATOM 6910  H HA   . MET A 1 20 ? -6.578  -1.810  1.882   1.00 0.00 ? 20 MET A HA   6  
ATOM 6911  H HB2  . MET A 1 20 ? -3.843  -0.946  2.949   1.00 0.00 ? 20 MET A HB2  6  
ATOM 6912  H HB3  . MET A 1 20 ? -4.402  -2.626  2.822   1.00 0.00 ? 20 MET A HB3  6  
ATOM 6913  H HG2  . MET A 1 20 ? -4.725  -2.336  0.386   1.00 0.00 ? 20 MET A HG2  6  
ATOM 6914  H HG3  . MET A 1 20 ? -4.127  -0.679  0.521   1.00 0.00 ? 20 MET A HG3  6  
ATOM 6915  H HE1  . MET A 1 20 ? -3.332  -4.452  0.593   1.00 0.00 ? 20 MET A HE1  6  
ATOM 6916  H HE2  . MET A 1 20 ? -2.797  -4.040  2.241   1.00 0.00 ? 20 MET A HE2  6  
ATOM 6917  H HE3  . MET A 1 20 ? -1.604  -4.519  1.014   1.00 0.00 ? 20 MET A HE3  6  
ATOM 6918  N N    . LYS A 1 21 ? -6.243  -0.223  4.766   1.00 0.00 ? 21 LYS A N    6  
ATOM 6919  C CA   . LYS A 1 21 ? -6.685  -0.232  6.153   1.00 0.00 ? 21 LYS A CA   6  
ATOM 6920  C C    . LYS A 1 21 ? -8.206  -0.308  6.201   1.00 0.00 ? 21 LYS A C    6  
ATOM 6921  O O    . LYS A 1 21 ? -8.762  -1.210  6.819   1.00 0.00 ? 21 LYS A O    6  
ATOM 6922  C CB   . LYS A 1 21 ? -6.180  1.026   6.871   1.00 0.00 ? 21 LYS A CB   6  
ATOM 6923  C CG   . LYS A 1 21 ? -6.530  0.946   8.366   1.00 0.00 ? 21 LYS A CG   6  
ATOM 6924  C CD   . LYS A 1 21 ? -7.698  1.888   8.699   1.00 0.00 ? 21 LYS A CD   6  
ATOM 6925  C CE   . LYS A 1 21 ? -7.162  3.250   9.155   1.00 0.00 ? 21 LYS A CE   6  
ATOM 6926  N NZ   . LYS A 1 21 ? -6.476  3.959   8.057   1.00 0.00 ? 21 LYS A NZ   6  
ATOM 6927  H H    . LYS A 1 21 ? -5.792  0.610   4.408   1.00 0.00 ? 21 LYS A H    6  
ATOM 6928  H HA   . LYS A 1 21 ? -6.274  -1.112  6.647   1.00 0.00 ? 21 LYS A HA   6  
ATOM 6929  H HB2  . LYS A 1 21 ? -5.102  1.094   6.760   1.00 0.00 ? 21 LYS A HB2  6  
ATOM 6930  H HB3  . LYS A 1 21 ? -6.642  1.906   6.432   1.00 0.00 ? 21 LYS A HB3  6  
ATOM 6931  H HG2  . LYS A 1 21 ? -6.814  -0.077  8.617   1.00 0.00 ? 21 LYS A HG2  6  
ATOM 6932  H HG3  . LYS A 1 21 ? -5.657  1.227   8.957   1.00 0.00 ? 21 LYS A HG3  6  
ATOM 6933  H HD2  . LYS A 1 21 ? -8.331  2.017   7.821   1.00 0.00 ? 21 LYS A HD2  6  
ATOM 6934  H HD3  . LYS A 1 21 ? -8.289  1.450   9.505   1.00 0.00 ? 21 LYS A HD3  6  
ATOM 6935  H HE2  . LYS A 1 21 ? -7.994  3.860   9.506   1.00 0.00 ? 21 LYS A HE2  6  
ATOM 6936  H HE3  . LYS A 1 21 ? -6.459  3.099   9.977   1.00 0.00 ? 21 LYS A HE3  6  
ATOM 6937  H HZ1  . LYS A 1 21 ? -7.132  4.137   7.303   1.00 0.00 ? 21 LYS A HZ1  6  
ATOM 6938  H HZ2  . LYS A 1 21 ? -6.116  4.839   8.398   1.00 0.00 ? 21 LYS A HZ2  6  
ATOM 6939  H HZ3  . LYS A 1 21 ? -5.714  3.394   7.714   1.00 0.00 ? 21 LYS A HZ3  6  
ATOM 6940  N N    . THR A 1 22 ? -8.873  0.642   5.542   1.00 0.00 ? 22 THR A N    6  
ATOM 6941  C CA   . THR A 1 22 ? -10.326 0.683   5.499   1.00 0.00 ? 22 THR A CA   6  
ATOM 6942  C C    . THR A 1 22 ? -10.857 -0.629  4.921   1.00 0.00 ? 22 THR A C    6  
ATOM 6943  O O    . THR A 1 22 ? -11.849 -1.166  5.400   1.00 0.00 ? 22 THR A O    6  
ATOM 6944  C CB   . THR A 1 22 ? -10.764 1.879   4.641   1.00 0.00 ? 22 THR A CB   6  
ATOM 6945  O OG1  . THR A 1 22 ? -10.156 3.056   5.132   1.00 0.00 ? 22 THR A OG1  6  
ATOM 6946  C CG2  . THR A 1 22 ? -12.285 2.032   4.699   1.00 0.00 ? 22 THR A CG2  6  
ATOM 6947  H H    . THR A 1 22 ? -8.361  1.362   5.051   1.00 0.00 ? 22 THR A H    6  
ATOM 6948  H HA   . THR A 1 22 ? -10.712 0.807   6.516   1.00 0.00 ? 22 THR A HA   6  
ATOM 6949  H HB   . THR A 1 22 ? -10.453 1.719   3.605   1.00 0.00 ? 22 THR A HB   6  
ATOM 6950  H HG1  . THR A 1 22 ? -9.224  3.048   4.882   1.00 0.00 ? 22 THR A HG1  6  
ATOM 6951  H HG21 . THR A 1 22 ? -12.580 2.937   4.168   1.00 0.00 ? 22 THR A HG21 6  
ATOM 6952  H HG22 . THR A 1 22 ? -12.757 1.169   4.231   1.00 0.00 ? 22 THR A HG22 6  
ATOM 6953  H HG23 . THR A 1 22 ? -12.605 2.102   5.740   1.00 0.00 ? 22 THR A HG23 6  
ATOM 6954  N N    . ARG A 1 23 ? -10.179 -1.138  3.893   1.00 0.00 ? 23 ARG A N    6  
ATOM 6955  C CA   . ARG A 1 23 ? -10.543 -2.386  3.248   1.00 0.00 ? 23 ARG A CA   6  
ATOM 6956  C C    . ARG A 1 23 ? -10.476 -3.537  4.247   1.00 0.00 ? 23 ARG A C    6  
ATOM 6957  O O    . ARG A 1 23 ? -11.425 -4.312  4.381   1.00 0.00 ? 23 ARG A O    6  
ATOM 6958  C CB   . ARG A 1 23 ? -9.562  -2.630  2.109   1.00 0.00 ? 23 ARG A CB   6  
ATOM 6959  C CG   . ARG A 1 23 ? -9.932  -1.779  0.897   1.00 0.00 ? 23 ARG A CG   6  
ATOM 6960  C CD   . ARG A 1 23 ? -11.034 -2.477  0.108   1.00 0.00 ? 23 ARG A CD   6  
ATOM 6961  N NE   . ARG A 1 23 ? -11.434 -1.707  -1.078  1.00 0.00 ? 23 ARG A NE   6  
ATOM 6962  C CZ   . ARG A 1 23 ? -12.115 -0.551  -1.022  1.00 0.00 ? 23 ARG A CZ   6  
ATOM 6963  N NH1  . ARG A 1 23 ? -12.485 -0.034  0.156   1.00 0.00 ? 23 ARG A NH1  6  
ATOM 6964  N NH2  . ARG A 1 23 ? -12.422 0.084   -2.157  1.00 0.00 ? 23 ARG A NH2  6  
ATOM 6965  H H    . ARG A 1 23 ? -9.370  -0.642  3.541   1.00 0.00 ? 23 ARG A H    6  
ATOM 6966  H HA   . ARG A 1 23 ? -11.556 -2.309  2.852   1.00 0.00 ? 23 ARG A HA   6  
ATOM 6967  H HB2  . ARG A 1 23 ? -8.562  -2.370  2.439   1.00 0.00 ? 23 ARG A HB2  6  
ATOM 6968  H HB3  . ARG A 1 23 ? -9.582  -3.676  1.839   1.00 0.00 ? 23 ARG A HB3  6  
ATOM 6969  H HG2  . ARG A 1 23 ? -10.270 -0.799  1.225   1.00 0.00 ? 23 ARG A HG2  6  
ATOM 6970  H HG3  . ARG A 1 23 ? -9.054  -1.668  0.267   1.00 0.00 ? 23 ARG A HG3  6  
ATOM 6971  H HD2  . ARG A 1 23 ? -10.662 -3.443  -0.216  1.00 0.00 ? 23 ARG A HD2  6  
ATOM 6972  H HD3  . ARG A 1 23 ? -11.898 -2.627  0.748   1.00 0.00 ? 23 ARG A HD3  6  
ATOM 6973  H HE   . ARG A 1 23 ? -11.179 -2.083  -1.988  1.00 0.00 ? 23 ARG A HE   6  
ATOM 6974  H HH11 . ARG A 1 23 ? -12.263 -0.521  1.011   1.00 0.00 ? 23 ARG A HH11 6  
ATOM 6975  H HH12 . ARG A 1 23 ? -12.985 0.841   0.190   1.00 0.00 ? 23 ARG A HH12 6  
ATOM 6976  H HH21 . ARG A 1 23 ? -12.174 -0.336  -3.053  1.00 0.00 ? 23 ARG A HH21 6  
ATOM 6977  H HH22 . ARG A 1 23 ? -12.895 0.973   -2.132  1.00 0.00 ? 23 ARG A HH22 6  
ATOM 6978  N N    . HIS A 1 24 ? -9.346  -3.635  4.944   1.00 0.00 ? 24 HIS A N    6  
ATOM 6979  C CA   . HIS A 1 24 ? -9.126  -4.660  5.947   1.00 0.00 ? 24 HIS A CA   6  
ATOM 6980  C C    . HIS A 1 24 ? -10.148 -4.494  7.080   1.00 0.00 ? 24 HIS A C    6  
ATOM 6981  O O    . HIS A 1 24 ? -10.438 -5.442  7.805   1.00 0.00 ? 24 HIS A O    6  
ATOM 6982  C CB   . HIS A 1 24 ? -7.680  -4.526  6.446   1.00 0.00 ? 24 HIS A CB   6  
ATOM 6983  C CG   . HIS A 1 24 ? -7.280  -5.559  7.465   1.00 0.00 ? 24 HIS A CG   6  
ATOM 6984  N ND1  . HIS A 1 24 ? -6.521  -6.684  7.150   1.00 0.00 ? 24 HIS A ND1  6  
ATOM 6985  C CD2  . HIS A 1 24 ? -7.482  -5.641  8.812   1.00 0.00 ? 24 HIS A CD2  6  
ATOM 6986  C CE1  . HIS A 1 24 ? -6.328  -7.356  8.304   1.00 0.00 ? 24 HIS A CE1  6  
ATOM 6987  N NE2  . HIS A 1 24 ? -6.889  -6.768  9.360   1.00 0.00 ? 24 HIS A NE2  6  
ATOM 6988  H H    . HIS A 1 24 ? -8.603  -2.972  4.779   1.00 0.00 ? 24 HIS A H    6  
ATOM 6989  H HA   . HIS A 1 24 ? -9.257  -5.639  5.490   1.00 0.00 ? 24 HIS A HA   6  
ATOM 6990  H HB2  . HIS A 1 24 ? -7.010  -4.609  5.590   1.00 0.00 ? 24 HIS A HB2  6  
ATOM 6991  H HB3  . HIS A 1 24 ? -7.555  -3.538  6.889   1.00 0.00 ? 24 HIS A HB3  6  
ATOM 6992  H HD1  . HIS A 1 24 ? -6.177  -6.945  6.238   1.00 0.00 ? 24 HIS A HD1  6  
ATOM 6993  H HD2  . HIS A 1 24 ? -8.021  -4.908  9.377   1.00 0.00 ? 24 HIS A HD2  6  
ATOM 6994  H HE1  . HIS A 1 24 ? -5.764  -8.274  8.369   1.00 0.00 ? 24 HIS A HE1  6  
ATOM 6995  N N    . GLN A 1 25 ? -10.703 -3.282  7.216   1.00 0.00 ? 25 GLN A N    6  
ATOM 6996  C CA   . GLN A 1 25 ? -11.708 -2.988  8.225   1.00 0.00 ? 25 GLN A CA   6  
ATOM 6997  C C    . GLN A 1 25 ? -13.118 -3.277  7.681   1.00 0.00 ? 25 GLN A C    6  
ATOM 6998  O O    . GLN A 1 25 ? -14.102 -2.816  8.257   1.00 0.00 ? 25 GLN A O    6  
ATOM 6999  C CB   . GLN A 1 25 ? -11.574 -1.510  8.624   1.00 0.00 ? 25 GLN A CB   6  
ATOM 7000  C CG   . GLN A 1 25 ? -12.022 -1.305  10.069  1.00 0.00 ? 25 GLN A CG   6  
ATOM 7001  C CD   . GLN A 1 25 ? -12.033 0.179   10.419  1.00 0.00 ? 25 GLN A CD   6  
ATOM 7002  O OE1  . GLN A 1 25 ? -11.053 0.706   10.940  1.00 0.00 ? 25 GLN A OE1  6  
ATOM 7003  N NE2  . GLN A 1 25 ? -13.145 0.855   10.129  1.00 0.00 ? 25 GLN A NE2  6  
ATOM 7004  H H    . GLN A 1 25 ? -10.421 -2.534  6.596   1.00 0.00 ? 25 GLN A H    6  
ATOM 7005  H HA   . GLN A 1 25 ? -11.529 -3.614  9.098   1.00 0.00 ? 25 GLN A HA   6  
ATOM 7006  H HB2  . GLN A 1 25 ? -10.532 -1.202  8.531   1.00 0.00 ? 25 GLN A HB2  6  
ATOM 7007  H HB3  . GLN A 1 25 ? -12.189 -0.899  7.962   1.00 0.00 ? 25 GLN A HB3  6  
ATOM 7008  H HG2  . GLN A 1 25 ? -13.021 -1.710  10.198  1.00 0.00 ? 25 GLN A HG2  6  
ATOM 7009  H HG3  . GLN A 1 25 ? -11.334 -1.824  10.736  1.00 0.00 ? 25 GLN A HG3  6  
ATOM 7010  H HE21 . GLN A 1 25 ? -13.927 0.378   9.701   1.00 0.00 ? 25 GLN A HE21 6  
ATOM 7011  H HE22 . GLN A 1 25 ? -13.203 1.840   10.338  1.00 0.00 ? 25 GLN A HE22 6  
ATOM 7012  N N    . ARG A 1 26 ? -13.216 -4.035  6.571   1.00 0.00 ? 26 ARG A N    6  
ATOM 7013  C CA   . ARG A 1 26 ? -14.505 -4.358  5.962   1.00 0.00 ? 26 ARG A CA   6  
ATOM 7014  C C    . ARG A 1 26 ? -14.555 -5.829  5.550   1.00 0.00 ? 26 ARG A C    6  
ATOM 7015  O O    . ARG A 1 26 ? -15.539 -6.511  5.828   1.00 0.00 ? 26 ARG A O    6  
ATOM 7016  C CB   . ARG A 1 26 ? -14.741 -3.457  4.745   1.00 0.00 ? 26 ARG A CB   6  
ATOM 7017  C CG   . ARG A 1 26 ? -15.041 -2.031  5.209   1.00 0.00 ? 26 ARG A CG   6  
ATOM 7018  C CD   . ARG A 1 26 ? -15.300 -1.134  3.997   1.00 0.00 ? 26 ARG A CD   6  
ATOM 7019  N NE   . ARG A 1 26 ? -15.501 0.260   4.416   1.00 0.00 ? 26 ARG A NE   6  
ATOM 7020  C CZ   . ARG A 1 26 ? -15.865 1.238   3.567   1.00 0.00 ? 26 ARG A CZ   6  
ATOM 7021  N NH1  . ARG A 1 26 ? -16.069 0.965   2.271   1.00 0.00 ? 26 ARG A NH1  6  
ATOM 7022  N NH2  . ARG A 1 26 ? -16.025 2.489   4.019   1.00 0.00 ? 26 ARG A NH2  6  
ATOM 7023  H H    . ARG A 1 26 ? -12.379 -4.392  6.133   1.00 0.00 ? 26 ARG A H    6  
ATOM 7024  H HA   . ARG A 1 26 ? -15.298 -4.179  6.689   1.00 0.00 ? 26 ARG A HA   6  
ATOM 7025  H HB2  . ARG A 1 26 ? -13.852 -3.454  4.114   1.00 0.00 ? 26 ARG A HB2  6  
ATOM 7026  H HB3  . ARG A 1 26 ? -15.589 -3.836  4.173   1.00 0.00 ? 26 ARG A HB3  6  
ATOM 7027  H HG2  . ARG A 1 26 ? -15.923 -2.036  5.849   1.00 0.00 ? 26 ARG A HG2  6  
ATOM 7028  H HG3  . ARG A 1 26 ? -14.193 -1.646  5.768   1.00 0.00 ? 26 ARG A HG3  6  
ATOM 7029  H HD2  . ARG A 1 26 ? -14.445 -1.187  3.323   1.00 0.00 ? 26 ARG A HD2  6  
ATOM 7030  H HD3  . ARG A 1 26 ? -16.192 -1.487  3.476   1.00 0.00 ? 26 ARG A HD3  6  
ATOM 7031  H HE   . ARG A 1 26 ? -15.353 0.482   5.390   1.00 0.00 ? 26 ARG A HE   6  
ATOM 7032  H HH11 . ARG A 1 26 ? -15.945 0.024   1.928   1.00 0.00 ? 26 ARG A HH11 6  
ATOM 7033  H HH12 . ARG A 1 26 ? -16.347 1.699   1.636   1.00 0.00 ? 26 ARG A HH12 6  
ATOM 7034  H HH21 . ARG A 1 26 ? -15.870 2.697   4.995   1.00 0.00 ? 26 ARG A HH21 6  
ATOM 7035  H HH22 . ARG A 1 26 ? -16.302 3.223   3.385   1.00 0.00 ? 26 ARG A HH22 6  
ATOM 7036  N N    . GLY A 1 27 ? -13.506 -6.322  4.878   1.00 0.00 ? 27 GLY A N    6  
ATOM 7037  C CA   . GLY A 1 27 ? -13.488 -7.706  4.414   1.00 0.00 ? 27 GLY A CA   6  
ATOM 7038  C C    . GLY A 1 27 ? -12.209 -8.016  3.639   1.00 0.00 ? 27 GLY A C    6  
ATOM 7039  O O    . GLY A 1 27 ? -11.660 -9.109  3.772   1.00 0.00 ? 27 GLY A O    6  
ATOM 7040  H H    . GLY A 1 27 ? -12.708 -5.729  4.682   1.00 0.00 ? 27 GLY A H    6  
ATOM 7041  H HA2  . GLY A 1 27 ? -13.554 -8.372  5.275   1.00 0.00 ? 27 GLY A HA2  6  
ATOM 7042  H HA3  . GLY A 1 27 ? -14.347 -7.876  3.765   1.00 0.00 ? 27 GLY A HA3  6  
ATOM 7043  N N    . ASP A 1 28 ? -11.736 -7.058  2.828   1.00 0.00 ? 28 ASP A N    6  
ATOM 7044  C CA   . ASP A 1 28 ? -10.514 -7.230  2.046   1.00 0.00 ? 28 ASP A CA   6  
ATOM 7045  C C    . ASP A 1 28 ? -9.311  -7.145  3.001   1.00 0.00 ? 28 ASP A C    6  
ATOM 7046  O O    . ASP A 1 28 ? -8.620  -6.129  3.072   1.00 0.00 ? 28 ASP A O    6  
ATOM 7047  C CB   . ASP A 1 28 ? -10.479 -6.162  0.935   1.00 0.00 ? 28 ASP A CB   6  
ATOM 7048  C CG   . ASP A 1 28 ? -9.077  -5.954  0.355   1.00 0.00 ? 28 ASP A CG   6  
ATOM 7049  O OD1  . ASP A 1 28 ? -8.320  -6.932  0.333   1.00 0.00 ? 28 ASP A OD1  6  
ATOM 7050  O OD2  . ASP A 1 28 ? -8.793  -4.812  -0.057  1.00 0.00 ? 28 ASP A OD2  6  
ATOM 7051  H H    . ASP A 1 28 ? -12.233 -6.179  2.752   1.00 0.00 ? 28 ASP A H    6  
ATOM 7052  H HA   . ASP A 1 28 ? -10.521 -8.221  1.573   1.00 0.00 ? 28 ASP A HA   6  
ATOM 7053  H HB2  . ASP A 1 28 ? -11.144 -6.478  0.129   1.00 0.00 ? 28 ASP A HB2  6  
ATOM 7054  H HB3  . ASP A 1 28 ? -10.842 -5.222  1.340   1.00 0.00 ? 28 ASP A HB3  6  
ATOM 7055  N N    . THR A 1 29 ? -9.085  -8.239  3.743   1.00 0.00 ? 29 THR A N    6  
ATOM 7056  C CA   . THR A 1 29 ? -7.992  -8.349  4.699   1.00 0.00 ? 29 THR A CA   6  
ATOM 7057  C C    . THR A 1 29 ? -6.853  -9.157  4.069   1.00 0.00 ? 29 THR A C    6  
ATOM 7058  O O    . THR A 1 29 ? -5.684  -8.951  4.395   1.00 0.00 ? 29 THR A O    6  
ATOM 7059  C CB   . THR A 1 29 ? -8.501  -9.061  5.965   1.00 0.00 ? 29 THR A CB   6  
ATOM 7060  O OG1  . THR A 1 29 ? -8.985  -10.343 5.621   1.00 0.00 ? 29 THR A OG1  6  
ATOM 7061  C CG2  . THR A 1 29 ? -9.627  -8.257  6.614   1.00 0.00 ? 29 THR A CG2  6  
ATOM 7062  H H    . THR A 1 29 ? -9.703  -9.035  3.642   1.00 0.00 ? 29 THR A H    6  
ATOM 7063  H HA   . THR A 1 29 ? -7.634  -7.353  4.966   1.00 0.00 ? 29 THR A HA   6  
ATOM 7064  H HB   . THR A 1 29 ? -7.681  -9.161  6.677   1.00 0.00 ? 29 THR A HB   6  
ATOM 7065  H HG1  . THR A 1 29 ? -9.360  -10.749 6.407   1.00 0.00 ? 29 THR A HG1  6  
ATOM 7066  H HG21 . THR A 1 29 ? -9.228  -7.322  6.989   1.00 0.00 ? 29 THR A HG21 6  
ATOM 7067  H HG22 . THR A 1 29 ? -10.049 -8.827  7.442   1.00 0.00 ? 29 THR A HG22 6  
ATOM 7068  H HG23 . THR A 1 29 ? -10.407 -8.054  5.882   1.00 0.00 ? 29 THR A HG23 6  
ATOM 7069  N N    . HIS A 1 30 ? -7.221  -10.088 3.172   1.00 0.00 ? 30 HIS A N    6  
ATOM 7070  C CA   . HIS A 1 30 ? -6.281  -10.975 2.497   1.00 0.00 ? 30 HIS A CA   6  
ATOM 7071  C C    . HIS A 1 30 ? -5.228  -10.176 1.705   1.00 0.00 ? 30 HIS A C    6  
ATOM 7072  O O    . HIS A 1 30 ? -5.427  -8.998  1.416   1.00 0.00 ? 30 HIS A O    6  
ATOM 7073  C CB   . HIS A 1 30 ? -7.085  -11.892 1.555   1.00 0.00 ? 30 HIS A CB   6  
ATOM 7074  C CG   . HIS A 1 30 ? -7.724  -11.141 0.409   1.00 0.00 ? 30 HIS A CG   6  
ATOM 7075  N ND1  . HIS A 1 30 ? -8.233  -11.768 -0.722  1.00 0.00 ? 30 HIS A ND1  6  
ATOM 7076  C CD2  . HIS A 1 30 ? -7.949  -9.808  0.192   1.00 0.00 ? 30 HIS A CD2  6  
ATOM 7077  C CE1  . HIS A 1 30 ? -8.718  -10.789 -1.519  1.00 0.00 ? 30 HIS A CE1  6  
ATOM 7078  N NE2  . HIS A 1 30 ? -8.575  -9.576  -1.016  1.00 0.00 ? 30 HIS A NE2  6  
ATOM 7079  H H    . HIS A 1 30 ? -8.199  -10.191 2.952   1.00 0.00 ? 30 HIS A H    6  
ATOM 7080  H HA   . HIS A 1 30 ? -5.785  -11.585 3.247   1.00 0.00 ? 30 HIS A HA   6  
ATOM 7081  H HB2  . HIS A 1 30 ? -6.425  -12.652 1.147   1.00 0.00 ? 30 HIS A HB2  6  
ATOM 7082  H HB3  . HIS A 1 30 ? -7.871  -12.384 2.129   1.00 0.00 ? 30 HIS A HB3  6  
ATOM 7083  H HD1  . HIS A 1 30 ? -8.239  -12.759 -0.913  1.00 0.00 ? 30 HIS A HD1  6  
ATOM 7084  H HD2  . HIS A 1 30 ? -7.670  -9.037  0.877   1.00 0.00 ? 30 HIS A HD2  6  
ATOM 7085  H HE1  . HIS A 1 30 ? -9.175  -10.971 -2.469  1.00 0.00 ? 30 HIS A HE1  6  
ATOM 7086  N N    . PRO A 1 31 ? -4.097  -10.814 1.343   1.00 0.00 ? 31 PRO A N    6  
ATOM 7087  C CA   . PRO A 1 31 ? -3.073  -10.175 0.548   1.00 0.00 ? 31 PRO A CA   6  
ATOM 7088  C C    . PRO A 1 31 ? -3.566  -9.929  -0.878  1.00 0.00 ? 31 PRO A C    6  
ATOM 7089  O O    . PRO A 1 31 ? -3.983  -10.863 -1.562  1.00 0.00 ? 31 PRO A O    6  
ATOM 7090  C CB   . PRO A 1 31 ? -1.880  -11.140 0.563   1.00 0.00 ? 31 PRO A CB   6  
ATOM 7091  C CG   . PRO A 1 31 ? -2.293  -12.349 1.408   1.00 0.00 ? 31 PRO A CG   6  
ATOM 7092  C CD   . PRO A 1 31 ? -3.778  -12.180 1.707   1.00 0.00 ? 31 PRO A CD   6  
ATOM 7093  H HA   . PRO A 1 31 ? -2.796  -9.225  1.001   1.00 0.00 ? 31 PRO A HA   6  
ATOM 7094  H HB2  . PRO A 1 31 ? -1.658  -11.469 -0.448  1.00 0.00 ? 31 PRO A HB2  6  
ATOM 7095  H HB3  . PRO A 1 31 ? -1.006  -10.656 0.997   1.00 0.00 ? 31 PRO A HB3  6  
ATOM 7096  H HG2  . PRO A 1 31 ? -2.123  -13.272 0.853   1.00 0.00 ? 31 PRO A HG2  6  
ATOM 7097  H HG3  . PRO A 1 31 ? -1.727  -12.362 2.338   1.00 0.00 ? 31 PRO A HG3  6  
ATOM 7098  H HD2  . PRO A 1 31 ? -4.357  -12.879 1.106   1.00 0.00 ? 31 PRO A HD2  6  
ATOM 7099  H HD3  . PRO A 1 31 ? -3.961  -12.351 2.766   1.00 0.00 ? 31 PRO A HD3  6  
ATOM 7100  N N    . LEU A 1 32 ? -3.500  -8.667  -1.321  1.00 0.00 ? 32 LEU A N    6  
ATOM 7101  C CA   . LEU A 1 32 ? -3.889  -8.285  -2.670  1.00 0.00 ? 32 LEU A CA   6  
ATOM 7102  C C    . LEU A 1 32 ? -2.629  -8.113  -3.519  1.00 0.00 ? 32 LEU A C    6  
ATOM 7103  O O    . LEU A 1 32 ? -1.567  -7.798  -2.986  1.00 0.00 ? 32 LEU A O    6  
ATOM 7104  C CB   . LEU A 1 32 ? -4.631  -6.949  -2.637  1.00 0.00 ? 32 LEU A CB   6  
ATOM 7105  C CG   . LEU A 1 32 ? -6.117  -7.127  -2.306  1.00 0.00 ? 32 LEU A CG   6  
ATOM 7106  C CD1  . LEU A 1 32 ? -6.785  -5.759  -2.390  1.00 0.00 ? 32 LEU A CD1  6  
ATOM 7107  C CD2  . LEU A 1 32 ? -6.793  -8.072  -3.306  1.00 0.00 ? 32 LEU A CD2  6  
ATOM 7108  H H    . LEU A 1 32 ? -3.156  -7.943  -0.703  1.00 0.00 ? 32 LEU A H    6  
ATOM 7109  H HA   . LEU A 1 32 ? -4.531  -9.056  -3.101  1.00 0.00 ? 32 LEU A HA   6  
ATOM 7110  H HB2  . LEU A 1 32 ? -4.173  -6.305  -1.883  1.00 0.00 ? 32 LEU A HB2  6  
ATOM 7111  H HB3  . LEU A 1 32 ? -4.538  -6.471  -3.610  1.00 0.00 ? 32 LEU A HB3  6  
ATOM 7112  H HG   . LEU A 1 32 ? -6.226  -7.524  -1.296  1.00 0.00 ? 32 LEU A HG   6  
ATOM 7113  H HD11 . LEU A 1 32 ? -7.853  -5.861  -2.214  1.00 0.00 ? 32 LEU A HD11 6  
ATOM 7114  H HD12 . LEU A 1 32 ? -6.353  -5.101  -1.636  1.00 0.00 ? 32 LEU A HD12 6  
ATOM 7115  H HD13 . LEU A 1 32 ? -6.619  -5.331  -3.387  1.00 0.00 ? 32 LEU A HD13 6  
ATOM 7116  H HD21 . LEU A 1 32 ? -6.587  -9.106  -3.033  1.00 0.00 ? 32 LEU A HD21 6  
ATOM 7117  H HD22 . LEU A 1 32 ? -6.413  -7.876  -4.305  1.00 0.00 ? 32 LEU A HD22 6  
ATOM 7118  H HD23 . LEU A 1 32 ? -7.870  -7.907  -3.290  1.00 0.00 ? 32 LEU A HD23 6  
ATOM 7119  N N    . THR A 1 33 ? -2.740  -8.292  -4.839  1.00 0.00 ? 33 THR A N    6  
ATOM 7120  C CA   . THR A 1 33 ? -1.603  -8.089  -5.732  1.00 0.00 ? 33 THR A CA   6  
ATOM 7121  C C    . THR A 1 33 ? -1.273  -6.593  -5.796  1.00 0.00 ? 33 THR A C    6  
ATOM 7122  O O    . THR A 1 33 ? -2.061  -5.754  -5.353  1.00 0.00 ? 33 THR A O    6  
ATOM 7123  C CB   . THR A 1 33 ? -1.919  -8.623  -7.138  1.00 0.00 ? 33 THR A CB   6  
ATOM 7124  O OG1  . THR A 1 33 ? -2.965  -7.870  -7.706  1.00 0.00 ? 33 THR A OG1  6  
ATOM 7125  C CG2  . THR A 1 33 ? -2.324  -10.100 -7.073  1.00 0.00 ? 33 THR A CG2  6  
ATOM 7126  H H    . THR A 1 33 ? -3.631  -8.564  -5.240  1.00 0.00 ? 33 THR A H    6  
ATOM 7127  H HA   . THR A 1 33 ? -0.737  -8.625  -5.335  1.00 0.00 ? 33 THR A HA   6  
ATOM 7128  H HB   . THR A 1 33 ? -1.032  -8.526  -7.765  1.00 0.00 ? 33 THR A HB   6  
ATOM 7129  H HG1  . THR A 1 33 ? -3.774  -8.050  -7.211  1.00 0.00 ? 33 THR A HG1  6  
ATOM 7130  H HG21 . THR A 1 33 ? -2.585  -10.447 -8.073  1.00 0.00 ? 33 THR A HG21 6  
ATOM 7131  H HG22 . THR A 1 33 ? -3.181  -10.221 -6.415  1.00 0.00 ? 33 THR A HG22 6  
ATOM 7132  H HG23 . THR A 1 33 ? -1.493  -10.687 -6.694  1.00 0.00 ? 33 THR A HG23 6  
ATOM 7133  N N    . LEU A 1 34 ? -0.107  -6.264  -6.357  1.00 0.00 ? 34 LEU A N    6  
ATOM 7134  C CA   . LEU A 1 34 ? 0.331   -4.883  -6.488  1.00 0.00 ? 34 LEU A CA   6  
ATOM 7135  C C    . LEU A 1 34 ? -0.697  -4.089  -7.307  1.00 0.00 ? 34 LEU A C    6  
ATOM 7136  O O    . LEU A 1 34 ? -1.210  -3.076  -6.845  1.00 0.00 ? 34 LEU A O    6  
ATOM 7137  C CB   . LEU A 1 34 ? 1.721   -4.874  -7.167  1.00 0.00 ? 34 LEU A CB   6  
ATOM 7138  C CG   . LEU A 1 34 ? 2.568   -3.649  -6.749  1.00 0.00 ? 34 LEU A CG   6  
ATOM 7139  C CD1  . LEU A 1 34 ? 1.777   -2.352  -6.920  1.00 0.00 ? 34 LEU A CD1  6  
ATOM 7140  C CD2  . LEU A 1 34 ? 3.031   -3.783  -5.295  1.00 0.00 ? 34 LEU A CD2  6  
ATOM 7141  H H    . LEU A 1 34 ? 0.499   -6.992  -6.704  1.00 0.00 ? 34 LEU A H    6  
ATOM 7142  H HA   . LEU A 1 34 ? 0.410   -4.445  -5.495  1.00 0.00 ? 34 LEU A HA   6  
ATOM 7143  H HB2  . LEU A 1 34 ? 2.258   -5.781  -6.889  1.00 0.00 ? 34 LEU A HB2  6  
ATOM 7144  H HB3  . LEU A 1 34 ? 1.591   -4.862  -8.249  1.00 0.00 ? 34 LEU A HB3  6  
ATOM 7145  H HG   . LEU A 1 34 ? 3.451   -3.606  -7.390  1.00 0.00 ? 34 LEU A HG   6  
ATOM 7146  H HD11 . LEU A 1 34 ? 2.455   -1.501  -6.842  1.00 0.00 ? 34 LEU A HD11 6  
ATOM 7147  H HD12 . LEU A 1 34 ? 1.300   -2.344  -7.899  1.00 0.00 ? 34 LEU A HD12 6  
ATOM 7148  H HD13 . LEU A 1 34 ? 1.018   -2.278  -6.142  1.00 0.00 ? 34 LEU A HD13 6  
ATOM 7149  H HD21 . LEU A 1 34 ? 3.716   -2.969  -5.057  1.00 0.00 ? 34 LEU A HD21 6  
ATOM 7150  H HD22 . LEU A 1 34 ? 2.174   -3.738  -4.625  1.00 0.00 ? 34 LEU A HD22 6  
ATOM 7151  H HD23 . LEU A 1 34 ? 3.543   -4.734  -5.165  1.00 0.00 ? 34 LEU A HD23 6  
ATOM 7152  N N    . ASP A 1 35 ? -0.992  -4.552  -8.525  1.00 0.00 ? 35 ASP A N    6  
ATOM 7153  C CA   . ASP A 1 35 ? -1.911  -3.858  -9.420  1.00 0.00 ? 35 ASP A CA   6  
ATOM 7154  C C    . ASP A 1 35 ? -3.294  -3.672  -8.778  1.00 0.00 ? 35 ASP A C    6  
ATOM 7155  O O    . ASP A 1 35 ? -3.894  -2.611  -8.930  1.00 0.00 ? 35 ASP A O    6  
ATOM 7156  C CB   . ASP A 1 35 ? -2.003  -4.627  -10.736 1.00 0.00 ? 35 ASP A CB   6  
ATOM 7157  C CG   . ASP A 1 35 ? -0.657  -4.606  -11.454 1.00 0.00 ? 35 ASP A CG   6  
ATOM 7158  O OD1  . ASP A 1 35 ? -0.315  -3.527  -11.996 1.00 0.00 ? 35 ASP A OD1  6  
ATOM 7159  O OD2  . ASP A 1 35 ? 0.012   -5.660  -11.443 1.00 0.00 ? 35 ASP A OD2  6  
ATOM 7160  H H    . ASP A 1 35 ? -0.560  -5.404  -8.853  1.00 0.00 ? 35 ASP A H    6  
ATOM 7161  H HA   . ASP A 1 35 ? -1.500  -2.870  -9.631  1.00 0.00 ? 35 ASP A HA   6  
ATOM 7162  H HB2  . ASP A 1 35 ? -2.290  -5.660  -10.534 1.00 0.00 ? 35 ASP A HB2  6  
ATOM 7163  H HB3  . ASP A 1 35 ? -2.756  -4.163  -11.372 1.00 0.00 ? 35 ASP A HB3  6  
ATOM 7164  N N    . GLU A 1 36 ? -3.799  -4.689  -8.055  1.00 0.00 ? 36 GLU A N    6  
ATOM 7165  C CA   . GLU A 1 36 ? -5.099  -4.583  -7.384  1.00 0.00 ? 36 GLU A CA   6  
ATOM 7166  C C    . GLU A 1 36 ? -5.100  -3.386  -6.433  1.00 0.00 ? 36 GLU A C    6  
ATOM 7167  O O    . GLU A 1 36 ? -6.102  -2.689  -6.308  1.00 0.00 ? 36 GLU A O    6  
ATOM 7168  C CB   . GLU A 1 36 ? -5.400  -5.881  -6.630  1.00 0.00 ? 36 GLU A CB   6  
ATOM 7169  C CG   . GLU A 1 36 ? -5.929  -6.934  -7.611  1.00 0.00 ? 36 GLU A CG   6  
ATOM 7170  C CD   . GLU A 1 36 ? -6.095  -8.286  -6.928  1.00 0.00 ? 36 GLU A CD   6  
ATOM 7171  O OE1  . GLU A 1 36 ? -5.112  -8.718  -6.284  1.00 0.00 ? 36 GLU A OE1  6  
ATOM 7172  O OE2  . GLU A 1 36 ? -7.195  -8.860  -7.060  1.00 0.00 ? 36 GLU A OE2  6  
ATOM 7173  H H    . GLU A 1 36 ? -3.277  -5.551  -7.963  1.00 0.00 ? 36 GLU A H    6  
ATOM 7174  H HA   . GLU A 1 36 ? -5.876  -4.429  -8.127  1.00 0.00 ? 36 GLU A HA   6  
ATOM 7175  H HB2  . GLU A 1 36 ? -4.490  -6.245  -6.154  1.00 0.00 ? 36 GLU A HB2  6  
ATOM 7176  H HB3  . GLU A 1 36 ? -6.155  -5.690  -5.867  1.00 0.00 ? 36 GLU A HB3  6  
ATOM 7177  H HG2  . GLU A 1 36 ? -6.895  -6.609  -7.998  1.00 0.00 ? 36 GLU A HG2  6  
ATOM 7178  H HG3  . GLU A 1 36 ? -5.230  -7.037  -8.441  1.00 0.00 ? 36 GLU A HG3  6  
ATOM 7179  N N    . ILE A 1 37 ? -3.972  -3.142  -5.767  1.00 0.00 ? 37 ILE A N    6  
ATOM 7180  C CA   . ILE A 1 37 ? -3.850  -2.020  -4.854  1.00 0.00 ? 37 ILE A CA   6  
ATOM 7181  C C    . ILE A 1 37 ? -3.799  -0.708  -5.647  1.00 0.00 ? 37 ILE A C    6  
ATOM 7182  O O    . ILE A 1 37 ? -4.406  0.281   -5.236  1.00 0.00 ? 37 ILE A O    6  
ATOM 7183  C CB   . ILE A 1 37 ? -2.586  -2.212  -3.992  1.00 0.00 ? 37 ILE A CB   6  
ATOM 7184  C CG1  . ILE A 1 37 ? -2.850  -3.301  -2.942  1.00 0.00 ? 37 ILE A CG1  6  
ATOM 7185  C CG2  . ILE A 1 37 ? -2.210  -0.896  -3.299  1.00 0.00 ? 37 ILE A CG2  6  
ATOM 7186  C CD1  . ILE A 1 37 ? -1.526  -3.906  -2.464  1.00 0.00 ? 37 ILE A CD1  6  
ATOM 7187  H H    . ILE A 1 37 ? -3.170  -3.748  -5.896  1.00 0.00 ? 37 ILE A H    6  
ATOM 7188  H HA   . ILE A 1 37 ? -4.729  -1.998  -4.203  1.00 0.00 ? 37 ILE A HA   6  
ATOM 7189  H HB   . ILE A 1 37 ? -1.760  -2.523  -4.627  1.00 0.00 ? 37 ILE A HB   6  
ATOM 7190  H HG12 . ILE A 1 37 ? -3.378  -2.870  -2.093  1.00 0.00 ? 37 ILE A HG12 6  
ATOM 7191  H HG13 . ILE A 1 37 ? -3.463  -4.088  -3.382  1.00 0.00 ? 37 ILE A HG13 6  
ATOM 7192  H HG21 . ILE A 1 37 ? -3.087  -0.471  -2.818  1.00 0.00 ? 37 ILE A HG21 6  
ATOM 7193  H HG22 . ILE A 1 37 ? -1.825  -0.193  -4.037  1.00 0.00 ? 37 ILE A HG22 6  
ATOM 7194  H HG23 . ILE A 1 37 ? -1.444  -1.086  -2.550  1.00 0.00 ? 37 ILE A HG23 6  
ATOM 7195  H HD11 . ILE A 1 37 ? -0.983  -4.313  -3.317  1.00 0.00 ? 37 ILE A HD11 6  
ATOM 7196  H HD12 . ILE A 1 37 ? -1.731  -4.705  -1.753  1.00 0.00 ? 37 ILE A HD12 6  
ATOM 7197  H HD13 . ILE A 1 37 ? -0.924  -3.138  -1.982  1.00 0.00 ? 37 ILE A HD13 6  
ATOM 7198  N N    . LEU A 1 38 ? -3.076  -0.696  -6.777  1.00 0.00 ? 38 LEU A N    6  
ATOM 7199  C CA   . LEU A 1 38 ? -2.938  0.507   -7.594  1.00 0.00 ? 38 LEU A CA   6  
ATOM 7200  C C    . LEU A 1 38 ? -4.290  0.960   -8.143  1.00 0.00 ? 38 LEU A C    6  
ATOM 7201  O O    . LEU A 1 38 ? -4.696  2.100   -7.924  1.00 0.00 ? 38 LEU A O    6  
ATOM 7202  C CB   . LEU A 1 38 ? -1.983  0.250   -8.770  1.00 0.00 ? 38 LEU A CB   6  
ATOM 7203  C CG   . LEU A 1 38 ? -0.561  -0.078  -8.293  1.00 0.00 ? 38 LEU A CG   6  
ATOM 7204  C CD1  . LEU A 1 38 ? 0.377   -0.084  -9.498  1.00 0.00 ? 38 LEU A CD1  6  
ATOM 7205  C CD2  . LEU A 1 38 ? -0.054  0.953   -7.278  1.00 0.00 ? 38 LEU A CD2  6  
ATOM 7206  H H    . LEU A 1 38 ? -2.602  -1.540  -7.078  1.00 0.00 ? 38 LEU A H    6  
ATOM 7207  H HA   . LEU A 1 38 ? -2.534  1.306   -6.976  1.00 0.00 ? 38 LEU A HA   6  
ATOM 7208  H HB2  . LEU A 1 38 ? -2.360  -0.585  -9.359  1.00 0.00 ? 38 LEU A HB2  6  
ATOM 7209  H HB3  . LEU A 1 38 ? -1.953  1.134   -9.398  1.00 0.00 ? 38 LEU A HB3  6  
ATOM 7210  H HG   . LEU A 1 38 ? -0.561  -1.058  -7.842  1.00 0.00 ? 38 LEU A HG   6  
ATOM 7211  H HD11 . LEU A 1 38 ? 0.064   -0.854  -10.202 1.00 0.00 ? 38 LEU A HD11 6  
ATOM 7212  H HD12 . LEU A 1 38 ? 0.349   0.890   -9.987  1.00 0.00 ? 38 LEU A HD12 6  
ATOM 7213  H HD13 . LEU A 1 38 ? 1.394   -0.288  -9.164  1.00 0.00 ? 38 LEU A HD13 6  
ATOM 7214  H HD21 . LEU A 1 38 ? 1.012   0.797   -7.107  1.00 0.00 ? 38 LEU A HD21 6  
ATOM 7215  H HD22 . LEU A 1 38 ? -0.211  1.956   -7.667  1.00 0.00 ? 38 LEU A HD22 6  
ATOM 7216  H HD23 . LEU A 1 38 ? -0.588  0.837   -6.336  1.00 0.00 ? 38 LEU A HD23 6  
ATOM 7217  N N    . ASP A 1 39 ? -4.974  0.075   -8.878  1.00 0.00 ? 39 ASP A N    6  
ATOM 7218  C CA   . ASP A 1 39 ? -6.234  0.415   -9.530  1.00 0.00 ? 39 ASP A CA   6  
ATOM 7219  C C    . ASP A 1 39 ? -7.242  0.983   -8.531  1.00 0.00 ? 39 ASP A C    6  
ATOM 7220  O O    . ASP A 1 39 ? -7.955  1.933   -8.848  1.00 0.00 ? 39 ASP A O    6  
ATOM 7221  C CB   . ASP A 1 39 ? -6.797  -0.832  -10.247 1.00 0.00 ? 39 ASP A CB   6  
ATOM 7222  C CG   . ASP A 1 39 ? -7.918  -1.502  -9.459  1.00 0.00 ? 39 ASP A CG   6  
ATOM 7223  O OD1  . ASP A 1 39 ? -9.070  -1.038  -9.604  1.00 0.00 ? 39 ASP A OD1  6  
ATOM 7224  O OD2  . ASP A 1 39 ? -7.604  -2.465  -8.733  1.00 0.00 ? 39 ASP A OD2  6  
ATOM 7225  H H    . ASP A 1 39 ? -4.604  -0.860  -9.004  1.00 0.00 ? 39 ASP A H    6  
ATOM 7226  H HA   . ASP A 1 39 ? -6.032  1.178   -10.280 1.00 0.00 ? 39 ASP A HA   6  
ATOM 7227  H HB2  . ASP A 1 39 ? -7.190  -0.532  -11.216 1.00 0.00 ? 39 ASP A HB2  6  
ATOM 7228  H HB3  . ASP A 1 39 ? -5.995  -1.553  -10.398 1.00 0.00 ? 39 ASP A HB3  6  
ATOM 7229  N N    . GLU A 1 40 ? -7.308  0.400   -7.334  1.00 0.00 ? 40 GLU A N    6  
ATOM 7230  C CA   . GLU A 1 40 ? -8.287  0.802   -6.343  1.00 0.00 ? 40 GLU A CA   6  
ATOM 7231  C C    . GLU A 1 40 ? -7.902  2.121   -5.644  1.00 0.00 ? 40 GLU A C    6  
ATOM 7232  O O    . GLU A 1 40 ? -8.676  2.629   -4.834  1.00 0.00 ? 40 GLU A O    6  
ATOM 7233  C CB   . GLU A 1 40 ? -8.471  -0.343  -5.345  1.00 0.00 ? 40 GLU A CB   6  
ATOM 7234  C CG   . GLU A 1 40 ? -9.920  -0.353  -4.848  1.00 0.00 ? 40 GLU A CG   6  
ATOM 7235  C CD   . GLU A 1 40 ? -10.317 -1.698  -4.248  1.00 0.00 ? 40 GLU A CD   6  
ATOM 7236  O OE1  . GLU A 1 40 ? -9.451  -2.593  -4.206  1.00 0.00 ? 40 GLU A OE1  6  
ATOM 7237  O OE2  . GLU A 1 40 ? -11.492 -1.799  -3.833  1.00 0.00 ? 40 GLU A OE2  6  
ATOM 7238  H H    . GLU A 1 40 ? -6.678  -0.360  -7.108  1.00 0.00 ? 40 GLU A H    6  
ATOM 7239  H HA   . GLU A 1 40 ? -9.234  0.961   -6.858  1.00 0.00 ? 40 GLU A HA   6  
ATOM 7240  H HB2  . GLU A 1 40 ? -8.255  -1.290  -5.842  1.00 0.00 ? 40 GLU A HB2  6  
ATOM 7241  H HB3  . GLU A 1 40 ? -7.791  -0.212  -4.506  1.00 0.00 ? 40 GLU A HB3  6  
ATOM 7242  H HG2  . GLU A 1 40 ? -10.035 0.422   -4.094  1.00 0.00 ? 40 GLU A HG2  6  
ATOM 7243  H HG3  . GLU A 1 40 ? -10.581 -0.137  -5.686  1.00 0.00 ? 40 GLU A HG3  6  
ATOM 7244  N N    . THR A 1 41 ? -6.726  2.689   -5.966  1.00 0.00 ? 41 THR A N    6  
ATOM 7245  C CA   . THR A 1 41 ? -6.299  3.980   -5.413  1.00 0.00 ? 41 THR A CA   6  
ATOM 7246  C C    . THR A 1 41 ? -6.063  4.991   -6.543  1.00 0.00 ? 41 THR A C    6  
ATOM 7247  O O    . THR A 1 41 ? -5.700  6.130   -6.279  1.00 0.00 ? 41 THR A O    6  
ATOM 7248  C CB   . THR A 1 41 ? -5.043  3.807   -4.564  1.00 0.00 ? 41 THR A CB   6  
ATOM 7249  O OG1  . THR A 1 41 ? -4.100  3.012   -5.249  1.00 0.00 ? 41 THR A OG1  6  
ATOM 7250  C CG2  . THR A 1 41 ? -5.391  3.163   -3.225  1.00 0.00 ? 41 THR A CG2  6  
ATOM 7251  H H    . THR A 1 41 ? -6.110  2.226   -6.622  1.00 0.00 ? 41 THR A H    6  
ATOM 7252  H HA   . THR A 1 41 ? -7.076  4.379   -4.776  1.00 0.00 ? 41 THR A HA   6  
ATOM 7253  H HB   . THR A 1 41 ? -4.623  4.781   -4.375  1.00 0.00 ? 41 THR A HB   6  
ATOM 7254  H HG1  . THR A 1 41 ? -4.456  2.121   -5.336  1.00 0.00 ? 41 THR A HG1  6  
ATOM 7255  H HG21 . THR A 1 41 ? -5.710  2.133   -3.383  1.00 0.00 ? 41 THR A HG21 6  
ATOM 7256  H HG22 . THR A 1 41 ? -4.511  3.177   -2.583  1.00 0.00 ? 41 THR A HG22 6  
ATOM 7257  H HG23 . THR A 1 41 ? -6.192  3.725   -2.745  1.00 0.00 ? 41 THR A HG23 6  
ATOM 7258  N N    . GLN A 1 42 ? -6.288  4.566   -7.797  1.00 0.00 ? 42 GLN A N    6  
ATOM 7259  C CA   . GLN A 1 42 ? -6.124  5.414   -8.977  1.00 0.00 ? 42 GLN A CA   6  
ATOM 7260  C C    . GLN A 1 42 ? -4.636  5.628   -9.236  1.00 0.00 ? 42 GLN A C    6  
ATOM 7261  O O    . GLN A 1 42 ? -4.244  6.635   -9.822  1.00 0.00 ? 42 GLN A O    6  
ATOM 7262  C CB   . GLN A 1 42 ? -6.851  6.775   -8.822  1.00 0.00 ? 42 GLN A CB   6  
ATOM 7263  C CG   . GLN A 1 42 ? -8.208  6.641   -8.099  1.00 0.00 ? 42 GLN A CG   6  
ATOM 7264  C CD   . GLN A 1 42 ? -8.948  5.363   -8.478  1.00 0.00 ? 42 GLN A CD   6  
ATOM 7265  O OE1  . GLN A 1 42 ? -9.514  5.266   -9.562  1.00 0.00 ? 42 GLN A OE1  6  
ATOM 7266  N NE2  . GLN A 1 42 ? -8.938  4.386   -7.572  1.00 0.00 ? 42 GLN A NE2  6  
ATOM 7267  H H    . GLN A 1 42 ? -6.589  3.613   -7.947  1.00 0.00 ? 42 GLN A H    6  
ATOM 7268  H HA   . GLN A 1 42 ? -6.549  4.891   -9.835  1.00 0.00 ? 42 GLN A HA   6  
ATOM 7269  H HB2  . GLN A 1 42 ? -6.217  7.458   -8.258  1.00 0.00 ? 42 GLN A HB2  6  
ATOM 7270  H HB3  . GLN A 1 42 ? -7.022  7.193   -9.814  1.00 0.00 ? 42 GLN A HB3  6  
ATOM 7271  H HG2  . GLN A 1 42 ? -8.043  6.650   -7.023  1.00 0.00 ? 42 GLN A HG2  6  
ATOM 7272  H HG3  . GLN A 1 42 ? -8.830  7.497   -8.363  1.00 0.00 ? 42 GLN A HG3  6  
ATOM 7273  H HE21 . GLN A 1 42 ? -8.433  4.513   -6.701  1.00 0.00 ? 42 GLN A HE21 6  
ATOM 7274  H HE22 . GLN A 1 42 ? -9.420  3.521   -7.758  1.00 0.00 ? 42 GLN A HE22 6  
ATOM 7275  N N    . HIS A 1 43 ? -3.810  4.676   -8.789  1.00 0.00 ? 43 HIS A N    6  
ATOM 7276  C CA   . HIS A 1 43 ? -2.370  4.754   -8.946  1.00 0.00 ? 43 HIS A CA   6  
ATOM 7277  C C    . HIS A 1 43 ? -1.910  3.772   -10.019 1.00 0.00 ? 43 HIS A C    6  
ATOM 7278  O O    . HIS A 1 43 ? -0.870  3.151   -9.866  1.00 0.00 ? 43 HIS A O    6  
ATOM 7279  C CB   . HIS A 1 43 ? -1.697  4.407   -7.614  1.00 0.00 ? 43 HIS A CB   6  
ATOM 7280  C CG   . HIS A 1 43 ? -2.191  5.207   -6.439  1.00 0.00 ? 43 HIS A CG   6  
ATOM 7281  N ND1  . HIS A 1 43 ? -1.915  4.837   -5.137  1.00 0.00 ? 43 HIS A ND1  6  
ATOM 7282  C CD2  . HIS A 1 43 ? -2.941  6.346   -6.323  1.00 0.00 ? 43 HIS A CD2  6  
ATOM 7283  C CE1  . HIS A 1 43 ? -2.485  5.755   -4.339  1.00 0.00 ? 43 HIS A CE1  6  
ATOM 7284  N NE2  . HIS A 1 43 ? -3.131  6.706   -4.999  1.00 0.00 ? 43 HIS A NE2  6  
ATOM 7285  H H    . HIS A 1 43 ? -4.193  3.864   -8.319  1.00 0.00 ? 43 HIS A H    6  
ATOM 7286  H HA   . HIS A 1 43 ? -2.085  5.765   -9.238  1.00 0.00 ? 43 HIS A HA   6  
ATOM 7287  H HB2  . HIS A 1 43 ? -1.873  3.355   -7.404  1.00 0.00 ? 43 HIS A HB2  6  
ATOM 7288  H HB3  . HIS A 1 43 ? -0.623  4.567   -7.714  1.00 0.00 ? 43 HIS A HB3  6  
ATOM 7289  H HD1  . HIS A 1 43 ? -1.387  4.030   -4.842  1.00 0.00 ? 43 HIS A HD1  6  
ATOM 7290  H HD2  . HIS A 1 43 ? -3.344  6.887   -7.151  1.00 0.00 ? 43 HIS A HD2  6  
ATOM 7291  H HE1  . HIS A 1 43 ? -2.442  5.709   -3.269  1.00 0.00 ? 43 HIS A HE1  6  
ATOM 7292  N N    . LEU A 1 44 ? -2.678  3.618   -11.101 1.00 0.00 ? 44 LEU A N    6  
ATOM 7293  C CA   . LEU A 1 44 ? -2.307  2.689   -12.162 1.00 0.00 ? 44 LEU A CA   6  
ATOM 7294  C C    . LEU A 1 44 ? -1.323  3.363   -13.116 1.00 0.00 ? 44 LEU A C    6  
ATOM 7295  O O    . LEU A 1 44 ? -0.377  2.725   -13.576 1.00 0.00 ? 44 LEU A O    6  
ATOM 7296  C CB   . LEU A 1 44 ? -3.560  2.198   -12.894 1.00 0.00 ? 44 LEU A CB   6  
ATOM 7297  C CG   . LEU A 1 44 ? -3.706  0.679   -12.698 1.00 0.00 ? 44 LEU A CG   6  
ATOM 7298  C CD1  . LEU A 1 44 ? -5.101  0.242   -13.146 1.00 0.00 ? 44 LEU A CD1  6  
ATOM 7299  C CD2  . LEU A 1 44 ? -2.653  -0.059  -13.534 1.00 0.00 ? 44 LEU A CD2  6  
ATOM 7300  H H    . LEU A 1 44 ? -3.531  4.148   -11.195 1.00 0.00 ? 44 LEU A H    6  
ATOM 7301  H HA   . LEU A 1 44 ? -1.811  1.831   -11.710 1.00 0.00 ? 44 LEU A HA   6  
ATOM 7302  H HB2  . LEU A 1 44 ? -4.439  2.701   -12.490 1.00 0.00 ? 44 LEU A HB2  6  
ATOM 7303  H HB3  . LEU A 1 44 ? -3.474  2.420   -13.958 1.00 0.00 ? 44 LEU A HB3  6  
ATOM 7304  H HG   . LEU A 1 44 ? -3.568  0.430   -11.638 1.00 0.00 ? 44 LEU A HG   6  
ATOM 7305  H HD11 . LEU A 1 44 ? -5.214  0.423   -14.216 1.00 0.00 ? 44 LEU A HD11 6  
ATOM 7306  H HD12 . LEU A 1 44 ? -5.233  -0.820  -12.943 1.00 0.00 ? 44 LEU A HD12 6  
ATOM 7307  H HD13 . LEU A 1 44 ? -5.854  0.812   -12.603 1.00 0.00 ? 44 LEU A HD13 6  
ATOM 7308  H HD21 . LEU A 1 44 ? -2.797  -1.135  -13.430 1.00 0.00 ? 44 LEU A HD21 6  
ATOM 7309  H HD22 . LEU A 1 44 ? -2.757  0.221   -14.581 1.00 0.00 ? 44 LEU A HD22 6  
ATOM 7310  H HD23 . LEU A 1 44 ? -1.655  0.205   -13.185 1.00 0.00 ? 44 LEU A HD23 6  
ATOM 7311  N N    . ASP A 1 45 ? -1.535  4.654   -13.402 1.00 0.00 ? 45 ASP A N    6  
ATOM 7312  C CA   . ASP A 1 45 ? -0.626  5.418   -14.248 1.00 0.00 ? 45 ASP A CA   6  
ATOM 7313  C C    . ASP A 1 45 ? 0.752   5.429   -13.591 1.00 0.00 ? 45 ASP A C    6  
ATOM 7314  O O    . ASP A 1 45 ? 1.762   5.205   -14.257 1.00 0.00 ? 45 ASP A O    6  
ATOM 7315  C CB   . ASP A 1 45 ? -1.162  6.844   -14.415 1.00 0.00 ? 45 ASP A CB   6  
ATOM 7316  C CG   . ASP A 1 45 ? -2.587  6.832   -14.955 1.00 0.00 ? 45 ASP A CG   6  
ATOM 7317  O OD1  . ASP A 1 45 ? -3.498  6.565   -14.139 1.00 0.00 ? 45 ASP A OD1  6  
ATOM 7318  O OD2  . ASP A 1 45 ? -2.739  7.089   -16.167 1.00 0.00 ? 45 ASP A OD2  6  
ATOM 7319  H H    . ASP A 1 45 ? -2.342  5.129   -13.018 1.00 0.00 ? 45 ASP A H    6  
ATOM 7320  H HA   . ASP A 1 45 ? -0.557  4.941   -15.228 1.00 0.00 ? 45 ASP A HA   6  
ATOM 7321  H HB2  . ASP A 1 45 ? -1.150  7.349   -13.450 1.00 0.00 ? 45 ASP A HB2  6  
ATOM 7322  H HB3  . ASP A 1 45 ? -0.521  7.388   -15.111 1.00 0.00 ? 45 ASP A HB3  6  
ATOM 7323  N N    . ILE A 1 46 ? 0.753   5.675   -12.264 1.00 0.00 ? 46 ILE A N    6  
ATOM 7324  C CA   . ILE A 1 46 ? 1.942   5.675   -11.403 1.00 0.00 ? 46 ILE A CA   6  
ATOM 7325  C C    . ILE A 1 46 ? 3.251   5.912   -12.190 1.00 0.00 ? 46 ILE A C    6  
ATOM 7326  O O    . ILE A 1 46 ? 3.558   7.049   -12.545 1.00 0.00 ? 46 ILE A O    6  
ATOM 7327  C CB   . ILE A 1 46 ? 1.939   4.361   -10.576 1.00 0.00 ? 46 ILE A CB   6  
ATOM 7328  C CG1  . ILE A 1 46 ? 3.129   4.319   -9.619  1.00 0.00 ? 46 ILE A CG1  6  
ATOM 7329  C CG2  . ILE A 1 46 ? 1.944   3.110   -11.483 1.00 0.00 ? 46 ILE A CG2  6  
ATOM 7330  C CD1  . ILE A 1 46 ? 2.890   3.249   -8.552  1.00 0.00 ? 46 ILE A CD1  6  
ATOM 7331  H H    . ILE A 1 46 ? -0.132  5.865   -11.816 1.00 0.00 ? 46 ILE A H    6  
ATOM 7332  H HA   . ILE A 1 46 ? 1.833   6.497   -10.699 1.00 0.00 ? 46 ILE A HA   6  
ATOM 7333  H HB   . ILE A 1 46 ? 1.034   4.350   -9.980  1.00 0.00 ? 46 ILE A HB   6  
ATOM 7334  H HG12 . ILE A 1 46 ? 4.031   4.078   -10.165 1.00 0.00 ? 46 ILE A HG12 6  
ATOM 7335  H HG13 . ILE A 1 46 ? 3.238   5.290   -9.137  1.00 0.00 ? 46 ILE A HG13 6  
ATOM 7336  H HG21 . ILE A 1 46 ? 1.942   3.403   -12.528 1.00 0.00 ? 46 ILE A HG21 6  
ATOM 7337  H HG22 . ILE A 1 46 ? 1.058   2.514   -11.280 1.00 0.00 ? 46 ILE A HG22 6  
ATOM 7338  H HG23 . ILE A 1 46 ? 2.832   2.510   -11.278 1.00 0.00 ? 46 ILE A HG23 6  
ATOM 7339  H HD11 . ILE A 1 46 ? 3.721   3.246   -7.852  1.00 0.00 ? 46 ILE A HD11 6  
ATOM 7340  H HD12 . ILE A 1 46 ? 2.815   2.270   -9.028  1.00 0.00 ? 46 ILE A HD12 6  
ATOM 7341  H HD13 . ILE A 1 46 ? 1.966   3.465   -8.017  1.00 0.00 ? 46 ILE A HD13 6  
ATOM 7342  N N    . GLY A 1 47 ? 4.017   4.849   -12.441 1.00 0.00 ? 47 GLY A N    6  
ATOM 7343  C CA   . GLY A 1 47 ? 5.285   4.926   -13.132 1.00 0.00 ? 47 GLY A CA   6  
ATOM 7344  C C    . GLY A 1 47 ? 6.144   3.759   -12.666 1.00 0.00 ? 47 GLY A C    6  
ATOM 7345  O O    . GLY A 1 47 ? 6.011   3.318   -11.528 1.00 0.00 ? 47 GLY A O    6  
ATOM 7346  H H    . GLY A 1 47 ? 3.718   3.945   -12.133 1.00 0.00 ? 47 GLY A H    6  
ATOM 7347  H HA2  . GLY A 1 47 ? 5.121   4.859   -14.208 1.00 0.00 ? 47 GLY A HA2  6  
ATOM 7348  H HA3  . GLY A 1 47 ? 5.783   5.866   -12.892 1.00 0.00 ? 47 GLY A HA3  6  
ATOM 7349  N N    . LEU A 1 48 ? 7.015   3.250   -13.536 1.00 0.00 ? 48 LEU A N    6  
ATOM 7350  C CA   . LEU A 1 48 ? 7.859   2.113   -13.192 1.00 0.00 ? 48 LEU A CA   6  
ATOM 7351  C C    . LEU A 1 48 ? 8.653   2.409   -11.918 1.00 0.00 ? 48 LEU A C    6  
ATOM 7352  O O    . LEU A 1 48 ? 8.780   1.546   -11.057 1.00 0.00 ? 48 LEU A O    6  
ATOM 7353  C CB   . LEU A 1 48 ? 8.793   1.802   -14.367 1.00 0.00 ? 48 LEU A CB   6  
ATOM 7354  C CG   . LEU A 1 48 ? 9.581   0.509   -14.091 1.00 0.00 ? 48 LEU A CG   6  
ATOM 7355  C CD1  . LEU A 1 48 ? 9.652   -0.330  -15.368 1.00 0.00 ? 48 LEU A CD1  6  
ATOM 7356  C CD2  . LEU A 1 48 ? 11.003  0.849   -13.630 1.00 0.00 ? 48 LEU A CD2  6  
ATOM 7357  H H    . LEU A 1 48 ? 7.097   3.649   -14.460 1.00 0.00 ? 48 LEU A H    6  
ATOM 7358  H HA   . LEU A 1 48 ? 7.215   1.249   -13.009 1.00 0.00 ? 48 LEU A HA   6  
ATOM 7359  H HB2  . LEU A 1 48 ? 8.198   1.674   -15.272 1.00 0.00 ? 48 LEU A HB2  6  
ATOM 7360  H HB3  . LEU A 1 48 ? 9.489   2.631   -14.509 1.00 0.00 ? 48 LEU A HB3  6  
ATOM 7361  H HG   . LEU A 1 48 ? 9.077   -0.066  -13.312 1.00 0.00 ? 48 LEU A HG   6  
ATOM 7362  H HD11 . LEU A 1 48 ? 10.126  0.251   -16.161 1.00 0.00 ? 48 LEU A HD11 6  
ATOM 7363  H HD12 . LEU A 1 48 ? 10.234  -1.231  -15.181 1.00 0.00 ? 48 LEU A HD12 6  
ATOM 7364  H HD13 . LEU A 1 48 ? 8.643   -0.609  -15.678 1.00 0.00 ? 48 LEU A HD13 6  
ATOM 7365  H HD21 . LEU A 1 48 ? 10.962  1.436   -12.715 1.00 0.00 ? 48 LEU A HD21 6  
ATOM 7366  H HD22 . LEU A 1 48 ? 11.553  -0.073  -13.443 1.00 0.00 ? 48 LEU A HD22 6  
ATOM 7367  H HD23 . LEU A 1 48 ? 11.511  1.422   -14.406 1.00 0.00 ? 48 LEU A HD23 6  
ATOM 7368  N N    . LYS A 1 49 ? 9.184   3.631   -11.805 1.00 0.00 ? 49 LYS A N    6  
ATOM 7369  C CA   . LYS A 1 49 ? 9.973   4.035   -10.651 1.00 0.00 ? 49 LYS A CA   6  
ATOM 7370  C C    . LYS A 1 49 ? 9.149   3.913   -9.363  1.00 0.00 ? 49 LYS A C    6  
ATOM 7371  O O    . LYS A 1 49 ? 9.604   3.311   -8.394  1.00 0.00 ? 49 LYS A O    6  
ATOM 7372  C CB   . LYS A 1 49 ? 10.448  5.477   -10.860 1.00 0.00 ? 49 LYS A CB   6  
ATOM 7373  C CG   . LYS A 1 49 ? 11.498  5.841   -9.807  1.00 0.00 ? 49 LYS A CG   6  
ATOM 7374  C CD   . LYS A 1 49 ? 11.950  7.287   -10.021 1.00 0.00 ? 49 LYS A CD   6  
ATOM 7375  C CE   . LYS A 1 49 ? 13.090  7.619   -9.055  1.00 0.00 ? 49 LYS A CE   6  
ATOM 7376  N NZ   . LYS A 1 49 ? 13.505  9.026   -9.195  1.00 0.00 ? 49 LYS A NZ   6  
ATOM 7377  H H    . LYS A 1 49 ? 9.041   4.304   -12.544 1.00 0.00 ? 49 LYS A H    6  
ATOM 7378  H HA   . LYS A 1 49 ? 10.845  3.383   -10.577 1.00 0.00 ? 49 LYS A HA   6  
ATOM 7379  H HB2  . LYS A 1 49 ? 10.888  5.571   -11.854 1.00 0.00 ? 49 LYS A HB2  6  
ATOM 7380  H HB3  . LYS A 1 49 ? 9.599   6.156   -10.777 1.00 0.00 ? 49 LYS A HB3  6  
ATOM 7381  H HG2  . LYS A 1 49 ? 11.068  5.738   -8.811  1.00 0.00 ? 49 LYS A HG2  6  
ATOM 7382  H HG3  . LYS A 1 49 ? 12.355  5.172   -9.904  1.00 0.00 ? 49 LYS A HG3  6  
ATOM 7383  H HD2  . LYS A 1 49 ? 12.299  7.410   -11.048 1.00 0.00 ? 49 LYS A HD2  6  
ATOM 7384  H HD3  . LYS A 1 49 ? 11.111  7.960   -9.841  1.00 0.00 ? 49 LYS A HD3  6  
ATOM 7385  H HE2  . LYS A 1 49 ? 12.754  7.446   -8.032  1.00 0.00 ? 49 LYS A HE2  6  
ATOM 7386  H HE3  . LYS A 1 49 ? 13.941  6.971   -9.267  1.00 0.00 ? 49 LYS A HE3  6  
ATOM 7387  H HZ1  . LYS A 1 49 ? 13.789  9.201   -10.148 1.00 0.00 ? 49 LYS A HZ1  6  
ATOM 7388  H HZ2  . LYS A 1 49 ? 14.281  9.211   -8.575  1.00 0.00 ? 49 LYS A HZ2  6  
ATOM 7389  H HZ3  . LYS A 1 49 ? 12.729  9.632   -8.956  1.00 0.00 ? 49 LYS A HZ3  6  
ATOM 7390  N N    . GLN A 1 50 ? 7.943   4.492   -9.355  1.00 0.00 ? 50 GLN A N    6  
ATOM 7391  C CA   . GLN A 1 50 ? 7.077   4.471   -8.182  1.00 0.00 ? 50 GLN A CA   6  
ATOM 7392  C C    . GLN A 1 50 ? 6.625   3.037   -7.872  1.00 0.00 ? 50 GLN A C    6  
ATOM 7393  O O    . GLN A 1 50 ? 6.761   2.588   -6.739  1.00 0.00 ? 50 GLN A O    6  
ATOM 7394  C CB   . GLN A 1 50 ? 5.875   5.384   -8.427  1.00 0.00 ? 50 GLN A CB   6  
ATOM 7395  C CG   . GLN A 1 50 ? 6.252   6.840   -8.152  1.00 0.00 ? 50 GLN A CG   6  
ATOM 7396  C CD   . GLN A 1 50 ? 5.055   7.755   -8.390  1.00 0.00 ? 50 GLN A CD   6  
ATOM 7397  O OE1  . GLN A 1 50 ? 4.407   8.196   -7.443  1.00 0.00 ? 50 GLN A OE1  6  
ATOM 7398  N NE2  . GLN A 1 50 ? 4.757   8.037   -9.658  1.00 0.00 ? 50 GLN A NE2  6  
ATOM 7399  H H    . GLN A 1 50 ? 7.613   4.965   -10.185 1.00 0.00 ? 50 GLN A H    6  
ATOM 7400  H HA   . GLN A 1 50 ? 7.635   4.851   -7.324  1.00 0.00 ? 50 GLN A HA   6  
ATOM 7401  H HB2  . GLN A 1 50 ? 5.556   5.287   -9.461  1.00 0.00 ? 50 GLN A HB2  6  
ATOM 7402  H HB3  . GLN A 1 50 ? 5.061   5.094   -7.764  1.00 0.00 ? 50 GLN A HB3  6  
ATOM 7403  H HG2  . GLN A 1 50 ? 6.578   6.938   -7.116  1.00 0.00 ? 50 GLN A HG2  6  
ATOM 7404  H HG3  . GLN A 1 50 ? 7.067   7.134   -8.814  1.00 0.00 ? 50 GLN A HG3  6  
ATOM 7405  H HE21 . GLN A 1 50 ? 5.310   7.646   -10.405 1.00 0.00 ? 50 GLN A HE21 6  
ATOM 7406  H HE22 . GLN A 1 50 ? 3.977   8.643   -9.870  1.00 0.00 ? 50 GLN A HE22 6  
ATOM 7407  N N    . LYS A 1 51 ? 6.088   2.319   -8.873  1.00 0.00 ? 51 LYS A N    6  
ATOM 7408  C CA   . LYS A 1 51 ? 5.643   0.939   -8.683  1.00 0.00 ? 51 LYS A CA   6  
ATOM 7409  C C    . LYS A 1 51 ? 6.779   0.111   -8.084  1.00 0.00 ? 51 LYS A C    6  
ATOM 7410  O O    . LYS A 1 51 ? 6.586   -0.585  -7.089  1.00 0.00 ? 51 LYS A O    6  
ATOM 7411  C CB   . LYS A 1 51 ? 5.186   0.348   -10.030 1.00 0.00 ? 51 LYS A CB   6  
ATOM 7412  C CG   . LYS A 1 51 ? 4.892   -1.153  -9.869  1.00 0.00 ? 51 LYS A CG   6  
ATOM 7413  C CD   . LYS A 1 51 ? 4.309   -1.730  -11.172 1.00 0.00 ? 51 LYS A CD   6  
ATOM 7414  C CE   . LYS A 1 51 ? 2.775   -1.725  -11.112 1.00 0.00 ? 51 LYS A CE   6  
ATOM 7415  N NZ   . LYS A 1 51 ? 2.194   -2.518  -12.215 1.00 0.00 ? 51 LYS A NZ   6  
ATOM 7416  H H    . LYS A 1 51 ? 5.984   2.733   -9.788  1.00 0.00 ? 51 LYS A H    6  
ATOM 7417  H HA   . LYS A 1 51 ? 4.799   0.930   -7.991  1.00 0.00 ? 51 LYS A HA   6  
ATOM 7418  H HB2  . LYS A 1 51 ? 4.284   0.860   -10.363 1.00 0.00 ? 51 LYS A HB2  6  
ATOM 7419  H HB3  . LYS A 1 51 ? 5.974   0.486   -10.772 1.00 0.00 ? 51 LYS A HB3  6  
ATOM 7420  H HG2  . LYS A 1 51 ? 5.819   -1.679  -9.635  1.00 0.00 ? 51 LYS A HG2  6  
ATOM 7421  H HG3  . LYS A 1 51 ? 4.183   -1.300  -9.054  1.00 0.00 ? 51 LYS A HG3  6  
ATOM 7422  H HD2  . LYS A 1 51 ? 4.644   -1.129  -12.019 1.00 0.00 ? 51 LYS A HD2  6  
ATOM 7423  H HD3  . LYS A 1 51 ? 4.660   -2.755  -11.296 1.00 0.00 ? 51 LYS A HD3  6  
ATOM 7424  H HE2  . LYS A 1 51 ? 2.452   -2.154  -10.163 1.00 0.00 ? 51 LYS A HE2  6  
ATOM 7425  H HE3  . LYS A 1 51 ? 2.417   -0.698  -11.183 1.00 0.00 ? 51 LYS A HE3  6  
ATOM 7426  H HZ1  . LYS A 1 51 ? 2.602   -3.441  -12.219 1.00 0.00 ? 51 LYS A HZ1  6  
ATOM 7427  H HZ2  . LYS A 1 51 ? 1.186   -2.598  -12.083 1.00 0.00 ? 51 LYS A HZ2  6  
ATOM 7428  H HZ3  . LYS A 1 51 ? 2.381   -2.062  -13.095 1.00 0.00 ? 51 LYS A HZ3  6  
ATOM 7429  N N    . GLN A 1 52 ? 7.964   0.192   -8.698  1.00 0.00 ? 52 GLN A N    6  
ATOM 7430  C CA   . GLN A 1 52 ? 9.131   -0.544  -8.234  1.00 0.00 ? 52 GLN A CA   6  
ATOM 7431  C C    . GLN A 1 52 ? 9.451   -0.158  -6.790  1.00 0.00 ? 52 GLN A C    6  
ATOM 7432  O O    . GLN A 1 52 ? 9.643   -1.030  -5.947  1.00 0.00 ? 52 GLN A O    6  
ATOM 7433  C CB   . GLN A 1 52 ? 10.317  -0.244  -9.159  1.00 0.00 ? 52 GLN A CB   6  
ATOM 7434  C CG   . GLN A 1 52 ? 11.541  -1.055  -8.725  1.00 0.00 ? 52 GLN A CG   6  
ATOM 7435  C CD   . GLN A 1 52 ? 12.705  -0.834  -9.685  1.00 0.00 ? 52 GLN A CD   6  
ATOM 7436  O OE1  . GLN A 1 52 ? 13.669  -0.153  -9.349  1.00 0.00 ? 52 GLN A OE1  6  
ATOM 7437  N NE2  . GLN A 1 52 ? 12.614  -1.412  -10.883 1.00 0.00 ? 52 GLN A NE2  6  
ATOM 7438  H H    . GLN A 1 52 ? 8.062   0.782   -9.515  1.00 0.00 ? 52 GLN A H    6  
ATOM 7439  H HA   . GLN A 1 52 ? 8.914   -1.612  -8.275  1.00 0.00 ? 52 GLN A HA   6  
ATOM 7440  H HB2  . GLN A 1 52 ? 10.052  -0.513  -10.182 1.00 0.00 ? 52 GLN A HB2  6  
ATOM 7441  H HB3  . GLN A 1 52 ? 10.553  0.820   -9.115  1.00 0.00 ? 52 GLN A HB3  6  
ATOM 7442  H HG2  . GLN A 1 52 ? 11.843  -0.746  -7.724  1.00 0.00 ? 52 GLN A HG2  6  
ATOM 7443  H HG3  . GLN A 1 52 ? 11.285  -2.115  -8.710  1.00 0.00 ? 52 GLN A HG3  6  
ATOM 7444  H HE21 . GLN A 1 52 ? 11.800  -1.961  -11.118 1.00 0.00 ? 52 GLN A HE21 6  
ATOM 7445  H HE22 . GLN A 1 52 ? 13.358  -1.298  -11.555 1.00 0.00 ? 52 GLN A HE22 6  
ATOM 7446  N N    . TRP A 1 53 ? 9.508   1.150   -6.508  1.00 0.00 ? 53 TRP A N    6  
ATOM 7447  C CA   . TRP A 1 53 ? 9.808   1.637   -5.170  1.00 0.00 ? 53 TRP A CA   6  
ATOM 7448  C C    . TRP A 1 53 ? 8.844   1.022   -4.154  1.00 0.00 ? 53 TRP A C    6  
ATOM 7449  O O    . TRP A 1 53 ? 9.274   0.483   -3.137  1.00 0.00 ? 53 TRP A O    6  
ATOM 7450  C CB   . TRP A 1 53 ? 9.708   3.164   -5.139  1.00 0.00 ? 53 TRP A CB   6  
ATOM 7451  C CG   . TRP A 1 53 ? 9.619   3.727   -3.760  1.00 0.00 ? 53 TRP A CG   6  
ATOM 7452  C CD1  . TRP A 1 53 ? 10.583  3.656   -2.836  1.00 0.00 ? 53 TRP A CD1  6  
ATOM 7453  C CD2  . TRP A 1 53 ? 8.508   4.408   -3.109  1.00 0.00 ? 53 TRP A CD2  6  
ATOM 7454  N NE1  . TRP A 1 53 ? 10.181  4.228   -1.656  1.00 0.00 ? 53 TRP A NE1  6  
ATOM 7455  C CE2  . TRP A 1 53 ? 8.890   4.712   -1.764  1.00 0.00 ? 53 TRP A CE2  6  
ATOM 7456  C CE3  . TRP A 1 53 ? 7.211   4.800   -3.506  1.00 0.00 ? 53 TRP A CE3  6  
ATOM 7457  C CZ2  . TRP A 1 53 ? 8.035   5.360   -0.870  1.00 0.00 ? 53 TRP A CZ2  6  
ATOM 7458  C CZ3  . TRP A 1 53 ? 6.343   5.447   -2.609  1.00 0.00 ? 53 TRP A CZ3  6  
ATOM 7459  C CH2  . TRP A 1 53 ? 6.755   5.729   -1.293  1.00 0.00 ? 53 TRP A CH2  6  
ATOM 7460  H H    . TRP A 1 53 ? 9.341   1.829   -7.240  1.00 0.00 ? 53 TRP A H    6  
ATOM 7461  H HA   . TRP A 1 53 ? 10.827  1.347   -4.909  1.00 0.00 ? 53 TRP A HA   6  
ATOM 7462  H HB2  . TRP A 1 53 ? 10.586  3.583   -5.632  1.00 0.00 ? 53 TRP A HB2  6  
ATOM 7463  H HB3  . TRP A 1 53 ? 8.822   3.469   -5.693  1.00 0.00 ? 53 TRP A HB3  6  
ATOM 7464  H HD1  . TRP A 1 53 ? 11.544  3.193   -2.993  1.00 0.00 ? 53 TRP A HD1  6  
ATOM 7465  H HE1  . TRP A 1 53 ? 10.739  4.290   -0.809  1.00 0.00 ? 53 TRP A HE1  6  
ATOM 7466  H HE3  . TRP A 1 53 ? 6.880   4.603   -4.512  1.00 0.00 ? 53 TRP A HE3  6  
ATOM 7467  H HZ2  . TRP A 1 53 ? 8.359   5.573   0.139   1.00 0.00 ? 53 TRP A HZ2  6  
ATOM 7468  H HZ3  . TRP A 1 53 ? 5.355   5.731   -2.935  1.00 0.00 ? 53 TRP A HZ3  6  
ATOM 7469  H HH2  . TRP A 1 53 ? 6.084   6.233   -0.614  1.00 0.00 ? 53 TRP A HH2  6  
ATOM 7470  N N    . LEU A 1 54 ? 7.539   1.105   -4.429  1.00 0.00 ? 54 LEU A N    6  
ATOM 7471  C CA   . LEU A 1 54 ? 6.532   0.560   -3.535  1.00 0.00 ? 54 LEU A CA   6  
ATOM 7472  C C    . LEU A 1 54 ? 6.785   -0.928  -3.319  1.00 0.00 ? 54 LEU A C    6  
ATOM 7473  O O    . LEU A 1 54 ? 6.764   -1.409  -2.186  1.00 0.00 ? 54 LEU A O    6  
ATOM 7474  C CB   . LEU A 1 54 ? 5.132   0.763   -4.134  1.00 0.00 ? 54 LEU A CB   6  
ATOM 7475  C CG   . LEU A 1 54 ? 4.729   2.244   -4.101  1.00 0.00 ? 54 LEU A CG   6  
ATOM 7476  C CD1  . LEU A 1 54 ? 3.477   2.440   -4.957  1.00 0.00 ? 54 LEU A CD1  6  
ATOM 7477  C CD2  . LEU A 1 54 ? 4.427   2.680   -2.664  1.00 0.00 ? 54 LEU A CD2  6  
ATOM 7478  H H    . LEU A 1 54 ? 7.233   1.558   -5.281  1.00 0.00 ? 54 LEU A H    6  
ATOM 7479  H HA   . LEU A 1 54 ? 6.593   1.071   -2.583  1.00 0.00 ? 54 LEU A HA   6  
ATOM 7480  H HB2  . LEU A 1 54 ? 5.130   0.414   -5.166  1.00 0.00 ? 54 LEU A HB2  6  
ATOM 7481  H HB3  . LEU A 1 54 ? 4.409   0.183   -3.561  1.00 0.00 ? 54 LEU A HB3  6  
ATOM 7482  H HG   . LEU A 1 54 ? 5.536   2.849   -4.503  1.00 0.00 ? 54 LEU A HG   6  
ATOM 7483  H HD11 . LEU A 1 54 ? 3.252   3.505   -5.034  1.00 0.00 ? 54 LEU A HD11 6  
ATOM 7484  H HD12 . LEU A 1 54 ? 2.635   1.923   -4.497  1.00 0.00 ? 54 LEU A HD12 6  
ATOM 7485  H HD13 . LEU A 1 54 ? 3.650   2.035   -5.953  1.00 0.00 ? 54 LEU A HD13 6  
ATOM 7486  H HD21 . LEU A 1 54 ? 3.929   3.649   -2.675  1.00 0.00 ? 54 LEU A HD21 6  
ATOM 7487  H HD22 . LEU A 1 54 ? 3.778   1.945   -2.187  1.00 0.00 ? 54 LEU A HD22 6  
ATOM 7488  H HD23 . LEU A 1 54 ? 5.356   2.762   -2.102  1.00 0.00 ? 54 LEU A HD23 6  
ATOM 7489  N N    . MET A 1 55 ? 7.005   -1.649  -4.417  1.00 0.00 ? 55 MET A N    6  
ATOM 7490  C CA   . MET A 1 55 ? 7.177   -3.087  -4.389  1.00 0.00 ? 55 MET A CA   6  
ATOM 7491  C C    . MET A 1 55 ? 8.375   -3.514  -3.531  1.00 0.00 ? 55 MET A C    6  
ATOM 7492  O O    . MET A 1 55 ? 8.228   -4.406  -2.699  1.00 0.00 ? 55 MET A O    6  
ATOM 7493  C CB   . MET A 1 55 ? 7.335   -3.588  -5.831  1.00 0.00 ? 55 MET A CB   6  
ATOM 7494  C CG   . MET A 1 55 ? 7.140   -5.103  -5.882  1.00 0.00 ? 55 MET A CG   6  
ATOM 7495  S SD   . MET A 1 55 ? 7.299   -5.802  -7.544  1.00 0.00 ? 55 MET A SD   6  
ATOM 7496  C CE   . MET A 1 55 ? 6.980   -7.540  -7.152  1.00 0.00 ? 55 MET A CE   6  
ATOM 7497  H H    . MET A 1 55 ? 7.038   -1.186  -5.317  1.00 0.00 ? 55 MET A H    6  
ATOM 7498  H HA   . MET A 1 55 ? 6.275   -3.527  -3.964  1.00 0.00 ? 55 MET A HA   6  
ATOM 7499  H HB2  . MET A 1 55 ? 6.587   -3.111  -6.464  1.00 0.00 ? 55 MET A HB2  6  
ATOM 7500  H HB3  . MET A 1 55 ? 8.330   -3.337  -6.198  1.00 0.00 ? 55 MET A HB3  6  
ATOM 7501  H HG2  . MET A 1 55 ? 7.881   -5.574  -5.236  1.00 0.00 ? 55 MET A HG2  6  
ATOM 7502  H HG3  . MET A 1 55 ? 6.146   -5.337  -5.504  1.00 0.00 ? 55 MET A HG3  6  
ATOM 7503  H HE1  . MET A 1 55 ? 5.984   -7.639  -6.722  1.00 0.00 ? 55 MET A HE1  6  
ATOM 7504  H HE2  . MET A 1 55 ? 7.723   -7.894  -6.436  1.00 0.00 ? 55 MET A HE2  6  
ATOM 7505  H HE3  . MET A 1 55 ? 7.043   -8.134  -8.063  1.00 0.00 ? 55 MET A HE3  6  
ATOM 7506  N N    . THR A 1 56 ? 9.559   -2.907  -3.740  1.00 0.00 ? 56 THR A N    6  
ATOM 7507  C CA   . THR A 1 56 ? 10.766  -3.331  -3.026  1.00 0.00 ? 56 THR A CA   6  
ATOM 7508  C C    . THR A 1 56 ? 11.422  -2.172  -2.251  1.00 0.00 ? 56 THR A C    6  
ATOM 7509  O O    . THR A 1 56 ? 12.622  -1.935  -2.370  1.00 0.00 ? 56 THR A O    6  
ATOM 7510  C CB   . THR A 1 56 ? 11.736  -3.997  -4.022  1.00 0.00 ? 56 THR A CB   6  
ATOM 7511  O OG1  . THR A 1 56 ? 12.935  -4.354  -3.366  1.00 0.00 ? 56 THR A OG1  6  
ATOM 7512  C CG2  . THR A 1 56 ? 12.047  -3.056  -5.191  1.00 0.00 ? 56 THR A CG2  6  
ATOM 7513  H H    . THR A 1 56 ? 9.632   -2.154  -4.411  1.00 0.00 ? 56 THR A H    6  
ATOM 7514  H HA   . THR A 1 56 ? 10.482  -4.088  -2.303  1.00 0.00 ? 56 THR A HA   6  
ATOM 7515  H HB   . THR A 1 56 ? 11.269  -4.902  -4.408  1.00 0.00 ? 56 THR A HB   6  
ATOM 7516  H HG1  . THR A 1 56 ? 13.536  -4.733  -4.011  1.00 0.00 ? 56 THR A HG1  6  
ATOM 7517  H HG21 . THR A 1 56 ? 11.178  -2.988  -5.845  1.00 0.00 ? 56 THR A HG21 6  
ATOM 7518  H HG22 . THR A 1 56 ? 12.294  -2.064  -4.814  1.00 0.00 ? 56 THR A HG22 6  
ATOM 7519  H HG23 . THR A 1 56 ? 12.892  -3.447  -5.758  1.00 0.00 ? 56 THR A HG23 6  
ATOM 7520  N N    . GLU A 1 57 ? 10.634  -1.473  -1.424  1.00 0.00 ? 57 GLU A N    6  
ATOM 7521  C CA   . GLU A 1 57 ? 11.168  -0.443  -0.535  1.00 0.00 ? 57 GLU A CA   6  
ATOM 7522  C C    . GLU A 1 57 ? 10.116  -0.035  0.495   1.00 0.00 ? 57 GLU A C    6  
ATOM 7523  O O    . GLU A 1 57 ? 10.376  -0.078  1.696   1.00 0.00 ? 57 GLU A O    6  
ATOM 7524  C CB   . GLU A 1 57 ? 11.659  0.785   -1.312  1.00 0.00 ? 57 GLU A CB   6  
ATOM 7525  C CG   . GLU A 1 57 ? 12.819  1.426   -0.531  1.00 0.00 ? 57 GLU A CG   6  
