data_1D8K
# 
_entry.id   1D8K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1D8K         
RCSB  RCSB009888   
WWPDB D_1000009888 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB      1D8J           . unspecified 
TargetDB trt001000206.1 . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1D8K 
_pdbx_database_status.recvd_initial_deposition_date   1999-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Okuda, M.'                                              1 
'Watanabe, Y.'                                           2 
'Okamura, H.'                                            3 
'Hanaoka, F.'                                            4 
'Ohkuma, Y.'                                             5 
'Nishimura, Y.'                                          6 
'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 7 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the central core domain of TFIIEbeta with a novel double-stranded DNA-binding surface.' 
_citation.journal_abbrev            'EMBO J.' 
_citation.journal_volume            19 
_citation.page_first                1346 
_citation.page_last                 1356 
_citation.year                      2000 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10716934 
_citation.pdbx_database_id_DOI      10.1093/emboj/19.6.1346 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Okuda, M.'     1 
primary 'Watanabe, Y.'  2 
primary 'Okamura, H.'   3 
primary 'Hanaoka, F.'   4 
primary 'Ohkuma, Y.'    5 
primary 'Nishimura, Y.' 6 
# 
_cell.entry_id           1D8K 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1D8K 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'GENERAL TRANSCRIPTION FACTOR TFIIE-BETA' 
_entity.formula_weight             9287.704 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CENTRAL CORE DOMAIN' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNV
R
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNV
R
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         trt001000206.1 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  LEU n 
1 3  SER n 
1 4  GLY n 
1 5  SER n 
1 6  SER n 
1 7  GLY n 
1 8  TYR n 
1 9  LYS n 
1 10 PHE n 
1 11 GLY n 
1 12 VAL n 
1 13 LEU n 
1 14 ALA n 
1 15 LYS n 
1 16 ILE n 
1 17 VAL n 
1 18 ASN n 
1 19 TYR n 
1 20 MET n 
1 21 LYS n 
1 22 THR n 
1 23 ARG n 
1 24 HIS n 
1 25 GLN n 
1 26 ARG n 
1 27 GLY n 
1 28 ASP n 
1 29 THR n 
1 30 HIS n 
1 31 PRO n 
1 32 LEU n 
1 33 THR n 
1 34 LEU n 
1 35 ASP n 
1 36 GLU n 
1 37 ILE n 
1 38 LEU n 
1 39 ASP n 
1 40 GLU n 
1 41 THR n 
1 42 GLN n 
1 43 HIS n 
1 44 LEU n 
1 45 ASP n 
1 46 ILE n 
1 47 GLY n 
1 48 LEU n 
1 49 LYS n 
1 50 GLN n 
1 51 LYS n 
1 52 GLN n 
1 53 TRP n 
1 54 LEU n 
1 55 MET n 
1 56 THR n 
1 57 GLU n 
1 58 ALA n 
1 59 LEU n 
1 60 VAL n 
1 61 ASN n 
1 62 ASN n 
1 63 PRO n 
1 64 LYS n 
1 65 ILE n 
1 66 GLU n 
1 67 VAL n 
1 68 ILE n 
1 69 ASP n 
1 70 GLY n 
1 71 LYS n 
1 72 TYR n 
1 73 ALA n 
1 74 PHE n 
1 75 LYS n 
1 76 PRO n 
1 77 LYS n 
1 78 TYR n 
1 79 ASN n 
1 80 VAL n 
1 81 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET3A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    T2EB_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P29084 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1D8K 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 81 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29084 
_struct_ref_seq.db_align_beg                  66 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  146 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       81 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 '2D NOESY'             3 
2 1 3D_13C-SEPARATED_NOESY 1 
3 1 3D_15N-SEPARATED_NOESY 2 
4 1 4D_13C-SEPARATED_NOESY 1 
5 1 HNHA                   2 
6 1 HMQC-J                 2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  6.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '500mM NACL' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1-2MM PROTEIN U-15N,13C; 20MM PHOSPHATE BUFFER, 500MM NACL' ? 
2 '1-2MM PROTEIN U-15N; 20MM PHOSPHATE BUFFER, 500MM NACL'     ? 
3 '1-2MM PROTEIN ; 20MM PHOSPHATE BUFFER, 500MM NACL'          ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 DMX Bruker 600 ? 
2 AMX Bruker 500 ? 
# 
_pdbx_nmr_refine.entry_id           1D8K 
_pdbx_nmr_refine.method             '4D SIMULATED ANNEALING' 
_pdbx_nmr_refine.details            
;THE STRUCTURES ARE BASED ON A TOTAL OF 1224 RESTRAINTS, 1184 ARE NOE-DERIVED DISTANCE CONSTRAINTS, 38 DIHEDRAL ANGLE RESTRAINTS, 40 DISTANCE RESTRAINTS FROM HYDROGEN BONDS.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1D8K 
_pdbx_nmr_details.text       'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY.' 