ATOM 7526  C CD   . GLU A 1 57 ? 13.059  2.867   -0.959  1.00 0.00 ? 57 GLU A CD   6  
ATOM 7527  O OE1  . GLU A 1 57 ? 13.814  3.052   -1.937  1.00 0.00 ? 57 GLU A OE1  6  
ATOM 7528  O OE2  . GLU A 1 57 ? 12.481  3.760   -0.298  1.00 0.00 ? 57 GLU A OE2  6  
ATOM 7529  H H    . GLU A 1 57 ? 9.644   -1.673  -1.390  1.00 0.00 ? 57 GLU A H    6  
ATOM 7530  H HA   . GLU A 1 57 ? 12.019  -0.862  -0.005  1.00 0.00 ? 57 GLU A HA   6  
ATOM 7531  H HB2  . GLU A 1 57 ? 12.005  0.489   -2.302  1.00 0.00 ? 57 GLU A HB2  6  
ATOM 7532  H HB3  . GLU A 1 57 ? 10.846  1.501   -1.410  1.00 0.00 ? 57 GLU A HB3  6  
ATOM 7533  H HG2  . GLU A 1 57 ? 12.584  1.410   0.534   1.00 0.00 ? 57 GLU A HG2  6  
ATOM 7534  H HG3  . GLU A 1 57 ? 13.727  0.847   -0.702  1.00 0.00 ? 57 GLU A HG3  6  
ATOM 7535  N N    . ALA A 1 58 ? 8.932   0.377   0.026   1.00 0.00 ? 58 ALA A N    6  
ATOM 7536  C CA   . ALA A 1 58 ? 7.879   0.859   0.909   1.00 0.00 ? 58 ALA A CA   6  
ATOM 7537  C C    . ALA A 1 58 ? 7.088   -0.295  1.525   1.00 0.00 ? 58 ALA A C    6  
ATOM 7538  O O    . ALA A 1 58 ? 7.065   -0.445  2.744   1.00 0.00 ? 58 ALA A O    6  
ATOM 7539  C CB   . ALA A 1 58 ? 6.944   1.774   0.121   1.00 0.00 ? 58 ALA A CB   6  
ATOM 7540  H H    . ALA A 1 58 ? 8.760   0.372   -0.972  1.00 0.00 ? 58 ALA A H    6  
ATOM 7541  H HA   . ALA A 1 58 ? 8.336   1.439   1.713   1.00 0.00 ? 58 ALA A HA   6  
ATOM 7542  H HB1  . ALA A 1 58 ? 6.307   1.175   -0.526  1.00 0.00 ? 58 ALA A HB1  6  
ATOM 7543  H HB2  . ALA A 1 58 ? 6.323   2.340   0.815   1.00 0.00 ? 58 ALA A HB2  6  
ATOM 7544  H HB3  . ALA A 1 58 ? 7.531   2.465   -0.485  1.00 0.00 ? 58 ALA A HB3  6  
ATOM 7545  N N    . LEU A 1 59 ? 6.423   -1.093  0.679   1.00 0.00 ? 59 LEU A N    6  
ATOM 7546  C CA   . LEU A 1 59 ? 5.547   -2.171  1.138   1.00 0.00 ? 59 LEU A CA   6  
ATOM 7547  C C    . LEU A 1 59 ? 6.344   -3.346  1.724   1.00 0.00 ? 59 LEU A C    6  
ATOM 7548  O O    . LEU A 1 59 ? 5.752   -4.348  2.118   1.00 0.00 ? 59 LEU A O    6  
ATOM 7549  C CB   . LEU A 1 59 ? 4.681   -2.652  -0.040  1.00 0.00 ? 59 LEU A CB   6  
ATOM 7550  C CG   . LEU A 1 59 ? 3.929   -1.476  -0.699  1.00 0.00 ? 59 LEU A CG   6  
ATOM 7551  C CD1  . LEU A 1 59 ? 3.259   -1.969  -1.982  1.00 0.00 ? 59 LEU A CD1  6  
ATOM 7552  C CD2  . LEU A 1 59 ? 2.857   -0.923  0.248   1.00 0.00 ? 59 LEU A CD2  6  
ATOM 7553  H H    . LEU A 1 59 ? 6.510   -0.944  -0.319  1.00 0.00 ? 59 LEU A H    6  
ATOM 7554  H HA   . LEU A 1 59 ? 4.893   -1.781  1.914   1.00 0.00 ? 59 LEU A HA   6  
ATOM 7555  H HB2  . LEU A 1 59 ? 5.322   -3.127  -0.782  1.00 0.00 ? 59 LEU A HB2  6  
ATOM 7556  H HB3  . LEU A 1 59 ? 3.958   -3.379  0.322   1.00 0.00 ? 59 LEU A HB3  6  
ATOM 7557  H HG   . LEU A 1 59 ? 4.632   -0.682  -0.948  1.00 0.00 ? 59 LEU A HG   6  
ATOM 7558  H HD11 . LEU A 1 59 ? 4.020   -2.335  -2.672  1.00 0.00 ? 59 LEU A HD11 6  
ATOM 7559  H HD12 . LEU A 1 59 ? 2.567   -2.777  -1.745  1.00 0.00 ? 59 LEU A HD12 6  
ATOM 7560  H HD13 . LEU A 1 59 ? 2.713   -1.149  -2.448  1.00 0.00 ? 59 LEU A HD13 6  
ATOM 7561  H HD21 . LEU A 1 59 ? 2.145   -1.711  0.491   1.00 0.00 ? 59 LEU A HD21 6  
ATOM 7562  H HD22 . LEU A 1 59 ? 3.323   -0.557  1.161   1.00 0.00 ? 59 LEU A HD22 6  
ATOM 7563  H HD23 . LEU A 1 59 ? 2.331   -0.102  -0.242  1.00 0.00 ? 59 LEU A HD23 6  
ATOM 7564  N N    . VAL A 1 60 ? 7.676   -3.233  1.782   1.00 0.00 ? 60 VAL A N    6  
ATOM 7565  C CA   . VAL A 1 60 ? 8.520   -4.300  2.304   1.00 0.00 ? 60 VAL A CA   6  
ATOM 7566  C C    . VAL A 1 60 ? 8.567   -4.231  3.833   1.00 0.00 ? 60 VAL A C    6  
ATOM 7567  O O    . VAL A 1 60 ? 8.367   -5.242  4.503   1.00 0.00 ? 60 VAL A O    6  
ATOM 7568  C CB   . VAL A 1 60 ? 9.929   -4.165  1.709   1.00 0.00 ? 60 VAL A CB   6  
ATOM 7569  C CG1  . VAL A 1 60 ? 10.796  -5.353  2.131   1.00 0.00 ? 60 VAL A CG1  6  
ATOM 7570  C CG2  . VAL A 1 60 ? 9.843   -4.140  0.187   1.00 0.00 ? 60 VAL A CG2  6  
ATOM 7571  H H    . VAL A 1 60 ? 8.121   -2.391  1.454   1.00 0.00 ? 60 VAL A H    6  
ATOM 7572  H HA   . VAL A 1 60 ? 8.102   -5.262  2.006   1.00 0.00 ? 60 VAL A HA   6  
ATOM 7573  H HB   . VAL A 1 60 ? 10.387  -3.238  2.059   1.00 0.00 ? 60 VAL A HB   6  
ATOM 7574  H HG11 . VAL A 1 60 ? 10.963  -5.322  3.207   1.00 0.00 ? 60 VAL A HG11 6  
ATOM 7575  H HG12 . VAL A 1 60 ? 10.293  -6.283  1.866   1.00 0.00 ? 60 VAL A HG12 6  
ATOM 7576  H HG13 . VAL A 1 60 ? 11.755  -5.302  1.612   1.00 0.00 ? 60 VAL A HG13 6  
ATOM 7577  H HG21 . VAL A 1 60 ? 9.274   -3.270  -0.136  1.00 0.00 ? 60 VAL A HG21 6  
ATOM 7578  H HG22 . VAL A 1 60 ? 9.350   -5.047  -0.165  1.00 0.00 ? 60 VAL A HG22 6  
ATOM 7579  H HG23 . VAL A 1 60 ? 10.849  -4.089  -0.226  1.00 0.00 ? 60 VAL A HG23 6  
ATOM 7580  N N    . ASN A 1 61 ? 8.839   -3.036  4.374   1.00 0.00 ? 61 ASN A N    6  
ATOM 7581  C CA   . ASN A 1 61 ? 8.951   -2.828  5.819   1.00 0.00 ? 61 ASN A CA   6  
ATOM 7582  C C    . ASN A 1 61 ? 7.914   -1.803  6.286   1.00 0.00 ? 61 ASN A C    6  
ATOM 7583  O O    . ASN A 1 61 ? 8.190   -0.993  7.169   1.00 0.00 ? 61 ASN A O    6  
ATOM 7584  C CB   . ASN A 1 61 ? 10.376  -2.354  6.146   1.00 0.00 ? 61 ASN A CB   6  
ATOM 7585  C CG   . ASN A 1 61 ? 10.741  -1.107  5.340   1.00 0.00 ? 61 ASN A CG   6  
ATOM 7586  O OD1  . ASN A 1 61 ? 10.617  0.011   5.830   1.00 0.00 ? 61 ASN A OD1  6  
ATOM 7587  N ND2  . ASN A 1 61 ? 11.193  -1.307  4.102   1.00 0.00 ? 61 ASN A ND2  6  
ATOM 7588  H H    . ASN A 1 61 ? 8.979   -2.239  3.769   1.00 0.00 ? 61 ASN A H    6  
ATOM 7589  H HA   . ASN A 1 61 ? 8.768   -3.770  6.335   1.00 0.00 ? 61 ASN A HA   6  
ATOM 7590  H HB2  . ASN A 1 61 ? 10.444  -2.126  7.211   1.00 0.00 ? 61 ASN A HB2  6  
ATOM 7591  H HB3  . ASN A 1 61 ? 11.081  -3.152  5.908   1.00 0.00 ? 61 ASN A HB3  6  
ATOM 7592  H HD21 . ASN A 1 61 ? 11.348  -2.246  3.768   1.00 0.00 ? 61 ASN A HD21 6  
ATOM 7593  H HD22 . ASN A 1 61 ? 11.374  -0.516  3.496   1.00 0.00 ? 61 ASN A HD22 6  
ATOM 7594  N N    . ASN A 1 62 ? 6.718   -1.844  5.695   1.00 0.00 ? 62 ASN A N    6  
ATOM 7595  C CA   . ASN A 1 62 ? 5.653   -0.917  6.048   1.00 0.00 ? 62 ASN A CA   6  
ATOM 7596  C C    . ASN A 1 62 ? 5.043   -1.311  7.402   1.00 0.00 ? 62 ASN A C    6  
ATOM 7597  O O    . ASN A 1 62 ? 4.746   -2.485  7.620   1.00 0.00 ? 62 ASN A O    6  
ATOM 7598  C CB   . ASN A 1 62 ? 4.590   -0.952  4.958   1.00 0.00 ? 62 ASN A CB   6  
ATOM 7599  C CG   . ASN A 1 62 ? 3.630   0.223   5.094   1.00 0.00 ? 62 ASN A CG   6  
ATOM 7600  O OD1  . ASN A 1 62 ? 2.633   0.135   5.803   1.00 0.00 ? 62 ASN A OD1  6  
ATOM 7601  N ND2  . ASN A 1 62 ? 3.935   1.329   4.416   1.00 0.00 ? 62 ASN A ND2  6  
ATOM 7602  H H    . ASN A 1 62 ? 6.537   -2.533  4.979   1.00 0.00 ? 62 ASN A H    6  
ATOM 7603  H HA   . ASN A 1 62 ? 6.069   0.086   6.103   1.00 0.00 ? 62 ASN A HA   6  
ATOM 7604  H HB2  . ASN A 1 62 ? 5.071   -0.907  3.986   1.00 0.00 ? 62 ASN A HB2  6  
ATOM 7605  H HB3  . ASN A 1 62 ? 4.039   -1.884  5.038   1.00 0.00 ? 62 ASN A HB3  6  
ATOM 7606  H HD21 . ASN A 1 62 ? 4.769   1.356   3.845   1.00 0.00 ? 62 ASN A HD21 6  
ATOM 7607  H HD22 . ASN A 1 62 ? 3.334   2.137   4.474   1.00 0.00 ? 62 ASN A HD22 6  
ATOM 7608  N N    . PRO A 1 63 ? 4.846   -0.342  8.320   1.00 0.00 ? 63 PRO A N    6  
ATOM 7609  C CA   . PRO A 1 63 ? 4.277   -0.615  9.628   1.00 0.00 ? 63 PRO A CA   6  
ATOM 7610  C C    . PRO A 1 63 ? 2.822   -1.097  9.533   1.00 0.00 ? 63 PRO A C    6  
ATOM 7611  O O    . PRO A 1 63 ? 2.325   -1.723  10.470  1.00 0.00 ? 63 PRO A O    6  
ATOM 7612  C CB   . PRO A 1 63 ? 4.362   0.705   10.401  1.00 0.00 ? 63 PRO A CB   6  
ATOM 7613  C CG   . PRO A 1 63 ? 4.794   1.781   9.399   1.00 0.00 ? 63 PRO A CG   6  
ATOM 7614  C CD   . PRO A 1 63 ? 5.183   1.053   8.112   1.00 0.00 ? 63 PRO A CD   6  
ATOM 7615  H HA   . PRO A 1 63 ? 4.877   -1.372  10.135  1.00 0.00 ? 63 PRO A HA   6  
ATOM 7616  H HB2  . PRO A 1 63 ? 3.389   0.958   10.825  1.00 0.00 ? 63 PRO A HB2  6  
ATOM 7617  H HB3  . PRO A 1 63 ? 5.103   0.622   11.197  1.00 0.00 ? 63 PRO A HB3  6  
ATOM 7618  H HG2  . PRO A 1 63 ? 3.965   2.463   9.204   1.00 0.00 ? 63 PRO A HG2  6  
ATOM 7619  H HG3  . PRO A 1 63 ? 5.648   2.336   9.789   1.00 0.00 ? 63 PRO A HG3  6  
ATOM 7620  H HD2  . PRO A 1 63 ? 4.622   1.459   7.271   1.00 0.00 ? 63 PRO A HD2  6  
ATOM 7621  H HD3  . PRO A 1 63 ? 6.255   1.160   7.938   1.00 0.00 ? 63 PRO A HD3  6  
ATOM 7622  N N    . LYS A 1 64 ? 2.134   -0.798  8.414   1.00 0.00 ? 64 LYS A N    6  
ATOM 7623  C CA   . LYS A 1 64 ? 0.728   -1.166  8.244   1.00 0.00 ? 64 LYS A CA   6  
ATOM 7624  C C    . LYS A 1 64 ? 0.528   -2.127  7.066   1.00 0.00 ? 64 LYS A C    6  
ATOM 7625  O O    . LYS A 1 64 ? -0.611  -2.386  6.686   1.00 0.00 ? 64 LYS A O    6  
ATOM 7626  C CB   . LYS A 1 64 ? -0.104  0.114   8.042   1.00 0.00 ? 64 LYS A CB   6  
ATOM 7627  C CG   . LYS A 1 64 ? -1.152  0.235   9.147   1.00 0.00 ? 64 LYS A CG   6  
ATOM 7628  C CD   . LYS A 1 64 ? -0.483  0.605   10.475  1.00 0.00 ? 64 LYS A CD   6  
ATOM 7629  C CE   . LYS A 1 64 ? -1.254  -0.032  11.632  1.00 0.00 ? 64 LYS A CE   6  
ATOM 7630  N NZ   . LYS A 1 64 ? -1.001  -1.486  11.706  1.00 0.00 ? 64 LYS A NZ   6  
ATOM 7631  H H    . LYS A 1 64 ? 2.588   -0.293  7.664   1.00 0.00 ? 64 LYS A H    6  
ATOM 7632  H HA   . LYS A 1 64 ? 0.383   -1.666  9.148   1.00 0.00 ? 64 LYS A HA   6  
ATOM 7633  H HB2  . LYS A 1 64 ? 0.550   0.987   8.064   1.00 0.00 ? 64 LYS A HB2  6  
ATOM 7634  H HB3  . LYS A 1 64 ? -0.611  0.070   7.079   1.00 0.00 ? 64 LYS A HB3  6  
ATOM 7635  H HG2  . LYS A 1 64 ? -1.870  1.012   8.878   1.00 0.00 ? 64 LYS A HG2  6  
ATOM 7636  H HG3  . LYS A 1 64 ? -1.675  -0.714  9.251   1.00 0.00 ? 64 LYS A HG3  6  
ATOM 7637  H HD2  . LYS A 1 64 ? 0.546   0.248   10.482  1.00 0.00 ? 64 LYS A HD2  6  
ATOM 7638  H HD3  . LYS A 1 64 ? -0.487  1.690   10.591  1.00 0.00 ? 64 LYS A HD3  6  
ATOM 7639  H HE2  . LYS A 1 64 ? -0.940  0.432   12.567  1.00 0.00 ? 64 LYS A HE2  6  
ATOM 7640  H HE3  . LYS A 1 64 ? -2.322  0.142   11.487  1.00 0.00 ? 64 LYS A HE3  6  
ATOM 7641  H HZ1  . LYS A 1 64 ? -0.016  -1.650  11.860  1.00 0.00 ? 64 LYS A HZ1  6  
ATOM 7642  H HZ2  . LYS A 1 64 ? -1.535  -1.883  12.474  1.00 0.00 ? 64 LYS A HZ2  6  
ATOM 7643  H HZ3  . LYS A 1 64 ? -1.285  -1.929  10.841  1.00 0.00 ? 64 LYS A HZ3  6  
ATOM 7644  N N    . ILE A 1 65 ? 1.612   -2.665  6.492   1.00 0.00 ? 65 ILE A N    6  
ATOM 7645  C CA   . ILE A 1 65 ? 1.504   -3.610  5.380   1.00 0.00 ? 65 ILE A CA   6  
ATOM 7646  C C    . ILE A 1 65 ? 2.544   -4.717  5.564   1.00 0.00 ? 65 ILE A C    6  
ATOM 7647  O O    . ILE A 1 65 ? 3.591   -4.493  6.167   1.00 0.00 ? 65 ILE A O    6  
ATOM 7648  C CB   . ILE A 1 65 ? 1.673   -2.857  4.027   1.00 0.00 ? 65 ILE A CB   6  
ATOM 7649  C CG1  . ILE A 1 65 ? 0.300   -2.569  3.389   1.00 0.00 ? 65 ILE A CG1  6  
ATOM 7650  C CG2  . ILE A 1 65 ? 2.511   -3.686  3.043   1.00 0.00 ? 65 ILE A CG2  6  
ATOM 7651  C CD1  . ILE A 1 65 ? -0.101  -1.116  3.646   1.00 0.00 ? 65 ILE A CD1  6  
ATOM 7652  H H    . ILE A 1 65 ? 2.536   -2.426  6.831   1.00 0.00 ? 65 ILE A H    6  
ATOM 7653  H HA   . ILE A 1 65 ? 0.521   -4.069  5.410   1.00 0.00 ? 65 ILE A HA   6  
ATOM 7654  H HB   . ILE A 1 65 ? 2.176   -1.914  4.204   1.00 0.00 ? 65 ILE A HB   6  
ATOM 7655  H HG12 . ILE A 1 65 ? 0.359   -2.734  2.313   1.00 0.00 ? 65 ILE A HG12 6  
ATOM 7656  H HG13 . ILE A 1 65 ? -0.452  -3.228  3.807   1.00 0.00 ? 65 ILE A HG13 6  
ATOM 7657  H HG21 . ILE A 1 65 ? 3.506   -3.852  3.453   1.00 0.00 ? 65 ILE A HG21 6  
ATOM 7658  H HG22 . ILE A 1 65 ? 2.599   -3.146  2.104   1.00 0.00 ? 65 ILE A HG22 6  
ATOM 7659  H HG23 . ILE A 1 65 ? 2.025   -4.644  2.861   1.00 0.00 ? 65 ILE A HG23 6  
ATOM 7660  H HD11 . ILE A 1 65 ? -0.047  -0.903  4.711   1.00 0.00 ? 65 ILE A HD11 6  
ATOM 7661  H HD12 . ILE A 1 65 ? -1.122  -0.955  3.296   1.00 0.00 ? 65 ILE A HD12 6  
ATOM 7662  H HD13 . ILE A 1 65 ? 0.575   -0.451  3.108   1.00 0.00 ? 65 ILE A HD13 6  
ATOM 7663  N N    . GLU A 1 66 ? 2.245   -5.913  5.049   1.00 0.00 ? 66 GLU A N    6  
ATOM 7664  C CA   . GLU A 1 66 ? 3.141   -7.052  5.149   1.00 0.00 ? 66 GLU A CA   6  
ATOM 7665  C C    . GLU A 1 66 ? 3.087   -7.845  3.845   1.00 0.00 ? 66 GLU A C    6  
ATOM 7666  O O    . GLU A 1 66 ? 2.076   -7.817  3.147   1.00 0.00 ? 66 GLU A O    6  
ATOM 7667  C CB   . GLU A 1 66 ? 2.726   -7.911  6.347   1.00 0.00 ? 66 GLU A CB   6  
ATOM 7668  C CG   . GLU A 1 66 ? 3.903   -8.775  6.807   1.00 0.00 ? 66 GLU A CG   6  
ATOM 7669  C CD   . GLU A 1 66 ? 3.675   -9.288  8.222   1.00 0.00 ? 66 GLU A CD   6  
ATOM 7670  O OE1  . GLU A 1 66 ? 2.725   -10.078 8.395   1.00 0.00 ? 66 GLU A OE1  6  
ATOM 7671  O OE2  . GLU A 1 66 ? 4.457   -8.880  9.109   1.00 0.00 ? 66 GLU A OE2  6  
ATOM 7672  H H    . GLU A 1 66 ? 1.364   -6.042  4.565   1.00 0.00 ? 66 GLU A H    6  
ATOM 7673  H HA   . GLU A 1 66 ? 4.159   -6.692  5.300   1.00 0.00 ? 66 GLU A HA   6  
ATOM 7674  H HB2  . GLU A 1 66 ? 2.420   -7.261  7.165   1.00 0.00 ? 66 GLU A HB2  6  
ATOM 7675  H HB3  . GLU A 1 66 ? 1.890   -8.551  6.067   1.00 0.00 ? 66 GLU A HB3  6  
ATOM 7676  H HG2  . GLU A 1 66 ? 4.013   -9.624  6.131   1.00 0.00 ? 66 GLU A HG2  6  
ATOM 7677  H HG3  . GLU A 1 66 ? 4.817   -8.181  6.788   1.00 0.00 ? 66 GLU A HG3  6  
ATOM 7678  N N    . VAL A 1 67 ? 4.179   -8.540  3.514   1.00 0.00 ? 67 VAL A N    6  
ATOM 7679  C CA   . VAL A 1 67 ? 4.273   -9.298  2.273   1.00 0.00 ? 67 VAL A CA   6  
ATOM 7680  C C    . VAL A 1 67 ? 3.949   -10.769 2.527   1.00 0.00 ? 67 VAL A C    6  
ATOM 7681  O O    . VAL A 1 67 ? 4.616   -11.421 3.328   1.00 0.00 ? 67 VAL A O    6  
ATOM 7682  C CB   . VAL A 1 67 ? 5.687   -9.139  1.699   1.00 0.00 ? 67 VAL A CB   6  
ATOM 7683  C CG1  . VAL A 1 67 ? 5.720   -9.646  0.255   1.00 0.00 ? 67 VAL A CG1  6  
ATOM 7684  C CG2  . VAL A 1 67 ? 6.082   -7.659  1.727   1.00 0.00 ? 67 VAL A CG2  6  
ATOM 7685  H H    . VAL A 1 67 ? 4.976   -8.541  4.135   1.00 0.00 ? 67 VAL A H    6  
ATOM 7686  H HA   . VAL A 1 67 ? 3.559   -8.896  1.555   1.00 0.00 ? 67 VAL A HA   6  
ATOM 7687  H HB   . VAL A 1 67 ? 6.394   -9.712  2.301   1.00 0.00 ? 67 VAL A HB   6  
ATOM 7688  H HG11 . VAL A 1 67 ? 6.741   -9.599  -0.124  1.00 0.00 ? 67 VAL A HG11 6  
ATOM 7689  H HG12 . VAL A 1 67 ? 5.370   -10.677 0.222   1.00 0.00 ? 67 VAL A HG12 6  
ATOM 7690  H HG13 . VAL A 1 67 ? 5.076   -9.023  -0.365  1.00 0.00 ? 67 VAL A HG13 6  
ATOM 7691  H HG21 . VAL A 1 67 ? 6.329   -7.366  2.747   1.00 0.00 ? 67 VAL A HG21 6  
ATOM 7692  H HG22 . VAL A 1 67 ? 5.248   -7.057  1.370   1.00 0.00 ? 67 VAL A HG22 6  
ATOM 7693  H HG23 . VAL A 1 67 ? 6.947   -7.500  1.085   1.00 0.00 ? 67 VAL A HG23 6  
ATOM 7694  N N    . ILE A 1 68 ? 2.920   -11.283 1.834   1.00 0.00 ? 68 ILE A N    6  
ATOM 7695  C CA   . ILE A 1 68 ? 2.497   -12.674 1.962   1.00 0.00 ? 68 ILE A CA   6  
ATOM 7696  C C    . ILE A 1 68 ? 2.158   -13.216 0.575   1.00 0.00 ? 68 ILE A C    6  
ATOM 7697  O O    . ILE A 1 68 ? 1.502   -12.534 -0.213  1.00 0.00 ? 68 ILE A O    6  
ATOM 7698  C CB   . ILE A 1 68 ? 1.273   -12.766 2.899   1.00 0.00 ? 68 ILE A CB   6  
ATOM 7699  C CG1  . ILE A 1 68 ? 1.696   -12.509 4.356   1.00 0.00 ? 68 ILE A CG1  6  
ATOM 7700  C CG2  . ILE A 1 68 ? 0.647   -14.164 2.799   1.00 0.00 ? 68 ILE A CG2  6  
ATOM 7701  C CD1  . ILE A 1 68 ? 1.300   -11.093 4.771   1.00 0.00 ? 68 ILE A CD1  6  
ATOM 7702  H H    . ILE A 1 68 ? 2.411   -10.691 1.188   1.00 0.00 ? 68 ILE A H    6  
ATOM 7703  H HA   . ILE A 1 68 ? 3.314   -13.263 2.381   1.00 0.00 ? 68 ILE A HA   6  
ATOM 7704  H HB   . ILE A 1 68 ? 0.534   -12.023 2.600   1.00 0.00 ? 68 ILE A HB   6  
ATOM 7705  H HG12 . ILE A 1 68 ? 1.196   -13.223 5.010   1.00 0.00 ? 68 ILE A HG12 6  
ATOM 7706  H HG13 . ILE A 1 68 ? 2.773   -12.630 4.454   1.00 0.00 ? 68 ILE A HG13 6  
ATOM 7707  H HG21 . ILE A 1 68 ? 1.412   -14.921 2.977   1.00 0.00 ? 68 ILE A HG21 6  
ATOM 7708  H HG22 . ILE A 1 68 ? 0.219   -14.305 1.807   1.00 0.00 ? 68 ILE A HG22 6  
ATOM 7709  H HG23 . ILE A 1 68 ? -0.142  -14.264 3.546   1.00 0.00 ? 68 ILE A HG23 6  
ATOM 7710  H HD11 . ILE A 1 68 ? 0.214   -11.001 4.759   1.00 0.00 ? 68 ILE A HD11 6  
ATOM 7711  H HD12 . ILE A 1 68 ? 1.732   -10.374 4.077   1.00 0.00 ? 68 ILE A HD12 6  
ATOM 7712  H HD13 . ILE A 1 68 ? 1.669   -10.893 5.776   1.00 0.00 ? 68 ILE A HD13 6  
ATOM 7713  N N    . ASP A 1 69 ? 2.609   -14.451 0.284   1.00 0.00 ? 69 ASP A N    6  
ATOM 7714  C CA   . ASP A 1 69 ? 2.353   -15.108 -0.997  1.00 0.00 ? 69 ASP A CA   6  
ATOM 7715  C C    . ASP A 1 69 ? 2.866   -14.241 -2.158  1.00 0.00 ? 69 ASP A C    6  
ATOM 7716  O O    . ASP A 1 69 ? 2.356   -14.319 -3.277  1.00 0.00 ? 69 ASP A O    6  
ATOM 7717  C CB   . ASP A 1 69 ? 0.843   -15.386 -1.121  1.00 0.00 ? 69 ASP A CB   6  
ATOM 7718  C CG   . ASP A 1 69 ? 0.517   -16.192 -2.374  1.00 0.00 ? 69 ASP A CG   6  
ATOM 7719  O OD1  . ASP A 1 69 ? 1.207   -17.210 -2.594  1.00 0.00 ? 69 ASP A OD1  6  
ATOM 7720  O OD2  . ASP A 1 69 ? -0.416  -15.767 -3.092  1.00 0.00 ? 69 ASP A OD2  6  
ATOM 7721  H H    . ASP A 1 69 ? 3.146   -14.955 0.974   1.00 0.00 ? 69 ASP A H    6  
ATOM 7722  H HA   . ASP A 1 69 ? 2.886   -16.058 -1.011  1.00 0.00 ? 69 ASP A HA   6  
ATOM 7723  H HB2  . ASP A 1 69 ? 0.513   -15.948 -0.247  1.00 0.00 ? 69 ASP A HB2  6  
ATOM 7724  H HB3  . ASP A 1 69 ? 0.304   -14.440 -1.159  1.00 0.00 ? 69 ASP A HB3  6  
ATOM 7725  N N    . GLY A 1 70 ? 3.882   -13.408 -1.891  1.00 0.00 ? 70 GLY A N    6  
ATOM 7726  C CA   . GLY A 1 70 ? 4.449   -12.529 -2.903  1.00 0.00 ? 70 GLY A CA   6  
ATOM 7727  C C    . GLY A 1 70 ? 3.586   -11.273 -3.082  1.00 0.00 ? 70 GLY A C    6  
ATOM 7728  O O    . GLY A 1 70 ? 4.071   -10.264 -3.592  1.00 0.00 ? 70 GLY A O    6  
ATOM 7729  H H    . GLY A 1 70 ? 4.272   -13.381 -0.961  1.00 0.00 ? 70 GLY A H    6  
ATOM 7730  H HA2  . GLY A 1 70 ? 5.451   -12.232 -2.596  1.00 0.00 ? 70 GLY A HA2  6  
ATOM 7731  H HA3  . GLY A 1 70 ? 4.508   -13.062 -3.853  1.00 0.00 ? 70 GLY A HA3  6  
ATOM 7732  N N    . LYS A 1 71 ? 2.309   -11.335 -2.665  1.00 0.00 ? 71 LYS A N    6  
ATOM 7733  C CA   . LYS A 1 71 ? 1.399   -10.206 -2.785  1.00 0.00 ? 71 LYS A CA   6  
ATOM 7734  C C    . LYS A 1 71 ? 1.572   -9.318  -1.546  1.00 0.00 ? 71 LYS A C    6  
ATOM 7735  O O    . LYS A 1 71 ? 2.542   -9.488  -0.803  1.00 0.00 ? 71 LYS A O    6  
ATOM 7736  C CB   . LYS A 1 71 ? -0.057  -10.688 -2.938  1.00 0.00 ? 71 LYS A CB   6  
ATOM 7737  C CG   . LYS A 1 71 ? -0.140  -12.060 -3.636  1.00 0.00 ? 71 LYS A CG   6  
ATOM 7738  C CD   . LYS A 1 71 ? 0.545   -12.010 -5.010  1.00 0.00 ? 71 LYS A CD   6  
ATOM 7739  C CE   . LYS A 1 71 ? 0.092   -13.201 -5.864  1.00 0.00 ? 71 LYS A CE   6  
ATOM 7740  N NZ   . LYS A 1 71 ? 0.456   -14.482 -5.230  1.00 0.00 ? 71 LYS A NZ   6  
ATOM 7741  H H    . LYS A 1 71 ? 1.960   -12.183 -2.249  1.00 0.00 ? 71 LYS A H    6  
ATOM 7742  H HA   . LYS A 1 71 ? 1.664   -9.625  -3.673  1.00 0.00 ? 71 LYS A HA   6  
ATOM 7743  H HB2  . LYS A 1 71 ? -0.512  -10.761 -1.960  1.00 0.00 ? 71 LYS A HB2  6  
ATOM 7744  H HB3  . LYS A 1 71 ? -0.609  -9.963  -3.526  1.00 0.00 ? 71 LYS A HB3  6  
ATOM 7745  H HG2  . LYS A 1 71 ? 0.333   -12.817 -3.016  1.00 0.00 ? 71 LYS A HG2  6  
ATOM 7746  H HG3  . LYS A 1 71 ? -1.192  -12.321 -3.771  1.00 0.00 ? 71 LYS A HG3  6  
ATOM 7747  H HD2  . LYS A 1 71 ? 0.280   -11.082 -5.515  1.00 0.00 ? 71 LYS A HD2  6  
ATOM 7748  H HD3  . LYS A 1 71 ? 1.626   -12.052 -4.886  1.00 0.00 ? 71 LYS A HD3  6  
ATOM 7749  H HE2  . LYS A 1 71 ? -0.990  -13.160 -5.995  1.00 0.00 ? 71 LYS A HE2  6  
ATOM 7750  H HE3  . LYS A 1 71 ? 0.571   -13.140 -6.842  1.00 0.00 ? 71 LYS A HE3  6  
ATOM 7751  H HZ1  . LYS A 1 71 ? 0.375   -15.230 -5.904  1.00 0.00 ? 71 LYS A HZ1  6  
ATOM 7752  H HZ2  . LYS A 1 71 ? -0.166  -14.668 -4.448  1.00 0.00 ? 71 LYS A HZ2  6  
ATOM 7753  H HZ3  . LYS A 1 71 ? 1.410   -14.436 -4.890  1.00 0.00 ? 71 LYS A HZ3  6  
ATOM 7754  N N    . TYR A 1 72 ? 0.652   -8.368  -1.320  1.00 0.00 ? 72 TYR A N    6  
ATOM 7755  C CA   . TYR A 1 72 ? 0.776   -7.439  -0.203  1.00 0.00 ? 72 TYR A CA   6  
ATOM 7756  C C    . TYR A 1 72 ? -0.537  -7.334  0.567   1.00 0.00 ? 72 TYR A C    6  
ATOM 7757  O O    . TYR A 1 72 ? -1.588  -7.073  -0.011  1.00 0.00 ? 72 TYR A O    6  
ATOM 7758  C CB   . TYR A 1 72 ? 1.228   -6.083  -0.744  1.00 0.00 ? 72 TYR A CB   6  
ATOM 7759  C CG   . TYR A 1 72 ? 2.574   -6.175  -1.430  1.00 0.00 ? 72 TYR A CG   6  
ATOM 7760  C CD1  . TYR A 1 72 ? 2.649   -6.538  -2.789  1.00 0.00 ? 72 TYR A CD1  6  
ATOM 7761  C CD2  . TYR A 1 72 ? 3.752   -5.947  -0.700  1.00 0.00 ? 72 TYR A CD2  6  
ATOM 7762  C CE1  . TYR A 1 72 ? 3.900   -6.680  -3.408  1.00 0.00 ? 72 TYR A CE1  6  
ATOM 7763  C CE2  . TYR A 1 72 ? 5.004   -6.082  -1.323  1.00 0.00 ? 72 TYR A CE2  6  
ATOM 7764  C CZ   . TYR A 1 72 ? 5.077   -6.455  -2.675  1.00 0.00 ? 72 TYR A CZ   6  
ATOM 7765  O OH   . TYR A 1 72 ? 6.292   -6.606  -3.272  1.00 0.00 ? 72 TYR A OH   6  
ATOM 7766  H H    . TYR A 1 72 ? -0.145  -8.273  -1.940  1.00 0.00 ? 72 TYR A H    6  
ATOM 7767  H HA   . TYR A 1 72 ? 1.542   -7.807  0.479   1.00 0.00 ? 72 TYR A HA   6  
ATOM 7768  H HB2  . TYR A 1 72 ? 0.487   -5.720  -1.457  1.00 0.00 ? 72 TYR A HB2  6  
ATOM 7769  H HB3  . TYR A 1 72 ? 1.299   -5.376  0.084   1.00 0.00 ? 72 TYR A HB3  6  
ATOM 7770  H HD1  . TYR A 1 72 ? 1.745   -6.722  -3.350  1.00 0.00 ? 72 TYR A HD1  6  
ATOM 7771  H HD2  . TYR A 1 72 ? 3.695   -5.677  0.344   1.00 0.00 ? 72 TYR A HD2  6  
ATOM 7772  H HE1  . TYR A 1 72 ? 3.958   -6.967  -4.448  1.00 0.00 ? 72 TYR A HE1  6  
ATOM 7773  H HE2  . TYR A 1 72 ? 5.909   -5.912  -0.760  1.00 0.00 ? 72 TYR A HE2  6  
ATOM 7774  H HH   . TYR A 1 72 ? 6.234   -7.004  -4.142  1.00 0.00 ? 72 TYR A HH   6  
ATOM 7775  N N    . ALA A 1 73 ? -0.448  -7.545  1.886   1.00 0.00 ? 73 ALA A N    6  
ATOM 7776  C CA   . ALA A 1 73 ? -1.590  -7.501  2.786   1.00 0.00 ? 73 ALA A CA   6  
ATOM 7777  C C    . ALA A 1 73 ? -1.434  -6.339  3.755   1.00 0.00 ? 73 ALA A C    6  
ATOM 7778  O O    . ALA A 1 73 ? -0.351  -5.771  3.872   1.00 0.00 ? 73 ALA A O    6  
ATOM 7779  C CB   . ALA A 1 73 ? -1.646  -8.815  3.566   1.00 0.00 ? 73 ALA A CB   6  
ATOM 7780  H H    . ALA A 1 73 ? 0.456   -7.749  2.290   1.00 0.00 ? 73 ALA A H    6  
ATOM 7781  H HA   . ALA A 1 73 ? -2.510  -7.377  2.215   1.00 0.00 ? 73 ALA A HA   6  
ATOM 7782  H HB1  . ALA A 1 73 ? -1.670  -9.652  2.873   1.00 0.00 ? 73 ALA A HB1  6  
ATOM 7783  H HB2  . ALA A 1 73 ? -2.540  -8.832  4.188   1.00 0.00 ? 73 ALA A HB2  6  
ATOM 7784  H HB3  . ALA A 1 73 ? -0.760  -8.896  4.198   1.00 0.00 ? 73 ALA A HB3  6  
ATOM 7785  N N    . PHE A 1 74 ? -2.517  -5.998  4.462   1.00 0.00 ? 74 PHE A N    6  
ATOM 7786  C CA   . PHE A 1 74 ? -2.490  -4.941  5.457   1.00 0.00 ? 74 PHE A CA   6  
ATOM 7787  C C    . PHE A 1 74 ? -2.195  -5.552  6.825   1.00 0.00 ? 74 PHE A C    6  
ATOM 7788  O O    . PHE A 1 74 ? -2.860  -6.499  7.241   1.00 0.00 ? 74 PHE A O    6  
ATOM 7789  C CB   . PHE A 1 74 ? -3.822  -4.189  5.450   1.00 0.00 ? 74 PHE A CB   6  
ATOM 7790  C CG   . PHE A 1 74 ? -4.039  -3.331  6.677   1.00 0.00 ? 74 PHE A CG   6  
ATOM 7791  C CD1  . PHE A 1 74 ? -4.614  -3.889  7.827   1.00 0.00 ? 74 PHE A CD1  6  
ATOM 7792  C CD2  . PHE A 1 74 ? -3.669  -1.975  6.666   1.00 0.00 ? 74 PHE A CD2  6  
ATOM 7793  C CE1  . PHE A 1 74 ? -4.841  -3.097  8.958   1.00 0.00 ? 74 PHE A CE1  6  
ATOM 7794  C CE2  . PHE A 1 74 ? -3.885  -1.184  7.806   1.00 0.00 ? 74 PHE A CE2  6  
ATOM 7795  C CZ   . PHE A 1 74 ? -4.478  -1.748  8.950   1.00 0.00 ? 74 PHE A CZ   6  
ATOM 7796  H H    . PHE A 1 74 ? -3.384  -6.492  4.314   1.00 0.00 ? 74 PHE A H    6  
ATOM 7797  H HA   . PHE A 1 74 ? -1.700  -4.240  5.209   1.00 0.00 ? 74 PHE A HA   6  
ATOM 7798  H HB2  . PHE A 1 74 ? -3.848  -3.550  4.574   1.00 0.00 ? 74 PHE A HB2  6  
ATOM 7799  H HB3  . PHE A 1 74 ? -4.639  -4.907  5.375   1.00 0.00 ? 74 PHE A HB3  6  
ATOM 7800  H HD1  . PHE A 1 74 ? -4.884  -4.928  7.840   1.00 0.00 ? 74 PHE A HD1  6  
ATOM 7801  H HD2  . PHE A 1 74 ? -3.223  -1.542  5.783   1.00 0.00 ? 74 PHE A HD2  6  
ATOM 7802  H HE1  . PHE A 1 74 ? -5.296  -3.528  9.834   1.00 0.00 ? 74 PHE A HE1  6  
ATOM 7803  H HE2  . PHE A 1 74 ? -3.604  -0.144  7.801   1.00 0.00 ? 74 PHE A HE2  6  
ATOM 7804  H HZ   . PHE A 1 74 ? -4.656  -1.143  9.822   1.00 0.00 ? 74 PHE A HZ   6  
ATOM 7805  N N    . LYS A 1 75 ? -1.189  -5.005  7.515   1.00 0.00 ? 75 LYS A N    6  
ATOM 7806  C CA   . LYS A 1 75 ? -0.777  -5.485  8.823   1.00 0.00 ? 75 LYS A CA   6  
ATOM 7807  C C    . LYS A 1 75 ? -1.667  -4.848  9.901   1.00 0.00 ? 75 LYS A C    6  
ATOM 7808  O O    . LYS A 1 75 ? -1.678  -3.620  10.032  1.00 0.00 ? 75 LYS A O    6  
ATOM 7809  C CB   . LYS A 1 75 ? 0.694   -5.108  9.036   1.00 0.00 ? 75 LYS A CB   6  
ATOM 7810  C CG   . LYS A 1 75 ? 1.229   -5.732  10.334  1.00 0.00 ? 75 LYS A CG   6  
ATOM 7811  C CD   . LYS A 1 75 ? 2.709   -6.107  10.167  1.00 0.00 ? 75 LYS A CD   6  
ATOM 7812  C CE   . LYS A 1 75 ? 3.550   -4.859  9.851   1.00 0.00 ? 75 LYS A CE   6  
ATOM 7813  N NZ   . LYS A 1 75 ? 4.447   -5.093  8.703   1.00 0.00 ? 75 LYS A NZ   6  
ATOM 7814  H H    . LYS A 1 75 ? -0.687  -4.223  7.117   1.00 0.00 ? 75 LYS A H    6  
ATOM 7815  H HA   . LYS A 1 75 ? -0.873  -6.567  8.850   1.00 0.00 ? 75 LYS A HA   6  
ATOM 7816  H HB2  . LYS A 1 75 ? 1.280   -5.471  8.193   1.00 0.00 ? 75 LYS A HB2  6  
ATOM 7817  H HB3  . LYS A 1 75 ? 0.783   -4.025  9.092   1.00 0.00 ? 75 LYS A HB3  6  
ATOM 7818  H HG2  . LYS A 1 75 ? 1.123   -5.018  11.152  1.00 0.00 ? 75 LYS A HG2  6  
ATOM 7819  H HG3  . LYS A 1 75 ? 0.660   -6.631  10.567  1.00 0.00 ? 75 LYS A HG3  6  
ATOM 7820  H HD2  . LYS A 1 75 ? 3.071   -6.559  11.093  1.00 0.00 ? 75 LYS A HD2  6  
ATOM 7821  H HD3  . LYS A 1 75 ? 2.808   -6.828  9.358   1.00 0.00 ? 75 LYS A HD3  6  
ATOM 7822  H HE2  . LYS A 1 75 ? 2.892   -4.026  9.620   1.00 0.00 ? 75 LYS A HE2  6  
ATOM 7823  H HE3  . LYS A 1 75 ? 4.150   -4.603  10.726  1.00 0.00 ? 75 LYS A HE3  6  
ATOM 7824  H HZ1  . LYS A 1 75 ? 3.895   -5.282  7.873   1.00 0.00 ? 75 LYS A HZ1  6  
ATOM 7825  H HZ2  . LYS A 1 75 ? 5.048   -5.881  8.896   1.00 0.00 ? 75 LYS A HZ2  6  
ATOM 7826  H HZ3  . LYS A 1 75 ? 5.012   -4.267  8.543   1.00 0.00 ? 75 LYS A HZ3  6  
ATOM 7827  N N    . PRO A 1 76 ? -2.418  -5.665  10.678  1.00 0.00 ? 76 PRO A N    6  
ATOM 7828  C CA   . PRO A 1 76 ? -3.296  -5.157  11.713  1.00 0.00 ? 76 PRO A CA   6  
ATOM 7829  C C    . PRO A 1 76 ? -2.506  -4.333  12.731  1.00 0.00 ? 76 PRO A C    6  
ATOM 7830  O O    . PRO A 1 76 ? -2.790  -3.152  12.925  1.00 0.00 ? 76 PRO A O    6  
ATOM 7831  C CB   . PRO A 1 76 ? -3.956  -6.381  12.351  1.00 0.00 ? 76 PRO A CB   6  
ATOM 7832  C CG   . PRO A 1 76 ? -3.409  -7.616  11.625  1.00 0.00 ? 76 PRO A CG   6  
ATOM 7833  C CD   . PRO A 1 76 ? -2.431  -7.111  10.564  1.00 0.00 ? 76 PRO A CD   6  
ATOM 7834  H HA   . PRO A 1 76 ? -4.062  -4.534  11.260  1.00 0.00 ? 76 PRO A HA   6  
ATOM 7835  H HB2  . PRO A 1 76 ? -3.711  -6.433  13.412  1.00 0.00 ? 76 PRO A HB2  6  
ATOM 7836  H HB3  . PRO A 1 76 ? -5.038  -6.324  12.223  1.00 0.00 ? 76 PRO A HB3  6  
ATOM 7837  H HG2  . PRO A 1 76 ? -2.890  -8.265  12.331  1.00 0.00 ? 76 PRO A HG2  6  
ATOM 7838  H HG3  . PRO A 1 76 ? -4.225  -8.161  11.149  1.00 0.00 ? 76 PRO A HG3  6  
ATOM 7839  H HD2  . PRO A 1 76 ? -1.436  -7.514  10.756  1.00 0.00 ? 76 PRO A HD2  6  
ATOM 7840  H HD3  . PRO A 1 76 ? -2.773  -7.408  9.573   1.00 0.00 ? 76 PRO A HD3  6  
ATOM 7841  N N    . LYS A 1 77 ? -1.507  -4.953  13.375  1.00 0.00 ? 77 LYS A N    6  
ATOM 7842  C CA   . LYS A 1 77 ? -0.674  -4.262  14.351  1.00 0.00 ? 77 LYS A CA   6  
ATOM 7843  C C    . LYS A 1 77 ? 0.596   -5.067  14.632  1.00 0.00 ? 77 LYS A C    6  
ATOM 7844  O O    . LYS A 1 77 ? 1.681   -4.496  14.683  1.00 0.00 ? 77 LYS A O    6  
ATOM 7845  C CB   . LYS A 1 77 ? -1.470  -3.994  15.645  1.00 0.00 ? 77 LYS A CB   6  
ATOM 7846  C CG   . LYS A 1 77 ? -2.102  -5.283  16.189  1.00 0.00 ? 77 LYS A CG   6  
ATOM 7847  C CD   . LYS A 1 77 ? -3.010  -4.939  17.373  1.00 0.00 ? 77 LYS A CD   6  
ATOM 7848  C CE   . LYS A 1 77 ? -3.637  -6.219  17.930  1.00 0.00 ? 77 LYS A CE   6  
ATOM 7849  N NZ   . LYS A 1 77 ? -4.551  -5.920  19.050  1.00 0.00 ? 77 LYS A NZ   6  
ATOM 7850  H H    . LYS A 1 77 ? -1.317  -5.925  13.181  1.00 0.00 ? 77 LYS A H    6  
ATOM 7851  H HA   . LYS A 1 77 ? -0.378  -3.301  13.930  1.00 0.00 ? 77 LYS A HA   6  
ATOM 7852  H HB2  . LYS A 1 77 ? -0.798  -3.579  16.398  1.00 0.00 ? 77 LYS A HB2  6  
ATOM 7853  H HB3  . LYS A 1 77 ? -2.258  -3.270  15.437  1.00 0.00 ? 77 LYS A HB3  6  
ATOM 7854  H HG2  . LYS A 1 77 ? -2.693  -5.759  15.409  1.00 0.00 ? 77 LYS A HG2  6  
ATOM 7855  H HG3  . LYS A 1 77 ? -1.320  -5.962  16.523  1.00 0.00 ? 77 LYS A HG3  6  
ATOM 7856  H HD2  . LYS A 1 77 ? -2.422  -4.452  18.152  1.00 0.00 ? 77 LYS A HD2  6  
ATOM 7857  H HD3  . LYS A 1 77 ? -3.800  -4.263  17.039  1.00 0.00 ? 77 LYS A HD3  6  
ATOM 7858  H HE2  . LYS A 1 77 ? -4.196  -6.720  17.138  1.00 0.00 ? 77 LYS A HE2  6  
ATOM 7859  H HE3  . LYS A 1 77 ? -2.845  -6.882  18.283  1.00 0.00 ? 77 LYS A HE3  6  
ATOM 7860  H HZ1  . LYS A 1 77 ? -4.037  -5.468  19.793  1.00 0.00 ? 77 LYS A HZ1  6  
ATOM 7861  H HZ2  . LYS A 1 77 ? -5.288  -5.309  18.730  1.00 0.00 ? 77 LYS A HZ2  6  
ATOM 7862  H HZ3  . LYS A 1 77 ? -4.954  -6.780  19.394  1.00 0.00 ? 77 LYS A HZ3  6  
ATOM 7863  N N    . TYR A 1 78 ? 0.460   -6.389  14.814  1.00 0.00 ? 78 TYR A N    6  
ATOM 7864  C CA   . TYR A 1 78 ? 1.601   -7.252  15.096  1.00 0.00 ? 78 TYR A CA   6  
ATOM 7865  C C    . TYR A 1 78 ? 1.379   -8.629  14.481  1.00 0.00 ? 78 TYR A C    6  
ATOM 7866  O O    . TYR A 1 78 ? 2.120   -9.029  13.590  1.00 0.00 ? 78 TYR A O    6  
ATOM 7867  C CB   . TYR A 1 78 ? 1.796   -7.363  16.614  1.00 0.00 ? 78 TYR A CB   6  
ATOM 7868  C CG   . TYR A 1 78 ? 2.243   -6.068  17.261  1.00 0.00 ? 78 TYR A CG   6  
ATOM 7869  C CD1  . TYR A 1 78 ? 3.559   -5.605  17.073  1.00 0.00 ? 78 TYR A CD1  6  
ATOM 7870  C CD2  . TYR A 1 78 ? 1.343   -5.322  18.046  1.00 0.00 ? 78 TYR A CD2  6  
ATOM 7871  C CE1  . TYR A 1 78 ? 3.973   -4.403  17.670  1.00 0.00 ? 78 TYR A CE1  6  
ATOM 7872  C CE2  . TYR A 1 78 ? 1.758   -4.120  18.641  1.00 0.00 ? 78 TYR A CE2  6  
ATOM 7873  C CZ   . TYR A 1 78 ? 3.074   -3.660  18.453  1.00 0.00 ? 78 TYR A CZ   6  
ATOM 7874  O OH   . TYR A 1 78 ? 3.478   -2.493  19.032  1.00 0.00 ? 78 TYR A OH   6  
ATOM 7875  H H    . TYR A 1 78 ? -0.453  -6.811  14.756  1.00 0.00 ? 78 TYR A H    6  
ATOM 7876  H HA   . TYR A 1 78 ? 2.498   -6.814  14.656  1.00 0.00 ? 78 TYR A HA   6  
ATOM 7877  H HB2  . TYR A 1 78 ? 0.855   -7.674  17.068  1.00 0.00 ? 78 TYR A HB2  6  
ATOM 7878  H HB3  . TYR A 1 78 ? 2.548   -8.127  16.815  1.00 0.00 ? 78 TYR A HB3  6  
ATOM 7879  H HD1  . TYR A 1 78 ? 4.250   -6.176  16.471  1.00 0.00 ? 78 TYR A HD1  6  
ATOM 7880  H HD2  . TYR A 1 78 ? 0.333   -5.675  18.192  1.00 0.00 ? 78 TYR A HD2  6  
ATOM 7881  H HE1  . TYR A 1 78 ? 4.983   -4.049  17.526  1.00 0.00 ? 78 TYR A HE1  6  
ATOM 7882  H HE2  . TYR A 1 78 ? 1.067   -3.550  19.243  1.00 0.00 ? 78 TYR A HE2  6  
ATOM 7883  H HH   . TYR A 1 78 ? 2.788   -2.071  19.547  1.00 0.00 ? 78 TYR A HH   6  
ATOM 7884  N N    . ASN A 1 79 ? 0.352   -9.348  14.967  1.00 0.00 ? 79 ASN A N    6  
ATOM 7885  C CA   . ASN A 1 79 ? 0.030   -10.692 14.491  1.00 0.00 ? 79 ASN A CA   6  
ATOM 7886  C C    . ASN A 1 79 ? 1.238   -11.615 14.672  1.00 0.00 ? 79 ASN A C    6  
ATOM 7887  O O    . ASN A 1 79 ? 1.982   -11.869 13.725  1.00 0.00 ? 79 ASN A O    6  
ATOM 7888  C CB   . ASN A 1 79 ? -0.418  -10.637 13.022  1.00 0.00 ? 79 ASN A CB   6  
ATOM 7889  C CG   . ASN A 1 79 ? -0.778  -12.028 12.507  1.00 0.00 ? 79 ASN A CG   6  
ATOM 7890  O OD1  . ASN A 1 79 ? -0.164  -12.521 11.564  1.00 0.00 ? 79 ASN A OD1  6  
ATOM 7891  N ND2  . ASN A 1 79 ? -1.776  -12.661 13.126  1.00 0.00 ? 79 ASN A ND2  6  
ATOM 7892  H H    . ASN A 1 79 ? -0.222  -8.956  15.697  1.00 0.00 ? 79 ASN A H    6  
ATOM 7893  H HA   . ASN A 1 79 ? -0.795  -11.081 15.091  1.00 0.00 ? 79 ASN A HA   6  
ATOM 7894  H HB2  . ASN A 1 79 ? -1.291  -9.990  12.939  1.00 0.00 ? 79 ASN A HB2  6  
ATOM 7895  H HB3  . ASN A 1 79 ? 0.387   -10.230 12.412  1.00 0.00 ? 79 ASN A HB3  6  
ATOM 7896  H HD21 . ASN A 1 79 ? -2.262  -12.212 13.887  1.00 0.00 ? 79 ASN A HD21 6  
ATOM 7897  H HD22 . ASN A 1 79 ? -2.042  -13.589 12.831  1.00 0.00 ? 79 ASN A HD22 6  
ATOM 7898  N N    . VAL A 1 80 ? 1.428   -12.112 15.900  1.00 0.00 ? 80 VAL A N    6  
ATOM 7899  C CA   . VAL A 1 80 ? 2.538   -13.000 16.215  1.00 0.00 ? 80 VAL A CA   6  
ATOM 7900  C C    . VAL A 1 80 ? 2.444   -14.278 15.377  1.00 0.00 ? 80 VAL A C    6  
ATOM 7901  O O    . VAL A 1 80 ? 1.347   -14.724 15.038  1.00 0.00 ? 80 VAL A O    6  
ATOM 7902  C CB   . VAL A 1 80 ? 2.525   -13.311 17.725  1.00 0.00 ? 80 VAL A CB   6  
ATOM 7903  C CG1  . VAL A 1 80 ? 1.292   -14.150 18.090  1.00 0.00 ? 80 VAL A CG1  6  
ATOM 7904  C CG2  . VAL A 1 80 ? 3.795   -14.078 18.111  1.00 0.00 ? 80 VAL A CG2  6  
ATOM 7905  H H    . VAL A 1 80 ? 0.785   -11.871 16.638  1.00 0.00 ? 80 VAL A H    6  
ATOM 7906  H HA   . VAL A 1 80 ? 3.470   -12.489 15.972  1.00 0.00 ? 80 VAL A HA   6  
ATOM 7907  H HB   . VAL A 1 80 ? 2.495   -12.373 18.281  1.00 0.00 ? 80 VAL A HB   6  
ATOM 7908  H HG11 . VAL A 1 80 ? 1.233   -14.253 19.174  1.00 0.00 ? 80 VAL A HG11 6  
ATOM 7909  H HG12 . VAL A 1 80 ? 1.373   -15.140 17.640  1.00 0.00 ? 80 VAL A HG12 6  
ATOM 7910  H HG13 . VAL A 1 80 ? 0.392   -13.657 17.724  1.00 0.00 ? 80 VAL A HG13 6  
ATOM 7911  H HG21 . VAL A 1 80 ? 4.671   -13.532 17.761  1.00 0.00 ? 80 VAL A HG21 6  
ATOM 7912  H HG22 . VAL A 1 80 ? 3.779   -15.069 17.658  1.00 0.00 ? 80 VAL A HG22 6  
ATOM 7913  H HG23 . VAL A 1 80 ? 3.842   -14.178 19.195  1.00 0.00 ? 80 VAL A HG23 6  
ATOM 7914  N N    . ARG A 1 81 ? 3.606   -14.856 15.048  1.00 0.00 ? 81 ARG A N    6  
ATOM 7915  C CA   . ARG A 1 81 ? 3.687   -16.079 14.261  1.00 0.00 ? 81 ARG A CA   6  
ATOM 7916  C C    . ARG A 1 81 ? 4.382   -17.158 15.085  1.00 0.00 ? 81 ARG A C    6  
ATOM 7917  O O    . ARG A 1 81 ? 4.039   -18.340 14.868  1.00 0.00 ? 81 ARG A O    6  
ATOM 7918  C CB   . ARG A 1 81 ? 4.467   -15.800 12.973  1.00 0.00 ? 81 ARG A CB   6  
ATOM 7919  C CG   . ARG A 1 81 ? 3.579   -15.044 11.980  1.00 0.00 ? 81 ARG A CG   6  
ATOM 7920  C CD   . ARG A 1 81 ? 4.397   -14.669 10.741  1.00 0.00 ? 81 ARG A CD   6  
ATOM 7921  N NE   . ARG A 1 81 ? 5.065   -13.369 10.918  1.00 0.00 ? 81 ARG A NE   6  
ATOM 7922  C CZ   . ARG A 1 81 ? 4.538   -12.202 10.496  1.00 0.00 ? 81 ARG A CZ   6  
ATOM 7923  N NH1  . ARG A 1 81 ? 3.274   -12.150 10.058  1.00 0.00 ? 81 ARG A NH1  6  
ATOM 7924  N NH2  . ARG A 1 81 ? 5.283   -11.091 10.512  1.00 0.00 ? 81 ARG A NH2  6  
ATOM 7925  O OXT  . ARG A 1 81 ? 5.353   -16.795 15.785  1.00 0.00 ? 81 ARG A OXT  6  
ATOM 7926  H H    . ARG A 1 81 ? 4.471   -14.439 15.356  1.00 0.00 ? 81 ARG A H    6  
ATOM 7927  H HA   . ARG A 1 81 ? 2.683   -16.419 14.005  1.00 0.00 ? 81 ARG A HA   6  
ATOM 7928  H HB2  . ARG A 1 81 ? 5.349   -15.202 13.203  1.00 0.00 ? 81 ARG A HB2  6  
ATOM 7929  H HB3  . ARG A 1 81 ? 4.779   -16.746 12.529  1.00 0.00 ? 81 ARG A HB3  6  
ATOM 7930  H HG2  . ARG A 1 81 ? 2.746   -15.683 11.683  1.00 0.00 ? 81 ARG A HG2  6  
ATOM 7931  H HG3  . ARG A 1 81 ? 3.191   -14.140 12.449  1.00 0.00 ? 81 ARG A HG3  6  
ATOM 7932  H HD2  . ARG A 1 81 ? 5.153   -15.435 10.565  1.00 0.00 ? 81 ARG A HD2  6  
ATOM 7933  H HD3  . ARG A 1 81 ? 3.737   -14.622 9.875   1.00 0.00 ? 81 ARG A HD3  6  
ATOM 7934  H HE   . ARG A 1 81 ? 5.964   -13.366 11.376  1.00 0.00 ? 81 ARG A HE   6  
ATOM 7935  H HH11 . ARG A 1 81 ? 2.667   -12.948 10.169  1.00 0.00 ? 81 ARG A HH11 6  
ATOM 7936  H HH12 . ARG A 1 81 ? 2.923   -11.304 9.615   1.00 0.00 ? 81 ARG A HH12 6  
ATOM 7937  H HH21 . ARG A 1 81 ? 6.221   -11.116 10.883  1.00 0.00 ? 81 ARG A HH21 6  
ATOM 7938  H HH22 . ARG A 1 81 ? 4.904   -10.218 10.148  1.00 0.00 ? 81 ARG A HH22 6  
ATOM 7939  N N    . ALA A 1 1  ? 16.930  26.922  -7.284  1.00 0.00 ? 1  ALA A N    7  
ATOM 7940  C CA   . ALA A 1 1  ? 16.088  27.968  -6.677  1.00 0.00 ? 1  ALA A CA   7  
ATOM 7941  C C    . ALA A 1 1  ? 14.654  27.465  -6.527  1.00 0.00 ? 1  ALA A C    7  
ATOM 7942  O O    . ALA A 1 1  ? 14.293  26.450  -7.119  1.00 0.00 ? 1  ALA A O    7  
ATOM 7943  C CB   . ALA A 1 1  ? 16.121  29.240  -7.525  1.00 0.00 ? 1  ALA A CB   7  
ATOM 7944  H H1   . ALA A 1 1  ? 17.873  27.264  -7.386  1.00 0.00 ? 1  ALA A H1   7  
ATOM 7945  H H2   . ALA A 1 1  ? 16.559  26.679  -8.192  1.00 0.00 ? 1  ALA A H2   7  
ATOM 7946  H H3   . ALA A 1 1  ? 16.929  26.104  -6.691  1.00 0.00 ? 1  ALA A H3   7  
ATOM 7947  H HA   . ALA A 1 1  ? 16.482  28.199  -5.685  1.00 0.00 ? 1  ALA A HA   7  
ATOM 7948  H HB1  . ALA A 1 1  ? 15.525  30.015  -7.044  1.00 0.00 ? 1  ALA A HB1  7  
ATOM 7949  H HB2  . ALA A 1 1  ? 15.711  29.029  -8.514  1.00 0.00 ? 1  ALA A HB2  7  
ATOM 7950  H HB3  . ALA A 1 1  ? 17.151  29.585  -7.625  1.00 0.00 ? 1  ALA A HB3  7  
ATOM 7951  N N    . LEU A 1 2  ? 13.845  28.181  -5.734  1.00 0.00 ? 2  LEU A N    7  
ATOM 7952  C CA   . LEU A 1 2  ? 12.454  27.811  -5.499  1.00 0.00 ? 2  LEU A CA   7  
ATOM 7953  C C    . LEU A 1 2  ? 12.394  26.430  -4.830  1.00 0.00 ? 2  LEU A C    7  
ATOM 7954  O O    . LEU A 1 2  ? 13.352  26.018  -4.175  1.00 0.00 ? 2  LEU A O    7  
ATOM 7955  C CB   . LEU A 1 2  ? 11.687  27.832  -6.836  1.00 0.00 ? 2  LEU A CB   7  
ATOM 7956  C CG   . LEU A 1 2  ? 10.245  28.312  -6.611  1.00 0.00 ? 2  LEU A CG   7  
ATOM 7957  C CD1  . LEU A 1 2  ? 10.207  29.844  -6.596  1.00 0.00 ? 2  LEU A CD1  7  
ATOM 7958  C CD2  . LEU A 1 2  ? 9.352   27.794  -7.740  1.00 0.00 ? 2  LEU A CD2  7  
ATOM 7959  H H    . LEU A 1 2  ? 14.201  29.007  -5.277  1.00 0.00 ? 2  LEU A H    7  
ATOM 7960  H HA   . LEU A 1 2  ? 12.011  28.544  -4.826  1.00 0.00 ? 2  LEU A HA   7  
ATOM 7961  H HB2  . LEU A 1 2  ? 12.185  28.510  -7.529  1.00 0.00 ? 2  LEU A HB2  7  
ATOM 7962  H HB3  . LEU A 1 2  ? 11.674  26.828  -7.265  1.00 0.00 ? 2  LEU A HB3  7  
ATOM 7963  H HG   . LEU A 1 2  ? 9.876   27.933  -5.658  1.00 0.00 ? 2  LEU A HG   7  
ATOM 7964  H HD11 . LEU A 1 2  ? 10.547  30.227  -7.558  1.00 0.00 ? 2  LEU A HD11 7  
ATOM 7965  H HD12 . LEU A 1 2  ? 9.185   30.179  -6.413  1.00 0.00 ? 2  LEU A HD12 7  
ATOM 7966  H HD13 . LEU A 1 2  ? 10.857  30.218  -5.806  1.00 0.00 ? 2  LEU A HD13 7  
ATOM 7967  H HD21 . LEU A 1 2  ? 9.344   26.703  -7.727  1.00 0.00 ? 2  LEU A HD21 7  
ATOM 7968  H HD22 . LEU A 1 2  ? 9.736   28.143  -8.699  1.00 0.00 ? 2  LEU A HD22 7  
ATOM 7969  H HD23 . LEU A 1 2  ? 8.336   28.164  -7.598  1.00 0.00 ? 2  LEU A HD23 7  
ATOM 7970  N N    . SER A 1 3  ? 11.269  25.720  -4.992  1.00 0.00 ? 3  SER A N    7  
ATOM 7971  C CA   . SER A 1 3  ? 11.093  24.399  -4.409  1.00 0.00 ? 3  SER A CA   7  
ATOM 7972  C C    . SER A 1 3  ? 9.938   23.686  -5.113  1.00 0.00 ? 3  SER A C    7  
ATOM 7973  O O    . SER A 1 3  ? 9.369   24.213  -6.068  1.00 0.00 ? 3  SER A O    7  
ATOM 7974  C CB   . SER A 1 3  ? 10.816  24.537  -2.905  1.00 0.00 ? 3  SER A CB   7  
ATOM 7975  O OG   . SER A 1 3  ? 10.837  23.261  -2.297  1.00 0.00 ? 3  SER A OG   7  
ATOM 7976  H H    . SER A 1 3  ? 10.512  26.101  -5.539  1.00 0.00 ? 3  SER A H    7  
ATOM 7977  H HA   . SER A 1 3  ? 12.007  23.822  -4.552  1.00 0.00 ? 3  SER A HA   7  
ATOM 7978  H HB2  . SER A 1 3  ? 11.583  25.164  -2.450  1.00 0.00 ? 3  SER A HB2  7  
ATOM 7979  H HB3  . SER A 1 3  ? 9.838   24.995  -2.755  1.00 0.00 ? 3  SER A HB3  7  
ATOM 7980  H HG   . SER A 1 3  ? 10.654  23.365  -1.360  1.00 0.00 ? 3  SER A HG   7  
ATOM 7981  N N    . GLY A 1 4  ? 9.599   22.487  -4.635  1.00 0.00 ? 4  GLY A N    7  
ATOM 7982  C CA   . GLY A 1 4  ? 8.525   21.696  -5.205  1.00 0.00 ? 4  GLY A CA   7  
ATOM 7983  C C    . GLY A 1 4  ? 8.181   20.549  -4.264  1.00 0.00 ? 4  GLY A C    7  
ATOM 7984  O O    . GLY A 1 4  ? 8.374   19.382  -4.606  1.00 0.00 ? 4  GLY A O    7  
ATOM 7985  H H    . GLY A 1 4  ? 10.105  22.109  -3.844  1.00 0.00 ? 4  GLY A H    7  
ATOM 7986  H HA2  . GLY A 1 4  ? 7.644   22.324  -5.346  1.00 0.00 ? 4  GLY A HA2  7  
ATOM 7987  H HA3  . GLY A 1 4  ? 8.841   21.294  -6.168  1.00 0.00 ? 4  GLY A HA3  7  
ATOM 7988  N N    . SER A 1 5  ? 7.675   20.886  -3.071  1.00 0.00 ? 5  SER A N    7  
ATOM 7989  C CA   . SER A 1 5  ? 7.318   19.897  -2.066  1.00 0.00 ? 5  SER A CA   7  
ATOM 7990  C C    . SER A 1 5  ? 5.987   19.231  -2.428  1.00 0.00 ? 5  SER A C    7  
ATOM 7991  O O    . SER A 1 5  ? 4.993   19.404  -1.726  1.00 0.00 ? 5  SER A O    7  
ATOM 7992  C CB   . SER A 1 5  ? 7.231   20.584  -0.701  1.00 0.00 ? 5  SER A CB   7  
ATOM 7993  O OG   . SER A 1 5  ? 8.445   21.255  -0.432  1.00 0.00 ? 5  SER A OG   7  
ATOM 7994  H H    . SER A 1 5  ? 7.537   21.861  -2.849  1.00 0.00 ? 5  SER A H    7  
ATOM 7995  H HA   . SER A 1 5  ? 8.096   19.133  -2.027  1.00 0.00 ? 5  SER A HA   7  
ATOM 7996  H HB2  . SER A 1 5  ? 6.413   21.306  -0.707  1.00 0.00 ? 5  SER A HB2  7  
ATOM 7997  H HB3  . SER A 1 5  ? 7.049   19.836  0.072   1.00 0.00 ? 5  SER A HB3  7  
ATOM 7998  H HG   . SER A 1 5  ? 9.157   20.612  -0.441  1.00 0.00 ? 5  SER A HG   7  
ATOM 7999  N N    . SER A 1 6  ? 5.978   18.462  -3.524  1.00 0.00 ? 6  SER A N    7  
ATOM 8000  C CA   . SER A 1 6  ? 4.782   17.758  -3.967  1.00 0.00 ? 6  SER A CA   7  
ATOM 8001  C C    . SER A 1 6  ? 4.471   16.604  -3.012  1.00 0.00 ? 6  SER A C    7  
ATOM 8002  O O    . SER A 1 6  ? 3.317   16.205  -2.880  1.00 0.00 ? 6  SER A O    7  
ATOM 8003  C CB   . SER A 1 6  ? 5.001   17.236  -5.390  1.00 0.00 ? 6  SER A CB   7  
ATOM 8004  O OG   . SER A 1 6  ? 3.798   16.687  -5.884  1.00 0.00 ? 6  SER A OG   7  
ATOM 8005  H H    . SER A 1 6  ? 6.825   18.360  -4.068  1.00 0.00 ? 6  SER A H    7  
ATOM 8006  H HA   . SER A 1 6  ? 3.942   18.454  -3.972  1.00 0.00 ? 6  SER A HA   7  
ATOM 8007  H HB2  . SER A 1 6  ? 5.316   18.058  -6.034  1.00 0.00 ? 6  SER A HB2  7  
ATOM 8008  H HB3  . SER A 1 6  ? 5.774   16.467  -5.381  1.00 0.00 ? 6  SER A HB3  7  
ATOM 8009  H HG   . SER A 1 6  ? 3.418   16.119  -5.208  1.00 0.00 ? 6  SER A HG   7  
ATOM 8010  N N    . GLY A 1 7  ? 5.506   16.071  -2.349  1.00 0.00 ? 7  GLY A N    7  
ATOM 8011  C CA   . GLY A 1 7  ? 5.342   14.975  -1.409  1.00 0.00 ? 7  GLY A CA   7  
ATOM 8012  C C    . GLY A 1 7  ? 5.028   13.674  -2.144  1.00 0.00 ? 7  GLY A C    7  
ATOM 8013  O O    . GLY A 1 7  ? 4.255   12.851  -1.649  1.00 0.00 ? 7  GLY A O    7  
ATOM 8014  H H    . GLY A 1 7  ? 6.433   16.435  -2.498  1.00 0.00 ? 7  GLY A H    7  
ATOM 8015  H HA2  . GLY A 1 7  ? 6.264   14.850  -0.840  1.00 0.00 ? 7  GLY A HA2  7  
ATOM 8016  H HA3  . GLY A 1 7  ? 4.527   15.206  -0.722  1.00 0.00 ? 7  GLY A HA3  7  
ATOM 8017  N N    . TYR A 1 8  ? 5.632   13.481  -3.328  1.00 0.00 ? 8  TYR A N    7  
ATOM 8018  C CA   . TYR A 1 8  ? 5.422   12.269  -4.105  1.00 0.00 ? 8  TYR A CA   7  
ATOM 8019  C C    . TYR A 1 8  ? 5.966   11.071  -3.322  1.00 0.00 ? 8  TYR A C    7  
ATOM 8020  O O    . TYR A 1 8  ? 6.717   11.253  -2.367  1.00 0.00 ? 8  TYR A O    7  
ATOM 8021  C CB   . TYR A 1 8  ? 6.067   12.412  -5.495  1.00 0.00 ? 8  TYR A CB   7  
ATOM 8022  C CG   . TYR A 1 8  ? 7.531   12.018  -5.567  1.00 0.00 ? 8  TYR A CG   7  
ATOM 8023  C CD1  . TYR A 1 8  ? 8.483   12.648  -4.743  1.00 0.00 ? 8  TYR A CD1  7  
ATOM 8024  C CD2  . TYR A 1 8  ? 7.942   11.026  -6.480  1.00 0.00 ? 8  TYR A CD2  7  
ATOM 8025  C CE1  . TYR A 1 8  ? 9.839   12.282  -4.830  1.00 0.00 ? 8  TYR A CE1  7  
ATOM 8026  C CE2  . TYR A 1 8  ? 9.295   10.663  -6.565  1.00 0.00 ? 8  TYR A CE2  7  
ATOM 8027  C CZ   . TYR A 1 8  ? 10.244  11.291  -5.742  1.00 0.00 ? 8  TYR A CZ   7  
ATOM 8028  O OH   . TYR A 1 8  ? 11.560  10.935  -5.827  1.00 0.00 ? 8  TYR A OH   7  
ATOM 8029  H H    . TYR A 1 8  ? 6.252   14.186  -3.696  1.00 0.00 ? 8  TYR A H    7  
ATOM 8030  H HA   . TYR A 1 8  ? 4.346   12.133  -4.240  1.00 0.00 ? 8  TYR A HA   7  
ATOM 8031  H HB2  . TYR A 1 8  ? 5.510   11.787  -6.194  1.00 0.00 ? 8  TYR A HB2  7  
ATOM 8032  H HB3  . TYR A 1 8  ? 5.973   13.450  -5.816  1.00 0.00 ? 8  TYR A HB3  7  
ATOM 8033  H HD1  . TYR A 1 8  ? 8.177   13.412  -4.047  1.00 0.00 ? 8  TYR A HD1  7  
ATOM 8034  H HD2  . TYR A 1 8  ? 7.215   10.544  -7.117  1.00 0.00 ? 8  TYR A HD2  7  
ATOM 8035  H HE1  . TYR A 1 8  ? 10.569  12.765  -4.199  1.00 0.00 ? 8  TYR A HE1  7  
ATOM 8036  H HE2  . TYR A 1 8  ? 9.606   9.902   -7.264  1.00 0.00 ? 8  TYR A HE2  7  
ATOM 8037  H HH   . TYR A 1 8  ? 12.131  11.482  -5.279  1.00 0.00 ? 8  TYR A HH   7  
ATOM 8038  N N    . LYS A 1 9  ? 5.558   9.853   -3.721  1.00 0.00 ? 9  LYS A N    7  
ATOM 8039  C CA   . LYS A 1 9  ? 5.899   8.606   -3.019  1.00 0.00 ? 9  LYS A CA   7  
ATOM 8040  C C    . LYS A 1 9  ? 5.068   8.501   -1.769  1.00 0.00 ? 9  LYS A C    7  
ATOM 8041  O O    . LYS A 1 9  ? 4.257   7.592   -1.623  1.00 0.00 ? 9  LYS A O    7  
ATOM 8042  C CB   . LYS A 1 9  ? 7.385   8.515   -2.606  1.00 0.00 ? 9  LYS A CB   7  
ATOM 8043  C CG   . LYS A 1 9  ? 8.288   8.829   -3.768  1.00 0.00 ? 9  LYS A CG   7  
ATOM 8044  C CD   . LYS A 1 9  ? 9.763   8.815   -3.320  1.00 0.00 ? 9  LYS A CD   7  
ATOM 8045  C CE   . LYS A 1 9  ? 10.115  7.464   -2.680  1.00 0.00 ? 9  LYS A CE   7  
ATOM 8046  N NZ   . LYS A 1 9  ? 11.566  7.337   -2.447  1.00 0.00 ? 9  LYS A NZ   7  
ATOM 8047  H H    . LYS A 1 9  ? 4.968   9.779   -4.540  1.00 0.00 ? 9  LYS A H    7  
ATOM 8048  H HA   . LYS A 1 9  ? 5.661   7.765   -3.670  1.00 0.00 ? 9  LYS A HA   7  
ATOM 8049  H HB2  . LYS A 1 9  ? 7.591   9.207   -1.793  1.00 0.00 ? 9  LYS A HB2  7  
ATOM 8050  H HB3  . LYS A 1 9  ? 7.587   7.505   -2.266  1.00 0.00 ? 9  LYS A HB3  7  
ATOM 8051  H HG2  . LYS A 1 9  ? 8.129   8.092   -4.545  1.00 0.00 ? 9  LYS A HG2  7  
ATOM 8052  H HG3  . LYS A 1 9  ? 8.039   9.810   -4.139  1.00 0.00 ? 9  LYS A HG3  7  
ATOM 8053  H HD2  . LYS A 1 9  ? 10.402  8.980   -4.187  1.00 0.00 ? 9  LYS A HD2  7  
ATOM 8054  H HD3  . LYS A 1 9  ? 9.928   9.612   -2.594  1.00 0.00 ? 9  LYS A HD3  7  
ATOM 8055  H HE2  . LYS A 1 9  ? 9.600   7.375   -1.724  1.00 0.00 ? 9  LYS A HE2  7  
ATOM 8056  H HE3  . LYS A 1 9  ? 9.788   6.662   -3.340  1.00 0.00 ? 9  LYS A HE3  7  
ATOM 8057  H HZ1  . LYS A 1 9  ? 11.760  6.449   -2.003  1.00 0.00 ? 9  LYS A HZ1  7  
ATOM 8058  H HZ2  . LYS A 1 9  ? 12.055  7.384   -3.330  1.00 0.00 ? 9  LYS A HZ2  7  
ATOM 8059  H HZ3  . LYS A 1 9  ? 11.880  8.087   -1.848  1.00 0.00 ? 9  LYS A HZ3  7  
ATOM 8060  N N    . PHE A 1 10 ? 5.305   9.430   -0.854  1.00 0.00 ? 10 PHE A N    7  
ATOM 8061  C CA   . PHE A 1 10 ? 4.690   9.403   0.432   1.00 0.00 ? 10 PHE A CA   7  
ATOM 8062  C C    . PHE A 1 10 ? 3.174   9.545   0.318   1.00 0.00 ? 10 PHE A C    7  
ATOM 8063  O O    . PHE A 1 10 ? 2.437   8.796   0.952   1.00 0.00 ? 10 PHE A O    7  
ATOM 8064  C CB   . PHE A 1 10 ? 5.293   10.510  1.300   1.00 0.00 ? 10 PHE A CB   7  
ATOM 8065  C CG   . PHE A 1 10 ? 6.806   10.564  1.214   1.00 0.00 ? 10 PHE A CG   7  
ATOM 8066  C CD1  . PHE A 1 10 ? 7.574   9.487   1.692   1.00 0.00 ? 10 PHE A CD1  7  
ATOM 8067  C CD2  . PHE A 1 10 ? 7.442   11.677  0.636   1.00 0.00 ? 10 PHE A CD2  7  
ATOM 8068  C CE1  . PHE A 1 10 ? 8.975   9.524   1.592   1.00 0.00 ? 10 PHE A CE1  7  
ATOM 8069  C CE2  . PHE A 1 10 ? 8.843   11.713  0.537   1.00 0.00 ? 10 PHE A CE2  7  
ATOM 8070  C CZ   . PHE A 1 10 ? 9.609   10.637  1.015   1.00 0.00 ? 10 PHE A CZ   7  
ATOM 8071  H H    . PHE A 1 10 ? 5.960   10.174  -1.054  1.00 0.00 ? 10 PHE A H    7  
ATOM 8072  H HA   . PHE A 1 10 ? 4.932   8.444   0.868   1.00 0.00 ? 10 PHE A HA   7  
ATOM 8073  H HB2  . PHE A 1 10 ? 4.887   11.470  0.977   1.00 0.00 ? 10 PHE A HB2  7  
ATOM 8074  H HB3  . PHE A 1 10 ? 5.005   10.340  2.338   1.00 0.00 ? 10 PHE A HB3  7  
ATOM 8075  H HD1  . PHE A 1 10 ? 7.087   8.628   2.132   1.00 0.00 ? 10 PHE A HD1  7  
ATOM 8076  H HD2  . PHE A 1 10 ? 6.853   12.503  0.262   1.00 0.00 ? 10 PHE A HD2  7  
ATOM 8077  H HE1  . PHE A 1 10 ? 9.563   8.695   1.957   1.00 0.00 ? 10 PHE A HE1  7  
ATOM 8078  H HE2  . PHE A 1 10 ? 9.330   12.566  0.090   1.00 0.00 ? 10 PHE A HE2  7  
ATOM 8079  H HZ   . PHE A 1 10 ? 10.685  10.665  0.939   1.00 0.00 ? 10 PHE A HZ   7  
ATOM 8080  N N    . GLY A 1 11 ? 2.709   10.506  -0.490  1.00 0.00 ? 11 GLY A N    7  
ATOM 8081  C CA   . GLY A 1 11 ? 1.283   10.730  -0.684  1.00 0.00 ? 11 GLY A CA   7  
ATOM 8082  C C    . GLY A 1 11 ? 0.617   9.466   -1.228  1.00 0.00 ? 11 GLY A C    7  
ATOM 8083  O O    . GLY A 1 11 ? -0.403  9.020   -0.700  1.00 0.00 ? 11 GLY A O    7  
ATOM 8084  H H    . GLY A 1 11 ? 3.361   11.103  -0.988  1.00 0.00 ? 11 GLY A H    7  
ATOM 8085  H HA2  . GLY A 1 11 ? 0.828   10.998  0.270   1.00 0.00 ? 11 GLY A HA2  7  
ATOM 8086  H HA3  . GLY A 1 11 ? 1.140   11.545  -1.393  1.00 0.00 ? 11 GLY A HA3  7  
ATOM 8087  N N    . VAL A 1 12 ? 1.201   8.890   -2.284  1.00 0.00 ? 12 VAL A N    7  
ATOM 8088  C CA   . VAL A 1 12 ? 0.675   7.683   -2.903  1.00 0.00 ? 12 VAL A CA   7  
ATOM 8089  C C    . VAL A 1 12 ? 0.639   6.546   -1.876  1.00 0.00 ? 12 VAL A C    7  
ATOM 8090  O O    . VAL A 1 12 ? -0.372  5.858   -1.747  1.00 0.00 ? 12 VAL A O    7  
ATOM 8091  C CB   . VAL A 1 12 ? 1.549   7.321   -4.118  1.00 0.00 ? 12 VAL A CB   7  
ATOM 8092  C CG1  . VAL A 1 12 ? 1.336   5.856   -4.505  1.00 0.00 ? 12 VAL A CG1  7  
ATOM 8093  C CG2  . VAL A 1 12 ? 1.167   8.215   -5.303  1.00 0.00 ? 12 VAL A CG2  7  
ATOM 8094  H H    . VAL A 1 12 ? 2.037   9.300   -2.675  1.00 0.00 ? 12 VAL A H    7  
ATOM 8095  H HA   . VAL A 1 12 ? -0.343  7.876   -3.245  1.00 0.00 ? 12 VAL A HA   7  
ATOM 8096  H HB   . VAL A 1 12 ? 2.604   7.479   -3.871  1.00 0.00 ? 12 VAL A HB   7  
ATOM 8097  H HG11 . VAL A 1 12 ? 1.741   5.681   -5.500  1.00 0.00 ? 12 VAL A HG11 7  
ATOM 8098  H HG12 . VAL A 1 12 ? 1.846   5.211   -3.791  1.00 0.00 ? 12 VAL A HG12 7  
ATOM 8099  H HG13 . VAL A 1 12 ? 0.273   5.631   -4.503  1.00 0.00 ? 12 VAL A HG13 7  
ATOM 8100  H HG21 . VAL A 1 12 ? 1.820   7.998   -6.149  1.00 0.00 ? 12 VAL A HG21 7  
ATOM 8101  H HG22 . VAL A 1 12 ? 1.277   9.263   -5.021  1.00 0.00 ? 12 VAL A HG22 7  
ATOM 8102  H HG23 . VAL A 1 12 ? 0.130   8.023   -5.588  1.00 0.00 ? 12 VAL A HG23 7  
ATOM 8103  N N    . LEU A 1 13 ? 1.743   6.352   -1.149  1.00 0.00 ? 13 LEU A N    7  
ATOM 8104  C CA   . LEU A 1 13 ? 1.840   5.299   -0.149  1.00 0.00 ? 13 LEU A CA   7  
ATOM 8105  C C    . LEU A 1 13 ? 0.764   5.483   0.920   1.00 0.00 ? 13 LEU A C    7  
ATOM 8106  O O    . LEU A 1 13 ? 0.108   4.523   1.302   1.00 0.00 ? 13 LEU A O    7  
ATOM 8107  C CB   . LEU A 1 13 ? 3.244   5.328   0.469   1.00 0.00 ? 13 LEU A CB   7  
ATOM 8108  C CG   . LEU A 1 13 ? 3.376   4.280   1.586   1.00 0.00 ? 13 LEU A CG   7  
ATOM 8109  C CD1  . LEU A 1 13 ? 3.209   2.868   1.012   1.00 0.00 ? 13 LEU A CD1  7  
ATOM 8110  C CD2  . LEU A 1 13 ? 4.758   4.404   2.231   1.00 0.00 ? 13 LEU A CD2  7  
ATOM 8111  H H    . LEU A 1 13 ? 2.547   6.950   -1.292  1.00 0.00 ? 13 LEU A H    7  
ATOM 8112  H HA   . LEU A 1 13 ? 1.691   4.338   -0.639  1.00 0.00 ? 13 LEU A HA   7  
ATOM 8113  H HB2  . LEU A 1 13 ? 3.979   5.119   -0.307  1.00 0.00 ? 13 LEU A HB2  7  
ATOM 8114  H HB3  . LEU A 1 13 ? 3.434   6.319   0.884   1.00 0.00 ? 13 LEU A HB3  7  
ATOM 8115  H HG   . LEU A 1 13 ? 2.612   4.453   2.346   1.00 0.00 ? 13 LEU A HG   7  
ATOM 8116  H HD11 . LEU A 1 13 ? 2.172   2.709   0.724   1.00 0.00 ? 13 LEU A HD11 7  
ATOM 8117  H HD12 . LEU A 1 13 ? 3.490   2.134   1.766   1.00 0.00 ? 13 LEU A HD12 7  
ATOM 8118  H HD13 . LEU A 1 13 ? 3.851   2.752   0.138   1.00 0.00 ? 13 LEU A HD13 7  
ATOM 8119  H HD21 . LEU A 1 13 ? 4.885   5.411   2.629   1.00 0.00 ? 13 LEU A HD21 7  
ATOM 8120  H HD22 . LEU A 1 13 ? 4.850   3.682   3.041   1.00 0.00 ? 13 LEU A HD22 7  
ATOM 8121  H HD23 . LEU A 1 13 ? 5.527   4.210   1.484   1.00 0.00 ? 13 LEU A HD23 7  
ATOM 8122  N N    . ALA A 1 14 ? 0.584   6.717   1.403   1.00 0.00 ? 14 ALA A N    7  
ATOM 8123  C CA   . ALA A 1 14 ? -0.403  7.009   2.433   1.00 0.00 ? 14 ALA A CA   7  
ATOM 8124  C C    . ALA A 1 14 ? -1.807  6.652   1.941   1.00 0.00 ? 14 ALA A C    7  
ATOM 8125  O O    . ALA A 1 14 ? -2.593  6.071   2.687   1.00 0.00 ? 14 ALA A O    7  
ATOM 8126  C CB   . ALA A 1 14 ? -0.322  8.491   2.804   1.00 0.00 ? 14 ALA A CB   7  
ATOM 8127  H H    . ALA A 1 14 ? 1.150   7.478   1.051   1.00 0.00 ? 14 ALA A H    7  
ATOM 8128  H HA   . ALA A 1 14 ? -0.177  6.412   3.319   1.00 0.00 ? 14 ALA A HA   7  
ATOM 8129  H HB1  . ALA A 1 14 ? 0.679   8.721   3.169   1.00 0.00 ? 14 ALA A HB1  7  
ATOM 8130  H HB2  . ALA A 1 14 ? -0.537  9.100   1.926   1.00 0.00 ? 14 ALA A HB2  7  
ATOM 8131  H HB3  . ALA A 1 14 ? -1.051  8.711   3.584   1.00 0.00 ? 14 ALA A HB3  7  
ATOM 8132  N N    . LYS A 1 15 ? -2.122  6.997   0.686   1.00 0.00 ? 15 LYS A N    7  
ATOM 8133  C CA   . LYS A 1 15 ? -3.425  6.709   0.117   1.00 0.00 ? 15 LYS A CA   7  
ATOM 8134  C C    . LYS A 1 15 ? -3.614  5.196   0.015   1.00 0.00 ? 15 LYS A C    7  
ATOM 8135  O O    . LYS A 1 15 ? -4.676  4.683   0.356   1.00 0.00 ? 15 LYS A O    7  
ATOM 8136  C CB   . LYS A 1 15 ? -3.538  7.381   -1.255  1.00 0.00 ? 15 LYS A CB   7  
ATOM 8137  C CG   . LYS A 1 15 ? -4.891  7.048   -1.890  1.00 0.00 ? 15 LYS A CG   7  
ATOM 8138  C CD   . LYS A 1 15 ? -5.207  8.071   -2.985  1.00 0.00 ? 15 LYS A CD   7  
ATOM 8139  C CE   . LYS A 1 15 ? -6.219  7.485   -3.974  1.00 0.00 ? 15 LYS A CE   7  
ATOM 8140  N NZ   . LYS A 1 15 ? -7.483  7.131   -3.304  1.00 0.00 ? 15 LYS A NZ   7  
ATOM 8141  H H    . LYS A 1 15 ? -1.442  7.470   0.106   1.00 0.00 ? 15 LYS A H    7  
ATOM 8142  H HA   . LYS A 1 15 ? -4.195  7.116   0.774   1.00 0.00 ? 15 LYS A HA   7  
ATOM 8143  H HB2  . LYS A 1 15 ? -3.452  8.462   -1.132  1.00 0.00 ? 15 LYS A HB2  7  
ATOM 8144  H HB3  . LYS A 1 15 ? -2.737  7.026   -1.903  1.00 0.00 ? 15 LYS A HB3  7  
ATOM 8145  H HG2  . LYS A 1 15 ? -4.848  6.049   -2.326  1.00 0.00 ? 15 LYS A HG2  7  
ATOM 8146  H HG3  . LYS A 1 15 ? -5.670  7.079   -1.128  1.00 0.00 ? 15 LYS A HG3  7  
ATOM 8147  H HD2  . LYS A 1 15 ? -5.621  8.974   -2.531  1.00 0.00 ? 15 LYS A HD2  7  
ATOM 8148  H HD3  . LYS A 1 15 ? -4.291  8.326   -3.517  1.00 0.00 ? 15 LYS A HD3  7  
ATOM 8149  H HE2  . LYS A 1 15 ? -6.423  8.221   -4.754  1.00 0.00 ? 15 LYS A HE2  7  
ATOM 8150  H HE3  . LYS A 1 15 ? -5.795  6.592   -4.432  1.00 0.00 ? 15 LYS A HE3  7  
ATOM 8151  H HZ1  . LYS A 1 15 ? -7.881  7.955   -2.876  1.00 0.00 ? 15 LYS A HZ1  7  
ATOM 8152  H HZ2  . LYS A 1 15 ? -7.306  6.435   -2.596  1.00 0.00 ? 15 LYS A HZ2  7  
ATOM 8153  H HZ3  . LYS A 1 15 ? -8.132  6.759   -3.985  1.00 0.00 ? 15 LYS A HZ3  7  
ATOM 8154  N N    . ILE A 1 16 ? -2.577  4.488   -0.450  1.00 0.00 ? 16 ILE A N    7  
ATOM 8155  C CA   . ILE A 1 16 ? -2.621  3.039   -0.578  1.00 0.00 ? 16 ILE A CA   7  
ATOM 8156  C C    . ILE A 1 16 ? -2.847  2.405   0.796   1.00 0.00 ? 16 ILE A C    7  
ATOM 8157  O O    . ILE A 1 16 ? -3.690  1.523   0.942   1.00 0.00 ? 16 ILE A O    7  
ATOM 8158  C CB   . ILE A 1 16 ? -1.308  2.546   -1.211  1.00 0.00 ? 16 ILE A CB   7  
ATOM 8159  C CG1  . ILE A 1 16 ? -1.309  2.877   -2.714  1.00 0.00 ? 16 ILE A CG1  7  
ATOM 8160  C CG2  . ILE A 1 16 ? -1.176  1.029   -1.011  1.00 0.00 ? 16 ILE A CG2  7  
ATOM 8161  C CD1  . ILE A 1 16 ? 0.114   2.785   -3.275  1.00 0.00 ? 16 ILE A CD1  7  
ATOM 8162  H H    . ILE A 1 16 ? -1.726  4.967   -0.721  1.00 0.00 ? 16 ILE A H    7  
ATOM 8163  H HA   . ILE A 1 16 ? -3.449  2.769   -1.227  1.00 0.00 ? 16 ILE A HA   7  
ATOM 8164  H HB   . ILE A 1 16 ? -0.467  3.044   -0.731  1.00 0.00 ? 16 ILE A HB   7  
ATOM 8165  H HG12 . ILE A 1 16 ? -1.949  2.172   -3.242  1.00 0.00 ? 16 ILE A HG12 7  
ATOM 8166  H HG13 . ILE A 1 16 ? -1.689  3.890   -2.863  1.00 0.00 ? 16 ILE A HG13 7  
ATOM 8167  H HG21 . ILE A 1 16 ? -0.980  0.814   0.039   1.00 0.00 ? 16 ILE A HG21 7  
ATOM 8168  H HG22 . ILE A 1 16 ? -2.101  0.540   -1.314  1.00 0.00 ? 16 ILE A HG22 7  
ATOM 8169  H HG23 . ILE A 1 16 ? -0.352  0.650   -1.612  1.00 0.00 ? 16 ILE A HG23 7  
ATOM 8170  H HD11 . ILE A 1 16 ? 0.784   3.399   -2.674  1.00 0.00 ? 16 ILE A HD11 7  
ATOM 8171  H HD12 . ILE A 1 16 ? 0.452   1.751   -3.254  1.00 0.00 ? 16 ILE A HD12 7  
ATOM 8172  H HD13 . ILE A 1 16 ? 0.121   3.145   -4.303  1.00 0.00 ? 16 ILE A HD13 7  
ATOM 8173  N N    . VAL A 1 17 ? -2.090  2.861   1.797   1.00 0.00 ? 17 VAL A N    7  
ATOM 8174  C CA   . VAL A 1 17 ? -2.196  2.351   3.154   1.00 0.00 ? 17 VAL A CA   7  
ATOM 8175  C C    . VAL A 1 17 ? -3.613  2.557   3.681   1.00 0.00 ? 17 VAL A C    7  
ATOM 8176  O O    . VAL A 1 17 ? -4.206  1.633   4.227   1.00 0.00 ? 17 VAL A O    7  
ATOM 8177  C CB   . VAL A 1 17 ? -1.158  3.065   4.038   1.00 0.00 ? 17 VAL A CB   7  
ATOM 8178  C CG1  . VAL A 1 17 ? -1.517  2.909   5.519   1.00 0.00 ? 17 VAL A CG1  7  
ATOM 8179  C CG2  . VAL A 1 17 ? 0.225   2.455   3.792   1.00 0.00 ? 17 VAL A CG2  7  
ATOM 8180  H H    . VAL A 1 17 ? -1.415  3.590   1.615   1.00 0.00 ? 17 VAL A H    7  
ATOM 8181  H HA   . VAL A 1 17 ? -1.978  1.284   3.148   1.00 0.00 ? 17 VAL A HA   7  
ATOM 8182  H HB   . VAL A 1 17 ? -1.134  4.125   3.786   1.00 0.00 ? 17 VAL A HB   7  
ATOM 8183  H HG11 . VAL A 1 17 ? -1.723  1.861   5.738   1.00 0.00 ? 17 VAL A HG11 7  
ATOM 8184  H HG12 . VAL A 1 17 ? -2.397  3.509   5.747   1.00 0.00 ? 17 VAL A HG12 7  
ATOM 8185  H HG13 . VAL A 1 17 ? -0.682  3.250   6.131   1.00 0.00 ? 17 VAL A HG13 7  
ATOM 8186  H HG21 . VAL A 1 17 ? 0.437   2.452   2.724   1.00 0.00 ? 17 VAL A HG21 7  
ATOM 8187  H HG22 . VAL A 1 17 ? 0.244   1.433   4.168   1.00 0.00 ? 17 VAL A HG22 7  
ATOM 8188  H HG23 . VAL A 1 17 ? 0.980   3.046   4.309   1.00 0.00 ? 17 VAL A HG23 7  
ATOM 8189  N N    . ASN A 1 18 ? -4.154  3.769   3.517   1.00 0.00 ? 18 ASN A N    7  
ATOM 8190  C CA   . ASN A 1 18 ? -5.492  4.086   3.995   1.00 0.00 ? 18 ASN A CA   7  
ATOM 8191  C C    . ASN A 1 18 ? -6.522  3.196   3.299   1.00 0.00 ? 18 ASN A C    7  
ATOM 8192  O O    . ASN A 1 18 ? -7.415  2.661   3.946   1.00 0.00 ? 18 ASN A O    7  
ATOM 8193  C CB   . ASN A 1 18 ? -5.788  5.563   3.730   1.00 0.00 ? 18 ASN A CB   7  
ATOM 8194  C CG   . ASN A 1 18 ? -7.187  5.931   4.215   1.00 0.00 ? 18 ASN A CG   7  
ATOM 8195  O OD1  . ASN A 1 18 ? -7.376  6.247   5.385   1.00 0.00 ? 18 ASN A OD1  7  
ATOM 8196  N ND2  . ASN A 1 18 ? -8.168  5.888   3.311   1.00 0.00 ? 18 ASN A ND2  7  
ATOM 8197  H H    . ASN A 1 18 ? -3.624  4.496   3.048   1.00 0.00 ? 18 ASN A H    7  
ATOM 8198  H HA   . ASN A 1 18 ? -5.536  3.903   5.073   1.00 0.00 ? 18 ASN A HA   7  
ATOM 8199  H HB2  . ASN A 1 18 ? -5.055  6.175   4.258   1.00 0.00 ? 18 ASN A HB2  7  
ATOM 8200  H HB3  . ASN A 1 18 ? -5.713  5.761   2.660   1.00 0.00 ? 18 ASN A HB3  7  
ATOM 8201  H HD21 . ASN A 1 18 ? -7.965  5.621   2.359   1.00 0.00 ? 18 ASN A HD21 7  
ATOM 8202  H HD22 . ASN A 1 18 ? -9.111  6.121   3.583   1.00 0.00 ? 18 ASN A HD22 7  
ATOM 8203  N N    . TYR A 1 19 ? -6.393  3.040   1.978   1.00 0.00 ? 19 TYR A N    7  
ATOM 8204  C CA   . TYR A 1 19 ? -7.311  2.217   1.207   1.00 0.00 ? 19 TYR A CA   7  
ATOM 8205  C C    . TYR A 1 19 ? -7.274  0.775   1.728   1.00 0.00 ? 19 TYR A C    7  
ATOM 8206  O O    . TYR A 1 19 ? -8.301  0.251   2.150   1.00 0.00 ? 19 TYR A O    7  
ATOM 8207  C CB   . TYR A 1 19 ? -6.939  2.301   -0.284  1.00 0.00 ? 19 TYR A CB   7  
ATOM 8208  C CG   . TYR A 1 19 ? -6.972  0.973   -1.008  1.00 0.00 ? 19 TYR A CG   7  
ATOM 8209  C CD1  . TYR A 1 19 ? -8.180  0.271   -1.149  1.00 0.00 ? 19 TYR A CD1  7  
ATOM 8210  C CD2  . TYR A 1 19 ? -5.787  0.435   -1.530  1.00 0.00 ? 19 TYR A CD2  7  
ATOM 8211  C CE1  . TYR A 1 19 ? -8.196  -0.966  -1.810  1.00 0.00 ? 19 TYR A CE1  7  
ATOM 8212  C CE2  . TYR A 1 19 ? -5.808  -0.797  -2.194  1.00 0.00 ? 19 TYR A CE2  7  
ATOM 8213  C CZ   . TYR A 1 19 ? -7.012  -1.497  -2.335  1.00 0.00 ? 19 TYR A CZ   7  
ATOM 8214  O OH   . TYR A 1 19 ? -7.035  -2.697  -2.978  1.00 0.00 ? 19 TYR A OH   7  
ATOM 8215  H H    . TYR A 1 19 ? -5.637  3.504   1.490   1.00 0.00 ? 19 TYR A H    7  
ATOM 8216  H HA   . TYR A 1 19 ? -8.322  2.606   1.336   1.00 0.00 ? 19 TYR A HA   7  
ATOM 8217  H HB2  . TYR A 1 19 ? -7.633  2.983   -0.777  1.00 0.00 ? 19 TYR A HB2  7  
ATOM 8218  H HB3  . TYR A 1 19 ? -5.934  2.711   -0.371  1.00 0.00 ? 19 TYR A HB3  7  
ATOM 8219  H HD1  . TYR A 1 19 ? -9.095  0.680   -0.746  1.00 0.00 ? 19 TYR A HD1  7  
ATOM 8220  H HD2  . TYR A 1 19 ? -4.856  0.968   -1.419  1.00 0.00 ? 19 TYR A HD2  7  
ATOM 8221  H HE1  . TYR A 1 19 ? -9.117  -1.508  -1.916  1.00 0.00 ? 19 TYR A HE1  7  
ATOM 8222  H HE2  . TYR A 1 19 ? -4.898  -1.207  -2.587  1.00 0.00 ? 19 TYR A HE2  7  
ATOM 8223  H HH   . TYR A 1 19 ? -6.185  -2.942  -3.348  1.00 0.00 ? 19 TYR A HH   7  
ATOM 8224  N N    . MET A 1 20 ? -6.095  0.138   1.700   1.00 0.00 ? 20 MET A N    7  
ATOM 8225  C CA   . MET A 1 20 ? -5.947  -1.238  2.164   1.00 0.00 ? 20 MET A CA   7  
ATOM 8226  C C    . MET A 1 20 ? -6.460  -1.365  3.596   1.00 0.00 ? 20 MET A C    7  
ATOM 8227  O O    . MET A 1 20 ? -7.075  -2.371  3.948   1.00 0.00 ? 20 MET A O    7  
ATOM 8228  C CB   . MET A 1 20 ? -4.471  -1.652  2.086   1.00 0.00 ? 20 MET A CB   7  
ATOM 8229  C CG   . MET A 1 20 ? -4.082  -1.966  0.640   1.00 0.00 ? 20 MET A CG   7  
ATOM 8230  S SD   . MET A 1 20 ? -4.905  -3.428  -0.054  1.00 0.00 ? 20 MET A SD   7  
ATOM 8231  C CE   . MET A 1 20 ? -4.109  -4.721  0.932   1.00 0.00 ? 20 MET A CE   7  
ATOM 8232  H H    . MET A 1 20 ? -5.277  0.616   1.346   1.00 0.00 ? 20 MET A H    7  
ATOM 8233  H HA   . MET A 1 20 ? -6.541  -1.895  1.526   1.00 0.00 ? 20 MET A HA   7  
ATOM 8234  H HB2  . MET A 1 20 ? -3.846  -0.841  2.462   1.00 0.00 ? 20 MET A HB2  7  
ATOM 8235  H HB3  . MET A 1 20 ? -4.314  -2.535  2.693   1.00 0.00 ? 20 MET A HB3  7  
ATOM 8236  H HG2  . MET A 1 20 ? -4.324  -1.106  0.023   1.00 0.00 ? 20 MET A HG2  7  
ATOM 8237  H HG3  . MET A 1 20 ? -3.005  -2.127  0.599   1.00 0.00 ? 20 MET A HG3  7  
ATOM 8238  H HE1  . MET A 1 20 ? -3.027  -4.640  0.834   1.00 0.00 ? 20 MET A HE1  7  
ATOM 8239  H HE2  . MET A 1 20 ? -4.433  -5.699  0.575   1.00 0.00 ? 20 MET A HE2  7  
ATOM 8240  H HE3  . MET A 1 20 ? -4.390  -4.608  1.977   1.00 0.00 ? 20 MET A HE3  7  
ATOM 8241  N N    . LYS A 1 21 ? -6.216  -0.342  4.420   1.00 0.00 ? 21 LYS A N    7  
ATOM 8242  C CA   . LYS A 1 21 ? -6.681  -0.339  5.791   1.00 0.00 ? 21 LYS A CA   7  
ATOM 8243  C C    . LYS A 1 21 ? -8.204  -0.429  5.809   1.00 0.00 ? 21 LYS A C    7  
ATOM 8244  O O    . LYS A 1 21 ? -8.757  -1.213  6.566   1.00 0.00 ? 21 LYS A O    7  
ATOM 8245  C CB   . LYS A 1 21 ? -6.181  0.929   6.492   1.00 0.00 ? 21 LYS A CB   7  
ATOM 8246  C CG   . LYS A 1 21 ? -6.578  0.912   7.973   1.00 0.00 ? 21 LYS A CG   7  
ATOM 8247  C CD   . LYS A 1 21 ? -7.925  1.620   8.174   1.00 0.00 ? 21 LYS A CD   7  
ATOM 8248  C CE   . LYS A 1 21 ? -7.896  2.412   9.479   1.00 0.00 ? 21 LYS A CE   7  
ATOM 8249  N NZ   . LYS A 1 21 ? -7.844  1.512   10.646  1.00 0.00 ? 21 LYS A NZ   7  
ATOM 8250  H H    . LYS A 1 21 ? -5.697  0.459   4.086   1.00 0.00 ? 21 LYS A H    7  
ATOM 8251  H HA   . LYS A 1 21 ? -6.273  -1.209  6.303   1.00 0.00 ? 21 LYS A HA   7  
ATOM 8252  H HB2  . LYS A 1 21 ? -5.096  0.972   6.417   1.00 0.00 ? 21 LYS A HB2  7  
ATOM 8253  H HB3  . LYS A 1 21 ? -6.603  1.805   6.010   1.00 0.00 ? 21 LYS A HB3  7  
ATOM 8254  H HG2  . LYS A 1 21 ? -6.655  -0.119  8.318   1.00 0.00 ? 21 LYS A HG2  7  
ATOM 8255  H HG3  . LYS A 1 21 ? -5.809  1.426   8.550   1.00 0.00 ? 21 LYS A HG3  7  
ATOM 8256  H HD2  . LYS A 1 21 ? -8.109  2.304   7.345   1.00 0.00 ? 21 LYS A HD2  7  
ATOM 8257  H HD3  . LYS A 1 21 ? -8.723  0.879   8.214   1.00 0.00 ? 21 LYS A HD3  7  
ATOM 8258  H HE2  . LYS A 1 21 ? -7.017  3.058   9.483   1.00 0.00 ? 21 LYS A HE2  7  
ATOM 8259  H HE3  . LYS A 1 21 ? -8.793  3.028   9.542   1.00 0.00 ? 21 LYS A HE3  7  
ATOM 8260  H HZ1  . LYS A 1 21 ? -7.017  0.937   10.593  1.00 0.00 ? 21 LYS A HZ1  7  
ATOM 8261  H HZ2  . LYS A 1 21 ? -7.820  2.061   11.494  1.00 0.00 ? 21 LYS A HZ2  7  
ATOM 8262  H HZ3  . LYS A 1 21 ? -8.667  0.918   10.654  1.00 0.00 ? 21 LYS A HZ3  7  
ATOM 8263  N N    . THR A 1 22 ? -8.880  0.367   4.968   1.00 0.00 ? 22 THR A N    7  
ATOM 8264  C CA   . THR A 1 22 ? -10.335 0.350   4.886   1.00 0.00 ? 22 THR A CA   7  
ATOM 8265  C C    . THR A 1 22 ? -10.818 -1.048  4.481   1.00 0.00 ? 22 THR A C    7  
ATOM 8266  O O    . THR A 1 22 ? -11.764 -1.566  5.072   1.00 0.00 ? 22 THR A O    7  
ATOM 8267  C CB   . THR A 1 22 ? -10.807 1.409   3.882   1.00 0.00 ? 22 THR A CB   7  
ATOM 8268  O OG1  . THR A 1 22 ? -10.277 2.667   4.240   1.00 0.00 ? 22 THR A OG1  7  
ATOM 8269  C CG2  . THR A 1 22 ? -12.336 1.487   3.887   1.00 0.00 ? 22 THR A CG2  7  
ATOM 8270  H H    . THR A 1 22 ? -8.373  1.005   4.363   1.00 0.00 ? 22 THR A H    7  
ATOM 8271  H HA   . THR A 1 22 ? -10.744 0.589   5.870   1.00 0.00 ? 22 THR A HA   7  
ATOM 8272  H HB   . THR A 1 22 ? -10.463 1.145   2.882   1.00 0.00 ? 22 THR A HB   7  
ATOM 8273  H HG1  . THR A 1 22 ? -10.500 2.841   5.157   1.00 0.00 ? 22 THR A HG1  7  
ATOM 8274  H HG21 . THR A 1 22 ? -12.689 1.676   4.901   1.00 0.00 ? 22 THR A HG21 7  
ATOM 8275  H HG22 . THR A 1 22 ? -12.752 0.546   3.527   1.00 0.00 ? 22 THR A HG22 7  
ATOM 8276  H HG23 . THR A 1 22 ? -12.660 2.297   3.234   1.00 0.00 ? 22 THR A HG23 7  
ATOM 8277  N N    . ARG A 1 23 ? -10.167 -1.658  3.477   1.00 0.00 ? 23 ARG A N    7  
ATOM 8278  C CA   . ARG A 1 23 ? -10.533 -2.999  3.022   1.00 0.00 ? 23 ARG A CA   7  
ATOM 8279  C C    . ARG A 1 23 ? -10.456 -3.971  4.199   1.00 0.00 ? 23 ARG A C    7  
ATOM 8280  O O    . ARG A 1 23 ? -11.414 -4.683  4.490   1.00 0.00 ? 23 ARG A O    7  
ATOM 8281  C CB   . ARG A 1 23 ? -9.588  -3.455  1.893   1.00 0.00 ? 23 ARG A CB   7  
ATOM 8282  C CG   . ARG A 1 23 ? -9.631  -2.494  0.696   1.00 0.00 ? 23 ARG A CG   7  
ATOM 8283  C CD   . ARG A 1 23 ? -11.071 -2.237  0.240   1.00 0.00 ? 23 ARG A CD   7  
ATOM 8284  N NE   . ARG A 1 23 ? -11.769 -3.500  -0.072  1.00 0.00 ? 23 ARG A NE   7  
ATOM 8285  C CZ   . ARG A 1 23 ? -11.796 -4.062  -1.299  1.00 0.00 ? 23 ARG A CZ   7  
ATOM 8286  N NH1  . ARG A 1 23 ? -11.289 -3.425  -2.365  1.00 0.00 ? 23 ARG A NH1  7  
ATOM 8287  N NH2  . ARG A 1 23 ? -12.340 -5.273  -1.452  1.00 0.00 ? 23 ARG A NH2  7  
ATOM 8288  H H    . ARG A 1 23 ? -9.397  -1.187  3.017   1.00 0.00 ? 23 ARG A H    7  
ATOM 8289  H HA   . ARG A 1 23 ? -11.556 -2.985  2.652   1.00 0.00 ? 23 ARG A HA   7  
ATOM 8290  H HB2  . ARG A 1 23 ? -8.569  -3.499  2.274   1.00 0.00 ? 23 ARG A HB2  7  
ATOM 8291  H HB3  . ARG A 1 23 ? -9.879  -4.446  1.558   1.00 0.00 ? 23 ARG A HB3  7  
ATOM 8292  H HG2  . ARG A 1 23 ? -9.172  -1.552  0.974   1.00 0.00 ? 23 ARG A HG2  7  
ATOM 8293  H HG3  . ARG A 1 23 ? -9.068  -2.934  -0.127  1.00 0.00 ? 23 ARG A HG3  7  
ATOM 8294  H HD2  . ARG A 1 23 ? -11.608 -1.716  1.028   1.00 0.00 ? 23 ARG A HD2  7  
ATOM 8295  H HD3  . ARG A 1 23 ? -11.052 -1.603  -0.640  1.00 0.00 ? 23 ARG A HD3  7  
ATOM 8296  H HE   . ARG A 1 23 ? -12.251 -3.967  0.689   1.00 0.00 ? 23 ARG A HE   7  
ATOM 8297  H HH11 . ARG A 1 23 ? -11.021 -2.448  -2.297  1.00 0.00 ? 23 ARG A HH11 7  
ATOM 8298  H HH12 . ARG A 1 23 ? -11.177 -3.912  -3.241  1.00 0.00 ? 23 ARG A HH12 7  
ATOM 8299  H HH21 . ARG A 1 23 ? -12.774 -5.734  -0.656  1.00 0.00 ? 23 ARG A HH21 7  
ATOM 8300  H HH22 . ARG A 1 23 ? -12.321 -5.728  -2.351  1.00 0.00 ? 23 ARG A HH22 7  
ATOM 8301  N N    . HIS A 1 24 ? -9.311  -3.990  4.873   1.00 0.00 ? 24 HIS A N    7  
ATOM 8302  C CA   . HIS A 1 24 ? -9.092  -4.865  6.008   1.00 0.00 ? 24 HIS A CA   7  
ATOM 8303  C C    . HIS A 1 24 ? -10.077 -4.541  7.136   1.00 0.00 ? 24 HIS A C    7  
ATOM 8304  O O    . HIS A 1 24 ? -10.518 -5.437  7.851   1.00 0.00 ? 24 HIS A O    7  
ATOM 8305  C CB   . HIS A 1 24 ? -7.641  -4.688  6.465   1.00 0.00 ? 24 HIS A CB   7  
ATOM 8306  C CG   . HIS A 1 24 ? -7.267  -5.558  7.634   1.00 0.00 ? 24 HIS A CG   7  
ATOM 8307  N ND1  . HIS A 1 24 ? -6.518  -6.722  7.500   1.00 0.00 ? 24 HIS A ND1  7  
ATOM 8308  C CD2  . HIS A 1 24 ? -7.493  -5.439  8.979   1.00 0.00 ? 24 HIS A CD2  7  
ATOM 8309  C CE1  . HIS A 1 24 ? -6.352  -7.222  8.742   1.00 0.00 ? 24 HIS A CE1  7  
ATOM 8310  N NE2  . HIS A 1 24 ? -6.923  -6.482  9.693   1.00 0.00 ? 24 HIS A NE2  7  
ATOM 8311  H H    . HIS A 1 24 ? -8.557  -3.375  4.590   1.00 0.00 ? 24 HIS A H    7  
ATOM 8312  H HA   . HIS A 1 24 ? -9.242  -5.894  5.694   1.00 0.00 ? 24 HIS A HA   7  
ATOM 8313  H HB2  . HIS A 1 24 ? -6.984  -4.928  5.630   1.00 0.00 ? 24 HIS A HB2  7  
ATOM 8314  H HB3  . HIS A 1 24 ? -7.486  -3.646  6.743   1.00 0.00 ? 24 HIS A HB3  7  
ATOM 8315  H HD1  . HIS A 1 24 ? -6.165  -7.117  6.640   1.00 0.00 ? 24 HIS A HD1  7  
ATOM 8316  H HD2  . HIS A 1 24 ? -8.037  -4.628  9.427   1.00 0.00 ? 24 HIS A HD2  7  
ATOM 8317  H HE1  . HIS A 1 24 ? -5.804  -8.129  8.948   1.00 0.00 ? 24 HIS A HE1  7  
ATOM 8318  N N    . GLN A 1 25 ? -10.419 -3.263  7.299   1.00 0.00 ? 25 GLN A N    7  
ATOM 8319  C CA   . GLN A 1 25 ? -11.316 -2.834  8.357   1.00 0.00 ? 25 GLN A CA   7  
ATOM 8320  C C    . GLN A 1 25 ? -12.731 -3.372  8.130   1.00 0.00 ? 25 GLN A C    7  
ATOM 8321  O O    . GLN A 1 25 ? -13.346 -3.882  9.065   1.00 0.00 ? 25 GLN A O    7  
ATOM 8322  C CB   . GLN A 1 25 ? -11.322 -1.302  8.426   1.00 0.00 ? 25 GLN A CB   7  
ATOM 8323  C CG   . GLN A 1 25 ? -11.905 -0.840  9.763   1.00 0.00 ? 25 GLN A CG   7  
ATOM 8324  C CD   . GLN A 1 25 ? -10.901 -1.034  10.894  1.00 0.00 ? 25 GLN A CD   7  
ATOM 8325  O OE1  . GLN A 1 25 ? -9.944  -0.269  11.014  1.00 0.00 ? 25 GLN A OE1  7  
ATOM 8326  N NE2  . GLN A 1 25 ? -11.116 -2.055  11.723  1.00 0.00 ? 25 GLN A NE2  7  
ATOM 8327  H H    . GLN A 1 25 ? -10.041 -2.561  6.676   1.00 0.00 ? 25 GLN A H    7  
ATOM 8328  H HA   . GLN A 1 25 ? -10.941 -3.226  9.303   1.00 0.00 ? 25 GLN A HA   7  
ATOM 8329  H HB2  . GLN A 1 25 ? -10.305 -0.929  8.336   1.00 0.00 ? 25 GLN A HB2  7  
ATOM 8330  H HB3  . GLN A 1 25 ? -11.926 -0.903  7.611   1.00 0.00 ? 25 GLN A HB3  7  
ATOM 8331  H HG2  . GLN A 1 25 ? -12.160 0.216   9.693   1.00 0.00 ? 25 GLN A HG2  7  
ATOM 8332  H HG3  . GLN A 1 25 ? -12.806 -1.410  9.978   1.00 0.00 ? 25 GLN A HG3  7  
ATOM 8333  H HE21 . GLN A 1 25 ? -11.912 -2.660  11.582  1.00 0.00 ? 25 GLN A HE21 7  
ATOM 8334  H HE22 . GLN A 1 25 ? -10.484 -2.221  12.491  1.00 0.00 ? 25 GLN A HE22 7  
ATOM 8335  N N    . ARG A 1 26 ? -13.260 -3.251  6.901   1.00 0.00 ? 26 ARG A N    7  
ATOM 8336  C CA   . ARG A 1 26 ? -14.624 -3.689  6.617   1.00 0.00 ? 26 ARG A CA   7  
ATOM 8337  C C    . ARG A 1 26 ? -14.732 -5.219  6.631   1.00 0.00 ? 26 ARG A C    7  
ATOM 8338  O O    . ARG A 1 26 ? -15.792 -5.746  6.962   1.00 0.00 ? 26 ARG A O    7  
ATOM 8339  C CB   . ARG A 1 26 ? -15.125 -3.092  5.289   1.00 0.00 ? 26 ARG A CB   7  
ATOM 8340  C CG   . ARG A 1 26 ? -14.371 -3.679  4.090   1.00 0.00 ? 26 ARG A CG   7  
ATOM 8341  C CD   . ARG A 1 26 ? -14.979 -3.143  2.787   1.00 0.00 ? 26 ARG A CD   7  
ATOM 8342  N NE   . ARG A 1 26 ? -16.397 -3.517  2.667   1.00 0.00 ? 26 ARG A NE   7  
ATOM 8343  C CZ   . ARG A 1 26 ? -16.817 -4.760  2.355   1.00 0.00 ? 26 ARG A CZ   7  
ATOM 8344  N NH1  . ARG A 1 26 ? -15.941 -5.700  1.981   1.00 0.00 ? 26 ARG A NH1  7  
ATOM 8345  N NH2  . ARG A 1 26 ? -18.121 -5.054  2.419   1.00 0.00 ? 26 ARG A NH2  7  
ATOM 8346  H H    . ARG A 1 26 ? -12.714 -2.840  6.153   1.00 0.00 ? 26 ARG A H    7  
ATOM 8347  H HA   . ARG A 1 26 ? -15.266 -3.305  7.411   1.00 0.00 ? 26 ARG A HA   7  
ATOM 8348  H HB2  . ARG A 1 26 ? -16.188 -3.309  5.185   1.00 0.00 ? 26 ARG A HB2  7  
ATOM 8349  H HB3  . ARG A 1 26 ? -14.983 -2.011  5.307   1.00 0.00 ? 26 ARG A HB3  7  
ATOM 8350  H HG2  . ARG A 1 26 ? -13.329 -3.383  4.143   1.00 0.00 ? 26 ARG A HG2  7  
ATOM 8351  H HG3  . ARG A 1 26 ? -14.442 -4.764  4.102   1.00 0.00 ? 26 ARG A HG3  7  
ATOM 8352  H HD2  . ARG A 1 26 ? -14.896 -2.056  2.779   1.00 0.00 ? 26 ARG A HD2  7  
ATOM 8353  H HD3  . ARG A 1 26 ? -14.424 -3.545  1.940   1.00 0.00 ? 26 ARG A HD3  7  
ATOM 8354  H HE   . ARG A 1 26 ? -17.083 -2.794  2.833   1.00 0.00 ? 26 ARG A HE   7  
ATOM 8355  H HH11 . ARG A 1 26 ? -14.963 -5.463  1.847   1.00 0.00 ? 26 ARG A HH11 7  
ATOM 8356  H HH12 . ARG A 1 26 ? -16.250 -6.649  1.829   1.00 0.00 ? 26 ARG A HH12 7  
ATOM 8357  H HH21 . ARG A 1 26 ? -18.786 -4.350  2.702   1.00 0.00 ? 26 ARG A HH21 7  
ATOM 8358  H HH22 . ARG A 1 26 ? -18.442 -5.983  2.183   1.00 0.00 ? 26 ARG A HH22 7  
ATOM 8359  N N    . GLY A 1 27 ? -13.649 -5.939  6.284   1.00 0.00 ? 27 GLY A N    7  
ATOM 8360  C CA   . GLY A 1 27 ? -13.675 -7.401  6.306   1.00 0.00 ? 27 GLY A CA   7  
ATOM 8361  C C    . GLY A 1 27 ? -12.721 -8.012  5.277   1.00 0.00 ? 27 GLY A C    7  
ATOM 8362  O O    . GLY A 1 27 ? -12.351 -9.178  5.405   1.00 0.00 ? 27 GLY A O    7  
ATOM 8363  H H    . GLY A 1 27 ? -12.795 -5.471  6.008   1.00 0.00 ? 27 GLY A H    7  
ATOM 8364  H HA2  . GLY A 1 27 ? -13.390 -7.744  7.300   1.00 0.00 ? 27 GLY A HA2  7  
ATOM 8365  H HA3  . GLY A 1 27 ? -14.687 -7.745  6.089   1.00 0.00 ? 27 GLY A HA3  7  
ATOM 8366  N N    . ASP A 1 28 ? -12.325 -7.239  4.259   1.00 0.00 ? 28 ASP A N    7  
ATOM 8367  C CA   . ASP A 1 28 ? -11.433 -7.734  3.216   1.00 0.00 ? 28 ASP A CA   7  
ATOM 8368  C C    . ASP A 1 28 ? -9.989  -7.717  3.720   1.00 0.00 ? 28 ASP A C    7  
ATOM 8369  O O    . ASP A 1 28 ? -9.154  -6.978  3.200   1.00 0.00 ? 28 ASP A O    7  
ATOM 8370  C CB   . ASP A 1 28 ? -11.579 -6.861  1.965   1.00 0.00 ? 28 ASP A CB   7  
ATOM 8371  C CG   . ASP A 1 28 ? -13.025 -6.767  1.504   1.00 0.00 ? 28 ASP A CG   7  
ATOM 8372  O OD1  . ASP A 1 28 ? -13.737 -7.782  1.625   1.00 0.00 ? 28 ASP A OD1  7  
ATOM 8373  O OD2  . ASP A 1 28 ? -13.393 -5.666  1.033   1.00 0.00 ? 28 ASP A OD2  7  
ATOM 8374  H H    . ASP A 1 28 ? -12.647 -6.284  4.199   1.00 0.00 ? 28 ASP A H    7  
ATOM 8375  H HA   . ASP A 1 28 ? -11.709 -8.759  2.964   1.00 0.00 ? 28 ASP A HA   7  
ATOM 8376  H HB2  . ASP A 1 28 ? -11.221 -5.864  2.191   1.00 0.00 ? 28 ASP A HB2  7  
ATOM 8377  H HB3  . ASP A 1 28 ? -10.975 -7.283  1.162   1.00 0.00 ? 28 ASP A HB3  7  
ATOM 8378  N N    . THR A 1 29 ? -9.698  -8.540  4.734   1.00 0.00 ? 29 THR A N    7  
ATOM 8379  C CA   . THR A 1 29 ? -8.362  -8.621  5.313   1.00 0.00 ? 29 THR A CA   7  
ATOM 8380  C C    . THR A 1 29 ? -7.440  -9.460  4.416   1.00 0.00 ? 29 THR A C    7  
ATOM 8381  O O    . THR A 1 29 ? -6.248  -9.580  4.699   1.00 0.00 ? 29 THR A O    7  
ATOM 8382  C CB   . THR A 1 29 ? -8.453  -9.238  6.719   1.00 0.00 ? 29 THR A CB   7  
ATOM 8383  O OG1  . THR A 1 29 ? -8.825  -10.597 6.617   1.00 0.00 ? 29 THR A OG1  7  
ATOM 8384  C CG2  . THR A 1 29 ? -9.490  -8.496  7.561   1.00 0.00 ? 29 THR A CG2  7  
ATOM 8385  H H    . THR A 1 29 ? -10.424 -9.129  5.121   1.00 0.00 ? 29 THR A H    7  
ATOM 8386  H HA   . THR A 1 29 ? -7.950  -7.616  5.397   1.00 0.00 ? 29 THR A HA   7  
ATOM 8387  H HB   . THR A 1 29 ? -7.482  -9.161  7.209   1.00 0.00 ? 29 THR A HB   7  
ATOM 8388  H HG1  . THR A 1 29 ? -8.885  -10.964 7.502   1.00 0.00 ? 29 THR A HG1  7  
ATOM 8389  H HG21 . THR A 1 29 ? -9.458  -8.868  8.586   1.00 0.00 ? 29 THR A HG21 7  
ATOM 8390  H HG22 . THR A 1 29 ? -9.262  -7.434  7.558   1.00 0.00 ? 29 THR A HG22 7  
ATOM 8391  H HG23 . THR A 1 29 ? -10.485 -8.656  7.151   1.00 0.00 ? 29 THR A HG23 7  
ATOM 8392  N N    . HIS A 1 30 ? -7.995  -10.043 3.340   1.00 0.00 ? 30 HIS A N    7  
ATOM 8393  C CA   . HIS A 1 30 ? -7.235  -10.890 2.432   1.00 0.00 ? 30 HIS A CA   7  
ATOM 8394  C C    . HIS A 1 30 ? -6.147  -10.074 1.707   1.00 0.00 ? 30 HIS A C    7  
ATOM 8395  O O    . HIS A 1 30 ? -6.280  -8.858  1.560   1.00 0.00 ? 30 HIS A O    7  
ATOM 8396  C CB   . HIS A 1 30 ? -8.204  -11.534 1.427   1.00 0.00 ? 30 HIS A CB   7  
ATOM 8397  C CG   . HIS A 1 30 ? -8.450  -10.680 0.206   1.00 0.00 ? 30 HIS A CG   7  
ATOM 8398  N ND1  . HIS A 1 30 ? -8.764  -9.326  0.280   1.00 0.00 ? 30 HIS A ND1  7  
ATOM 8399  C CD2  . HIS A 1 30 ? -8.422  -10.961 -1.137  1.00 0.00 ? 30 HIS A CD2  7  
ATOM 8400  C CE1  . HIS A 1 30 ? -8.903  -8.892  -0.988  1.00 0.00 ? 30 HIS A CE1  7  
ATOM 8401  N NE2  . HIS A 1 30 ? -8.709  -9.843  -1.901  1.00 0.00 ? 30 HIS A NE2  7  
ATOM 8402  H H    . HIS A 1 30 ? -8.973  -9.904  3.150   1.00 0.00 ? 30 HIS A H    7  
ATOM 8403  H HA   . HIS A 1 30 ? -6.764  -11.678 3.016   1.00 0.00 ? 30 HIS A HA   7  
ATOM 8404  H HB2  . HIS A 1 30 ? -7.793  -12.489 1.105   1.00 0.00 ? 30 HIS A HB2  7  
ATOM 8405  H HB3  . HIS A 1 30 ? -9.158  -11.717 1.923   1.00 0.00 ? 30 HIS A HB3  7  
ATOM 8406  H HD1  . HIS A 1 30 ? -8.865  -8.775  1.120   1.00 0.00 ? 30 HIS A HD1  7  
ATOM 8407  H HD2  . HIS A 1 30 ? -8.199  -11.933 -1.548  1.00 0.00 ? 30 HIS A HD2  7  
ATOM 8408  H HE1  . HIS A 1 30 ? -9.140  -7.871  -1.242  1.00 0.00 ? 30 HIS A HE1  7  
ATOM 8409  N N    . PRO A 1 31 ? -5.070  -10.744 1.246   1.00 0.00 ? 31 PRO A N    7  
ATOM 8410  C CA   . PRO A 1 31 ? -3.994  -10.096 0.522   1.00 0.00 ? 31 PRO A CA   7  
ATOM 8411  C C    . PRO A 1 31 ? -4.462  -9.638  -0.861  1.00 0.00 ? 31 PRO A C    7  
ATOM 8412  O O    . PRO A 1 31 ? -5.402  -10.201 -1.418  1.00 0.00 ? 31 PRO A O    7  
ATOM 8413  C CB   . PRO A 1 31 ? -2.895  -11.153 0.387   1.00 0.00 ? 31 PRO A CB   7  
ATOM 8414  C CG   . PRO A 1 31 ? -3.495  -12.484 0.851   1.00 0.00 ? 31 PRO A CG   7  
ATOM 8415  C CD   . PRO A 1 31 ? -4.871  -12.169 1.430   1.00 0.00 ? 31 PRO A CD   7  
ATOM 8416  H HA   . PRO A 1 31 ? -3.624  -9.243  1.091   1.00 0.00 ? 31 PRO A HA   7  
ATOM 8417  H HB2  . PRO A 1 31 ? -2.583  -11.234 -0.652  1.00 0.00 ? 31 PRO A HB2  7  
ATOM 8418  H HB3  . PRO A 1 31 ? -2.042  -10.890 1.011   1.00 0.00 ? 31 PRO A HB3  7  
ATOM 8419  H HG2  . PRO A 1 31 ? -3.595  -13.163 0.003   1.00 0.00 ? 31 PRO A HG2  7  
ATOM 8420  H HG3  . PRO A 1 31 ? -2.860  -12.935 1.614   1.00 0.00 ? 31 PRO A HG3  7  
ATOM 8421  H HD2  . PRO A 1 31 ? -5.637  -12.729 0.897   1.00 0.00 ? 31 PRO A HD2  7  
ATOM 8422  H HD3  . PRO A 1 31 ? -4.890  -12.421 2.491   1.00 0.00 ? 31 PRO A HD3  7  
ATOM 8423  N N    . LEU A 1 32 ? -3.780  -8.625  -1.416  1.00 0.00 ? 32 LEU A N    7  
ATOM 8424  C CA   . LEU A 1 32 ? -4.059  -8.119  -2.756  1.00 0.00 ? 32 LEU A CA   7  
ATOM 8425  C C    . LEU A 1 32 ? -2.731  -7.887  -3.476  1.00 0.00 ? 32 LEU A C    7  
ATOM 8426  O O    . LEU A 1 32 ? -1.755  -7.464  -2.854  1.00 0.00 ? 32 LEU A O    7  
ATOM 8427  C CB   . LEU A 1 32 ? -4.833  -6.795  -2.678  1.00 0.00 ? 32 LEU A CB   7  
ATOM 8428  C CG   . LEU A 1 32 ? -6.348  -7.028  -2.530  1.00 0.00 ? 32 LEU A CG   7  
ATOM 8429  C CD1  . LEU A 1 32 ? -7.060  -5.679  -2.630  1.00 0.00 ? 32 LEU A CD1  7  
ATOM 8430  C CD2  . LEU A 1 32 ? -6.874  -7.938  -3.643  1.00 0.00 ? 32 LEU A CD2  7  
ATOM 8431  H H    . LEU A 1 32 ? -3.026  -8.193  -0.897  1.00 0.00 ? 32 LEU A H    7  
ATOM 8432  H HA   . LEU A 1 32 ? -4.641  -8.854  -3.306  1.00 0.00 ? 32 LEU A HA   7  
ATOM 8433  H HB2  . LEU A 1 32 ? -4.473  -6.218  -1.827  1.00 0.00 ? 32 LEU A HB2  7  
ATOM 8434  H HB3  . LEU A 1 32 ? -4.650  -6.228  -3.591  1.00 0.00 ? 32 LEU A HB3  7  
ATOM 8435  H HG   . LEU A 1 32 ? -6.555  -7.477  -1.559  1.00 0.00 ? 32 LEU A HG   7  
ATOM 8436  H HD11 . LEU A 1 32 ? -6.667  -5.003  -1.873  1.00 0.00 ? 32 LEU A HD11 7  
ATOM 8437  H HD12 . LEU A 1 32 ? -8.129  -5.818  -2.475  1.00 0.00 ? 32 LEU A HD12 7  
ATOM 8438  H HD13 . LEU A 1 32 ? -6.889  -5.251  -3.625  1.00 0.00 ? 32 LEU A HD13 7  
ATOM 8439  H HD21 . LEU A 1 32 ? -7.948  -7.791  -3.755  1.00 0.00 ? 32 LEU A HD21 7  
ATOM 8440  H HD22 . LEU A 1 32 ? -6.680  -8.980  -3.392  1.00 0.00 ? 32 LEU A HD22 7  
ATOM 8441  H HD23 . LEU A 1 32 ? -6.378  -7.690  -4.576  1.00 0.00 ? 32 LEU A HD23 7  
ATOM 8442  N N    . THR A 1 33 ? -2.690  -8.157  -4.785  1.00 0.00 ? 33 THR A N    7  
ATOM 8443  C CA   . THR A 1 33 ? -1.480  -7.953  -5.574  1.00 0.00 ? 33 THR A CA   7  
ATOM 8444  C C    . THR A 1 33 ? -1.216  -6.457  -5.749  1.00 0.00 ? 33 THR A C    7  
ATOM 8445  O O    . THR A 1 33 ? -2.086  -5.626  -5.474  1.00 0.00 ? 33 THR A O    7  
ATOM 8446  C CB   . THR A 1 33 ? -1.623  -8.624  -6.947  1.00 0.00 ? 33 THR A CB   7  
ATOM 8447  O OG1  . THR A 1 33 ? -2.694  -8.036  -7.652  1.00 0.00 ? 33 THR A OG1  7  
ATOM 8448  C CG2  . THR A 1 33 ? -1.877  -10.125 -6.781  1.00 0.00 ? 33 THR A CG2  7  
ATOM 8449  H H    . THR A 1 33 ? -3.518  -8.510  -5.252  1.00 0.00 ? 33 THR A H    7  
ATOM 8450  H HA   . THR A 1 33 ? -0.636  -8.403  -5.048  1.00 0.00 ? 33 THR A HA   7  
ATOM 8451  H HB   . THR A 1 33 ? -0.703  -8.480  -7.513  1.00 0.00 ? 33 THR A HB   7  
ATOM 8452  H HG1  . THR A 1 33 ? -3.520  -8.278  -7.212  1.00 0.00 ? 33 THR A HG1  7  
ATOM 8453  H HG21 . THR A 1 33 ? -1.910  -10.596 -7.763  1.00 0.00 ? 33 THR A HG21 7  
ATOM 8454  H HG22 . THR A 1 33 ? -1.071  -10.566 -6.195  1.00 0.00 ? 33 THR A HG22 7  
ATOM 8455  H HG23 . THR A 1 33 ? -2.826  -10.283 -6.273  1.00 0.00 ? 33 THR A HG23 7  
ATOM 8456  N N    . LEU A 1 34 ? -0.011  -6.118  -6.221  1.00 0.00 ? 34 LEU A N    7  
ATOM 8457  C CA   . LEU A 1 34 ? 0.371   -4.736  -6.466  1.00 0.00 ? 34 LEU A CA   7  
ATOM 8458  C C    . LEU A 1 34 ? -0.620  -4.108  -7.456  1.00 0.00 ? 34 LEU A C    7  
ATOM 8459  O O    . LEU A 1 34 ? -1.120  -3.013  -7.225  1.00 0.00 ? 34 LEU A O    7  
ATOM 8460  C CB   . LEU A 1 34 ? 1.813   -4.713  -7.020  1.00 0.00 ? 34 LEU A CB   7  
ATOM 8461  C CG   . LEU A 1 34 ? 2.564   -3.414  -6.646  1.00 0.00 ? 34 LEU A CG   7  
ATOM 8462  C CD1  . LEU A 1 34 ? 1.738   -2.184  -7.006  1.00 0.00 ? 34 LEU A CD1  7  
ATOM 8463  C CD2  . LEU A 1 34 ? 2.894   -3.389  -5.150  1.00 0.00 ? 34 LEU A CD2  7  
ATOM 8464  H H    . LEU A 1 34 ? 0.664   -6.841  -6.423  1.00 0.00 ? 34 LEU A H    7  
ATOM 8465  H HA   . LEU A 1 34 ? 0.331   -4.189  -5.527  1.00 0.00 ? 34 LEU A HA   7  
ATOM 8466  H HB2  . LEU A 1 34 ? 2.364   -5.563  -6.614  1.00 0.00 ? 34 LEU A HB2  7  
ATOM 8467  H HB3  . LEU A 1 34 ? 1.780   -4.803  -8.106  1.00 0.00 ? 34 LEU A HB3  7  
ATOM 8468  H HG   . LEU A 1 34 ? 3.496   -3.380  -7.206  1.00 0.00 ? 34 LEU A HG   7  
ATOM 8469  H HD11 . LEU A 1 34 ? 0.923   -2.069  -6.294  1.00 0.00 ? 34 LEU A HD11 7  
ATOM 8470  H HD12 . LEU A 1 34 ? 2.374   -1.299  -6.972  1.00 0.00 ? 34 LEU A HD12 7  
ATOM 8471  H HD13 . LEU A 1 34 ? 1.336   -2.300  -8.011  1.00 0.00 ? 34 LEU A HD13 7  
ATOM 8472  H HD21 . LEU A 1 34 ? 3.477   -2.496  -4.926  1.00 0.00 ? 34 LEU A HD21 7  
ATOM 8473  H HD22 . LEU A 1 34 ? 3.475   -4.271  -4.893  1.00 0.00 ? 34 LEU A HD22 7  
ATOM 8474  H HD23 . LEU A 1 34 ? 1.977   -3.375  -4.566  1.00 0.00 ? 34 LEU A HD23 7  
ATOM 8475  N N    . ASP A 1 35 ? -0.904  -4.814  -8.558  1.00 0.00 ? 35 ASP A N    7  
ATOM 8476  C CA   . ASP A 1 35 ? -1.822  -4.326  -9.579  1.00 0.00 ? 35 ASP A CA   7  
ATOM 8477  C C    . ASP A 1 35 ? -3.185  -3.994  -8.960  1.00 0.00 ? 35 ASP A C    7  
ATOM 8478  O O    . ASP A 1 35 ? -3.693  -2.888  -9.143  1.00 0.00 ? 35 ASP A O    7  
ATOM 8479  C CB   . ASP A 1 35 ? -1.963  -5.386  -10.673 1.00 0.00 ? 35 ASP A CB   7  
ATOM 8480  C CG   . ASP A 1 35 ? -2.744  -4.836  -11.858 1.00 0.00 ? 35 ASP A CG   7  
ATOM 8481  O OD1  . ASP A 1 35 ? -2.119  -4.109  -12.660 1.00 0.00 ? 35 ASP A OD1  7  
ATOM 8482  O OD2  . ASP A 1 35 ? -3.949  -5.153  -11.939 1.00 0.00 ? 35 ASP A OD2  7  
ATOM 8483  H H    . ASP A 1 35 ? -0.473  -5.716  -8.696  1.00 0.00 ? 35 ASP A H    7  
ATOM 8484  H HA   . ASP A 1 35 ? -1.404  -3.419  -10.020 1.00 0.00 ? 35 ASP A HA   7  
ATOM 8485  H HB2  . ASP A 1 35 ? -0.971  -5.688  -11.010 1.00 0.00 ? 35 ASP A HB2  7  
ATOM 8486  H HB3  . ASP A 1 35 ? -2.483  -6.256  -10.270 1.00 0.00 ? 35 ASP A HB3  7  
ATOM 8487  N N    . GLU A 1 36 ? -3.767  -4.954  -8.224  1.00 0.00 ? 36 GLU A N    7  
ATOM 8488  C CA   . GLU A 1 36 ? -5.064  -4.766  -7.573  1.00 0.00 ? 36 GLU A CA   7  
ATOM 8489  C C    . GLU A 1 36 ? -5.038  -3.527  -6.674  1.00 0.00 ? 36 GLU A C    7  
ATOM 8490  O O    . GLU A 1 36 ? -6.031  -2.806  -6.582  1.00 0.00 ? 36 GLU A O    7  
ATOM 8491  C CB   . GLU A 1 36 ? -5.405  -6.021  -6.765  1.00 0.00 ? 36 GLU A CB   7  
ATOM 8492  C CG   . GLU A 1 36 ? -5.785  -7.160  -7.721  1.00 0.00 ? 36 GLU A CG   7  
ATOM 8493  C CD   . GLU A 1 36 ? -5.911  -8.484  -6.977  1.00 0.00 ? 36 GLU A CD   7  
ATOM 8494  O OE1  . GLU A 1 36 ? -4.911  -8.866  -6.327  1.00 0.00 ? 36 GLU A OE1  7  
ATOM 8495  O OE2  . GLU A 1 36 ? -6.998  -9.089  -7.070  1.00 0.00 ? 36 GLU A OE2  7  
ATOM 8496  H H    . GLU A 1 36 ? -3.301  -5.844  -8.108  1.00 0.00 ? 36 GLU A H    7  
ATOM 8497  H HA   . GLU A 1 36 ? -5.829  -4.625  -8.333  1.00 0.00 ? 36 GLU A HA   7  
ATOM 8498  H HB2  . GLU A 1 36 ? -4.542  -6.315  -6.169  1.00 0.00 ? 36 GLU A HB2  7  
ATOM 8499  H HB3  . GLU A 1 36 ? -6.246  -5.808  -6.104  1.00 0.00 ? 36 GLU A HB3  7  
ATOM 8500  H HG2  . GLU A 1 36 ? -6.739  -6.924  -8.195  1.00 0.00 ? 36 GLU A HG2  7  
ATOM 8501  H HG3  . GLU A 1 36 ? -5.020  -7.255  -8.491  1.00 0.00 ? 36 GLU A HG3  7  
ATOM 8502  N N    . ILE A 1 37 ? -3.907  -3.282  -6.009  1.00 0.00 ? 37 ILE A N    7  
ATOM 8503  C CA   . ILE A 1 37 ? -3.774  -2.144  -5.117  1.00 0.00 ? 37 ILE A CA   7  
ATOM 8504  C C    . ILE A 1 37 ? -3.760  -0.836  -5.914  1.00 0.00 ? 37 ILE A C    7  
ATOM 8505  O O    . ILE A 1 37 ? -4.527  0.078   -5.605  1.00 0.00 ? 37 ILE A O    7  
ATOM 8506  C CB   . ILE A 1 37 ? -2.497  -2.311  -4.271  1.00 0.00 ? 37 ILE A CB   7  
ATOM 8507  C CG1  . ILE A 1 37 ? -2.777  -3.297  -3.128  1.00 0.00 ? 37 ILE A CG1  7  
ATOM 8508  C CG2  . ILE A 1 37 ? -2.061  -0.958  -3.694  1.00 0.00 ? 37 ILE A CG2  7  
ATOM 8509  C CD1  . ILE A 1 37 ? -1.468  -3.885  -2.598  1.00 0.00 ? 37 ILE A CD1  7  
ATOM 8510  H H    . ILE A 1 37 ? -3.114  -3.903  -6.118  1.00 0.00 ? 37 ILE A H    7  
ATOM 8511  H HA   . ILE A 1 37 ? -4.639  -2.127  -4.454  1.00 0.00 ? 37 ILE A HA   7  
ATOM 8512  H HB   . ILE A 1 37 ? -1.698  -2.705  -4.896  1.00 0.00 ? 37 ILE A HB   7  
ATOM 8513  H HG12 . ILE A 1 37 ? -3.290  -2.778  -2.321  1.00 0.00 ? 37 ILE A HG12 7  
ATOM 8514  H HG13 . ILE A 1 37 ? -3.409  -4.105  -3.495  1.00 0.00 ? 37 ILE A HG13 7  
ATOM 8515  H HG21 . ILE A 1 37 ? -1.662  -0.331  -4.491  1.00 0.00 ? 37 ILE A HG21 7  
ATOM 8516  H HG22 . ILE A 1 37 ? -2.916  -0.461  -3.238  1.00 0.00 ? 37 ILE A HG22 7  
ATOM 8517  H HG23 . ILE A 1 37 ? -1.290  -1.114  -2.943  1.00 0.00 ? 37 ILE A HG23 7  
ATOM 8518  H HD11 . ILE A 1 37 ? -1.693  -4.632  -1.837  1.00 0.00 ? 37 ILE A HD11 7  
ATOM 8519  H HD12 . ILE A 1 37 ? -0.922  -4.355  -3.415  1.00 0.00 ? 37 ILE A HD12 7  
ATOM 8520  H HD13 . ILE A 1 37 ? -0.859  -3.096  -2.161  1.00 0.00 ? 37 ILE A HD13 7  
ATOM 8521  N N    . LEU A 1 38 ? -2.892  -0.738  -6.932  1.00 0.00 ? 38 LEU A N    7  
ATOM 8522  C CA   . LEU A 1 38 ? -2.797  0.476   -7.737  1.00 0.00 ? 38 LEU A CA   7  
ATOM 8523  C C    . LEU A 1 38 ? -4.153  0.803   -8.354  1.00 0.00 ? 38 LEU A C    7  
ATOM 8524  O O    . LEU A 1 38 ? -4.572  1.955   -8.344  1.00 0.00 ? 38 LEU A O    7  
ATOM 8525  C CB   . LEU A 1 38 ? -1.770  0.311   -8.860  1.00 0.00 ? 38 LEU A CB   7  
ATOM 8526  C CG   . LEU A 1 38 ? -0.347  0.105   -8.331  1.00 0.00 ? 38 LEU A CG   7  
ATOM 8527  C CD1  . LEU A 1 38 ? 0.602   0.001   -9.524  1.00 0.00 ? 38 LEU A CD1  7  
ATOM 8528  C CD2  . LEU A 1 38 ? 0.103   1.280   -7.452  1.00 0.00 ? 38 LEU A CD2  7  
ATOM 8529  H H    . LEU A 1 38 ? -2.283  -1.516  -7.154  1.00 0.00 ? 38 LEU A H    7  
ATOM 8530  H HA   . LEU A 1 38 ? -2.496  1.303   -7.099  1.00 0.00 ? 38 LEU A HA   7  
ATOM 8531  H HB2  . LEU A 1 38 ? -2.049  -0.546  -9.474  1.00 0.00 ? 38 LEU A HB2  7  
ATOM 8532  H HB3  . LEU A 1 38 ? -1.788  1.199   -9.467  1.00 0.00 ? 38 LEU A HB3  7  
ATOM 8533  H HG   . LEU A 1 38 ? -0.312  -0.811  -7.760  1.00 0.00 ? 38 LEU A HG   7  
ATOM 8534  H HD11 . LEU A 1 38 ? 0.306   -0.837  -10.154 1.00 0.00 ? 38 LEU A HD11 7  
ATOM 8535  H HD12 . LEU A 1 38 ? 1.619   -0.154  -9.167  1.00 0.00 ? 38 LEU A HD12 7  
ATOM 8536  H HD13 . LEU A 1 38 ? 0.558   0.927   -10.105 1.00 0.00 ? 38 LEU A HD13 7  
ATOM 8537  H HD21 . LEU A 1 38 ? 1.160   1.160   -7.203  1.00 0.00 ? 38 LEU A HD21 7  
ATOM 8538  H HD22 . LEU A 1 38 ? -0.481  1.303   -6.534  1.00 0.00 ? 38 LEU A HD22 7  
ATOM 8539  H HD23 . LEU A 1 38 ? -0.028  2.213   -7.994  1.00 0.00 ? 38 LEU A HD23 7  
ATOM 8540  N N    . ASP A 1 39 ? -4.828  -0.216  -8.902  1.00 0.00 ? 39 ASP A N    7  
ATOM 8541  C CA   . ASP A 1 39 ? -6.113  -0.037  -9.562  1.00 0.00 ? 39 ASP A CA   7  
ATOM 8542  C C    . ASP A 1 39 ? -7.091  0.714   -8.658  1.00 0.00 ? 39 ASP A C    7  
ATOM 8543  O O    . ASP A 1 39 ? -7.615  1.757   -9.050  1.00 0.00 ? 39 ASP A O    7  
ATOM 8544  C CB   . ASP A 1 39 ? -6.678  -1.407  -9.945  1.00 0.00 ? 39 ASP A CB   7  
ATOM 8545  C CG   . ASP A 1 39 ? -8.048  -1.264  -10.598 1.00 0.00 ? 39 ASP A CG   7  
ATOM 8546  O OD1  . ASP A 1 39 ? -8.073  -0.902  -11.794 1.00 0.00 ? 39 ASP A OD1  7  
ATOM 8547  O OD2  . ASP A 1 39 ? -9.044  -1.517  -9.887  1.00 0.00 ? 39 ASP A OD2  7  
ATOM 8548  H H    . ASP A 1 39 ? -4.434  -1.149  -8.870  1.00 0.00 ? 39 ASP A H    7  
ATOM 8549  H HA   . ASP A 1 39 ? -5.961  0.545   -10.470 1.00 0.00 ? 39 ASP A HA   7  
ATOM 8550  H HB2  . ASP A 1 39 ? -5.997  -1.893  -10.645 1.00 0.00 ? 39 ASP A HB2  7  
ATOM 8551  H HB3  . ASP A 1 39 ? -6.770  -2.023  -9.051  1.00 0.00 ? 39 ASP A HB3  7  
ATOM 8552  N N    . GLU A 1 40 ? -7.341  0.186   -7.455  1.00 0.00 ? 40 GLU A N    7  
ATOM 8553  C CA   . GLU A 1 40 ? -8.285  0.800   -6.532  1.00 0.00 ? 40 GLU A CA   7  
ATOM 8554  C C    . GLU A 1 40 ? -7.856  2.230   -6.191  1.00 0.00 ? 40 GLU A C    7  
ATOM 8555  O O    . GLU A 1 40 ? -8.694  3.128   -6.118  1.00 0.00 ? 40 GLU A O    7  
ATOM 8556  C CB   . GLU A 1 40 ? -8.392  -0.049  -5.260  1.00 0.00 ? 40 GLU A CB   7  
ATOM 8557  C CG   . GLU A 1 40 ? -9.675  0.343   -4.497  1.00 0.00 ? 40 GLU A CG   7  
ATOM 8558  C CD   . GLU A 1 40 ? -10.505 -0.874  -4.085  1.00 0.00 ? 40 GLU A CD   7  
ATOM 8559  O OE1  . GLU A 1 40 ? -10.513 -1.859  -4.852  1.00 0.00 ? 40 GLU A OE1  7  
ATOM 8560  O OE2  . GLU A 1 40 ? -11.124 -0.792  -3.001  1.00 0.00 ? 40 GLU A OE2  7  
ATOM 8561  H H    . GLU A 1 40 ? -6.876  -0.667  -7.174  1.00 0.00 ? 40 GLU A H    7  
ATOM 8562  H HA   . GLU A 1 40 ? -9.263  0.833   -7.014  1.00 0.00 ? 40 GLU A HA   7  
ATOM 8563  H HB2  . GLU A 1 40 ? -8.420  -1.106  -5.528  1.00 0.00 ? 40 GLU A HB2  7  
ATOM 8564  H HB3  . GLU A 1 40 ? -7.524  0.136   -4.628  1.00 0.00 ? 40 GLU A HB3  7  
ATOM 8565  H HG2  . GLU A 1 40 ? -9.396  0.900   -3.604  1.00 0.00 ? 40 GLU A HG2  7  
ATOM 8566  H HG3  . GLU A 1 40 ? -10.288 0.983   -5.130  1.00 0.00 ? 40 GLU A HG3  7  
ATOM 8567  N N    . THR A 1 41 ? -6.552  2.442   -5.979  1.00 0.00 ? 41 THR A N    7  
ATOM 8568  C CA   . THR A 1 41 ? -6.026  3.760   -5.634  1.00 0.00 ? 41 THR A CA   7  
ATOM 8569  C C    . THR A 1 41 ? -5.826  4.621   -6.888  1.00 0.00 ? 41 THR A C    7  
ATOM 8570  O O    . THR A 1 41 ? -5.271  5.702   -6.783  1.00 0.00 ? 41 THR A O    7  
ATOM 8571  C CB   . THR A 1 41 ? -4.714  3.602   -4.861  1.00 0.00 ? 41 THR A CB   7  
ATOM 8572  O OG1  . THR A 1 41 ? -3.817  2.802   -5.598  1.00 0.00 ? 41 THR A OG1  7  
ATOM 8573  C CG2  . THR A 1 41 ? -4.980  2.958   -3.497  1.00 0.00 ? 41 THR A CG2  7  
ATOM 8574  H H    . THR A 1 41 ? -5.901  1.670   -6.056  1.00 0.00 ? 41 THR A H    7  
ATOM 8575  H HA   . THR A 1 41 ? -6.734  4.272   -4.988  1.00 0.00 ? 41 THR A HA   7  
ATOM 8576  H HB   . THR A 1 41 ? -4.276  4.580   -4.704  1.00 0.00 ? 41 THR A HB   7  
ATOM 8577  H HG1  . THR A 1 41 ? -4.145  1.897   -5.604  1.00 0.00 ? 41 THR A HG1  7  
ATOM 8578  H HG21 . THR A 1 41 ? -5.042  3.736   -2.732  1.00 0.00 ? 41 THR A HG21 7  
ATOM 8579  H HG22 . THR A 1 41 ? -5.916  2.403   -3.526  1.00 0.00 ? 41 THR A HG22 7  
ATOM 8580  H HG23 . THR A 1 41 ? -4.166  2.279   -3.254  1.00 0.00 ? 41 THR A HG23 7  
ATOM 8581  N N    . GLN A 1 42 ? -6.282  4.142   -8.068  1.00 0.00 ? 42 GLN A N    7  
ATOM 8582  C CA   . GLN A 1 42 ? -6.180  4.884   -9.338  1.00 0.00 ? 42 GLN A CA   7  
ATOM 8583  C C    . GLN A 1 42 ? -4.713  5.000   -9.814  1.00 0.00 ? 42 GLN A C    7  
ATOM 8584  O O    . GLN A 1 42 ? -4.467  5.389   -10.955 1.00 0.00 ? 42 GLN A O    7  
ATOM 8585  C CB   . GLN A 1 42 ? -6.866  6.272   -9.184  1.00 0.00 ? 42 GLN A CB   7  
ATOM 8586  C CG   . GLN A 1 42 ? -6.535  7.203   -10.365 1.00 0.00 ? 42 GLN A CG   7  
ATOM 8587  C CD   . GLN A 1 42 ? -5.224  7.970   -10.149 1.00 0.00 ? 42 GLN A CD   7  
ATOM 8588  O OE1  . GLN A 1 42 ? -4.614  7.896   -9.083  1.00 0.00 ? 42 GLN A OE1  7  
ATOM 8589  N NE2  . GLN A 1 42 ? -4.793  8.710   -11.169 1.00 0.00 ? 42 GLN A NE2  7  
ATOM 8590  H H    . GLN A 1 42 ? -6.723  3.232   -8.095  1.00 0.00 ? 42 GLN A H    7  
ATOM 8591  H HA   . GLN A 1 42 ? -6.728  4.323   -10.095 1.00 0.00 ? 42 GLN A HA   7  
ATOM 8592  H HB2  . GLN A 1 42 ? -7.945  6.123   -9.148  1.00 0.00 ? 42 GLN A HB2  7  
ATOM 8593  H HB3  . GLN A 1 42 ? -6.551  6.748   -8.264  1.00 0.00 ? 42 GLN A HB3  7  
ATOM 8594  H HG2  . GLN A 1 42 ? -6.464  6.615   -11.277 1.00 0.00 ? 42 GLN A HG2  7  
ATOM 8595  H HG3  . GLN A 1 42 ? -7.343  7.925   -10.475 1.00 0.00 ? 42 GLN A HG3  7  
ATOM 8596  H HE21 . GLN A 1 42 ? -5.321  8.739   -12.030 1.00 0.00 ? 42 GLN A HE21 7  
ATOM 8597  H HE22 . GLN A 1 42 ? -3.940  9.241   -11.081 1.00 0.00 ? 42 GLN A HE22 7  
ATOM 8598  N N    . HIS A 1 43 ? -3.740  4.667   -8.959  1.00 0.00 ? 43 HIS A N    7  
ATOM 8599  C CA   . HIS A 1 43 ? -2.330  4.803   -9.301  1.00 0.00 ? 43 HIS A CA   7  
ATOM 8600  C C    . HIS A 1 43 ? -1.856  3.666   -10.226 1.00 0.00 ? 43 HIS A C    7  
ATOM 8601  O O    . HIS A 1 43 ? -0.720  3.222   -10.113 1.00 0.00 ? 43 HIS A O    7  
ATOM 8602  C CB   . HIS A 1 43 ? -1.503  4.803   -8.007  1.00 0.00 ? 43 HIS A CB   7  
ATOM 8603  C CG   . HIS A 1 43 ? -2.084  5.658   -6.913  1.00 0.00 ? 43 HIS A CG   7  
ATOM 8604  N ND1  . HIS A 1 43 ? -2.746  6.857   -7.148  1.00 0.00 ? 43 HIS A ND1  7  
ATOM 8605  C CD2  . HIS A 1 43 ? -2.122  5.499   -5.554  1.00 0.00 ? 43 HIS A CD2  7  
ATOM 8606  C CE1  . HIS A 1 43 ? -3.129  7.327   -5.942  1.00 0.00 ? 43 HIS A CE1  7  
ATOM 8607  N NE2  . HIS A 1 43 ? -2.777  6.544   -4.928  1.00 0.00 ? 43 HIS A NE2  7  
ATOM 8608  H H    . HIS A 1 43 ? -3.976  4.321   -8.043  1.00 0.00 ? 43 HIS A H    7  
ATOM 8609  H HA   . HIS A 1 43 ? -2.181  5.755   -9.813  1.00 0.00 ? 43 HIS A HA   7  
ATOM 8610  H HB2  . HIS A 1 43 ? -1.437  3.781   -7.639  1.00 0.00 ? 43 HIS A HB2  7  
ATOM 8611  H HB3  . HIS A 1 43 ? -0.500  5.160   -8.229  1.00 0.00 ? 43 HIS A HB3  7  
ATOM 8612  H HD1  . HIS A 1 43 ? -2.914  7.291   -8.047  1.00 0.00 ? 43 HIS A HD1  7  
ATOM 8613  H HD2  . HIS A 1 43 ? -1.706  4.652   -5.034  1.00 0.00 ? 43 HIS A HD2  7  
ATOM 8614  H HE1  . HIS A 1 43 ? -3.683  8.237   -5.813  1.00 0.00 ? 43 HIS A HE1  7  
ATOM 8615  N N    . LEU A 1 44 ? -2.706  3.189   -11.144 1.00 0.00 ? 44 LEU A N    7  
ATOM 8616  C CA   . LEU A 1 44 ? -2.317  2.109   -12.048 1.00 0.00 ? 44 LEU A CA   7  
ATOM 8617  C C    . LEU A 1 44 ? -1.242  2.610   -13.010 1.00 0.00 ? 44 LEU A C    7  
ATOM 8618  O O    . LEU A 1 44 ? -0.210  1.953   -13.188 1.00 0.00 ? 44 LEU A O    7  
ATOM 8619  C CB   . LEU A 1 44 ? -3.547  1.580   -12.796 1.00 0.00 ? 44 LEU A CB   7  
ATOM 8620  C CG   . LEU A 1 44 ? -3.567  0.044   -12.727 1.00 0.00 ? 44 LEU A CG   7  
ATOM 8621  C CD1  . LEU A 1 44 ? -4.898  -0.472  -13.277 1.00 0.00 ? 44 LEU A CD1  7  
ATOM 8622  C CD2  . LEU A 1 44 ? -2.418  -0.532  -13.561 1.00 0.00 ? 44 LEU A CD2  7  
ATOM 8623  H H    . LEU A 1 44 ? -3.636  3.575   -11.221 1.00 0.00 ? 44 LEU A H    7  
ATOM 8624  H HA   . LEU A 1 44 ? -1.896  1.298   -11.465 1.00 0.00 ? 44 LEU A HA   7  
ATOM 8625  H HB2  . LEU A 1 44 ? -4.451  1.972   -12.329 1.00 0.00 ? 44 LEU A HB2  7  
ATOM 8626  H HB3  . LEU A 1 44 ? -3.511  1.900   -13.838 1.00 0.00 ? 44 LEU A HB3  7  
ATOM 8627  H HG   . LEU A 1 44 ? -3.455  -0.276  -11.685 1.00 0.00 ? 44 LEU A HG   7  
ATOM 8628  H HD11 . LEU A 1 44 ? -4.986  -0.204  -14.330 1.00 0.00 ? 44 LEU A HD11 7  
ATOM 8629  H HD12 . LEU A 1 44 ? -5.720  -0.024  -12.720 1.00 0.00 ? 44 LEU A HD12 7  
ATOM 8630  H HD13 . LEU A 1 44 ? -4.939  -1.556  -13.174 1.00 0.00 ? 44 LEU A HD13 7  
ATOM 8631  H HD21 . LEU A 1 44 ? -2.534  -1.613  -13.638 1.00 0.00 ? 44 LEU A HD21 7  
ATOM 8632  H HD22 . LEU A 1 44 ? -1.468  -0.306  -13.080 1.00 0.00 ? 44 LEU A HD22 7  
ATOM 8633  H HD23 . LEU A 1 44 ? -2.434  -0.094  -14.559 1.00 0.00 ? 44 LEU A HD23 7  
ATOM 8634  N N    . ASP A 1 45 ? -1.474  3.780   -13.617 1.00 0.00 ? 45 ASP A N    7  
ATOM 8635  C CA   . ASP A 1 45 ? -0.517  4.378   -14.535 1.00 0.00 ? 45 ASP A CA   7  
ATOM 8636  C C    . ASP A 1 45 ? 0.503   5.213   -13.746 1.00 0.00 ? 45 ASP A C    7  
ATOM 8637  O O    . ASP A 1 45 ? 0.926   6.277   -14.195 1.00 0.00 ? 45 ASP A O    7  
ATOM 8638  C CB   . ASP A 1 45 ? -1.275  5.239   -15.555 1.00 0.00 ? 45 ASP A CB   7  
ATOM 8639  C CG   . ASP A 1 45 ? -0.358  5.699   -16.686 1.00 0.00 ? 45 ASP A CG   7  
ATOM 8640  O OD1  . ASP A 1 45 ? 0.474   4.871   -17.120 1.00 0.00 ? 45 ASP A OD1  7  
ATOM 8641  O OD2  . ASP A 1 45 ? -0.509  6.870   -17.097 1.00 0.00 ? 45 ASP A OD2  7  
ATOM 8642  H H    . ASP A 1 45 ? -2.336  4.273   -13.436 1.00 0.00 ? 45 ASP A H    7  
ATOM 8643  H HA   . ASP A 1 45 ? 0.010   3.584   -15.064 1.00 0.00 ? 45 ASP A HA   7  
ATOM 8644  H HB2  . ASP A 1 45 ? -2.092  4.655   -15.978 1.00 0.00 ? 45 ASP A HB2  7  
ATOM 8645  H HB3  . ASP A 1 45 ? -1.687  6.114   -15.049 1.00 0.00 ? 45 ASP A HB3  7  
ATOM 8646  N N    . ILE A 1 46 ? 0.900   4.723   -12.563 1.00 0.00 ? 46 ILE A N    7  
ATOM 8647  C CA   . ILE A 1 46 ? 1.871   5.411   -11.730 1.00 0.00 ? 46 ILE A CA   7  
ATOM 8648  C C    . ILE A 1 46 ? 3.258   5.282   -12.351 1.00 0.00 ? 46 ILE A C    7  
ATOM 8649  O O    . ILE A 1 46 ? 3.570   4.269   -12.979 1.00 0.00 ? 46 ILE A O    7  
ATOM 8650  C CB   . ILE A 1 46 ? 1.840   4.839   -10.308 1.00 0.00 ? 46 ILE A CB   7  
ATOM 8651  C CG1  . ILE A 1 46 ? 2.764   5.649   -9.394  1.00 0.00 ? 46 ILE A CG1  7  
ATOM 8652  C CG2  . ILE A 1 46 ? 2.274   3.372   -10.320 1.00 0.00 ? 46 ILE A CG2  7  
ATOM 8653  C CD1  . ILE A 1 46 ? 2.831   4.998   -8.014  1.00 0.00 ? 46 ILE A CD1  7  
ATOM 8654  H H    . ILE A 1 46 ? 0.522   3.848   -12.232 1.00 0.00 ? 46 ILE A H    7  
ATOM 8655  H HA   . ILE A 1 46 ? 1.604   6.457   -11.675 1.00 0.00 ? 46 ILE A HA   7  
ATOM 8656  H HB   . ILE A 1 46 ? 0.831   4.913   -9.928  1.00 0.00 ? 46 ILE A HB   7  
ATOM 8657  H HG12 . ILE A 1 46 ? 3.762   5.682   -9.820  1.00 0.00 ? 46 ILE A HG12 7  
ATOM 8658  H HG13 . ILE A 1 46 ? 2.377   6.664   -9.298  1.00 0.00 ? 46 ILE A HG13 7  
ATOM 8659  H HG21 . ILE A 1 46 ? 3.347   3.313   -10.489 1.00 0.00 ? 46 ILE A HG21 7  
ATOM 8660  H HG22 . ILE A 1 46 ? 2.033   2.911   -9.362  1.00 0.00 ? 46 ILE A HG22 7  
ATOM 8661  H HG23 . ILE A 1 46 ? 1.752   2.845   -11.113 1.00 0.00 ? 46 ILE A HG23 7  
ATOM 8662  H HD11 . ILE A 1 46 ? 3.486   4.126   -8.053  1.00 0.00 ? 46 ILE A HD11 7  
ATOM 8663  H HD12 . ILE A 1 46 ? 1.832   4.690   -7.706  1.00 0.00 ? 46 ILE A HD12 7  
ATOM 8664  H HD13 . ILE A 1 46 ? 3.225   5.716   -7.296  1.00 0.00 ? 46 ILE A HD13 7  
ATOM 8665  N N    . GLY A 1 47 ? 4.088   6.312   -12.169 1.00 0.00 ? 47 GLY A N    7  
ATOM 8666  C CA   . GLY A 1 47 ? 5.443   6.313   -12.686 1.00 0.00 ? 47 GLY A CA   7  
ATOM 8667  C C    . GLY A 1 47 ? 6.196   5.091   -12.164 1.00 0.00 ? 47 GLY A C    7  
ATOM 8668  O O    . GLY A 1 47 ? 6.077   4.743   -10.987 1.00 0.00 ? 47 GLY A O    7  
ATOM 8669  H H    . GLY A 1 47 ? 3.771   7.117   -11.649 1.00 0.00 ? 47 GLY A H    7  
ATOM 8670  H HA2  . GLY A 1 47 ? 5.414   6.285   -13.776 1.00 0.00 ? 47 GLY A HA2  7  
ATOM 8671  H HA3  . GLY A 1 47 ? 5.955   7.218   -12.362 1.00 0.00 ? 47 GLY A HA3  7  
ATOM 8672  N N    . LEU A 1 48 ? 6.967   4.440   -13.042 1.00 0.00 ? 48 LEU A N    7  
ATOM 8673  C CA   . LEU A 1 48 ? 7.722   3.250   -12.679 1.00 0.00 ? 48 LEU A CA   7  
ATOM 8674  C C    . LEU A 1 48 ? 8.630   3.537   -11.482 1.00 0.00 ? 48 LEU A C    7  
ATOM 8675  O O    . LEU A 1 48 ? 8.875   2.653   -10.668 1.00 0.00 ? 48 LEU A O    7  
ATOM 8676  C CB   . LEU A 1 48 ? 8.538   2.783   -13.892 1.00 0.00 ? 48 LEU A CB   7  
ATOM 8677  C CG   . LEU A 1 48 ? 9.212   1.434   -13.592 1.00 0.00 ? 48 LEU A CG   7  
ATOM 8678  C CD1  . LEU A 1 48 ? 9.074   0.511   -14.805 1.00 0.00 ? 48 LEU A CD1  7  
ATOM 8679  C CD2  . LEU A 1 48 ? 10.699  1.649   -13.287 1.00 0.00 ? 48 LEU A CD2  7  
ATOM 8680  H H    . LEU A 1 48 ? 7.032   4.775   -13.993 1.00 0.00 ? 48 LEU A H    7  
ATOM 8681  H HA   . LEU A 1 48 ? 7.016   2.466   -12.403 1.00 0.00 ? 48 LEU A HA   7  
ATOM 8682  H HB2  . LEU A 1 48 ? 7.872   2.670   -14.748 1.00 0.00 ? 48 LEU A HB2  7  
ATOM 8683  H HB3  . LEU A 1 48 ? 9.300   3.529   -14.126 1.00 0.00 ? 48 LEU A HB3  7  
ATOM 8684  H HG   . LEU A 1 48 ? 8.732   0.967   -12.732 1.00 0.00 ? 48 LEU A HG   7  
ATOM 8685  H HD11 . LEU A 1 48 ? 8.019   0.322   -15.000 1.00 0.00 ? 48 LEU A HD11 7  
ATOM 8686  H HD12 . LEU A 1 48 ? 9.526   0.985   -15.678 1.00 0.00 ? 48 LEU A HD12 7  
ATOM 8687  H HD13 . LEU A 1 48 ? 9.580   -0.433  -14.603 1.00 0.00 ? 48 LEU A HD13 7  
ATOM 8688  H HD21 . LEU A 1 48 ? 11.164  0.692   -13.045 1.00 0.00 ? 48 LEU A HD21 7  
ATOM 8689  H HD22 . LEU A 1 48 ? 10.808  2.327   -12.443 1.00 0.00 ? 48 LEU A HD22 7  
ATOM 8690  H HD23 . LEU A 1 48 ? 11.192  2.078   -14.162 1.00 0.00 ? 48 LEU A HD23 7  
ATOM 8691  N N    . LYS A 1 49 ? 9.122   4.779   -11.376 1.00 0.00 ? 49 LYS A N    7  
ATOM 8692  C CA   . LYS A 1 49 ? 9.983   5.182   -10.274 1.00 0.00 ? 49 LYS A CA   7  
ATOM 8693  C C    . LYS A 1 49 ? 9.304   4.866   -8.935  1.00 0.00 ? 49 LYS A C    7  
ATOM 8694  O O    . LYS A 1 49 ? 9.966   4.444   -7.988  1.00 0.00 ? 49 LYS A O    7  
ATOM 8695  C CB   . LYS A 1 49 ? 10.279  6.682   -10.398 1.00 0.00 ? 49 LYS A CB   7  
ATOM 8696  C CG   . LYS A 1 49 ? 11.392  7.081   -9.423  1.00 0.00 ? 49 LYS A CG   7  
ATOM 8697  C CD   . LYS A 1 49 ? 11.746  8.559   -9.633  1.00 0.00 ? 49 LYS A CD   7  
ATOM 8698  C CE   . LYS A 1 49 ? 13.006  8.917   -8.835  1.00 0.00 ? 49 LYS A CE   7  
ATOM 8699  N NZ   . LYS A 1 49 ? 12.762  8.856   -7.382  1.00 0.00 ? 49 LYS A NZ   7  
ATOM 8700  H H    . LYS A 1 49 ? 8.893   5.467   -12.078 1.00 0.00 ? 49 LYS A H    7  
ATOM 8701  H HA   . LYS A 1 49 ? 10.920  4.627   -10.336 1.00 0.00 ? 49 LYS A HA   7  
ATOM 8702  H HB2  . LYS A 1 49 ? 10.598  6.902   -11.417 1.00 0.00 ? 49 LYS A HB2  7  
ATOM 8703  H HB3  . LYS A 1 49 ? 9.376   7.250   -10.171 1.00 0.00 ? 49 LYS A HB3  7  
ATOM 8704  H HG2  . LYS A 1 49 ? 11.052  6.928   -8.399  1.00 0.00 ? 49 LYS A HG2  7  
ATOM 8705  H HG3  . LYS A 1 49 ? 12.274  6.467   -9.609  1.00 0.00 ? 49 LYS A HG3  7  
ATOM 8706  H HD2  . LYS A 1 49 ? 11.931  8.739   -10.693 1.00 0.00 ? 49 LYS A HD2  7  
ATOM 8707  H HD3  . LYS A 1 49 ? 10.915  9.183   -9.301  1.00 0.00 ? 49 LYS A HD3  7  
ATOM 8708  H HE2  . LYS A 1 49 ? 13.804  8.219   -9.093  1.00 0.00 ? 49 LYS A HE2  7  
ATOM 8709  H HE3  . LYS A 1 49 ? 13.320  9.928   -9.100  1.00 0.00 ? 49 LYS A HE3  7  
ATOM 8710  H HZ1  . LYS A 1 49 ? 13.625  9.032   -6.888  1.00 0.00 ? 49 LYS A HZ1  7  
ATOM 8711  H HZ2  . LYS A 1 49 ? 12.078  9.559   -7.122  1.00 0.00 ? 49 LYS A HZ2  7  
ATOM 8712  H HZ3  . LYS A 1 49 ? 12.414  7.941   -7.136  1.00 0.00 ? 49 LYS A HZ3  7  
ATOM 8713  N N    . GLN A 1 50 ? 7.981   5.075   -8.863  1.00 0.00 ? 50 GLN A N    7  
ATOM 8714  C CA   . GLN A 1 50 ? 7.219   4.821   -7.651  1.00 0.00 ? 50 GLN A CA   7  
ATOM 8715  C C    . GLN A 1 50 ? 6.779   3.354   -7.603  1.00 0.00 ? 50 GLN A C    7  
ATOM 8716  O O    . GLN A 1 50 ? 6.879   2.720   -6.561  1.00 0.00 ? 50 GLN A O    7  
ATOM 8717  C CB   . GLN A 1 50 ? 6.011   5.757   -7.604  1.00 0.00 ? 50 GLN A CB   7  
ATOM 8718  C CG   . GLN A 1 50 ? 6.482   7.208   -7.456  1.00 0.00 ? 50 GLN A CG   7  
ATOM 8719  C CD   . GLN A 1 50 ? 5.295   8.158   -7.343  1.00 0.00 ? 50 GLN A CD   7  
ATOM 8720  O OE1  . GLN A 1 50 ? 5.038   8.712   -6.277  1.00 0.00 ? 50 GLN A OE1  7  
ATOM 8721  N NE2  . GLN A 1 50 ? 4.571   8.348   -8.445  1.00 0.00 ? 50 GLN A NE2  7  
ATOM 8722  H H    . GLN A 1 50 ? 7.486   5.417   -9.676  1.00 0.00 ? 50 GLN A H    7  
ATOM 8723  H HA   . GLN A 1 50 ? 7.849   5.026   -6.786  1.00 0.00 ? 50 GLN A HA   7  
ATOM 8724  H HB2  . GLN A 1 50 ? 5.437   5.654   -8.523  1.00 0.00 ? 50 GLN A HB2  7  
ATOM 8725  H HB3  . GLN A 1 50 ? 5.385   5.493   -6.752  1.00 0.00 ? 50 GLN A HB3  7  
ATOM 8726  H HG2  . GLN A 1 50 ? 7.096   7.295   -6.559  1.00 0.00 ? 50 GLN A HG2  7  
ATOM 8727  H HG3  . GLN A 1 50 ? 7.080   7.484   -8.324  1.00 0.00 ? 50 GLN A HG3  7  
ATOM 8728  H HE21 . GLN A 1 50 ? 4.818   7.869   -9.299  1.00 0.00 ? 50 GLN A HE21 7  
ATOM 8729  H HE22 . GLN A 1 50 ? 3.777   8.970   -8.424  1.00 0.00 ? 50 GLN A HE22 7  
ATOM 8730  N N    . LYS A 1 51 ? 6.294   2.817   -8.735  1.00 0.00 ? 51 LYS A N    7  
ATOM 8731  C CA   . LYS A 1 51 ? 5.861   1.421   -8.818  1.00 0.00 ? 51 LYS A CA   7  
ATOM 8732  C C    . LYS A 1 51 ? 6.954   0.492   -8.283  1.00 0.00 ? 51 LYS A C    7  
ATOM 8733  O O    . LYS A 1 51 ? 6.680   -0.387  -7.467  1.00 0.00 ? 51 LYS A O    7  
ATOM 8734  C CB   . LYS A 1 51 ? 5.536   1.083   -10.280 1.00 0.00 ? 51 LYS A CB   7  
ATOM 8735  C CG   . LYS A 1 51 ? 4.746   -0.230  -10.356 1.00 0.00 ? 51 LYS A CG   7  
ATOM 8736  C CD   . LYS A 1 51 ? 4.169   -0.425  -11.769 1.00 0.00 ? 51 LYS A CD   7  
ATOM 8737  C CE   . LYS A 1 51 ? 3.097   0.639   -12.048 1.00 0.00 ? 51 LYS A CE   7  
ATOM 8738  N NZ   . LYS A 1 51 ? 2.147   0.198   -13.088 1.00 0.00 ? 51 LYS A NZ   7  
ATOM 8739  H H    . LYS A 1 51 ? 6.218   3.388   -9.566  1.00 0.00 ? 51 LYS A H    7  
ATOM 8740  H HA   . LYS A 1 51 ? 4.962   1.294   -8.214  1.00 0.00 ? 51 LYS A HA   7  
ATOM 8741  H HB2  . LYS A 1 51 ? 4.945   1.887   -10.710 1.00 0.00 ? 51 LYS A HB2  7  
ATOM 8742  H HB3  . LYS A 1 51 ? 6.462   0.980   -10.842 1.00 0.00 ? 51 LYS A HB3  7  
ATOM 8743  H HG2  . LYS A 1 51 ? 5.411   -1.064  -10.120 1.00 0.00 ? 51 LYS A HG2  7  
ATOM 8744  H HG3  . LYS A 1 51 ? 3.932   -0.207  -9.632  1.00 0.00 ? 51 LYS A HG3  7  
ATOM 8745  H HD2  . LYS A 1 51 ? 4.971   -0.337  -12.505 1.00 0.00 ? 51 LYS A HD2  7  
ATOM 8746  H HD3  . LYS A 1 51 ? 3.722   -1.417  -11.839 1.00 0.00 ? 51 LYS A HD3  7  
ATOM 8747  H HE2  . LYS A 1 51 ? 2.549   0.832   -11.132 1.00 0.00 ? 51 LYS A HE2  7  
ATOM 8748  H HE3  . LYS A 1 51 ? 3.581   1.559   -12.377 1.00 0.00 ? 51 LYS A HE3  7  
ATOM 8749  H HZ1  . LYS A 1 51 ? 1.422   0.900   -13.205 1.00 0.00 ? 51 LYS A HZ1  7  
ATOM 8750  H HZ2  . LYS A 1 51 ? 1.725   -0.676  -12.811 1.00 0.00 ? 51 LYS A HZ2  7  
ATOM 8751  H HZ3  . LYS A 1 51 ? 2.637   0.073   -13.963 1.00 0.00 ? 51 LYS A HZ3  7  
ATOM 8752  N N    . GLN A 1 52 ? 8.190   0.692   -8.747  1.00 0.00 ? 52 GLN A N    7  
ATOM 8753  C CA   . GLN A 1 52 ? 9.317   -0.121  -8.323  1.00 0.00 ? 52 GLN A CA   7  
ATOM 8754  C C    . GLN A 1 52 ? 9.601   0.122   -6.842  1.00 0.00 ? 52 GLN A C    7  
ATOM 8755  O O    . GLN A 1 52 ? 9.733   -0.829  -6.076  1.00 0.00 ? 52 GLN A O    7  
ATOM 8756  C CB   . GLN A 1 52 ? 10.540  0.232   -9.183  1.00 0.00 ? 52 GLN A CB   7  
ATOM 8757  C CG   . GLN A 1 52 ? 11.687  -0.746  -8.901  1.00 0.00 ? 52 GLN A CG   7  
ATOM 8758  C CD   . GLN A 1 52 ? 11.332  -2.158  -9.358  1.00 0.00 ? 52 GLN A CD   7  