# 
_pdbx_nmr_ensemble.entry_id                                      1D8K 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             1 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'LEAST RESTRAINT VIOLATIONS' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1D8K 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
processing           NMRPIPE             1.6 'DELAGLIO, GRZESIEK, VUISTER, ZHU, PFEIFER, BAX' 1 
'data analysis'      'PIPP, CAPP, STAPP' 3.9 'GARRETT, POWERS, GRONENBORN, CLORE'             2 
'structure solution' EMBOSS              5   'NAKAI, KIDERA, NAKAMURA'                        3 
refinement           EMBOSS              5   'NAKAI, KIDERA, NAKAMURA'                        4 
# 
_exptl.entry_id          1D8K 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1D8K 
_struct.title                     'SOLUTION STRUCTURE OF THE CENTRAL CORE DOMAIN OF TFIIE BETA' 
_struct.pdbx_descriptor           'GENERAL TRANSCRIPTION FACTOR TFIIE-BETA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1D8K 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
_struct_keywords.text            
'WINGED HELIX-TURN-HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, GENE REGULATION' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 PHE A 10 ? GLN A 25 ? PHE A 10 GLN A 25 1 ? 16 
HELX_P HELX_P2 2 LEU A 34 ? GLU A 40 ? LEU A 34 GLU A 40 1 ? 7  
HELX_P HELX_P3 3 LEU A 48 ? MET A 55 ? LEU A 48 MET A 55 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 32 ? LEU A 32 ? LEU A 32 LEU A 32 
A 2 ILE A 65 ? ILE A 68 ? ILE A 65 ILE A 68 
A 3 LYS A 71 ? PHE A 74 ? LYS A 71 PHE A 74 
# 
_database_PDB_matrix.entry_id          1D8K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1D8K 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . ALA A 1 1  ? 10.120  18.858  0.393   1.00 -0.26 ? 1  ALA A N    1 
ATOM 2    C CA   . ALA A 1 1  ? 9.859   19.950  -0.561  1.00 0.15  ? 1  ALA A CA   1 
ATOM 3    C C    . ALA A 1 1  ? 8.362   20.075  -0.819  1.00 0.62  ? 1  ALA A C    1 
ATOM 4    O O    . ALA A 1 1  ? 7.630   19.096  -0.692  1.00 -0.50 ? 1  ALA A O    1 
ATOM 5    C CB   . ALA A 1 1  ? 10.604  19.700  -1.874  1.00 -0.10 ? 1  ALA A CB   1 
ATOM 6    H H1   . ALA A 1 1  ? 9.741   17.995  0.027   1.00 0.31  ? 1  ALA A H1   1 
ATOM 7    H H2   . ALA A 1 1  ? 9.678   19.069  1.276   1.00 0.31  ? 1  ALA A H2   1 
ATOM 8    H H3   . ALA A 1 1  ? 11.116  18.758  0.529   1.00 0.31  ? 1  ALA A H3   1 
ATOM 9    H HA   . ALA A 1 1  ? 10.220  20.884  -0.127  1.00 0.05  ? 1  ALA A HA   1 
ATOM 10   H HB1  . ALA A 1 1  ? 11.673  19.617  -1.677  1.00 0.04  ? 1  ALA A HB1  1 
ATOM 11   H HB2  . ALA A 1 1  ? 10.425  20.531  -2.557  1.00 0.04  ? 1  ALA A HB2  1 
ATOM 12   H HB3  . ALA A 1 1  ? 10.245  18.775  -2.327  1.00 0.04  ? 1  ALA A HB3  1 
ATOM 13   N N    . LEU A 1 2  ? 7.909   21.280  -1.182  1.00 -0.46 ? 2  LEU A N    1 
ATOM 14   C CA   . LEU A 1 2  ? 6.498   21.531  -1.453  1.00 0.03  ? 2  LEU A CA   1 
ATOM 15   C C    . LEU A 1 2  ? 6.032   20.656  -2.621  1.00 0.62  ? 2  LEU A C    1 
ATOM 16   O O    . LEU A 1 2  ? 4.984   20.017  -2.544  1.00 -0.50 ? 2  LEU A O    1 
ATOM 17   C CB   . LEU A 1 2  ? 6.302   23.024  -1.769  1.00 -0.06 ? 2  LEU A CB   1 
ATOM 18   C CG   . LEU A 1 2  ? 5.055   23.563  -1.052  1.00 -0.01 ? 2  LEU A CG   1 