ATOM 8759  O OE1  . GLN A 1 52 ? 11.075  -3.033  -8.538  1.00 0.00 ? 52 GLN A OE1  7  
ATOM 8760  N NE2  . GLN A 1 52 ? 11.318  -2.378  -10.673 1.00 0.00 ? 52 GLN A NE2  7  
ATOM 8761  H H    . GLN A 1 52 ? 8.359   1.429   -9.416  1.00 0.00 ? 52 GLN A H    7  
ATOM 8762  H HA   . GLN A 1 52 ? 9.068   -1.172  -8.471  1.00 0.00 ? 52 GLN A HA   7  
ATOM 8763  H HB2  . GLN A 1 52 ? 10.269  0.176   -10.238 1.00 0.00 ? 52 GLN A HB2  7  
ATOM 8764  H HB3  . GLN A 1 52 ? 10.866  1.246   -8.950  1.00 0.00 ? 52 GLN A HB3  7  
ATOM 8765  H HG2  . GLN A 1 52 ? 12.578  -0.413  -9.435  1.00 0.00 ? 52 GLN A HG2  7  
ATOM 8766  H HG3  . GLN A 1 52 ? 11.899  -0.757  -7.832  1.00 0.00 ? 52 GLN A HG3  7  
ATOM 8767  H HE21 . GLN A 1 52 ? 11.536  -1.627  -11.311 1.00 0.00 ? 52 GLN A HE21 7  
ATOM 8768  H HE22 . GLN A 1 52 ? 11.090  -3.295  -11.026 1.00 0.00 ? 52 GLN A HE22 7  
ATOM 8769  N N    . TRP A 1 53 ? 9.693   1.399   -6.445  1.00 0.00 ? 53 TRP A N    7  
ATOM 8770  C CA   . TRP A 1 53 ? 9.966   1.773   -5.062  1.00 0.00 ? 53 TRP A CA   7  
ATOM 8771  C C    . TRP A 1 53 ? 9.002   1.059   -4.110  1.00 0.00 ? 53 TRP A C    7  
ATOM 8772  O O    . TRP A 1 53 ? 9.419   0.538   -3.078  1.00 0.00 ? 53 TRP A O    7  
ATOM 8773  C CB   . TRP A 1 53 ? 9.836   3.292   -4.924  1.00 0.00 ? 53 TRP A CB   7  
ATOM 8774  C CG   . TRP A 1 53 ? 9.738   3.784   -3.517  1.00 0.00 ? 53 TRP A CG   7  
ATOM 8775  C CD1  . TRP A 1 53 ? 10.739  3.800   -2.627  1.00 0.00 ? 53 TRP A CD1  7  
ATOM 8776  C CD2  . TRP A 1 53 ? 8.582   4.327   -2.807  1.00 0.00 ? 53 TRP A CD2  7  
ATOM 8777  N NE1  . TRP A 1 53 ? 10.319  4.305   -1.421  1.00 0.00 ? 53 TRP A NE1  7  
ATOM 8778  C CE2  . TRP A 1 53 ? 8.983   4.651   -1.472  1.00 0.00 ? 53 TRP A CE2  7  
ATOM 8779  C CE3  . TRP A 1 53 ? 7.234   4.583   -3.147  1.00 0.00 ? 53 TRP A CE3  7  
ATOM 8780  C CZ2  . TRP A 1 53 ? 8.103   5.193   -0.534  1.00 0.00 ? 53 TRP A CZ2  7  
ATOM 8781  C CZ3  . TRP A 1 53 ? 6.339   5.127   -2.202  1.00 0.00 ? 53 TRP A CZ3  7  
ATOM 8782  C CH2  . TRP A 1 53 ? 6.775   5.433   -0.899  1.00 0.00 ? 53 TRP A CH2  7  
ATOM 8783  H H    . TRP A 1 53 ? 9.572   2.139   -7.123  1.00 0.00 ? 53 TRP A H    7  
ATOM 8784  H HA   . TRP A 1 53 ? 10.987  1.482   -4.811  1.00 0.00 ? 53 TRP A HA   7  
ATOM 8785  H HB2  . TRP A 1 53 ? 10.702  3.757   -5.393  1.00 0.00 ? 53 TRP A HB2  7  
ATOM 8786  H HB3  . TRP A 1 53 ? 8.944   3.611   -5.457  1.00 0.00 ? 53 TRP A HB3  7  
ATOM 8787  H HD1  . TRP A 1 53 ? 11.742  3.448   -2.825  1.00 0.00 ? 53 TRP A HD1  7  
ATOM 8788  H HE1  . TRP A 1 53 ? 10.898  4.415   -0.593  1.00 0.00 ? 53 TRP A HE1  7  
ATOM 8789  H HE3  . TRP A 1 53 ? 6.886   4.359   -4.143  1.00 0.00 ? 53 TRP A HE3  7  
ATOM 8790  H HZ2  . TRP A 1 53 ? 8.445   5.424   0.465   1.00 0.00 ? 53 TRP A HZ2  7  
ATOM 8791  H HZ3  . TRP A 1 53 ? 5.313   5.311   -2.481  1.00 0.00 ? 53 TRP A HZ3  7  
ATOM 8792  H HH2  . TRP A 1 53 ? 6.088   5.856   -0.182  1.00 0.00 ? 53 TRP A HH2  7  
ATOM 8793  N N    . LEU A 1 54 ? 7.712   1.037   -4.458  1.00 0.00 ? 54 LEU A N    7  
ATOM 8794  C CA   . LEU A 1 54 ? 6.702   0.392   -3.635  1.00 0.00 ? 54 LEU A CA   7  
ATOM 8795  C C    . LEU A 1 54 ? 7.062   -1.077  -3.409  1.00 0.00 ? 54 LEU A C    7  
ATOM 8796  O O    . LEU A 1 54 ? 6.890   -1.597  -2.308  1.00 0.00 ? 54 LEU A O    7  
ATOM 8797  C CB   . LEU A 1 54 ? 5.329   0.501   -4.322  1.00 0.00 ? 54 LEU A CB   7  
ATOM 8798  C CG   . LEU A 1 54 ? 4.752   1.915   -4.159  1.00 0.00 ? 54 LEU A CG   7  
ATOM 8799  C CD1  . LEU A 1 54 ? 3.647   2.137   -5.194  1.00 0.00 ? 54 LEU A CD1  7  
ATOM 8800  C CD2  . LEU A 1 54 ? 4.166   2.089   -2.754  1.00 0.00 ? 54 LEU A CD2  7  
ATOM 8801  H H    . LEU A 1 54 ? 7.418   1.480   -5.318  1.00 0.00 ? 54 LEU A H    7  
ATOM 8802  H HA   . LEU A 1 54 ? 6.660   0.894   -2.675  1.00 0.00 ? 54 LEU A HA   7  
ATOM 8803  H HB2  . LEU A 1 54 ? 5.440   0.278   -5.384  1.00 0.00 ? 54 LEU A HB2  7  
ATOM 8804  H HB3  . LEU A 1 54 ? 4.644   -0.221  -3.875  1.00 0.00 ? 54 LEU A HB3  7  
ATOM 8805  H HG   . LEU A 1 54 ? 5.540   2.648   -4.315  1.00 0.00 ? 54 LEU A HG   7  
ATOM 8806  H HD11 . LEU A 1 54 ? 2.865   1.389   -5.059  1.00 0.00 ? 54 LEU A HD11 7  
ATOM 8807  H HD12 . LEU A 1 54 ? 3.221   3.133   -5.066  1.00 0.00 ? 54 LEU A HD12 7  
ATOM 8808  H HD13 . LEU A 1 54 ? 4.064   2.049   -6.197  1.00 0.00 ? 54 LEU A HD13 7  
ATOM 8809  H HD21 . LEU A 1 54 ? 3.437   1.302   -2.561  1.00 0.00 ? 54 LEU A HD21 7  
ATOM 8810  H HD22 . LEU A 1 54 ? 4.962   2.034   -2.014  1.00 0.00 ? 54 LEU A HD22 7  
ATOM 8811  H HD23 . LEU A 1 54 ? 3.676   3.061   -2.682  1.00 0.00 ? 54 LEU A HD23 7  
ATOM 8812  N N    . MET A 1 55 ? 7.550   -1.744  -4.460  1.00 0.00 ? 55 MET A N    7  
ATOM 8813  C CA   . MET A 1 55 ? 7.856   -3.167  -4.412  1.00 0.00 ? 55 MET A CA   7  
ATOM 8814  C C    . MET A 1 55 ? 9.263   -3.451  -3.867  1.00 0.00 ? 55 MET A C    7  
ATOM 8815  O O    . MET A 1 55 ? 9.583   -4.615  -3.635  1.00 0.00 ? 55 MET A O    7  
ATOM 8816  C CB   . MET A 1 55 ? 7.737   -3.743  -5.829  1.00 0.00 ? 55 MET A CB   7  
ATOM 8817  C CG   . MET A 1 55 ? 6.289   -3.665  -6.316  1.00 0.00 ? 55 MET A CG   7  
ATOM 8818  S SD   . MET A 1 55 ? 6.080   -4.094  -8.066  1.00 0.00 ? 55 MET A SD   7  
ATOM 8819  C CE   . MET A 1 55 ? 6.589   -5.830  -8.010  1.00 0.00 ? 55 MET A CE   7  
ATOM 8820  H H    . MET A 1 55 ? 7.700   -1.255  -5.334  1.00 0.00 ? 55 MET A H    7  
ATOM 8821  H HA   . MET A 1 55 ? 7.127   -3.663  -3.770  1.00 0.00 ? 55 MET A HA   7  
ATOM 8822  H HB2  . MET A 1 55 ? 8.377   -3.176  -6.505  1.00 0.00 ? 55 MET A HB2  7  
ATOM 8823  H HB3  . MET A 1 55 ? 8.057   -4.785  -5.820  1.00 0.00 ? 55 MET A HB3  7  
ATOM 8824  H HG2  . MET A 1 55 ? 5.683   -4.343  -5.717  1.00 0.00 ? 55 MET A HG2  7  
ATOM 8825  H HG3  . MET A 1 55 ? 5.924   -2.649  -6.168  1.00 0.00 ? 55 MET A HG3  7  
ATOM 8826  H HE1  . MET A 1 55 ? 6.431   -6.285  -8.988  1.00 0.00 ? 55 MET A HE1  7  
ATOM 8827  H HE2  . MET A 1 55 ? 7.644   -5.893  -7.750  1.00 0.00 ? 55 MET A HE2  7  
ATOM 8828  H HE3  . MET A 1 55 ? 5.996   -6.360  -7.264  1.00 0.00 ? 55 MET A HE3  7  
ATOM 8829  N N    . THR A 1 56 ? 10.115  -2.424  -3.681  1.00 0.00 ? 56 THR A N    7  
ATOM 8830  C CA   . THR A 1 56 ? 11.498  -2.661  -3.248  1.00 0.00 ? 56 THR A CA   7  
ATOM 8831  C C    . THR A 1 56 ? 11.957  -1.688  -2.155  1.00 0.00 ? 56 THR A C    7  
ATOM 8832  O O    . THR A 1 56 ? 13.162  -1.521  -1.967  1.00 0.00 ? 56 THR A O    7  
ATOM 8833  C CB   . THR A 1 56 ? 12.428  -2.558  -4.469  1.00 0.00 ? 56 THR A CB   7  
ATOM 8834  O OG1  . THR A 1 56 ? 12.291  -1.286  -5.064  1.00 0.00 ? 56 THR A OG1  7  
ATOM 8835  C CG2  . THR A 1 56 ? 12.072  -3.638  -5.494  1.00 0.00 ? 56 THR A CG2  7  
ATOM 8836  H H    . THR A 1 56 ? 9.815   -1.473  -3.857  1.00 0.00 ? 56 THR A H    7  
ATOM 8837  H HA   . THR A 1 56 ? 11.573  -3.670  -2.847  1.00 0.00 ? 56 THR A HA   7  
ATOM 8838  H HB   . THR A 1 56 ? 13.461  -2.697  -4.149  1.00 0.00 ? 56 THR A HB   7  
ATOM 8839  H HG1  . THR A 1 56 ? 11.392  -1.198  -5.391  1.00 0.00 ? 56 THR A HG1  7  
ATOM 8840  H HG21 . THR A 1 56 ? 11.080  -3.446  -5.901  1.00 0.00 ? 56 THR A HG21 7  
ATOM 8841  H HG22 . THR A 1 56 ? 12.804  -3.625  -6.302  1.00 0.00 ? 56 THR A HG22 7  
ATOM 8842  H HG23 . THR A 1 56 ? 12.084  -4.616  -5.011  1.00 0.00 ? 56 THR A HG23 7  
ATOM 8843  N N    . GLU A 1 57 ? 11.032  -1.050  -1.423  1.00 0.00 ? 57 GLU A N    7  
ATOM 8844  C CA   . GLU A 1 57 ? 11.431  -0.135  -0.355  1.00 0.00 ? 57 GLU A CA   7  
ATOM 8845  C C    . GLU A 1 57 ? 10.291  0.113   0.633   1.00 0.00 ? 57 GLU A C    7  
ATOM 8846  O O    . GLU A 1 57 ? 10.496  0.015   1.840   1.00 0.00 ? 57 GLU A O    7  
ATOM 8847  C CB   . GLU A 1 57 ? 11.901  1.190   -0.960  1.00 0.00 ? 57 GLU A CB   7  
ATOM 8848  C CG   . GLU A 1 57 ? 12.647  2.010   0.102   1.00 0.00 ? 57 GLU A CG   7  
ATOM 8849  C CD   . GLU A 1 57 ? 13.116  3.348   -0.462  1.00 0.00 ? 57 GLU A CD   7  
ATOM 8850  O OE1  . GLU A 1 57 ? 13.978  3.314   -1.366  1.00 0.00 ? 57 GLU A OE1  7  
ATOM 8851  O OE2  . GLU A 1 57 ? 12.598  4.383   0.018   1.00 0.00 ? 57 GLU A OE2  7  
ATOM 8852  H H    . GLU A 1 57 ? 10.049  -1.198  -1.601  1.00 0.00 ? 57 GLU A H    7  
ATOM 8853  H HA   . GLU A 1 57 ? 12.262  -0.581  0.185   1.00 0.00 ? 57 GLU A HA   7  
ATOM 8854  H HB2  . GLU A 1 57 ? 12.571  0.993   -1.799  1.00 0.00 ? 57 GLU A HB2  7  
ATOM 8855  H HB3  . GLU A 1 57 ? 11.040  1.746   -1.310  1.00 0.00 ? 57 GLU A HB3  7  
ATOM 8856  H HG2  . GLU A 1 57 ? 11.982  2.194   0.946   1.00 0.00 ? 57 GLU A HG2  7  
ATOM 8857  H HG3  . GLU A 1 57 ? 13.514  1.447   0.447   1.00 0.00 ? 57 GLU A HG3  7  
ATOM 8858  N N    . ALA A 1 58 ? 9.099   0.452   0.132   1.00 0.00 ? 58 ALA A N    7  
ATOM 8859  C CA   . ALA A 1 58 ? 7.976   0.790   0.999   1.00 0.00 ? 58 ALA A CA   7  
ATOM 8860  C C    . ALA A 1 58 ? 7.258   -0.460  1.518   1.00 0.00 ? 58 ALA A C    7  
ATOM 8861  O O    . ALA A 1 58 ? 7.422   -0.828  2.677   1.00 0.00 ? 58 ALA A O    7  
ATOM 8862  C CB   . ALA A 1 58 ? 7.004   1.691   0.239   1.00 0.00 ? 58 ALA A CB   7  
ATOM 8863  H H    . ALA A 1 58 ? 8.967   0.496   -0.871  1.00 0.00 ? 58 ALA A H    7  
ATOM 8864  H HA   . ALA A 1 58 ? 8.357   1.347   1.856   1.00 0.00 ? 58 ALA A HA   7  
ATOM 8865  H HB1  . ALA A 1 58 ? 7.536   2.564   -0.135  1.00 0.00 ? 58 ALA A HB1  7  
ATOM 8866  H HB2  . ALA A 1 58 ? 6.207   2.011   0.909   1.00 0.00 ? 58 ALA A HB2  7  
ATOM 8867  H HB3  . ALA A 1 58 ? 6.577   1.145   -0.595  1.00 0.00 ? 58 ALA A HB3  7  
ATOM 8868  N N    . LEU A 1 59 ? 6.441   -1.093  0.665   1.00 0.00 ? 59 LEU A N    7  
ATOM 8869  C CA   . LEU A 1 59 ? 5.612   -2.231  1.066   1.00 0.00 ? 59 LEU A CA   7  
ATOM 8870  C C    . LEU A 1 59 ? 6.454   -3.364  1.656   1.00 0.00 ? 59 LEU A C    7  
ATOM 8871  O O    . LEU A 1 59 ? 5.976   -4.094  2.521   1.00 0.00 ? 59 LEU A O    7  
ATOM 8872  C CB   . LEU A 1 59 ? 4.813   -2.736  -0.141  1.00 0.00 ? 59 LEU A CB   7  
ATOM 8873  C CG   . LEU A 1 59 ? 4.011   -1.595  -0.792  1.00 0.00 ? 59 LEU A CG   7  
ATOM 8874  C CD1  . LEU A 1 59 ? 3.158   -2.169  -1.923  1.00 0.00 ? 59 LEU A CD1  7  
ATOM 8875  C CD2  . LEU A 1 59 ? 3.099   -0.929  0.242   1.00 0.00 ? 59 LEU A CD2  7  
ATOM 8876  H H    . LEU A 1 59 ? 6.374   -0.771  -0.289  1.00 0.00 ? 59 LEU A H    7  
ATOM 8877  H HA   . LEU A 1 59 ? 4.912   -1.896  1.828   1.00 0.00 ? 59 LEU A HA   7  
ATOM 8878  H HB2  . LEU A 1 59 ? 5.497   -3.160  -0.875  1.00 0.00 ? 59 LEU A HB2  7  
ATOM 8879  H HB3  . LEU A 1 59 ? 4.123   -3.509  0.193   1.00 0.00 ? 59 LEU A HB3  7  
ATOM 8880  H HG   . LEU A 1 59 ? 4.693   -0.852  -1.202  1.00 0.00 ? 59 LEU A HG   7  
ATOM 8881  H HD11 . LEU A 1 59 ? 2.649   -1.359  -2.445  1.00 0.00 ? 59 LEU A HD11 7  
ATOM 8882  H HD12 . LEU A 1 59 ? 2.418   -2.856  -1.511  1.00 0.00 ? 59 LEU A HD12 7  
ATOM 8883  H HD13 . LEU A 1 59 ? 3.798   -2.704  -2.623  1.00 0.00 ? 59 LEU A HD13 7  
ATOM 8884  H HD21 . LEU A 1 59 ? 2.584   -1.695  0.819   1.00 0.00 ? 59 LEU A HD21 7  
ATOM 8885  H HD22 . LEU A 1 59 ? 3.694   -0.307  0.910   1.00 0.00 ? 59 LEU A HD22 7  
ATOM 8886  H HD23 . LEU A 1 59 ? 2.363   -0.306  -0.270  1.00 0.00 ? 59 LEU A HD23 7  
ATOM 8887  N N    . VAL A 1 60 ? 7.697   -3.514  1.190   1.00 0.00 ? 60 VAL A N    7  
ATOM 8888  C CA   . VAL A 1 60 ? 8.583   -4.574  1.663   1.00 0.00 ? 60 VAL A CA   7  
ATOM 8889  C C    . VAL A 1 60 ? 8.803   -4.491  3.182   1.00 0.00 ? 60 VAL A C    7  
ATOM 8890  O O    . VAL A 1 60 ? 9.174   -5.489  3.797   1.00 0.00 ? 60 VAL A O    7  
ATOM 8891  C CB   . VAL A 1 60 ? 9.926   -4.505  0.916   1.00 0.00 ? 60 VAL A CB   7  
ATOM 8892  C CG1  . VAL A 1 60 ? 9.720   -4.903  -0.546  1.00 0.00 ? 60 VAL A CG1  7  
ATOM 8893  C CG2  . VAL A 1 60 ? 10.500  -3.091  0.983   1.00 0.00 ? 60 VAL A CG2  7  
ATOM 8894  H H    . VAL A 1 60 ? 8.040   -2.883  0.484   1.00 0.00 ? 60 VAL A H    7  
ATOM 8895  H HA   . VAL A 1 60 ? 8.118   -5.535  1.441   1.00 0.00 ? 60 VAL A HA   7  
ATOM 8896  H HB   . VAL A 1 60 ? 10.631  -5.193  1.379   1.00 0.00 ? 60 VAL A HB   7  
ATOM 8897  H HG11 . VAL A 1 60 ? 9.045   -4.196  -1.027  1.00 0.00 ? 60 VAL A HG11 7  
ATOM 8898  H HG12 . VAL A 1 60 ? 9.291   -5.905  -0.594  1.00 0.00 ? 60 VAL A HG12 7  
ATOM 8899  H HG13 . VAL A 1 60 ? 10.680  -4.897  -1.062  1.00 0.00 ? 60 VAL A HG13 7  
ATOM 8900  H HG21 . VAL A 1 60 ? 11.503  -3.086  0.558   1.00 0.00 ? 60 VAL A HG21 7  
ATOM 8901  H HG22 . VAL A 1 60 ? 9.865   -2.415  0.417   1.00 0.00 ? 60 VAL A HG22 7  
ATOM 8902  H HG23 . VAL A 1 60 ? 10.545  -2.764  2.019   1.00 0.00 ? 60 VAL A HG23 7  
ATOM 8903  N N    . ASN A 1 61 ? 8.582   -3.312  3.792   1.00 0.00 ? 61 ASN A N    7  
ATOM 8904  C CA   . ASN A 1 61 ? 8.772   -3.146  5.232   1.00 0.00 ? 61 ASN A CA   7  
ATOM 8905  C C    . ASN A 1 61 ? 7.780   -2.125  5.800   1.00 0.00 ? 61 ASN A C    7  
ATOM 8906  O O    . ASN A 1 61 ? 8.059   -1.493  6.819   1.00 0.00 ? 61 ASN A O    7  
ATOM 8907  C CB   . ASN A 1 61 ? 10.220  -2.712  5.505   1.00 0.00 ? 61 ASN A CB   7  
ATOM 8908  C CG   . ASN A 1 61 ? 10.573  -1.430  4.750   1.00 0.00 ? 61 ASN A CG   7  
ATOM 8909  O OD1  . ASN A 1 61 ? 9.875   -0.425  4.858   1.00 0.00 ? 61 ASN A OD1  7  
ATOM 8910  N ND2  . ASN A 1 61 ? 11.661  -1.466  3.982   1.00 0.00 ? 61 ASN A ND2  7  
ATOM 8911  H H    . ASN A 1 61 ? 8.277   -2.512  3.250   1.00 0.00 ? 61 ASN A H    7  
ATOM 8912  H HA   . ASN A 1 61 ? 8.596   -4.103  5.724   1.00 0.00 ? 61 ASN A HA   7  
ATOM 8913  H HB2  . ASN A 1 61 ? 10.349  -2.543  6.574   1.00 0.00 ? 61 ASN A HB2  7  
ATOM 8914  H HB3  . ASN A 1 61 ? 10.894  -3.510  5.189   1.00 0.00 ? 61 ASN A HB3  7  
ATOM 8915  H HD21 . ASN A 1 61 ? 12.242  -2.291  3.968   1.00 0.00 ? 61 ASN A HD21 7  
ATOM 8916  H HD22 . ASN A 1 61 ? 11.900  -0.666  3.412   1.00 0.00 ? 61 ASN A HD22 7  
ATOM 8917  N N    . ASN A 1 62 ? 6.621   -1.962  5.151   1.00 0.00 ? 62 ASN A N    7  
ATOM 8918  C CA   . ASN A 1 62 ? 5.618   -1.015  5.613   1.00 0.00 ? 62 ASN A CA   7  
ATOM 8919  C C    . ASN A 1 62 ? 4.988   -1.540  6.912   1.00 0.00 ? 62 ASN A C    7  
ATOM 8920  O O    . ASN A 1 62 ? 4.517   -2.673  6.946   1.00 0.00 ? 62 ASN A O    7  
ATOM 8921  C CB   . ASN A 1 62 ? 4.561   -0.826  4.530   1.00 0.00 ? 62 ASN A CB   7  
ATOM 8922  C CG   . ASN A 1 62 ? 3.568   0.261   4.926   1.00 0.00 ? 62 ASN A CG   7  
ATOM 8923  O OD1  . ASN A 1 62 ? 2.571   -0.014  5.583   1.00 0.00 ? 62 ASN A OD1  7  
ATOM 8924  N ND2  . ASN A 1 62 ? 3.846   1.500   4.525   1.00 0.00 ? 62 ASN A ND2  7  
ATOM 8925  H H    . ASN A 1 62 ? 6.428   -2.505  4.320   1.00 0.00 ? 62 ASN A H    7  
ATOM 8926  H HA   . ASN A 1 62 ? 6.103   -0.060  5.796   1.00 0.00 ? 62 ASN A HA   7  
ATOM 8927  H HB2  . ASN A 1 62 ? 5.047   -0.541  3.599   1.00 0.00 ? 62 ASN A HB2  7  
ATOM 8928  H HB3  . ASN A 1 62 ? 4.032   -1.764  4.384   1.00 0.00 ? 62 ASN A HB3  7  
ATOM 8929  H HD21 . ASN A 1 62 ? 4.685   1.682   3.993   1.00 0.00 ? 62 ASN A HD21 7  
ATOM 8930  H HD22 . ASN A 1 62 ? 3.217   2.256   4.754   1.00 0.00 ? 62 ASN A HD22 7  
ATOM 8931  N N    . PRO A 1 63 ? 4.979   -0.726  7.988   1.00 0.00 ? 63 PRO A N    7  
ATOM 8932  C CA   . PRO A 1 63 ? 4.446   -1.141  9.273   1.00 0.00 ? 63 PRO A CA   7  
ATOM 8933  C C    . PRO A 1 63 ? 2.958   -1.501  9.194   1.00 0.00 ? 63 PRO A C    7  
ATOM 8934  O O    . PRO A 1 63 ? 2.473   -2.256  10.034  1.00 0.00 ? 63 PRO A O    7  
ATOM 8935  C CB   . PRO A 1 63 ? 4.675   0.040   10.221  1.00 0.00 ? 63 PRO A CB   7  
ATOM 8936  C CG   . PRO A 1 63 ? 5.251   1.186   9.381   1.00 0.00 ? 63 PRO A CG   7  
ATOM 8937  C CD   . PRO A 1 63 ? 5.506   0.624   7.983   1.00 0.00 ? 63 PRO A CD   7  
ATOM 8938  H HA   . PRO A 1 63 ? 5.007   -2.006  9.633   1.00 0.00 ? 63 PRO A HA   7  
ATOM 8939  H HB2  . PRO A 1 63 ? 3.732   0.348   10.674  1.00 0.00 ? 63 PRO A HB2  7  
ATOM 8940  H HB3  . PRO A 1 63 ? 5.385   -0.241  10.999  1.00 0.00 ? 63 PRO A HB3  7  
ATOM 8941  H HG2  . PRO A 1 63 ? 4.533   2.005   9.326   1.00 0.00 ? 63 PRO A HG2  7  
ATOM 8942  H HG3  . PRO A 1 63 ? 6.186   1.539   9.819   1.00 0.00 ? 63 PRO A HG3  7  
ATOM 8943  H HD2  . PRO A 1 63 ? 4.989   1.230   7.239   1.00 0.00 ? 63 PRO A HD2  7  
ATOM 8944  H HD3  . PRO A 1 63 ? 6.577   0.609   7.781   1.00 0.00 ? 63 PRO A HD3  7  
ATOM 8945  N N    . LYS A 1 64 ? 2.233   -0.956  8.202   1.00 0.00 ? 64 LYS A N    7  
ATOM 8946  C CA   . LYS A 1 64 ? 0.799   -1.201  8.068   1.00 0.00 ? 64 LYS A CA   7  
ATOM 8947  C C    . LYS A 1 64 ? 0.492   -2.142  6.896   1.00 0.00 ? 64 LYS A C    7  
ATOM 8948  O O    . LYS A 1 64 ? -0.678  -2.367  6.603   1.00 0.00 ? 64 LYS A O    7  
ATOM 8949  C CB   . LYS A 1 64 ? 0.068   0.142   7.886   1.00 0.00 ? 64 LYS A CB   7  
ATOM 8950  C CG   . LYS A 1 64 ? -0.784  0.450   9.126   1.00 0.00 ? 64 LYS A CG   7  
ATOM 8951  C CD   . LYS A 1 64 ? 0.114   0.858   10.302  1.00 0.00 ? 64 LYS A CD   7  
ATOM 8952  C CE   . LYS A 1 64 ? 0.463   2.345   10.197  1.00 0.00 ? 64 LYS A CE   7  
ATOM 8953  N NZ   . LYS A 1 64 ? 1.408   2.746   11.255  1.00 0.00 ? 64 LYS A NZ   7  
ATOM 8954  H H    . LYS A 1 64 ? 2.679   -0.351  7.525   1.00 0.00 ? 64 LYS A H    7  
ATOM 8955  H HA   . LYS A 1 64 ? 0.436   -1.670  8.982   1.00 0.00 ? 64 LYS A HA   7  
ATOM 8956  H HB2  . LYS A 1 64 ? 0.795   0.938   7.733   1.00 0.00 ? 64 LYS A HB2  7  
ATOM 8957  H HB3  . LYS A 1 64 ? -0.586  0.083   7.015   1.00 0.00 ? 64 LYS A HB3  7  
ATOM 8958  H HG2  . LYS A 1 64 ? -1.473  1.263   8.898   1.00 0.00 ? 64 LYS A HG2  7  
ATOM 8959  H HG3  . LYS A 1 64 ? -1.357  -0.438  9.400   1.00 0.00 ? 64 LYS A HG3  7  
ATOM 8960  H HD2  . LYS A 1 64 ? -0.417  0.678   11.238  1.00 0.00 ? 64 LYS A HD2  7  
ATOM 8961  H HD3  . LYS A 1 64 ? 1.028   0.265   10.288  1.00 0.00 ? 64 LYS A HD3  7  
ATOM 8962  H HE2  . LYS A 1 64 ? 0.914   2.542   9.225   1.00 0.00 ? 64 LYS A HE2  7  
ATOM 8963  H HE3  . LYS A 1 64 ? -0.451  2.934   10.292  1.00 0.00 ? 64 LYS A HE3  7  
ATOM 8964  H HZ1  . LYS A 1 64 ? 1.620   3.730   11.163  1.00 0.00 ? 64 LYS A HZ1  7  
ATOM 8965  H HZ2  . LYS A 1 64 ? 0.994   2.575   12.160  1.00 0.00 ? 64 LYS A HZ2  7  
ATOM 8966  H HZ3  . LYS A 1 64 ? 2.259   2.209   11.168  1.00 0.00 ? 64 LYS A HZ3  7  
ATOM 8967  N N    . ILE A 1 65 ? 1.520   -2.701  6.230   1.00 0.00 ? 65 ILE A N    7  
ATOM 8968  C CA   . ILE A 1 65 ? 1.300   -3.636  5.123   1.00 0.00 ? 65 ILE A CA   7  
ATOM 8969  C C    . ILE A 1 65 ? 2.395   -4.704  5.129   1.00 0.00 ? 65 ILE A C    7  
ATOM 8970  O O    . ILE A 1 65 ? 3.561   -4.408  4.881   1.00 0.00 ? 65 ILE A O    7  
ATOM 8971  C CB   . ILE A 1 65 ? 1.249   -2.888  3.773   1.00 0.00 ? 65 ILE A CB   7  
ATOM 8972  C CG1  . ILE A 1 65 ? 0.075   -1.890  3.779   1.00 0.00 ? 65 ILE A CG1  7  
ATOM 8973  C CG2  . ILE A 1 65 ? 1.060   -3.904  2.636   1.00 0.00 ? 65 ILE A CG2  7  
ATOM 8974  C CD1  . ILE A 1 65 ? -0.156  -1.317  2.381   1.00 0.00 ? 65 ILE A CD1  7  
ATOM 8975  H H    . ILE A 1 65 ? 2.473   -2.484  6.494   1.00 0.00 ? 65 ILE A H    7  
ATOM 8976  H HA   . ILE A 1 65 ? 0.346   -4.131  5.273   1.00 0.00 ? 65 ILE A HA   7  
ATOM 8977  H HB   . ILE A 1 65 ? 2.178   -2.349  3.619   1.00 0.00 ? 65 ILE A HB   7  
ATOM 8978  H HG12 . ILE A 1 65 ? -0.831  -2.396  4.106   1.00 0.00 ? 65 ILE A HG12 7  
ATOM 8979  H HG13 . ILE A 1 65 ? 0.299   -1.074  4.464   1.00 0.00 ? 65 ILE A HG13 7  
ATOM 8980  H HG21 . ILE A 1 65 ? 1.148   -3.399  1.676   1.00 0.00 ? 65 ILE A HG21 7  
ATOM 8981  H HG22 . ILE A 1 65 ? 1.824   -4.677  2.702   1.00 0.00 ? 65 ILE A HG22 7  
ATOM 8982  H HG23 . ILE A 1 65 ? 0.073   -4.362  2.717   1.00 0.00 ? 65 ILE A HG23 7  
ATOM 8983  H HD11 . ILE A 1 65 ? -0.569  -2.089  1.732   1.00 0.00 ? 65 ILE A HD11 7  
ATOM 8984  H HD12 . ILE A 1 65 ? 0.788   -0.961  1.972   1.00 0.00 ? 65 ILE A HD12 7  
ATOM 8985  H HD13 . ILE A 1 65 ? -0.857  -0.489  2.443   1.00 0.00 ? 65 ILE A HD13 7  
ATOM 8986  N N    . GLU A 1 66 ? 1.995   -5.951  5.415   1.00 0.00 ? 66 GLU A N    7  
ATOM 8987  C CA   . GLU A 1 66 ? 2.901   -7.087  5.466   1.00 0.00 ? 66 GLU A CA   7  
ATOM 8988  C C    . GLU A 1 66 ? 2.870   -7.825  4.124   1.00 0.00 ? 66 GLU A C    7  
ATOM 8989  O O    . GLU A 1 66 ? 1.892   -7.725  3.382   1.00 0.00 ? 66 GLU A O    7  
ATOM 8990  C CB   . GLU A 1 66 ? 2.453   -8.007  6.617   1.00 0.00 ? 66 GLU A CB   7  
ATOM 8991  C CG   . GLU A 1 66 ? 3.461   -9.142  6.842   1.00 0.00 ? 66 GLU A CG   7  
ATOM 8992  C CD   . GLU A 1 66 ? 4.861   -8.596  7.087   1.00 0.00 ? 66 GLU A CD   7  
ATOM 8993  O OE1  . GLU A 1 66 ? 5.118   -8.191  8.243   1.00 0.00 ? 66 GLU A OE1  7  
ATOM 8994  O OE2  . GLU A 1 66 ? 5.646   -8.594  6.112   1.00 0.00 ? 66 GLU A OE2  7  
ATOM 8995  H H    . GLU A 1 66 ? 1.016   -6.122  5.604   1.00 0.00 ? 66 GLU A H    7  
ATOM 8996  H HA   . GLU A 1 66 ? 3.912   -6.730  5.659   1.00 0.00 ? 66 GLU A HA   7  
ATOM 8997  H HB2  . GLU A 1 66 ? 2.370   -7.421  7.531   1.00 0.00 ? 66 GLU A HB2  7  
ATOM 8998  H HB3  . GLU A 1 66 ? 1.479   -8.435  6.377   1.00 0.00 ? 66 GLU A HB3  7  
ATOM 8999  H HG2  . GLU A 1 66 ? 3.150   -9.723  7.711   1.00 0.00 ? 66 GLU A HG2  7  
ATOM 9000  H HG3  . GLU A 1 66 ? 3.474   -9.794  5.971   1.00 0.00 ? 66 GLU A HG3  7  
ATOM 9001  N N    . VAL A 1 67 ? 3.941   -8.566  3.819   1.00 0.00 ? 67 VAL A N    7  
ATOM 9002  C CA   . VAL A 1 67 ? 4.042   -9.322  2.575   1.00 0.00 ? 67 VAL A CA   7  
ATOM 9003  C C    . VAL A 1 67 ? 3.792   -10.802 2.862   1.00 0.00 ? 67 VAL A C    7  
ATOM 9004  O O    . VAL A 1 67 ? 4.247   -11.316 3.883   1.00 0.00 ? 67 VAL A O    7  
ATOM 9005  C CB   . VAL A 1 67 ? 5.433   -9.109  1.965   1.00 0.00 ? 67 VAL A CB   7  
ATOM 9006  C CG1  . VAL A 1 67 ? 5.460   -9.646  0.530   1.00 0.00 ? 67 VAL A CG1  7  
ATOM 9007  C CG2  . VAL A 1 67 ? 5.759   -7.614  1.953   1.00 0.00 ? 67 VAL A CG2  7  
ATOM 9008  H H    . VAL A 1 67 ? 4.719   -8.613  4.472   1.00 0.00 ? 67 VAL A H    7  
ATOM 9009  H HA   . VAL A 1 67 ? 3.289   -8.963  1.873   1.00 0.00 ? 67 VAL A HA   7  
ATOM 9010  H HB   . VAL A 1 67 ? 6.178   -9.637  2.563   1.00 0.00 ? 67 VAL A HB   7  
ATOM 9011  H HG11 . VAL A 1 67 ? 4.710   -9.128  -0.068  1.00 0.00 ? 67 VAL A HG11 7  
ATOM 9012  H HG12 . VAL A 1 67 ? 5.245   -10.715 0.535   1.00 0.00 ? 67 VAL A HG12 7  
ATOM 9013  H HG13 . VAL A 1 67 ? 6.447   -9.479  0.098   1.00 0.00 ? 67 VAL A HG13 7  
ATOM 9014  H HG21 . VAL A 1 67 ? 4.901   -7.060  1.579   1.00 0.00 ? 67 VAL A HG21 7  
ATOM 9015  H HG22 . VAL A 1 67 ? 5.991   -7.283  2.966   1.00 0.00 ? 67 VAL A HG22 7  
ATOM 9016  H HG23 . VAL A 1 67 ? 6.619   -7.433  1.309   1.00 0.00 ? 67 VAL A HG23 7  
ATOM 9017  N N    . ILE A 1 68 ? 3.065   -11.486 1.962   1.00 0.00 ? 68 ILE A N    7  
ATOM 9018  C CA   . ILE A 1 68 ? 2.751   -12.901 2.136   1.00 0.00 ? 68 ILE A CA   7  
ATOM 9019  C C    . ILE A 1 68 ? 3.157   -13.671 0.865   1.00 0.00 ? 68 ILE A C    7  
ATOM 9020  O O    . ILE A 1 68 ? 4.348   -13.775 0.572   1.00 0.00 ? 68 ILE A O    7  
ATOM 9021  C CB   . ILE A 1 68 ? 1.251   -13.057 2.478   1.00 0.00 ? 68 ILE A CB   7  
ATOM 9022  C CG1  . ILE A 1 68 ? 0.882   -12.092 3.621   1.00 0.00 ? 68 ILE A CG1  7  
ATOM 9023  C CG2  . ILE A 1 68 ? 0.966   -14.502 2.920   1.00 0.00 ? 68 ILE A CG2  7  
ATOM 9024  C CD1  . ILE A 1 68 ? -0.559  -12.335 4.077   1.00 0.00 ? 68 ILE A CD1  7  
ATOM 9025  H H    . ILE A 1 68 ? 2.716   -11.014 1.134   1.00 0.00 ? 68 ILE A H    7  
ATOM 9026  H HA   . ILE A 1 68 ? 3.334   -13.292 2.969   1.00 0.00 ? 68 ILE A HA   7  
ATOM 9027  H HB   . ILE A 1 68 ? 0.647   -12.816 1.602   1.00 0.00 ? 68 ILE A HB   7  
ATOM 9028  H HG12 . ILE A 1 68 ? 1.558   -12.250 4.462   1.00 0.00 ? 68 ILE A HG12 7  
ATOM 9029  H HG13 . ILE A 1 68 ? 0.975   -11.064 3.273   1.00 0.00 ? 68 ILE A HG13 7  
ATOM 9030  H HG21 . ILE A 1 68 ? 1.337   -14.651 3.935   1.00 0.00 ? 68 ILE A HG21 7  
ATOM 9031  H HG22 . ILE A 1 68 ? -0.107  -14.686 2.895   1.00 0.00 ? 68 ILE A HG22 7  
ATOM 9032  H HG23 . ILE A 1 68 ? 1.464   -15.201 2.251   1.00 0.00 ? 68 ILE A HG23 7  
ATOM 9033  H HD11 . ILE A 1 68 ? -1.223  -12.320 3.213   1.00 0.00 ? 68 ILE A HD11 7  
ATOM 9034  H HD12 . ILE A 1 68 ? -0.855  -11.550 4.773   1.00 0.00 ? 68 ILE A HD12 7  
ATOM 9035  H HD13 . ILE A 1 68 ? -0.630  -13.302 4.575   1.00 0.00 ? 68 ILE A HD13 7  
ATOM 9036  N N    . ASP A 1 69 ? 2.181   -14.208 0.115   1.00 0.00 ? 69 ASP A N    7  
ATOM 9037  C CA   . ASP A 1 69 ? 2.457   -14.972 -1.096  1.00 0.00 ? 69 ASP A CA   7  
ATOM 9038  C C    . ASP A 1 69 ? 2.732   -14.017 -2.259  1.00 0.00 ? 69 ASP A C    7  
ATOM 9039  O O    . ASP A 1 69 ? 2.007   -14.010 -3.253  1.00 0.00 ? 69 ASP A O    7  
ATOM 9040  C CB   . ASP A 1 69 ? 1.249   -15.874 -1.389  1.00 0.00 ? 69 ASP A CB   7  
ATOM 9041  C CG   . ASP A 1 69 ? 1.457   -16.691 -2.661  1.00 0.00 ? 69 ASP A CG   7  
ATOM 9042  O OD1  . ASP A 1 69 ? 2.519   -17.340 -2.753  1.00 0.00 ? 69 ASP A OD1  7  
ATOM 9043  O OD2  . ASP A 1 69 ? 0.543   -16.647 -3.517  1.00 0.00 ? 69 ASP A OD2  7  
ATOM 9044  H H    . ASP A 1 69 ? 1.220   -14.091 0.389   1.00 0.00 ? 69 ASP A H    7  
ATOM 9045  H HA   . ASP A 1 69 ? 3.335   -15.597 -0.933  1.00 0.00 ? 69 ASP A HA   7  
ATOM 9046  H HB2  . ASP A 1 69 ? 1.102   -16.556 -0.552  1.00 0.00 ? 69 ASP A HB2  7  
ATOM 9047  H HB3  . ASP A 1 69 ? 0.359   -15.255 -1.504  1.00 0.00 ? 69 ASP A HB3  7  
ATOM 9048  N N    . GLY A 1 70 ? 3.782   -13.195 -2.131  1.00 0.00 ? 70 GLY A N    7  
ATOM 9049  C CA   . GLY A 1 70 ? 4.144   -12.228 -3.158  1.00 0.00 ? 70 GLY A CA   7  
ATOM 9050  C C    . GLY A 1 70 ? 3.231   -11.000 -3.092  1.00 0.00 ? 70 GLY A C    7  
ATOM 9051  O O    . GLY A 1 70 ? 3.679   -9.880  -3.335  1.00 0.00 ? 70 GLY A O    7  
ATOM 9052  H H    . GLY A 1 70 ? 4.349   -13.238 -1.292  1.00 0.00 ? 70 GLY A H    7  
ATOM 9053  H HA2  . GLY A 1 70 ? 5.178   -11.915 -3.007  1.00 0.00 ? 70 GLY A HA2  7  
ATOM 9054  H HA3  . GLY A 1 70 ? 4.052   -12.692 -4.141  1.00 0.00 ? 70 GLY A HA3  7  
ATOM 9055  N N    . LYS A 1 71 ? 1.949   -11.215 -2.764  1.00 0.00 ? 71 LYS A N    7  
ATOM 9056  C CA   . LYS A 1 71 ? 0.978   -10.137 -2.671  1.00 0.00 ? 71 LYS A CA   7  
ATOM 9057  C C    . LYS A 1 71 ? 1.199   -9.369  -1.370  1.00 0.00 ? 71 LYS A C    7  
ATOM 9058  O O    . LYS A 1 71 ? 2.092   -9.710  -0.588  1.00 0.00 ? 71 LYS A O    7  
ATOM 9059  C CB   . LYS A 1 71 ? -0.454  -10.702 -2.733  1.00 0.00 ? 71 LYS A CB   7  
ATOM 9060  C CG   . LYS A 1 71 ? -0.488  -12.016 -3.521  1.00 0.00 ? 71 LYS A CG   7  
ATOM 9061  C CD   . LYS A 1 71 ? -1.935  -12.381 -3.858  1.00 0.00 ? 71 LYS A CD   7  
ATOM 9062  C CE   . LYS A 1 71 ? -1.961  -13.631 -4.748  1.00 0.00 ? 71 LYS A CE   7  
ATOM 9063  N NZ   . LYS A 1 71 ? -1.342  -14.789 -4.070  1.00 0.00 ? 71 LYS A NZ   7  
ATOM 9064  H H    . LYS A 1 71 ? 1.639   -12.150 -2.573  1.00 0.00 ? 71 LYS A H    7  
ATOM 9065  H HA   . LYS A 1 71 ? 1.124   -9.458  -3.511  1.00 0.00 ? 71 LYS A HA   7  
ATOM 9066  H HB2  . LYS A 1 71 ? -0.814  -10.880 -1.727  1.00 0.00 ? 71 LYS A HB2  7  
ATOM 9067  H HB3  . LYS A 1 71 ? -1.101  -9.976  -3.220  1.00 0.00 ? 71 LYS A HB3  7  
ATOM 9068  H HG2  . LYS A 1 71 ? 0.084   -11.905 -4.445  1.00 0.00 ? 71 LYS A HG2  7  
ATOM 9069  H HG3  . LYS A 1 71 ? -0.055  -12.809 -2.917  1.00 0.00 ? 71 LYS A HG3  7  
ATOM 9070  H HD2  . LYS A 1 71 ? -2.484  -12.577 -2.937  1.00 0.00 ? 71 LYS A HD2  7  
ATOM 9071  H HD3  . LYS A 1 71 ? -2.404  -11.550 -4.388  1.00 0.00 ? 71 LYS A HD3  7  
ATOM 9072  H HE2  . LYS A 1 71 ? -2.997  -13.873 -4.989  1.00 0.00 ? 71 LYS A HE2  7  
ATOM 9073  H HE3  . LYS A 1 71 ? -1.419  -13.425 -5.670  1.00 0.00 ? 71 LYS A HE3  7  
ATOM 9074  H HZ1  . LYS A 1 71 ? -1.441  -15.612 -4.646  1.00 0.00 ? 71 LYS A HZ1  7  
ATOM 9075  H HZ2  . LYS A 1 71 ? -0.357  -14.610 -3.915  1.00 0.00 ? 71 LYS A HZ2  7  
ATOM 9076  H HZ3  . LYS A 1 71 ? -1.796  -14.946 -3.182  1.00 0.00 ? 71 LYS A HZ3  7  
ATOM 9077  N N    . TYR A 1 72 ? 0.390   -8.328  -1.143  1.00 0.00 ? 72 TYR A N    7  
ATOM 9078  C CA   . TYR A 1 72 ? 0.528   -7.484  0.033   1.00 0.00 ? 72 TYR A CA   7  
ATOM 9079  C C    . TYR A 1 72 ? -0.784  -7.449  0.810   1.00 0.00 ? 72 TYR A C    7  
ATOM 9080  O O    . TYR A 1 72 ? -1.853  -7.286  0.225   1.00 0.00 ? 72 TYR A O    7  
ATOM 9081  C CB   . TYR A 1 72 ? 0.948   -6.088  -0.422  1.00 0.00 ? 72 TYR A CB   7  
ATOM 9082  C CG   . TYR A 1 72 ? 2.239   -6.104  -1.214  1.00 0.00 ? 72 TYR A CG   7  
ATOM 9083  C CD1  . TYR A 1 72 ? 2.212   -6.330  -2.603  1.00 0.00 ? 72 TYR A CD1  7  
ATOM 9084  C CD2  . TYR A 1 72 ? 3.466   -5.919  -0.558  1.00 0.00 ? 72 TYR A CD2  7  
ATOM 9085  C CE1  . TYR A 1 72 ? 3.412   -6.370  -3.330  1.00 0.00 ? 72 TYR A CE1  7  
ATOM 9086  C CE2  . TYR A 1 72 ? 4.667   -5.955  -1.288  1.00 0.00 ? 72 TYR A CE2  7  
ATOM 9087  C CZ   . TYR A 1 72 ? 4.640   -6.180  -2.674  1.00 0.00 ? 72 TYR A CZ   7  
ATOM 9088  O OH   . TYR A 1 72 ? 5.804   -6.216  -3.384  1.00 0.00 ? 72 TYR A OH   7  
ATOM 9089  H H    . TYR A 1 72 ? -0.342  -8.104  -1.809  1.00 0.00 ? 72 TYR A H    7  
ATOM 9090  H HA   . TYR A 1 72 ? 1.307   -7.890  0.679   1.00 0.00 ? 72 TYR A HA   7  
ATOM 9091  H HB2  . TYR A 1 72 ? 0.159   -5.667  -1.041  1.00 0.00 ? 72 TYR A HB2  7  
ATOM 9092  H HB3  . TYR A 1 72 ? 1.080   -5.458  0.455   1.00 0.00 ? 72 TYR A HB3  7  
ATOM 9093  H HD1  . TYR A 1 72 ? 1.269   -6.478  -3.108  1.00 0.00 ? 72 TYR A HD1  7  
ATOM 9094  H HD2  . TYR A 1 72 ? 3.486   -5.751  0.508   1.00 0.00 ? 72 TYR A HD2  7  
ATOM 9095  H HE1  . TYR A 1 72 ? 3.392   -6.549  -4.395  1.00 0.00 ? 72 TYR A HE1  7  
ATOM 9096  H HE2  . TYR A 1 72 ? 5.610   -5.811  -0.781  1.00 0.00 ? 72 TYR A HE2  7  
ATOM 9097  H HH   . TYR A 1 72 ? 6.583   -6.102  -2.834  1.00 0.00 ? 72 TYR A HH   7  
ATOM 9098  N N    . ALA A 1 73 ? -0.685  -7.610  2.134   1.00 0.00 ? 73 ALA A N    7  
ATOM 9099  C CA   . ALA A 1 73 ? -1.838  -7.618  3.021   1.00 0.00 ? 73 ALA A CA   7  
ATOM 9100  C C    . ALA A 1 73 ? -1.656  -6.559  4.095   1.00 0.00 ? 73 ALA A C    7  
ATOM 9101  O O    . ALA A 1 73 ? -0.575  -6.439  4.661   1.00 0.00 ? 73 ALA A O    7  
ATOM 9102  C CB   . ALA A 1 73 ? -1.952  -8.999  3.662   1.00 0.00 ? 73 ALA A CB   7  
ATOM 9103  H H    . ALA A 1 73 ? 0.229   -7.732  2.552   1.00 0.00 ? 73 ALA A H    7  
ATOM 9104  H HA   . ALA A 1 73 ? -2.745  -7.408  2.452   1.00 0.00 ? 73 ALA A HA   7  
ATOM 9105  H HB1  . ALA A 1 73 ? -1.033  -9.218  4.210   1.00 0.00 ? 73 ALA A HB1  7  
ATOM 9106  H HB2  . ALA A 1 73 ? -2.798  -9.014  4.349   1.00 0.00 ? 73 ALA A HB2  7  
ATOM 9107  H HB3  . ALA A 1 73 ? -2.098  -9.749  2.890   1.00 0.00 ? 73 ALA A HB3  7  
ATOM 9108  N N    . PHE A 1 74 ? -2.708  -5.790  4.383   1.00 0.00 ? 74 PHE A N    7  
ATOM 9109  C CA   . PHE A 1 74 ? -2.632  -4.756  5.399   1.00 0.00 ? 74 PHE A CA   7  
ATOM 9110  C C    . PHE A 1 74 ? -2.341  -5.394  6.758   1.00 0.00 ? 74 PHE A C    7  
ATOM 9111  O O    . PHE A 1 74 ? -3.060  -6.291  7.200   1.00 0.00 ? 74 PHE A O    7  
ATOM 9112  C CB   . PHE A 1 74 ? -3.931  -3.954  5.427   1.00 0.00 ? 74 PHE A CB   7  
ATOM 9113  C CG   . PHE A 1 74 ? -4.096  -3.102  6.671   1.00 0.00 ? 74 PHE A CG   7  
ATOM 9114  C CD1  . PHE A 1 74 ? -4.672  -3.654  7.826   1.00 0.00 ? 74 PHE A CD1  7  
ATOM 9115  C CD2  . PHE A 1 74 ? -3.680  -1.759  6.672   1.00 0.00 ? 74 PHE A CD2  7  
ATOM 9116  C CE1  . PHE A 1 74 ? -4.856  -2.867  8.969   1.00 0.00 ? 74 PHE A CE1  7  
ATOM 9117  C CE2  . PHE A 1 74 ? -3.855  -0.972  7.823   1.00 0.00 ? 74 PHE A CE2  7  
ATOM 9118  C CZ   . PHE A 1 74 ? -4.452  -1.525  8.969   1.00 0.00 ? 74 PHE A CZ   7  
ATOM 9119  H H    . PHE A 1 74 ? -3.580  -5.924  3.892   1.00 0.00 ? 74 PHE A H    7  
ATOM 9120  H HA   . PHE A 1 74 ? -1.818  -4.082  5.146   1.00 0.00 ? 74 PHE A HA   7  
ATOM 9121  H HB2  . PHE A 1 74 ? -3.949  -3.302  4.563   1.00 0.00 ? 74 PHE A HB2  7  
ATOM 9122  H HB3  . PHE A 1 74 ? -4.771  -4.639  5.357   1.00 0.00 ? 74 PHE A HB3  7  
ATOM 9123  H HD1  . PHE A 1 74 ? -4.976  -4.684  7.831   1.00 0.00 ? 74 PHE A HD1  7  
ATOM 9124  H HD2  . PHE A 1 74 ? -3.231  -1.331  5.787   1.00 0.00 ? 74 PHE A HD2  7  
ATOM 9125  H HE1  . PHE A 1 74 ? -5.312  -3.293  9.850   1.00 0.00 ? 74 PHE A HE1  7  
ATOM 9126  H HE2  . PHE A 1 74 ? -3.540  0.060   7.823   1.00 0.00 ? 74 PHE A HE2  7  
ATOM 9127  H HZ   . PHE A 1 74 ? -4.605  -0.919  9.846   1.00 0.00 ? 74 PHE A HZ   7  
ATOM 9128  N N    . LYS A 1 75 ? -1.279  -4.919  7.409   1.00 0.00 ? 75 LYS A N    7  
ATOM 9129  C CA   . LYS A 1 75 ? -0.866  -5.407  8.708   1.00 0.00 ? 75 LYS A CA   7  
ATOM 9130  C C    . LYS A 1 75 ? -1.634  -4.640  9.792   1.00 0.00 ? 75 LYS A C    7  
ATOM 9131  O O    . LYS A 1 75 ? -1.648  -3.409  9.764   1.00 0.00 ? 75 LYS A O    7  
ATOM 9132  C CB   . LYS A 1 75 ? 0.646   -5.181  8.849   1.00 0.00 ? 75 LYS A CB   7  
ATOM 9133  C CG   . LYS A 1 75 ? 1.226   -6.102  9.924   1.00 0.00 ? 75 LYS A CG   7  
ATOM 9134  C CD   . LYS A 1 75 ? 2.740   -5.877  10.017  1.00 0.00 ? 75 LYS A CD   7  
ATOM 9135  C CE   . LYS A 1 75 ? 3.407   -7.064  10.719  1.00 0.00 ? 75 LYS A CE   7  
ATOM 9136  N NZ   . LYS A 1 75 ? 2.937   -7.196  12.108  1.00 0.00 ? 75 LYS A NZ   7  
ATOM 9137  H H    . LYS A 1 75 ? -0.735  -4.183  6.988   1.00 0.00 ? 75 LYS A H    7  
ATOM 9138  H HA   . LYS A 1 75 ? -1.079  -6.471  8.776   1.00 0.00 ? 75 LYS A HA   7  
ATOM 9139  H HB2  . LYS A 1 75 ? 1.129   -5.396  7.896   1.00 0.00 ? 75 LYS A HB2  7  
ATOM 9140  H HB3  . LYS A 1 75 ? 0.834   -4.144  9.120   1.00 0.00 ? 75 LYS A HB3  7  
ATOM 9141  H HG2  . LYS A 1 75 ? 0.763   -5.876  10.886  1.00 0.00 ? 75 LYS A HG2  7  
ATOM 9142  H HG3  . LYS A 1 75 ? 1.026   -7.140  9.658   1.00 0.00 ? 75 LYS A HG3  7  
ATOM 9143  H HD2  . LYS A 1 75 ? 3.155   -5.778  9.012   1.00 0.00 ? 75 LYS A HD2  7  
ATOM 9144  H HD3  . LYS A 1 75 ? 2.938   -4.962  10.578  1.00 0.00 ? 75 LYS A HD3  7  
ATOM 9145  H HE2  . LYS A 1 75 ? 3.175   -7.980  10.173  1.00 0.00 ? 75 LYS A HE2  7  
ATOM 9146  H HE3  . LYS A 1 75 ? 4.488   -6.915  10.720  1.00 0.00 ? 75 LYS A HE3  7  
ATOM 9147  H HZ1  . LYS A 1 75 ? 3.143   -6.347  12.617  1.00 0.00 ? 75 LYS A HZ1  7  
ATOM 9148  H HZ2  . LYS A 1 75 ? 3.408   -7.974  12.550  1.00 0.00 ? 75 LYS A HZ2  7  
ATOM 9149  H HZ3  . LYS A 1 75 ? 1.942   -7.359  12.114  1.00 0.00 ? 75 LYS A HZ3  7  
ATOM 9150  N N    . PRO A 1 76 ? -2.275  -5.346  10.750  1.00 0.00 ? 76 PRO A N    7  
ATOM 9151  C CA   . PRO A 1 76 ? -3.017  -4.704  11.816  1.00 0.00 ? 76 PRO A CA   7  
ATOM 9152  C C    . PRO A 1 76 ? -2.142  -3.678  12.538  1.00 0.00 ? 76 PRO A C    7  
ATOM 9153  O O    . PRO A 1 76 ? -0.951  -3.908  12.754  1.00 0.00 ? 76 PRO A O    7  
ATOM 9154  C CB   . PRO A 1 76 ? -3.470  -5.826  12.748  1.00 0.00 ? 76 PRO A CB   7  
ATOM 9155  C CG   . PRO A 1 76 ? -3.126  -7.148  12.050  1.00 0.00 ? 76 PRO A CG   7  
ATOM 9156  C CD   . PRO A 1 76 ? -2.294  -6.793  10.817  1.00 0.00 ? 76 PRO A CD   7  
ATOM 9157  H HA   . PRO A 1 76 ? -3.890  -4.208  11.397  1.00 0.00 ? 76 PRO A HA   7  
ATOM 9158  H HB2  . PRO A 1 76 ? -2.944  -5.758  13.698  1.00 0.00 ? 76 PRO A HB2  7  
ATOM 9159  H HB3  . PRO A 1 76 ? -4.546  -5.760  12.915  1.00 0.00 ? 76 PRO A HB3  7  
ATOM 9160  H HG2  . PRO A 1 76 ? -2.551  -7.787  12.720  1.00 0.00 ? 76 PRO A HG2  7  
ATOM 9161  H HG3  . PRO A 1 76 ? -4.042  -7.657  11.746  1.00 0.00 ? 76 PRO A HG3  7  
ATOM 9162  H HD2  . PRO A 1 76 ? -1.281  -7.180  10.926  1.00 0.00 ? 76 PRO A HD2  7  
ATOM 9163  H HD3  . PRO A 1 76 ? -2.763  -7.206  9.922   1.00 0.00 ? 76 PRO A HD3  7  
ATOM 9164  N N    . LYS A 1 77 ? -2.743  -2.538  12.898  1.00 0.00 ? 77 LYS A N    7  
ATOM 9165  C CA   . LYS A 1 77 ? -2.035  -1.449  13.547  1.00 0.00 ? 77 LYS A CA   7  
ATOM 9166  C C    . LYS A 1 77 ? -1.554  -1.861  14.941  1.00 0.00 ? 77 LYS A C    7  
ATOM 9167  O O    . LYS A 1 77 ? -2.341  -1.880  15.888  1.00 0.00 ? 77 LYS A O    7  
ATOM 9168  C CB   . LYS A 1 77 ? -2.972  -0.239  13.640  1.00 0.00 ? 77 LYS A CB   7  
ATOM 9169  C CG   . LYS A 1 77 ? -2.216  0.967   14.220  1.00 0.00 ? 77 LYS A CG   7  
ATOM 9170  C CD   . LYS A 1 77 ? -3.194  1.941   14.903  1.00 0.00 ? 77 LYS A CD   7  
ATOM 9171  C CE   . LYS A 1 77 ? -3.824  1.318   16.165  1.00 0.00 ? 77 LYS A CE   7  
ATOM 9172  N NZ   . LYS A 1 77 ? -2.816  0.656   17.016  1.00 0.00 ? 77 LYS A NZ   7  
ATOM 9173  H H    . LYS A 1 77 ? -3.726  -2.416  12.706  1.00 0.00 ? 77 LYS A H    7  
ATOM 9174  H HA   . LYS A 1 77 ? -1.169  -1.178  12.939  1.00 0.00 ? 77 LYS A HA   7  
ATOM 9175  H HB2  . LYS A 1 77 ? -3.339  0.012   12.644  1.00 0.00 ? 77 LYS A HB2  7  
ATOM 9176  H HB3  . LYS A 1 77 ? -3.814  -0.490  14.279  1.00 0.00 ? 77 LYS A HB3  7  
ATOM 9177  H HG2  . LYS A 1 77 ? -1.477  0.630   14.942  1.00 0.00 ? 77 LYS A HG2  7  
ATOM 9178  H HG3  . LYS A 1 77 ? -1.705  1.488   13.410  1.00 0.00 ? 77 LYS A HG3  7  
ATOM 9179  H HD2  . LYS A 1 77 ? -2.653  2.845   15.185  1.00 0.00 ? 77 LYS A HD2  7  
ATOM 9180  H HD3  . LYS A 1 77 ? -3.986  2.207   14.200  1.00 0.00 ? 77 LYS A HD3  7  
ATOM 9181  H HE2  . LYS A 1 77 ? -4.307  2.108   16.743  1.00 0.00 ? 77 LYS A HE2  7  
ATOM 9182  H HE3  . LYS A 1 77 ? -4.578  0.587   15.873  1.00 0.00 ? 77 LYS A HE3  7  
ATOM 9183  H HZ1  . LYS A 1 77 ? -2.548  -0.228  16.597  1.00 0.00 ? 77 LYS A HZ1  7  
ATOM 9184  H HZ2  . LYS A 1 77 ? -1.999  1.251   17.102  1.00 0.00 ? 77 LYS A HZ2  7  
ATOM 9185  H HZ3  . LYS A 1 77 ? -3.207  0.486   17.932  1.00 0.00 ? 77 LYS A HZ3  7  
ATOM 9186  N N    . TYR A 1 78 ? -0.256  -2.164  15.062  1.00 0.00 ? 78 TYR A N    7  
ATOM 9187  C CA   . TYR A 1 78 ? 0.355   -2.508  16.340  1.00 0.00 ? 78 TYR A CA   7  
ATOM 9188  C C    . TYR A 1 78 ? 1.468   -1.509  16.633  1.00 0.00 ? 78 TYR A C    7  
ATOM 9189  O O    . TYR A 1 78 ? 2.551   -1.597  16.059  1.00 0.00 ? 78 TYR A O    7  
ATOM 9190  C CB   . TYR A 1 78 ? 0.906   -3.938  16.288  1.00 0.00 ? 78 TYR A CB   7  
ATOM 9191  C CG   . TYR A 1 78 ? -0.160  -5.010  16.146  1.00 0.00 ? 78 TYR A CG   7  
ATOM 9192  C CD1  . TYR A 1 78 ? -1.322  -4.971  16.944  1.00 0.00 ? 78 TYR A CD1  7  
ATOM 9193  C CD2  . TYR A 1 78 ? 0.019   -6.058  15.225  1.00 0.00 ? 78 TYR A CD2  7  
ATOM 9194  C CE1  . TYR A 1 78 ? -2.298  -5.971  16.814  1.00 0.00 ? 78 TYR A CE1  7  
ATOM 9195  C CE2  . TYR A 1 78 ? -0.956  -7.062  15.101  1.00 0.00 ? 78 TYR A CE2  7  
ATOM 9196  C CZ   . TYR A 1 78 ? -2.115  -7.018  15.895  1.00 0.00 ? 78 TYR A CZ   7  
ATOM 9197  O OH   . TYR A 1 78 ? -3.062  -7.991  15.774  1.00 0.00 ? 78 TYR A OH   7  
ATOM 9198  H H    . TYR A 1 78 ? 0.335   -2.145  14.244  1.00 0.00 ? 78 TYR A H    7  
ATOM 9199  H HA   . TYR A 1 78 ? -0.391  -2.440  17.129  1.00 0.00 ? 78 TYR A HA   7  
ATOM 9200  H HB2  . TYR A 1 78 ? 1.593   -4.015  15.444  1.00 0.00 ? 78 TYR A HB2  7  
ATOM 9201  H HB3  . TYR A 1 78 ? 1.463   -4.126  17.206  1.00 0.00 ? 78 TYR A HB3  7  
ATOM 9202  H HD1  . TYR A 1 78 ? -1.463  -4.176  17.658  1.00 0.00 ? 78 TYR A HD1  7  
ATOM 9203  H HD2  . TYR A 1 78 ? 0.909   -6.094  14.614  1.00 0.00 ? 78 TYR A HD2  7  
ATOM 9204  H HE1  . TYR A 1 78 ? -3.189  -5.938  17.425  1.00 0.00 ? 78 TYR A HE1  7  
ATOM 9205  H HE2  . TYR A 1 78 ? -0.814  -7.866  14.396  1.00 0.00 ? 78 TYR A HE2  7  
ATOM 9206  H HH   . TYR A 1 78 ? -2.823  -8.673  15.144  1.00 0.00 ? 78 TYR A HH   7  
ATOM 9207  N N    . ASN A 1 79 ? 1.193   -0.552  17.528  1.00 0.00 ? 79 ASN A N    7  
ATOM 9208  C CA   . ASN A 1 79 ? 2.160   0.476   17.892  1.00 0.00 ? 79 ASN A CA   7  
ATOM 9209  C C    . ASN A 1 79 ? 1.850   1.006   19.293  1.00 0.00 ? 79 ASN A C    7  
ATOM 9210  O O    . ASN A 1 79 ? 1.817   2.215   19.511  1.00 0.00 ? 79 ASN A O    7  
ATOM 9211  C CB   . ASN A 1 79 ? 2.126   1.607   16.850  1.00 0.00 ? 79 ASN A CB   7  
ATOM 9212  C CG   . ASN A 1 79 ? 0.794   2.364   16.876  1.00 0.00 ? 79 ASN A CG   7  
ATOM 9213  O OD1  . ASN A 1 79 ? -0.275  1.755   16.909  1.00 0.00 ? 79 ASN A OD1  7  
ATOM 9214  N ND2  . ASN A 1 79 ? 0.861   3.695   16.860  1.00 0.00 ? 79 ASN A ND2  7  
ATOM 9215  H H    . ASN A 1 79 ? 0.286   -0.529  17.971  1.00 0.00 ? 79 ASN A H    7  
ATOM 9216  H HA   . ASN A 1 79 ? 3.159   0.036   17.901  1.00 0.00 ? 79 ASN A HA   7  
ATOM 9217  H HB2  . ASN A 1 79 ? 2.937   2.305   17.059  1.00 0.00 ? 79 ASN A HB2  7  
ATOM 9218  H HB3  . ASN A 1 79 ? 2.273   1.182   15.858  1.00 0.00 ? 79 ASN A HB3  7  
ATOM 9219  H HD21 . ASN A 1 79 ? 1.760   4.154   16.844  1.00 0.00 ? 79 ASN A HD21 7  
ATOM 9220  H HD22 . ASN A 1 79 ? 0.013   4.241   16.867  1.00 0.00 ? 79 ASN A HD22 7  
ATOM 9221  N N    . VAL A 1 80 ? 1.621   0.093   20.243  1.00 0.00 ? 80 VAL A N    7  
ATOM 9222  C CA   . VAL A 1 80 ? 1.318   0.470   21.614  1.00 0.00 ? 80 VAL A CA   7  
ATOM 9223  C C    . VAL A 1 80 ? 2.557   1.098   22.260  1.00 0.00 ? 80 VAL A C    7  
ATOM 9224  O O    . VAL A 1 80 ? 3.680   0.676   21.985  1.00 0.00 ? 80 VAL A O    7  
ATOM 9225  C CB   . VAL A 1 80 ? 0.838   -0.771  22.392  1.00 0.00 ? 80 VAL A CB   7  
ATOM 9226  C CG1  . VAL A 1 80 ? 1.987   -1.774  22.569  1.00 0.00 ? 80 VAL A CG1  7  
ATOM 9227  C CG2  . VAL A 1 80 ? 0.310   -0.353  23.768  1.00 0.00 ? 80 VAL A CG2  7  
ATOM 9228  H H    . VAL A 1 80 ? 1.660   -0.887  20.012  1.00 0.00 ? 80 VAL A H    7  
ATOM 9229  H HA   . VAL A 1 80 ? 0.515   1.208   21.604  1.00 0.00 ? 80 VAL A HA   7  
ATOM 9230  H HB   . VAL A 1 80 ? 0.032   -1.250  21.834  1.00 0.00 ? 80 VAL A HB   7  
ATOM 9231  H HG11 . VAL A 1 80 ? 2.737   -1.360  23.242  1.00 0.00 ? 80 VAL A HG11 7  
ATOM 9232  H HG12 . VAL A 1 80 ? 1.596   -2.699  22.993  1.00 0.00 ? 80 VAL A HG12 7  
ATOM 9233  H HG13 . VAL A 1 80 ? 2.444   -1.985  21.603  1.00 0.00 ? 80 VAL A HG13 7  
ATOM 9234  H HG21 . VAL A 1 80 ? -0.459  0.410   23.646  1.00 0.00 ? 80 VAL A HG21 7  
ATOM 9235  H HG22 . VAL A 1 80 ? 1.126   0.047   24.368  1.00 0.00 ? 80 VAL A HG22 7  
ATOM 9236  H HG23 . VAL A 1 80 ? -0.118  -1.220  24.271  1.00 0.00 ? 80 VAL A HG23 7  
ATOM 9237  N N    . ARG A 1 81 ? 2.339   2.109   23.115  1.00 0.00 ? 81 ARG A N    7  
ATOM 9238  C CA   . ARG A 1 81 ? 3.419   2.808   23.799  1.00 0.00 ? 81 ARG A CA   7  
ATOM 9239  C C    . ARG A 1 81 ? 4.371   3.429   22.767  1.00 0.00 ? 81 ARG A C    7  
ATOM 9240  O O    . ARG A 1 81 ? 3.908   4.353   22.065  1.00 0.00 ? 81 ARG A O    7  
ATOM 9241  C CB   . ARG A 1 81 ? 4.149   1.834   24.741  1.00 0.00 ? 81 ARG A CB   7  
ATOM 9242  C CG   . ARG A 1 81 ? 5.014   2.618   25.740  1.00 0.00 ? 81 ARG A CG   7  
ATOM 9243  C CD   . ARG A 1 81 ? 6.355   1.908   25.938  1.00 0.00 ? 81 ARG A CD   7  
ATOM 9244  N NE   . ARG A 1 81 ? 7.134   1.927   24.694  1.00 0.00 ? 81 ARG A NE   7  
ATOM 9245  C CZ   . ARG A 1 81 ? 8.353   1.380   24.578  1.00 0.00 ? 81 ARG A CZ   7  
ATOM 9246  N NH1  . ARG A 1 81 ? 8.929   0.785   25.630  1.00 0.00 ? 81 ARG A NH1  7  
ATOM 9247  N NH2  . ARG A 1 81 ? 8.992   1.431   23.403  1.00 0.00 ? 81 ARG A NH2  7  
ATOM 9248  O OXT  . ARG A 1 81 ? 5.566   3.052   22.781  1.00 0.00 ? 81 ARG A OXT  7  
ATOM 9249  H H    . ARG A 1 81 ? 1.393   2.408   23.297  1.00 0.00 ? 81 ARG A H    7  
ATOM 9250  H HA   . ARG A 1 81 ? 2.986   3.610   24.398  1.00 0.00 ? 81 ARG A HA   7  
ATOM 9251  H HB2  . ARG A 1 81 ? 3.414   1.244   25.289  1.00 0.00 ? 81 ARG A HB2  7  
ATOM 9252  H HB3  . ARG A 1 81 ? 4.778   1.165   24.156  1.00 0.00 ? 81 ARG A HB3  7  
ATOM 9253  H HG2  . ARG A 1 81 ? 5.193   3.625   25.359  1.00 0.00 ? 81 ARG A HG2  7  
ATOM 9254  H HG3  . ARG A 1 81 ? 4.493   2.683   26.696  1.00 0.00 ? 81 ARG A HG3  7  
ATOM 9255  H HD2  . ARG A 1 81 ? 6.916   2.416   26.722  1.00 0.00 ? 81 ARG A HD2  7  
ATOM 9256  H HD3  . ARG A 1 81 ? 6.173   0.874   26.236  1.00 0.00 ? 81 ARG A HD3  7  
ATOM 9257  H HE   . ARG A 1 81 ? 6.715   2.380   23.887  1.00 0.00 ? 81 ARG A HE   7  
ATOM 9258  H HH11 . ARG A 1 81 ? 8.446   0.747   26.515  1.00 0.00 ? 81 ARG A HH11 7  
ATOM 9259  H HH12 . ARG A 1 81 ? 9.846   0.373   25.539  1.00 0.00 ? 81 ARG A HH12 7  
ATOM 9260  H HH21 . ARG A 1 81 ? 8.552   1.876   22.607  1.00 0.00 ? 81 ARG A HH21 7  
ATOM 9261  H HH22 . ARG A 1 81 ? 9.912   1.026   23.307  1.00 0.00 ? 81 ARG A HH22 7  
ATOM 9262  N N    . ALA A 1 1  ? -9.711  14.788  4.766   1.00 0.00 ? 1  ALA A N    8  
ATOM 9263  C CA   . ALA A 1 1  ? -9.686  14.543  3.313   1.00 0.00 ? 1  ALA A CA   8  
ATOM 9264  C C    . ALA A 1 1  ? -8.515  13.633  2.954   1.00 0.00 ? 1  ALA A C    8  
ATOM 9265  O O    . ALA A 1 1  ? -7.640  13.394  3.784   1.00 0.00 ? 1  ALA A O    8  
ATOM 9266  C CB   . ALA A 1 1  ? -9.583  15.867  2.552   1.00 0.00 ? 1  ALA A CB   8  
ATOM 9267  H H1   . ALA A 1 1  ? -10.478 15.404  4.993   1.00 0.00 ? 1  ALA A H1   8  
ATOM 9268  H H2   . ALA A 1 1  ? -9.827  13.910  5.253   1.00 0.00 ? 1  ALA A H2   8  
ATOM 9269  H H3   . ALA A 1 1  ? -8.840  15.214  5.049   1.00 0.00 ? 1  ALA A H3   8  
ATOM 9270  H HA   . ALA A 1 1  ? -10.615 14.048  3.028   1.00 0.00 ? 1  ALA A HA   8  
ATOM 9271  H HB1  . ALA A 1 1  ? -9.612  15.674  1.479   1.00 0.00 ? 1  ALA A HB1  8  
ATOM 9272  H HB2  . ALA A 1 1  ? -8.645  16.363  2.806   1.00 0.00 ? 1  ALA A HB2  8  
ATOM 9273  H HB3  . ALA A 1 1  ? -10.419 16.511  2.827   1.00 0.00 ? 1  ALA A HB3  8  
ATOM 9274  N N    . LEU A 1 2  ? -8.505  13.125  1.715   1.00 0.00 ? 2  LEU A N    8  
ATOM 9275  C CA   . LEU A 1 2  ? -7.443  12.244  1.243   1.00 0.00 ? 2  LEU A CA   8  
ATOM 9276  C C    . LEU A 1 2  ? -7.260  12.411  -0.271  1.00 0.00 ? 2  LEU A C    8  
ATOM 9277  O O    . LEU A 1 2  ? -6.863  11.474  -0.961  1.00 0.00 ? 2  LEU A O    8  
ATOM 9278  C CB   . LEU A 1 2  ? -7.767  10.781  1.624   1.00 0.00 ? 2  LEU A CB   8  
ATOM 9279  C CG   . LEU A 1 2  ? -9.267  10.456  1.443   1.00 0.00 ? 2  LEU A CG   8  
ATOM 9280  C CD1  . LEU A 1 2  ? -9.675  10.572  -0.030  1.00 0.00 ? 2  LEU A CD1  8  
ATOM 9281  C CD2  . LEU A 1 2  ? -9.528  9.027   1.924   1.00 0.00 ? 2  LEU A CD2  8  
ATOM 9282  H H    . LEU A 1 2  ? -9.254  13.355  1.076   1.00 0.00 ? 2  LEU A H    8  
ATOM 9283  H HA   . LEU A 1 2  ? -6.510  12.528  1.730   1.00 0.00 ? 2  LEU A HA   8  
ATOM 9284  H HB2  . LEU A 1 2  ? -7.175  10.105  1.006   1.00 0.00 ? 2  LEU A HB2  8  
ATOM 9285  H HB3  . LEU A 1 2  ? -7.499  10.624  2.670   1.00 0.00 ? 2  LEU A HB3  8  
ATOM 9286  H HG   . LEU A 1 2  ? -9.866  11.143  2.040   1.00 0.00 ? 2  LEU A HG   8  
ATOM 9287  H HD11 . LEU A 1 2  ? -8.969  10.021  -0.650  1.00 0.00 ? 2  LEU A HD11 8  
ATOM 9288  H HD12 . LEU A 1 2  ? -9.683  11.618  -0.328  1.00 0.00 ? 2  LEU A HD12 8  
ATOM 9289  H HD13 . LEU A 1 2  ? -10.674 10.155  -0.162  1.00 0.00 ? 2  LEU A HD13 8  
ATOM 9290  H HD21 . LEU A 1 2  ? -9.249  8.939   2.973   1.00 0.00 ? 2  LEU A HD21 8  
ATOM 9291  H HD22 . LEU A 1 2  ? -10.587 8.793   1.811   1.00 0.00 ? 2  LEU A HD22 8  
ATOM 9292  H HD23 . LEU A 1 2  ? -8.938  8.329   1.331   1.00 0.00 ? 2  LEU A HD23 8  
ATOM 9293  N N    . SER A 1 3  ? -7.551  13.614  -0.783  1.00 0.00 ? 3  SER A N    8  
ATOM 9294  C CA   . SER A 1 3  ? -7.430  13.904  -2.203  1.00 0.00 ? 3  SER A CA   8  
ATOM 9295  C C    . SER A 1 3  ? -7.373  15.418  -2.415  1.00 0.00 ? 3  SER A C    8  
ATOM 9296  O O    . SER A 1 3  ? -8.134  15.969  -3.208  1.00 0.00 ? 3  SER A O    8  
ATOM 9297  C CB   . SER A 1 3  ? -8.619  13.283  -2.947  1.00 0.00 ? 3  SER A CB   8  
ATOM 9298  O OG   . SER A 1 3  ? -9.824  13.645  -2.303  1.00 0.00 ? 3  SER A OG   8  
ATOM 9299  H H    . SER A 1 3  ? -7.869  14.353  -0.173  1.00 0.00 ? 3  SER A H    8  
ATOM 9300  H HA   . SER A 1 3  ? -6.506  13.461  -2.581  1.00 0.00 ? 3  SER A HA   8  
ATOM 9301  H HB2  . SER A 1 3  ? -8.634  13.641  -3.977  1.00 0.00 ? 3  SER A HB2  8  
ATOM 9302  H HB3  . SER A 1 3  ? -8.522  12.197  -2.945  1.00 0.00 ? 3  SER A HB3  8  
ATOM 9303  H HG   . SER A 1 3  ? -10.561 13.341  -2.839  1.00 0.00 ? 3  SER A HG   8  
ATOM 9304  N N    . GLY A 1 4  ? -6.462  16.089  -1.700  1.00 0.00 ? 4  GLY A N    8  
ATOM 9305  C CA   . GLY A 1 4  ? -6.306  17.530  -1.810  1.00 0.00 ? 4  GLY A CA   8  
ATOM 9306  C C    . GLY A 1 4  ? -4.986  17.965  -1.182  1.00 0.00 ? 4  GLY A C    8  
ATOM 9307  O O    . GLY A 1 4  ? -4.956  18.900  -0.384  1.00 0.00 ? 4  GLY A O    8  
ATOM 9308  H H    . GLY A 1 4  ? -5.861  15.588  -1.062  1.00 0.00 ? 4  GLY A H    8  
ATOM 9309  H HA2  . GLY A 1 4  ? -6.315  17.817  -2.861  1.00 0.00 ? 4  GLY A HA2  8  
ATOM 9310  H HA3  . GLY A 1 4  ? -7.131  18.023  -1.295  1.00 0.00 ? 4  GLY A HA3  8  
ATOM 9311  N N    . SER A 1 5  ? -3.893  17.283  -1.547  1.00 0.00 ? 5  SER A N    8  
ATOM 9312  C CA   . SER A 1 5  ? -2.569  17.596  -1.033  1.00 0.00 ? 5  SER A CA   8  
ATOM 9313  C C    . SER A 1 5  ? -1.519  16.893  -1.888  1.00 0.00 ? 5  SER A C    8  
ATOM 9314  O O    . SER A 1 5  ? -1.841  15.959  -2.624  1.00 0.00 ? 5  SER A O    8  
ATOM 9315  C CB   . SER A 1 5  ? -2.463  17.149  0.430   1.00 0.00 ? 5  SER A CB   8  
ATOM 9316  O OG   . SER A 1 5  ? -1.241  17.599  0.974   1.00 0.00 ? 5  SER A OG   8  
ATOM 9317  H H    . SER A 1 5  ? -3.978  16.521  -2.207  1.00 0.00 ? 5  SER A H    8  
ATOM 9318  H HA   . SER A 1 5  ? -2.411  18.674  -1.088  1.00 0.00 ? 5  SER A HA   8  
ATOM 9319  H HB2  . SER A 1 5  ? -3.289  17.571  1.003   1.00 0.00 ? 5  SER A HB2  8  
ATOM 9320  H HB3  . SER A 1 5  ? -2.506  16.060  0.482   1.00 0.00 ? 5  SER A HB3  8  
ATOM 9321  H HG   . SER A 1 5  ? -1.171  17.279  1.878   1.00 0.00 ? 5  SER A HG   8  
ATOM 9322  N N    . SER A 1 6  ? -0.264  17.344  -1.787  1.00 0.00 ? 6  SER A N    8  
ATOM 9323  C CA   . SER A 1 6  ? 0.836   16.760  -2.540  1.00 0.00 ? 6  SER A CA   8  
ATOM 9324  C C    . SER A 1 6  ? 1.486   15.645  -1.715  1.00 0.00 ? 6  SER A C    8  
ATOM 9325  O O    . SER A 1 6  ? 0.915   15.190  -0.725  1.00 0.00 ? 6  SER A O    8  
ATOM 9326  C CB   . SER A 1 6  ? 1.851   17.858  -2.880  1.00 0.00 ? 6  SER A CB   8  
ATOM 9327  O OG   . SER A 1 6  ? 2.761   17.383  -3.853  1.00 0.00 ? 6  SER A OG   8  
ATOM 9328  H H    . SER A 1 6  ? -0.062  18.114  -1.164  1.00 0.00 ? 6  SER A H    8  
ATOM 9329  H HA   . SER A 1 6  ? 0.450   16.336  -3.468  1.00 0.00 ? 6  SER A HA   8  
ATOM 9330  H HB2  . SER A 1 6  ? 1.325   18.729  -3.274  1.00 0.00 ? 6  SER A HB2  8  
ATOM 9331  H HB3  . SER A 1 6  ? 2.397   18.142  -1.979  1.00 0.00 ? 6  SER A HB3  8  
ATOM 9332  H HG   . SER A 1 6  ? 2.298   17.306  -4.692  1.00 0.00 ? 6  SER A HG   8  
ATOM 9333  N N    . GLY A 1 7  ? 2.684   15.213  -2.131  1.00 0.00 ? 7  GLY A N    8  
ATOM 9334  C CA   . GLY A 1 7  ? 3.417   14.165  -1.439  1.00 0.00 ? 7  GLY A CA   8  
ATOM 9335  C C    . GLY A 1 7  ? 3.943   13.147  -2.443  1.00 0.00 ? 7  GLY A C    8  
ATOM 9336  O O    . GLY A 1 7  ? 3.350   12.084  -2.619  1.00 0.00 ? 7  GLY A O    8  
ATOM 9337  H H    . GLY A 1 7  ? 3.103   15.628  -2.953  1.00 0.00 ? 7  GLY A H    8  
ATOM 9338  H HA2  . GLY A 1 7  ? 4.256   14.606  -0.901  1.00 0.00 ? 7  GLY A HA2  8  
ATOM 9339  H HA3  . GLY A 1 7  ? 2.760   13.661  -0.730  1.00 0.00 ? 7  GLY A HA3  8  
ATOM 9340  N N    . TYR A 1 8  ? 5.062   13.471  -3.100  1.00 0.00 ? 8  TYR A N    8  
ATOM 9341  C CA   . TYR A 1 8  ? 5.672   12.576  -4.071  1.00 0.00 ? 8  TYR A CA   8  
ATOM 9342  C C    . TYR A 1 8  ? 6.037   11.261  -3.381  1.00 0.00 ? 8  TYR A C    8  
ATOM 9343  O O    . TYR A 1 8  ? 6.823   11.262  -2.434  1.00 0.00 ? 8  TYR A O    8  
ATOM 9344  C CB   . TYR A 1 8  ? 6.912   13.253  -4.668  1.00 0.00 ? 8  TYR A CB   8  
ATOM 9345  C CG   . TYR A 1 8  ? 7.725   12.348  -5.574  1.00 0.00 ? 8  TYR A CG   8  
ATOM 9346  C CD1  . TYR A 1 8  ? 7.100   11.655  -6.628  1.00 0.00 ? 8  TYR A CD1  8  
ATOM 9347  C CD2  . TYR A 1 8  ? 9.109   12.202  -5.361  1.00 0.00 ? 8  TYR A CD2  8  
ATOM 9348  C CE1  . TYR A 1 8  ? 7.857   10.815  -7.462  1.00 0.00 ? 8  TYR A CE1  8  
ATOM 9349  C CE2  . TYR A 1 8  ? 9.863   11.361  -6.197  1.00 0.00 ? 8  TYR A CE2  8  
ATOM 9350  C CZ   . TYR A 1 8  ? 9.238   10.666  -7.246  1.00 0.00 ? 8  TYR A CZ   8  
ATOM 9351  O OH   . TYR A 1 8  ? 9.971   9.849   -8.054  1.00 0.00 ? 8  TYR A OH   8  
ATOM 9352  H H    . TYR A 1 8  ? 5.506   14.359  -2.922  1.00 0.00 ? 8  TYR A H    8  
ATOM 9353  H HA   . TYR A 1 8  ? 4.955   12.376  -4.868  1.00 0.00 ? 8  TYR A HA   8  
ATOM 9354  H HB2  . TYR A 1 8  ? 6.590   14.122  -5.243  1.00 0.00 ? 8  TYR A HB2  8  
ATOM 9355  H HB3  . TYR A 1 8  ? 7.549   13.594  -3.851  1.00 0.00 ? 8  TYR A HB3  8  
ATOM 9356  H HD1  . TYR A 1 8  ? 6.040   11.767  -6.797  1.00 0.00 ? 8  TYR A HD1  8  
ATOM 9357  H HD2  . TYR A 1 8  ? 9.591   12.733  -4.555  1.00 0.00 ? 8  TYR A HD2  8  
ATOM 9358  H HE1  . TYR A 1 8  ? 7.377   10.283  -8.270  1.00 0.00 ? 8  TYR A HE1  8  
ATOM 9359  H HE2  . TYR A 1 8  ? 10.925  11.247  -6.031  1.00 0.00 ? 8  TYR A HE2  8  
ATOM 9360  H HH   . TYR A 1 8  ? 9.442   9.408   -8.720  1.00 0.00 ? 8  TYR A HH   8  
ATOM 9361  N N    . LYS A 1 9  ? 5.454   10.146  -3.864  1.00 0.00 ? 9  LYS A N    8  
ATOM 9362  C CA   . LYS A 1 9  ? 5.665   8.801   -3.307  1.00 0.00 ? 9  LYS A CA   8  
ATOM 9363  C C    . LYS A 1 9  ? 4.920   8.655   -1.991  1.00 0.00 ? 9  LYS A C    8  
ATOM 9364  O O    . LYS A 1 9  ? 4.046   7.802   -1.855  1.00 0.00 ? 9  LYS A O    8  
ATOM 9365  C CB   . LYS A 1 9  ? 7.160   8.499   -3.077  1.00 0.00 ? 9  LYS A CB   8  
ATOM 9366  C CG   . LYS A 1 9  ? 7.998   9.043   -4.211  1.00 0.00 ? 9  LYS A CG   8  
ATOM 9367  C CD   . LYS A 1 9  ? 9.310   8.253   -4.325  1.00 0.00 ? 9  LYS A CD   8  
ATOM 9368  C CE   . LYS A 1 9  ? 10.079  8.294   -2.998  1.00 0.00 ? 9  LYS A CE   8  
ATOM 9369  N NZ   . LYS A 1 9  ? 10.270  9.678   -2.527  1.00 0.00 ? 9  LYS A NZ   8  
ATOM 9370  H H    . LYS A 1 9  ? 4.827   10.228  -4.651  1.00 0.00 ? 9  LYS A H    8  
ATOM 9371  H HA   . LYS A 1 9  ? 5.269   8.070   -4.011  1.00 0.00 ? 9  LYS A HA   8  
ATOM 9372  H HB2  . LYS A 1 9  ? 7.489   8.946   -2.140  1.00 0.00 ? 9  LYS A HB2  8  
ATOM 9373  H HB3  . LYS A 1 9  ? 7.301   7.429   -3.026  1.00 0.00 ? 9  LYS A HB3  8  
ATOM 9374  H HG2  . LYS A 1 9  ? 7.441   8.955   -5.137  1.00 0.00 ? 9  LYS A HG2  8  
ATOM 9375  H HG3  . LYS A 1 9  ? 8.217   10.082  -4.014  1.00 0.00 ? 9  LYS A HG3  8  
ATOM 9376  H HD2  . LYS A 1 9  ? 9.086   7.215   -4.580  1.00 0.00 ? 9  LYS A HD2  8  
ATOM 9377  H HD3  . LYS A 1 9  ? 9.926   8.689   -5.113  1.00 0.00 ? 9  LYS A HD3  8  
ATOM 9378  H HE2  . LYS A 1 9  ? 9.527   7.732   -2.243  1.00 0.00 ? 9  LYS A HE2  8  
ATOM 9379  H HE3  . LYS A 1 9  ? 11.056  7.828   -3.139  1.00 0.00 ? 9  LYS A HE3  8  
ATOM 9380  H HZ1  . LYS A 1 9  ? 10.717  10.222  -3.251  1.00 0.00 ? 9  LYS A HZ1  8  
ATOM 9381  H HZ2  . LYS A 1 9  ? 9.372   10.086  -2.305  1.00 0.00 ? 9  LYS A HZ2  8  
ATOM 9382  H HZ3  . LYS A 1 9  ? 10.851  9.676   -1.701  1.00 0.00 ? 9  LYS A HZ3  8  
ATOM 9383  N N    . PHE A 1 10 ? 5.297   9.479   -1.018  1.00 0.00 ? 10 PHE A N    8  
ATOM 9384  C CA   . PHE A 1 10 ? 4.772   9.396   0.320   1.00 0.00 ? 10 PHE A CA   8  
ATOM 9385  C C    . PHE A 1 10 ? 3.245   9.524   0.337   1.00 0.00 ? 10 PHE A C    8  
ATOM 9386  O O    . PHE A 1 10 ? 2.572   8.762   1.025   1.00 0.00 ? 10 PHE A O    8  
ATOM 9387  C CB   . PHE A 1 10 ? 5.424   10.484  1.179   1.00 0.00 ? 10 PHE A CB   8  
ATOM 9388  C CG   . PHE A 1 10 ? 6.918   10.612  0.944   1.00 0.00 ? 10 PHE A CG   8  
ATOM 9389  C CD1  . PHE A 1 10 ? 7.745   9.477   1.033   1.00 0.00 ? 10 PHE A CD1  8  
ATOM 9390  C CD2  . PHE A 1 10 ? 7.478   11.863  0.619   1.00 0.00 ? 10 PHE A CD2  8  
ATOM 9391  C CE1  . PHE A 1 10 ? 9.125   9.591   0.800   1.00 0.00 ? 10 PHE A CE1  8  
ATOM 9392  C CE2  . PHE A 1 10 ? 8.859   11.976  0.387   1.00 0.00 ? 10 PHE A CE2  8  
ATOM 9393  C CZ   . PHE A 1 10 ? 9.683   10.841  0.478   1.00 0.00 ? 10 PHE A CZ   8  
ATOM 9394  H H    . PHE A 1 10 ? 5.996   10.181  -1.208  1.00 0.00 ? 10 PHE A H    8  
ATOM 9395  H HA   . PHE A 1 10 ? 5.051   8.426   0.713   1.00 0.00 ? 10 PHE A HA   8  
ATOM 9396  H HB2  . PHE A 1 10 ? 4.951   11.440  0.952   1.00 0.00 ? 10 PHE A HB2  8  
ATOM 9397  H HB3  . PHE A 1 10 ? 5.253   10.250  2.230   1.00 0.00 ? 10 PHE A HB3  8  
ATOM 9398  H HD1  . PHE A 1 10 ? 7.319   8.515   1.279   1.00 0.00 ? 10 PHE A HD1  8  
ATOM 9399  H HD2  . PHE A 1 10 ? 6.846   12.736  0.545   1.00 0.00 ? 10 PHE A HD2  8  
ATOM 9400  H HE1  . PHE A 1 10 ? 9.757   8.719   0.868   1.00 0.00 ? 10 PHE A HE1  8  
ATOM 9401  H HE2  . PHE A 1 10 ? 9.287   12.935  0.139   1.00 0.00 ? 10 PHE A HE2  8  
ATOM 9402  H HZ   . PHE A 1 10 ? 10.746  10.930  0.302   1.00 0.00 ? 10 PHE A HZ   8  
ATOM 9403  N N    . GLY A 1 11 ? 2.704   10.488  -0.415  1.00 0.00 ? 11 GLY A N    8  
ATOM 9404  C CA   . GLY A 1 11 ? 1.266   10.716  -0.466  1.00 0.00 ? 11 GLY A CA   8  
ATOM 9405  C C    . GLY A 1 11 ? 0.551   9.480   -1.007  1.00 0.00 ? 11 GLY A C    8  
ATOM 9406  O O    . GLY A 1 11 ? -0.417  9.007   -0.409  1.00 0.00 ? 11 GLY A O    8  
ATOM 9407  H H    . GLY A 1 11 ? 3.302   11.087  -0.970  1.00 0.00 ? 11 GLY A H    8  
ATOM 9408  H HA2  . GLY A 1 11 ? 0.900   10.935  0.537   1.00 0.00 ? 11 GLY A HA2  8  
ATOM 9409  H HA3  . GLY A 1 11 ? 1.059   11.565  -1.118  1.00 0.00 ? 11 GLY A HA3  8  
ATOM 9410  N N    . VAL A 1 12 ? 1.032   8.960   -2.141  1.00 0.00 ? 12 VAL A N    8  
ATOM 9411  C CA   . VAL A 1 12 ? 0.448   7.782   -2.764  1.00 0.00 ? 12 VAL A CA   8  
ATOM 9412  C C    . VAL A 1 12 ? 0.475   6.611   -1.777  1.00 0.00 ? 12 VAL A C    8  
ATOM 9413  O O    . VAL A 1 12 ? -0.530  5.929   -1.595  1.00 0.00 ? 12 VAL A O    8  
ATOM 9414  C CB   . VAL A 1 12 ? 1.230   7.451   -4.049  1.00 0.00 ? 12 VAL A CB   8  
ATOM 9415  C CG1  . VAL A 1 12 ? 0.787   6.091   -4.595  1.00 0.00 ? 12 VAL A CG1  8  
ATOM 9416  C CG2  . VAL A 1 12 ? 0.958   8.529   -5.106  1.00 0.00 ? 12 VAL A CG2  8  
ATOM 9417  H H    . VAL A 1 12 ? 1.829   9.392   -2.588  1.00 0.00 ? 12 VAL A H    8  
ATOM 9418  H HA   . VAL A 1 12 ? -0.589  7.998   -3.026  1.00 0.00 ? 12 VAL A HA   8  
ATOM 9419  H HB   . VAL A 1 12 ? 2.299   7.423   -3.829  1.00 0.00 ? 12 VAL A HB   8  
ATOM 9420  H HG11 . VAL A 1 12 ? -0.300  6.043   -4.619  1.00 0.00 ? 12 VAL A HG11 8  
ATOM 9421  H HG12 . VAL A 1 12 ? 1.178   5.960   -5.606  1.00 0.00 ? 12 VAL A HG12 8  
ATOM 9422  H HG13 . VAL A 1 12 ? 1.173   5.298   -3.955  1.00 0.00 ? 12 VAL A HG13 8  
ATOM 9423  H HG21 . VAL A 1 12 ? 1.270   9.501   -4.725  1.00 0.00 ? 12 VAL A HG21 8  
ATOM 9424  H HG22 . VAL A 1 12 ? 1.519   8.298   -6.012  1.00 0.00 ? 12 VAL A HG22 8  
ATOM 9425  H HG23 . VAL A 1 12 ? -0.108  8.554   -5.336  1.00 0.00 ? 12 VAL A HG23 8  
ATOM 9426  N N    . LEU A 1 13 ? 1.631   6.388   -1.144  1.00 0.00 ? 13 LEU A N    8  
ATOM 9427  C CA   . LEU A 1 13 ? 1.802   5.305   -0.185  1.00 0.00 ? 13 LEU A CA   8  
ATOM 9428  C C    . LEU A 1 13 ? 0.819   5.458   0.977   1.00 0.00 ? 13 LEU A C    8  
ATOM 9429  O O    . LEU A 1 13 ? 0.179   4.490   1.373   1.00 0.00 ? 13 LEU A O    8  
ATOM 9430  C CB   . LEU A 1 13 ? 3.251   5.316   0.312   1.00 0.00 ? 13 LEU A CB   8  
ATOM 9431  C CG   . LEU A 1 13 ? 3.460   4.285   1.432   1.00 0.00 ? 13 LEU A CG   8  
ATOM 9432  C CD1  . LEU A 1 13 ? 3.176   2.872   0.908   1.00 0.00 ? 13 LEU A CD1  8  
ATOM 9433  C CD2  . LEU A 1 13 ? 4.907   4.369   1.920   1.00 0.00 ? 13 LEU A CD2  8  
ATOM 9434  H H    . LEU A 1 13 ? 2.426   6.986   -1.332  1.00 0.00 ? 13 LEU A H    8  
ATOM 9435  H HA   . LEU A 1 13 ? 1.609   4.359   -0.690  1.00 0.00 ? 13 LEU A HA   8  
ATOM 9436  H HB2  . LEU A 1 13 ? 3.913   5.079   -0.519  1.00 0.00 ? 13 LEU A HB2  8  
ATOM 9437  H HB3  . LEU A 1 13 ? 3.495   6.309   0.691   1.00 0.00 ? 13 LEU A HB3  8  
ATOM 9438  H HG   . LEU A 1 13 ? 2.790   4.504   2.263   1.00 0.00 ? 13 LEU A HG   8  
ATOM 9439  H HD11 . LEU A 1 13 ? 2.105   2.747   0.752   1.00 0.00 ? 13 LEU A HD11 8  
ATOM 9440  H HD12 . LEU A 1 13 ? 3.521   2.138   1.637   1.00 0.00 ? 13 LEU A HD12 8  
ATOM 9441  H HD13 . LEU A 1 13 ? 3.701   2.720   -0.035  1.00 0.00 ? 13 LEU A HD13 8  
ATOM 9442  H HD21 . LEU A 1 13 ? 5.072   5.335   2.401   1.00 0.00 ? 13 LEU A HD21 8  
ATOM 9443  H HD22 . LEU A 1 13 ? 5.585   4.269   1.072   1.00 0.00 ? 13 LEU A HD22 8  
ATOM 9444  H HD23 . LEU A 1 13 ? 5.099   3.571   2.637   1.00 0.00 ? 13 LEU A HD23 8  
ATOM 9445  N N    . ALA A 1 14 ? 0.702   6.671   1.524   1.00 0.00 ? 14 ALA A N    8  
ATOM 9446  C CA   . ALA A 1 14 ? -0.196  6.928   2.644   1.00 0.00 ? 14 ALA A CA   8  
ATOM 9447  C C    . ALA A 1 14 ? -1.637  6.597   2.257   1.00 0.00 ? 14 ALA A C    8  
ATOM 9448  O O    . ALA A 1 14 ? -2.358  5.970   3.034   1.00 0.00 ? 14 ALA A O    8  
ATOM 9449  C CB   . ALA A 1 14 ? -0.073  8.395   3.064   1.00 0.00 ? 14 ALA A CB   8  
ATOM 9450  H H    . ALA A 1 14 ? 1.250   7.440   1.161   1.00 0.00 ? 14 ALA A H    8  
ATOM 9451  H HA   . ALA A 1 14 ? 0.096   6.295   3.486   1.00 0.00 ? 14 ALA A HA   8  
ATOM 9452  H HB1  . ALA A 1 14 ? -0.355  9.038   2.231   1.00 0.00 ? 14 ALA A HB1  8  
ATOM 9453  H HB2  . ALA A 1 14 ? 0.957   8.606   3.352   1.00 0.00 ? 14 ALA A HB2  8  
ATOM 9454  H HB3  . ALA A 1 14 ? -0.732  8.587   3.910   1.00 0.00 ? 14 ALA A HB3  8  
ATOM 9455  N N    . LYS A 1 15 ? -2.061  7.014   1.057   1.00 0.00 ? 15 LYS A N    8  
ATOM 9456  C CA   . LYS A 1 15 ? -3.410  6.757   0.595   1.00 0.00 ? 15 LYS A CA   8  
ATOM 9457  C C    . LYS A 1 15 ? -3.612  5.255   0.397   1.00 0.00 ? 15 LYS A C    8  
ATOM 9458  O O    . LYS A 1 15 ? -4.672  4.730   0.720   1.00 0.00 ? 15 LYS A O    8  
ATOM 9459  C CB   . LYS A 1 15 ? -3.658  7.527   -0.702  1.00 0.00 ? 15 LYS A CB   8  
ATOM 9460  C CG   . LYS A 1 15 ? -5.155  7.822   -0.847  1.00 0.00 ? 15 LYS A CG   8  
ATOM 9461  C CD   . LYS A 1 15 ? -5.382  8.848   -1.965  1.00 0.00 ? 15 LYS A CD   8  
ATOM 9462  C CE   . LYS A 1 15 ? -4.805  8.343   -3.292  1.00 0.00 ? 15 LYS A CE   8  
ATOM 9463  N NZ   . LYS A 1 15 ? -5.305  6.995   -3.618  1.00 0.00 ? 15 LYS A NZ   8  
ATOM 9464  H H    . LYS A 1 15 ? -1.436  7.524   0.446   1.00 0.00 ? 15 LYS A H    8  
ATOM 9465  H HA   . LYS A 1 15 ? -4.109  7.109   1.355   1.00 0.00 ? 15 LYS A HA   8  
ATOM 9466  H HB2  . LYS A 1 15 ? -3.108  8.469   -0.674  1.00 0.00 ? 15 LYS A HB2  8  
ATOM 9467  H HB3  . LYS A 1 15 ? -3.314  6.933   -1.549  1.00 0.00 ? 15 LYS A HB3  8  
ATOM 9468  H HG2  . LYS A 1 15 ? -5.690  6.900   -1.075  1.00 0.00 ? 15 LYS A HG2  8  
ATOM 9469  H HG3  . LYS A 1 15 ? -5.533  8.231   0.091   1.00 0.00 ? 15 LYS A HG3  8  
ATOM 9470  H HD2  . LYS A 1 15 ? -6.452  9.024   -2.078  1.00 0.00 ? 15 LYS A HD2  8  
ATOM 9471  H HD3  . LYS A 1 15 ? -4.890  9.785   -1.694  1.00 0.00 ? 15 LYS A HD3  8  
ATOM 9472  H HE2  . LYS A 1 15 ? -5.093  9.031   -4.088  1.00 0.00 ? 15 LYS A HE2  8  
ATOM 9473  H HE3  . LYS A 1 15 ? -3.718  8.316   -3.226  1.00 0.00 ? 15 LYS A HE3  8  
ATOM 9474  H HZ1  . LYS A 1 15 ? -4.847  6.661   -4.458  1.00 0.00 ? 15 LYS A HZ1  8  
ATOM 9475  H HZ2  . LYS A 1 15 ? -5.100  6.367   -2.857  1.00 0.00 ? 15 LYS A HZ2  8  
ATOM 9476  H HZ3  . LYS A 1 15 ? -6.303  7.031   -3.770  1.00 0.00 ? 15 LYS A HZ3  8  
ATOM 9477  N N    . ILE A 1 16 ? -2.589  4.565   -0.128  1.00 0.00 ? 16 ILE A N    8  
ATOM 9478  C CA   . ILE A 1 16 ? -2.650  3.123   -0.330  1.00 0.00 ? 16 ILE A CA   8  
ATOM 9479  C C    . ILE A 1 16 ? -2.818  2.433   1.022   1.00 0.00 ? 16 ILE A C    8  
ATOM 9480  O O    . ILE A 1 16 ? -3.662  1.552   1.170   1.00 0.00 ? 16 ILE A O    8  
ATOM 9481  C CB   . ILE A 1 16 ? -1.371  2.648   -1.044  1.00 0.00 ? 16 ILE A CB   8  
ATOM 9482  C CG1  . ILE A 1 16 ? -1.484  2.959   -2.546  1.00 0.00 ? 16 ILE A CG1  8  
ATOM 9483  C CG2  . ILE A 1 16 ? -1.192  1.137   -0.834  1.00 0.00 ? 16 ILE A CG2  8  
ATOM 9484  C CD1  . ILE A 1 16 ? -0.119  2.813   -3.224  1.00 0.00 ? 16 ILE A CD1  8  
ATOM 9485  H H    . ILE A 1 16 ? -1.739  5.051   -0.391  1.00 0.00 ? 16 ILE A H    8  
ATOM 9486  H HA   . ILE A 1 16 ? -3.510  2.888   -0.955  1.00 0.00 ? 16 ILE A HA   8  
ATOM 9487  H HB   . ILE A 1 16 ? -0.511  3.170   -0.631  1.00 0.00 ? 16 ILE A HB   8  
ATOM 9488  H HG12 . ILE A 1 16 ? -2.191  2.272   -3.007  1.00 0.00 ? 16 ILE A HG12 8  
ATOM 9489  H HG13 . ILE A 1 16 ? -1.841  3.981   -2.678  1.00 0.00 ? 16 ILE A HG13 8  
ATOM 9490  H HG21 . ILE A 1 16 ? -2.128  0.624   -1.056  1.00 0.00 ? 16 ILE A HG21 8  
ATOM 9491  H HG22 . ILE A 1 16 ? -0.911  0.943   0.201   1.00 0.00 ? 16 ILE A HG22 8  
ATOM 9492  H HG23 . ILE A 1 16 ? -0.409  0.764   -1.491  1.00 0.00 ? 16 ILE A HG23 8  
ATOM 9493  H HD11 . ILE A 1 16 ? 0.154   1.761   -3.278  1.00 0.00 ? 16 ILE A HD11 8  
ATOM 9494  H HD12 . ILE A 1 16 ? -0.170  3.223   -4.233  1.00 0.00 ? 16 ILE A HD12 8  
ATOM 9495  H HD13 . ILE A 1 16 ? 0.633   3.354   -2.652  1.00 0.00 ? 16 ILE A HD13 8  
ATOM 9496  N N    . VAL A 1 17 ? -2.013  2.840   2.008   1.00 0.00 ? 17 VAL A N    8  
ATOM 9497  C CA   . VAL A 1 17 ? -2.075  2.276   3.345   1.00 0.00 ? 17 VAL A CA   8  
ATOM 9498  C C    . VAL A 1 17 ? -3.479  2.470   3.918   1.00 0.00 ? 17 VAL A C    8  
ATOM 9499  O O    . VAL A 1 17 ? -4.065  1.527   4.430   1.00 0.00 ? 17 VAL A O    8  
ATOM 9500  C CB   . VAL A 1 17 ? -1.002  2.945   4.228   1.00 0.00 ? 17 VAL A CB   8  
ATOM 9501  C CG1  . VAL A 1 17 ? -1.378  2.837   5.710   1.00 0.00 ? 17 VAL A CG1  8  
ATOM 9502  C CG2  . VAL A 1 17 ? 0.346   2.252   4.003   1.00 0.00 ? 17 VAL A CG2  8  
ATOM 9503  H H    . VAL A 1 17 ? -1.334  3.567   1.829   1.00 0.00 ? 17 VAL A H    8  
ATOM 9504  H HA   . VAL A 1 17 ? -1.867  1.207   3.287   1.00 0.00 ? 17 VAL A HA   8  
ATOM 9505  H HB   . VAL A 1 17 ? -0.915  3.996   3.958   1.00 0.00 ? 17 VAL A HB   8  
ATOM 9506  H HG11 . VAL A 1 17 ? -1.638  1.804   5.951   1.00 0.00 ? 17 VAL A HG11 8  
ATOM 9507  H HG12 . VAL A 1 17 ? -0.529  3.148   6.321   1.00 0.00 ? 17 VAL A HG12 8  
ATOM 9508  H HG13 . VAL A 1 17 ? -2.227  3.486   5.922   1.00 0.00 ? 17 VAL A HG13 8  
ATOM 9509  H HG21 . VAL A 1 17 ? 0.296   1.226   4.370   1.00 0.00 ? 17 VAL A HG21 8  
ATOM 9510  H HG22 . VAL A 1 17 ? 1.126   2.791   4.541   1.00 0.00 ? 17 VAL A HG22 8  
ATOM 9511  H HG23 . VAL A 1 17 ? 0.579   2.246   2.938   1.00 0.00 ? 17 VAL A HG23 8  
ATOM 9512  N N    . ASN A 1 18 ? -4.016  3.695   3.829   1.00 0.00 ? 18 ASN A N    8  
ATOM 9513  C CA   . ASN A 1 18 ? -5.344  3.995   4.352   1.00 0.00 ? 18 ASN A CA   8  
ATOM 9514  C C    . ASN A 1 18 ? -6.403  3.185   3.604   1.00 0.00 ? 18 ASN A C    8  
ATOM 9515  O O    . ASN A 1 18 ? -7.363  2.717   4.213   1.00 0.00 ? 18 ASN A O    8  
ATOM 9516  C CB   . ASN A 1 18 ? -5.620  5.493   4.220   1.00 0.00 ? 18 ASN A CB   8  
ATOM 9517  C CG   . ASN A 1 18 ? -6.985  5.848   4.804   1.00 0.00 ? 18 ASN A CG   8  
ATOM 9518  O OD1  . ASN A 1 18 ? -7.360  5.350   5.866   1.00 0.00 ? 18 ASN A OD1  8  
ATOM 9519  N ND2  . ASN A 1 18 ? -7.730  6.709   4.110   1.00 0.00 ? 18 ASN A ND2  8  
ATOM 9520  H H    . ASN A 1 18 ? -3.492  4.442   3.386   1.00 0.00 ? 18 ASN A H    8  
ATOM 9521  H HA   . ASN A 1 18 ? -5.380  3.722   5.412   1.00 0.00 ? 18 ASN A HA   8  
ATOM 9522  H HB2  . ASN A 1 18 ? -4.847  6.049   4.753   1.00 0.00 ? 18 ASN A HB2  8  
ATOM 9523  H HB3  . ASN A 1 18 ? -5.595  5.771   3.165   1.00 0.00 ? 18 ASN A HB3  8  
ATOM 9524  H HD21 . ASN A 1 18 ? -7.381  7.093   3.245   1.00 0.00 ? 18 ASN A HD21 8  
ATOM 9525  H HD22 . ASN A 1 18 ? -8.641  6.974   4.453   1.00 0.00 ? 18 ASN A HD22 8  
ATOM 9526  N N    . TYR A 1 19 ? -6.230  3.017   2.289   1.00 0.00 ? 19 TYR A N    8  
ATOM 9527  C CA   . TYR A 1 19 ? -7.167  2.251   1.483   1.00 0.00 ? 19 TYR A CA   8  
ATOM 9528  C C    . TYR A 1 19 ? -7.194  0.806   1.972   1.00 0.00 ? 19 TYR A C    8  
ATOM 9529  O O    . TYR A 1 19 ? -8.253  0.297   2.326   1.00 0.00 ? 19 TYR A O    8  
ATOM 9530  C CB   . TYR A 1 19 ? -6.765  2.323   0.002   1.00 0.00 ? 19 TYR A CB   8  
ATOM 9531  C CG   . TYR A 1 19 ? -7.073  1.050   -0.763  1.00 0.00 ? 19 TYR A CG   8  
ATOM 9532  C CD1  . TYR A 1 19 ? -8.404  0.612   -0.896  1.00 0.00 ? 19 TYR A CD1  8  
ATOM 9533  C CD2  . TYR A 1 19 ? -6.026  0.289   -1.313  1.00 0.00 ? 19 TYR A CD2  8  
ATOM 9534  C CE1  . TYR A 1 19 ? -8.682  -0.588  -1.570  1.00 0.00 ? 19 TYR A CE1  8  
ATOM 9535  C CE2  . TYR A 1 19 ? -6.307  -0.909  -1.988  1.00 0.00 ? 19 TYR A CE2  8  
ATOM 9536  C CZ   . TYR A 1 19 ? -7.633  -1.350  -2.111  1.00 0.00 ? 19 TYR A CZ   8  
ATOM 9537  O OH   . TYR A 1 19 ? -7.902  -2.522  -2.750  1.00 0.00 ? 19 TYR A OH   8  
ATOM 9538  H H    . TYR A 1 19 ? -5.427  3.428   1.831   1.00 0.00 ? 19 TYR A H    8  
ATOM 9539  H HA   . TYR A 1 19 ? -8.164  2.679   1.598   1.00 0.00 ? 19 TYR A HA   8  
ATOM 9540  H HB2  . TYR A 1 19 ? -7.299  3.150   -0.466  1.00 0.00 ? 19 TYR A HB2  8  
ATOM 9541  H HB3  . TYR A 1 19 ? -5.698  2.517   -0.064  1.00 0.00 ? 19 TYR A HB3  8  
ATOM 9542  H HD1  . TYR A 1 19 ? -9.209  1.192   -0.472  1.00 0.00 ? 19 TYR A HD1  8  
ATOM 9543  H HD2  . TYR A 1 19 ? -5.003  0.621   -1.208  1.00 0.00 ? 19 TYR A HD2  8  
ATOM 9544  H HE1  . TYR A 1 19 ? -9.703  -0.928  -1.666  1.00 0.00 ? 19 TYR A HE1  8  
ATOM 9545  H HE2  . TYR A 1 19 ? -5.503  -1.495  -2.403  1.00 0.00 ? 19 TYR A HE2  8  
ATOM 9546  H HH   . TYR A 1 19 ? -7.145  -2.870  -3.229  1.00 0.00 ? 19 TYR A HH   8  
ATOM 9547  N N    . MET A 1 20 ? -6.028  0.145   1.994   1.00 0.00 ? 20 MET A N    8  
ATOM 9548  C CA   . MET A 1 20 ? -5.938  -1.236  2.445   1.00 0.00 ? 20 MET A CA   8  
ATOM 9549  C C    . MET A 1 20 ? -6.414  -1.338  3.890   1.00 0.00 ? 20 MET A C    8  
ATOM 9550  O O    . MET A 1 20 ? -7.032  -2.327  4.267   1.00 0.00 ? 20 MET A O    8  
ATOM 9551  C CB   . MET A 1 20 ? -4.498  -1.736  2.311   1.00 0.00 ? 20 MET A CB   8  
ATOM 9552  C CG   . MET A 1 20 ? -4.121  -1.866  0.830   1.00 0.00 ? 20 MET A CG   8  
ATOM 9553  S SD   . MET A 1 20 ? -3.090  -3.309  0.458   1.00 0.00 ? 20 MET A SD   8  
ATOM 9554  C CE   . MET A 1 20 ? -4.328  -4.615  0.671   1.00 0.00 ? 20 MET A CE   8  
ATOM 9555  H H    . MET A 1 20 ? -5.182  0.609   1.692   1.00 0.00 ? 20 MET A H    8  
ATOM 9556  H HA   . MET A 1 20 ? -6.586  -1.854  1.820   1.00 0.00 ? 20 MET A HA   8  
ATOM 9557  H HB2  . MET A 1 20 ? -3.820  -1.036  2.799   1.00 0.00 ? 20 MET A HB2  8  
ATOM 9558  H HB3  . MET A 1 20 ? -4.416  -2.710  2.787   1.00 0.00 ? 20 MET A HB3  8  
ATOM 9559  H HG2  . MET A 1 20 ? -5.032  -1.936  0.240   1.00 0.00 ? 20 MET A HG2  8  
ATOM 9560  H HG3  . MET A 1 20 ? -3.581  -0.969  0.531   1.00 0.00 ? 20 MET A HG3  8  
ATOM 9561  H HE1  . MET A 1 20 ? -4.657  -4.642  1.709   1.00 0.00 ? 20 MET A HE1  8  
ATOM 9562  H HE2  . MET A 1 20 ? -5.182  -4.415  0.025   1.00 0.00 ? 20 MET A HE2  8  
ATOM 9563  H HE3  . MET A 1 20 ? -3.891  -5.576  0.405   1.00 0.00 ? 20 MET A HE3  8  
ATOM 9564  N N    . LYS A 1 21 ? -6.132  -0.309  4.697   1.00 0.00 ? 21 LYS A N    8  
ATOM 9565  C CA   . LYS A 1 21 ? -6.566  -0.270  6.082   1.00 0.00 ? 21 LYS A CA   8  
ATOM 9566  C C    . LYS A 1 21 ? -8.095  -0.314  6.127   1.00 0.00 ? 21 LYS A C    8  
ATOM 9567  O O    . LYS A 1 21 ? -8.663  -1.067  6.902   1.00 0.00 ? 21 LYS A O    8  
ATOM 9568  C CB   . LYS A 1 21 ? -6.011  1.006   6.747   1.00 0.00 ? 21 LYS A CB   8  
ATOM 9569  C CG   . LYS A 1 21 ? -6.292  1.010   8.258   1.00 0.00 ? 21 LYS A CG   8  
ATOM 9570  C CD   . LYS A 1 21 ? -6.940  2.333   8.680   1.00 0.00 ? 21 LYS A CD   8  
ATOM 9571  C CE   . LYS A 1 21 ? -8.406  2.352   8.263   1.00 0.00 ? 21 LYS A CE   8  
ATOM 9572  N NZ   . LYS A 1 21 ? -8.611  3.148   7.039   1.00 0.00 ? 21 LYS A NZ   8  
ATOM 9573  H H    . LYS A 1 21 ? -5.605  0.476   4.339   1.00 0.00 ? 21 LYS A H    8  
ATOM 9574  H HA   . LYS A 1 21 ? -6.173  -1.142  6.601   1.00 0.00 ? 21 LYS A HA   8  
ATOM 9575  H HB2  . LYS A 1 21 ? -4.934  1.047   6.593   1.00 0.00 ? 21 LYS A HB2  8  
ATOM 9576  H HB3  . LYS A 1 21 ? -6.465  1.875   6.292   1.00 0.00 ? 21 LYS A HB3  8  
ATOM 9577  H HG2  . LYS A 1 21 ? -6.949  0.179   8.517   1.00 0.00 ? 21 LYS A HG2  8  
ATOM 9578  H HG3  . LYS A 1 21 ? -5.354  0.902   8.791   1.00 0.00 ? 21 LYS A HG3  8  
ATOM 9579  H HD2  . LYS A 1 21 ? -6.881  2.427   9.765   1.00 0.00 ? 21 LYS A HD2  8  
ATOM 9580  H HD3  . LYS A 1 21 ? -6.412  3.166   8.218   1.00 0.00 ? 21 LYS A HD3  8  
ATOM 9581  H HE2  . LYS A 1 21 ? -8.736  1.330   8.089   1.00 0.00 ? 21 LYS A HE2  8  
ATOM 9582  H HE3  . LYS A 1 21 ? -8.995  2.783   9.068   1.00 0.00 ? 21 LYS A HE3  8  
ATOM 9583  H HZ1  . LYS A 1 21 ? -9.599  3.194   6.824   1.00 0.00 ? 21 LYS A HZ1  8  
ATOM 9584  H HZ2  . LYS A 1 21 ? -8.253  4.086   7.175   1.00 0.00 ? 21 LYS A HZ2  8  
ATOM 9585  H HZ3  . LYS A 1 21 ? -8.126  2.716   6.265   1.00 0.00 ? 21 LYS A HZ3  8  
ATOM 9586  N N    . THR A 1 22 ? -8.755  0.496   5.287   1.00 0.00 ? 22 THR A N    8  
ATOM 9587  C CA   . THR A 1 22 ? -10.213 0.552   5.241   1.00 0.00 ? 22 THR A CA   8  
ATOM 9588  C C    . THR A 1 22 ? -10.781 -0.764  4.701   1.00 0.00 ? 22 THR A C    8  
ATOM 9589  O O    . THR A 1 22 ? -11.742 -1.289  5.248   1.00 0.00 ? 22 THR A O    8  
ATOM 9590  C CB   . THR A 1 22 ? -10.649 1.729   4.352   1.00 0.00 ? 22 THR A CB   8  
ATOM 9591  O OG1  . THR A 1 22 ? -10.020 2.914   4.787   1.00 0.00 ? 22 THR A OG1  8  
ATOM 9592  C CG2  . THR A 1 22 ? -12.163 1.913   4.433   1.00 0.00 ? 22 THR A CG2  8  
ATOM 9593  H H    . THR A 1 22 ? -8.234  1.094   4.658   1.00 0.00 ? 22 THR A H    8  
ATOM 9594  H HA   . THR A 1 22 ? -10.593 0.709   6.258   1.00 0.00 ? 22 THR A HA   8  
ATOM 9595  H HB   . THR A 1 22 ? -10.364 1.530   3.317   1.00 0.00 ? 22 THR A HB   8  
ATOM 9596  H HG1  . THR A 1 22 ? -9.191  3.011   4.306   1.00 0.00 ? 22 THR A HG1  8  
ATOM 9597  H HG21 . THR A 1 22 ? -12.457 2.063   5.472   1.00 0.00 ? 22 THR A HG21 8  
ATOM 9598  H HG22 . THR A 1 22 ? -12.455 2.784   3.845   1.00 0.00 ? 22 THR A HG22 8  
ATOM 9599  H HG23 . THR A 1 22 ? -12.661 1.028   4.037   1.00 0.00 ? 22 THR A HG23 8  
ATOM 9600  N N    . ARG A 1 23 ? -10.184 -1.288  3.624   1.00 0.00 ? 23 ARG A N    8  
ATOM 9601  C CA   . ARG A 1 23 ? -10.631 -2.531  3.007   1.00 0.00 ? 23 ARG A CA   8  
ATOM 9602  C C    . ARG A 1 23 ? -10.541 -3.673  4.021   1.00 0.00 ? 23 ARG A C    8  
ATOM 9603  O O    . ARG A 1 23 ? -11.477 -4.461  4.165   1.00 0.00 ? 23 ARG A O    8  
ATOM 9604  C CB   . ARG A 1 23 ? -9.754  -2.811  1.778   1.00 0.00 ? 23 ARG A CB   8  
ATOM 9605  C CG   . ARG A 1 23 ? -10.299 -4.014  1.011   1.00 0.00 ? 23 ARG A CG   8  
ATOM 9606  C CD   . ARG A 1 23 ? -9.362  -4.363  -0.147  1.00 0.00 ? 23 ARG A CD   8  
ATOM 9607  N NE   . ARG A 1 23 ? -10.023 -5.280  -1.093  1.00 0.00 ? 23 ARG A NE   8  
ATOM 9608  C CZ   . ARG A 1 23 ? -10.696 -4.872  -2.186  1.00 0.00 ? 23 ARG A CZ   8  
ATOM 9609  N NH1  . ARG A 1 23 ? -10.506 -3.646  -2.687  1.00 0.00 ? 23 ARG A NH1  8  
ATOM 9610  N NH2  . ARG A 1 23 ? -11.560 -5.706  -2.775  1.00 0.00 ? 23 ARG A NH2  8  
ATOM 9611  H H    . ARG A 1 23 ? -9.392  -0.812  3.215   1.00 0.00 ? 23 ARG A H    8  
ATOM 9612  H HA   . ARG A 1 23 ? -11.674 -2.418  2.691   1.00 0.00 ? 23 ARG A HA   8  
ATOM 9613  H HB2  . ARG A 1 23 ? -9.755  -1.936  1.125   1.00 0.00 ? 23 ARG A HB2  8  
ATOM 9614  H HB3  . ARG A 1 23 ? -8.734  -3.019  2.101   1.00 0.00 ? 23 ARG A HB3  8  
ATOM 9615  H HG2  . ARG A 1 23 ? -10.369 -4.865  1.684   1.00 0.00 ? 23 ARG A HG2  8  
ATOM 9616  H HG3  . ARG A 1 23 ? -11.289 -3.776  0.622   1.00 0.00 ? 23 ARG A HG3  8  
ATOM 9617  H HD2  . ARG A 1 23 ? -9.072  -3.451  -0.660  1.00 0.00 ? 23 ARG A HD2  8  
ATOM 9618  H HD3  . ARG A 1 23 ? -8.468  -4.846  0.250   1.00 0.00 ? 23 ARG A HD3  8  
ATOM 9619  H HE   . ARG A 1 23 ? -9.969  -6.271  -0.897  1.00 0.00 ? 23 ARG A HE   8  
ATOM 9620  H HH11 . ARG A 1 23 ? -9.728  -3.084  -2.372  1.00 0.00 ? 23 ARG A HH11 8  
ATOM 9621  H HH12 . ARG A 1 23 ? -11.144 -3.276  -3.389  1.00 0.00 ? 23 ARG A HH12 8  
ATOM 9622  H HH21 . ARG A 1 23 ? -11.724 -6.630  -2.376  1.00 0.00 ? 23 ARG A HH21 8  
ATOM 9623  H HH22 . ARG A 1 23 ? -12.049 -5.422  -3.610  1.00 0.00 ? 23 ARG A HH22 8  
ATOM 9624  N N    . HIS A 1 24 ? -9.414  -3.746  4.729   1.00 0.00 ? 24 HIS A N    8  
ATOM 9625  C CA   . HIS A 1 24 ? -9.213  -4.733  5.773   1.00 0.00 ? 24 HIS A CA   8  
ATOM 9626  C C    . HIS A 1 24 ? -10.237 -4.476  6.875   1.00 0.00 ? 24 HIS A C    8  
ATOM 9627  O O    . HIS A 1 24 ? -10.812 -5.409  7.432   1.00 0.00 ? 24 HIS A O    8  
ATOM 9628  C CB   . HIS A 1 24 ? -7.778  -4.603  6.288   1.00 0.00 ? 24 HIS A CB   8  
ATOM 9629  C CG   . HIS A 1 24 ? -7.441  -5.565  7.396   1.00 0.00 ? 24 HIS A CG   8  
ATOM 9630  N ND1  . HIS A 1 24 ? -6.642  -6.687  7.203   1.00 0.00 ? 24 HIS A ND1  8  
ATOM 9631  C CD2  . HIS A 1 24 ? -7.748  -5.578  8.729   1.00 0.00 ? 24 HIS A CD2  8  
ATOM 9632  C CE1  . HIS A 1 24 ? -6.529  -7.292  8.402   1.00 0.00 ? 24 HIS A CE1  8  
ATOM 9633  N NE2  . HIS A 1 24 ? -7.181  -6.663  9.379   1.00 0.00 ? 24 HIS A NE2  8  
ATOM 9634  H H    . HIS A 1 24 ? -8.670  -3.086  4.551   1.00 0.00 ? 24 HIS A H    8  
ATOM 9635  H HA   . HIS A 1 24 ? -9.364  -5.730  5.362   1.00 0.00 ? 24 HIS A HA   8  
ATOM 9636  H HB2  . HIS A 1 24 ? -7.094  -4.778  5.457   1.00 0.00 ? 24 HIS A HB2  8  
ATOM 9637  H HB3  . HIS A 1 24 ? -7.631  -3.588  6.653   1.00 0.00 ? 24 HIS A HB3  8  
ATOM 9638  H HD1  . HIS A 1 24 ? -6.226  -6.989  6.334   1.00 0.00 ? 24 HIS A HD1  8  
ATOM 9639  H HD2  . HIS A 1 24 ? -8.348  -4.829  9.216   1.00 0.00 ? 24 HIS A HD2  8  
ATOM 9640  H HE1  . HIS A 1 24 ? -5.958  -8.195  8.558   1.00 0.00 ? 24 HIS A HE1  8  
ATOM 9641  N N    . GLN A 1 25 ? -10.473 -3.192  7.165   1.00 0.00 ? 25 GLN A N    8  
ATOM 9642  C CA   . GLN A 1 25 ? -11.462 -2.765  8.138   1.00 0.00 ? 25 GLN A CA   8  
ATOM 9643  C C    . GLN A 1 25 ? -12.852 -2.825  7.486   1.00 0.00 ? 25 GLN A C    8  
ATOM 9644  O O    . GLN A 1 25 ? -13.577 -1.829  7.460   1.00 0.00 ? 25 GLN A O    8  
ATOM 9645  C CB   . GLN A 1 25 ? -11.102 -1.336  8.581   1.00 0.00 ? 25 GLN A CB   8  
ATOM 9646  C CG   . GLN A 1 25 ? -11.877 -0.940  9.830   1.00 0.00 ? 25 GLN A CG   8  
ATOM 9647  C CD   . GLN A 1 25 ? -11.401 0.410   10.353  1.00 0.00 ? 25 GLN A CD   8  
ATOM 9648  O OE1  . GLN A 1 25 ? -11.403 1.399   9.620   1.00 0.00 ? 25 GLN A OE1  8  
ATOM 9649  N NE2  . GLN A 1 25 ? -10.990 0.452   11.618  1.00 0.00 ? 25 GLN A NE2  8  
ATOM 9650  H H    . GLN A 1 25 ? -9.951  -2.474  6.680   1.00 0.00 ? 25 GLN A H    8  
ATOM 9651  H HA   . GLN A 1 25 ? -11.436 -3.432  9.001   1.00 0.00 ? 25 GLN A HA   8  
ATOM 9652  H HB2  . GLN A 1 25 ? -10.038 -1.290  8.804   1.00 0.00 ? 25 GLN A HB2  8  
ATOM 9653  H HB3  . GLN A 1 25 ? -11.331 -0.639  7.778   1.00 0.00 ? 25 GLN A HB3  8  
ATOM 9654  H HG2  . GLN A 1 25 ? -12.939 -0.883  9.601   1.00 0.00 ? 25 GLN A HG2  8  
ATOM 9655  H HG3  . GLN A 1 25 ? -11.715 -1.692  10.589  1.00 0.00 ? 25 GLN A HG3  8  
ATOM 9656  H HE21 . GLN A 1 25 ? -11.025 -0.391  12.191  1.00 0.00 ? 25 GLN A HE21 8  
ATOM 9657  H HE22 . GLN A 1 25 ? -10.645 1.315   12.005  1.00 0.00 ? 25 GLN A HE22 8  
ATOM 9658  N N    . ARG A 1 26 ? -13.212 -4.000  6.945   1.00 0.00 ? 26 ARG A N    8  
ATOM 9659  C CA   . ARG A 1 26 ? -14.486 -4.194  6.263   1.00 0.00 ? 26 ARG A CA   8  
ATOM 9660  C C    . ARG A 1 26 ? -14.754 -5.686  6.083   1.00 0.00 ? 26 ARG A C    8  
ATOM 9661  O O    . ARG A 1 26 ? -15.761 -6.196  6.567   1.00 0.00 ? 26 ARG A O    8  
ATOM 9662  C CB   . ARG A 1 26 ? -14.451 -3.480  4.898   1.00 0.00 ? 26 ARG A CB   8  
ATOM 9663  C CG   . ARG A 1 26 ? -15.419 -2.297  4.900   1.00 0.00 ? 26 ARG A CG   8  
ATOM 9664  C CD   . ARG A 1 26 ? -14.944 -1.231  3.908   1.00 0.00 ? 26 ARG A CD   8  
ATOM 9665  N NE   . ARG A 1 26 ? -15.633 0.046   4.133   1.00 0.00 ? 26 ARG A NE   8  
ATOM 9666  C CZ   . ARG A 1 26 ? -15.381 0.848   5.189   1.00 0.00 ? 26 ARG A CZ   8  
ATOM 9667  N NH1  . ARG A 1 26 ? -14.511 0.473   6.139   1.00 0.00 ? 26 ARG A NH1  8  
ATOM 9668  N NH2  . ARG A 1 26 ? -16.005 2.028   5.288   1.00 0.00 ? 26 ARG A NH2  8  
ATOM 9669  H H    . ARG A 1 26 ? -12.579 -4.788  7.002   1.00 0.00 ? 26 ARG A H    8  
ATOM 9670  H HA   . ARG A 1 26 ? -15.283 -3.768  6.873   1.00 0.00 ? 26 ARG A HA   8  
ATOM 9671  H HB2  . ARG A 1 26 ? -13.443 -3.122  4.705   1.00 0.00 ? 26 ARG A HB2  8  
ATOM 9672  H HB3  . ARG A 1 26 ? -14.740 -4.180  4.112   1.00 0.00 ? 26 ARG A HB3  8  
ATOM 9673  H HG2  . ARG A 1 26 ? -16.412 -2.641  4.612   1.00 0.00 ? 26 ARG A HG2  8  
ATOM 9674  H HG3  . ARG A 1 26 ? -15.464 -1.868  5.895   1.00 0.00 ? 26 ARG A HG3  8  
ATOM 9675  H HD2  . ARG A 1 26 ? -13.871 -1.083  4.023   1.00 0.00 ? 26 ARG A HD2  8  
ATOM 9676  H HD3  . ARG A 1 26 ? -15.146 -1.573  2.892   1.00 0.00 ? 26 ARG A HD3  8  
ATOM 9677  H HE   . ARG A 1 26 ? -16.327 0.327   3.456   1.00 0.00 ? 26 ARG A HE   8  
ATOM 9678  H HH11 . ARG A 1 26 ? -14.053 -0.433  6.085   1.00 0.00 ? 26 ARG A HH11 8  
ATOM 9679  H HH12 . ARG A 1 26 ? -14.309 1.089   6.913   1.00 0.00 ? 26 ARG A HH12 8  
ATOM 9680  H HH21 . ARG A 1 26 ? -16.658 2.317   4.574   1.00 0.00 ? 26 ARG A HH21 8  
ATOM 9681  H HH22 . ARG A 1 26 ? -15.825 2.630   6.079   1.00 0.00 ? 26 ARG A HH22 8  
ATOM 9682  N N    . GLY A 1 27 ? -13.853 -6.387  5.383   1.00 0.00 ? 27 GLY A N    8  
ATOM 9683  C CA   . GLY A 1 27 ? -14.018 -7.813  5.139   1.00 0.00 ? 27 GLY A CA   8  
ATOM 9684  C C    . GLY A 1 27 ? -12.848 -8.361  4.326   1.00 0.00 ? 27 GLY A C    8  
ATOM 9685  O O    . GLY A 1 27 ? -12.327 -9.431  4.637   1.00 0.00 ? 27 GLY A O    8  
ATOM 9686  H H    . GLY A 1 27 ? -13.035 -5.923  5.007   1.00 0.00 ? 27 GLY A H    8  
ATOM 9687  H HA2  . GLY A 1 27 ? -14.067 -8.337  6.095   1.00 0.00 ? 27 GLY A HA2  8  
ATOM 9688  H HA3  . GLY A 1 27 ? -14.944 -7.980  4.591   1.00 0.00 ? 27 GLY A HA3  8  
ATOM 9689  N N    . ASP A 1 28 ? -12.441 -7.629  3.282   1.00 0.00 ? 28 ASP A N    8  
ATOM 9690  C CA   . ASP A 1 28 ? -11.336 -8.044  2.427   1.00 0.00 ? 28 ASP A CA   8  
ATOM 9691  C C    . ASP A 1 28 ? -10.008 -7.823  3.160   1.00 0.00 ? 28 ASP A C    8  
ATOM 9692  O O    . ASP A 1 28 ? -9.263  -6.894  2.850   1.00 0.00 ? 28 ASP A O    8  
ATOM 9693  C CB   . ASP A 1 28 ? -11.379 -7.250  1.111   1.00 0.00 ? 28 ASP A CB   8  
ATOM 9694  C CG   . ASP A 1 28 ? -12.099 -8.016  0.009   1.00 0.00 ? 28 ASP A CG   8  
ATOM 9695  O OD1  . ASP A 1 28 ? -13.097 -8.690  0.335   1.00 0.00 ? 28 ASP A OD1  8  
ATOM 9696  O OD2  . ASP A 1 28 ? -11.629 -7.905  -1.149  1.00 0.00 ? 28 ASP A OD2  8  
ATOM 9697  H H    . ASP A 1 28 ? -12.906 -6.760  3.070   1.00 0.00 ? 28 ASP A H    8  
ATOM 9698  H HA   . ASP A 1 28 ? -11.438 -9.108  2.201   1.00 0.00 ? 28 ASP A HA   8  
ATOM 9699  H HB2  . ASP A 1 28 ? -11.896 -6.306  1.279   1.00 0.00 ? 28 ASP A HB2  8  
ATOM 9700  H HB3  . ASP A 1 28 ? -10.362 -7.048  0.786   1.00 0.00 ? 28 ASP A HB3  8  
ATOM 9701  N N    . THR A 1 29 ? -9.712  -8.690  4.131   1.00 0.00 ? 29 THR A N    8  
ATOM 9702  C CA   . THR A 1 29 ? -8.472  -8.615  4.888   1.00 0.00 ? 29 THR A CA   8  
ATOM 9703  C C    . THR A 1 29 ? -7.346  -9.316  4.120   1.00 0.00 ? 29 THR A C    8  
ATOM 9704  O O    . THR A 1 29 ? -6.186  -9.243  4.521   1.00 0.00 ? 29 THR A O    8  
ATOM 9705  C CB   . THR A 1 29 ? -8.678  -9.266  6.264   1.00 0.00 ? 29 THR A CB   8  
ATOM 9706  O OG1  . THR A 1 29 ? -9.073  -10.612 6.097   1.00 0.00 ? 29 THR A OG1  8  
ATOM 9707  C CG2  . THR A 1 29 ? -9.758  -8.516  7.043   1.00 0.00 ? 29 THR A CG2  8  
ATOM 9708  H H    . THR A 1 29 ? -10.365 -9.431  4.355   1.00 0.00 ? 29 THR A H    8  
ATOM 9709  H HA   . THR A 1 29 ? -8.202  -7.570  5.030   1.00 0.00 ? 29 THR A HA   8  
ATOM 9710  H HB   . THR A 1 29 ? -7.744  -9.227  6.825   1.00 0.00 ? 29 THR A HB   8  
ATOM 9711  H HG1  . THR A 1 29 ? -8.324  -11.113 5.767   1.00 0.00 ? 29 THR A HG1  8  
ATOM 9712  H HG21 . THR A 1 29 ? -9.871  -8.965  8.030   1.00 0.00 ? 29 THR A HG21 8  
ATOM 9713  H HG22 . THR A 1 29 ? -9.469  -7.474  7.152   1.00 0.00 ? 29 THR A HG22 8  
ATOM 9714  H HG23 . THR A 1 29 ? -10.706 -8.575  6.509   1.00 0.00 ? 29 THR A HG23 8  
ATOM 9715  N N    . HIS A 1 30 ? -7.692  -10.003 3.015   1.00 0.00 ? 30 HIS A N    8  
ATOM 9716  C CA   . HIS A 1 30 ? -6.716  -10.729 2.216   1.00 0.00 ? 30 HIS A CA   8  
ATOM 9717  C C    . HIS A 1 30 ? -5.758  -9.743  1.522   1.00 0.00 ? 30 HIS A C    8  
ATOM 9718  O O    . HIS A 1 30 ? -6.116  -8.584  1.302   1.00 0.00 ? 30 HIS A O    8  
ATOM 9719  C CB   . HIS A 1 30 ? -7.455  -11.611 1.195   1.00 0.00 ? 30 HIS A CB   8  
ATOM 9720  C CG   . HIS A 1 30 ? -7.668  -10.933 -0.136  1.00 0.00 ? 30 HIS A CG   8  
ATOM 9721  N ND1  . HIS A 1 30 ? -8.313  -9.709  -0.266  1.00 0.00 ? 30 HIS A ND1  8  
ATOM 9722  C CD2  . HIS A 1 30 ? -7.325  -11.288 -1.416  1.00 0.00 ? 30 HIS A CD2  8  
ATOM 9723  C CE1  . HIS A 1 30 ? -8.316  -9.410  -1.580  1.00 0.00 ? 30 HIS A CE1  8  
ATOM 9724  N NE2  . HIS A 1 30 ? -7.727  -10.338 -2.338  1.00 0.00 ? 30 HIS A NE2  8  
ATOM 9725  H H    . HIS A 1 30 ? -8.656  -10.026 2.724   1.00 0.00 ? 30 HIS A H    8  
ATOM 9726  H HA   . HIS A 1 30 ? -6.147  -11.373 2.882   1.00 0.00 ? 30 HIS A HA   8  
ATOM 9727  H HB2  . HIS A 1 30 ? -6.874  -12.518 1.031   1.00 0.00 ? 30 HIS A HB2  8  
ATOM 9728  H HB3  . HIS A 1 30 ? -8.426  -11.891 1.605   1.00 0.00 ? 30 HIS A HB3  8  
ATOM 9729  H HD1  . HIS A 1 30 ? -8.702  -9.149  0.479   1.00 0.00 ? 30 HIS A HD1  8  
ATOM 9730  H HD2  . HIS A 1 30 ? -6.801  -12.197 -1.673  1.00 0.00 ? 30 HIS A HD2  8  
ATOM 9731  H HE1  . HIS A 1 30 ? -8.747  -8.507  -1.980  1.00 0.00 ? 30 HIS A HE1  8  
ATOM 9732  N N    . PRO A 1 31 ? -4.536  -10.198 1.180   1.00 0.00 ? 31 PRO A N    8  
ATOM 9733  C CA   . PRO A 1 31 ? -3.539  -9.364  0.538   1.00 0.00 ? 31 PRO A CA   8  
ATOM 9734  C C    . PRO A 1 31 ? -3.886  -9.098  -0.928  1.00 0.00 ? 31 PRO A C    8  
ATOM 9735  O O    . PRO A 1 31 ? -4.667  -9.831  -1.535  1.00 0.00 ? 31 PRO A O    8  
ATOM 9736  C CB   . PRO A 1 31 ? -2.233  -10.152 0.643   1.00 0.00 ? 31 PRO A CB   8  
ATOM 9737  C CG   . PRO A 1 31 ? -2.620  -11.591 0.992   1.00 0.00 ? 31 PRO A CG   8  
ATOM 9738  C CD   . PRO A 1 31 ? -4.082  -11.553 1.428   1.00 0.00 ? 31 PRO A CD   8  
ATOM 9739  H HA   . PRO A 1 31 ? -3.448  -8.421  1.072   1.00 0.00 ? 31 PRO A HA   8  
ATOM 9740  H HB2  . PRO A 1 31 ? -1.705  -10.121 -0.299  1.00 0.00 ? 31 PRO A HB2  8  
ATOM 9741  H HB3  . PRO A 1 31 ? -1.606  -9.738  1.426   1.00 0.00 ? 31 PRO A HB3  8  
ATOM 9742  H HG2  . PRO A 1 31 ? -2.508  -12.231 0.116   1.00 0.00 ? 31 PRO A HG2  8  
ATOM 9743  H HG3  . PRO A 1 31 ? -1.999  -11.959 1.805   1.00 0.00 ? 31 PRO A HG3  8  
ATOM 9744  H HD2  . PRO A 1 31 ? -4.666  -12.262 0.842   1.00 0.00 ? 31 PRO A HD2  8  
ATOM 9745  H HD3  . PRO A 1 31 ? -4.155  -11.789 2.489   1.00 0.00 ? 31 PRO A HD3  8  
ATOM 9746  N N    . LEU A 1 32 ? -3.277  -8.046  -1.491  1.00 0.00 ? 32 LEU A N    8  
ATOM 9747  C CA   . LEU A 1 32 ? -3.455  -7.671  -2.887  1.00 0.00 ? 32 LEU A CA   8  
ATOM 9748  C C    . LEU A 1 32 ? -2.084  -7.367  -3.494  1.00 0.00 ? 32 LEU A C    8  
ATOM 9749  O O    . LEU A 1 32 ? -1.248  -6.748  -2.835  1.00 0.00 ? 32 LEU A O    8  
ATOM 9750  C CB   . LEU A 1 32 ? -4.324  -6.410  -2.983  1.00 0.00 ? 32 LEU A CB   8  
ATOM 9751  C CG   . LEU A 1 32 ? -5.810  -6.712  -2.733  1.00 0.00 ? 32 LEU A CG   8  
ATOM 9752  C CD1  . LEU A 1 32 ? -6.604  -5.418  -2.913  1.00 0.00 ? 32 LEU A CD1  8  
ATOM 9753  C CD2  . LEU A 1 32 ? -6.329  -7.750  -3.730  1.00 0.00 ? 32 LEU A CD2  8  
ATOM 9754  H H    . LEU A 1 32 ? -2.653  -7.481  -0.931  1.00 0.00 ? 32 LEU A H    8  
ATOM 9755  H HA   . LEU A 1 32 ? -3.923  -8.486  -3.432  1.00 0.00 ? 32 LEU A HA   8  
ATOM 9756  H HB2  . LEU A 1 32 ? -3.980  -5.684  -2.245  1.00 0.00 ? 32 LEU A HB2  8  
ATOM 9757  H HB3  . LEU A 1 32 ? -4.211  -5.981  -3.977  1.00 0.00 ? 32 LEU A HB3  8  
ATOM 9758  H HG   . LEU A 1 32 ? -5.944  -7.082  -1.716  1.00 0.00 ? 32 LEU A HG   8  
ATOM 9759  H HD11 . LEU A 1 32 ? -7.660  -5.607  -2.721  1.00 0.00 ? 32 LEU A HD11 8  
ATOM 9760  H HD12 . LEU A 1 32 ? -6.238  -4.666  -2.217  1.00 0.00 ? 32 LEU A HD12 8  
ATOM 9761  H HD13 . LEU A 1 32 ? -6.480  -5.057  -3.940  1.00 0.00 ? 32 LEU A HD13 8  
ATOM 9762  H HD21 . LEU A 1 32 ? -6.010  -8.741  -3.427  1.00 0.00 ? 32 LEU A HD21 8  
ATOM 9763  H HD22 . LEU A 1 32 ? -5.940  -7.532  -4.719  1.00 0.00 ? 32 LEU A HD22 8  
ATOM 9764  H HD23 . LEU A 1 32 ? -7.418  -7.717  -3.757  1.00 0.00 ? 32 LEU A HD23 8  
ATOM 9765  N N    . THR A 1 33 ? -1.849  -7.778  -4.748  1.00 0.00 ? 33 THR A N    8  
ATOM 9766  C CA   . THR A 1 33 ? -0.599  -7.455  -5.431  1.00 0.00 ? 33 THR A CA   8  
ATOM 9767  C C    . THR A 1 33 ? -0.483  -5.940  -5.560  1.00 0.00 ? 33 THR A C    8  
ATOM 9768  O O    . THR A 1 33 ? -1.445  -5.209  -5.313  1.00 0.00 ? 33 THR A O    8  
ATOM 9769  C CB   . THR A 1 33 ? -0.546  -8.085  -6.835  1.00 0.00 ? 33 THR A CB   8  
ATOM 9770  O OG1  . THR A 1 33 ? -1.524  -7.491  -7.657  1.00 0.00 ? 33 THR A OG1  8  
ATOM 9771  C CG2  . THR A 1 33 ? -0.781  -9.589  -6.764  1.00 0.00 ? 33 THR A CG2  8  
ATOM 9772  H H    . THR A 1 33 ? -2.552  -8.313  -5.244  1.00 0.00 ? 33 THR A H    8  
ATOM 9773  H HA   . THR A 1 33 ? 0.237   -7.827  -4.841  1.00 0.00 ? 33 THR A HA   8  
ATOM 9774  H HB   . THR A 1 33 ? 0.439   -7.902  -7.267  1.00 0.00 ? 33 THR A HB   8  
ATOM 9775  H HG1  . THR A 1 33 ? -1.543  -7.959  -8.497  1.00 0.00 ? 33 THR A HG1  8  
ATOM 9776  H HG21 . THR A 1 33 ? -0.235  -10.003 -5.920  1.00 0.00 ? 33 THR A HG21 8  
ATOM 9777  H HG22 . THR A 1 33 ? -0.430  -10.054 -7.685  1.00 0.00 ? 33 THR A HG22 8  
ATOM 9778  H HG23 . THR A 1 33 ? -1.844  -9.786  -6.647  1.00 0.00 ? 33 THR A HG23 8  
ATOM 9779  N N    . LEU A 1 34 ? 0.692   -5.468  -5.957  1.00 0.00 ? 34 LEU A N    8  
ATOM 9780  C CA   . LEU A 1 34 ? 0.916   -4.053  -6.141  1.00 0.00 ? 34 LEU A CA   8  
ATOM 9781  C C    . LEU A 1 34 ? -0.071  -3.523  -7.185  1.00 0.00 ? 34 LEU A C    8  
ATOM 9782  O O    . LEU A 1 34 ? -0.748  -2.535  -6.946  1.00 0.00 ? 34 LEU A O    8  
ATOM 9783  C CB   . LEU A 1 34 ? 2.380   -3.842  -6.564  1.00 0.00 ? 34 LEU A CB   8  
ATOM 9784  C CG   . LEU A 1 34 ? 2.774   -2.349  -6.576  1.00 0.00 ? 34 LEU A CG   8  
ATOM 9785  C CD1  . LEU A 1 34 ? 2.240   -1.662  -7.832  1.00 0.00 ? 34 LEU A CD1  8  
ATOM 9786  C CD2  . LEU A 1 34 ? 2.238   -1.630  -5.336  1.00 0.00 ? 34 LEU A CD2  8  
ATOM 9787  H H    . LEU A 1 34 ? 1.453   -6.104  -6.143  1.00 0.00 ? 34 LEU A H    8  
ATOM 9788  H HA   . LEU A 1 34 ? 0.736   -3.550  -5.193  1.00 0.00 ? 34 LEU A HA   8  
ATOM 9789  H HB2  . LEU A 1 34 ? 3.027   -4.367  -5.862  1.00 0.00 ? 34 LEU A HB2  8  
ATOM 9790  H HB3  . LEU A 1 34 ? 2.531   -4.262  -7.560  1.00 0.00 ? 34 LEU A HB3  8  
ATOM 9791  H HG   . LEU A 1 34 ? 3.863   -2.283  -6.577  1.00 0.00 ? 34 LEU A HG   8  
ATOM 9792  H HD11 . LEU A 1 34 ? 2.249   -2.364  -8.664  1.00 0.00 ? 34 LEU A HD11 8  
ATOM 9793  H HD12 . LEU A 1 34 ? 2.873   -0.809  -8.071  1.00 0.00 ? 34 LEU A HD12 8  
ATOM 9794  H HD13 . LEU A 1 34 ? 1.225   -1.317  -7.661  1.00 0.00 ? 34 LEU A HD13 8  
ATOM 9795  H HD21 . LEU A 1 34 ? 2.712   -0.655  -5.255  1.00 0.00 ? 34 LEU A HD21 8  
ATOM 9796  H HD22 . LEU A 1 34 ? 1.161   -1.498  -5.419  1.00 0.00 ? 34 LEU A HD22 8  
ATOM 9797  H HD23 . LEU A 1 34 ? 2.466   -2.218  -4.450  1.00 0.00 ? 34 LEU A HD23 8  
ATOM 9798  N N    . ASP A 1 35 ? -0.153  -4.191  -8.342  1.00 0.00 ? 35 ASP A N    8  
ATOM 9799  C CA   . ASP A 1 35 ? -1.045  -3.771  -9.415  1.00 0.00 ? 35 ASP A CA   8  
ATOM 9800  C C    . ASP A 1 35 ? -2.512  -3.808  -8.958  1.00 0.00 ? 35 ASP A C    8  
ATOM 9801  O O    . ASP A 1 35 ? -3.275  -2.892  -9.277  1.00 0.00 ? 35 ASP A O    8  
ATOM 9802  C CB   . ASP A 1 35 ? -0.814  -4.655  -10.640 1.00 0.00 ? 35 ASP A CB   8  
ATOM 9803  C CG   . ASP A 1 35 ? 0.581   -4.417  -11.215 1.00 0.00 ? 35 ASP A CG   8  
ATOM 9804  O OD1  . ASP A 1 35 ? 0.775   -3.336  -11.826 1.00 0.00 ? 35 ASP A OD1  8  
ATOM 9805  O OD2  . ASP A 1 35 ? 1.430   -5.313  -11.031 1.00 0.00 ? 35 ASP A OD2  8  
ATOM 9806  H H    . ASP A 1 35 ? 0.420   -5.010  -8.489  1.00 0.00 ? 35 ASP A H    8  
ATOM 9807  H HA   . ASP A 1 35 ? -0.798  -2.747  -9.685  1.00 0.00 ? 35 ASP A HA   8  
ATOM 9808  H HB2  . ASP A 1 35 ? -0.915  -5.703  -10.356 1.00 0.00 ? 35 ASP A HB2  8  
ATOM 9809  H HB3  . ASP A 1 35 ? -1.559  -4.416  -11.401 1.00 0.00 ? 35 ASP A HB3  8  
ATOM 9810  N N    . GLU A 1 36 ? -2.913  -4.853  -8.206  1.00 0.00 ? 36 GLU A N    8  
ATOM 9811  C CA   . GLU A 1 36 ? -4.286  -4.955  -7.702  1.00 0.00 ? 36 GLU A CA   8  
ATOM 9812  C C    . GLU A 1 36 ? -4.641  -3.698  -6.902  1.00 0.00 ? 36 GLU A C    8  
ATOM 9813  O O    . GLU A 1 36 ? -5.782  -3.246  -6.931  1.00 0.00 ? 36 GLU A O    8  
ATOM 9814  C CB   . GLU A 1 36 ? -4.441  -6.207  -6.828  1.00 0.00 ? 36 GLU A CB   8  
ATOM 9815  C CG   . GLU A 1 36 ? -4.691  -7.443  -7.706  1.00 0.00 ? 36 GLU A CG   8  
ATOM 9816  C CD   . GLU A 1 36 ? -4.897  -8.701  -6.858  1.00 0.00 ? 36 GLU A CD   8  
ATOM 9817  O OE1  . GLU A 1 36 ? -4.071  -8.924  -5.941  1.00 0.00 ? 36 GLU A OE1  8  
ATOM 9818  O OE2  . GLU A 1 36 ? -5.877  -9.421  -7.137  1.00 0.00 ? 36 GLU A OE2  8  
ATOM 9819  H H    . GLU A 1 36 ? -2.257  -5.589  -7.974  1.00 0.00 ? 36 GLU A H    8  
ATOM 9820  H HA   . GLU A 1 36 ? -4.969  -5.032  -8.545  1.00 0.00 ? 36 GLU A HA   8  
ATOM 9821  H HB2  . GLU A 1 36 ? -3.540  -6.355  -6.237  1.00 0.00 ? 36 GLU A HB2  8  
ATOM 9822  H HB3  . GLU A 1 36 ? -5.290  -6.069  -6.159  1.00 0.00 ? 36 GLU A HB3  8  
ATOM 9823  H HG2  . GLU A 1 36 ? -5.584  -7.274  -8.310  1.00 0.00 ? 36 GLU A HG2  8  
ATOM 9824  H HG3  . GLU A 1 36 ? -3.842  -7.593  -8.368  1.00 0.00 ? 36 GLU A HG3  8  
ATOM 9825  N N    . ILE A 1 37 ? -3.659  -3.132  -6.189  1.00 0.00 ? 37 ILE A N    8  
ATOM 9826  C CA   . ILE A 1 37 ? -3.876  -1.931  -5.398  1.00 0.00 ? 37 ILE A CA   8  
ATOM 9827  C C    . ILE A 1 37 ? -4.088  -0.723  -6.322  1.00 0.00 ? 37 ILE A C    8  
ATOM 9828  O O    . ILE A 1 37 ? -4.987  0.079   -6.077  1.00 0.00 ? 37 ILE A O    8  
ATOM 9829  C CB   . ILE A 1 37 ? -2.677  -1.721  -4.453  1.00 0.00 ? 37 ILE A CB   8  
ATOM 9830  C CG1  . ILE A 1 37 ? -2.704  -2.791  -3.348  1.00 0.00 ? 37 ILE A CG1  8  
ATOM 9831  C CG2  . ILE A 1 37 ? -2.744  -0.327  -3.824  1.00 0.00 ? 37 ILE A CG2  8  
ATOM 9832  C CD1  . ILE A 1 37 ? -1.346  -2.858  -2.643  1.00 0.00 ? 37 ILE A CD1  8  
ATOM 9833  H H    . ILE A 1 37 ? -2.734  -3.544  -6.194  1.00 0.00 ? 37 ILE A H    8  
ATOM 9834  H HA   . ILE A 1 37 ? -4.776  -2.067  -4.794  1.00 0.00 ? 37 ILE A HA   8  
ATOM 9835  H HB   . ILE A 1 37 ? -1.752  -1.811  -5.015  1.00 0.00 ? 37 ILE A HB   8  
ATOM 9836  H HG12 . ILE A 1 37 ? -3.477  -2.546  -2.621  1.00 0.00 ? 37 ILE A HG12 8  
ATOM 9837  H HG13 . ILE A 1 37 ? -2.923  -3.762  -3.789  1.00 0.00 ? 37 ILE A HG13 8  
ATOM 9838  H HG21 . ILE A 1 37 ? -3.695  -0.202  -3.308  1.00 0.00 ? 37 ILE A HG21 8  
ATOM 9839  H HG22 . ILE A 1 37 ? -1.930  -0.211  -3.114  1.00 0.00 ? 37 ILE A HG22 8  
ATOM 9840  H HG23 . ILE A 1 37 ? -2.650  0.431   -4.600  1.00 0.00 ? 37 ILE A HG23 8  
ATOM 9841  H HD11 . ILE A 1 37 ? -1.201  -1.962  -2.039  1.00 0.00 ? 37 ILE A HD11 8  
ATOM 9842  H HD12 . ILE A 1 37 ? -1.317  -3.735  -1.996  1.00 0.00 ? 37 ILE A HD12 8  
ATOM 9843  H HD13 . ILE A 1 37 ? -0.552  -2.928  -3.384  1.00 0.00 ? 37 ILE A HD13 8  
ATOM 9844  N N    . LEU A 1 38 ? -3.263  -0.593  -7.382  1.00 0.00 ? 38 LEU A N    8  
ATOM 9845  C CA   . LEU A 1 38 ? -3.365  0.541   -8.314  1.00 0.00 ? 38 LEU A CA   8  
ATOM 9846  C C    . LEU A 1 38 ? -4.799  0.688   -8.825  1.00 0.00 ? 38 LEU A C    8  
ATOM 9847  O O    . LEU A 1 38 ? -5.266  1.803   -9.033  1.00 0.00 ? 38 LEU A O    8  
ATOM 9848  C CB   . LEU A 1 38 ? -2.434  0.361   -9.528  1.00 0.00 ? 38 LEU A CB   8  
ATOM 9849  C CG   . LEU A 1 38 ? -0.997  0.023   -9.119  1.00 0.00 ? 38 LEU A CG   8  
ATOM 9850  C CD1  . LEU A 1 38 ? -0.171  -0.213  -10.382 1.00 0.00 ? 38 LEU A CD1  8  
ATOM 9851  C CD2  . LEU A 1 38 ? -0.362  1.161   -8.307  1.00 0.00 ? 38 LEU A CD2  8  
ATOM 9852  H H    . LEU A 1 38 ? -2.548  -1.289  -7.546  1.00 0.00 ? 38 LEU A H    8  
ATOM 9853  H HA   . LEU A 1 38 ? -3.087  1.453   -7.788  1.00 0.00 ? 38 LEU A HA   8  
ATOM 9854  H HB2  . LEU A 1 38 ? -2.822  -0.446  -10.151 1.00 0.00 ? 38 LEU A HB2  8  
ATOM 9855  H HB3  . LEU A 1 38 ? -2.430  1.279   -10.106 1.00 0.00 ? 38 LEU A HB3  8  
ATOM 9856  H HG   . LEU A 1 38 ? -1.003  -0.878  -8.532  1.00 0.00 ? 38 LEU A HG   8  
ATOM 9857  H HD11 . LEU A 1 38 ? 0.028   0.740   -10.872 1.00 0.00 ? 38 LEU A HD11 8  
ATOM 9858  H HD12 . LEU A 1 38 ? -0.723  -0.861  -11.064 1.00 0.00 ? 38 LEU A HD12 8  
ATOM 9859  H HD13 . LEU A 1 38 ? 0.768   -0.689  -10.115 1.00 0.00 ? 38 LEU A HD13 8  
ATOM 9860  H HD21 . LEU A 1 38 ? 0.690   0.932   -8.117  1.00 0.00 ? 38 LEU A HD21 8  
ATOM 9861  H HD22 . LEU A 1 38 ? -0.882  1.271   -7.356  1.00 0.00 ? 38 LEU A HD22 8  
ATOM 9862  H HD23 . LEU A 1 38 ? -0.426  2.089   -8.867  1.00 0.00 ? 38 LEU A HD23 8  
ATOM 9863  N N    . ASP A 1 39 ? -5.487  -0.441  -9.044  1.00 0.00 ? 39 ASP A N    8  
ATOM 9864  C CA   . ASP A 1 39 ? -6.848  -0.426  -9.561  1.00 0.00 ? 39 ASP A CA   8  
ATOM 9865  C C    . ASP A 1 39 ? -7.767  0.385   -8.639  1.00 0.00 ? 39 ASP A C    8  
ATOM 9866  O O    . ASP A 1 39 ? -8.358  1.374   -9.070  1.00 0.00 ? 39 ASP A O    8  
ATOM 9867  C CB   . ASP A 1 39 ? -7.351  -1.865  -9.705  1.00 0.00 ? 39 ASP A CB   8  
ATOM 9868  C CG   . ASP A 1 39 ? -8.745  -1.893  -10.319 1.00 0.00 ? 39 ASP A CG   8  
ATOM 9869  O OD1  . ASP A 1 39 ? -8.820  -1.757  -11.560 1.00 0.00 ? 39 ASP A OD1  8  
ATOM 9870  O OD2  . ASP A 1 39 ? -9.706  -2.050  -9.538  1.00 0.00 ? 39 ASP A OD2  8  
ATOM 9871  H H    . ASP A 1 39 ? -5.053  -1.337  -8.855  1.00 0.00 ? 39 ASP A H    8  
ATOM 9872  H HA   . ASP A 1 39 ? -6.839  0.042   -10.548 1.00 0.00 ? 39 ASP A HA   8  
ATOM 9873  H HB2  . ASP A 1 39 ? -6.667  -2.421  -10.346 1.00 0.00 ? 39 ASP A HB2  8  
ATOM 9874  H HB3  . ASP A 1 39 ? -7.383  -2.336  -8.723  1.00 0.00 ? 39 ASP A HB3  8  
ATOM 9875  N N    . GLU A 1 40 ? -7.884  -0.037  -7.372  1.00 0.00 ? 40 GLU A N    8  
ATOM 9876  C CA   . GLU A 1 40 ? -8.732  0.645   -6.398  1.00 0.00 ? 40 GLU A CA   8  
ATOM 9877  C C    . GLU A 1 40 ? -8.231  2.075   -6.190  1.00 0.00 ? 40 GLU A C    8  
ATOM 9878  O O    . GLU A 1 40 ? -8.914  3.031   -6.559  1.00 0.00 ? 40 GLU A O    8  
ATOM 9879  C CB   . GLU A 1 40 ? -8.732  -0.153  -5.093  1.00 0.00 ? 40 GLU A CB   8  
ATOM 9880  C CG   . GLU A 1 40 ? -9.685  -1.352  -5.235  1.00 0.00 ? 40 GLU A CG   8  
ATOM 9881  C CD   . GLU A 1 40 ? -11.092 -1.014  -4.743  1.00 0.00 ? 40 GLU A CD   8  
ATOM 9882  O OE1  . GLU A 1 40 ? -11.441 0.186   -4.781  1.00 0.00 ? 40 GLU A OE1  8  
ATOM 9883  O OE2  . GLU A 1 40 ? -11.792 -1.969  -4.335  1.00 0.00 ? 40 GLU A OE2  8  
ATOM 9884  H H    . GLU A 1 40 ? -7.373  -0.853  -7.072  1.00 0.00 ? 40 GLU A H    8  
ATOM 9885  H HA   . GLU A 1 40 ? -9.751  0.686   -6.786  1.00 0.00 ? 40 GLU A HA   8  
ATOM 9886  H HB2  . GLU A 1 40 ? -7.723  -0.514  -4.890  1.00 0.00 ? 40 GLU A HB2  8  
ATOM 9887  H HB3  . GLU A 1 40 ? -9.060  0.483   -4.272  1.00 0.00 ? 40 GLU A HB3  8  
ATOM 9888  H HG2  . GLU A 1 40 ? -9.737  -1.649  -6.283  1.00 0.00 ? 40 GLU A HG2  8  
ATOM 9889  H HG3  . GLU A 1 40 ? -9.299  -2.185  -4.654  1.00 0.00 ? 40 GLU A HG3  8  
ATOM 9890  N N    . THR A 1 41 ? -7.029  2.227   -5.619  1.00 0.00 ? 41 THR A N    8  
ATOM 9891  C CA   . THR A 1 41 ? -6.415  3.537   -5.469  1.00 0.00 ? 41 THR A CA   8  
ATOM 9892  C C    . THR A 1 41 ? -5.858  3.917   -6.833  1.00 0.00 ? 41 THR A C    8  
ATOM 9893  O O    . THR A 1 41 ? -4.677  3.746   -7.076  1.00 0.00 ? 41 THR A O    8  
ATOM 9894  C CB   . THR A 1 41 ? -5.320  3.490   -4.389  1.00 0.00 ? 41 THR A CB   8  
ATOM 9895  O OG1  . THR A 1 41 ? -4.690  2.230   -4.398  1.00 0.00 ? 41 THR A OG1  8  
ATOM 9896  C CG2  . THR A 1 41 ? -5.938  3.732   -3.009  1.00 0.00 ? 41 THR A CG2  8  
ATOM 9897  H H    . THR A 1 41 ? -6.512  1.415   -5.303  1.00 0.00 ? 41 THR A H    8  
ATOM 9898  H HA   . THR A 1 41 ? -7.164  4.273   -5.180  1.00 0.00 ? 41 THR A HA   8  
ATOM 9899  H HB   . THR A 1 41 ? -4.584  4.262   -4.587  1.00 0.00 ? 41 THR A HB   8  
ATOM 9900  H HG1  . THR A 1 41 ? -4.022  2.217   -3.712  1.00 0.00 ? 41 THR A HG1  8  
ATOM 9901  H HG21 . THR A 1 41 ? -6.591  2.899   -2.754  1.00 0.00 ? 41 THR A HG21 8  
ATOM 9902  H HG22 . THR A 1 41 ? -5.144  3.815   -2.262  1.00 0.00 ? 41 THR A HG22 8  
ATOM 9903  H HG23 . THR A 1 41 ? -6.517  4.654   -3.023  1.00 0.00 ? 41 THR A HG23 8  
ATOM 9904  N N    . GLN A 1 42 ? -6.758  4.410   -7.714  1.00 0.00 ? 42 GLN A N    8  
ATOM 9905  C CA   . GLN A 1 42 ? -6.463  4.779   -9.107  1.00 0.00 ? 42 GLN A CA   8  
ATOM 9906  C C    . GLN A 1 42 ? -5.039  5.314   -9.284  1.00 0.00 ? 42 GLN A C    8  
ATOM 9907  O O    . GLN A 1 42 ? -4.818  6.523   -9.248  1.00 0.00 ? 42 GLN A O    8  
ATOM 9908  C CB   . GLN A 1 42 ? -7.505  5.820   -9.556  1.00 0.00 ? 42 GLN A CB   8  
ATOM 9909  C CG   . GLN A 1 42 ? -7.243  6.279   -11.001 1.00 0.00 ? 42 GLN A CG   8  
ATOM 9910  C CD   . GLN A 1 42 ? -7.061  5.092   -11.942 1.00 0.00 ? 42 GLN A CD   8  
ATOM 9911  O OE1  . GLN A 1 42 ? -8.017  4.391   -12.252 1.00 0.00 ? 42 GLN A OE1  8  
ATOM 9912  N NE2  . GLN A 1 42 ? -5.827  4.872   -12.397 1.00 0.00 ? 42 GLN A NE2  8  
ATOM 9913  H H    . GLN A 1 42 ? -7.715  4.522   -7.404  1.00 0.00 ? 42 GLN A H    8  
ATOM 9914  H HA   . GLN A 1 42 ? -6.576  3.888   -9.724  1.00 0.00 ? 42 GLN A HA   8  
ATOM 9915  H HB2  . GLN A 1 42 ? -8.500  5.377   -9.498  1.00 0.00 ? 42 GLN A HB2  8  
ATOM 9916  H HB3  . GLN A 1 42 ? -7.461  6.684   -8.893  1.00 0.00 ? 42 GLN A HB3  8  
ATOM 9917  H HG2  . GLN A 1 42 ? -8.092  6.871   -11.341 1.00 0.00 ? 42 GLN A HG2  8  
ATOM 9918  H HG3  . GLN A 1 42 ? -6.349  6.899   -11.028 1.00 0.00 ? 42 GLN A HG3  8  
ATOM 9919  H HE21 . GLN A 1 42 ? -5.070  5.476   -12.113 1.00 0.00 ? 42 GLN A HE21 8  
ATOM 9920  H HE22 . GLN A 1 42 ? -5.655  4.103   -13.025 1.00 0.00 ? 42 GLN A HE22 8  
ATOM 9921  N N    . HIS A 1 43 ? -4.084  4.396   -9.491  1.00 0.00 ? 43 HIS A N    8  
ATOM 9922  C CA   . HIS A 1 43 ? -2.683  4.738   -9.703  1.00 0.00 ? 43 HIS A CA   8  
ATOM 9923  C C    . HIS A 1 43 ? -2.102  3.825   -10.775 1.00 0.00 ? 43 HIS A C    8  
ATOM 9924  O O    . HIS A 1 43 ? -0.922  3.543   -10.757 1.00 0.00 ? 43 HIS A O    8  
ATOM 9925  C CB   . HIS A 1 43 ? -1.888  4.580   -8.390  1.00 0.00 ? 43 HIS A CB   8  
ATOM 9926  C CG   . HIS A 1 43 ? -2.420  5.406   -7.245  1.00 0.00 ? 43 HIS A CG   8  
ATOM 9927  N ND1  . HIS A 1 43 ? -2.986  6.660   -7.415  1.00 0.00 ? 43 HIS A ND1  8  
ATOM 9928  C CD2  . HIS A 1 43 ? -2.497  5.168   -5.897  1.00 0.00 ? 43 HIS A CD2  8  
ATOM 9929  C CE1  . HIS A 1 43 ? -3.367  7.083   -6.196  1.00 0.00 ? 43 HIS A CE1  8  
ATOM 9930  N NE2  . HIS A 1 43 ? -3.097  6.218   -5.222  1.00 0.00 ? 43 HIS A NE2  8  
ATOM 9931  H H    . HIS A 1 43 ? -4.338  3.416   -9.501  1.00 0.00 ? 43 HIS A H    8  
ATOM 9932  H HA   . HIS A 1 43 ? -2.603  5.767   -10.046 1.00 0.00 ? 43 HIS A HA   8  
ATOM 9933  H HB2  . HIS A 1 43 ? -1.912  3.533   -8.095  1.00 0.00 ? 43 HIS A HB2  8  
ATOM 9934  H HB3  . HIS A 1 43 ? -0.854  4.869   -8.570  1.00 0.00 ? 43 HIS A HB3  8  
ATOM 9935  H HD1  . HIS A 1 43 ? -3.098  7.158   -8.288  1.00 0.00 ? 43 HIS A HD1  8  
ATOM 9936  H HD2  . HIS A 1 43 ? -2.148  4.264   -5.421  1.00 0.00 ? 43 HIS A HD2  8  
ATOM 9937  H HE1  . HIS A 1 43 ? -3.859  8.026   -6.025  1.00 0.00 ? 43 HIS A HE1  8  
ATOM 9938  N N    . LEU A 1 44 ? -2.928  3.357   -11.718 1.00 0.00 ? 44 LEU A N    8  
ATOM 9939  C CA   . LEU A 1 44 ? -2.438  2.498   -12.788 1.00 0.00 ? 44 LEU A CA   8  
ATOM 9940  C C    . LEU A 1 44 ? -1.358  3.250   -13.571 1.00 0.00 ? 44 LEU A C    8  
ATOM 9941  O O    . LEU A 1 44 ? -0.345  2.664   -13.952 1.00 0.00 ? 44 LEU A O    8  
ATOM 9942  C CB   . LEU A 1 44 ? -3.603  2.065   -13.677 1.00 0.00 ? 44 LEU A CB   8  
ATOM 9943  C CG   . LEU A 1 44 ? -4.376  0.928   -12.981 1.00 0.00 ? 44 LEU A CG   8  
ATOM 9944  C CD1  . LEU A 1 44 ? -5.855  1.001   -13.366 1.00 0.00 ? 44 LEU A CD1  8  
ATOM 9945  C CD2  . LEU A 1 44 ? -3.804  -0.424  -13.414 1.00 0.00 ? 44 LEU A CD2  8  
ATOM 9946  H H    . LEU A 1 44 ? -3.907  3.601   -11.700 1.00 0.00 ? 44 LEU A H    8  
ATOM 9947  H HA   . LEU A 1 44 ? -1.987  1.609   -12.347 1.00 0.00 ? 44 LEU A HA   8  
ATOM 9948  H HB2  . LEU A 1 44 ? -4.267  2.912   -13.845 1.00 0.00 ? 44 LEU A HB2  8  
ATOM 9949  H HB3  . LEU A 1 44 ? -3.220  1.711   -14.635 1.00 0.00 ? 44 LEU A HB3  8  
ATOM 9950  H HG   . LEU A 1 44 ? -4.278  1.026   -11.893 1.00 0.00 ? 44 LEU A HG   8  
ATOM 9951  H HD11 . LEU A 1 44 ? -5.951  0.981   -14.452 1.00 0.00 ? 44 LEU A HD11 8  
ATOM 9952  H HD12 . LEU A 1 44 ? -6.287  1.925   -12.980 1.00 0.00 ? 44 LEU A HD12 8  
ATOM 9953  H HD13 . LEU A 1 44 ? -6.386  0.149   -12.939 1.00 0.00 ? 44 LEU A HD13 8  
ATOM 9954  H HD21 . LEU A 1 44 ? -3.937  -0.550  -14.489 1.00 0.00 ? 44 LEU A HD21 8  
ATOM 9955  H HD22 . LEU A 1 44 ? -4.325  -1.225  -12.889 1.00 0.00 ? 44 LEU A HD22 8  
ATOM 9956  H HD23 . LEU A 1 44 ? -2.742  -0.465  -13.173 1.00 0.00 ? 44 LEU A HD23 8  
ATOM 9957  N N    . ASP A 1 45 ? -1.567  4.560   -13.775 1.00 0.00 ? 45 ASP A N    8  
ATOM 9958  C CA   . ASP A 1 45 ? -0.571  5.419   -14.398 1.00 0.00 ? 45 ASP A CA   8  
ATOM 9959  C C    . ASP A 1 45 ? 0.289   6.001   -13.272 1.00 0.00 ? 45 ASP A C    8  
ATOM 9960  O O    . ASP A 1 45 ? 0.216   7.190   -12.967 1.00 0.00 ? 45 ASP A O    8  
ATOM 9961  C CB   . ASP A 1 45 ? -1.268  6.519   -15.205 1.00 0.00 ? 45 ASP A CB   8  
ATOM 9962  C CG   . ASP A 1 45 ? -0.252  7.422   -15.902 1.00 0.00 ? 45 ASP A CG   8  
ATOM 9963  O OD1  . ASP A 1 45 ? 0.877   6.935   -16.141 1.00 0.00 ? 45 ASP A OD1  8  
ATOM 9964  O OD2  . ASP A 1 45 ? -0.624  8.581   -16.184 1.00 0.00 ? 45 ASP A OD2  8  
ATOM 9965  H H    . ASP A 1 45 ? -2.431  4.979   -13.469 1.00 0.00 ? 45 ASP A H    8  
ATOM 9966  H HA   . ASP A 1 45 ? 0.058   4.826   -15.064 1.00 0.00 ? 45 ASP A HA   8  
ATOM 9967  H HB2  . ASP A 1 45 ? -1.907  6.060   -15.958 1.00 0.00 ? 45 ASP A HB2  8  
ATOM 9968  H HB3  . ASP A 1 45 ? -1.881  7.123   -14.535 1.00 0.00 ? 45 ASP A HB3  8  
ATOM 9969  N N    . ILE A 1 46 ? 1.083   5.131   -12.643 1.00 0.00 ? 46 ILE A N    8  
ATOM 9970  C CA   . ILE A 1 46 ? 1.898   5.490   -11.487 1.00 0.00 ? 46 ILE A CA   8  
ATOM 9971  C C    . ILE A 1 46 ? 3.317   5.872   -11.913 1.00 0.00 ? 46 ILE A C    8  
ATOM 9972  O O    . ILE A 1 46 ? 3.854   6.880   -11.452 1.00 0.00 ? 46 ILE A O    8  
ATOM 9973  C CB   . ILE A 1 46 ? 1.906   4.310   -10.482 1.00 0.00 ? 46 ILE A CB   8  
ATOM 9974  C CG1  . ILE A 1 46 ? 3.113   4.420   -9.559  1.00 0.00 ? 46 ILE A CG1  8  
ATOM 9975  C CG2  . ILE A 1 46 ? 1.948   2.954   -11.212 1.00 0.00 ? 46 ILE A CG2  8  
ATOM 9976  C CD1  . ILE A 1 46 ? 2.932   3.520   -8.337  1.00 0.00 ? 46 ILE A CD1  8  
ATOM 9977  H H    . ILE A 1 46 ? 1.113   4.177   -12.967 1.00 0.00 ? 46 ILE A H    8  
ATOM 9978  H HA   . ILE A 1 46 ? 1.445   6.352   -10.995 1.00 0.00 ? 46 ILE A HA   8  
ATOM 9979  H HB   . ILE A 1 46 ? 1.008   4.358   -9.882  1.00 0.00 ? 46 ILE A HB   8  
ATOM 9980  H HG12 . ILE A 1 46 ? 4.003   4.113   -10.102 1.00 0.00 ? 46 ILE A HG12 8  
ATOM 9981  H HG13 . ILE A 1 46 ? 3.219   5.454   -9.230  1.00 0.00 ? 46 ILE A HG13 8  
ATOM 9982  H HG21 . ILE A 1 46 ? 1.039   2.819   -11.790 1.00 0.00 ? 46 ILE A HG21 8  
ATOM 9983  H HG22 . ILE A 1 46 ? 2.809   2.919   -11.874 1.00 0.00 ? 46 ILE A HG22 8  
ATOM 9984  H HG23 . ILE A 1 46 ? 2.023   2.153   -10.482 1.00 0.00 ? 46 ILE A HG23 8  
ATOM 9985  H HD11 . ILE A 1 46 ? 1.959   3.709   -7.883  1.00 0.00 ? 46 ILE A HD11 8  
ATOM 9986  H HD12 . ILE A 1 46 ? 3.717   3.734   -7.613  1.00 0.00 ? 46 ILE A HD12 8  
ATOM 9987  H HD13 . ILE A 1 46 ? 2.996   2.476   -8.638  1.00 0.00 ? 46 ILE A HD13 8  
ATOM 9988  N N    . GLY A 1 47 ? 3.922   5.059   -12.778 1.00 0.00 ? 47 GLY A N    8  
ATOM 9989  C CA   . GLY A 1 47 ? 5.285   5.272   -13.239 1.00 0.00 ? 47 GLY A CA   8  
ATOM 9990  C C    . GLY A 1 47 ? 6.181   4.195   -12.641 1.00 0.00 ? 47 GLY A C    8  
ATOM 9991  O O    . GLY A 1 47 ? 6.124   3.943   -11.441 1.00 0.00 ? 47 GLY A O    8  
ATOM 9992  H H    . GLY A 1 47 ? 3.428   4.258   -13.123 1.00 0.00 ? 47 GLY A H    8  
ATOM 9993  H HA2  . GLY A 1 47 ? 5.312   5.209   -14.328 1.00 0.00 ? 47 GLY A HA2  8  
ATOM 9994  H HA3  . GLY A 1 47 ? 5.636   6.254   -12.925 1.00 0.00 ? 47 GLY A HA3  8  
ATOM 9995  N N    . LEU A 1 48 ? 7.000   3.555   -13.482 1.00 0.00 ? 48 LEU A N    8  
ATOM 9996  C CA   . LEU A 1 48 ? 7.875   2.472   -13.047 1.00 0.00 ? 48 LEU A CA   8  
ATOM 9997  C C    . LEU A 1 48 ? 8.703   2.885   -11.825 1.00 0.00 ? 48 LEU A C    8  
ATOM 9998  O O    . LEU A 1 48 ? 8.892   2.086   -10.914 1.00 0.00 ? 48 LEU A O    8  
ATOM 9999  C CB   . LEU A 1 48 ? 8.785   2.066   -14.213 1.00 0.00 ? 48 LEU A CB   8  
ATOM 10000 C CG   . LEU A 1 48 ? 9.602   0.816   -13.842 1.00 0.00 ? 48 LEU A CG   8  
ATOM 10001 C CD1  . LEU A 1 48 ? 9.646   -0.140  -15.035 1.00 0.00 ? 48 LEU A CD1  8  
ATOM 10002 C CD2  . LEU A 1 48 ? 11.032  1.218   -13.464 1.00 0.00 ? 48 LEU A CD2  8  
ATOM 10003 H H    . LEU A 1 48 ? 7.015   3.816   -14.457 1.00 0.00 ? 48 LEU A H    8  
ATOM 10004 H HA   . LEU A 1 48 ? 7.254   1.618   -12.773 1.00 0.00 ? 48 LEU A HA   8  
ATOM 10005 H HB2  . LEU A 1 48 ? 8.170   1.848   -15.087 1.00 0.00 ? 48 LEU A HB2  8  
ATOM 10006 H HB3  . LEU A 1 48 ? 9.463   2.888   -14.450 1.00 0.00 ? 48 LEU A HB3  8  
ATOM 10007 H HG   . LEU A 1 48 ? 9.134   0.310   -12.996 1.00 0.00 ? 48 LEU A HG   8  
ATOM 10008 H HD11 . LEU A 1 48 ? 10.250  -1.012  -14.782 1.00 0.00 ? 48 LEU A HD11 8  
ATOM 10009 H HD12 . LEU A 1 48 ? 10.085  0.367   -15.894 1.00 0.00 ? 48 LEU A HD12 8  
ATOM 10010 H HD13 . LEU A 1 48 ? 8.634   -0.462  -15.282 1.00 0.00 ? 48 LEU A HD13 8  
ATOM 10011 H HD21 . LEU A 1 48 ? 11.599  0.327   -13.191 1.00 0.00 ? 48 LEU A HD21 8  
ATOM 10012 H HD22 . LEU A 1 48 ? 11.011  1.904   -12.620 1.00 0.00 ? 48 LEU A HD22 8  
ATOM 10013 H HD23 . LEU A 1 48 ? 11.511  1.704   -14.314 1.00 0.00 ? 48 LEU A HD23 8  
ATOM 10014 N N    . LYS A 1 49 ? 9.198   4.128   -11.810 1.00 0.00 ? 49 LYS A N    8  
ATOM 10015 C CA   . LYS A 1 49 ? 10.024  4.619   -10.710 1.00 0.00 ? 49 LYS A CA   8  
ATOM 10016 C C    . LYS A 1 49 ? 9.285   4.498   -9.367  1.00 0.00 ? 49 LYS A C    8  
ATOM 10017 O O    . LYS A 1 49 ? 9.917   4.253   -8.341  1.00 0.00 ? 49 LYS A O    8  
ATOM 10018 C CB   . LYS A 1 49 ? 10.442  6.071   -10.993 1.00 0.00 ? 49 LYS A CB   8  
ATOM 10019 C CG   . LYS A 1 49 ? 9.223   7.004   -10.966 1.00 0.00 ? 49 LYS A CG   8  
ATOM 10020 C CD   . LYS A 1 49 ? 9.605   8.387   -11.509 1.00 0.00 ? 49 LYS A CD   8  
ATOM 10021 C CE   . LYS A 1 49 ? 9.615   8.367   -13.044 1.00 0.00 ? 49 LYS A CE   8  
ATOM 10022 N NZ   . LYS A 1 49 ? 9.903   9.707   -13.588 1.00 0.00 ? 49 LYS A NZ   8  
ATOM 10023 H H    . LYS A 1 49 ? 9.007   4.750   -12.580 1.00 0.00 ? 49 LYS A H    8  
ATOM 10024 H HA   . LYS A 1 49 ? 10.925  4.007   -10.661 1.00 0.00 ? 49 LYS A HA   8  
ATOM 10025 H HB2  . LYS A 1 49 ? 11.156  6.393   -10.234 1.00 0.00 ? 49 LYS A HB2  8  
ATOM 10026 H HB3  . LYS A 1 49 ? 10.917  6.120   -11.972 1.00 0.00 ? 49 LYS A HB3  8  
ATOM 10027 H HG2  . LYS A 1 49 ? 8.422   6.582   -11.574 1.00 0.00 ? 49 LYS A HG2  8  
ATOM 10028 H HG3  . LYS A 1 49 ? 8.877   7.109   -9.938  1.00 0.00 ? 49 LYS A HG3  8  
ATOM 10029 H HD2  . LYS A 1 49 ? 8.876   9.121   -11.165 1.00 0.00 ? 49 LYS A HD2  8  
ATOM 10030 H HD3  . LYS A 1 49 ? 10.595  8.662   -11.141 1.00 0.00 ? 49 LYS A HD3  8  
ATOM 10031 H HE2  . LYS A 1 49 ? 10.378  7.671   -13.392 1.00 0.00 ? 49 LYS A HE2  8  
ATOM 10032 H HE3  . LYS A 1 49 ? 8.640   8.038   -13.405 1.00 0.00 ? 49 LYS A HE3  8  
ATOM 10033 H HZ1  . LYS A 1 49 ? 9.190   10.356  -13.282 1.00 0.00 ? 49 LYS A HZ1  8  
ATOM 10034 H HZ2  . LYS A 1 49 ? 10.805  10.019  -13.259 1.00 0.00 ? 49 LYS A HZ2  8  
ATOM 10035 H HZ3  . LYS A 1 49 ? 9.908   9.666   -14.598 1.00 0.00 ? 49 LYS A HZ3  8  
ATOM 10036 N N    . GLN A 1 50 ? 7.954   4.671   -9.372  1.00 0.00 ? 50 GLN A N    8  
ATOM 10037 C CA   . GLN A 1 50 ? 7.157   4.588   -8.152  1.00 0.00 ? 50 GLN A CA   8  
ATOM 10038 C C    . GLN A 1 50 ? 6.692   3.143   -7.932  1.00 0.00 ? 50 GLN A C    8  
ATOM 10039 O O    . GLN A 1 50 ? 6.819   2.620   -6.835  1.00 0.00 ? 50 GLN A O    8  
ATOM 10040 C CB   . GLN A 1 50 ? 5.962   5.534   -8.258  1.00 0.00 ? 50 GLN A CB   8  
ATOM 10041 C CG   . GLN A 1 50 ? 6.436   6.965   -8.505  1.00 0.00 ? 50 GLN A CG   8  
ATOM 10042 C CD   . GLN A 1 50 ? 5.375   7.970   -8.069  1.00 0.00 ? 50 GLN A CD   8  
ATOM 10043 O OE1  . GLN A 1 50 ? 5.480   8.560   -6.996  1.00 0.00 ? 50 GLN A OE1  8  
ATOM 10044 N NE2  . GLN A 1 50 ? 4.354   8.166   -8.904  1.00 0.00 ? 50 GLN A NE2  8  
ATOM 10045 H H    . GLN A 1 50 ? 7.478   4.864   -10.242 1.00 0.00 ? 50 GLN A H    8  
ATOM 10046 H HA   . GLN A 1 50 ? 7.768   4.893   -7.303  1.00 0.00 ? 50 GLN A HA   8  
ATOM 10047 H HB2  . GLN A 1 50 ? 5.341   5.227   -9.082  1.00 0.00 ? 50 GLN A HB2  8  
ATOM 10048 H HB3  . GLN A 1 50 ? 5.386   5.494   -7.332  1.00 0.00 ? 50 GLN A HB3  8  
ATOM 10049 H HG2  . GLN A 1 50 ? 7.351   7.144   -7.943  1.00 0.00 ? 50 GLN A HG2  8  
ATOM 10050 H HG3  . GLN A 1 50 ? 6.633   7.094   -9.571  1.00 0.00 ? 50 GLN A HG3  8  
ATOM 10051 H HE21 . GLN A 1 50 ? 4.310   7.659   -9.781  1.00 0.00 ? 50 GLN A HE21 8  
ATOM 10052 H HE22 . GLN A 1 50 ? 3.625   8.820   -8.660  1.00 0.00 ? 50 GLN A HE22 8  
ATOM 10053 N N    . LYS A 1 51 ? 6.157   2.500   -8.983  1.00 0.00 ? 51 LYS A N    8  
ATOM 10054 C CA   . LYS A 1 51 ? 5.712   1.112   -8.912  1.00 0.00 ? 51 LYS A CA   8  
ATOM 10055 C C    . LYS A 1 51 ? 6.820   0.236   -8.312  1.00 0.00 ? 51 LYS A C    8  
ATOM 10056 O O    . LYS A 1 51 ? 6.583   -0.497  -7.353  1.00 0.00 ? 51 LYS A O    8  
ATOM 10057 C CB   . LYS A 1 51 ? 5.342   0.642   -10.329 1.00 0.00 ? 51 LYS A CB   8  
ATOM 10058 C CG   . LYS A 1 51 ? 4.932   -0.840  -10.319 1.00 0.00 ? 51 LYS A CG   8  
ATOM 10059 C CD   . LYS A 1 51 ? 3.485   -0.996  -10.805 1.00 0.00 ? 51 LYS A CD   8  
ATOM 10060 C CE   . LYS A 1 51 ? 3.394   -0.776  -12.316 1.00 0.00 ? 51 LYS A CE   8  
ATOM 10061 N NZ   . LYS A 1 51 ? 2.046   -1.121  -12.812 1.00 0.00 ? 51 LYS A NZ   8  
ATOM 10062 H H    . LYS A 1 51 ? 6.055   2.985   -9.862  1.00 0.00 ? 51 LYS A H    8  
ATOM 10063 H HA   . LYS A 1 51 ? 4.830   1.052   -8.275  1.00 0.00 ? 51 LYS A HA   8  
ATOM 10064 H HB2  . LYS A 1 51 ? 4.516   1.248   -10.701 1.00 0.00 ? 51 LYS A HB2  8  
ATOM 10065 H HB3  . LYS A 1 51 ? 6.202   0.769   -10.985 1.00 0.00 ? 51 LYS A HB3  8  
ATOM 10066 H HG2  . LYS A 1 51 ? 5.596   -1.405  -10.974 1.00 0.00 ? 51 LYS A HG2  8  
ATOM 10067 H HG3  . LYS A 1 51 ? 5.009   -1.235  -9.307  1.00 0.00 ? 51 LYS A HG3  8  
ATOM 10068 H HD2  . LYS A 1 51 ? 3.138   -2.003  -10.572 1.00 0.00 ? 51 LYS A HD2  8  
ATOM 10069 H HD3  . LYS A 1 51 ? 2.855   -0.270  -10.294 1.00 0.00 ? 51 LYS A HD3  8  
ATOM 10070 H HE2  . LYS A 1 51 ? 3.602   0.270   -12.543 1.00 0.00 ? 51 LYS A HE2  8  
ATOM 10071 H HE3  . LYS A 1 51 ? 4.130   -1.407  -12.817 1.00 0.00 ? 51 LYS A HE3  8  
ATOM 10072 H HZ1  . LYS A 1 51 ? 1.795   -2.057  -12.500 1.00 0.00 ? 51 LYS A HZ1  8  
ATOM 10073 H HZ2  . LYS A 1 51 ? 2.039   -1.091  -13.821 1.00 0.00 ? 51 LYS A HZ2  8  
ATOM 10074 H HZ3  . LYS A 1 51 ? 1.374   -0.459  -12.452 1.00 0.00 ? 51 LYS A HZ3  8  
ATOM 10075 N N    . GLN A 1 52 ? 8.027   0.318   -8.883  1.00 0.00 ? 52 GLN A N    8  
ATOM 10076 C CA   . GLN A 1 52 ? 9.164   -0.460  -8.417  1.00 0.00 ? 52 GLN A CA   8  
ATOM 10077 C C    . GLN A 1 52 ? 9.452   -0.139  -6.950  1.00 0.00 ? 52 GLN A C    8  
ATOM 10078 O O    . GLN A 1 52 ? 9.669   -1.043  -6.150  1.00 0.00 ? 52 GLN A O    8  
ATOM 10079 C CB   . GLN A 1 52 ? 10.383  -0.144  -9.298  1.00 0.00 ? 52 GLN A CB   8  
ATOM 10080 C CG   . GLN A 1 52 ? 11.560  -1.063  -8.939  1.00 0.00 ? 52 GLN A CG   8  
ATOM 10081 C CD   . GLN A 1 52 ? 11.265  -2.520  -9.293  1.00 0.00 ? 52 GLN A CD   8  
ATOM 10082 O OE1  . GLN A 1 52 ? 10.406  -2.804  -10.125 1.00 0.00 ? 52 GLN A OE1  8  
ATOM 10083 N NE2  . GLN A 1 52 ? 11.983  -3.447  -8.659  1.00 0.00 ? 52 GLN A NE2  8  
ATOM 10084 H H    . GLN A 1 52 ? 8.165   0.940   -9.668  1.00 0.00 ? 52 GLN A H    8  
ATOM 10085 H HA   . GLN A 1 52 ? 8.923   -1.519  -8.506  1.00 0.00 ? 52 GLN A HA   8  
ATOM 10086 H HB2  . GLN A 1 52 ? 10.118  -0.289  -10.346 1.00 0.00 ? 52 GLN A HB2  8  
ATOM 10087 H HB3  . GLN A 1 52 ? 10.678  0.894   -9.144  1.00 0.00 ? 52 GLN A HB3  8  
ATOM 10088 H HG2  . GLN A 1 52 ? 12.442  -0.738  -9.490  1.00 0.00 ? 52 GLN A HG2  8  
ATOM 10089 H HG3  . GLN A 1 52 ? 11.762  -0.988  -7.870  1.00 0.00 ? 52 GLN A HG3  8  
ATOM 10090 H HE21 . GLN A 1 52 ? 12.680  -3.169  -7.983  1.00 0.00 ? 52 GLN A HE21 8  
ATOM 10091 H HE22 . GLN A 1 52 ? 11.829  -4.425  -8.858  1.00 0.00 ? 52 GLN A HE22 8  
ATOM 10092 N N    . TRP A 1 53 ? 9.451   1.152   -6.600  1.00 0.00 ? 53 TRP A N    8  
ATOM 10093 C CA   . TRP A 1 53 ? 9.711   1.580   -5.235  1.00 0.00 ? 53 TRP A CA   8  
ATOM 10094 C C    . TRP A 1 53 ? 8.711   0.917   -4.284  1.00 0.00 ? 53 TRP A C    8  
ATOM 10095 O O    . TRP A 1 53 ? 9.112   0.274   -3.322  1.00 0.00 ? 53 TRP A O    8  
ATOM 10096 C CB   . TRP A 1 53 ? 9.630   3.108   -5.163  1.00 0.00 ? 53 TRP A CB   8  
ATOM 10097 C CG   . TRP A 1 53 ? 9.496   3.675   -3.786  1.00 0.00 ? 53 TRP A CG   8  
ATOM 10098 C CD1  . TRP A 1 53 ? 10.453  3.682   -2.842  1.00 0.00 ? 53 TRP A CD1  8  
ATOM 10099 C CD2  . TRP A 1 53 ? 8.344   4.327   -3.172  1.00 0.00 ? 53 TRP A CD2  8  
ATOM 10100 N NE1  . TRP A 1 53 ? 10.007  4.292   -1.694  1.00 0.00 ? 53 TRP A NE1  8  
ATOM 10101 C CE2  . TRP A 1 53 ? 8.698   4.716   -1.842  1.00 0.00 ? 53 TRP A CE2  8  
ATOM 10102 C CE3  . TRP A 1 53 ? 7.032   4.637   -3.599  1.00 0.00 ? 53 TRP A CE3  8  
ATOM 10103 C CZ2  . TRP A 1 53 ? 7.809   5.377   -0.994  1.00 0.00 ? 53 TRP A CZ2  8  
ATOM 10104 C CZ3  . TRP A 1 53 ? 6.125   5.290   -2.740  1.00 0.00 ? 53 TRP A CZ3  8  
ATOM 10105 C CH2  . TRP A 1 53 ? 6.516   5.659   -1.439  1.00 0.00 ? 53 TRP A CH2  8  
ATOM 10106 H H    . TRP A 1 53 ? 9.263   1.860   -7.297  1.00 0.00 ? 53 TRP A H    8  
ATOM 10107 H HA   . TRP A 1 53 ? 10.718  1.271   -4.955  1.00 0.00 ? 53 TRP A HA   8  
ATOM 10108 H HB2  . TRP A 1 53 ? 10.531  3.520   -5.617  1.00 0.00 ? 53 TRP A HB2  8  
ATOM 10109 H HB3  . TRP A 1 53 ? 8.774   3.436   -5.746  1.00 0.00 ? 53 TRP A HB3  8  
ATOM 10110 H HD1  . TRP A 1 53 ? 11.442  3.261   -2.967  1.00 0.00 ? 53 TRP A HD1  8  
ATOM 10111 H HE1  . TRP A 1 53 ? 10.544  4.421   -0.849  1.00 0.00 ? 53 TRP A HE1  8  
ATOM 10112 H HE3  . TRP A 1 53 ? 6.720   4.370   -4.595  1.00 0.00 ? 53 TRP A HE3  8  
ATOM 10113 H HZ2  . TRP A 1 53 ? 8.116   5.669   -0.005  1.00 0.00 ? 53 TRP A HZ2  8  
ATOM 10114 H HZ3  . TRP A 1 53 ? 5.126   5.511   -3.086  1.00 0.00 ? 53 TRP A HZ3  8  
ATOM 10115 H HH2  . TRP A 1 53 ? 5.819   6.162   -0.787  1.00 0.00 ? 53 TRP A HH2  8  
ATOM 10116 N N    . LEU A 1 54 ? 7.410   1.064   -4.552  1.00 0.00 ? 54 LEU A N    8  
ATOM 10117 C CA   . LEU A 1 54 ? 6.388   0.458   -3.712  1.00 0.00 ? 54 LEU A CA   8  
ATOM 10118 C C    . LEU A 1 54 ? 6.690   -1.026  -3.520  1.00 0.00 ? 54 LEU A C    8  
ATOM 10119 O O    . LEU A 1 54 ? 6.612   -1.543  -2.407  1.00 0.00 ? 54 LEU A O    8  
ATOM 10120 C CB   . LEU A 1 54 ? 5.001   0.619   -4.355  1.00 0.00 ? 54 LEU A CB   8  
ATOM 10121 C CG   . LEU A 1 54 ? 4.536   2.082   -4.326  1.00 0.00 ? 54 LEU A CG   8  
ATOM 10122 C CD1  . LEU A 1 54 ? 3.257   2.216   -5.153  1.00 0.00 ? 54 LEU A CD1  8  
ATOM 10123 C CD2  . LEU A 1 54 ? 4.250   2.519   -2.885  1.00 0.00 ? 54 LEU A CD2  8  
ATOM 10124 H H    . LEU A 1 54 ? 7.119   1.603   -5.355  1.00 0.00 ? 54 LEU A H    8  
ATOM 10125 H HA   . LEU A 1 54 ? 6.393   0.946   -2.746  1.00 0.00 ? 54 LEU A HA   8  
ATOM 10126 H HB2  . LEU A 1 54 ? 5.046   0.277   -5.389  1.00 0.00 ? 54 LEU A HB2  8  
ATOM 10127 H HB3  . LEU A 1 54 ? 4.284   0.006   -3.808  1.00 0.00 ? 54 LEU A HB3  8  
ATOM 10128 H HG   . LEU A 1 54 ? 5.303   2.716   -4.755  1.00 0.00 ? 54 LEU A HG   8  
ATOM 10129 H HD11 . LEU A 1 54 ? 2.454   1.654   -4.678  1.00 0.00 ? 54 LEU A HD11 8  
ATOM 10130 H HD12 . LEU A 1 54 ? 3.430   1.826   -6.156  1.00 0.00 ? 54 LEU A HD12 8  
ATOM 10131 H HD13 . LEU A 1 54 ? 2.975   3.267   -5.218  1.00 0.00 ? 54 LEU A HD13 8  
ATOM 10132 H HD21 . LEU A 1 54 ? 3.699   3.459   -2.894  1.00 0.00 ? 54 LEU A HD21 8  
ATOM 10133 H HD22 . LEU A 1 54 ? 5.188   2.658   -2.351  1.00 0.00 ? 54 LEU A HD22 8  
ATOM 10134 H HD23 . LEU A 1 54 ? 3.655   1.757   -2.382  1.00 0.00 ? 54 LEU A HD23 8  
ATOM 10135 N N    . MET A 1 55 ? 7.023   -1.703  -4.623  1.00 0.00 ? 55 MET A N    8  
ATOM 10136 C CA   . MET A 1 55 ? 7.273   -3.131  -4.621  1.00 0.00 ? 55 MET A CA   8  
ATOM 10137 C C    . MET A 1 55 ? 8.445   -3.512  -3.704  1.00 0.00 ? 55 MET A C    8  
ATOM 10138 O O    . MET A 1 55 ? 8.286   -4.394  -2.861  1.00 0.00 ? 55 MET A O    8  
ATOM 10139 C CB   . MET A 1 55 ? 7.536   -3.577  -6.071  1.00 0.00 ? 55 MET A CB   8  
ATOM 10140 C CG   . MET A 1 55 ? 7.340   -5.091  -6.214  1.00 0.00 ? 55 MET A CG   8  
ATOM 10141 S SD   . MET A 1 55 ? 8.714   -6.095  -5.587  1.00 0.00 ? 55 MET A SD   8  
ATOM 10142 C CE   . MET A 1 55 ? 9.930   -5.782  -6.891  1.00 0.00 ? 55 MET A CE   8  
ATOM 10143 H H    . MET A 1 55 ? 7.093   -1.209  -5.505  1.00 0.00 ? 55 MET A H    8  
ATOM 10144 H HA   . MET A 1 55 ? 6.374   -3.632  -4.258  1.00 0.00 ? 55 MET A HA   8  
ATOM 10145 H HB2  . MET A 1 55 ? 6.837   -3.067  -6.734  1.00 0.00 ? 55 MET A HB2  8  
ATOM 10146 H HB3  . MET A 1 55 ? 8.553   -3.314  -6.355  1.00 0.00 ? 55 MET A HB3  8  
ATOM 10147 H HG2  . MET A 1 55 ? 6.433   -5.373  -5.682  1.00 0.00 ? 55 MET A HG2  8  
ATOM 10148 H HG3  . MET A 1 55 ? 7.202   -5.323  -7.271  1.00 0.00 ? 55 MET A HG3  8  
ATOM 10149 H HE1  . MET A 1 55 ? 10.835  -6.354  -6.687  1.00 0.00 ? 55 MET A HE1  8  
ATOM 10150 H HE2  . MET A 1 55 ? 9.517   -6.084  -7.853  1.00 0.00 ? 55 MET A HE2  8  
ATOM 10151 H HE3  . MET A 1 55 ? 10.170  -4.721  -6.916  1.00 0.00 ? 55 MET A HE3  8  
ATOM 10152 N N    . THR A 1 56 ? 9.622   -2.877  -3.872  1.00 0.00 ? 56 THR A N    8  
ATOM 10153 C CA   . THR A 1 56 ? 10.814  -3.259  -3.109  1.00 0.00 ? 56 THR A CA   8  
ATOM 10154 C C    . THR A 1 56 ? 11.357  -2.094  -2.258  1.00 0.00 ? 56 THR A C    8  
ATOM 10155 O O    . THR A 1 56 ? 12.549  -1.794  -2.297  1.00 0.00 ? 56 THR A O    8  
ATOM 10156 C CB   . THR A 1 56 ? 11.879  -3.819  -4.073  1.00 0.00 ? 56 THR A CB   8  
ATOM 10157 O OG1  . THR A 1 56 ? 13.066  -4.118  -3.367  1.00 0.00 ? 56 THR A OG1  8  
ATOM 10158 C CG2  . THR A 1 56 ? 12.184  -2.815  -5.190  1.00 0.00 ? 56 THR A CG2  8  
ATOM 10159 H H    . THR A 1 56 ? 9.700   -2.130  -4.550  1.00 0.00 ? 56 THR A H    8  
ATOM 10160 H HA   . THR A 1 56 ? 10.541  -4.060  -2.432  1.00 0.00 ? 56 THR A HA   8  
ATOM 10161 H HB   . THR A 1 56 ? 11.499  -4.738  -4.515  1.00 0.00 ? 56 THR A HB   8  
ATOM 10162 H HG1  . THR A 1 56 ? 13.393  -3.308  -2.963  1.00 0.00 ? 56 THR A HG1  8  
ATOM 10163 H HG21 . THR A 1 56 ? 13.098  -3.112  -5.704  1.00 0.00 ? 56 THR A HG21 8  
ATOM 10164 H HG22 . THR A 1 56 ? 12.314  -1.819  -4.768  1.00 0.00 ? 56 THR A HG22 8  
ATOM 10165 H HG23 . THR A 1 56 ? 11.361  -2.802  -5.901  1.00 0.00 ? 56 THR A HG23 8  
ATOM 10166 N N    . GLU A 1 57 ? 10.484  -1.464  -1.465  1.00 0.00 ? 57 GLU A N    8  
ATOM 10167 C CA   . GLU A 1 57 ? 10.900  -0.420  -0.528  1.00 0.00 ? 57 GLU A CA   8  
ATOM 10168 C C    . GLU A 1 57 ? 9.761   -0.129  0.447   1.00 0.00 ? 57 GLU A C    8  
ATOM 10169 O O    . GLU A 1 57 ? 9.875   -0.405  1.638   1.00 0.00 ? 57 GLU A O    8  
ATOM 10170 C CB   . GLU A 1 57 ? 11.332  0.856   -1.275  1.00 0.00 ? 57 GLU A CB   8  
ATOM 10171 C CG   . GLU A 1 57 ? 11.793  1.931   -0.278  1.00 0.00 ? 57 GLU A CG   8  
ATOM 10172 C CD   . GLU A 1 57 ? 12.885  1.412   0.648   1.00 0.00 ? 57 GLU A CD   8  
ATOM 10173 O OE1  . GLU A 1 57 ? 13.911  0.944   0.112   1.00 0.00 ? 57 GLU A OE1  8  
ATOM 10174 O OE2  . GLU A 1 57 ? 12.672  1.497   1.876   1.00 0.00 ? 57 GLU A OE2  8  
ATOM 10175 H H    . GLU A 1 57 ? 9.508   -1.723  -1.495  1.00 0.00 ? 57 GLU A H    8  
ATOM 10176 H HA   . GLU A 1 57 ? 11.751  -0.788  0.038   1.00 0.00 ? 57 GLU A HA   8  
ATOM 10177 H HB2  . GLU A 1 57 ? 12.152  0.621   -1.953  1.00 0.00 ? 57 GLU A HB2  8  
ATOM 10178 H HB3  . GLU A 1 57 ? 10.497  1.243   -1.843  1.00 0.00 ? 57 GLU A HB3  8  
ATOM 10179 H HG2  . GLU A 1 57 ? 12.181  2.785   -0.830  1.00 0.00 ? 57 GLU A HG2  8  
ATOM 10180 H HG3  . GLU A 1 57 ? 10.941  2.255   0.322   1.00 0.00 ? 57 GLU A HG3  8  
ATOM 10181 N N    . ALA A 1 58 ? 8.663   0.437   -0.061  1.00 0.00 ? 58 ALA A N    8  
ATOM 10182 C CA   . ALA A 1 58 ? 7.536   0.813   0.778   1.00 0.00 ? 58 ALA A CA   8  
ATOM 10183 C C    . ALA A 1 58 ? 6.855   -0.418  1.370   1.00 0.00 ? 58 ALA A C    8  
ATOM 10184 O O    . ALA A 1 58 ? 6.783   -0.561  2.588   1.00 0.00 ? 58 ALA A O    8  
ATOM 10185 C CB   . ALA A 1 58 ? 6.539   1.624   -0.043  1.00 0.00 ? 58 ALA A CB   8  
ATOM 10186 H H    . ALA A 1 58 ? 8.610   0.625   -1.055  1.00 0.00 ? 58 ALA A H    8  
ATOM 10187 H HA   . ALA A 1 58 ? 7.903   1.437   1.596   1.00 0.00 ? 58 ALA A HA   8  
ATOM 10188 H HB1  . ALA A 1 58 ? 6.005   0.962   -0.721  1.00 0.00 ? 58 ALA A HB1  8  
ATOM 10189 H HB2  . ALA A 1 58 ? 7.070   2.384   -0.616  1.00 0.00 ? 58 ALA A HB2  8  
ATOM 10190 H HB3  . ALA A 1 58 ? 5.830   2.102   0.626   1.00 0.00 ? 58 ALA A HB3  8  
ATOM 10191 N N    . LEU A 1 59 ? 6.341   -1.303  0.509   1.00 0.00 ? 59 LEU A N    8  
ATOM 10192 C CA   . LEU A 1 59 ? 5.600   -2.479  0.948   1.00 0.00 ? 59 LEU A CA   8  
ATOM 10193 C C    . LEU A 1 59 ? 6.558   -3.586  1.384   1.00 0.00 ? 59 LEU A C    8  
ATOM 10194 O O    . LEU A 1 59 ? 6.300   -4.764  1.142   1.00 0.00 ? 59 LEU A O    8  
ATOM 10195 C CB   . LEU A 1 59 ? 4.690   -2.964  -0.192  1.00 0.00 ? 59 LEU A CB   8  
ATOM 10196 C CG   . LEU A 1 59 ? 3.829   -1.812  -0.742  1.00 0.00 ? 59 LEU A CG   8  
ATOM 10197 C CD1  . LEU A 1 59 ? 2.857   -2.372  -1.779  1.00 0.00 ? 59 LEU A CD1  8  
ATOM 10198 C CD2  . LEU A 1 59 ? 3.033   -1.144  0.383   1.00 0.00 ? 59 LEU A CD2  8  
ATOM 10199 H H    . LEU A 1 59 ? 6.460   -1.160  -0.481  1.00 0.00 ? 59 LEU A H    8  
ATOM 10200 H HA   . LEU A 1 59 ? 4.979   -2.206  1.801   1.00 0.00 ? 59 LEU A HA   8  
ATOM 10201 H HB2  . LEU A 1 59 ? 5.310   -3.363  -0.997  1.00 0.00 ? 59 LEU A HB2  8  
ATOM 10202 H HB3  . LEU A 1 59 ? 4.039   -3.753  0.179   1.00 0.00 ? 59 LEU A HB3  8  
ATOM 10203 H HG   . LEU A 1 59 ? 4.469   -1.071  -1.218  1.00 0.00 ? 59 LEU A HG   8  
ATOM 10204 H HD11 . LEU A 1 59 ? 3.416   -2.900  -2.551  1.00 0.00 ? 59 LEU A HD11 8  
ATOM 10205 H HD12 . LEU A 1 59 ? 2.295   -1.554  -2.229  1.00 0.00 ? 59 LEU A HD12 8  
ATOM 10206 H HD13 . LEU A 1 59 ? 2.167   -3.063  -1.294  1.00 0.00 ? 59 LEU A HD13 8  
ATOM 10207 H HD21 . LEU A 1 59 ? 2.321   -0.439  -0.047  1.00 0.00 ? 59 LEU A HD21 8  
ATOM 10208 H HD22 . LEU A 1 59 ? 2.494   -1.902  0.946   1.00 0.00 ? 59 LEU A HD22 8  
ATOM 10209 H HD23 . LEU A 1 59 ? 3.711   -0.608  1.046   1.00 0.00 ? 59 LEU A HD23 8  
ATOM 10210 N N    . VAL A 1 60 ? 7.662   -3.198  2.030   1.00 0.00 ? 60 VAL A N    8  
ATOM 10211 C CA   . VAL A 1 60 ? 8.661   -4.139  2.511   1.00 0.00 ? 60 VAL A CA   8  
ATOM 10212 C C    . VAL A 1 60 ? 8.971   -3.861  3.982   1.00 0.00 ? 60 VAL A C    8  
ATOM 10213 O O    . VAL A 1 60 ? 9.034   -4.793  4.782   1.00 0.00 ? 60 VAL A O    8  
ATOM 10214 C CB   . VAL A 1 60 ? 9.926   -4.018  1.651   1.00 0.00 ? 60 VAL A CB   8  
ATOM 10215 C CG1  . VAL A 1 60 ? 10.955  -5.068  2.075   1.00 0.00 ? 60 VAL A CG1  8  
ATOM 10216 C CG2  . VAL A 1 60 ? 9.574   -4.239  0.182   1.00 0.00 ? 60 VAL A CG2  8  
ATOM 10217 H H    . VAL A 1 60 ? 7.816   -2.215  2.192   1.00 0.00 ? 60 VAL A H    8  
ATOM 10218 H HA   . VAL A 1 60 ? 8.271   -5.154  2.423   1.00 0.00 ? 60 VAL A HA   8  
ATOM 10219 H HB   . VAL A 1 60 ? 10.357  -3.023  1.773   1.00 0.00 ? 60 VAL A HB   8  
ATOM 10220 H HG11 . VAL A 1 60 ? 10.498  -6.058  2.044   1.00 0.00 ? 60 VAL A HG11 8  
ATOM 10221 H HG12 . VAL A 1 60 ? 11.301  -4.858  3.086   1.00 0.00 ? 60 VAL A HG12 8  
ATOM 10222 H HG13 . VAL A 1 60 ? 11.804  -5.041  1.387   1.00 0.00 ? 60 VAL A HG13 8  
ATOM 10223 H HG21 . VAL A 1 60 ? 8.993   -5.156  0.080   1.00 0.00 ? 60 VAL A HG21 8  
ATOM 10224 H HG22 . VAL A 1 60 ? 8.990   -3.396  -0.186  1.00 0.00 ? 60 VAL A HG22 8  
ATOM 10225 H HG23 . VAL A 1 60 ? 10.490  -4.325  -0.394  1.00 0.00 ? 60 VAL A HG23 8  
ATOM 10226 N N    . ASN A 1 61 ? 9.171   -2.579  4.336   1.00 0.00 ? 61 ASN A N    8  
ATOM 10227 C CA   . ASN A 1 61 ? 9.511   -2.196  5.708   1.00 0.00 ? 61 ASN A CA   8  
ATOM 10228 C C    . ASN A 1 61 ? 8.379   -1.407  6.380   1.00 0.00 ? 61 ASN A C    8  
ATOM 10229 O O    . ASN A 1 61 ? 8.460   -1.135  7.578   1.00 0.00 ? 61 ASN A O    8  
ATOM 10230 C CB   . ASN A 1 61 ? 10.813  -1.383  5.704   1.00 0.00 ? 61 ASN A CB   8  
ATOM 10231 C CG   . ASN A 1 61 ? 10.766  -0.240  4.693   1.00 0.00 ? 61 ASN A CG   8  
ATOM 10232 O OD1  . ASN A 1 61 ? 9.775   0.482   4.609   1.00 0.00 ? 61 ASN A OD1  8  
ATOM 10233 N ND2  . ASN A 1 61 ? 11.845  -0.080  3.929   1.00 0.00 ? 61 ASN A ND2  8  
ATOM 10234 H H    . ASN A 1 61 ? 9.095   -1.848  3.641   1.00 0.00 ? 61 ASN A H    8  
ATOM 10235 H HA   . ASN A 1 61 ? 9.682   -3.101  6.292   1.00 0.00 ? 61 ASN A HA   8  
ATOM 10236 H HB2  . ASN A 1 61 ? 10.981  -0.971  6.700   1.00 0.00 ? 61 ASN A HB2  8  
ATOM 10237 H HB3  . ASN A 1 61 ? 11.641  -2.046  5.452   1.00 0.00 ? 61 ASN A HB3  8  
ATOM 10238 H HD21 . ASN A 1 61 ? 12.642  -0.684  4.050   1.00 0.00 ? 61 ASN A HD21 8  
ATOM 10239 H HD22 . ASN A 1 61 ? 11.864  0.651   3.219   1.00 0.00 ? 61 ASN A HD22 8  
ATOM 10240 N N    . ASN A 1 62 ? 7.323   -1.036  5.635   1.00 0.00 ? 62 ASN A N    8  
ATOM 10241 C CA   . ASN A 1 62 ? 6.208   -0.297  6.221   1.00 0.00 ? 62 ASN A CA   8  
ATOM 10242 C C    . ASN A 1 62 ? 5.557   -1.158  7.323   1.00 0.00 ? 62 ASN A C    8  
ATOM 10243 O O    . ASN A 1 62 ? 5.168   -2.295  7.058   1.00 0.00 ? 62 ASN A O    8  
ATOM 10244 C CB   . ASN A 1 62 ? 5.197   0.068   5.130   1.00 0.00 ? 62 ASN A CB   8  
ATOM 10245 C CG   . ASN A 1 62 ? 4.077   0.943   5.687   1.00 0.00 ? 62 ASN A CG   8  
ATOM 10246 O OD1  . ASN A 1 62 ? 3.284   0.495   6.506   1.00 0.00 ? 62 ASN A OD1  8  
ATOM 10247 N ND2  . ASN A 1 62 ? 4.017   2.197   5.239   1.00 0.00 ? 62 ASN A ND2  8  
ATOM 10248 H H    . ASN A 1 62 ? 7.288   -1.270  4.652   1.00 0.00 ? 62 ASN A H    8  
ATOM 10249 H HA   . ASN A 1 62 ? 6.594   0.622   6.653   1.00 0.00 ? 62 ASN A HA   8  
ATOM 10250 H HB2  . ASN A 1 62 ? 5.710   0.615   4.340   1.00 0.00 ? 62 ASN A HB2  8  
ATOM 10251 H HB3  . ASN A 1 62 ? 4.770   -0.842  4.714   1.00 0.00 ? 62 ASN A HB3  8  
ATOM 10252 H HD21 . ASN A 1 62 ? 4.693   2.525   4.566   1.00 0.00 ? 62 ASN A HD21 8  
ATOM 10253 H HD22 . ASN A 1 62 ? 3.295   2.816   5.577   1.00 0.00 ? 62 ASN A HD22 8  
ATOM 10254 N N    . PRO A 1 63 ? 5.449   -0.629  8.565   1.00 0.00 ? 63 PRO A N    8  
ATOM 10255 C CA   . PRO A 1 63 ? 4.909   -1.372  9.692   1.00 0.00 ? 63 PRO A CA   8  
ATOM 10256 C C    . PRO A 1 63 ? 3.473   -1.845  9.445   1.00 0.00 ? 63 PRO A C    8  
ATOM 10257 O O    . PRO A 1 63 ? 3.096   -2.920  9.906   1.00 0.00 ? 63 PRO A O    8  
ATOM 10258 C CB   . PRO A 1 63 ? 4.974   -0.420  10.892  1.00 0.00 ? 63 PRO A CB   8  
ATOM 10259 C CG   . PRO A 1 63 ? 5.527   0.914   10.380  1.00 0.00 ? 63 PRO A CG   8  
ATOM 10260 C CD   . PRO A 1 63 ? 5.872   0.716   8.904   1.00 0.00 ? 63 PRO A CD   8  
ATOM 10261 H HA   . PRO A 1 63 ? 5.543   -2.238  9.887   1.00 0.00 ? 63 PRO A HA   8  
ATOM 10262 H HB2  . PRO A 1 63 ? 3.978   -0.273  11.310  1.00 0.00 ? 63 PRO A HB2  8  
ATOM 10263 H HB3  . PRO A 1 63 ? 5.638   -0.829  11.654  1.00 0.00 ? 63 PRO A HB3  8  
ATOM 10264 H HG2  . PRO A 1 63 ? 4.773   1.695   10.484  1.00 0.00 ? 63 PRO A HG2  8  
ATOM 10265 H HG3  . PRO A 1 63 ? 6.423   1.187   10.939  1.00 0.00 ? 63 PRO A HG3  8  
ATOM 10266 H HD2  . PRO A 1 63 ? 5.337   1.446   8.296   1.00 0.00 ? 63 PRO A HD2  8  
ATOM 10267 H HD3  . PRO A 1 63 ? 6.948   0.821   8.759   1.00 0.00 ? 63 PRO A HD3  8  
ATOM 10268 N N    . LYS A 1 64 ? 2.672   -1.045  8.731   1.00 0.00 ? 64 LYS A N    8  
ATOM 10269 C CA   . LYS A 1 64 ? 1.276   -1.382  8.474   1.00 0.00 ? 64 LYS A CA   8  
ATOM 10270 C C    . LYS A 1 64 ? 1.139   -2.258  7.222   1.00 0.00 ? 64 LYS A C    8  
ATOM 10271 O O    . LYS A 1 64 ? 0.062   -2.317  6.636   1.00 0.00 ? 64 LYS A O    8  
ATOM 10272 C CB   . LYS A 1 64 ? 0.461   -0.090  8.329   1.00 0.00 ? 64 LYS A CB   8  
ATOM 10273 C CG   . LYS A 1 64 ? 0.317   0.582   9.696   1.00 0.00 ? 64 LYS A CG   8  
ATOM 10274 C CD   . LYS A 1 64 ? -0.594  1.808   9.571   1.00 0.00 ? 64 LYS A CD   8  
ATOM 10275 C CE   . LYS A 1 64 ? -0.953  2.343   10.963  1.00 0.00 ? 64 LYS A CE   8  
ATOM 10276 N NZ   . LYS A 1 64 ? -1.850  1.416   11.681  1.00 0.00 ? 64 LYS A NZ   8  
ATOM 10277 H H    . LYS A 1 64 ? 3.031   -0.175  8.358   1.00 0.00 ? 64 LYS A H    8  
ATOM 10278 H HA   . LYS A 1 64 ? 0.887   -1.938  9.324   1.00 0.00 ? 64 LYS A HA   8  
ATOM 10279 H HB2  . LYS A 1 64 ? 0.966   0.587   7.640   1.00 0.00 ? 64 LYS A HB2  8  
ATOM 10280 H HB3  . LYS A 1 64 ? -0.530  -0.327  7.940   1.00 0.00 ? 64 LYS A HB3  8  
ATOM 10281 H HG2  . LYS A 1 64 ? -0.119  -0.127  10.399  1.00 0.00 ? 64 LYS A HG2  8  
ATOM 10282 H HG3  . LYS A 1 64 ? 1.299   0.893   10.056  1.00 0.00 ? 64 LYS A HG3  8  
ATOM 10283 H HD2  . LYS A 1 64 ? -0.074  2.586   9.009   1.00 0.00 ? 64 LYS A HD2  8  
ATOM 10284 H HD3  . LYS A 1 64 ? -1.507  1.533   9.043   1.00 0.00 ? 64 LYS A HD3  8  
ATOM 10285 H HE2  . LYS A 1 64 ? -0.039  2.478   11.542  1.00 0.00 ? 64 LYS A HE2  8  
ATOM 10286 H HE3  . LYS A 1 64 ? -1.452  3.307   10.855  1.00 0.00 ? 64 LYS A HE3  8  
ATOM 10287 H HZ1  . LYS A 1 64 ? -2.089  1.808   12.582  1.00 0.00 ? 64 LYS A HZ1  8  
ATOM 10288 H HZ2  . LYS A 1 64 ? -2.693  1.276   11.142  1.00 0.00 ? 64 LYS A HZ2  8  
ATOM 10289 H HZ3  . LYS A 1 64 ? -1.385  0.530   11.813  1.00 0.00 ? 64 LYS A HZ3  8  
ATOM 10290 N N    . ILE A 1 65 ? 2.221   -2.945  6.814   1.00 0.00 ? 65 ILE A N    8  
ATOM 10291 C CA   . ILE A 1 65 ? 2.189   -3.823  5.650   1.00 0.00 ? 65 ILE A CA   8  
ATOM 10292 C C    . ILE A 1 65 ? 2.902   -5.135  5.976   1.00 0.00 ? 65 ILE A C    8  
ATOM 10293 O O    . ILE A 1 65 ? 3.896   -5.142  6.700   1.00 0.00 ? 65 ILE A O    8  
ATOM 10294 C CB   . ILE A 1 65 ? 2.871   -3.135  4.449   1.00 0.00 ? 65 ILE A CB   8  
ATOM 10295 C CG1  . ILE A 1 65 ? 2.134   -1.834  4.059   1.00 0.00 ? 65 ILE A CG1  8  
ATOM 10296 C CG2  . ILE A 1 65 ? 2.900   -4.097  3.254   1.00 0.00 ? 65 ILE A CG2  8  
ATOM 10297 C CD1  . ILE A 1 65 ? 0.778   -2.135  3.405   1.00 0.00 ? 65 ILE A CD1  8  
ATOM 10298 H H    . ILE A 1 65 ? 3.091   -2.862  7.324   1.00 0.00 ? 65 ILE A H    8  
ATOM 10299 H HA   . ILE A 1 65 ? 1.156   -4.044  5.396   1.00 0.00 ? 65 ILE A HA   8  
ATOM 10300 H HB   . ILE A 1 65 ? 3.896   -2.889  4.724   1.00 0.00 ? 65 ILE A HB   8  
ATOM 10301 H HG12 . ILE A 1 65 ? 1.977   -1.224  4.946   1.00 0.00 ? 65 ILE A HG12 8  
ATOM 10302 H HG13 . ILE A 1 65 ? 2.750   -1.276  3.353   1.00 0.00 ? 65 ILE A HG13 8  
ATOM 10303 H HG21 . ILE A 1 65 ? 3.656   -4.865  3.422   1.00 0.00 ? 65 ILE A HG21 8  
ATOM 10304 H HG22 . ILE A 1 65 ? 3.146   -3.545  2.349   1.00 0.00 ? 65 ILE A HG22 8  
ATOM 10305 H HG23 . ILE A 1 65 ? 1.925   -4.570  3.137   1.00 0.00 ? 65 ILE A HG23 8  
ATOM 10306 H HD11 . ILE A 1 65 ? 0.264   -1.196  3.196   1.00 0.00 ? 65 ILE A HD11 8  
ATOM 10307 H HD12 . ILE A 1 65 ? 0.170   -2.733  4.075   1.00 0.00 ? 65 ILE A HD12 8  
ATOM 10308 H HD13 . ILE A 1 65 ? 0.930   -2.674  2.473   1.00 0.00 ? 65 ILE A HD13 8  
ATOM 10309 N N    . GLU A 1 66 ? 2.388   -6.241  5.425   1.00 0.00 ? 66 GLU A N    8  
ATOM 10310 C CA   . GLU A 1 66 ? 2.983   -7.556  5.596   1.00 0.00 ? 66 GLU A CA   8  
ATOM 10311 C C    . GLU A 1 66 ? 2.776   -8.368  4.314   1.00 0.00 ? 66 GLU A C    8  
ATOM 10312 O O    . GLU A 1 66 ? 1.723   -8.275  3.681   1.00 0.00 ? 66 GLU A O    8  
ATOM 10313 C CB   . GLU A 1 66 ? 2.371   -8.257  6.819   1.00 0.00 ? 66 GLU A CB   8  
ATOM 10314 C CG   . GLU A 1 66 ? 0.842   -8.346  6.689   1.00 0.00 ? 66 GLU A CG   8  
ATOM 10315 C CD   . GLU A 1 66 ? 0.214   -8.917  7.957   1.00 0.00 ? 66 GLU A CD   8  
ATOM 10316 O OE1  . GLU A 1 66 ? 0.993   -9.278  8.871   1.00 0.00 ? 66 GLU A OE1  8  
ATOM 10317 O OE2  . GLU A 1 66 ? -1.031  -8.980  7.992   1.00 0.00 ? 66 GLU A OE2  8  
ATOM 10318 H H    . GLU A 1 66 ? 1.554   -6.169  4.857   1.00 0.00 ? 66 GLU A H    8  
ATOM 10319 H HA   . GLU A 1 66 ? 4.055   -7.439  5.762   1.00 0.00 ? 66 GLU A HA   8  
ATOM 10320 H HB2  . GLU A 1 66 ? 2.784   -9.263  6.903   1.00 0.00 ? 66 GLU A HB2  8  
ATOM 10321 H HB3  . GLU A 1 66 ? 2.622   -7.690  7.716   1.00 0.00 ? 66 GLU A HB3  8  
ATOM 10322 H HG2  . GLU A 1 66 ? 0.435   -7.352  6.512   1.00 0.00 ? 66 GLU A HG2  8  
ATOM 10323 H HG3  . GLU A 1 66 ? 0.590   -8.990  5.848   1.00 0.00 ? 66 GLU A HG3  8  
ATOM 10324 N N    . VAL A 1 67 ? 3.789   -9.155  3.928   1.00 0.00 ? 67 VAL A N    8  
ATOM 10325 C CA   . VAL A 1 67 ? 3.734   -9.962  2.713   1.00 0.00 ? 67 VAL A CA   8  
ATOM 10326 C C    . VAL A 1 67 ? 3.332   -11.390 3.068   1.00 0.00 ? 67 VAL A C    8  
ATOM 10327 O O    . VAL A 1 67 ? 3.846   -11.950 4.037   1.00 0.00 ? 67 VAL A O    8  
ATOM 10328 C CB   . VAL A 1 67 ? 5.108   -9.948  2.022   1.00 0.00 ? 67 VAL A CB   8  
ATOM 10329 C CG1  . VAL A 1 67 ? 4.953   -10.402 0.566   1.00 0.00 ? 67 VAL A CG1  8  
ATOM 10330 C CG2  . VAL A 1 67 ? 5.701   -8.535  2.051   1.00 0.00 ? 67 VAL A CG2  8  
ATOM 10331 H H    . VAL A 1 67 ? 4.627   -9.198  4.488   1.00 0.00 ? 67 VAL A H    8  
ATOM 10332 H HA   . VAL A 1 67 ? 2.990   -9.539  2.035   1.00 0.00 ? 67 VAL A HA   8  
ATOM 10333 H HB   . VAL A 1 67 ? 5.782   -10.630 2.542   1.00 0.00 ? 67 VAL A HB   8  
ATOM 10334 H HG11 . VAL A 1 67 ? 4.286   -9.720  0.039   1.00 0.00 ? 67 VAL A HG11 8  
ATOM 10335 H HG12 . VAL A 1 67 ? 5.928   -10.404 0.080   1.00 0.00 ? 67 VAL A HG12 8  
ATOM 10336 H HG13 . VAL A 1 67 ? 4.537   -11.409 0.540   1.00 0.00 ? 67 VAL A HG13 8  
ATOM 10337 H HG21 . VAL A 1 67 ? 6.543   -8.479  1.362   1.00 0.00 ? 67 VAL A HG21 8  
ATOM 10338 H HG22 . VAL A 1 67 ? 4.942   -7.815  1.755   1.00 0.00 ? 67 VAL A HG22 8  
ATOM 10339 H HG23 . VAL A 1 67 ? 6.045   -8.303  3.060   1.00 0.00 ? 67 VAL A HG23 8  
ATOM 10340 N N    . ILE A 1 68 ? 2.417   -11.981 2.283   1.00 0.00 ? 68 ILE A N    8  
ATOM 10341 C CA   . ILE A 1 68 ? 1.967   -13.351 2.517   1.00 0.00 ? 68 ILE A CA   8  
ATOM 10342 C C    . ILE A 1 68 ? 2.610   -14.256 1.471   1.00 0.00 ? 68 ILE A C    8  
ATOM 10343 O O    . ILE A 1 68 ? 3.330   -15.191 1.813   1.00 0.00 ? 68 ILE A O    8  
ATOM 10344 C CB   . ILE A 1 68 ? 0.426   -13.415 2.447   1.00 0.00 ? 68 ILE A CB   8  
ATOM 10345 C CG1  . ILE A 1 68 ? -0.186  -12.983 3.792   1.00 0.00 ? 68 ILE A CG1  8  
ATOM 10346 C CG2  . ILE A 1 68 ? -0.030  -14.849 2.145   1.00 0.00 ? 68 ILE A CG2  8  
ATOM 10347 C CD1  . ILE A 1 68 ? 0.084   -11.501 4.061   1.00 0.00 ? 68 ILE A CD1  8  
ATOM 10348 H H    . ILE A 1 68 ? 2.022   -11.472 1.497   1.00 0.00 ? 68 ILE A H    8  
ATOM 10349 H HA   . ILE A 1 68 ? 2.288   -13.676 3.507   1.00 0.00 ? 68 ILE A HA   8  
ATOM 10350 H HB   . ILE A 1 68 ? 0.072   -12.754 1.657   1.00 0.00 ? 68 ILE A HB   8  
ATOM 10351 H HG12 . ILE A 1 68 ? -1.263  -13.147 3.765   1.00 0.00 ? 68 ILE A HG12 8  
ATOM 10352 H HG13 . ILE A 1 68 ? 0.247   -13.579 4.597   1.00 0.00 ? 68 ILE A HG13 8  
ATOM 10353 H HG21 . ILE A 1 68 ? 0.486   -15.544 2.809   1.00 0.00 ? 68 ILE A HG21 8  
ATOM 10354 H HG22 . ILE A 1 68 ? 0.198   -15.099 1.110   1.00 0.00 ? 68 ILE A HG22 8  
ATOM 10355 H HG23 . ILE A 1 68 ? -1.105  -14.930 2.304   1.00 0.00 ? 68 ILE A HG23 8  
ATOM 10356 H HD11 . ILE A 1 68 ? 1.097   -11.376 4.436   1.00 0.00 ? 68 ILE A HD11 8  
ATOM 10357 H HD12 . ILE A 1 68 ? -0.037  -10.933 3.138   1.00 0.00 ? 68 ILE A HD12 8  
ATOM 10358 H HD13 . ILE A 1 68 ? -0.622  -11.136 4.806   1.00 0.00 ? 68 ILE A HD13 8  
ATOM 10359 N N    . ASP A 1 69 ? 2.346   -13.962 0.195   1.00 0.00 ? 69 ASP A N    8  
ATOM 10360 C CA   . ASP A 1 69 ? 2.894   -14.724 -0.913  1.00 0.00 ? 69 ASP A CA   8  
ATOM 10361 C C    . ASP A 1 69 ? 2.815   -13.870 -2.171  1.00 0.00 ? 69 ASP A C    8  
ATOM 10362 O O    . ASP A 1 69 ? 1.928   -14.058 -3.005  1.00 0.00 ? 69 ASP A O    8  
ATOM 10363 C CB   . ASP A 1 69 ? 2.106   -16.032 -1.078  1.00 0.00 ? 69 ASP A CB   8  
ATOM 10364 C CG   . ASP A 1 69 ? 2.638   -16.852 -2.249  1.00 0.00 ? 69 ASP A CG   8  
ATOM 10365 O OD1  . ASP A 1 69 ? 3.863   -16.773 -2.492  1.00 0.00 ? 69 ASP A OD1  8  
ATOM 10366 O OD2  . ASP A 1 69 ? 1.811   -17.544 -2.880  1.00 0.00 ? 69 ASP A OD2  8  
ATOM 10367 H H    . ASP A 1 69 ? 1.744   -13.181 -0.020  1.00 0.00 ? 69 ASP A H    8  
ATOM 10368 H HA   . ASP A 1 69 ? 3.939   -14.959 -0.705  1.00 0.00 ? 69 ASP A HA   8  
ATOM 10369 H HB2  . ASP A 1 69 ? 2.193   -16.620 -0.165  1.00 0.00 ? 69 ASP A HB2  8  
ATOM 10370 H HB3  . ASP A 1 69 ? 1.056   -15.799 -1.254  1.00 0.00 ? 69 ASP A HB3  8  
ATOM 10371 N N    . GLY A 1 70 ? 3.739   -12.912 -2.301  1.00 0.00 ? 70 GLY A N    8  
ATOM 10372 C CA   . GLY A 1 70 ? 3.765   -12.012 -3.443  1.00 0.00 ? 70 GLY A CA   8  
ATOM 10373 C C    . GLY A 1 70 ? 2.759   -10.874 -3.252  1.00 0.00 ? 70 GLY A C    8  
ATOM 10374 O O    . GLY A 1 70 ? 3.056   -9.726  -3.579  1.00 0.00 ? 70 GLY A O    8  
ATOM 10375 H H    . GLY A 1 70 ? 4.443   -12.799 -1.587  1.00 0.00 ? 70 GLY A H    8  
ATOM 10376 H HA2  . GLY A 1 70 ? 4.767   -11.593 -3.544  1.00 0.00 ? 70 GLY A HA2  8  
ATOM 10377 H HA3  . GLY A 1 70 ? 3.515   -12.566 -4.348  1.00 0.00 ? 70 GLY A HA3  8  
ATOM 10378 N N    . LYS A 1 71 ? 1.568   -11.193 -2.723  1.00 0.00 ? 71 LYS A N    8  
ATOM 10379 C CA   . LYS A 1 71 ? 0.530   -10.201 -2.506  1.00 0.00 ? 71 LYS A CA   8  
ATOM 10380 C C    . LYS A 1 71 ? 0.793   -9.485  -1.175  1.00 0.00 ? 71 LYS A C    8  
ATOM 10381 O O    . LYS A 1 71 ? 1.300   -10.097 -0.227  1.00 0.00 ? 71 LYS A O    8  
ATOM 10382 C CB   . LYS A 1 71 ? -0.848  -10.882 -2.520  1.00 0.00 ? 71 LYS A CB   8  
ATOM 10383 C CG   . LYS A 1 71 ? -1.016  -11.748 -3.780  1.00 0.00 ? 71 LYS A CG   8  
ATOM 10384 C CD   . LYS A 1 71 ? -2.297  -11.346 -4.521  1.00 0.00 ? 71 LYS A CD   8  
ATOM 10385 C CE   . LYS A 1 71 ? -3.532  -11.865 -3.781  1.00 0.00 ? 71 LYS A CE   8  
ATOM 10386 N NZ   . LYS A 1 71 ? -4.710  -11.020 -4.068  1.00 0.00 ? 71 LYS A NZ   8  
ATOM 10387 H H    . LYS A 1 71 ? 1.376   -12.150 -2.463  1.00 0.00 ? 71 LYS A H    8  
ATOM 10388 H HA   . LYS A 1 71 ? 0.566   -9.470  -3.313  1.00 0.00 ? 71 LYS A HA   8  
ATOM 10389 H HB2  . LYS A 1 71 ? -0.947  -11.512 -1.647  1.00 0.00 ? 71 LYS A HB2  8  
ATOM 10390 H HB3  . LYS A 1 71 ? -1.623  -10.117 -2.500  1.00 0.00 ? 71 LYS A HB3  8  
ATOM 10391 H HG2  . LYS A 1 71 ? -0.162  -11.605 -4.439  1.00 0.00 ? 71 LYS A HG2  8  
ATOM 10392 H HG3  . LYS A 1 71 ? -1.076  -12.799 -3.493  1.00 0.00 ? 71 LYS A HG3  8  
ATOM 10393 H HD2  . LYS A 1 71 ? -2.347  -10.264 -4.585  1.00 0.00 ? 71 LYS A HD2  8  
ATOM 10394 H HD3  . LYS A 1 71 ? -2.279  -11.766 -5.528  1.00 0.00 ? 71 LYS A HD3  8  
ATOM 10395 H HE2  . LYS A 1 71 ? -3.738  -12.887 -4.101  1.00 0.00 ? 71 LYS A HE2  8  
ATOM 10396 H HE3  . LYS A 1 71 ? -3.343  -11.859 -2.708  1.00 0.00 ? 71 LYS A HE3  8  
ATOM 10397 H HZ1  . LYS A 1 71 ? -5.524  -11.603 -4.200  1.00 0.00 ? 71 LYS A HZ1  8  
ATOM 10398 H HZ2  . LYS A 1 71 ? -4.870  -10.392 -3.287  1.00 0.00 ? 71 LYS A HZ2  8  
ATOM 10399 H HZ3  . LYS A 1 71 ? -4.544  -10.474 -4.912  1.00 0.00 ? 71 LYS A HZ3  8  
ATOM 10400 N N    . TYR A 1 72 ? 0.460   -8.184  -1.113  1.00 0.00 ? 72 TYR A N    8  
ATOM 10401 C CA   . TYR A 1 72 ? 0.716   -7.360  0.065   1.00 0.00 ? 72 TYR A CA   8  
ATOM 10402 C C    . TYR A 1 72 ? -0.576  -7.114  0.840   1.00 0.00 ? 72 TYR A C    8  
ATOM 10403 O O    . TYR A 1 72 ? -1.557  -6.645  0.272   1.00 0.00 ? 72 TYR A O    8  
ATOM 10404 C CB   . TYR A 1 72 ? 1.321   -6.028  -0.388  1.00 0.00 ? 72 TYR A CB   8  
ATOM 10405 C CG   . TYR A 1 72 ? 2.569   -6.195  -1.227  1.00 0.00 ? 72 TYR A CG   8  
ATOM 10406 C CD1  . TYR A 1 72 ? 3.806   -6.418  -0.601  1.00 0.00 ? 72 TYR A CD1  8  
ATOM 10407 C CD2  . TYR A 1 72 ? 2.492   -6.137  -2.631  1.00 0.00 ? 72 TYR A CD2  8  
ATOM 10408 C CE1  . TYR A 1 72 ? 4.965   -6.590  -1.374  1.00 0.00 ? 72 TYR A CE1  8  
ATOM 10409 C CE2  . TYR A 1 72 ? 3.653   -6.308  -3.405  1.00 0.00 ? 72 TYR A CE2  8  
ATOM 10410 C CZ   . TYR A 1 72 ? 4.889   -6.539  -2.775  1.00 0.00 ? 72 TYR A CZ   8  
ATOM 10411 O OH   . TYR A 1 72 ? 6.013   -6.717  -3.522  1.00 0.00 ? 72 TYR A OH   8  
ATOM 10412 H H    . TYR A 1 72 ? 0.024   -7.744  -1.915  1.00 0.00 ? 72 TYR A H    8  
ATOM 10413 H HA   . TYR A 1 72 ? 1.430   -7.869  0.714   1.00 0.00 ? 72 TYR A HA   8  
ATOM 10414 H HB2  . TYR A 1 72 ? 0.577   -5.483  -0.970  1.00 0.00 ? 72 TYR A HB2  8  
ATOM 10415 H HB3  . TYR A 1 72 ? 1.570   -5.438  0.496   1.00 0.00 ? 72 TYR A HB3  8  
ATOM 10416 H HD1  . TYR A 1 72 ? 3.863   -6.457  0.475   1.00 0.00 ? 72 TYR A HD1  8  
ATOM 10417 H HD2  . TYR A 1 72 ? 1.541   -5.964  -3.114  1.00 0.00 ? 72 TYR A HD2  8  
ATOM 10418 H HE1  . TYR A 1 72 ? 5.914   -6.765  -0.890  1.00 0.00 ? 72 TYR A HE1  8  
ATOM 10419 H HE2  . TYR A 1 72 ? 3.594   -6.264  -4.483  1.00 0.00 ? 72 TYR A HE2  8  
ATOM 10420 H HH   . TYR A 1 72 ? 5.827   -6.860  -4.451  1.00 0.00 ? 72 TYR A HH   8  
ATOM 10421 N N    . ALA A 1 73 ? -0.564  -7.423  2.144   1.00 0.00 ? 73 ALA A N    8  
ATOM 10422 C CA   . ALA A 1 73 ? -1.717  -7.208  3.012   1.00 0.00 ? 73 ALA A CA   8  
ATOM 10423 C C    . ALA A 1 73 ? -1.405  -6.107  4.006   1.00 0.00 ? 73 ALA A C    8  
ATOM 10424 O O    . ALA A 1 73 ? -0.254  -5.920  4.392   1.00 0.00 ? 73 ALA A O    8  
ATOM 10425 C CB   . ALA A 1 73 ? -2.053  -8.497  3.769   1.00 0.00 ? 73 ALA A CB   8  
ATOM 10426 H H    . ALA A 1 73 ? 0.275   -7.814  2.557   1.00 0.00 ? 73 ALA A H    8  
ATOM 10427 H HA   . ALA A 1 73 ? -2.576  -6.912  2.413   1.00 0.00 ? 73 ALA A HA   8  
ATOM 10428 H HB1  . ALA A 1 73 ? -2.638  -8.254  4.656   1.00 0.00 ? 73 ALA A HB1  8  
ATOM 10429 H HB2  . ALA A 1 73 ? -2.631  -9.159  3.132   1.00 0.00 ? 73 ALA A HB2  8  
ATOM 10430 H HB3  . ALA A 1 73 ? -1.133  -8.993  4.070   1.00 0.00 ? 73 ALA A HB3  8  
ATOM 10431 N N    . PHE A 1 74 ? -2.440  -5.387  4.429   1.00 0.00 ? 74 PHE A N    8  
ATOM 10432 C CA   . PHE A 1 74 ? -2.296  -4.356  5.429   1.00 0.00 ? 74 PHE A CA   8  
ATOM 10433 C C    . PHE A 1 74 ? -2.232  -5.031  6.793   1.00 0.00 ? 74 PHE A C    8  
ATOM 10434 O O    . PHE A 1 74 ? -3.152  -5.756  7.170   1.00 0.00 ? 74 PHE A O    8  
ATOM 10435 C CB   . PHE A 1 74 ? -3.471  -3.384  5.324   1.00 0.00 ? 74 PHE A CB   8  
ATOM 10436 C CG   . PHE A 1 74 ? -3.875  -2.754  6.638   1.00 0.00 ? 74 PHE A CG   8  
ATOM 10437 C CD1  . PHE A 1 74 ? -3.275  -1.562  7.069   1.00 0.00 ? 74 PHE A CD1  8  
ATOM 10438 C CD2  . PHE A 1 74 ? -4.874  -3.357  7.415   1.00 0.00 ? 74 PHE A CD2  8  
ATOM 10439 C CE1  . PHE A 1 74 ? -3.687  -0.969  8.274   1.00 0.00 ? 74 PHE A CE1  8  
ATOM 10440 C CE2  . PHE A 1 74 ? -5.291  -2.765  8.613   1.00 0.00 ? 74 PHE A CE2  8  
ATOM 10441 C CZ   . PHE A 1 74 ? -4.706  -1.568  9.040   1.00 0.00 ? 74 PHE A CZ   8  
ATOM 10442 H H    . PHE A 1 74 ? -3.360  -5.569  4.060   1.00 0.00 ? 74 PHE A H    8  
ATOM 10443 H HA   . PHE A 1 74 ? -1.369  -3.813  5.254   1.00 0.00 ? 74 PHE A HA   8  
ATOM 10444 H HB2  . PHE A 1 74 ? -3.200  -2.593  4.628   1.00 0.00 ? 74 PHE A HB2  8  
ATOM 10445 H HB3  . PHE A 1 74 ? -4.331  -3.919  4.922   1.00 0.00 ? 74 PHE A HB3  8  
ATOM 10446 H HD1  . PHE A 1 74 ? -2.505  -1.095  6.471   1.00 0.00 ? 74 PHE A HD1  8  
ATOM 10447 H HD2  . PHE A 1 74 ? -5.326  -4.274  7.082   1.00 0.00 ? 74 PHE A HD2  8  
ATOM 10448 H HE1  . PHE A 1 74 ? -3.234  -0.047  8.602   1.00 0.00 ? 74 PHE A HE1  8  
ATOM 10449 H HE2  . PHE A 1 74 ? -6.071  -3.227  9.202   1.00 0.00 ? 74 PHE A HE2  8  
ATOM 10450 H HZ   . PHE A 1 74 ? -5.046  -1.099  9.950   1.00 0.00 ? 74 PHE A HZ   8  
ATOM 10451 N N    . LYS A 1 75 ? -1.141  -4.803  7.522   1.00 0.00 ? 75 LYS A N    8  
ATOM 10452 C CA   . LYS A 1 75 ? -0.945  -5.413  8.820   1.00 0.00 ? 75 LYS A CA   8  
ATOM 10453 C C    . LYS A 1 75 ? -1.857  -4.728  9.849   1.00 0.00 ? 75 LYS A C    8  
ATOM 10454 O O    . LYS A 1 75 ? -1.756  -3.514  10.041  1.00 0.00 ? 75 LYS A O    8  
ATOM 10455 C CB   . LYS A 1 75 ? 0.530   -5.284  9.207   1.00 0.00 ? 75 LYS A CB   8  
ATOM 10456 C CG   . LYS A 1 75 ? 0.825   -6.152  10.431  1.00 0.00 ? 75 LYS A CG   8  
ATOM 10457 C CD   . LYS A 1 75 ? 2.328   -6.118  10.733  1.00 0.00 ? 75 LYS A CD   8  
ATOM 10458 C CE   . LYS A 1 75 ? 2.724   -7.356  11.544  1.00 0.00 ? 75 LYS A CE   8  
ATOM 10459 N NZ   . LYS A 1 75 ? 2.825   -8.550  10.681  1.00 0.00 ? 75 LYS A NZ   8  
ATOM 10460 H H    . LYS A 1 75 ? -0.422  -4.189  7.165   1.00 0.00 ? 75 LYS A H    8  
ATOM 10461 H HA   . LYS A 1 75 ? -1.196  -6.466  8.750   1.00 0.00 ? 75 LYS A HA   8  
ATOM 10462 H HB2  . LYS A 1 75 ? 1.148   -5.617  8.373   1.00 0.00 ? 75 LYS A HB2  8  
ATOM 10463 H HB3  . LYS A 1 75 ? 0.760   -4.245  9.430   1.00 0.00 ? 75 LYS A HB3  8  
ATOM 10464 H HG2  . LYS A 1 75 ? 0.273   -5.772  11.291  1.00 0.00 ? 75 LYS A HG2  8  
ATOM 10465 H HG3  . LYS A 1 75 ? 0.517   -7.177  10.229  1.00 0.00 ? 75 LYS A HG3  8  
ATOM 10466 H HD2  . LYS A 1 75 ? 2.889   -6.102  9.797   1.00 0.00 ? 75 LYS A HD2  8  
ATOM 10467 H HD3  . LYS A 1 75 ? 2.559   -5.219  11.306  1.00 0.00 ? 75 LYS A HD3  8  
ATOM 10468 H HE2  . LYS A 1 75 ? 3.691   -7.178  12.016  1.00 0.00 ? 75 LYS A HE2  8  
ATOM 10469 H HE3  . LYS A 1 75 ? 1.977   -7.533  12.317  1.00 0.00 ? 75 LYS A HE3  8  
ATOM 10470 H HZ1  . LYS A 1 75 ? 3.040   -9.357  11.246  1.00 0.00 ? 75 LYS A HZ1  8  
ATOM 10471 H HZ2  . LYS A 1 75 ? 3.556   -8.412  9.999   1.00 0.00 ? 75 LYS A HZ2  8  
ATOM 10472 H HZ3  . LYS A 1 75 ? 1.943   -8.700  10.200  1.00 0.00 ? 75 LYS A HZ3  8  
ATOM 10473 N N    . PRO A 1 76 ? -2.756  -5.492  10.513  1.00 0.00 ? 76 PRO A N    8  
ATOM 10474 C CA   . PRO A 1 76 ? -3.669  -4.939  11.492  1.00 0.00 ? 76 PRO A CA   8  
ATOM 10475 C C    . PRO A 1 76 ? -2.894  -4.356  12.674  1.00 0.00 ? 76 PRO A C    8  
ATOM 10476 O O    . PRO A 1 76 ? -1.999  -5.010  13.212  1.00 0.00 ? 76 PRO A O    8  
ATOM 10477 C CB   . PRO A 1 76 ? -4.565  -6.100  11.936  1.00 0.00 ? 76 PRO A CB   8  
ATOM 10478 C CG   . PRO A 1 76 ? -4.000  -7.370  11.289  1.00 0.00 ? 76 PRO A CG   8  
ATOM 10479 C CD   . PRO A 1 76 ? -2.903  -6.922  10.323  1.00 0.00 ? 76 PRO A CD   8  
ATOM 10480 H HA   . PRO A 1 76 ? -4.279  -4.164  11.028  1.00 0.00 ? 76 PRO A HA   8  
ATOM 10481 H HB2  . PRO A 1 76 ? -4.550  -6.195  13.022  1.00 0.00 ? 76 PRO A HB2  8  
ATOM 10482 H HB3  . PRO A 1 76 ? -5.586  -5.932  11.592  1.00 0.00 ? 76 PRO A HB3  8  
ATOM 10483 H HG2  . PRO A 1 76 ? -3.577  -8.020  12.055  1.00 0.00 ? 76 PRO A HG2  8  
ATOM 10484 H HG3  . PRO A 1 76 ? -4.786  -7.896  10.748  1.00 0.00 ? 76 PRO A HG3  8  
ATOM 10485 H HD2  . PRO A 1 76 ? -1.970  -7.434  10.557  1.00 0.00 ? 76 PRO A HD2  8  
ATOM 10486 H HD3  . PRO A 1 76 ? -3.204  -7.138  9.297   1.00 0.00 ? 76 PRO A HD3  8  
ATOM 10487 N N    . LYS A 1 77 ? -3.240  -3.127  13.078  1.00 0.00 ? 77 LYS A N    8  
ATOM 10488 C CA   . LYS A 1 77 ? -2.584  -2.472  14.197  1.00 0.00 ? 77 LYS A CA   8  
ATOM 10489 C C    . LYS A 1 77 ? -3.452  -1.317  14.698  1.00 0.00 ? 77 LYS A C    8  
ATOM 10490 O O    . LYS A 1 77 ? -3.818  -0.434  13.921  1.00 0.00 ? 77 LYS A O    8  
ATOM 10491 C CB   . LYS A 1 77 ? -1.201  -1.966  13.756  1.00 0.00 ? 77 LYS A CB   8  
ATOM 10492 C CG   . LYS A 1 77 ? -0.306  -1.747  14.982  1.00 0.00 ? 77 LYS A CG   8  
ATOM 10493 C CD   . LYS A 1 77 ? 0.338   -3.074  15.402  1.00 0.00 ? 77 LYS A CD   8  
ATOM 10494 C CE   . LYS A 1 77 ? 1.202   -2.851  16.647  1.00 0.00 ? 77 LYS A CE   8  
ATOM 10495 N NZ   . LYS A 1 77 ? 1.822   -4.112  17.095  1.00 0.00 ? 77 LYS A NZ   8  
ATOM 10496 H H    . LYS A 1 77 ? -3.980  -2.632  12.600  1.00 0.00 ? 77 LYS A H    8  
ATOM 10497 H HA   . LYS A 1 77 ? -2.459  -3.197  15.002  1.00 0.00 ? 77 LYS A HA   8  
ATOM 10498 H HB2  . LYS A 1 77 ? -0.736  -2.699  13.095  1.00 0.00 ? 77 LYS A HB2  8  
ATOM 10499 H HB3  . LYS A 1 77 ? -1.317  -1.024  13.220  1.00 0.00 ? 77 LYS A HB3  8  
ATOM 10500 H HG2  . LYS A 1 77 ? 0.478   -1.030  14.731  1.00 0.00 ? 77 LYS A HG2  8  
ATOM 10501 H HG3  . LYS A 1 77 ? -0.903  -1.356  15.804  1.00 0.00 ? 77 LYS A HG3  8  
ATOM 10502 H HD2  . LYS A 1 77 ? -0.440  -3.802  15.626  1.00 0.00 ? 77 LYS A HD2  8  
ATOM 10503 H HD3  . LYS A 1 77 ? 0.962   -3.448  14.589  1.00 0.00 ? 77 LYS A HD3  8  
ATOM 10504 H HE2  . LYS A 1 77 ? 1.988   -2.130  16.415  1.00 0.00 ? 77 LYS A HE2  8  
ATOM 10505 H HE3  . LYS A 1 77 ? 0.579   -2.454  17.450  1.00 0.00 ? 77 LYS A HE3  8  
ATOM 10506 H HZ1  . LYS A 1 77 ? 2.407   -4.481  16.358  1.00 0.00 ? 77 LYS A HZ1  8  
ATOM 10507 H HZ2  . LYS A 1 77 ? 1.099   -4.782  17.319  1.00 0.00 ? 77 LYS A HZ2  8  
ATOM 10508 H HZ3  . LYS A 1 77 ? 2.385   -3.938  17.916  1.00 0.00 ? 77 LYS A HZ3  8  
ATOM 10509 N N    . TYR A 1 78 ? -3.774  -1.336  16.002  1.00 0.00 ? 78 TYR A N    8  
ATOM 10510 C CA   . TYR A 1 78 ? -4.590  -0.306  16.640  1.00 0.00 ? 78 TYR A CA   8  
ATOM 10511 C C    . TYR A 1 78 ? -5.952  -0.195  15.940  1.00 0.00 ? 78 TYR A C    8  
ATOM 10512 O O    . TYR A 1 78 ? -6.775  -1.098  16.071  1.00 0.00 ? 78 TYR A O    8  
ATOM 10513 C CB   . TYR A 1 78 ? -3.831  1.032   16.647  1.00 0.00 ? 78 TYR A CB   8  
ATOM 10514 C CG   . TYR A 1 78 ? -2.523  0.971   17.410  1.00 0.00 ? 78 TYR A CG   8  
ATOM 10515 C CD1  . TYR A 1 78 ? -2.529  0.748   18.799  1.00 0.00 ? 78 TYR A CD1  8  
ATOM 10516 C CD2  . TYR A 1 78 ? -1.301  1.135   16.731  1.00 0.00 ? 78 TYR A CD2  8  
ATOM 10517 C CE1  . TYR A 1 78 ? -1.316  0.686   19.506  1.00 0.00 ? 78 TYR A CE1  8  
ATOM 10518 C CE2  . TYR A 1 78 ? -0.089  1.072   17.440  1.00 0.00 ? 78 TYR A CE2  8  
ATOM 10519 C CZ   . TYR A 1 78 ? -0.097  0.847   18.828  1.00 0.00 ? 78 TYR A CZ   8  
ATOM 10520 O OH   . TYR A 1 78 ? 1.080   0.785   19.513  1.00 0.00 ? 78 TYR A OH   8  
ATOM 10521 H H    . TYR A 1 78 ? -3.441  -2.095  16.579  1.00 0.00 ? 78 TYR A H    8  
ATOM 10522 H HA   . TYR A 1 78 ? -4.765  -0.604  17.673  1.00 0.00 ? 78 TYR A HA   8  
ATOM 10523 H HB2  . TYR A 1 78 ? -3.622  1.331   15.621  1.00 0.00 ? 78 TYR A HB2  8  
ATOM 10524 H HB3  . TYR A 1 78 ? -4.465  1.791   17.110  1.00 0.00 ? 78 TYR A HB3  8  
ATOM 10525 H HD1  . TYR A 1 78 ? -3.466  0.623   19.322  1.00 0.00 ? 78 TYR A HD1  8  
ATOM 10526 H HD2  . TYR A 1 78 ? -1.294  1.308   15.665  1.00 0.00 ? 78 TYR A HD2  8  
ATOM 10527 H HE1  . TYR A 1 78 ? -1.324  0.512   20.573  1.00 0.00 ? 78 TYR A HE1  8  
ATOM 10528 H HE2  . TYR A 1 78 ? 0.848   1.197   16.919  1.00 0.00 ? 78 TYR A HE2  8  
ATOM 10529 H HH   . TYR A 1 78 ? 0.958   0.685   20.460  1.00 0.00 ? 78 TYR A HH   8  
ATOM 10530 N N    . ASN A 1 79 ? -6.182  0.917   15.209  1.00 0.00 ? 79 ASN A N    8  
ATOM 10531 C CA   . ASN A 1 79 ? -7.445  1.174   14.506  1.00 0.00 ? 79 ASN A CA   8  
ATOM 10532 C C    . ASN A 1 79 ? -8.594  1.337   15.508  1.00 0.00 ? 79 ASN A C    8  
ATOM 10533 O O    . ASN A 1 79 ? -8.475  0.966   16.674  1.00 0.00 ? 79 ASN A O    8  
ATOM 10534 C CB   . ASN A 1 79 ? -7.747  0.052   13.491  1.00 0.00 ? 79 ASN A CB   8  
ATOM 10535 C CG   . ASN A 1 79 ? -7.143  0.373   12.130  1.00 0.00 ? 79 ASN A CG   8  
ATOM 10536 O OD1  . ASN A 1 79 ? -7.867  0.589   11.164  1.00 0.00 ? 79 ASN A OD1  8  
ATOM 10537 N ND2  . ASN A 1 79 ? -5.813  0.405   12.052  1.00 0.00 ? 79 ASN A ND2  8  
ATOM 10538 H H    . ASN A 1 79 ? -5.460  1.616   15.140  1.00 0.00 ? 79 ASN A H    8  
ATOM 10539 H HA   . ASN A 1 79 ? -7.341  2.111   13.957  1.00 0.00 ? 79 ASN A HA   8  
ATOM 10540 H HB2  . ASN A 1 79 ? -7.338  -0.891  13.845  1.00 0.00 ? 79 ASN A HB2  8  
ATOM 10541 H HB3  . ASN A 1 79 ? -8.826  -0.049  13.383  1.00 0.00 ? 79 ASN A HB3  8  
ATOM 10542 H HD21 . ASN A 1 79 ? -5.254  0.196   12.872  1.00 0.00 ? 79 ASN A HD21 8  
ATOM 10543 H HD22 . ASN A 1 79 ? -5.367  0.638   11.181  1.00 0.00 ? 79 ASN A HD22 8  
ATOM 10544 N N    . VAL A 1 80 ? -9.713  1.905   15.041  1.00 0.00 ? 80 VAL A N    8  
ATOM 10545 C CA   . VAL A 1 80 ? -10.882 2.116   15.882  1.00 0.00 ? 80 VAL A CA   8  
ATOM 10546 C C    . VAL A 1 80 ? -11.650 0.804   16.011  1.00 0.00 ? 80 VAL A C    8  
ATOM 10547 O O    . VAL A 1 80 ? -11.883 0.323   17.118  1.00 0.00 ? 80 VAL A O    8  
ATOM 10548 C CB   . VAL A 1 80 ? -11.764 3.214   15.262  1.00 0.00 ? 80 VAL A CB   8  
ATOM 10549 C CG1  . VAL A 1 80 ? -13.007 3.433   16.130  1.00 0.00 ? 80 VAL A CG1  8  
ATOM 10550 C CG2  . VAL A 1 80 ? -10.974 4.524   15.174  1.00 0.00 ? 80 VAL A CG2  8  
ATOM 10551 H H    . VAL A 1 80 ? -9.758  2.197   14.077  1.00 0.00 ? 80 VAL A H    8  
ATOM 10552 H HA   . VAL A 1 80 ? -10.558 2.438   16.872  1.00 0.00 ? 80 VAL A HA   8  
ATOM 10553 H HB   . VAL A 1 80 ? -12.073 2.912   14.261  1.00 0.00 ? 80 VAL A HB   8  
ATOM 10554 H HG11 . VAL A 1 80 ? -13.625 2.534   16.120  1.00 0.00 ? 80 VAL A HG11 8  
ATOM 10555 H HG12 . VAL A 1 80 ? -12.704 3.652   17.154  1.00 0.00 ? 80 VAL A HG12 8  
ATOM 10556 H HG13 . VAL A 1 80 ? -13.584 4.270   15.736  1.00 0.00 ? 80 VAL A HG13 8  
ATOM 10557 H HG21 . VAL A 1 80 ? -10.128 4.398   14.498  1.00 0.00 ? 80 VAL A HG21 8  
ATOM 10558 H HG22 . VAL A 1 80 ? -11.622 5.315   14.795  1.00 0.00 ? 80 VAL A HG22 8  
ATOM 10559 H HG23 . VAL A 1 80 ? -10.608 4.798   16.165  1.00 0.00 ? 80 VAL A HG23 8  
ATOM 10560 N N    . ARG A 1 81 ? -12.036 0.228   14.869  1.00 0.00 ? 81 ARG A N    8  
ATOM 10561 C CA   . ARG A 1 81 ? -12.759 -1.030  14.833  1.00 0.00 ? 81 ARG A CA   8  
ATOM 10562 C C    . ARG A 1 81 ? -12.593 -1.647  13.444  1.00 0.00 ? 81 ARG A C    8  
ATOM 10563 O O    . ARG A 1 81 ? -13.542 -1.482  12.647  1.00 0.00 ? 81 ARG A O    8  
ATOM 10564 C CB   . ARG A 1 81 ? -14.238 -0.780  15.176  1.00 0.00 ? 81 ARG A CB   8  
ATOM 10565 C CG   . ARG A 1 81 ? -15.005 -2.108  15.283  1.00 0.00 ? 81 ARG A CG   8  
ATOM 10566 C CD   . ARG A 1 81 ? -14.520 -2.903  16.503  1.00 0.00 ? 81 ARG A CD   8  
ATOM 10567 N NE   . ARG A 1 81 ? -15.444 -4.002  16.819  1.00 0.00 ? 81 ARG A NE   8  
ATOM 10568 C CZ   . ARG A 1 81 ? -16.603 -3.827  17.483  1.00 0.00 ? 81 ARG A CZ   8  
ATOM 10569 N NH1  . ARG A 1 81 ? -16.986 -2.600  17.865  1.00 0.00 ? 81 ARG A NH1  8  
ATOM 10570 N NH2  . ARG A 1 81 ? -17.376 -4.884  17.761  1.00 0.00 ? 81 ARG A NH2  8  
ATOM 10571 O OXT  . ARG A 1 81 ? -11.418 -1.905  13.104  1.00 0.00 ? 81 ARG A OXT  8  
ATOM 10572 H H    . ARG A 1 81 ? -11.819 0.672   13.989  1.00 0.00 ? 81 ARG A H    8  
ATOM 10573 H HA   . ARG A 1 81 ? -12.327 -1.704  15.571  1.00 0.00 ? 81 ARG A HA   8  
ATOM 10574 H HB2  . ARG A 1 81 ? -14.303 -0.252  16.128  1.00 0.00 ? 81 ARG A HB2  8  
ATOM 10575 H HB3  . ARG A 1 81 ? -14.691 -0.165  14.396  1.00 0.00 ? 81 ARG A HB3  8  
ATOM 10576 H HG2  . ARG A 1 81 ? -16.068 -1.897  15.389  1.00 0.00 ? 81 ARG A HG2  8  
ATOM 10577 H HG3  . ARG A 1 81 ? -14.846 -2.698  14.381  1.00 0.00 ? 81 ARG A HG3  8  
ATOM 10578 H HD2  . ARG A 1 81 ? -13.537 -3.322  16.290  1.00 0.00 ? 81 ARG A HD2  8  
ATOM 10579 H HD3  . ARG A 1 81 ? -14.442 -2.237  17.363  1.00 0.00 ? 81 ARG A HD3  8  
ATOM 10580 H HE   . ARG A 1 81 ? -15.185 -4.930  16.517  1.00 0.00 ? 81 ARG A HE   8  
ATOM 10581 H HH11 . ARG A 1 81 ? -16.414 -1.800  17.640  1.00 0.00 ? 81 ARG A HH11 8  
ATOM 10582 H HH12 . ARG A 1 81 ? -17.847 -2.475  18.377  1.00 0.00 ? 81 ARG A HH12 8  
ATOM 10583 H HH21 . ARG A 1 81 ? -17.091 -5.809  17.474  1.00 0.00 ? 81 ARG A HH21 8  
ATOM 10584 H HH22 . ARG A 1 81 ? -18.246 -4.758  18.259  1.00 0.00 ? 81 ARG A HH22 8  
ATOM 10585 N N    . ALA A 1 1  ? 9.023   25.228  -6.672  1.00 0.00 ? 1  ALA A N    9  
ATOM 10586 C CA   . ALA A 1 1  ? 7.943   26.228  -6.751  1.00 0.00 ? 1  ALA A CA   9  
ATOM 10587 C C    . ALA A 1 1  ? 6.930   25.998  -5.633  1.00 0.00 ? 1  ALA A C    9  
ATOM 10588 O O    . ALA A 1 1  ? 6.976   24.967  -4.961  1.00 0.00 ? 1  ALA A O    9  
ATOM 10589 C CB   . ALA A 1 1  ? 7.253   26.159  -8.116  1.00 0.00 ? 1  ALA A CB   9  
ATOM 10590 H H1   . ALA A 1 1  ? 9.688   25.389  -7.416  1.00 0.00 ? 1  ALA A H1   9  
ATOM 10591 H H2   . ALA A 1 1  ? 9.490   25.308  -5.780  1.00 0.00 ? 1  ALA A H2   9  
ATOM 10592 H H3   . ALA A 1 1  ? 8.631   24.302  -6.763  1.00 0.00 ? 1  ALA A H3   9  
ATOM 10593 H HA   . ALA A 1 1  ? 8.377   27.221  -6.630  1.00 0.00 ? 1  ALA A HA   9  
ATOM 10594 H HB1  . ALA A 1 1  ? 6.487   26.934  -8.178  1.00 0.00 ? 1  ALA A HB1  9  
ATOM 10595 H HB2  . ALA A 1 1  ? 7.990   26.315  -8.905  1.00 0.00 ? 1  ALA A HB2  9  
ATOM 10596 H HB3  . ALA A 1 1  ? 6.788   25.181  -8.241  1.00 0.00 ? 1  ALA A HB3  9  
ATOM 10597 N N    . LEU A 1 2  ? 6.017   26.959  -5.436  1.00 0.00 ? 2  LEU A N    9  
ATOM 10598 C CA   . LEU A 1 2  ? 4.995   26.860  -4.406  1.00 0.00 ? 2  LEU A CA   9  
ATOM 10599 C C    . LEU A 1 2  ? 4.155   25.607  -4.644  1.00 0.00 ? 2  LEU A C    9  
ATOM 10600 O O    . LEU A 1 2  ? 3.437   25.522  -5.639  1.00 0.00 ? 2  LEU A O    9  
ATOM 10601 C CB   . LEU A 1 2  ? 4.125   28.126  -4.439  1.00 0.00 ? 2  LEU A CB   9  
ATOM 10602 C CG   . LEU A 1 2  ? 2.987   28.035  -3.407  1.00 0.00 ? 2  LEU A CG   9  
ATOM 10603 C CD1  . LEU A 1 2  ? 3.562   27.910  -1.991  1.00 0.00 ? 2  LEU A CD1  9  
ATOM 10604 C CD2  . LEU A 1 2  ? 2.127   29.297  -3.493  1.00 0.00 ? 2  LEU A CD2  9  
ATOM 10605 H H    . LEU A 1 2  ? 6.029   27.784  -6.019  1.00 0.00 ? 2  LEU A H    9  
ATOM 10606 H HA   . LEU A 1 2  ? 5.483   26.788  -3.434  1.00 0.00 ? 2  LEU A HA   9  
ATOM 10607 H HB2  . LEU A 1 2  ? 4.746   28.995  -4.214  1.00 0.00 ? 2  LEU A HB2  9  
ATOM 10608 H HB3  . LEU A 1 2  ? 3.696   28.241  -5.435  1.00 0.00 ? 2  LEU A HB3  9  
ATOM 10609 H HG   . LEU A 1 2  ? 2.365   27.165  -3.623  1.00 0.00 ? 2  LEU A HG   9  
ATOM 10610 H HD11 . LEU A 1 2  ? 3.989   26.917  -1.856  1.00 0.00 ? 2  LEU A HD11 9  
ATOM 10611 H HD12 . LEU A 1 2  ? 4.335   28.662  -1.843  1.00 0.00 ? 2  LEU A HD12 9  
ATOM 10612 H HD13 . LEU A 1 2  ? 2.765   28.059  -1.262  1.00 0.00 ? 2  LEU A HD13 9  
ATOM 10613 H HD21 . LEU A 1 2  ? 2.737   30.171  -3.258  1.00 0.00 ? 2  LEU A HD21 9  
ATOM 10614 H HD22 . LEU A 1 2  ? 1.304   29.228  -2.782  1.00 0.00 ? 2  LEU A HD22 9  
ATOM 10615 H HD23 . LEU A 1 2  ? 1.726   29.397  -4.502  1.00 0.00 ? 2  LEU A HD23 9  
ATOM 10616 N N    . SER A 1 3  ? 4.259   24.634  -3.728  1.00 0.00 ? 3  SER A N    9  
ATOM 10617 C CA   . SER A 1 3  ? 3.534   23.370  -3.832  1.00 0.00 ? 3  SER A CA   9  
ATOM 10618 C C    . SER A 1 3  ? 3.845   22.691  -5.171  1.00 0.00 ? 3  SER A C    9  
ATOM 10619 O O    . SER A 1 3  ? 2.981   22.035  -5.751  1.00 0.00 ? 3  SER A O    9  
ATOM 10620 C CB   . SER A 1 3  ? 2.029   23.623  -3.678  1.00 0.00 ? 3  SER A CB   9  
ATOM 10621 O OG   . SER A 1 3  ? 1.788   24.335  -2.484  1.00 0.00 ? 3  SER A OG   9  
ATOM 10622 H H    . SER A 1 3  ? 4.863   24.766  -2.930  1.00 0.00 ? 3  SER A H    9  
ATOM 10623 H HA   . SER A 1 3  ? 3.862   22.714  -3.026  1.00 0.00 ? 3  SER A HA   9  
ATOM 10624 H HB2  . SER A 1 3  ? 1.663   24.202  -4.527  1.00 0.00 ? 3  SER A HB2  9  
ATOM 10625 H HB3  . SER A 1 3  ? 1.503   22.668  -3.641  1.00 0.00 ? 3  SER A HB3  9  
ATOM 10626 H HG   . SER A 1 3  ? 2.213   25.193  -2.548  1.00 0.00 ? 3  SER A HG   9  
ATOM 10627 N N    . GLY A 1 4  ? 5.086   22.852  -5.656  1.00 0.00 ? 4  GLY A N    9  
ATOM 10628 C CA   . GLY A 1 4  ? 5.508   22.261  -6.915  1.00 0.00 ? 4  GLY A CA   9  
ATOM 10629 C C    . GLY A 1 4  ? 5.840   20.786  -6.716  1.00 0.00 ? 4  GLY A C    9  
ATOM 10630 O O    . GLY A 1 4  ? 7.003   20.401  -6.801  1.00 0.00 ? 4  GLY A O    9  
ATOM 10631 H H    . GLY A 1 4  ? 5.758   23.403  -5.138  1.00 0.00 ? 4  GLY A H    9  
ATOM 10632 H HA2  . GLY A 1 4  ? 4.709   22.357  -7.651  1.00 0.00 ? 4  GLY A HA2  9  
ATOM 10633 H HA3  . GLY A 1 4  ? 6.393   22.784  -7.277  1.00 0.00 ? 4  GLY A HA3  9  
ATOM 10634 N N    . SER A 1 5  ? 4.801   19.975  -6.449  1.00 0.00 ? 5  SER A N    9  
ATOM 10635 C CA   . SER A 1 5  ? 4.937   18.533  -6.227  1.00 0.00 ? 5  SER A CA   9  
ATOM 10636 C C    . SER A 1 5  ? 5.605   18.263  -4.876  1.00 0.00 ? 5  SER A C    9  
ATOM 10637 O O    . SER A 1 5  ? 6.588   18.906  -4.520  1.00 0.00 ? 5  SER A O    9  
ATOM 10638 C CB   . SER A 1 5  ? 5.728   17.882  -7.371  1.00 0.00 ? 5  SER A CB   9  
ATOM 10639 O OG   . SER A 1 5  ? 5.253   18.361  -8.614  1.00 0.00 ? 5  SER A OG   9  
ATOM 10640 H H    . SER A 1 5  ? 3.872   20.373  -6.394  1.00 0.00 ? 5  SER A H    9  
ATOM 10641 H HA   . SER A 1 5  ? 3.938   18.097  -6.212  1.00 0.00 ? 5  SER A HA   9  
ATOM 10642 H HB2  . SER A 1 5  ? 6.787   18.119  -7.271  1.00 0.00 ? 5  SER A HB2  9  
ATOM 10643 H HB3  . SER A 1 5  ? 5.598   16.801  -7.329  1.00 0.00 ? 5  SER A HB3  9  
ATOM 10644 H HG   . SER A 1 5  ? 4.309   18.197  -8.664  1.00 0.00 ? 5  SER A HG   9  
ATOM 10645 N N    . SER A 1 6  ? 5.057   17.301  -4.123  1.00 0.00 ? 6  SER A N    9  
ATOM 10646 C CA   . SER A 1 6  ? 5.593   16.939  -2.818  1.00 0.00 ? 6  SER A CA   9  
ATOM 10647 C C    . SER A 1 6  ? 5.142   15.526  -2.457  1.00 0.00 ? 6  SER A C    9  
ATOM 10648 O O    . SER A 1 6  ? 5.970   14.664  -2.167  1.00 0.00 ? 6  SER A O    9  
ATOM 10649 C CB   . SER A 1 6  ? 5.118   17.954  -1.771  1.00 0.00 ? 6  SER A CB   9  
ATOM 10650 O OG   . SER A 1 6  ? 5.689   17.645  -0.516  1.00 0.00 ? 6  SER A OG   9  
ATOM 10651 H H    . SER A 1 6  ? 4.247   16.804  -4.462  1.00 0.00 ? 6  SER A H    9  
ATOM 10652 H HA   . SER A 1 6  ? 6.683   16.961  -2.862  1.00 0.00 ? 6  SER A HA   9  
ATOM 10653 H HB2  . SER A 1 6  ? 5.426   18.955  -2.070  1.00 0.00 ? 6  SER A HB2  9  
ATOM 10654 H HB3  . SER A 1 6  ? 4.030   17.919  -1.694  1.00 0.00 ? 6  SER A HB3  9  
ATOM 10655 H HG   . SER A 1 6  ? 5.339   16.802  -0.218  1.00 0.00 ? 6  SER A HG   9  
ATOM 10656 N N    . GLY A 1 7  ? 3.825   15.288  -2.477  1.00 0.00 ? 7  GLY A N    9  
ATOM 10657 C CA   . GLY A 1 7  ? 3.268   13.986  -2.147  1.00 0.00 ? 7  GLY A CA   9  
ATOM 10658 C C    . GLY A 1 7  ? 3.294   13.061  -3.365  1.00 0.00 ? 7  GLY A C    9  
ATOM 10659 O O    . GLY A 1 7  ? 2.308   12.384  -3.645  1.00 0.00 ? 7  GLY A O    9  
ATOM 10660 H H    . GLY A 1 7  ? 3.187   16.030  -2.727  1.00 0.00 ? 7  GLY A H    9  
ATOM 10661 H HA2  . GLY A 1 7  ? 3.849   13.536  -1.342  1.00 0.00 ? 7  GLY A HA2  9  
ATOM 10662 H HA3  . GLY A 1 7  ? 2.237   14.112  -1.815  1.00 0.00 ? 7  GLY A HA3  9  
ATOM 10663 N N    . TYR A 1 8  ? 4.428   13.028  -4.082  1.00 0.00 ? 8  TYR A N    9  
ATOM 10664 C CA   . TYR A 1 8  ? 4.583   12.177  -5.259  1.00 0.00 ? 8  TYR A CA   9  
ATOM 10665 C C    . TYR A 1 8  ? 5.132   10.808  -4.854  1.00 0.00 ? 8  TYR A C    9  
ATOM 10666 O O    . TYR A 1 8  ? 5.490   10.000  -5.708  1.00 0.00 ? 8  TYR A O    9  
ATOM 10667 C CB   . TYR A 1 8  ? 5.517   12.864  -6.263  1.00 0.00 ? 8  TYR A CB   9  
ATOM 10668 C CG   . TYR A 1 8  ? 6.890   13.183  -5.697  1.00 0.00 ? 8  TYR A CG   9  
ATOM 10669 C CD1  . TYR A 1 8  ? 7.908   12.210  -5.714  1.00 0.00 ? 8  TYR A CD1  9  
ATOM 10670 C CD2  . TYR A 1 8  ? 7.148   14.454  -5.154  1.00 0.00 ? 8  TYR A CD2  9  
ATOM 10671 C CE1  . TYR A 1 8  ? 9.175   12.510  -5.187  1.00 0.00 ? 8  TYR A CE1  9  
ATOM 10672 C CE2  . TYR A 1 8  ? 8.414   14.753  -4.627  1.00 0.00 ? 8  TYR A CE2  9  
ATOM 10673 C CZ   . TYR A 1 8  ? 9.429   13.780  -4.643  1.00 0.00 ? 8  TYR A CZ   9  
ATOM 10674 O OH   . TYR A 1 8  ? 10.659  14.067  -4.130  1.00 0.00 ? 8  TYR A OH   9  
ATOM 10675 H H    . TYR A 1 8  ? 5.209   13.606  -3.803  1.00 0.00 ? 8  TYR A H    9  
ATOM 10676 H HA   . TYR A 1 8  ? 3.611   12.035  -5.721  1.00 0.00 ? 8  TYR A HA   9  
ATOM 10677 H HB2  . TYR A 1 8  ? 5.640   12.212  -7.130  1.00 0.00 ? 8  TYR A HB2  9  
ATOM 10678 H HB3  . TYR A 1 8  ? 5.051   13.793  -6.593  1.00 0.00 ? 8  TYR A HB3  9  
ATOM 10679 H HD1  . TYR A 1 8  ? 7.717   11.234  -6.131  1.00 0.00 ? 8  TYR A HD1  9  
ATOM 10680 H HD2  . TYR A 1 8  ? 6.372   15.203  -5.141  1.00 0.00 ? 8  TYR A HD2  9  
ATOM 10681 H HE1  . TYR A 1 8  ? 9.954   11.763  -5.200  1.00 0.00 ? 8  TYR A HE1  9  
ATOM 10682 H HE2  . TYR A 1 8  ? 8.609   15.729  -4.210  1.00 0.00 ? 8  TYR A HE2  9  
ATOM 10683 H HH   . TYR A 1 8  ? 10.730  14.968  -3.807  1.00 0.00 ? 8  TYR A HH   9  
ATOM 10684 N N    . LYS A 1 9  ? 5.194   10.561  -3.549  1.00 0.00 ? 9  LYS A N    9  
ATOM 10685 C CA   . LYS A 1 9  ? 5.707   9.319   -3.000  1.00 0.00 ? 9  LYS A CA   9  
ATOM 10686 C C    . LYS A 1 9  ? 5.025   9.059   -1.668  1.00 0.00 ? 9  LYS A C    9  
ATOM 10687 O O    . LYS A 1 9  ? 4.338   8.058   -1.500  1.00 0.00 ? 9  LYS A O    9  
ATOM 10688 C CB   . LYS A 1 9  ? 7.229   9.438   -2.809  1.00 0.00 ? 9  LYS A CB   9  
ATOM 10689 C CG   . LYS A 1 9  ? 7.959   8.676   -3.919  1.00 0.00 ? 9  LYS A CG   9  
ATOM 10690 C CD   . LYS A 1 9  ? 9.458   9.020   -3.905  1.00 0.00 ? 9  LYS A CD   9  
ATOM 10691 C CE   . LYS A 1 9  ? 10.246  7.963   -3.121  1.00 0.00 ? 9  LYS A CE   9  
ATOM 10692 N NZ   . LYS A 1 9  ? 9.894   7.975   -1.691  1.00 0.00 ? 9  LYS A NZ   9  
ATOM 10693 H H    . LYS A 1 9  ? 4.875   11.264  -2.906  1.00 0.00 ? 9  LYS A H    9  
ATOM 10694 H HA   . LYS A 1 9  ? 5.485   8.497   -3.683  1.00 0.00 ? 9  LYS A HA   9  
ATOM 10695 H HB2  . LYS A 1 9  ? 7.516   10.490  -2.840  1.00 0.00 ? 9  LYS A HB2  9  
ATOM 10696 H HB3  . LYS A 1 9  ? 7.505   9.019   -1.842  1.00 0.00 ? 9  LYS A HB3  9  
ATOM 10697 H HG2  . LYS A 1 9  ? 7.826   7.606   -3.772  1.00 0.00 ? 9  LYS A HG2  9  
ATOM 10698 H HG3  . LYS A 1 9  ? 7.539   8.957   -4.883  1.00 0.00 ? 9  LYS A HG3  9  
ATOM 10699 H HD2  . LYS A 1 9  ? 9.827   9.047   -4.931  1.00 0.00 ? 9  LYS A HD2  9  
ATOM 10700 H HD3  . LYS A 1 9  ? 9.605   9.998   -3.446  1.00 0.00 ? 9  LYS A HD3  9  
ATOM 10701 H HE2  . LYS A 1 9  ? 10.035  6.976   -3.535  1.00 0.00 ? 9  LYS A HE2  9  
ATOM 10702 H HE3  . LYS A 1 9  ? 11.313  8.168   -3.224  1.00 0.00 ? 9  LYS A HE3  9  
ATOM 10703 H HZ1  . LYS A 1 9  ? 8.927   7.706   -1.581  1.00 0.00 ? 9  LYS A HZ1  9  
ATOM 10704 H HZ2  . LYS A 1 9  ? 10.030  8.903   -1.317  1.00 0.00 ? 9  LYS A HZ2  9  
ATOM 10705 H HZ3  . LYS A 1 9  ? 10.482  7.321   -1.194  1.00 0.00 ? 9  LYS A HZ3  9  
ATOM 10706 N N    . PHE A 1 10 ? 5.227   9.974   -0.723  1.00 0.00 ? 10 PHE A N    9  
ATOM 10707 C CA   . PHE A 1 10 ? 4.666   9.856   0.610   1.00 0.00 ? 10 PHE A CA   9  
ATOM 10708 C C    . PHE A 1 10 ? 3.142   9.943   0.548   1.00 0.00 ? 10 PHE A C    9  
ATOM 10709 O O    . PHE A 1 10 ? 2.450   9.179   1.211   1.00 0.00 ? 10 PHE A O    9  
ATOM 10710 C CB   . PHE A 1 10 ? 5.248   10.965  1.496   1.00 0.00 ? 10 PHE A CB   9  
ATOM 10711 C CG   . PHE A 1 10 ? 6.674   11.322  1.129   1.00 0.00 ? 10 PHE A CG   9  
ATOM 10712 C CD1  . PHE A 1 10 ? 7.716   10.414  1.392   1.00 0.00 ? 10 PHE A CD1  9  
ATOM 10713 C CD2  . PHE A 1 10 ? 6.953   12.549  0.498   1.00 0.00 ? 10 PHE A CD2  9  
ATOM 10714 C CE1  . PHE A 1 10 ? 9.035   10.735  1.025   1.00 0.00 ? 10 PHE A CE1  9  
ATOM 10715 C CE2  . PHE A 1 10 ? 8.270   12.867  0.132   1.00 0.00 ? 10 PHE A CE2  9  
ATOM 10716 C CZ   . PHE A 1 10 ? 9.312   11.961  0.394   1.00 0.00 ? 10 PHE A CZ   9  
ATOM 10717 H H    . PHE A 1 10 ? 5.796   10.782  -0.930  1.00 0.00 ? 10 PHE A H    9  
ATOM 10718 H HA   . PHE A 1 10 ? 4.951   8.887   1.022   1.00 0.00 ? 10 PHE A HA   9  
ATOM 10719 H HB2  . PHE A 1 10 ? 4.627   11.855  1.399   1.00 0.00 ? 10 PHE A HB2  9  
ATOM 10720 H HB3  . PHE A 1 10 ? 5.222   10.634  2.535   1.00 0.00 ? 10 PHE A HB3  9  
ATOM 10721 H HD1  . PHE A 1 10 ? 7.502   9.468   1.869   1.00 0.00 ? 10 PHE A HD1  9  
ATOM 10722 H HD2  . PHE A 1 10 ? 6.153   13.245  0.291   1.00 0.00 ? 10 PHE A HD2  9  
ATOM 10723 H HE1  . PHE A 1 10 ? 9.836   10.038  1.227   1.00 0.00 ? 10 PHE A HE1  9  
ATOM 10724 H HE2  . PHE A 1 10 ? 8.483   13.809  -0.356  1.00 0.00 ? 10 PHE A HE2  9  
ATOM 10725 H HZ   . PHE A 1 10 ? 10.324  12.206  0.108   1.00 0.00 ? 10 PHE A HZ   9  
ATOM 10726 N N    . GLY A 1 11 ? 2.623   10.878  -0.259  1.00 0.00 ? 11 GLY A N    9  
ATOM 10727 C CA   . GLY A 1 11 ? 1.188   11.051  -0.417  1.00 0.00 ? 11 GLY A CA   9  
ATOM 10728 C C    . GLY A 1 11 ? 0.577   9.800   -1.041  1.00 0.00 ? 11 GLY A C    9  
ATOM 10729 O O    . GLY A 1 11 ? -0.444  9.300   -0.569  1.00 0.00 ? 11 GLY A O    9  
ATOM 10730 H H    . GLY A 1 11 ? 3.237   11.484  -0.781  1.00 0.00 ? 11 GLY A H    9  
ATOM 10731 H HA2  . GLY A 1 11 ? 0.734   11.229  0.558   1.00 0.00 ? 11 GLY A HA2  9  
ATOM 10732 H HA3  . GLY A 1 11 ? 0.996   11.906  -1.066  1.00 0.00 ? 11 GLY A HA3  9  
ATOM 10733 N N    . VAL A 1 12 ? 1.210   9.292   -2.105  1.00 0.00 ? 12 VAL A N    9  
ATOM 10734 C CA   . VAL A 1 12 ? 0.741   8.096   -2.786  1.00 0.00 ? 12 VAL A CA   9  
ATOM 10735 C C    . VAL A 1 12 ? 0.752   6.918   -1.807  1.00 0.00 ? 12 VAL A C    9  
ATOM 10736 O O    . VAL A 1 12 ? -0.213  6.163   -1.729  1.00 0.00 ? 12 VAL A O    9  
ATOM 10737 C CB   . VAL A 1 12 ? 1.635   7.815   -4.009  1.00 0.00 ? 12 VAL A CB   9  
ATOM 10738 C CG1  . VAL A 1 12 ? 1.040   6.672   -4.833  1.00 0.00 ? 12 VAL A CG1  9  
ATOM 10739 C CG2  . VAL A 1 12 ? 1.722   9.067   -4.893  1.00 0.00 ? 12 VAL A CG2  9  
ATOM 10740 H H    . VAL A 1 12 ? 2.042   9.744   -2.450  1.00 0.00 ? 12 VAL A H    9  
ATOM 10741 H HA   . VAL A 1 12 ? -0.282  8.263   -3.127  1.00 0.00 ? 12 VAL A HA   9  
ATOM 10742 H HB   . VAL A 1 12 ? 2.637   7.539   -3.674  1.00 0.00 ? 12 VAL A HB   9  
ATOM 10743 H HG11 . VAL A 1 12 ? 0.078   6.983   -5.238  1.00 0.00 ? 12 VAL A HG11 9  
ATOM 10744 H HG12 . VAL A 1 12 ? 1.714   6.427   -5.654  1.00 0.00 ? 12 VAL A HG12 9  
ATOM 10745 H HG13 . VAL A 1 12 ? 0.904   5.795   -4.202  1.00 0.00 ? 12 VAL A HG13 9  
ATOM 10746 H HG21 . VAL A 1 12 ? 0.717   9.438   -5.098  1.00 0.00 ? 12 VAL A HG21 9  
ATOM 10747 H HG22 . VAL A 1 12 ? 2.212   8.813   -5.833  1.00 0.00 ? 12 VAL A HG22 9  
ATOM 10748 H HG23 . VAL A 1 12 ? 2.296   9.837   -4.383  1.00 0.00 ? 12 VAL A HG23 9  
ATOM 10749 N N    . LEU A 1 13 ? 1.850   6.770   -1.056  1.00 0.00 ? 13 LEU A N    9  
ATOM 10750 C CA   . LEU A 1 13 ? 1.990   5.699   -0.079  1.00 0.00 ? 13 LEU A CA   9  
ATOM 10751 C C    . LEU A 1 13 ? 0.884   5.800   0.971   1.00 0.00 ? 13 LEU A C    9  
ATOM 10752 O O    . LEU A 1 13 ? 0.262   4.798   1.312   1.00 0.00 ? 13 LEU A O    9  
ATOM 10753 C CB   . LEU A 1 13 ? 3.376   5.797   0.567   1.00 0.00 ? 13 LEU A CB   9  
ATOM 10754 C CG   . LEU A 1 13 ? 3.555   4.719   1.647   1.00 0.00 ? 13 LEU A CG   9  
ATOM 10755 C CD1  . LEU A 1 13 ? 3.391   3.326   1.031   1.00 0.00 ? 13 LEU A CD1  9  
ATOM 10756 C CD2  . LEU A 1 13 ? 4.953   4.848   2.255   1.00 0.00 ? 13 LEU A CD2  9  
ATOM 10757 H H    . LEU A 1 13 ? 2.617   7.421   -1.162  1.00 0.00 ? 13 LEU A H    9  
ATOM 10758 H HA   . LEU A 1 13 ? 1.905   4.744   -0.594  1.00 0.00 ? 13 LEU A HA   9  
ATOM 10759 H HB2  . LEU A 1 13 ? 4.137   5.665   -0.200  1.00 0.00 ? 13 LEU A HB2  9  
ATOM 10760 H HB3  . LEU A 1 13 ? 3.493   6.781   1.021   1.00 0.00 ? 13 LEU A HB3  9  
ATOM 10761 H HG   . LEU A 1 13 ? 2.810   4.857   2.431   1.00 0.00 ? 13 LEU A HG   9  
ATOM 10762 H HD11 . LEU A 1 13 ? 3.819   2.579   1.699   1.00 0.00 ? 13 LEU A HD11 9  
ATOM 10763 H HD12 . LEU A 1 13 ? 2.333   3.113   0.885   1.00 0.00 ? 13 LEU A HD12 9  
ATOM 10764 H HD13 . LEU A 1 13 ? 3.903   3.289   0.070   1.00 0.00 ? 13 LEU A HD13 9  
ATOM 10765 H HD21 . LEU A 1 13 ? 5.052   5.822   2.734   1.00 0.00 ? 13 LEU A HD21 9  
ATOM 10766 H HD22 . LEU A 1 13 ? 5.702   4.753   1.470   1.00 0.00 ? 13 LEU A HD22 9  
ATOM 10767 H HD23 . LEU A 1 13 ? 5.103   4.063   2.996   1.00 0.00 ? 13 LEU A HD23 9  
ATOM 10768 N N    . ALA A 1 14 ? 0.641   7.010   1.482   1.00 0.00 ? 14 ALA A N    9  
ATOM 10769 C CA   . ALA A 1 14 ? -0.389  7.232   2.486   1.00 0.00 ? 14 ALA A CA   9  
ATOM 10770 C C    . ALA A 1 14 ? -1.752  6.815   1.937   1.00 0.00 ? 14 ALA A C    9  
ATOM 10771 O O    . ALA A 1 14 ? -2.552  6.221   2.657   1.00 0.00 ? 14 ALA A O    9  
ATOM 10772 C CB   . ALA A 1 14 ? -0.395  8.708   2.890   1.00 0.00 ? 14 ALA A CB   9  
ATOM 10773 H H    . ALA A 1 14 ? 1.184   7.805   1.169   1.00 0.00 ? 14 ALA A H    9  
ATOM 10774 H HA   . ALA A 1 14 ? -0.162  6.626   3.366   1.00 0.00 ? 14 ALA A HA   9  
ATOM 10775 H HB1  . ALA A 1 14 ? -0.618  9.324   2.020   1.00 0.00 ? 14 ALA A HB1  9  
ATOM 10776 H HB2  . ALA A 1 14 ? -1.156  8.871   3.654   1.00 0.00 ? 14 ALA A HB2  9  
ATOM 10777 H HB3  . ALA A 1 14 ? 0.582   8.980   3.288   1.00 0.00 ? 14 ALA A HB3  9  
ATOM 10778 N N    . LYS A 1 15 ? -2.017  7.122   0.658   1.00 0.00 ? 15 LYS A N    9  
ATOM 10779 C CA   . LYS A 1 15 ? -3.270  6.768   0.026   1.00 0.00 ? 15 LYS A CA   9  
ATOM 10780 C C    . LYS A 1 15 ? -3.418  5.248   -0.011  1.00 0.00 ? 15 LYS A C    9  
ATOM 10781 O O    . LYS A 1 15 ? -4.495  4.728   0.265   1.00 0.00 ? 15 LYS A O    9  
ATOM 10782 C CB   . LYS A 1 15 ? -3.300  7.368   -1.382  1.00 0.00 ? 15 LYS A CB   9  
ATOM 10783 C CG   . LYS A 1 15 ? -4.696  7.213   -1.993  1.00 0.00 ? 15 LYS A CG   9  
ATOM 10784 C CD   . LYS A 1 15 ? -5.037  8.454   -2.828  1.00 0.00 ? 15 LYS A CD   9  
ATOM 10785 C CE   . LYS A 1 15 ? -4.029  8.638   -3.973  1.00 0.00 ? 15 LYS A CE   9  
ATOM 10786 N NZ   . LYS A 1 15 ? -4.014  7.473   -4.873  1.00 0.00 ? 15 LYS A NZ   9  
ATOM 10787 H H    . LYS A 1 15 ? -1.329  7.612   0.104   1.00 0.00 ? 15 LYS A H    9  
ATOM 10788 H HA   . LYS A 1 15 ? -4.089  7.191   0.609   1.00 0.00 ? 15 LYS A HA   9  
ATOM 10789 H HB2  . LYS A 1 15 ? -3.048  8.428   -1.321  1.00 0.00 ? 15 LYS A HB2  9  
ATOM 10790 H HB3  . LYS A 1 15 ? -2.571  6.860   -2.012  1.00 0.00 ? 15 LYS A HB3  9  
ATOM 10791 H HG2  . LYS A 1 15 ? -4.723  6.324   -2.623  1.00 0.00 ? 15 LYS A HG2  9  
ATOM 10792 H HG3  . LYS A 1 15 ? -5.433  7.108   -1.194  1.00 0.00 ? 15 LYS A HG3  9  
ATOM 10793 H HD2  . LYS A 1 15 ? -6.040  8.345   -3.243  1.00 0.00 ? 15 LYS A HD2  9  
ATOM 10794 H HD3  . LYS A 1 15 ? -5.010  9.334   -2.183  1.00 0.00 ? 15 LYS A HD3  9  
ATOM 10795 H HE2  . LYS A 1 15 ? -4.305  9.523   -4.547  1.00 0.00 ? 15 LYS A HE2  9  
ATOM 10796 H HE3  . LYS A 1 15 ? -3.032  8.782   -3.557  1.00 0.00 ? 15 LYS A HE3  9  
ATOM 10797 H HZ1  . LYS A 1 15 ? -3.673  6.664   -4.375  1.00 0.00 ? 15 LYS A HZ1  9  
ATOM 10798 H HZ2  . LYS A 1 15 ? -4.948  7.290   -5.213  1.00 0.00 ? 15 LYS A HZ2  9  
ATOM 10799 H HZ3  . LYS A 1 15 ? -3.403  7.659   -5.657  1.00 0.00 ? 15 LYS A HZ3  9  
ATOM 10800 N N    . ILE A 1 16 ? -2.332  4.538   -0.344  1.00 0.00 ? 16 ILE A N    9  
ATOM 10801 C CA   . ILE A 1 16 ? -2.347  3.081   -0.398  1.00 0.00 ? 16 ILE A CA   9  
ATOM 10802 C C    . ILE A 1 16 ? -2.611  2.519   0.995   1.00 0.00 ? 16 ILE A C    9  
ATOM 10803 O O    . ILE A 1 16 ? -3.497  1.693   1.168   1.00 0.00 ? 16 ILE A O    9  
ATOM 10804 C CB   . ILE A 1 16 ? -1.010  2.564   -0.950  1.00 0.00 ? 16 ILE A CB   9  
ATOM 10805 C CG1  . ILE A 1 16 ? -0.860  2.987   -2.417  1.00 0.00 ? 16 ILE A CG1  9  
ATOM 10806 C CG2  . ILE A 1 16 ? -0.971  1.034   -0.842  1.00 0.00 ? 16 ILE A CG2  9  
ATOM 10807 C CD1  . ILE A 1 16 ? 0.583   2.775   -2.881  1.00 0.00 ? 16 ILE A CD1  9  
ATOM 10808 H H    . ILE A 1 16 ? -1.466  5.018   -0.565  1.00 0.00 ? 16 ILE A H    9  
ATOM 10809 H HA   . ILE A 1 16 ? -3.148  2.762   -1.060  1.00 0.00 ? 16 ILE A HA   9  
ATOM 10810 H HB   . ILE A 1 16 ? -0.191  2.985   -0.367  1.00 0.00 ? 16 ILE A HB   9  
ATOM 10811 H HG12 . ILE A 1 16 ? -1.531  2.394   -3.041  1.00 0.00 ? 16 ILE A HG12 9  
ATOM 10812 H HG13 . ILE A 1 16 ? -1.117  4.041   -2.517  1.00 0.00 ? 16 ILE A HG13 9  
ATOM 10813 H HG21 . ILE A 1 16 ? -1.880  0.616   -1.275  1.00 0.00 ? 16 ILE A HG21 9  
ATOM 10814 H HG22 . ILE A 1 16 ? -0.106  0.648   -1.376  1.00 0.00 ? 16 ILE A HG22 9  
ATOM 10815 H HG23 . ILE A 1 16 ? -0.903  0.743   0.206   1.00 0.00 ? 16 ILE A HG23 9  
ATOM 10816 H HD11 . ILE A 1 16 ? 0.738   3.286   -3.830  1.00 0.00 ? 16 ILE A HD11 9  
ATOM 10817 H HD12 . ILE A 1 16 ? 1.269   3.180   -2.138  1.00 0.00 ? 16 ILE A HD12 9  
ATOM 10818 H HD13 . ILE A 1 16 ? 0.776   1.711   -3.010  1.00 0.00 ? 16 ILE A HD13 9  
ATOM 10819 N N    . VAL A 1 17 ? -1.835  2.967   1.983   1.00 0.00 ? 17 VAL A N    9  
ATOM 10820 C CA   . VAL A 1 17 ? -1.977  2.508   3.355   1.00 0.00 ? 17 VAL A CA   9  
ATOM 10821 C C    . VAL A 1 17 ? -3.410  2.736   3.840   1.00 0.00 ? 17 VAL A C    9  
ATOM 10822 O O    . VAL A 1 17 ? -4.005  1.850   4.449   1.00 0.00 ? 17 VAL A O    9  
ATOM 10823 C CB   . VAL A 1 17 ? -0.961  3.254   4.235   1.00 0.00 ? 17 VAL A CB   9  
ATOM 10824 C CG1  . VAL A 1 17 ? -1.354  3.161   5.711   1.00 0.00 ? 17 VAL A CG1  9  
ATOM 10825 C CG2  . VAL A 1 17 ? 0.423   2.630   4.043   1.00 0.00 ? 17 VAL A CG2  9  
ATOM 10826 H H    . VAL A 1 17 ? -1.118  3.651   1.780   1.00 0.00 ? 17 VAL A H    9  
ATOM 10827 H HA   . VAL A 1 17 ? -1.761  1.439   3.394   1.00 0.00 ? 17 VAL A HA   9  
ATOM 10828 H HB   . VAL A 1 17 ? -0.927  4.303   3.939   1.00 0.00 ? 17 VAL A HB   9  
ATOM 10829 H HG11 . VAL A 1 17 ? -0.545  3.555   6.325   1.00 0.00 ? 17 VAL A HG11 9  
ATOM 10830 H HG12 . VAL A 1 17 ? -2.256  3.746   5.888   1.00 0.00 ? 17 VAL A HG12 9  
ATOM 10831 H HG13 . VAL A 1 17 ? -1.536  2.119   5.977   1.00 0.00 ? 17 VAL A HG13 9  
ATOM 10832 H HG21 . VAL A 1 17 ? 0.680   2.630   2.983   1.00 0.00 ? 17 VAL A HG21 9  
ATOM 10833 H HG22 . VAL A 1 17 ? 0.414   1.604   4.414   1.00 0.00 ? 17 VAL A HG22 9  
ATOM 10834 H HG23 . VAL A 1 17 ? 1.162   3.209   4.595   1.00 0.00 ? 17 VAL A HG23 9  
ATOM 10835 N N    . ASN A 1 18 ? -3.960  3.923   3.568   1.00 0.00 ? 18 ASN A N    9  
ATOM 10836 C CA   . ASN A 1 18 ? -5.309  4.263   3.991   1.00 0.00 ? 18 ASN A CA   9  
ATOM 10837 C C    . ASN A 1 18 ? -6.322  3.351   3.299   1.00 0.00 ? 18 ASN A C    9  
ATOM 10838 O O    . ASN A 1 18 ? -7.236  2.840   3.942   1.00 0.00 ? 18 ASN A O    9  
ATOM 10839 C CB   . ASN A 1 18 ? -5.587  5.731   3.655   1.00 0.00 ? 18 ASN A CB   9  
ATOM 10840 C CG   . ASN A 1 18 ? -7.014  6.115   4.031   1.00 0.00 ? 18 ASN A CG   9  
ATOM 10841 O OD1  . ASN A 1 18 ? -7.906  6.099   3.187   1.00 0.00 ? 18 ASN A OD1  9  
ATOM 10842 N ND2  . ASN A 1 18 ? -7.228  6.462   5.299   1.00 0.00 ? 18 ASN A ND2  9  
ATOM 10843 H H    . ASN A 1 18 ? -3.428  4.616   3.055   1.00 0.00 ? 18 ASN A H    9  
ATOM 10844 H HA   . ASN A 1 18 ? -5.386  4.125   5.073   1.00 0.00 ? 18 ASN A HA   9  
ATOM 10845 H HB2  . ASN A 1 18 ? -4.888  6.363   4.202   1.00 0.00 ? 18 ASN A HB2  9  
ATOM 10846 H HB3  . ASN A 1 18 ? -5.446  5.887   2.585   1.00 0.00 ? 18 ASN A HB3  9  
ATOM 10847 H HD21 . ASN A 1 18 ? -6.463  6.471   5.956   1.00 0.00 ? 18 ASN A HD21 9  
ATOM 10848 H HD22 . ASN A 1 18 ? -8.158  6.715   5.601   1.00 0.00 ? 18 ASN A HD22 9  
ATOM 10849 N N    . TYR A 1 19 ? -6.157  3.149   1.988   1.00 0.00 ? 19 TYR A N    9  
ATOM 10850 C CA   . TYR A 1 19 ? -7.055  2.304   1.218   1.00 0.00 ? 19 TYR A CA   9  
ATOM 10851 C C    . TYR A 1 19 ? -7.020  0.870   1.760   1.00 0.00 ? 19 TYR A C    9  
ATOM 10852 O O    . TYR A 1 19 ? -8.057  0.328   2.136   1.00 0.00 ? 19 TYR A O    9  
ATOM 10853 C CB   . TYR A 1 19 ? -6.651  2.341   -0.263  1.00 0.00 ? 19 TYR A CB   9  
ATOM 10854 C CG   . TYR A 1 19 ? -6.848  1.016   -0.959  1.00 0.00 ? 19 TYR A CG   9  
ATOM 10855 C CD1  . TYR A 1 19 ? -8.139  0.480   -1.095  1.00 0.00 ? 19 TYR A CD1  9  
ATOM 10856 C CD2  . TYR A 1 19 ? -5.738  0.301   -1.431  1.00 0.00 ? 19 TYR A CD2  9  
ATOM 10857 C CE1  . TYR A 1 19 ? -8.315  -0.772  -1.695  1.00 0.00 ? 19 TYR A CE1  9  
ATOM 10858 C CE2  . TYR A 1 19 ? -5.916  -0.952  -2.031  1.00 0.00 ? 19 TYR A CE2  9  
ATOM 10859 C CZ   . TYR A 1 19 ? -7.200  -1.492  -2.162  1.00 0.00 ? 19 TYR A CZ   9  
ATOM 10860 O OH   . TYR A 1 19 ? -7.359  -2.716  -2.738  1.00 0.00 ? 19 TYR A OH   9  
ATOM 10861 H H    . TYR A 1 19 ? -5.387  3.595   1.505   1.00 0.00 ? 19 TYR A H    9  
ATOM 10862 H HA   . TYR A 1 19 ? -8.071  2.690   1.315   1.00 0.00 ? 19 TYR A HA   9  
ATOM 10863 H HB2  . TYR A 1 19 ? -7.247  3.100   -0.773  1.00 0.00 ? 19 TYR A HB2  9  
ATOM 10864 H HB3  . TYR A 1 19 ? -5.600  2.616   -0.335  1.00 0.00 ? 19 TYR A HB3  9  
ATOM 10865 H HD1  . TYR A 1 19 ? -8.993  1.027   -0.725  1.00 0.00 ? 19 TYR A HD1  9  
ATOM 10866 H HD2  . TYR A 1 19 ? -4.745  0.709   -1.322  1.00 0.00 ? 19 TYR A HD2  9  
ATOM 10867 H HE1  . TYR A 1 19 ? -9.303  -1.184  -1.788  1.00 0.00 ? 19 TYR A HE1  9  
ATOM 10868 H HE2  . TYR A 1 19 ? -5.066  -1.503  -2.384  1.00 0.00 ? 19 TYR A HE2  9  
ATOM 10869 H HH   . TYR A 1 19 ? -8.238  -2.848  -3.113  1.00 0.00 ? 19 TYR A HH   9  
ATOM 10870 N N    . MET A 1 20 ? -5.828  0.259   1.789   1.00 0.00 ? 20 MET A N    9  
ATOM 10871 C CA   . MET A 1 20 ? -5.663  -1.109  2.263   1.00 0.00 ? 20 MET A CA   9  
ATOM 10872 C C    . MET A 1 20 ? -6.224  -1.244  3.674   1.00 0.00 ? 20 MET A C    9  
ATOM 10873 O O    . MET A 1 20 ? -6.857  -2.243  3.991   1.00 0.00 ? 20 MET A O    9  
ATOM 10874 C CB   . MET A 1 20 ? -4.180  -1.495  2.226   1.00 0.00 ? 20 MET A CB   9  
ATOM 10875 C CG   . MET A 1 20 ? -3.709  -1.623  0.775   1.00 0.00 ? 20 MET A CG   9  
ATOM 10876 S SD   . MET A 1 20 ? -1.976  -2.125  0.597   1.00 0.00 ? 20 MET A SD   9  
ATOM 10877 C CE   . MET A 1 20 ? -2.086  -3.821  1.223   1.00 0.00 ? 20 MET A CE   9  
ATOM 10878 H H    . MET A 1 20 ? -5.009  0.754   1.472   1.00 0.00 ? 20 MET A H    9  
ATOM 10879 H HA   . MET A 1 20 ? -6.217  -1.782  1.606   1.00 0.00 ? 20 MET A HA   9  
ATOM 10880 H HB2  . MET A 1 20 ? -3.591  -0.732  2.737   1.00 0.00 ? 20 MET A HB2  9  
ATOM 10881 H HB3  . MET A 1 20 ? -4.049  -2.448  2.730   1.00 0.00 ? 20 MET A HB3  9  
ATOM 10882 H HG2  . MET A 1 20 ? -4.335  -2.356  0.268   1.00 0.00 ? 20 MET A HG2  9  
ATOM 10883 H HG3  . MET A 1 20 ? -3.835  -0.662  0.284   1.00 0.00 ? 20 MET A HG3  9  
ATOM 10884 H HE1  . MET A 1 20 ? -1.121  -4.312  1.108   1.00 0.00 ? 20 MET A HE1  9  
ATOM 10885 H HE2  . MET A 1 20 ? -2.841  -4.369  0.657   1.00 0.00 ? 20 MET A HE2  9  
ATOM 10886 H HE3  . MET A 1 20 ? -2.361  -3.806  2.276   1.00 0.00 ? 20 MET A HE3  9  
ATOM 10887 N N    . LYS A 1 21 ? -5.998  -0.232  4.518   1.00 0.00 ? 21 LYS A N    9  
ATOM 10888 C CA   . LYS A 1 21 ? -6.510  -0.236  5.877   1.00 0.00 ? 21 LYS A CA   9  
ATOM 10889 C C    . LYS A 1 21 ? -8.038  -0.294  5.851   1.00 0.00 ? 21 LYS A C    9  
ATOM 10890 O O    . LYS A 1 21 ? -8.636  -1.122  6.529   1.00 0.00 ? 21 LYS A O    9  
ATOM 10891 C CB   . LYS A 1 21 ? -6.022  1.022   6.601   1.00 0.00 ? 21 LYS A CB   9  
ATOM 10892 C CG   . LYS A 1 21 ? -6.674  1.121   7.980   1.00 0.00 ? 21 LYS A CG   9  
ATOM 10893 C CD   . LYS A 1 21 ? -6.051  2.285   8.754   1.00 0.00 ? 21 LYS A CD   9  
ATOM 10894 C CE   . LYS A 1 21 ? -7.123  2.961   9.607   1.00 0.00 ? 21 LYS A CE   9  
ATOM 10895 N NZ   . LYS A 1 21 ? -6.535  3.979   10.495  1.00 0.00 ? 21 LYS A NZ   9  
ATOM 10896 H H    . LYS A 1 21 ? -5.459  0.569   4.210   1.00 0.00 ? 21 LYS A H    9  
ATOM 10897 H HA   . LYS A 1 21 ? -6.130  -1.116  6.398   1.00 0.00 ? 21 LYS A HA   9  
ATOM 10898 H HB2  . LYS A 1 21 ? -4.940  0.976   6.714   1.00 0.00 ? 21 LYS A HB2  9  
ATOM 10899 H HB3  . LYS A 1 21 ? -6.284  1.902   6.016   1.00 0.00 ? 21 LYS A HB3  9  
ATOM 10900 H HG2  . LYS A 1 21 ? -7.744  1.294   7.865   1.00 0.00 ? 21 LYS A HG2  9  
ATOM 10901 H HG3  . LYS A 1 21 ? -6.514  0.192   8.529   1.00 0.00 ? 21 LYS A HG3  9  
ATOM 10902 H HD2  . LYS A 1 21 ? -5.255  1.906   9.396   1.00 0.00 ? 21 LYS A HD2  9  
ATOM 10903 H HD3  . LYS A 1 21 ? -5.638  3.008   8.050   1.00 0.00 ? 21 LYS A HD3  9  
ATOM 10904 H HE2  . LYS A 1 21 ? -7.850  3.440   8.947   1.00 0.00 ? 21 LYS A HE2  9  
ATOM 10905 H HE3  . LYS A 1 21 ? -7.628  2.208   10.210  1.00 0.00 ? 21 LYS A HE3  9  
ATOM 10906 H HZ1  . LYS A 1 21 ? -6.066  4.681   9.941   1.00 0.00 ? 21 LYS A HZ1  9  
ATOM 10907 H HZ2  . LYS A 1 21 ? -5.871  3.541   11.117  1.00 0.00 ? 21 LYS A HZ2  9  
ATOM 10908 H HZ3  . LYS A 1 21 ? -7.268  4.415   11.039  1.00 0.00 ? 21 LYS A HZ3  9  
ATOM 10909 N N    . THR A 1 22 ? -8.666  0.589   5.069   1.00 0.00 ? 22 THR A N    9  
ATOM 10910 C CA   . THR A 1 22 ? -10.118 0.637   4.971   1.00 0.00 ? 22 THR A CA   9  
ATOM 10911 C C    . THR A 1 22 ? -10.658 -0.706  4.469   1.00 0.00 ? 22 THR A C    9  
ATOM 10912 O O    . THR A 1 22 ? -11.611 -1.236  5.034   1.00 0.00 ? 22 THR A O    9  
ATOM 10913 C CB   . THR A 1 22 ? -10.528 1.781   4.034   1.00 0.00 ? 22 THR A CB   9  
ATOM 10914 O OG1  . THR A 1 22 ? -9.990  2.996   4.513   1.00 0.00 ? 22 THR A OG1  9  
ATOM 10915 C CG2  . THR A 1 22 ? -12.054 1.894   3.984   1.00 0.00 ? 22 THR A CG2  9  
ATOM 10916 H H    . THR A 1 22 ? -8.126  1.249   4.525   1.00 0.00 ? 22 THR A H    9  
ATOM 10917 H HA   . THR A 1 22 ? -10.530 0.830   5.965   1.00 0.00 ? 22 THR A HA   9  
ATOM 10918 H HB   . THR A 1 22 ? -10.146 1.587   3.031   1.00 0.00 ? 22 THR A HB   9  
ATOM 10919 H HG1  . THR A 1 22 ? -9.039  2.991   4.362   1.00 0.00 ? 22 THR A HG1  9  
ATOM 10920 H HG21 . THR A 1 22 ? -12.334 2.767   3.395   1.00 0.00 ? 22 THR A HG21 9  
ATOM 10921 H HG22 . THR A 1 22 ? -12.445 1.999   4.997   1.00 0.00 ? 22 THR A HG22 9  
ATOM 10922 H HG23 . THR A 1 22 ? -12.472 0.999   3.524   1.00 0.00 ? 22 THR A HG23 9  
ATOM 10923 N N    . ARG A 1 23 ? -10.048 -1.257  3.410   1.00 0.00 ? 23 ARG A N    9  
ATOM 10924 C CA   . ARG A 1 23 ? -10.474 -2.536  2.856   1.00 0.00 ? 23 ARG A CA   9  
ATOM 10925 C C    . ARG A 1 23 ? -10.335 -3.629  3.925   1.00 0.00 ? 23 ARG A C    9  
ATOM 10926 O O    . ARG A 1 23 ? -11.235 -4.449  4.101   1.00 0.00 ? 23 ARG A O    9  
ATOM 10927 C CB   . ARG A 1 23 ? -9.638  -2.856  1.606   1.00 0.00 ? 23 ARG A CB   9  
ATOM 10928 C CG   . ARG A 1 23 ? -10.055 -4.220  1.049   1.00 0.00 ? 23 ARG A CG   9  
ATOM 10929 C CD   . ARG A 1 23 ? -9.523  -4.412  -0.377  1.00 0.00 ? 23 ARG A CD   9  
ATOM 10930 N NE   . ARG A 1 23 ? -10.328 -3.679  -1.370  1.00 0.00 ? 23 ARG A NE   9  
ATOM 10931 C CZ   . ARG A 1 23 ? -11.629 -3.929  -1.618  1.00 0.00 ? 23 ARG A CZ   9  
ATOM 10932 N NH1  . ARG A 1 23 ? -12.214 -5.036  -1.150  1.00 0.00 ? 23 ARG A NH1  9  
ATOM 10933 N NH2  . ARG A 1 23 ? -12.342 -3.060  -2.345  1.00 0.00 ? 23 ARG A NH2  9  
ATOM 10934 H H    . ARG A 1 23 ? -9.269  -0.781  2.977   1.00 0.00 ? 23 ARG A H    9  
ATOM 10935 H HA   . ARG A 1 23 ? -11.522 -2.461  2.566   1.00 0.00 ? 23 ARG A HA   9  
ATOM 10936 H HB2  . ARG A 1 23 ? -9.809  -2.088  0.851   1.00 0.00 ? 23 ARG A HB2  9  
ATOM 10937 H HB3  . ARG A 1 23 ? -8.580  -2.879  1.868   1.00 0.00 ? 23 ARG A HB3  9  
ATOM 10938 H HG2  . ARG A 1 23 ? -9.645  -5.001  1.687   1.00 0.00 ? 23 ARG A HG2  9  
ATOM 10939 H HG3  . ARG A 1 23 ? -11.140 -4.290  1.046   1.00 0.00 ? 23 ARG A HG3  9  
ATOM 10940 H HD2  . ARG A 1 23 ? -8.493  -4.057  -0.424  1.00 0.00 ? 23 ARG A HD2  9  
ATOM 10941 H HD3  . ARG A 1 23 ? -9.538  -5.474  -0.623  1.00 0.00 ? 23 ARG A HD3  9  
ATOM 10942 H HE   . ARG A 1 23 ? -9.865  -2.953  -1.897  1.00 0.00 ? 23 ARG A HE   9  
ATOM 10943 H HH11 . ARG A 1 23 ? -11.656 -5.756  -0.700  1.00 0.00 ? 23 ARG A HH11 9  
ATOM 10944 H HH12 . ARG A 1 23 ? -13.208 -5.163  -1.248  1.00 0.00 ? 23 ARG A HH12 9  
ATOM 10945 H HH21 . ARG A 1 23 ? -11.888 -2.241  -2.748  1.00 0.00 ? 23 ARG A HH21 9  
ATOM 10946 H HH22 . ARG A 1 23 ? -13.325 -3.216  -2.499  1.00 0.00 ? 23 ARG A HH22 9  
ATOM 10947 N N    . HIS A 1 24 ? -9.206  -3.626  4.645   1.00 0.00 ? 24 HIS A N    9  
ATOM 10948 C CA   . HIS A 1 24 ? -8.951  -4.584  5.712   1.00 0.00 ? 24 HIS A CA   9  
ATOM 10949 C C    . HIS A 1 24 ? -10.016 -4.442  6.803   1.00 0.00 ? 24 HIS A C    9  
ATOM 10950 O O    . HIS A 1 24 ? -10.435 -5.431  7.399   1.00 0.00 ? 24 HIS A O    9  
ATOM 10951 C CB   . HIS A 1 24 ? -7.545  -4.332  6.267   1.00 0.00 ? 24 HIS A CB   9  
ATOM 10952 C CG   . HIS A 1 24 ? -7.097  -5.367  7.264   1.00 0.00 ? 24 HIS A CG   9  
ATOM 10953 N ND1  . HIS A 1 24 ? -6.349  -6.485  6.909   1.00 0.00 ? 24 HIS A ND1  9  
ATOM 10954 C CD2  . HIS A 1 24 ? -7.244  -5.462  8.624   1.00 0.00 ? 24 HIS A CD2  9  
ATOM 10955 C CE1  . HIS A 1 24 ? -6.103  -7.166  8.048   1.00 0.00 ? 24 HIS A CE1  9  
ATOM 10956 N NE2  . HIS A 1 24 ? -6.623  -6.592  9.132   1.00 0.00 ? 24 HIS A NE2  9  
ATOM 10957 H H    . HIS A 1 24 ? -8.498  -2.931  4.451   1.00 0.00 ? 24 HIS A H    9  
ATOM 10958 H HA   . HIS A 1 24 ? -8.994  -5.590  5.307   1.00 0.00 ? 24 HIS A HA   9  
ATOM 10959 H HB2  . HIS A 1 24 ? -6.840  -4.327  5.437   1.00 0.00 ? 24 HIS A HB2  9  
ATOM 10960 H HB3  . HIS A 1 24 ? -7.526  -3.356  6.748   1.00 0.00 ? 24 HIS A HB3  9  
ATOM 10961 H HD1  . HIS A 1 24 ? -6.047  -6.738  5.979   1.00 0.00 ? 24 HIS A HD1  9  
ATOM 10962 H HD2  . HIS A 1 24 ? -7.767  -4.739  9.223   1.00 0.00 ? 24 HIS A HD2  9  
ATOM 10963 H HE1  . HIS A 1 24 ? -5.534  -8.083  8.079   1.00 0.00 ? 24 HIS A HE1  9  
ATOM 10964 N N    . GLN A 1 25 ? -10.458 -3.206  7.053   1.00 0.00 ? 25 GLN A N    9  
ATOM 10965 C CA   . GLN A 1 25 ? -11.473 -2.927  8.059   1.00 0.00 ? 25 GLN A CA   9  
ATOM 10966 C C    . GLN A 1 25 ? -12.883 -3.231  7.518   1.00 0.00 ? 25 GLN A C    9  
ATOM 10967 O O    . GLN A 1 25 ? -13.871 -2.839  8.138   1.00 0.00 ? 25 GLN A O    9  
ATOM 10968 C CB   . GLN A 1 25 ? -11.358 -1.452  8.476   1.00 0.00 ? 25 GLN A CB   9  
ATOM 10969 C CG   . GLN A 1 25 ? -10.111 -1.244  9.345   1.00 0.00 ? 25 GLN A CG   9  
ATOM 10970 C CD   . GLN A 1 25 ? -10.280 -1.886  10.718  1.00 0.00 ? 25 GLN A CD   9  
ATOM 10971 O OE1  . GLN A 1 25 ? -11.154 -1.494  11.486  1.00 0.00 ? 25 GLN A OE1  9  
ATOM 10972 N NE2  . GLN A 1 25 ? -9.441  -2.875  11.029  1.00 0.00 ? 25 GLN A NE2  9  
ATOM 10973 H H    . GLN A 1 25 ? -10.079 -2.426  6.531   1.00 0.00 ? 25 GLN A H    9  
ATOM 10974 H HA   . GLN A 1 25 ? -11.292 -3.557  8.930   1.00 0.00 ? 25 GLN A HA   9  
ATOM 10975 H HB2  . GLN A 1 25 ? -11.284 -0.829  7.586   1.00 0.00 ? 25 GLN A HB2  9  
ATOM 10976 H HB3  . GLN A 1 25 ? -12.242 -1.161  9.041   1.00 0.00 ? 25 GLN A HB3  9  
ATOM 10977 H HG2  . GLN A 1 25 ? -9.247  -1.684  8.848   1.00 0.00 ? 25 GLN A HG2  9  
ATOM 10978 H HG3  . GLN A 1 25 ? -9.941  -0.175  9.473   1.00 0.00 ? 25 GLN A HG3  9  
ATOM 10979 H HE21 . GLN A 1 25 ? -8.733  -3.160  10.369  1.00 0.00 ? 25 GLN A HE21 9  
ATOM 10980 H HE22 . GLN A 1 25 ? -9.516  -3.336  11.922  1.00 0.00 ? 25 GLN A HE22 9  
ATOM 10981 N N    . ARG A 1 26 ? -12.982 -3.929  6.368   1.00 0.00 ? 26 ARG A N    9  
ATOM 10982 C CA   . ARG A 1 26 ? -14.273 -4.271  5.771   1.00 0.00 ? 26 ARG A CA   9  
ATOM 10983 C C    . ARG A 1 26 ? -14.348 -5.778  5.479   1.00 0.00 ? 26 ARG A C    9  
ATOM 10984 O O    . ARG A 1 26 ? -15.033 -6.194  4.546   1.00 0.00 ? 26 ARG A O    9  
ATOM 10985 C CB   . ARG A 1 26 ? -14.472 -3.451  4.489   1.00 0.00 ? 26 ARG A CB   9  
ATOM 10986 C CG   . ARG A 1 26 ? -14.764 -1.989  4.846   1.00 0.00 ? 26 ARG A CG   9  
ATOM 10987 C CD   . ARG A 1 26 ? -14.716 -1.127  3.582   1.00 0.00 ? 26 ARG A CD   9  
ATOM 10988 N NE   . ARG A 1 26 ? -15.760 -1.527  2.630   1.00 0.00 ? 26 ARG A NE   9  
ATOM 10989 C CZ   . ARG A 1 26 ? -15.875 -0.994  1.401   1.00 0.00 ? 26 ARG A CZ   9  
ATOM 10990 N NH1  . ARG A 1 26 ? -15.024 -0.043  0.996   1.00 0.00 ? 26 ARG A NH1  9  
ATOM 10991 N NH2  . ARG A 1 26 ? -16.847 -1.415  0.580   1.00 0.00 ? 26 ARG A NH2  9  
ATOM 10992 H H    . ARG A 1 26 ? -12.144 -4.231  5.890   1.00 0.00 ? 26 ARG A H    9  
ATOM 10993 H HA   . ARG A 1 26 ? -15.070 -4.020  6.472   1.00 0.00 ? 26 ARG A HA   9  
ATOM 10994 H HB2  . ARG A 1 26 ? -13.570 -3.505  3.879   1.00 0.00 ? 26 ARG A HB2  9  
ATOM 10995 H HB3  . ARG A 1 26 ? -15.312 -3.857  3.925   1.00 0.00 ? 26 ARG A HB3  9  
ATOM 10996 H HG2  . ARG A 1 26 ? -15.752 -1.917  5.299   1.00 0.00 ? 26 ARG A HG2  9  
ATOM 10997 H HG3  . ARG A 1 26 ? -14.017 -1.631  5.554   1.00 0.00 ? 26 ARG A HG3  9  
ATOM 10998 H HD2  . ARG A 1 26 ? -14.865 -0.082  3.859   1.00 0.00 ? 26 ARG A HD2  9  
ATOM 10999 H HD3  . ARG A 1 26 ? -13.738 -1.237  3.113   1.00 0.00 ? 26 ARG A HD3  9  
ATOM 11000 H HE   . ARG A 1 26 ? -16.416 -2.237  2.925   1.00 0.00 ? 26 ARG A HE   9  
ATOM 11001 H HH11 . ARG A 1 26 ? -14.298 0.282   1.617   1.00 0.00 ? 26 ARG A HH11 9  
ATOM 11002 H HH12 . ARG A 1 26 ? -15.107 0.351   0.070   1.00 0.00 ? 26 ARG A HH12 9  
ATOM 11003 H HH21 . ARG A 1 26 ? -17.489 -2.133  0.884   1.00 0.00 ? 26 ARG A HH21 9  
ATOM 11004 H HH22 . ARG A 1 26 ? -16.937 -1.017  -0.343  1.00 0.00 ? 26 ARG A HH22 9  
ATOM 11005 N N    . GLY A 1 27 ? -13.650 -6.597  6.281   1.00 0.00 ? 27 GLY A N    9  
ATOM 11006 C CA   . GLY A 1 27 ? -13.684 -8.052  6.132   1.00 0.00 ? 27 GLY A CA   9  
ATOM 11007 C C    . GLY A 1 27 ? -12.634 -8.529  5.129   1.00 0.00 ? 27 GLY A C    9  
ATOM 11008 O O    . GLY A 1 27 ? -12.063 -9.606  5.296   1.00 0.00 ? 27 GLY A O    9  
ATOM 11009 H H    . GLY A 1 27 ? -13.086 -6.207  7.019   1.00 0.00 ? 27 GLY A H    9  
ATOM 11010 H HA2  . GLY A 1 27 ? -13.487 -8.512  7.101   1.00 0.00 ? 27 GLY A HA2  9  
ATOM 11011 H HA3  . GLY A 1 27 ? -14.672 -8.357  5.787   1.00 0.00 ? 27 GLY A HA3  9  
ATOM 11012 N N    . ASP A 1 28 ? -12.384 -7.727  4.091   1.00 0.00 ? 28 ASP A N    9  
ATOM 11013 C CA   . ASP A 1 28 ? -11.403 -8.052  3.065   1.00 0.00 ? 28 ASP A CA   9  
ATOM 11014 C C    . ASP A 1 28 ? -9.997  -7.835  3.634   1.00 0.00 ? 28 ASP A C    9  
ATOM 11015 O O    . ASP A 1 28 ? -9.349  -6.831  3.348   1.00 0.00 ? 28 ASP A O    9  
ATOM 11016 C CB   . ASP A 1 28 ? -11.673 -7.168  1.847   1.00 0.00 ? 28 ASP A CB   9  
ATOM 11017 C CG   . ASP A 1 28 ? -10.798 -7.559  0.662   1.00 0.00 ? 28 ASP A CG   9  
ATOM 11018 O OD1  . ASP A 1 28 ? -9.643  -7.946  0.907   1.00 0.00 ? 28 ASP A OD1  9  
ATOM 11019 O OD2  . ASP A 1 28 ? -11.307 -7.457  -0.471  1.00 0.00 ? 28 ASP A OD2  9  
ATOM 11020 H H    . ASP A 1 28 ? -12.887 -6.856  4.008   1.00 0.00 ? 28 ASP A H    9  
ATOM 11021 H HA   . ASP A 1 28 ? -11.511 -9.099  2.769   1.00 0.00 ? 28 ASP A HA   9  
ATOM 11022 H HB2  . ASP A 1 28 ? -12.721 -7.273  1.560   1.00 0.00 ? 28 ASP A HB2  9  
ATOM 11023 H HB3  . ASP A 1 28 ? -11.483 -6.134  2.110   1.00 0.00 ? 28 ASP A HB3  9  
ATOM 11024 N N    . THR A 1 29 ? -9.537  -8.787  4.454   1.00 0.00 ? 29 THR A N    9  
ATOM 11025 C CA   . THR A 1 29 ? -8.233  -8.712  5.096   1.00 0.00 ? 29 THR A CA   9  
ATOM 11026 C C    . THR A 1 29 ? -7.186  -9.514  4.310   1.00 0.00 ? 29 THR A C    9  
ATOM 11027 O O    . THR A 1 29 ? -6.010  -9.515  4.680   1.00 0.00 ? 29 THR A O    9  
ATOM 11028 C CB   . THR A 1 29 ? -8.355  -9.262  6.524   1.00 0.00 ? 29 THR A CB   9  
ATOM 11029 O OG1  . THR A 1 29 ? -8.832  -10.590 6.478   1.00 0.00 ? 29 THR A OG1  9  
ATOM 11030 C CG2  . THR A 1 29 ? -9.326  -8.405  7.337   1.00 0.00 ? 29 THR A CG2  9  
ATOM 11031 H H    . THR A 1 29 ? -10.117 -9.593  4.651   1.00 0.00 ? 29 THR A H    9  
ATOM 11032 H HA   . THR A 1 29 ? -7.915  -7.670  5.147   1.00 0.00 ? 29 THR A HA   9  
ATOM 11033 H HB   . THR A 1 29 ? -7.378  -9.244  7.004   1.00 0.00 ? 29 THR A HB   9  
ATOM 11034 H HG1  . THR A 1 29 ? -8.952  -10.903 7.378   1.00 0.00 ? 29 THR A HG1  9  
ATOM 11035 H HG21 . THR A 1 29 ? -8.984  -7.375  7.337   1.00 0.00 ? 29 THR A HG21 9  
ATOM 11036 H HG22 . THR A 1 29 ? -10.321 -8.457  6.897   1.00 0.00 ? 29 THR A HG22 9  
ATOM 11037 H HG23 . THR A 1 29 ? -9.366  -8.773  8.362   1.00 0.00 ? 29 THR A HG23 9  
ATOM 11038 N N    . HIS A 1 30 ? -7.604  -10.204 3.236   1.00 0.00 ? 30 HIS A N    9  
ATOM 11039 C CA   . HIS A 1 30 ? -6.697  -11.040 2.456   1.00 0.00 ? 30 HIS A CA   9  
ATOM 11040 C C    . HIS A 1 30 ? -5.709  -10.167 1.654   1.00 0.00 ? 30 HIS A C    9  
ATOM 11041 O O    . HIS A 1 30 ? -5.994  -9.002  1.378   1.00 0.00 ? 30 HIS A O    9  
ATOM 11042 C CB   . HIS A 1 30 ? -7.516  -11.956 1.530   1.00 0.00 ? 30 HIS A CB   9  
ATOM 11043 C CG   . HIS A 1 30 ? -7.811  -11.333 0.192   1.00 0.00 ? 30 HIS A CG   9  
ATOM 11044 N ND1  . HIS A 1 30 ? -8.462  -10.119 0.062   1.00 0.00 ? 30 HIS A ND1  9  
ATOM 11045 C CD2  . HIS A 1 30 ? -7.548  -11.731 -1.095  1.00 0.00 ? 30 HIS A CD2  9  
ATOM 11046 C CE1  . HIS A 1 30 ? -8.556  -9.863  -1.252  1.00 0.00 ? 30 HIS A CE1  9  
ATOM 11047 N NE2  . HIS A 1 30 ? -8.018  -10.812 -2.019  1.00 0.00 ? 30 HIS A NE2  9  
ATOM 11048 H H    . HIS A 1 30 ? -8.572  -10.159 2.957   1.00 0.00 ? 30 HIS A H    9  
ATOM 11049 H HA   . HIS A 1 30 ? -6.138  -11.663 3.149   1.00 0.00 ? 30 HIS A HA   9  
ATOM 11050 H HB2  . HIS A 1 30 ? -6.963  -12.880 1.371   1.00 0.00 ? 30 HIS A HB2  9  
ATOM 11051 H HB3  . HIS A 1 30 ? -8.460  -12.198 2.021   1.00 0.00 ? 30 HIS A HB3  9  
ATOM 11052 H HD1  . HIS A 1 30 ? -8.803  -9.529  0.812   1.00 0.00 ? 30 HIS A HD1  9  
ATOM 11053 H HD2  . HIS A 1 30 ? -7.038  -12.645 -1.357  1.00 0.00 ? 30 HIS A HD2  9  
ATOM 11054 H HE1  . HIS A 1 30 ? -9.020  -8.973  -1.646  1.00 0.00 ? 30 HIS A HE1  9  
ATOM 11055 N N    . PRO A 1 31 ? -4.539  -10.736 1.281   1.00 0.00 ? 31 PRO A N    9  
ATOM 11056 C CA   . PRO A 1 31 ? -3.520  -10.027 0.525   1.00 0.00 ? 31 PRO A CA   9  
ATOM 11057 C C    . PRO A 1 31 ? -4.008  -9.663  -0.882  1.00 0.00 ? 31 PRO A C    9  
ATOM 11058 O O    . PRO A 1 31 ? -4.901  -10.313 -1.418  1.00 0.00 ? 31 PRO A O    9  
ATOM 11059 C CB   . PRO A 1 31 ? -2.327  -10.986 0.443   1.00 0.00 ? 31 PRO A CB   9  
ATOM 11060 C CG   . PRO A 1 31 ? -2.739  -12.286 1.139   1.00 0.00 ? 31 PRO A CG   9  
ATOM 11061 C CD   . PRO A 1 31 ? -4.177  -12.101 1.609   1.00 0.00 ? 31 PRO A CD   9  
ATOM 11062 H HA   . PRO A 1 31 ? -3.230  -9.123  1.058   1.00 0.00 ? 31 PRO A HA   9  
ATOM 11063 H HB2  . PRO A 1 31 ? -2.095  -11.191 -0.592  1.00 0.00 ? 31 PRO A HB2  9  
ATOM 11064 H HB3  . PRO A 1 31 ? -1.460  -10.552 0.939   1.00 0.00 ? 31 PRO A HB3  9  
ATOM 11065 H HG2  . PRO A 1 31 ? -2.680  -13.119 0.438   1.00 0.00 ? 31 PRO A HG2  9  
ATOM 11066 H HG3  . PRO A 1 31 ? -2.092  -12.473 1.994   1.00 0.00 ? 31 PRO A HG3  9  
ATOM 11067 H HD2  . PRO A 1 31 ? -4.830  -12.799 1.088   1.00 0.00 ? 31 PRO A HD2  9  
ATOM 11068 H HD3  . PRO A 1 31 ? -4.233  -12.263 2.685   1.00 0.00 ? 31 PRO A HD3  9  
ATOM 11069 N N    . LEU A 1 32 ? -3.396  -8.621  -1.478  1.00 0.00 ? 32 LEU A N    9  
ATOM 11070 C CA   . LEU A 1 32 ? -3.724  -8.173  -2.831  1.00 0.00 ? 32 LEU A CA   9  
ATOM 11071 C C    . LEU A 1 32 ? -2.431  -7.844  -3.594  1.00 0.00 ? 32 LEU A C    9  
ATOM 11072 O O    . LEU A 1 32 ? -1.497  -7.287  -3.018  1.00 0.00 ? 32 LEU A O    9  
ATOM 11073 C CB   . LEU A 1 32 ? -4.596  -6.909  -2.766  1.00 0.00 ? 32 LEU A CB   9  
ATOM 11074 C CG   . LEU A 1 32 ? -6.072  -7.242  -2.491  1.00 0.00 ? 32 LEU A CG   9  
ATOM 11075 C CD1  . LEU A 1 32 ? -6.882  -5.944  -2.541  1.00 0.00 ? 32 LEU A CD1  9  
ATOM 11076 C CD2  . LEU A 1 32 ? -6.621  -8.202  -3.551  1.00 0.00 ? 32 LEU A CD2  9  
ATOM 11077 H H    . LEU A 1 32 ? -2.671  -8.122  -0.979  1.00 0.00 ? 32 LEU A H    9  
ATOM 11078 H HA   . LEU A 1 32 ? -4.262  -8.963  -3.356  1.00 0.00 ? 32 LEU A HA   9  
ATOM 11079 H HB2  . LEU A 1 32 ? -4.222  -6.259  -1.973  1.00 0.00 ? 32 LEU A HB2  9  
ATOM 11080 H HB3  . LEU A 1 32 ? -4.522  -6.381  -3.717  1.00 0.00 ? 32 LEU A HB3  9  
ATOM 11081 H HG   . LEU A 1 32 ? -6.169  -7.693  -1.502  1.00 0.00 ? 32 LEU A HG   9  
ATOM 11082 H HD11 . LEU A 1 32 ? -6.810  -5.509  -3.544  1.00 0.00 ? 32 LEU A HD11 9  
ATOM 11083 H HD12 . LEU A 1 32 ? -6.488  -5.240  -1.811  1.00 0.00 ? 32 LEU A HD12 9  
ATOM 11084 H HD13 . LEU A 1 32 ? -7.926  -6.157  -2.314  1.00 0.00 ? 32 LEU A HD13 9  
ATOM 11085 H HD21 . LEU A 1 32 ? -7.709  -8.159  -3.551  1.00 0.00 ? 32 LEU A HD21 9  
ATOM 11086 H HD22 . LEU A 1 32 ? -6.303  -9.219  -3.328  1.00 0.00 ? 32 LEU A HD22 9  
ATOM 11087 H HD23 . LEU A 1 32 ? -6.250  -7.911  -4.528  1.00 0.00 ? 32 LEU A HD23 9  
ATOM 11088 N N    . THR A 1 33 ? -2.387  -8.176  -4.894  1.00 0.00 ? 33 THR A N    9  
ATOM 11089 C CA   . THR A 1 33 ? -1.239  -7.854  -5.753  1.00 0.00 ? 33 THR A CA   9  
ATOM 11090 C C    . THR A 1 33 ? -1.073  -6.336  -5.876  1.00 0.00 ? 33 THR A C    9  
ATOM 11091 O O    . THR A 1 33 ? -1.958  -5.568  -5.496  1.00 0.00 ? 33 THR A O    9  
ATOM 11092 C CB   . THR A 1 33 ? -1.441  -8.447  -7.163  1.00 0.00 ? 33 THR A CB   9  
ATOM 11093 O OG1  . THR A 1 33 ? -2.610  -7.908  -7.735  1.00 0.00 ? 33 THR A OG1  9  
ATOM 11094 C CG2  . THR A 1 33 ? -1.556  -9.970  -7.109  1.00 0.00 ? 33 THR A CG2  9  
ATOM 11095 H H    . THR A 1 33 ? -3.172  -8.664  -5.306  1.00 0.00 ? 33 THR A H    9  
ATOM 11096 H HA   . THR A 1 33 ? -0.333  -8.272  -5.316  1.00 0.00 ? 33 THR A HA   9  
ATOM 11097 H HB   . THR A 1 33 ? -0.587  -8.179  -7.787  1.00 0.00 ? 33 THR A HB   9  
ATOM 11098 H HG1  . THR A 1 33 ? -3.373  -8.248  -7.250  1.00 0.00 ? 33 THR A HG1  9  
ATOM 11099 H HG21 . THR A 1 33 ? -1.831  -10.347 -8.094  1.00 0.00 ? 33 THR A HG21 9  
ATOM 11100 H HG22 . THR A 1 33 ? -0.597  -10.395 -6.819  1.00 0.00 ? 33 THR A HG22 9  
ATOM 11101 H HG23 . THR A 1 33 ? -2.318  -10.260 -6.387  1.00 0.00 ? 33 THR A HG23 9  
ATOM 11102 N N    . LEU A 1 34 ? 0.071   -5.918  -6.433  1.00 0.00 ? 34 LEU A N    9  
ATOM 11103 C CA   . LEU A 1 34 ? 0.357   -4.513  -6.674  1.00 0.00 ? 34 LEU A CA   9  
ATOM 11104 C C    . LEU A 1 34 ? -0.738  -3.936  -7.580  1.00 0.00 ? 34 LEU A C    9  
ATOM 11105 O O    . LEU A 1 34 ? -1.338  -2.919  -7.257  1.00 0.00 ? 34 LEU A O    9  
ATOM 11106 C CB   . LEU A 1 34 ? 1.751   -4.409  -7.332  1.00 0.00 ? 34 LEU A CB   9  
ATOM 11107 C CG   . LEU A 1 34 ? 2.386   -3.022  -7.107  1.00 0.00 ? 34 LEU A CG   9  
ATOM 11108 C CD1  . LEU A 1 34 ? 3.849   -3.070  -7.549  1.00 0.00 ? 34 LEU A CD1  9  
ATOM 11109 C CD2  . LEU A 1 34 ? 1.650   -1.957  -7.918  1.00 0.00 ? 34 LEU A CD2  9  
ATOM 11110 H H    . LEU A 1 34 ? 0.764   -6.597  -6.710  1.00 0.00 ? 34 LEU A H    9  
ATOM 11111 H HA   . LEU A 1 34 ? 0.364   -3.978  -5.725  1.00 0.00 ? 34 LEU A HA   9  
ATOM 11112 H HB2  . LEU A 1 34 ? 2.402   -5.167  -6.895  1.00 0.00 ? 34 LEU A HB2  9  
ATOM 11113 H HB3  . LEU A 1 34 ? 1.661   -4.596  -8.403  1.00 0.00 ? 34 LEU A HB3  9  
ATOM 11114 H HG   . LEU A 1 34 ? 2.347   -2.759  -6.051  1.00 0.00 ? 34 LEU A HG   9  
ATOM 11115 H HD11 . LEU A 1 34 ? 3.900   -3.259  -8.621  1.00 0.00 ? 34 LEU A HD11 9  
ATOM 11116 H HD12 . LEU A 1 34 ? 4.329   -2.120  -7.322  1.00 0.00 ? 34 LEU A HD12 9  
ATOM 11117 H HD13 . LEU A 1 34 ? 4.362   -3.870  -7.016  1.00 0.00 ? 34 LEU A HD13 9  
ATOM 11118 H HD21 . LEU A 1 34 ? 1.380   -2.358  -8.894  1.00 0.00 ? 34 LEU A HD21 9  
ATOM 11119 H HD22 . LEU A 1 34 ? 2.296   -1.089  -8.048  1.00 0.00 ? 34 LEU A HD22 9  
ATOM 11120 H HD23 . LEU A 1 34 ? 0.751   -1.655  -7.385  1.00 0.00 ? 34 LEU A HD23 9  
ATOM 11121 N N    . ASP A 1 35 ? -0.995  -4.603  -8.713  1.00 0.00 ? 35 ASP A N    9  
ATOM 11122 C CA   . ASP A 1 35 ? -2.001  -4.169  -9.677  1.00 0.00 ? 35 ASP A CA   9  
ATOM 11123 C C    . ASP A 1 35 ? -3.368  -3.994  -9.007  1.00 0.00 ? 35 ASP A C    9  
ATOM 11124 O O    . ASP A 1 35 ? -4.022  -2.970  -9.199  1.00 0.00 ? 35 ASP A O    9  
ATOM 11125 C CB   . ASP A 1 35 ? -2.081  -5.196  -10.810 1.00 0.00 ? 35 ASP A CB   9  
ATOM 11126 C CG   . ASP A 1 35 ? -0.724  -5.366  -11.483 1.00 0.00 ? 35 ASP A CG   9  
ATOM 11127 O OD1  . ASP A 1 35 ? 0.121   -6.072  -10.886 1.00 0.00 ? 35 ASP A OD1  9  
ATOM 11128 O OD2  . ASP A 1 35 ? -0.554  -4.785  -12.577 1.00 0.00 ? 35 ASP A OD2  9  
ATOM 11129 H H    . ASP A 1 35 ? -0.471  -5.444  -8.924  1.00 0.00 ? 35 ASP A H    9  
ATOM 11130 H HA   . ASP A 1 35 ? -1.691  -3.210  -10.097 1.00 0.00 ? 35 ASP A HA   9  
ATOM 11131 H HB2  . ASP A 1 35 ? -2.400  -6.156  -10.403 1.00 0.00 ? 35 ASP A HB2  9  
ATOM 11132 H HB3  . ASP A 1 35 ? -2.808  -4.860  -11.548 1.00 0.00 ? 35 ASP A HB3  9  
ATOM 11133 N N    . GLU A 1 36 ? -3.801  -4.993  -8.223  1.00 0.00 ? 36 GLU A N    9  
ATOM 11134 C CA   . GLU A 1 36 ? -5.089  -4.933  -7.531  1.00 0.00 ? 36 GLU A CA   9  
ATOM 11135 C C    . GLU A 1 36 ? -5.160  -3.680  -6.653  1.00 0.00 ? 36 GLU A C    9  
ATOM 11136 O O    . GLU A 1 36 ? -6.227  -3.083  -6.515  1.00 0.00 ? 36 GLU A O    9  
ATOM 11137 C CB   . GLU A 1 36 ? -5.285  -6.207  -6.704  1.00 0.00 ? 36 GLU A CB   9  
ATOM 11138 C CG   . GLU A 1 36 ? -5.685  -7.361  -7.635  1.00 0.00 ? 36 GLU A CG   9  
ATOM 11139 C CD   . GLU A 1 36 ? -5.678  -8.697  -6.900  1.00 0.00 ? 36 GLU A CD   9  
ATOM 11140 O OE1  . GLU A 1 36 ? -4.623  -9.014  -6.306  1.00 0.00 ? 36 GLU A OE1  9  
ATOM 11141 O OE2  . GLU A 1 36 ? -6.723  -9.378  -6.949  1.00 0.00 ? 36 GLU A OE2  9  
ATOM 11142 H H    . GLU A 1 36 ? -3.227  -5.818  -8.097  1.00 0.00 ? 36 GLU A H    9  
ATOM 11143 H HA   . GLU A 1 36 ? -5.885  -4.878  -8.271  1.00 0.00 ? 36 GLU A HA   9  
ATOM 11144 H HB2  . GLU A 1 36 ? -4.358  -6.454  -6.189  1.00 0.00 ? 36 GLU A HB2  9  
ATOM 11145 H HB3  . GLU A 1 36 ? -6.075  -6.045  -5.970  1.00 0.00 ? 36 GLU A HB3  9  
ATOM 11146 H HG2  . GLU A 1 36 ? -6.688  -7.173  -8.023  1.00 0.00 ? 36 GLU A HG2  9  
ATOM 11147 H HG3  . GLU A 1 36 ? -4.988  -7.409  -8.469  1.00 0.00 ? 36 GLU A HG3  9  
ATOM 11148 N N    . ILE A 1 37 ? -4.028  -3.278  -6.068  1.00 0.00 ? 37 ILE A N    9  
ATOM 11149 C CA   . ILE A 1 37 ? -3.973  -2.089  -5.232  1.00 0.00 ? 37 ILE A CA   9  
ATOM 11150 C C    . ILE A 1 37 ? -4.051  -0.831  -6.104  1.00 0.00 ? 37 ILE A C    9  
ATOM 11151 O O    . ILE A 1 37 ? -4.804  0.088   -5.780  1.00 0.00 ? 37 ILE A O    9  
ATOM 11152 C CB   . ILE A 1 37 ? -2.677  -2.115  -4.395  1.00 0.00 ? 37 ILE A CB   9  
ATOM 11153 C CG1  . ILE A 1 37 ? -2.801  -3.181  -3.292  1.00 0.00 ? 37 ILE A CG1  9  
ATOM 11154 C CG2  . ILE A 1 37 ? -2.429  -0.739  -3.763  1.00 0.00 ? 37 ILE A CG2  9  
ATOM 11155 C CD1  . ILE A 1 37 ? -1.412  -3.609  -2.813  1.00 0.00 ? 37 ILE A CD1  9  
ATOM 11156 H H    . ILE A 1 37 ? -3.175  -3.807  -6.209  1.00 0.00 ? 37 ILE A H    9  
ATOM 11157 H HA   . ILE A 1 37 ? -4.831  -2.094  -4.555  1.00 0.00 ? 37 ILE A HA   9  
ATOM 11158 H HB   . ILE A 1 37 ? -1.838  -2.365  -5.038  1.00 0.00 ? 37 ILE A HB   9  
ATOM 11159 H HG12 . ILE A 1 37 ? -3.359  -2.774  -2.452  1.00 0.00 ? 37 ILE A HG12 9  
ATOM 11160 H HG13 . ILE A 1 37 ? -3.326  -4.051  -3.685  1.00 0.00 ? 37 ILE A HG13 9  
ATOM 11161 H HG21 . ILE A 1 37 ? -2.183  -0.017  -4.541  1.00 0.00 ? 37 ILE A HG21 9  
ATOM 11162 H HG22 . ILE A 1 37 ? -3.323  -0.411  -3.236  1.00 0.00 ? 37 ILE A HG22 9  
ATOM 11163 H HG23 . ILE A 1 37 ? -1.599  -0.805  -3.062  1.00 0.00 ? 37 ILE A HG23 9  
ATOM 11164 H HD11 . ILE A 1 37 ? -1.518  -4.386  -2.057  1.00 0.00 ? 37 ILE A HD11 9  
ATOM 11165 H HD12 . ILE A 1 37 ? -0.892  -2.756  -2.383  1.00 0.00 ? 37 ILE A HD12 9  
ATOM 11166 H HD13 . ILE A 1 37 ? -0.839  -3.998  -3.654  1.00 0.00 ? 37 ILE A HD13 9  
ATOM 11167 N N    . LEU A 1 38 ? -3.269  -0.785  -7.205  1.00 0.00 ? 38 LEU A N    9  
ATOM 11168 C CA   . LEU A 1 38 ? -3.235  0.381   -8.095  1.00 0.00 ? 38 LEU A CA   9  
ATOM 11169 C C    . LEU A 1 38 ? -4.646  0.867   -8.416  1.00 0.00 ? 38 LEU A C    9  
ATOM 11170 O O    . LEU A 1 38 ? -4.969  2.017   -8.157  1.00 0.00 ? 38 LEU A O    9  
ATOM 11171 C CB   . LEU A 1 38 ? -2.526  0.041   -9.420  1.00 0.00 ? 38 LEU A CB   9  
ATOM 11172 C CG   . LEU A 1 38 ? -1.027  -0.247  -9.237  1.00 0.00 ? 38 LEU A CG   9  
ATOM 11173 C CD1  . LEU A 1 38 ? -0.346  -0.196  -10.605 1.00 0.00 ? 38 LEU A CD1  9  
ATOM 11174 C CD2  . LEU A 1 38 ? -0.352  0.775   -8.306  1.00 0.00 ? 38 LEU A CD2  9  
ATOM 11175 H H    . LEU A 1 38 ? -2.678  -1.577  -7.430  1.00 0.00 ? 38 LEU A H    9  
ATOM 11176 H HA   . LEU A 1 38 ? -2.698  1.187   -7.599  1.00 0.00 ? 38 LEU A HA   9  
ATOM 11177 H HB2  . LEU A 1 38 ? -3.000  -0.833  -9.862  1.00 0.00 ? 38 LEU A HB2  9  
ATOM 11178 H HB3  . LEU A 1 38 ? -2.642  0.876   -10.097 1.00 0.00 ? 38 LEU A HB3  9  
ATOM 11179 H HG   . LEU A 1 38 ? -0.915  -1.236  -8.829  1.00 0.00 ? 38 LEU A HG   9  
ATOM 11180 H HD11 . LEU A 1 38 ? 0.672   -0.572  -10.518 1.00 0.00 ? 38 LEU A HD11 9  
ATOM 11181 H HD12 . LEU A 1 38 ? -0.900  -0.812  -11.312 1.00 0.00 ? 38 LEU A HD12 9  
ATOM 11182 H HD13 . LEU A 1 38 ? -0.321  0.835   -10.963 1.00 0.00 ? 38 LEU A HD13 9  
ATOM 11183 H HD21 . LEU A 1 38 ? -0.636  1.779   -8.599  1.00 0.00 ? 38 LEU A HD21 9  
ATOM 11184 H HD22 . LEU A 1 38 ? -0.658  0.594   -7.276  1.00 0.00 ? 38 LEU A HD22 9  
ATOM 11185 H HD23 . LEU A 1 38 ? 0.734   0.676   -8.380  1.00 0.00 ? 38 LEU A HD23 9  
ATOM 11186 N N    . ASP A 1 39 ? -5.468  -0.014  -9.000  1.00 0.00 ? 39 ASP A N    9  
ATOM 11187 C CA   . ASP A 1 39 ? -6.820  0.331   -9.433  1.00 0.00 ? 39 ASP A CA   9  
ATOM 11188 C C    . ASP A 1 39 ? -7.582  1.114   -8.359  1.00 0.00 ? 39 ASP A C    9  
ATOM 11189 O O    . ASP A 1 39 ? -8.063  2.217   -8.620  1.00 0.00 ? 39 ASP A O    9  
ATOM 11190 C CB   . ASP A 1 39 ? -7.568  -0.956  -9.793  1.00 0.00 ? 39 ASP A CB   9  
ATOM 11191 C CG   . ASP A 1 39 ? -8.979  -0.644  -10.278 1.00 0.00 ? 39 ASP A CG   9  
ATOM 11192 O OD1  . ASP A 1 39 ? -9.111  -0.339  -11.482 1.00 0.00 ? 39 ASP A OD1  9  
ATOM 11193 O OD2  . ASP A 1 39 ? -9.898  -0.717  -9.434  1.00 0.00 ? 39 ASP A OD2  9  
ATOM 11194 H H    . ASP A 1 39 ? -5.144  -0.959  -9.165  1.00 0.00 ? 39 ASP A H    9  
ATOM 11195 H HA   . ASP A 1 39 ? -6.748  0.952   -10.325 1.00 0.00 ? 39 ASP A HA   9  
ATOM 11196 H HB2  . ASP A 1 39 ? -7.025  -1.476  -10.583 1.00 0.00 ? 39 ASP A HB2  9  
ATOM 11197 H HB3  . ASP A 1 39 ? -7.624  -1.599  -8.914  1.00 0.00 ? 39 ASP A HB3  9  
ATOM 11198 N N    . GLU A 1 40 ? -7.702  0.540   -7.162  1.00 0.00 ? 40 GLU A N    9  
ATOM 11199 C CA   . GLU A 1 40 ? -8.452  1.160   -6.075  1.00 0.00 ? 40 GLU A CA   9  
ATOM 11200 C C    . GLU A 1 40 ? -7.813  2.487   -5.637  1.00 0.00 ? 40 GLU A C    9  
ATOM 11201 O O    . GLU A 1 40 ? -8.510  3.367   -5.134  1.00 0.00 ? 40 GLU A O    9  
ATOM 11202 C CB   . GLU A 1 40 ? -8.550  0.165   -4.921  1.00 0.00 ? 40 GLU A CB   9  
ATOM 11203 C CG   . GLU A 1 40 ? -9.372  -1.049  -5.382  1.00 0.00 ? 40 GLU A CG   9  
ATOM 11204 C CD   . GLU A 1 40 ? -10.124 -1.687  -4.225  1.00 0.00 ? 40 GLU A CD   9  
ATOM 11205 O OE1  . GLU A 1 40 ? -11.052 -1.028  -3.707  1.00 0.00 ? 40 GLU A OE1  9  
ATOM 11206 O OE2  . GLU A 1 40 ? -9.761  -2.827  -3.874  1.00 0.00 ? 40 GLU A OE2  9  
ATOM 11207 H H    . GLU A 1 40 ? -7.273  -0.360  -6.994  1.00 0.00 ? 40 GLU A H    9  
ATOM 11208 H HA   . GLU A 1 40 ? -9.461  1.372   -6.432  1.00 0.00 ? 40 GLU A HA   9  
ATOM 11209 H HB2  . GLU A 1 40 ? -7.550  -0.159  -4.629  1.00 0.00 ? 40 GLU A HB2  9  
ATOM 11210 H HB3  . GLU A 1 40 ? -9.039  0.639   -4.073  1.00 0.00 ? 40 GLU A HB3  9  
ATOM 11211 H HG2  . GLU A 1 40 ? -10.093 -0.729  -6.135  1.00 0.00 ? 40 GLU A HG2  9  
ATOM 11212 H HG3  . GLU A 1 40 ? -8.702  -1.786  -5.826  1.00 0.00 ? 40 GLU A HG3  9  
ATOM 11213 N N    . THR A 1 41 ? -6.499  2.639   -5.841  1.00 0.00 ? 41 THR A N    9  
ATOM 11214 C CA   . THR A 1 41 ? -5.790  3.880   -5.517  1.00 0.00 ? 41 THR A CA   9  
ATOM 11215 C C    . THR A 1 41 ? -5.605  4.715   -6.786  1.00 0.00 ? 41 THR A C    9  
ATOM 11216 O O    . THR A 1 41 ? -4.789  5.617   -6.796  1.00 0.00 ? 41 THR A O    9  
ATOM 11217 C CB   . THR A 1 41 ? -4.452  3.549   -4.856  1.00 0.00 ? 41 THR A CB   9  
ATOM 11218 O OG1  . THR A 1 41 ? -3.745  2.614   -5.635  1.00 0.00 ? 41 THR A OG1  9  
ATOM 11219 C CG2  . THR A 1 41 ? -4.690  2.972   -3.459  1.00 0.00 ? 41 THR A CG2  9  
ATOM 11220 H H    . THR A 1 41 ? -5.967  1.878   -6.245  1.00 0.00 ? 41 THR A H    9  
ATOM 11221 H HA   . THR A 1 41 ? -6.356  4.466   -4.819  1.00 0.00 ? 41 THR A HA   9  
ATOM 11222 H HB   . THR A 1 41 ? -3.868  4.456   -4.762  1.00 0.00 ? 41 THR A HB   9  
ATOM 11223 H HG1  . THR A 1 41 ? -4.250  1.798   -5.665  1.00 0.00 ? 41 THR A HG1  9  
ATOM 11224 H HG21 . THR A 1 41 ? -4.987  3.773   -2.778  1.00 0.00 ? 41 THR A HG21 9  
ATOM 11225 H HG22 . THR A 1 41 ? -3.773  2.514   -3.097  1.00 0.00 ? 41 THR A HG22 9  
ATOM 11226 H HG23 . THR A 1 41 ? -5.477  2.219   -3.500  1.00 0.00 ? 41 THR A HG23 9  
ATOM 11227 N N    . GLN A 1 42 ? -6.376  4.403   -7.849  1.00 0.00 ? 42 GLN A N    9  
ATOM 11228 C CA   . GLN A 1 42 ? -6.275  5.076   -9.145  1.00 0.00 ? 42 GLN A CA   9  
ATOM 11229 C C    . GLN A 1 42 ? -4.993  4.595   -9.835  1.00 0.00 ? 42 GLN A C    9  
ATOM 11230 O O    . GLN A 1 42 ? -5.034  3.611   -10.566 1.00 0.00 ? 42 GLN A O    9  
ATOM 11231 C CB   . GLN A 1 42 ? -6.339  6.614   -8.979  1.00 0.00 ? 42 GLN A CB   9  
ATOM 11232 C CG   . GLN A 1 42 ? -6.359  7.304   -10.349 1.00 0.00 ? 42 GLN A CG   9  
ATOM 11233 C CD   . GLN A 1 42 ? -4.953  7.692   -10.804 1.00 0.00 ? 42 GLN A CD   9  
ATOM 11234 O OE1  . GLN A 1 42 ? -4.191  8.281   -10.040 1.00 0.00 ? 42 GLN A OE1  9  
ATOM 11235 N NE2  . GLN A 1 42 ? -4.610  7.362   -12.047 1.00 0.00 ? 42 GLN A NE2  9  
ATOM 11236 H H    . GLN A 1 42 ? -7.053  3.655   -7.765  1.00 0.00 ? 42 GLN A H    9  
ATOM 11237 H HA   . GLN A 1 42 ? -7.125  4.765   -9.753  1.00 0.00 ? 42 GLN A HA   9  
ATOM 11238 H HB2  . GLN A 1 42 ? -7.251  6.873   -8.439  1.00 0.00 ? 42 GLN A HB2  9  
ATOM 11239 H HB3  . GLN A 1 42 ? -5.485  6.971   -8.415  1.00 0.00 ? 42 GLN A HB3  9  
ATOM 11240 H HG2  . GLN A 1 42 ? -6.803  6.632   -11.083 1.00 0.00 ? 42 GLN A HG2  9  
ATOM 11241 H HG3  . GLN A 1 42 ? -6.965  8.206   -10.281 1.00 0.00 ? 42 GLN A HG3  9  
ATOM 11242 H HE21 . GLN A 1 42 ? -5.269  6.881   -12.641 1.00 0.00 ? 42 GLN A HE21 9  
ATOM 11243 H HE22 . GLN A 1 42 ? -3.690  7.591   -12.393 1.00 0.00 ? 42 GLN A HE22 9  
ATOM 11244 N N    . HIS A 1 43 ? -3.867  5.283   -9.579  1.00 0.00 ? 43 HIS A N    9  
ATOM 11245 C CA   . HIS A 1 43 ? -2.551  4.919   -10.112 1.00 0.00 ? 43 HIS A CA   9  
ATOM 11246 C C    . HIS A 1 43 ? -2.663  4.256   -11.505 1.00 0.00 ? 43 HIS A C    9  
ATOM 11247 O O    . HIS A 1 43 ? -2.990  4.928   -12.481 1.00 0.00 ? 43 HIS A O    9  
ATOM 11248 C CB   . HIS A 1 43 ? -1.864  3.980   -9.109  1.00 0.00 ? 43 HIS A CB   9  
ATOM 11249 C CG   . HIS A 1 43 ? -1.811  4.508   -7.697  1.00 0.00 ? 43 HIS A CG   9  
ATOM 11250 N ND1  . HIS A 1 43 ? -1.368  3.731   -6.639  1.00 0.00 ? 43 HIS A ND1  9  
ATOM 11251 C CD2  . HIS A 1 43 ? -2.169  5.701   -7.118  1.00 0.00 ? 43 HIS A CD2  9  
ATOM 11252 C CE1  . HIS A 1 43 ? -1.490  4.480   -5.533  1.00 0.00 ? 43 HIS A CE1  9  
ATOM 11253 N NE2  . HIS A 1 43 ? -1.974  5.692   -5.755  1.00 0.00 ? 43 HIS A NE2  9  
ATOM 11254 H H    . HIS A 1 43 ? -3.918  6.091   -8.981  1.00 0.00 ? 43 HIS A H    9  
ATOM 11255 H HA   . HIS A 1 43 ? -1.951  5.825   -10.207 1.00 0.00 ? 43 HIS A HA   9  
ATOM 11256 H HB2  . HIS A 1 43 ? -2.409  3.039   -9.086  1.00 0.00 ? 43 HIS A HB2  9  
ATOM 11257 H HB3  . HIS A 1 43 ? -0.846  3.790   -9.448  1.00 0.00 ? 43 HIS A HB3  9  
ATOM 11258 H HD1  . HIS A 1 43 ? -1.031  2.781   -6.689  1.00 0.00 ? 43 HIS A HD1  9  
ATOM 11259 H HD2  . HIS A 1 43 ? -2.590  6.526   -7.643  1.00 0.00 ? 43 HIS A HD2  9  
ATOM 11260 H HE1  . HIS A 1 43 ? -1.252  4.125   -4.560  1.00 0.00 ? 43 HIS A HE1  9  
ATOM 11261 N N    . LEU A 1 44 ? -2.385  2.931   -11.566 1.00 0.00 ? 44 LEU A N    9  
ATOM 11262 C CA   . LEU A 1 44 ? -2.456  2.113   -12.783 1.00 0.00 ? 44 LEU A CA   9  
ATOM 11263 C C    . LEU A 1 44 ? -1.346  2.501   -13.750 1.00 0.00 ? 44 LEU A C    9  
ATOM 11264 O O    . LEU A 1 44 ? -0.459  1.688   -14.010 1.00 0.00 ? 44 LEU A O    9  
ATOM 11265 C CB   . LEU A 1 44 ? -3.850  2.186   -13.422 1.00 0.00 ? 44 LEU A CB   9  
ATOM 11266 C CG   . LEU A 1 44 ? -4.701  1.022   -12.891 1.00 0.00 ? 44 LEU A CG   9  
ATOM 11267 C CD1  . LEU A 1 44 ? -6.185  1.378   -13.007 1.00 0.00 ? 44 LEU A CD1  9  
ATOM 11268 C CD2  . LEU A 1 44 ? -4.419  -0.241  -13.710 1.00 0.00 ? 44 LEU A CD2  9  
ATOM 11269 H H    . LEU A 1 44 ? -2.112  2.463   -10.725 1.00 0.00 ? 44 LEU A H    9  
ATOM 11270 H HA   . LEU A 1 44 ? -2.281  1.079   -12.491 1.00 0.00 ? 44 LEU A HA   9  
ATOM 11271 H HB2  . LEU A 1 44 ? -4.327  3.129   -13.170 1.00 0.00 ? 44 LEU A HB2  9  
ATOM 11272 H HB3  . LEU A 1 44 ? -3.760  2.105   -14.506 1.00 0.00 ? 44 LEU A HB3  9  
ATOM 11273 H HG   . LEU A 1 44 ? -4.449  0.834   -11.838 1.00 0.00 ? 44 LEU A HG   9  
ATOM 11274 H HD11 . LEU A 1 44 ? -6.423  1.616   -14.044 1.00 0.00 ? 44 LEU A HD11 9  
ATOM 11275 H HD12 . LEU A 1 44 ? -6.404  2.242   -12.378 1.00 0.00 ? 44 LEU A HD12 9  
ATOM 11276 H HD13 . LEU A 1 44 ? -6.789  0.530   -12.682 1.00 0.00 ? 44 LEU A HD13 9  
ATOM 11277 H HD21 . LEU A 1 44 ? -4.687  -0.067  -14.753 1.00 0.00 ? 44 LEU A HD21 9  
ATOM 11278 H HD22 . LEU A 1 44 ? -5.009  -1.068  -13.317 1.00 0.00 ? 44 LEU A HD22 9  
ATOM 11279 H HD23 . LEU A 1 44 ? -3.360  -0.492  -13.646 1.00 0.00 ? 44 LEU A HD23 9  
ATOM 11280 N N    . ASP A 1 45 ? -1.372  3.731   -14.268 1.00 0.00 ? 45 ASP A N    9  
ATOM 11281 C CA   . ASP A 1 45 ? -0.298  4.213   -15.115 1.00 0.00 ? 45 ASP A CA   9  
ATOM 11282 C C    . ASP A 1 45 ? 0.977   4.175   -14.279 1.00 0.00 ? 45 ASP A C    9  
ATOM 11283 O O    . ASP A 1 45 ? 1.846   3.347   -14.532 1.00 0.00 ? 45 ASP A O    9  
ATOM 11284 C CB   . ASP A 1 45 ? -0.614  5.633   -15.597 1.00 0.00 ? 45 ASP A CB   9  
ATOM 11285 C CG   . ASP A 1 45 ? 0.604   6.266   -16.259 1.00 0.00 ? 45 ASP A CG   9  
ATOM 11286 O OD1  . ASP A 1 45 ? 0.884   5.883   -17.415 1.00 0.00 ? 45 ASP A OD1  9  
ATOM 11287 O OD2  . ASP A 1 45 ? 1.230   7.119   -15.596 1.00 0.00 ? 45 ASP A OD2  9  
ATOM 11288 H H    . ASP A 1 45 ? -2.138  4.355   -14.053 1.00 0.00 ? 45 ASP A H    9  
ATOM 11289 H HA   . ASP A 1 45 ? -0.189  3.553   -15.977 1.00 0.00 ? 45 ASP A HA   9  
ATOM 11290 H HB2  . ASP A 1 45 ? -1.432  5.593   -16.317 1.00 0.00 ? 45 ASP A HB2  9  
ATOM 11291 H HB3  . ASP A 1 45 ? -0.918  6.245   -14.748 1.00 0.00 ? 45 ASP A HB3  9  
ATOM 11292 N N    . ILE A 1 46 ? 1.026   5.071   -13.266 1.00 0.00 ? 46 ILE A N    9  
ATOM 11293 C CA   . ILE A 1 46 ? 2.099   5.190   -12.261 1.00 0.00 ? 46 ILE A CA   9  
ATOM 11294 C C    . ILE A 1 46 ? 3.523   5.186   -12.850 1.00 0.00 ? 46 ILE A C    9  
ATOM 11295 O O    . ILE A 1 46 ? 3.866   4.412   -13.734 1.00 0.00 ? 46 ILE A O    9  
ATOM 11296 C CB   . ILE A 1 46 ? 1.926   4.118   -11.162 1.00 0.00 ? 46 ILE A CB   9  
ATOM 11297 C CG1  . ILE A 1 46 ? 2.986   4.332   -10.076 1.00 0.00 ? 46 ILE A CG1  9  
ATOM 11298 C CG2  . ILE A 1 46 ? 2.057   2.702   -11.729 1.00 0.00 ? 46 ILE A CG2  9  
ATOM 11299 C CD1  . ILE A 1 46 ? 2.626   3.542   -8.817  1.00 0.00 ? 46 ILE A CD1  9  
ATOM 11300 H H    . ILE A 1 46 ? 0.255   5.714   -13.174 1.00 0.00 ? 46 ILE A H    9  
ATOM 11301 H HA   . ILE A 1 46 ? 1.960   6.153   -11.775 1.00 0.00 ? 46 ILE A HA   9  
ATOM 11302 H HB   . ILE A 1 46 ? 0.943   4.232   -10.720 1.00 0.00 ? 46 ILE A HB   9  
ATOM 11303 H HG12 . ILE A 1 46 ? 3.951   3.998   -10.445 1.00 0.00 ? 46 ILE A HG12 9  
ATOM 11304 H HG13 . ILE A 1 46 ? 3.038   5.392   -9.829  1.00 0.00 ? 46 ILE A HG13 9  
ATOM 11305 H HG21 . ILE A 1 46 ? 1.215   2.492   -12.378 1.00 0.00 ? 46 ILE A HG21 9  
ATOM 11306 H HG22 . ILE A 1 46 ? 2.061   1.988   -10.913 1.00 0.00 ? 46 ILE A HG22 9  
ATOM 11307 H HG23 . ILE A 1 46 ? 2.986   2.614   -12.290 1.00 0.00 ? 46 ILE A HG23 9  
ATOM 11308 H HD11 . ILE A 1 46 ? 3.264   3.864   -7.994  1.00 0.00 ? 46 ILE A HD11 9  
ATOM 11309 H HD12 . ILE A 1 46 ? 1.583   3.721   -8.556  1.00 0.00 ? 46 ILE A HD12 9  
ATOM 11310 H HD13 . ILE A 1 46 ? 2.780   2.479   -8.994  1.00 0.00 ? 46 ILE A HD13 9  
ATOM 11311 N N    . GLY A 1 47 ? 4.370   6.067   -12.321 1.00 0.00 ? 47 GLY A N    9  
ATOM 11312 C CA   . GLY A 1 47 ? 5.754   6.140   -12.745 1.00 0.00 ? 47 GLY A CA   9  
ATOM 11313 C C    . GLY A 1 47 ? 6.454   4.834   -12.381 1.00 0.00 ? 47 GLY A C    9  
ATOM 11314 O O    . GLY A 1 47 ? 6.245   4.305   -11.293 1.00 0.00 ? 47 GLY A O    9  
ATOM 11315 H H    . GLY A 1 47 ? 4.051   6.697   -11.597 1.00 0.00 ? 47 GLY A H    9  
ATOM 11316 H HA2  . GLY A 1 47 ? 5.799   6.294   -13.824 1.00 0.00 ? 47 GLY A HA2  9  
ATOM 11317 H HA3  . GLY A 1 47 ? 6.246   6.970   -12.239 1.00 0.00 ? 47 GLY A HA3  9  
ATOM 11318 N N    . LEU A 1 48 ? 7.280   4.309   -13.291 1.00 0.00 ? 48 LEU A N    9  
ATOM 11319 C CA   . LEU A 1 48 ? 7.990   3.061   -13.052 1.00 0.00 ? 48 LEU A CA   9  
ATOM 11320 C C    . LEU A 1 48 ? 8.735   3.134   -11.718 1.00 0.00 ? 48 LEU A C    9  
ATOM 11321 O O    . LEU A 1 48 ? 8.734   2.171   -10.954 1.00 0.00 ? 48 LEU A O    9  
ATOM 11322 C CB   . LEU A 1 48 ? 8.961   2.809   -14.216 1.00 0.00 ? 48 LEU A CB   9  
ATOM 11323 C CG   . LEU A 1 48 ? 9.760   1.513   -13.990 1.00 0.00 ? 48 LEU A CG   9  
ATOM 11324 C CD1  . LEU A 1 48 ? 8.816   0.307   -13.947 1.00 0.00 ? 48 LEU A CD1  9  
ATOM 11325 C CD2  . LEU A 1 48 ? 10.758  1.333   -15.136 1.00 0.00 ? 48 LEU A CD2  9  
ATOM 11326 H H    . LEU A 1 48 ? 7.420   4.782   -14.172 1.00 0.00 ? 48 LEU A H    9  
ATOM 11327 H HA   . LEU A 1 48 ? 7.263   2.250   -13.008 1.00 0.00 ? 48 LEU A HA   9  
ATOM 11328 H HB2  . LEU A 1 48 ? 8.395   2.725   -15.144 1.00 0.00 ? 48 LEU A HB2  9  
ATOM 11329 H HB3  . LEU A 1 48 ? 9.653   3.648   -14.293 1.00 0.00 ? 48 LEU A HB3  9  
ATOM 11330 H HG   . LEU A 1 48 ? 10.308  1.578   -13.049 1.00 0.00 ? 48 LEU A HG   9  
ATOM 11331 H HD11 . LEU A 1 48 ? 8.124   0.354   -14.788 1.00 0.00 ? 48 LEU A HD11 9  
ATOM 11332 H HD12 . LEU A 1 48 ? 9.397   -0.613  -14.006 1.00 0.00 ? 48 LEU A HD12 9  
ATOM 11333 H HD13 . LEU A 1 48 ? 8.253   0.315   -13.013 1.00 0.00 ? 48 LEU A HD13 9  
ATOM 11334 H HD21 . LEU A 1 48 ? 11.426  2.193   -15.176 1.00 0.00 ? 48 LEU A HD21 9  
ATOM 11335 H HD22 . LEU A 1 48 ? 10.218  1.248   -16.080 1.00 0.00 ? 48 LEU A HD22 9  
ATOM 11336 H HD23 . LEU A 1 48 ? 11.343  0.427   -14.971 1.00 0.00 ? 48 LEU A HD23 9  
ATOM 11337 N N    . LYS A 1 49 ? 9.363   4.281   -11.442 1.00 0.00 ? 49 LYS A N    9  
ATOM 11338 C CA   . LYS A 1 49 ? 10.103  4.486   -10.206 1.00 0.00 ? 49 LYS A CA   9  
ATOM 11339 C C    . LYS A 1 49 ? 9.170   4.329   -9.001  1.00 0.00 ? 49 LYS A C    9  
ATOM 11340 O O    . LYS A 1 49 ? 9.559   3.742   -7.996  1.00 0.00 ? 49 LYS A O    9  
ATOM 11341 C CB   . LYS A 1 49 ? 10.741  5.880   -10.224 1.00 0.00 ? 49 LYS A CB   9  
ATOM 11342 C CG   . LYS A 1 49 ? 11.820  5.942   -11.315 1.00 0.00 ? 49 LYS A CG   9  
ATOM 11343 C CD   . LYS A 1 49 ? 12.300  7.387   -11.506 1.00 0.00 ? 49 LYS A CD   9  
ATOM 11344 C CE   . LYS A 1 49 ? 13.118  7.839   -10.292 1.00 0.00 ? 49 LYS A CE   9  
ATOM 11345 N NZ   . LYS A 1 49 ? 13.734  9.158   -10.530 1.00 0.00 ? 49 LYS A NZ   9  
ATOM 11346 H H    . LYS A 1 49 ? 9.329   5.039   -12.108 1.00 0.00 ? 49 LYS A H    9  
ATOM 11347 H HA   . LYS A 1 49 ? 10.893  3.738   -10.139 1.00 0.00 ? 49 LYS A HA   9  
ATOM 11348 H HB2  . LYS A 1 49 ? 9.973   6.628   -10.427 1.00 0.00 ? 49 LYS A HB2  9  
ATOM 11349 H HB3  . LYS A 1 49 ? 11.194  6.080   -9.253  1.00 0.00 ? 49 LYS A HB3  9  
ATOM 11350 H HG2  . LYS A 1 49 ? 12.664  5.313   -11.027 1.00 0.00 ? 49 LYS A HG2  9  
ATOM 11351 H HG3  . LYS A 1 49 ? 11.407  5.577   -12.256 1.00 0.00 ? 49 LYS A HG3  9  
ATOM 11352 H HD2  . LYS A 1 49 ? 12.923  7.440   -12.400 1.00 0.00 ? 49 LYS A HD2  9  
ATOM 11353 H HD3  . LYS A 1 49 ? 11.437  8.043   -11.631 1.00 0.00 ? 49 LYS A HD3  9  
ATOM 11354 H HE2  . LYS A 1 49 ? 12.464  7.903   -9.421  1.00 0.00 ? 49 LYS A HE2  9  
ATOM 11355 H HE3  . LYS A 1 49 ? 13.904  7.108   -10.095 1.00 0.00 ? 49 LYS A HE3  9  
ATOM 11356 H HZ1  . LYS A 1 49 ? 13.011  9.844   -10.695 1.00 0.00 ? 49 LYS A HZ1  9  
ATOM 11357 H HZ2  . LYS A 1 49 ? 14.339  9.106   -11.337 1.00 0.00 ? 49 LYS A HZ2  9  
ATOM 11358 H HZ3  . LYS A 1 49 ? 14.275  9.428   -9.721  1.00 0.00 ? 49 LYS A HZ3  9  
ATOM 11359 N N    . GLN A 1 50 ? 7.940   4.854   -9.104  1.00 0.00 ? 50 GLN A N    9  
ATOM 11360 C CA   . GLN A 1 50 ? 6.965   4.767   -8.023  1.00 0.00 ? 50 GLN A CA   9  
ATOM 11361 C C    . GLN A 1 50 ? 6.556   3.307   -7.820  1.00 0.00 ? 50 GLN A C    9  
ATOM 11362 O O    . GLN A 1 50 ? 6.716   2.774   -6.737  1.00 0.00 ? 50 GLN A O    9  
ATOM 11363 C CB   . GLN A 1 50 ? 5.739   5.628   -8.353  1.00 0.00 ? 50 GLN A CB   9  
ATOM 11364 C CG   . GLN A 1 50 ? 6.143   7.092   -8.536  1.00 0.00 ? 50 GLN A CG   9  
ATOM 11365 C CD   . GLN A 1 50 ? 4.939   7.935   -8.949  1.00 0.00 ? 50 GLN A CD   9  
ATOM 11366 O OE1  . GLN A 1 50 ? 4.390   7.743   -10.030 1.00 0.00 ? 50 GLN A OE1  9  
ATOM 11367 N NE2  . GLN A 1 50 ? 4.528   8.866   -8.091  1.00 0.00 ? 50 GLN A NE2  9  
ATOM 11368 H H    . GLN A 1 50 ? 7.668   5.323   -9.956  1.00 0.00 ? 50 GLN A H    9  
ATOM 11369 H HA   . GLN A 1 50 ? 7.420   5.139   -7.102  1.00 0.00 ? 50 GLN A HA   9  
ATOM 11370 H HB2  . GLN A 1 50 ? 5.284   5.269   -9.268  1.00 0.00 ? 50 GLN A HB2  9  
ATOM 11371 H HB3  . GLN A 1 50 ? 5.017   5.554   -7.539  1.00 0.00 ? 50 GLN A HB3  9  
ATOM 11372 H HG2  . GLN A 1 50 ? 6.549   7.474   -7.598  1.00 0.00 ? 50 GLN A HG2  9  
ATOM 11373 H HG3  . GLN A 1 50 ? 6.905   7.162   -9.311  1.00 0.00 ? 50 GLN A HG3  9  
ATOM 11374 H HE21 . GLN A 1 50 ? 5.013   8.997   -7.212  1.00 0.00 ? 50 GLN A HE21 9  
ATOM 11375 H HE22 . GLN A 1 50 ? 3.733   9.443   -8.321  1.00 0.00 ? 50 GLN A HE22 9  
ATOM 11376 N N    . LYS A 1 51 ? 6.031   2.670   -8.875  1.00 0.00 ? 51 LYS A N    9  
ATOM 11377 C CA   . LYS A 1 51 ? 5.605   1.270   -8.828  1.00 0.00 ? 51 LYS A CA   9  
ATOM 11378 C C    . LYS A 1 51 ? 6.709   0.388   -8.232  1.00 0.00 ? 51 LYS A C    9  
ATOM 11379 O O    . LYS A 1 51 ? 6.441   -0.423  -7.346  1.00 0.00 ? 51 LYS A O    9  
ATOM 11380 C CB   . LYS A 1 51 ? 5.259   0.834   -10.258 1.00 0.00 ? 51 LYS A CB   9  
ATOM 11381 C CG   . LYS A 1 51 ? 4.766   -0.618  -10.272 1.00 0.00 ? 51 LYS A CG   9  
ATOM 11382 C CD   . LYS A 1 51 ? 3.601   -0.767  -11.260 1.00 0.00 ? 51 LYS A CD   9  
ATOM 11383 C CE   . LYS A 1 51 ? 4.055   -0.416  -12.684 1.00 0.00 ? 51 LYS A CE   9  
ATOM 11384 N NZ   . LYS A 1 51 ? 2.898   -0.303  -13.595 1.00 0.00 ? 51 LYS A NZ   9  
ATOM 11385 H H    . LYS A 1 51 ? 5.920   3.169   -9.748  1.00 0.00 ? 51 LYS A H    9  
ATOM 11386 H HA   . LYS A 1 51 ? 4.710   1.182   -8.203  1.00 0.00 ? 51 LYS A HA   9  
ATOM 11387 H HB2  . LYS A 1 51 ? 4.476   1.485   -10.644 1.00 0.00 ? 51 LYS A HB2  9  
ATOM 11388 H HB3  . LYS A 1 51 ? 6.143   0.923   -10.888 1.00 0.00 ? 51 LYS A HB3  9  
ATOM 11389 H HG2  . LYS A 1 51 ? 5.584   -1.277  -10.570 1.00 0.00 ? 51 LYS A HG2  9  
ATOM 11390 H HG3  . LYS A 1 51 ? 4.426   -0.896  -9.276  1.00 0.00 ? 51 LYS A HG3  9  
ATOM 11391 H HD2  . LYS A 1 51 ? 3.240   -1.797  -11.239 1.00 0.00 ? 51 LYS A HD2  9  
ATOM 11392 H HD3  . LYS A 1 51 ? 2.795   -0.099  -10.963 1.00 0.00 ? 51 LYS A HD3  9  
ATOM 11393 H HE2  . LYS A 1 51 ? 4.588   0.534   -12.671 1.00 0.00 ? 51 LYS A HE2  9  
ATOM 11394 H HE3  . LYS A 1 51 ? 4.724   -1.196  -13.049 1.00 0.00 ? 51 LYS A HE3  9  
ATOM 11395 H HZ1  . LYS A 1 51 ? 2.387   -1.174  -13.603 1.00 0.00 ? 51 LYS A HZ1  9  
ATOM 11396 H HZ2  . LYS A 1 51 ? 2.291   0.442   -13.281 1.00 0.00 ? 51 LYS A HZ2  9  
ATOM 11397 H HZ3  . LYS A 1 51 ? 3.225   -0.096  -14.530 1.00 0.00 ? 51 LYS A HZ3  9  
ATOM 11398 N N    . GLN A 1 52 ? 7.945   0.543   -8.719  1.00 0.00 ? 52 GLN A N    9  
ATOM 11399 C CA   . GLN A 1 52 ? 9.066   -0.248  -8.235  1.00 0.00 ? 52 GLN A CA   9  
ATOM 11400 C C    . GLN A 1 52 ? 9.334   0.066   -6.761  1.00 0.00 ? 52 GLN A C    9  
ATOM 11401 O O    . GLN A 1 52 ? 9.495   -0.849  -5.952  1.00 0.00 ? 52 GLN A O    9  
ATOM 11402 C CB   . GLN A 1 52 ? 10.301  0.049   -9.096  1.00 0.00 ? 52 GLN A CB   9  
ATOM 11403 C CG   . GLN A 1 52 ? 11.406  -0.975  -8.805  1.00 0.00 ? 52 GLN A CG   9  
ATOM 11404 C CD   . GLN A 1 52 ? 10.973  -2.384  -9.210  1.00 0.00 ? 52 GLN A CD   9  
ATOM 11405 O OE1  . GLN A 1 52 ? 10.376  -2.574  -10.266 1.00 0.00 ? 52 GLN A OE1  9  
ATOM 11406 N NE2  . GLN A 1 52 ? 11.276  -3.371  -8.368  1.00 0.00 ? 52 GLN A NE2  9  
ATOM 11407 H H    . GLN A 1 52 ? 8.116   1.226   -9.446  1.00 0.00 ? 52 GLN A H    9  
ATOM 11408 H HA   . GLN A 1 52 ? 8.812   -1.304  -8.329  1.00 0.00 ? 52 GLN A HA   9  
ATOM 11409 H HB2  . GLN A 1 52 ? 10.029  -0.004  -10.151 1.00 0.00 ? 52 GLN A HB2  9  
ATOM 11410 H HB3  . GLN A 1 52 ? 10.669  1.051   -8.871  1.00 0.00 ? 52 GLN A HB3  9  
ATOM 11411 H HG2  . GLN A 1 52 ? 12.300  -0.704  -9.368  1.00 0.00 ? 52 GLN A HG2  9  
ATOM 11412 H HG3  . GLN A 1 52 ? 11.640  -0.961  -7.741  1.00 0.00 ? 52 GLN A HG3  9  
ATOM 11413 H HE21 . GLN A 1 52 ? 11.781  -3.171  -7.518  1.00 0.00 ? 52 GLN A HE21 9  
ATOM 11414 H HE22 . GLN A 1 52 ? 10.997  -4.318  -8.581  1.00 0.00 ? 52 GLN A HE22 9  
ATOM 11415 N N    . TRP A 1 53 ? 9.382   1.359   -6.413  1.00 0.00 ? 53 TRP A N    9  
ATOM 11416 C CA   . TRP A 1 53 ? 9.631   1.783   -5.043  1.00 0.00 ? 53 TRP A CA   9  
ATOM 11417 C C    . TRP A 1 53 ? 8.582   1.182   -4.107  1.00 0.00 ? 53 TRP A C    9  
ATOM 11418 O O    . TRP A 1 53 ? 8.924   0.662   -3.050  1.00 0.00 ? 53 TRP A O    9  
ATOM 11419 C CB   . TRP A 1 53 ? 9.609   3.313   -4.970  1.00 0.00 ? 53 TRP A CB   9  
ATOM 11420 C CG   . TRP A 1 53 ? 9.593   3.864   -3.580  1.00 0.00 ? 53 TRP A CG   9  
ATOM 11421 C CD1  . TRP A 1 53 ? 10.599  3.782   -2.697  1.00 0.00 ? 53 TRP A CD1  9  
ATOM 11422 C CD2  . TRP A 1 53 ? 8.524   4.569   -2.884  1.00 0.00 ? 53 TRP A CD2  9  
ATOM 11423 N NE1  . TRP A 1 53 ? 10.255  4.367   -1.504  1.00 0.00 ? 53 TRP A NE1  9  
ATOM 11424 C CE2  . TRP A 1 53 ? 8.975   4.880   -1.562  1.00 0.00 ? 53 TRP A CE2  9  
ATOM 11425 C CE3  . TRP A 1 53 ? 7.213   4.978   -3.224  1.00 0.00 ? 53 TRP A CE3  9  
ATOM 11426 C CZ2  . TRP A 1 53 ? 8.176   5.560   -0.638  1.00 0.00 ? 53 TRP A CZ2  9  
ATOM 11427 C CZ3  . TRP A 1 53 ? 6.406   5.667   -2.298  1.00 0.00 ? 53 TRP A CZ3  9  
ATOM 11428 C CH2  . TRP A 1 53 ? 6.887   5.959   -1.008  1.00 0.00 ? 53 TRP A CH2  9  
ATOM 11429 H H    . TRP A 1 53 ? 9.242   2.072   -7.117  1.00 0.00 ? 53 TRP A H    9  
ATOM 11430 H HA   . TRP A 1 53 ? 10.618  1.431   -4.738  1.00 0.00 ? 53 TRP A HA   9  
ATOM 11431 H HB2  . TRP A 1 53 ? 10.491  3.697   -5.483  1.00 0.00 ? 53 TRP A HB2  9  
ATOM 11432 H HB3  . TRP A 1 53 ? 8.723   3.672   -5.490  1.00 0.00 ? 53 TRP A HB3  9  
ATOM 11433 H HD1  . TRP A 1 53 ? 11.548  3.303   -2.891  1.00 0.00 ? 53 TRP A HD1  9  
ATOM 11434 H HE1  . TRP A 1 53 ? 10.848  4.419   -0.678  1.00 0.00 ? 53 TRP A HE1  9  
ATOM 11435 H HE3  . TRP A 1 53 ? 6.826   4.762   -4.207  1.00 0.00 ? 53 TRP A HE3  9  
ATOM 11436 H HZ2  . TRP A 1 53 ? 8.550   5.775   0.352   1.00 0.00 ? 53 TRP A HZ2  9  
ATOM 11437 H HZ3  . TRP A 1 53 ? 5.410   5.970   -2.581  1.00 0.00 ? 53 TRP A HZ3  9  
ATOM 11438 H HH2  . TRP A 1 53 ? 6.265   6.494   -0.306  1.00 0.00 ? 53 TRP A HH2  9  
ATOM 11439 N N    . LEU A 1 54 ? 7.305   1.249   -4.497  1.00 0.00 ? 54 LEU A N    9  
ATOM 11440 C CA   . LEU A 1 54 ? 6.229   0.699   -3.694  1.00 0.00 ? 54 LEU A CA   9  
ATOM 11441 C C    . LEU A 1 54 ? 6.501   -0.774  -3.427  1.00 0.00 ? 54 LEU A C    9  
ATOM 11442 O O    . LEU A 1 54 ? 6.453   -1.227  -2.285  1.00 0.00 ? 54 LEU A O    9  
ATOM 11443 C CB   . LEU A 1 54 ? 4.885   0.848   -4.431  1.00 0.00 ? 54 LEU A CB   9  
ATOM 11444 C CG   . LEU A 1 54 ? 4.421   2.314   -4.472  1.00 0.00 ? 54 LEU A CG   9  
ATOM 11445 C CD1  . LEU A 1 54 ? 3.162   2.413   -5.335  1.00 0.00 ? 54 LEU A CD1  9  
ATOM 11446 C CD2  . LEU A 1 54 ? 4.107   2.816   -3.058  1.00 0.00 ? 54 LEU A CD2  9  
ATOM 11447 H H    . LEU A 1 54 ? 7.074   1.689   -5.373  1.00 0.00 ? 54 LEU A H    9  
ATOM 11448 H HA   . LEU A 1 54 ? 6.183   1.225   -2.756  1.00 0.00 ? 54 LEU A HA   9  
ATOM 11449 H HB2  . LEU A 1 54 ? 4.992   0.480   -5.450  1.00 0.00 ? 54 LEU A HB2  9  
ATOM 11450 H HB3  . LEU A 1 54 ? 4.129   0.251   -3.917  1.00 0.00 ? 54 LEU A HB3  9  
ATOM 11451 H HG   . LEU A 1 54 ? 5.199   2.931   -4.909  1.00 0.00 ? 54 LEU A HG   9  
ATOM 11452 H HD11 . LEU A 1 54 ? 2.374   1.798   -4.902  1.00 0.00 ? 54 LEU A HD11 9  
ATOM 11453 H HD12 . LEU A 1 54 ? 2.832   3.451   -5.379  1.00 0.00 ? 54 LEU A HD12 9  
ATOM 11454 H HD13 . LEU A 1 54 ? 3.384   2.060   -6.341  1.00 0.00 ? 54 LEU A HD13 9  
ATOM 11455 H HD21 . LEU A 1 54 ? 5.036   3.026   -2.531  1.00 0.00 ? 54 LEU A HD21 9  
ATOM 11456 H HD22 . LEU A 1 54 ? 3.518   3.730   -3.120  1.00 0.00 ? 54 LEU A HD22 9  
ATOM 11457 H HD23 . LEU A 1 54 ? 3.544   2.057   -2.516  1.00 0.00 ? 54 LEU A HD23 9  
ATOM 11458 N N    . MET A 1 55 ? 6.771   -1.513  -4.500  1.00 0.00 ? 55 MET A N    9  
ATOM 11459 C CA   . MET A 1 55 ? 6.958   -2.945  -4.444  1.00 0.00 ? 55 MET A CA   9  
ATOM 11460 C C    . MET A 1 55 ? 8.071   -3.361  -3.476  1.00 0.00 ? 55 MET A C    9  
ATOM 11461 O O    . MET A 1 55 ? 7.827   -4.193  -2.602  1.00 0.00 ? 55 MET A O    9  
ATOM 11462 C CB   . MET A 1 55 ? 7.265   -3.441  -5.866  1.00 0.00 ? 55 MET A CB   9  
ATOM 11463 C CG   . MET A 1 55 ? 7.212   -4.971  -5.929  1.00 0.00 ? 55 MET A CG   9  
ATOM 11464 S SD   . MET A 1 55 ? 7.927   -5.671  -7.440  1.00 0.00 ? 55 MET A SD   9  
ATOM 11465 C CE   . MET A 1 55 ? 6.801   -4.961  -8.665  1.00 0.00 ? 55 MET A CE   9  
ATOM 11466 H H    . MET A 1 55 ? 6.829   -1.063  -5.407  1.00 0.00 ? 55 MET A H    9  
ATOM 11467 H HA   . MET A 1 55 ? 6.021   -3.389  -4.102  1.00 0.00 ? 55 MET A HA   9  
ATOM 11468 H HB2  . MET A 1 55 ? 6.532   -3.029  -6.557  1.00 0.00 ? 55 MET A HB2  9  
ATOM 11469 H HB3  . MET A 1 55 ? 8.260   -3.106  -6.159  1.00 0.00 ? 55 MET A HB3  9  
ATOM 11470 H HG2  . MET A 1 55 ? 7.755   -5.374  -5.076  1.00 0.00 ? 55 MET A HG2  9  
ATOM 11471 H HG3  . MET A 1 55 ? 6.170   -5.286  -5.859  1.00 0.00 ? 55 MET A HG3  9  
ATOM 11472 H HE1  . MET A 1 55 ? 7.070   -5.324  -9.657  1.00 0.00 ? 55 MET A HE1  9  
ATOM 11473 H HE2  . MET A 1 55 ? 6.878   -3.874  -8.645  1.00 0.00 ? 55 MET A HE2  9  
ATOM 11474 H HE3  . MET A 1 55 ? 5.778   -5.258  -8.435  1.00 0.00 ? 55 MET A HE3  9  
ATOM 11475 N N    . THR A 1 56 ? 9.290   -2.820  -3.639  1.00 0.00 ? 56 THR A N    9  
ATOM 11476 C CA   . THR A 1 56 ? 10.433  -3.259  -2.833  1.00 0.00 ? 56 THR A CA   9  
ATOM 11477 C C    . THR A 1 56 ? 11.049  -2.102  -2.033  1.00 0.00 ? 56 THR A C    9  
ATOM 11478 O O    . THR A 1 56 ? 12.263  -1.906  -2.049  1.00 0.00 ? 56 THR A O    9  
ATOM 11479 C CB   . THR A 1 56 ? 11.460  -3.945  -3.759  1.00 0.00 ? 56 THR A CB   9  
ATOM 11480 O OG1  . THR A 1 56 ? 12.595  -4.342  -3.018  1.00 0.00 ? 56 THR A OG1  9  
ATOM 11481 C CG2  . THR A 1 56 ? 11.886  -3.001  -4.890  1.00 0.00 ? 56 THR A CG2  9  
ATOM 11482 H H    . THR A 1 56 ? 9.437   -2.109  -4.344  1.00 0.00 ? 56 THR A H    9  
ATOM 11483 H HA   . THR A 1 56 ? 10.087  -4.001  -2.127  1.00 0.00 ? 56 THR A HA   9  
ATOM 11484 H HB   . THR A 1 56 ? 11.001  -4.832  -4.192  1.00 0.00 ? 56 THR A HB   9  
ATOM 11485 H HG1  . THR A 1 56 ? 12.306  -4.885  -2.281  1.00 0.00 ? 56 THR A HG1  9  
ATOM 11486 H HG21 . THR A 1 56 ? 12.707  -3.453  -5.447  1.00 0.00 ? 56 THR A HG21 9  
ATOM 11487 H HG22 . THR A 1 56 ? 12.214  -2.049  -4.475  1.00 0.00 ? 56 THR A HG22 9  
ATOM 11488 H HG23 . THR A 1 56 ? 11.046  -2.835  -5.561  1.00 0.00 ? 56 THR A HG23 9  
ATOM 11489 N N    . GLU A 1 57 ? 10.216  -1.347  -1.306  1.00 0.00 ? 57 GLU A N    9  
ATOM 11490 C CA   . GLU A 1 57 ? 10.711  -0.271  -0.454  1.00 0.00 ? 57 GLU A CA   9  
ATOM 11491 C C    . GLU A 1 57 ? 9.588   0.269   0.434   1.00 0.00 ? 57 GLU A C    9  
ATOM 11492 O O    . GLU A 1 57 ? 9.643   0.142   1.654   1.00 0.00 ? 57 GLU A O    9  
ATOM 11493 C CB   . GLU A 1 57 ? 11.312  0.854   -1.318  1.00 0.00 ? 57 GLU A CB   9  
ATOM 11494 C CG   . GLU A 1 57 ? 12.566  1.430   -0.647  1.00 0.00 ? 57 GLU A CG   9  
ATOM 11495 C CD   . GLU A 1 57 ? 12.212  2.209   0.617   1.00 0.00 ? 57 GLU A CD   9  
ATOM 11496 O OE1  . GLU A 1 57 ? 11.802  3.382   0.464   1.00 0.00 ? 57 GLU A OE1  9  
ATOM 11497 O OE2  . GLU A 1 57 ? 12.358  1.620   1.706   1.00 0.00 ? 57 GLU A OE2  9  
ATOM 11498 H H    . GLU A 1 57 ? 9.222   -1.525  -1.337  1.00 0.00 ? 57 GLU A H    9  
ATOM 11499 H HA   . GLU A 1 57 ? 11.493  -0.675  0.186   1.00 0.00 ? 57 GLU A HA   9  
ATOM 11500 H HB2  . GLU A 1 57 ? 11.581  0.461   -2.298  1.00 0.00 ? 57 GLU A HB2  9  
ATOM 11501 H HB3  . GLU A 1 57 ? 10.579  1.643   -1.441  1.00 0.00 ? 57 GLU A HB3  9  
ATOM 11502 H HG2  . GLU A 1 57 ? 13.242  0.615   -0.389  1.00 0.00 ? 57 GLU A HG2  9  
ATOM 11503 H HG3  . GLU A 1 57 ? 13.067  2.099   -1.346  1.00 0.00 ? 57 GLU A HG3  9  
ATOM 11504 N N    . ALA A 1 58 ? 8.577   0.884   -0.184  1.00 0.00 ? 58 ALA A N    9  
ATOM 11505 C CA   . ALA A 1 58 ? 7.480   1.505   0.544   1.00 0.00 ? 58 ALA A CA   9  
ATOM 11506 C C    . ALA A 1 58 ? 6.671   0.470   1.319   1.00 0.00 ? 58 ALA A C    9  
ATOM 11507 O O    . ALA A 1 58 ? 6.402   0.655   2.503   1.00 0.00 ? 58 ALA A O    9  
ATOM 11508 C CB   . ALA A 1 58 ? 6.579   2.236   -0.444  1.00 0.00 ? 58 ALA A CB   9  
ATOM 11509 H H    . ALA A 1 58 ? 8.571   0.938   -1.195  1.00 0.00 ? 58 ALA A H    9  
ATOM 11510 H HA   . ALA A 1 58 ? 7.892   2.230   1.248   1.00 0.00 ? 58 ALA A HA   9  
ATOM 11511 H HB1  . ALA A 1 58 ? 6.126   3.093   0.045   1.00 0.00 ? 58 ALA A HB1  9  
ATOM 11512 H HB2  . ALA A 1 58 ? 7.168   2.573   -1.296  1.00 0.00 ? 58 ALA A HB2  9  
ATOM 11513 H HB3  . ALA A 1 58 ? 5.794   1.558   -0.787  1.00 0.00 ? 58 ALA A HB3  9  
ATOM 11514 N N    . LEU A 1 59 ? 6.268   -0.608  0.639   1.00 0.00 ? 59 LEU A N    9  
ATOM 11515 C CA   . LEU A 1 59 ? 5.449   -1.647  1.244   1.00 0.00 ? 59 LEU A CA   9  
ATOM 11516 C C    . LEU A 1 59 ? 6.311   -2.585  2.097   1.00 0.00 ? 59 LEU A C    9  
ATOM 11517 O O    . LEU A 1 59 ? 5.827   -3.147  3.077   1.00 0.00 ? 59 LEU A O    9  
ATOM 11518 C CB   . LEU A 1 59 ? 4.726   -2.420  0.130   1.00 0.00 ? 59 LEU A CB   9  
ATOM 11519 C CG   . LEU A 1 59 ? 3.807   -1.476  -0.674  1.00 0.00 ? 59 LEU A CG   9  
ATOM 11520 C CD1  . LEU A 1 59 ? 3.149   -2.259  -1.811  1.00 0.00 ? 59 LEU A CD1  9  
ATOM 11521 C CD2  . LEU A 1 59 ? 2.714   -0.887  0.225   1.00 0.00 ? 59 LEU A CD2  9  
ATOM 11522 H H    . LEU A 1 59 ? 6.530   -0.712  -0.335  1.00 0.00 ? 59 LEU A H    9  
ATOM 11523 H HA   . LEU A 1 59 ? 4.707   -1.183  1.891   1.00 0.00 ? 59 LEU A HA   9  
ATOM 11524 H HB2  . LEU A 1 59 ? 5.466   -2.858  -0.540  1.00 0.00 ? 59 LEU A HB2  9  
ATOM 11525 H HB3  . LEU A 1 59 ? 4.130   -3.216  0.568   1.00 0.00 ? 59 LEU A HB3  9  
ATOM 11526 H HG   . LEU A 1 59 ? 4.396   -0.664  -1.096  1.00 0.00 ? 59 LEU A HG   9  
ATOM 11527 H HD11 . LEU A 1 59 ? 3.918   -2.726  -2.426  1.00 0.00 ? 59 LEU A HD11 9  
ATOM 11528 H HD12 . LEU A 1 59 ? 2.500   -3.029  -1.394  1.00 0.00 ? 59 LEU A HD12 9  
ATOM 11529 H HD13 . LEU A 1 59 ? 2.557   -1.579  -2.425  1.00 0.00 ? 59 LEU A HD13 9  
ATOM 11530 H HD21 . LEU A 1 59 ? 1.963   -0.397  -0.393  1.00 0.00 ? 59 LEU A HD21 9  
ATOM 11531 H HD22 . LEU A 1 59 ? 2.245   -1.683  0.798   1.00 0.00 ? 59 LEU A HD22 9  
ATOM 11532 H HD23 . LEU A 1 59 ? 3.151   -0.157  0.904   1.00 0.00 ? 59 LEU A HD23 9  
ATOM 11533 N N    . VAL A 1 60 ? 7.585   -2.753  1.729   1.00 0.00 ? 60 VAL A N    9  
ATOM 11534 C CA   . VAL A 1 60 ? 8.492   -3.623  2.465   1.00 0.00 ? 60 VAL A CA   9  
ATOM 11535 C C    . VAL A 1 60 ? 8.887   -2.959  3.783   1.00 0.00 ? 60 VAL A C    9  
ATOM 11536 O O    . VAL A 1 60 ? 9.131   -1.758  3.819   1.00 0.00 ? 60 VAL A O    9  
ATOM 11537 C CB   . VAL A 1 60 ? 9.728   -3.911  1.602   1.00 0.00 ? 60 VAL A CB   9  
ATOM 11538 C CG1  . VAL A 1 60 ? 10.676  -4.866  2.331   1.00 0.00 ? 60 VAL A CG1  9  
ATOM 11539 C CG2  . VAL A 1 60 ? 9.289   -4.551  0.289   1.00 0.00 ? 60 VAL A CG2  9  
ATOM 11540 H H    . VAL A 1 60 ? 7.939   -2.268  0.918   1.00 0.00 ? 60 VAL A H    9  
ATOM 11541 H HA   . VAL A 1 60 ? 7.984   -4.565  2.679   1.00 0.00 ? 60 VAL A HA   9  
ATOM 11542 H HB   . VAL A 1 60 ? 10.250  -2.975  1.391   1.00 0.00 ? 60 VAL A HB   9  
ATOM 11543 H HG11 . VAL A 1 60 ? 11.087  -4.373  3.211   1.00 0.00 ? 60 VAL A HG11 9  
ATOM 11544 H HG12 . VAL A 1 60 ? 11.490  -5.149  1.661   1.00 0.00 ? 60 VAL A HG12 9  
ATOM 11545 H HG13 . VAL A 1 60 ? 10.131  -5.759  2.635   1.00 0.00 ? 60 VAL A HG13 9  
ATOM 11546 H HG21 . VAL A 1 60 ? 10.163  -4.939  -0.233  1.00 0.00 ? 60 VAL A HG21 9  
ATOM 11547 H HG22 . VAL A 1 60 ? 8.796   -3.804  -0.331  1.00 0.00 ? 60 VAL A HG22 9  
ATOM 11548 H HG23 . VAL A 1 60 ? 8.598   -5.369  0.494   1.00 0.00 ? 60 VAL A HG23 9  
ATOM 11549 N N    . ASN A 1 61 ? 8.945   -3.757  4.866   1.00 0.00 ? 61 ASN A N    9  
ATOM 11550 C CA   . ASN A 1 61 ? 9.326   -3.278  6.203   1.00 0.00 ? 61 ASN A CA   9  
ATOM 11551 C C    . ASN A 1 61 ? 8.248   -2.350  6.802   1.00 0.00 ? 61 ASN A C    9  
ATOM 11552 O O    . ASN A 1 61 ? 8.323   -2.004  7.980   1.00 0.00 ? 61 ASN A O    9  
ATOM 11553 C CB   . ASN A 1 61 ? 10.717  -2.594  6.145   1.00 0.00 ? 61 ASN A CB   9  
ATOM 11554 C CG   . ASN A 1 61 ? 10.688  -1.154  6.664   1.00 0.00 ? 61 ASN A CG   9  
ATOM 11555 O OD1  . ASN A 1 61 ? 11.069  -0.895  7.802   1.00 0.00 ? 61 ASN A OD1  9  
ATOM 11556 N ND2  . ASN A 1 61 ? 10.241  -0.219  5.825   1.00 0.00 ? 61 ASN A ND2  9  
ATOM 11557 H H    . ASN A 1 61 ? 8.721   -4.736  4.766   1.00 0.00 ? 61 ASN A H    9  
ATOM 11558 H HA   . ASN A 1 61 ? 9.410   -4.148  6.856   1.00 0.00 ? 61 ASN A HA   9  
ATOM 11559 H HB2  . ASN A 1 61 ? 11.413  -3.169  6.757   1.00 0.00 ? 61 ASN A HB2  9  
ATOM 11560 H HB3  . ASN A 1 61 ? 11.079  -2.594  5.117   1.00 0.00 ? 61 ASN A HB3  9  
ATOM 11561 H HD21 . ASN A 1 61 ? 9.929   -0.479  4.896   1.00 0.00 ? 61 ASN A HD21 9  
ATOM 11562 H HD22 . ASN A 1 61 ? 10.213  0.747   6.117   1.00 0.00 ? 61 ASN A HD22 9  
ATOM 11563 N N    . ASN A 1 62 ? 7.249   -1.953  6.002   1.00 0.00 ? 62 ASN A N    9  
ATOM 11564 C CA   . ASN A 1 62 ? 6.192   -1.067  6.463   1.00 0.00 ? 62 ASN A CA   9  
ATOM 11565 C C    . ASN A 1 62 ? 5.449   -1.712  7.643   1.00 0.00 ? 62 ASN A C    9  
ATOM 11566 O O    . ASN A 1 62 ? 4.963   -2.834  7.515   1.00 0.00 ? 62 ASN A O    9  
ATOM 11567 C CB   . ASN A 1 62 ? 5.234   -0.803  5.306   1.00 0.00 ? 62 ASN A CB   9  
ATOM 11568 C CG   . ASN A 1 62 ? 4.411   0.456   5.545   1.00 0.00 ? 62 ASN A CG   9  
ATOM 11569 O OD1  . ASN A 1 62 ? 3.642   0.524   6.500   1.00 0.00 ? 62 ASN A OD1  9  
ATOM 11570 N ND2  . ASN A 1 62 ? 4.575   1.451   4.673   1.00 0.00 ? 62 ASN A ND2  9  
ATOM 11571 H H    . ASN A 1 62 ? 7.217   -2.268  5.046   1.00 0.00 ? 62 ASN A H    9  
ATOM 11572 H HA   . ASN A 1 62 ? 6.638   -0.125  6.773   1.00 0.00 ? 62 ASN A HA   9  
ATOM 11573 H HB2  . ASN A 1 62 ? 5.805   -0.689  4.389   1.00 0.00 ? 62 ASN A HB2  9  
ATOM 11574 H HB3  . ASN A 1 62 ? 4.563   -1.648  5.202   1.00 0.00 ? 62 ASN A HB3  9  
ATOM 11575 H HD21 . ASN A 1 62 ? 5.220   1.343   3.897   1.00 0.00 ? 62 ASN A HD21 9  
ATOM 11576 H HD22 . ASN A 1 62 ? 4.056   2.308   4.787   1.00 0.00 ? 62 ASN A HD22 9  
ATOM 11577 N N    . PRO A 1 63 ? 5.352   -1.015  8.796   1.00 0.00 ? 63 PRO A N    9  
ATOM 11578 C CA   . PRO A 1 63 ? 4.680   -1.544  9.969   1.00 0.00 ? 63 PRO A CA   9  
ATOM 11579 C C    . PRO A 1 63 ? 3.184   -1.782  9.718   1.00 0.00 ? 63 PRO A C    9  
ATOM 11580 O O    . PRO A 1 63 ? 2.529   -2.426  10.535  1.00 0.00 ? 63 PRO A O    9  
ATOM 11581 C CB   . PRO A 1 63 ? 4.891   -0.504  11.074  1.00 0.00 ? 63 PRO A CB   9  
ATOM 11582 C CG   . PRO A 1 63 ? 5.572   0.707   10.426  1.00 0.00 ? 63 PRO A CG   9  
ATOM 11583 C CD   . PRO A 1 63 ? 5.910   0.309   8.990   1.00 0.00 ? 63 PRO A CD   9  
ATOM 11584 H HA   . PRO A 1 63 ? 5.151   -2.484  10.262  1.00 0.00 ? 63 PRO A HA   9  
ATOM 11585 H HB2  . PRO A 1 63 ? 3.931   -0.208  11.501  1.00 0.00 ? 63 PRO A HB2  9  
ATOM 11586 H HB3  . PRO A 1 63 ? 5.532   -0.916  11.854  1.00 0.00 ? 63 PRO A HB3  9  
ATOM 11587 H HG2  . PRO A 1 63 ? 4.892   1.560   10.425  1.00 0.00 ? 63 PRO A HG2  9  
ATOM 11588 H HG3  . PRO A 1 63 ? 6.483   0.959   10.969  1.00 0.00 ? 63 PRO A HG3  9  
ATOM 11589 H HD2  . PRO A 1 63 ? 5.461   1.015   8.292   1.00 0.00 ? 63 PRO A HD2  9  
ATOM 11590 H HD3  . PRO A 1 63 ? 6.993   0.284   8.859   1.00 0.00 ? 63 PRO A HD3  9  
ATOM 11591 N N    . LYS A 1 64 ? 2.639   -1.261  8.603   1.00 0.00 ? 64 LYS A N    9  
ATOM 11592 C CA   . LYS A 1 64 ? 1.220   -1.408  8.292   1.00 0.00 ? 64 LYS A CA   9  
ATOM 11593 C C    . LYS A 1 64 ? 1.001   -2.327  7.087   1.00 0.00 ? 64 LYS A C    9  
ATOM 11594 O O    . LYS A 1 64 ? -0.126  -2.449  6.618   1.00 0.00 ? 64 LYS A O    9  
ATOM 11595 C CB   . LYS A 1 64 ? 0.621   -0.021  8.027   1.00 0.00 ? 64 LYS A CB   9  
ATOM 11596 C CG   . LYS A 1 64 ? 0.726   0.838   9.290   1.00 0.00 ? 64 LYS A CG   9  
ATOM 11597 C CD   . LYS A 1 64 ? 0.230   2.253   8.992   1.00 0.00 ? 64 LYS A CD   9  
ATOM 11598 C CE   . LYS A 1 64 ? 0.286   3.095   10.270  1.00 0.00 ? 64 LYS A CE   9  
ATOM 11599 N NZ   . LYS A 1 64 ? -0.024  4.508   9.988   1.00 0.00 ? 64 LYS A NZ   9  
ATOM 11600 H H    . LYS A 1 64 ? 3.218   -0.743  7.956   1.00 0.00 ? 64 LYS A H    9  
ATOM 11601 H HA   . LYS A 1 64 ? 0.711   -1.847  9.150   1.00 0.00 ? 64 LYS A HA   9  
ATOM 11602 H HB2  . LYS A 1 64 ? 1.163   0.458   7.213   1.00 0.00 ? 64 LYS A HB2  9  
ATOM 11603 H HB3  . LYS A 1 64 ? -0.429  -0.127  7.749   1.00 0.00 ? 64 LYS A HB3  9  
ATOM 11604 H HG2  . LYS A 1 64 ? 0.118   0.397   10.080  1.00 0.00 ? 64 LYS A HG2  9  
ATOM 11605 H HG3  . LYS A 1 64 ? 1.766   0.883   9.616   1.00 0.00 ? 64 LYS A HG3  9  
ATOM 11606 H HD2  . LYS A 1 64 ? 0.865   2.707   8.229   1.00 0.00 ? 64 LYS A HD2  9  
ATOM 11607 H HD3  . LYS A 1 64 ? -0.798  2.209   8.629   1.00 0.00 ? 64 LYS A HD3  9  
ATOM 11608 H HE2  . LYS A 1 64 ? -0.439  2.704   10.987  1.00 0.00 ? 64 LYS A HE2  9  
ATOM 11609 H HE3  . LYS A 1 64 ? 1.286   3.027   10.700  1.00 0.00 ? 64 LYS A HE3  9  
ATOM 11610 H HZ1  . LYS A 1 64 ? 0.653   4.879   9.335   1.00 0.00 ? 64 LYS A HZ1  9  
ATOM 11611 H HZ2  . LYS A 1 64 ? 0.014   5.039   10.847  1.00 0.00 ? 64 LYS A HZ2  9  
ATOM 11612 H HZ3  . LYS A 1 64 ? -0.948  4.579   9.590   1.00 0.00 ? 64 LYS A HZ3  9  
ATOM 11613 N N    . ILE A 1 65 ? 2.067   -2.980  6.587   1.00 0.00 ? 65 ILE A N    9  
ATOM 11614 C CA   . ILE A 1 65 ? 1.951   -3.897  5.452   1.00 0.00 ? 65 ILE A CA   9  
ATOM 11615 C C    . ILE A 1 65 ? 2.765   -5.157  5.737   1.00 0.00 ? 65 ILE A C    9  
ATOM 11616 O O    . ILE A 1 65 ? 3.697   -5.134  6.542   1.00 0.00 ? 65 ILE A O    9  
ATOM 11617 C CB   . ILE A 1 65 ? 2.456   -3.224  4.152   1.00 0.00 ? 65 ILE A CB   9  
ATOM 11618 C CG1  . ILE A 1 65 ? 1.832   -1.822  3.959   1.00 0.00 ? 65 ILE A CG1  9  
ATOM 11619 C CG2  . ILE A 1 65 ? 2.116   -4.108  2.943   1.00 0.00 ? 65 ILE A CG2  9  
ATOM 11620 C CD1  . ILE A 1 65 ? 0.370   -1.930  3.516   1.00 0.00 ? 65 ILE A CD1  9  
ATOM 11621 H H    . ILE A 1 65 ? 2.980   -2.849  7.003   1.00 0.00 ? 65 ILE A H    9  
ATOM 11622 H HA   . ILE A 1 65 ? 0.907   -4.177  5.325   1.00 0.00 ? 65 ILE A HA   9  
ATOM 11623 H HB   . ILE A 1 65 ? 3.535   -3.122  4.209   1.00 0.00 ? 65 ILE A HB   9  
ATOM 11624 H HG12 . ILE A 1 65 ? 1.888   -1.262  4.890   1.00 0.00 ? 65 ILE A HG12 9  
ATOM 11625 H HG13 . ILE A 1 65 ? 2.395   -1.287  3.194   1.00 0.00 ? 65 ILE A HG13 9  
ATOM 11626 H HG21 . ILE A 1 65 ? 2.786   -4.967  2.919   1.00 0.00 ? 65 ILE A HG21 9  
ATOM 11627 H HG22 . ILE A 1 65 ? 1.085   -4.455  3.017   1.00 0.00 ? 65 ILE A HG22 9  
ATOM 11628 H HG23 . ILE A 1 65 ? 2.240   -3.535  2.027   1.00 0.00 ? 65 ILE A HG23 9  
ATOM 11629 H HD11 . ILE A 1 65 ? -0.105  -0.951  3.596   1.00 0.00 ? 65 ILE A HD11 9  
ATOM 11630 H HD12 . ILE A 1 65 ? -0.157  -2.637  4.149   1.00 0.00 ? 65 ILE A HD12 9  
ATOM 11631 H HD13 . ILE A 1 65 ? 0.325   -2.267  2.482   1.00 0.00 ? 65 ILE A HD13 9  
ATOM 11632 N N    . GLU A 1 66 ? 2.413   -6.254  5.064   1.00 0.00 ? 66 GLU A N    9  
ATOM 11633 C CA   . GLU A 1 66 ? 3.128   -7.511  5.185   1.00 0.00 ? 66 GLU A CA   9  
ATOM 11634 C C    . GLU A 1 66 ? 3.058   -8.244  3.848   1.00 0.00 ? 66 GLU A C    9  
ATOM 11635 O O    . GLU A 1 66 ? 2.046   -8.169  3.156   1.00 0.00 ? 66 GLU A O    9  
ATOM 11636 C CB   . GLU A 1 66 ? 2.506   -8.352  6.307   1.00 0.00 ? 66 GLU A CB   9  
ATOM 11637 C CG   . GLU A 1 66 ? 3.341   -9.618  6.552   1.00 0.00 ? 66 GLU A CG   9  
ATOM 11638 C CD   . GLU A 1 66 ? 4.802   -9.275  6.817   1.00 0.00 ? 66 GLU A CD   9  
ATOM 11639 O OE1  . GLU A 1 66 ? 5.099   -8.906  7.974   1.00 0.00 ? 66 GLU A OE1  9  
ATOM 11640 O OE2  . GLU A 1 66 ? 5.595   -9.384  5.856   1.00 0.00 ? 66 GLU A OE2  9  
ATOM 11641 H H    . GLU A 1 66 ? 1.622   -6.218  4.436   1.00 0.00 ? 66 GLU A H    9  
ATOM 11642 H HA   . GLU A 1 66 ? 4.171   -7.302  5.421   1.00 0.00 ? 66 GLU A HA   9  
ATOM 11643 H HB2  . GLU A 1 66 ? 2.473   -7.763  7.219   1.00 0.00 ? 66 GLU A HB2  9  
ATOM 11644 H HB3  . GLU A 1 66 ? 1.491   -8.637  6.025   1.00 0.00 ? 66 GLU A HB3  9  
ATOM 11645 H HG2  . GLU A 1 66 ? 2.938   -10.149 7.414   1.00 0.00 ? 66 GLU A HG2  9  
ATOM 11646 H HG3  . GLU A 1 66 ? 3.279   -10.265 5.677   1.00 0.00 ? 66 GLU A HG3  9  
ATOM 11647 N N    . VAL A 1 67 ? 4.134   -8.945  3.487   1.00 0.00 ? 67 VAL A N    9  
ATOM 11648 C CA   . VAL A 1 67 ? 4.192   -9.676  2.231   1.00 0.00 ? 67 VAL A CA   9  
ATOM 11649 C C    . VAL A 1 67 ? 3.768   -11.119 2.475   1.00 0.00 ? 67 VAL A C    9  
ATOM 11650 O O    . VAL A 1 67 ? 4.516   -11.897 3.063   1.00 0.00 ? 67 VAL A O    9  
ATOM 11651 C CB   . VAL A 1 67 ? 5.612   -9.595  1.659   1.00 0.00 ? 67 VAL A CB   9  
ATOM 11652 C CG1  . VAL A 1 67 ? 5.666   -10.305 0.302   1.00 0.00 ? 67 VAL A CG1  9  
ATOM 11653 C CG2  . VAL A 1 67 ? 5.999   -8.125  1.476   1.00 0.00 ? 67 VAL A CG2  9  
ATOM 11654 H H    . VAL A 1 67 ? 4.941   -8.980  4.103   1.00 0.00 ? 67 VAL A H    9  
ATOM 11655 H HA   . VAL A 1 67 ? 3.504   -9.219  1.520   1.00 0.00 ? 67 VAL A HA   9  
ATOM 11656 H HB   . VAL A 1 67 ? 6.312   -10.070 2.347   1.00 0.00 ? 67 VAL A HB   9  
ATOM 11657 H HG11 . VAL A 1 67 ? 4.932   -9.862  -0.371  1.00 0.00 ? 67 VAL A HG11 9  
ATOM 11658 H HG12 . VAL A 1 67 ? 6.663   -10.195 -0.127  1.00 0.00 ? 67 VAL A HG12 9  
ATOM 11659 H HG13 . VAL A 1 67 ? 5.445   -11.364 0.434   1.00 0.00 ? 67 VAL A HG13 9  
ATOM 11660 H HG21 . VAL A 1 67 ? 5.228   -7.617  0.895   1.00 0.00 ? 67 VAL A HG21 9  
ATOM 11661 H HG22 . VAL A 1 67 ? 6.088   -7.646  2.452   1.00 0.00 ? 67 VAL A HG22 9  
ATOM 11662 H HG23 . VAL A 1 67 ? 6.952   -8.059  0.953   1.00 0.00 ? 67 VAL A HG23 9  
ATOM 11663 N N    . ILE A 1 68 ? 2.557   -11.467 2.022   1.00 0.00 ? 68 ILE A N    9  
ATOM 11664 C CA   . ILE A 1 68 ? 2.003   -12.801 2.205   1.00 0.00 ? 68 ILE A CA   9  
ATOM 11665 C C    . ILE A 1 68 ? 1.698   -13.404 0.838   1.00 0.00 ? 68 ILE A C    9  
ATOM 11666 O O    . ILE A 1 68 ? 0.992   -12.793 0.036   1.00 0.00 ? 68 ILE A O    9  
ATOM 11667 C CB   . ILE A 1 68 ? 0.724   -12.709 3.055   1.00 0.00 ? 68 ILE A CB   9  
ATOM 11668 C CG1  . ILE A 1 68 ? 1.021   -12.089 4.438   1.00 0.00 ? 68 ILE A CG1  9  
ATOM 11669 C CG2  . ILE A 1 68 ? 0.113   -14.108 3.223   1.00 0.00 ? 68 ILE A CG2  9  
ATOM 11670 C CD1  . ILE A 1 68 ? 1.936   -12.996 5.273   1.00 0.00 ? 68 ILE A CD1  9  
ATOM 11671 H H    . ILE A 1 68 ? 1.992   -10.782 1.532   1.00 0.00 ? 68 ILE A H    9  
ATOM 11672 H HA   . ILE A 1 68 ? 2.730   -13.431 2.712   1.00 0.00 ? 68 ILE A HA   9  
ATOM 11673 H HB   . ILE A 1 68 ? 0.007   -12.074 2.537   1.00 0.00 ? 68 ILE A HB   9  
ATOM 11674 H HG12 . ILE A 1 68 ? 1.502   -11.120 4.304   1.00 0.00 ? 68 ILE A HG12 9  
ATOM 11675 H HG13 . ILE A 1 68 ? 0.082   -11.946 4.971   1.00 0.00 ? 68 ILE A HG13 9  
ATOM 11676 H HG21 . ILE A 1 68 ? -0.632  -14.086 4.019   1.00 0.00 ? 68 ILE A HG21 9  
ATOM 11677 H HG22 . ILE A 1 68 ? 0.897   -14.822 3.478   1.00 0.00 ? 68 ILE A HG22 9  
ATOM 11678 H HG23 . ILE A 1 68 ? -0.363  -14.411 2.291   1.00 0.00 ? 68 ILE A HG23 9  
ATOM 11679 H HD11 . ILE A 1 68 ? 2.091   -12.545 6.253   1.00 0.00 ? 68 ILE A HD11 9  
ATOM 11680 H HD12 . ILE A 1 68 ? 1.471   -13.972 5.400   1.00 0.00 ? 68 ILE A HD12 9  
ATOM 11681 H HD13 . ILE A 1 68 ? 2.897   -13.112 4.777   1.00 0.00 ? 68 ILE A HD13 9  
ATOM 11682 N N    . ASP A 1 69 ? 2.236   -14.608 0.579   1.00 0.00 ? 69 ASP A N    9  
ATOM 11683 C CA   . ASP A 1 69 ? 2.029   -15.313 -0.685  1.00 0.00 ? 69 ASP A CA   9  
ATOM 11684 C C    . ASP A 1 69 ? 2.537   -14.465 -1.863  1.00 0.00 ? 69 ASP A C    9  
ATOM 11685 O O    . ASP A 1 69 ? 2.148   -14.684 -3.003  1.00 0.00 ? 69 ASP A O    9  
ATOM 11686 C CB   . ASP A 1 69 ? 0.529   -15.652 -0.827  1.00 0.00 ? 69 ASP A CB   9  
ATOM 11687 C CG   . ASP A 1 69 ? 0.249   -16.508 -2.058  1.00 0.00 ? 69 ASP A CG   9  
ATOM 11688 O OD1  . ASP A 1 69 ? 1.027   -17.460 -2.281  1.00 0.00 ? 69 ASP A OD1  9  
ATOM 11689 O OD2  . ASP A 1 69 ? -0.747  -16.191 -2.753  1.00 0.00 ? 69 ASP A OD2  9  
ATOM 11690 H H    . ASP A 1 69 ? 2.809   -15.054 1.281   1.00 0.00 ? 69 ASP A H    9  
ATOM 11691 H HA   . ASP A 1 69 ? 2.598   -16.240 -0.658  1.00 0.00 ? 69 ASP A HA   9  
ATOM 11692 H HB2  . ASP A 1 69 ? 0.204   -16.196 0.060   1.00 0.00 ? 69 ASP A HB2  9  
ATOM 11693 H HB3  . ASP A 1 69 ? -0.043  -14.730 -0.903  1.00 0.00 ? 69 ASP A HB3  9  
ATOM 11694 N N    . GLY A 1 70 ? 3.412   -13.493 -1.578  1.00 0.00 ? 70 GLY A N    9  
ATOM 11695 C CA   . GLY A 1 70 ? 3.951   -12.607 -2.602  1.00 0.00 ? 70 GLY A CA   9  
ATOM 11696 C C    . GLY A 1 70 ? 3.098   -11.340 -2.719  1.00 0.00 ? 70 GLY A C    9  
ATOM 11697 O O    . GLY A 1 70 ? 3.610   -10.281 -3.075  1.00 0.00 ? 70 GLY A O    9  
ATOM 11698 H H    . GLY A 1 70 ? 3.712   -13.359 -0.625  1.00 0.00 ? 70 GLY A H    9  
ATOM 11699 H HA2  . GLY A 1 70 ? 4.970   -12.328 -2.334  1.00 0.00 ? 70 GLY A HA2  9  
ATOM 11700 H HA3  . GLY A 1 70 ? 3.962   -13.122 -3.563  1.00 0.00 ? 70 GLY A HA3  9  
ATOM 11701 N N    . LYS A 1 71 ? 1.795   -11.450 -2.414  1.00 0.00 ? 71 LYS A N    9  
ATOM 11702 C CA   . LYS A 1 71 ? 0.884   -10.314 -2.480  1.00 0.00 ? 71 LYS A CA   9  
ATOM 11703 C C    . LYS A 1 71 ? 1.067   -9.465  -1.216  1.00 0.00 ? 71 LYS A C    9  
ATOM 11704 O O    . LYS A 1 71 ? 1.733   -9.892  -0.272  1.00 0.00 ? 71 LYS A O    9  
ATOM 11705 C CB   . LYS A 1 71 ? -0.570  -10.808 -2.609  1.00 0.00 ? 71 LYS A CB   9  
ATOM 11706 C CG   . LYS A 1 71 ? -0.945  -11.072 -4.074  1.00 0.00 ? 71 LYS A CG   9  
ATOM 11707 C CD   . LYS A 1 71 ? -0.122  -12.218 -4.690  1.00 0.00 ? 71 LYS A CD   9  
ATOM 11708 C CE   . LYS A 1 71 ? -0.329  -13.536 -3.929  1.00 0.00 ? 71 LYS A CE   9  
ATOM 11709 N NZ   . LYS A 1 71 ? -1.744  -13.929 -3.869  1.00 0.00 ? 71 LYS A NZ   9  
ATOM 11710 H H    . LYS A 1 71 ? 1.424   -12.341 -2.121  1.00 0.00 ? 71 LYS A H    9  
ATOM 11711 H HA   . LYS A 1 71 ? 1.132   -9.706  -3.351  1.00 0.00 ? 71 LYS A HA   9  
ATOM 11712 H HB2  . LYS A 1 71 ? -0.702  -11.712 -2.039  1.00 0.00 ? 71 LYS A HB2  9  
ATOM 11713 H HB3  . LYS A 1 71 ? -1.236  -10.042 -2.215  1.00 0.00 ? 71 LYS A HB3  9  
ATOM 11714 H HG2  . LYS A 1 71 ? -2.006  -11.316 -4.133  1.00 0.00 ? 71 LYS A HG2  9  
ATOM 11715 H HG3  . LYS A 1 71 ? -0.763  -10.172 -4.642  1.00 0.00 ? 71 LYS A HG3  9  
ATOM 11716 H HD2  . LYS A 1 71 ? -0.433  -12.359 -5.725  1.00 0.00 ? 71 LYS A HD2  9  
ATOM 11717 H HD3  . LYS A 1 71 ? 0.934   -11.954 -4.675  1.00 0.00 ? 71 LYS A HD3  9  
ATOM 11718 H HE2  . LYS A 1 71 ? 0.228   -14.322 -4.438  1.00 0.00 ? 71 LYS A HE2  9  
ATOM 11719 H HE3  . LYS A 1 71 ? 0.052   -13.434 -2.918  1.00 0.00 ? 71 LYS A HE3  9  
ATOM 11720 H HZ1  . LYS A 1 71 ? -1.814  -14.846 -3.432  1.00 0.00 ? 71 LYS A HZ1  9  
ATOM 11721 H HZ2  . LYS A 1 71 ? -2.125  -13.970 -4.802  1.00 0.00 ? 71 LYS A HZ2  9  
ATOM 11722 H HZ3  . LYS A 1 71 ? -2.261  -13.257 -3.322  1.00 0.00 ? 71 LYS A HZ3  9  
ATOM 11723 N N    . TYR A 1 72 ? 0.482   -8.259  -1.203  1.00 0.00 ? 72 TYR A N    9  
ATOM 11724 C CA   . TYR A 1 72 ? 0.625   -7.343  -0.079  1.00 0.00 ? 72 TYR A CA   9  
ATOM 11725 C C    . TYR A 1 72 ? -0.651  -7.317  0.755   1.00 0.00 ? 72 TYR A C    9  
ATOM 11726 O O    . TYR A 1 72 ? -1.733  -7.059  0.233   1.00 0.00 ? 72 TYR A O    9  
ATOM 11727 C CB   . TYR A 1 72 ? 0.961   -5.953  -0.612  1.00 0.00 ? 72 TYR A CB   9  
ATOM 11728 C CG   . TYR A 1 72 ? 2.274   -5.924  -1.358  1.00 0.00 ? 72 TYR A CG   9  
ATOM 11729 C CD1  . TYR A 1 72 ? 3.477   -5.756  -0.652  1.00 0.00 ? 72 TYR A CD1  9  
ATOM 11730 C CD2  . TYR A 1 72 ? 2.295   -6.092  -2.755  1.00 0.00 ? 72 TYR A CD2  9  
ATOM 11731 C CE1  . TYR A 1 72 ? 4.701   -5.756  -1.339  1.00 0.00 ? 72 TYR A CE1  9  
ATOM 11732 C CE2  . TYR A 1 72 ? 3.520   -6.094  -3.440  1.00 0.00 ? 72 TYR A CE2  9  
ATOM 11733 C CZ   . TYR A 1 72 ? 4.722   -5.929  -2.732  1.00 0.00 ? 72 TYR A CZ   9  
ATOM 11734 O OH   . TYR A 1 72 ? 5.907   -5.942  -3.397  1.00 0.00 ? 72 TYR A OH   9  
ATOM 11735 H H    . TYR A 1 72 ? -0.073  -7.960  -1.997  1.00 0.00 ? 72 TYR A H    9  
ATOM 11736 H HA   . TYR A 1 72 ? 1.449   -7.679  0.552   1.00 0.00 ? 72 TYR A HA   9  
ATOM 11737 H HB2  . TYR A 1 72 ? 0.166   -5.631  -1.283  1.00 0.00 ? 72 TYR A HB2  9  
ATOM 11738 H HB3  . TYR A 1 72 ? 1.017   -5.257  0.227   1.00 0.00 ? 72 TYR A HB3  9  
ATOM 11739 H HD1  . TYR A 1 72 ? 3.461   -5.633  0.421   1.00 0.00 ? 72 TYR A HD1  9  
ATOM 11740 H HD2  . TYR A 1 72 ? 1.372   -6.226  -3.298  1.00 0.00 ? 72 TYR A HD2  9  
ATOM 11741 H HE1  . TYR A 1 72 ? 5.626   -5.631  -0.796  1.00 0.00 ? 72 TYR A HE1  9  
ATOM 11742 H HE2  . TYR A 1 72 ? 3.539   -6.228  -4.512  1.00 0.00 ? 72 TYR A HE2  9  
ATOM 11743 H HH   . TYR A 1 72 ? 6.643   -5.630  -2.860  1.00 0.00 ? 72 TYR A HH   9  
ATOM 11744 N N    . ALA A 1 73 ? -0.505  -7.586  2.056   1.00 0.00 ? 73 ALA A N    9  
ATOM 11745 C CA   . ALA A 1 73 ? -1.612  -7.600  2.997   1.00 0.00 ? 73 ALA A CA   9  
ATOM 11746 C C    . ALA A 1 73 ? -1.386  -6.531  4.057   1.00 0.00 ? 73 ALA A C    9  
ATOM 11747 O O    . ALA A 1 73 ? -0.273  -6.382  4.551   1.00 0.00 ? 73 ALA A O    9  
ATOM 11748 C CB   . ALA A 1 73 ? -1.687  -8.978  3.654   1.00 0.00 ? 73 ALA A CB   9  
ATOM 11749 H H    . ALA A 1 73 ? 0.418   -7.790  2.416   1.00 0.00 ? 73 ALA A H    9  
ATOM 11750 H HA   . ALA A 1 73 ? -2.547  -7.398  2.472   1.00 0.00 ? 73 ALA A HA   9  
ATOM 11751 H HB1  . ALA A 1 73 ? -1.929  -9.728  2.905   1.00 0.00 ? 73 ALA A HB1  9  
ATOM 11752 H HB2  . ALA A 1 73 ? -0.720  -9.218  4.105   1.00 0.00 ? 73 ALA A HB2  9  
ATOM 11753 H HB3  . ALA A 1 73 ? -2.456  -8.974  4.425   1.00 0.00 ? 73 ALA A HB3  9  
ATOM 11754 N N    . PHE A 1 74 ? -2.440  -5.793  4.416   1.00 0.00 ? 74 PHE A N    9  
ATOM 11755 C CA   . PHE A 1 74 ? -2.338  -4.776  5.447   1.00 0.00 ? 74 PHE A CA   9  
ATOM 11756 C C    . PHE A 1 74 ? -2.075  -5.461  6.785   1.00 0.00 ? 74 PHE A C    9  
ATOM 11757 O O    . PHE A 1 74 ? -2.811  -6.367  7.173   1.00 0.00 ? 74 PHE A O    9  
ATOM 11758 C CB   . PHE A 1 74 ? -3.627  -3.949  5.482   1.00 0.00 ? 74 PHE A CB   9  
ATOM 11759 C CG   . PHE A 1 74 ? -3.810  -3.143  6.756   1.00 0.00 ? 74 PHE A CG   9  
ATOM 11760 C CD1  . PHE A 1 74 ? -4.405  -3.738  7.880   1.00 0.00 ? 74 PHE A CD1  9  
ATOM 11761 C CD2  . PHE A 1 74 ? -3.399  -1.798  6.812   1.00 0.00 ? 74 PHE A CD2  9  
ATOM 11762 C CE1  . PHE A 1 74 ? -4.608  -2.994  9.049   1.00 0.00 ? 74 PHE A CE1  9  
ATOM 11763 C CE2  . PHE A 1 74 ? -3.595  -1.055  7.991   1.00 0.00 ? 74 PHE A CE2  9  
ATOM 11764 C CZ   . PHE A 1 74 ? -4.208  -1.655  9.107   1.00 0.00 ? 74 PHE A CZ   9  
ATOM 11765 H H    . PHE A 1 74 ? -3.335  -5.944  3.971   1.00 0.00 ? 74 PHE A H    9  
ATOM 11766 H HA   . PHE A 1 74 ? -1.504  -4.117  5.214   1.00 0.00 ? 74 PHE A HA   9  
ATOM 11767 H HB2  . PHE A 1 74 ? -3.618  -3.262  4.641   1.00 0.00 ? 74 PHE A HB2  9  
ATOM 11768 H HB3  . PHE A 1 74 ? -4.479  -4.620  5.371   1.00 0.00 ? 74 PHE A HB3  9  
ATOM 11769 H HD1  . PHE A 1 74 ? -4.709  -4.766  7.842   1.00 0.00 ? 74 PHE A HD1  9  
ATOM 11770 H HD2  . PHE A 1 74 ? -2.937  -1.336  5.952   1.00 0.00 ? 74 PHE A HD2  9  
ATOM 11771 H HE1  . PHE A 1 74 ? -5.078  -3.455  9.904   1.00 0.00 ? 74 PHE A HE1  9  
ATOM 11772 H HE2  . PHE A 1 74 ? -3.281  -0.023  8.038   1.00 0.00 ? 74 PHE A HE2  9  
ATOM 11773 H HZ   . PHE A 1 74 ? -4.369  -1.086  10.009  1.00 0.00 ? 74 PHE A HZ   9  
ATOM 11774 N N    . LYS A 1 75 ? -1.019  -5.029  7.480   1.00 0.00 ? 75 LYS A N    9  
ATOM 11775 C CA   . LYS A 1 75 ? -0.639  -5.601  8.760   1.00 0.00 ? 75 LYS A CA   9  
ATOM 11776 C C    . LYS A 1 75 ? -1.535  -5.026  9.864   1.00 0.00 ? 75 LYS A C    9  
ATOM 11777 O O    . LYS A 1 75 ? -1.511  -3.818  10.094  1.00 0.00 ? 75 LYS A O    9  
ATOM 11778 C CB   . LYS A 1 75 ? 0.837   -5.270  9.027   1.00 0.00 ? 75 LYS A CB   9  
ATOM 11779 C CG   . LYS A 1 75 ? 1.256   -5.784  10.410  1.00 0.00 ? 75 LYS A CG   9  
ATOM 11780 C CD   . LYS A 1 75 ? 2.782   -5.690  10.556  1.00 0.00 ? 75 LYS A CD   9  
ATOM 11781 C CE   . LYS A 1 75 ? 3.457   -6.889  9.876   1.00 0.00 ? 75 LYS A CE   9  
ATOM 11782 N NZ   . LYS A 1 75 ? 4.447   -6.449  8.873   1.00 0.00 ? 75 LYS A NZ   9  
ATOM 11783 H H    . LYS A 1 75 ? -0.457  -4.277  7.108   1.00 0.00 ? 75 LYS A H    9  
ATOM 11784 H HA   . LYS A 1 75 ? -0.752  -6.681  8.714   1.00 0.00 ? 75 LYS A HA   9  
ATOM 11785 H HB2  . LYS A 1 75 ? 1.453   -5.736  8.263   1.00 0.00 ? 75 LYS A HB2  9  
ATOM 11786 H HB3  . LYS A 1 75 ? 0.977   -4.193  8.987   1.00 0.00 ? 75 LYS A HB3  9  
ATOM 11787 H HG2  . LYS A 1 75 ? 0.786   -5.172  11.180  1.00 0.00 ? 75 LYS A HG2  9  
ATOM 11788 H HG3  . LYS A 1 75 ? 0.940   -6.821  10.530  1.00 0.00 ? 75 LYS A HG3  9  
ATOM 11789 H HD2  . LYS A 1 75 ? 3.132   -4.766  10.098  1.00 0.00 ? 75 LYS A HD2  9  
ATOM 11790 H HD3  . LYS A 1 75 ? 3.042   -5.685  11.616  1.00 0.00 ? 75 LYS A HD3  9  
ATOM 11791 H HE2  . LYS A 1 75 ? 3.962   -7.489  10.634  1.00 0.00 ? 75 LYS A HE2  9  
ATOM 11792 H HE3  . LYS A 1 75 ? 2.702   -7.501  9.387   1.00 0.00 ? 75 LYS A HE3  9  
ATOM 11793 H HZ1  . LYS A 1 75 ? 3.984   -5.908  8.151   1.00 0.00 ? 75 LYS A HZ1  9  
ATOM 11794 H HZ2  . LYS A 1 75 ? 4.883   -7.265  8.454   1.00 0.00 ? 75 LYS A HZ2  9  
ATOM 11795 H HZ3  . LYS A 1 75 ? 5.152   -5.882  9.320   1.00 0.00 ? 75 LYS A HZ3  9  
ATOM 11796 N N    . PRO A 1 76 ? -2.326  -5.875  10.559  1.00 0.00 ? 76 PRO A N    9  
ATOM 11797 C CA   . PRO A 1 76 ? -3.186  -5.424  11.632  1.00 0.00 ? 76 PRO A CA   9  
ATOM 11798 C C    . PRO A 1 76 ? -2.337  -4.931  12.800  1.00 0.00 ? 76 PRO A C    9  
ATOM 11799 O O    . PRO A 1 76 ? -2.575  -3.850  13.332  1.00 0.00 ? 76 PRO A O    9  
ATOM 11800 C CB   . PRO A 1 76 ? -4.035  -6.633  12.026  1.00 0.00 ? 76 PRO A CB   9  
ATOM 11801 C CG   . PRO A 1 76 ? -3.434  -7.845  11.307  1.00 0.00 ? 76 PRO A CG   9  
ATOM 11802 C CD   . PRO A 1 76 ? -2.399  -7.304  10.320  1.00 0.00 ? 76 PRO A CD   9  
ATOM 11803 H HA   . PRO A 1 76 ? -3.830  -4.621  11.279  1.00 0.00 ? 76 PRO A HA   9  
ATOM 11804 H HB2  . PRO A 1 76 ? -4.005  -6.782  13.106  1.00 0.00 ? 76 PRO A HB2  9  
ATOM 11805 H HB3  . PRO A 1 76 ? -5.066  -6.483  11.700  1.00 0.00 ? 76 PRO A HB3  9  
ATOM 11806 H HG2  . PRO A 1 76 ? -2.949  -8.499  12.029  1.00 0.00 ? 76 PRO A HG2  9  
ATOM 11807 H HG3  . PRO A 1 76 ? -4.213  -8.390  10.774  1.00 0.00 ? 76 PRO A HG3  9  
ATOM 11808 H HD2  . PRO A 1 76 ? -1.431  -7.769  10.504  1.00 0.00 ? 76 PRO A HD2  9  
ATOM 11809 H HD3  . PRO A 1 76 ? -2.724  -7.501  9.300   1.00 0.00 ? 76 PRO A HD3  9  
ATOM 11810 N N    . LYS A 1 77 ? -1.336  -5.733  13.186  1.00 0.00 ? 77 LYS A N    9  
ATOM 11811 C CA   . LYS A 1 77 ? -0.426  -5.380  14.264  1.00 0.00 ? 77 LYS A CA   9  
ATOM 11812 C C    . LYS A 1 77 ? 0.882   -6.164  14.106  1.00 0.00 ? 77 LYS A C    9  
ATOM 11813 O O    . LYS A 1 77 ? 1.957   -5.572  14.102  1.00 0.00 ? 77 LYS A O    9  
ATOM 11814 C CB   . LYS A 1 77 ? -1.094  -5.622  15.634  1.00 0.00 ? 77 LYS A CB   9  
ATOM 11815 C CG   . LYS A 1 77 ? -1.642  -7.053  15.755  1.00 0.00 ? 77 LYS A CG   9  
ATOM 11816 C CD   . LYS A 1 77 ? -2.501  -7.155  17.020  1.00 0.00 ? 77 LYS A CD   9  
ATOM 11817 C CE   . LYS A 1 77 ? -2.865  -8.618  17.296  1.00 0.00 ? 77 LYS A CE   9  
ATOM 11818 N NZ   . LYS A 1 77 ? -3.707  -9.174  16.222  1.00 0.00 ? 77 LYS A NZ   9  
ATOM 11819 H H    . LYS A 1 77 ? -1.197  -6.615  12.715  1.00 0.00 ? 77 LYS A H    9  
ATOM 11820 H HA   . LYS A 1 77 ? -0.193  -4.317  14.182  1.00 0.00 ? 77 LYS A HA   9  
ATOM 11821 H HB2  . LYS A 1 77 ? -0.363  -5.448  16.424  1.00 0.00 ? 77 LYS A HB2  9  
ATOM 11822 H HB3  . LYS A 1 77 ? -1.917  -4.916  15.755  1.00 0.00 ? 77 LYS A HB3  9  
ATOM 11823 H HG2  . LYS A 1 77 ? -2.250  -7.289  14.884  1.00 0.00 ? 77 LYS A HG2  9  
ATOM 11824 H HG3  . LYS A 1 77 ? -0.816  -7.756  15.826  1.00 0.00 ? 77 LYS A HG3  9  
ATOM 11825 H HD2  . LYS A 1 77 ? -1.941  -6.760  17.869  1.00 0.00 ? 77 LYS A HD2  9  
ATOM 11826 H HD3  . LYS A 1 77 ? -3.413  -6.572  16.888  1.00 0.00 ? 77 LYS A HD3  9  
ATOM 11827 H HE2  . LYS A 1 77 ? -1.951  -9.208  17.375  1.00 0.00 ? 77 LYS A HE2  9  
ATOM 11828 H HE3  . LYS A 1 77 ? -3.409  -8.677  18.240  1.00 0.00 ? 77 LYS A HE3  9  
ATOM 11829 H HZ1  . LYS A 1 77 ? -4.500  -8.567  16.067  1.00 0.00 ? 77 LYS A HZ1  9  
ATOM 11830 H HZ2  . LYS A 1 77 ? -3.164  -9.246  15.369  1.00 0.00 ? 77 LYS A HZ2  9  
ATOM 11831 H HZ3  . LYS A 1 77 ? -4.033  -10.091 16.490  1.00 0.00 ? 77 LYS A HZ3  9  
ATOM 11832 N N    . TYR A 1 78 ? 0.786   -7.496  13.963  1.00 0.00 ? 78 TYR A N    9  
ATOM 11833 C CA   . TYR A 1 78 ? 1.955   -8.352  13.770  1.00 0.00 ? 78 TYR A CA   9  
ATOM 11834 C C    . TYR A 1 78 ? 1.492   -9.775  13.439  1.00 0.00 ? 78 TYR A C    9  
ATOM 11835 O O    . TYR A 1 78 ? 1.921   -10.343 12.438  1.00 0.00 ? 78 TYR A O    9  
ATOM 11836 C CB   . TYR A 1 78 ? 2.871   -8.328  15.015  1.00 0.00 ? 78 TYR A CB   9  
ATOM 11837 C CG   . TYR A 1 78 ? 2.162   -8.574  16.336  1.00 0.00 ? 78 TYR A CG   9  
ATOM 11838 C CD1  . TYR A 1 78 ? 1.602   -7.500  17.050  1.00 0.00 ? 78 TYR A CD1  9  
ATOM 11839 C CD2  . TYR A 1 78 ? 2.086   -9.876  16.860  1.00 0.00 ? 78 TYR A C