ATOM 19   C CD1  . LEU A 1 2  ? 4.976   25.079  -1.244  1.00 -0.11 ? 2  LEU A CD1  1 
ATOM 20   C CD2  . LEU A 1 2  ? 3.792   22.912  -1.625  1.00 -0.11 ? 2  LEU A CD2  1 
ATOM 21   H H    . LEU A 1 2  ? 8.557   22.050  -1.274  1.00 0.25  ? 2  LEU A H    1 
ATOM 22   H HA   . LEU A 1 2  ? 5.920   21.274  -0.565  1.00 0.05  ? 2  LEU A HA   1 
ATOM 23   H HB2  . LEU A 1 2  ? 7.175   23.582  -1.428  1.00 0.03  ? 2  LEU A HB2  1 
ATOM 24   H HB3  . LEU A 1 2  ? 6.190   23.160  -2.845  1.00 0.03  ? 2  LEU A HB3  1 
ATOM 25   H HG   . LEU A 1 2  ? 5.124   23.340  0.014   1.00 0.03  ? 2  LEU A HG   1 
ATOM 26   H HD11 . LEU A 1 2  ? 5.874   25.545  -0.838  1.00 0.03  ? 2  LEU A HD11 1 
ATOM 27   H HD12 . LEU A 1 2  ? 4.101   25.468  -0.723  1.00 0.03  ? 2  LEU A HD12 1 
ATOM 28   H HD13 . LEU A 1 2  ? 4.897   25.309  -2.307  1.00 0.03  ? 2  LEU A HD13 1 
ATOM 29   H HD21 . LEU A 1 2  ? 3.802   22.989  -2.713  1.00 0.03  ? 2  LEU A HD21 1 
ATOM 30   H HD22 . LEU A 1 2  ? 2.912   23.423  -1.235  1.00 0.03  ? 2  LEU A HD22 1 
ATOM 31   H HD23 . LEU A 1 2  ? 3.757   21.864  -1.336  1.00 0.03  ? 2  LEU A HD23 1 
ATOM 32   N N    . SER A 1 3  ? 6.825   20.626  -3.703  1.00 -0.46 ? 3  SER A N    1 
ATOM 33   C CA   . SER A 1 3  ? 6.504   19.836  -4.886  1.00 0.03  ? 3  SER A CA   1 
ATOM 34   C C    . SER A 1 3  ? 6.514   18.335  -4.563  1.00 0.62  ? 3  SER A C    1 
ATOM 35   O O    . SER A 1 3  ? 6.046   17.534  -5.368  1.00 -0.50 ? 3  SER A O    1 
ATOM 36   C CB   . SER A 1 3  ? 7.514   20.152  -5.991  1.00 0.02  ? 3  SER A CB   1 
ATOM 37   O OG   . SER A 1 3  ? 7.109   19.535  -7.194  1.00 -0.55 ? 3  SER A OG   1 
ATOM 38   H H    . SER A 1 3  ? 7.677   21.168  -3.709  1.00 0.25  ? 3  SER A H    1 
ATOM 39   H HA   . SER A 1 3  ? 5.507   20.113  -5.232  1.00 0.05  ? 3  SER A HA   1 
ATOM 40   H HB2  . SER A 1 3  ? 7.567   21.232  -6.139  1.00 0.12  ? 3  SER A HB2  1 
ATOM 41   H HB3  . SER A 1 3  ? 8.498   19.778  -5.704  1.00 0.12  ? 3  SER A HB3  1 
ATOM 42   H HG   . SER A 1 3  ? 6.894   18.614  -7.009  1.00 0.31  ? 3  SER A HG   1 
ATOM 43   N N    . GLY A 1 4  ? 7.049   17.957  -3.390  1.00 -0.46 ? 4  GLY A N    1 
ATOM 44   C CA   . GLY A 1 4  ? 7.100   16.566  -2.970  1.00 0.03  ? 4  GLY A CA   1 
ATOM 45   C C    . GLY A 1 4  ? 5.918   16.254  -2.055  1.00 0.62  ? 4  GLY A C    1 
ATOM 46   O O    . GLY A 1 4  ? 5.321   15.179  -2.149  1.00 -0.50 ? 4  GLY A O    1 
ATOM 47   H H    . GLY A 1 4  ? 7.427   18.655  -2.767  1.00 0.25  ? 4  GLY A H    1 
ATOM 48   H HA2  . GLY A 1 4  ? 7.063   15.919  -3.844  1.00 0.03  ? 4  GLY A HA2  1 
ATOM 49   H HA3  . GLY A 1 4  ? 8.029   16.388  -2.429  1.00 0.03  ? 4  GLY A HA3  1 
ATOM 50   N N    . SER A 1 5  ? 5.588   17.207  -1.169  1.00 -0.46 ? 5  SER A N    1 
ATOM 51   C CA   . SER A 1 5  ? 4.493   17.063  -0.220  1.00 0.03  ? 5  SER A CA   1 
ATOM 52   C C    . SER A 1 5  ? 3.180   16.785  -0.954  1.00 0.62  ? 5  SER A C    1 
ATOM 53   O O    . SER A 1 5  ? 2.335   16.052  -0.444  1.00 -0.50 ? 5  SER A O    1 
ATOM 54   C CB   . SER A 1 5  ? 4.385   18.345  0.612   1.00 0.02  ? 5  SER A CB   1 
ATOM 55   O OG   . SER A 1 5  ? 3.362   18.205  1.574   1.00 -0.55 ? 5  SER A OG   1 
ATOM 56   H H    . SER A 1 5  ? 6.120   18.067  -1.150  1.00 0.25  ? 5  SER A H    1 
ATOM 57   H HA   . SER A 1 5  ? 4.710   16.227  0.445   1.00 0.05  ? 5  SER A HA   1 
ATOM 58   H HB2  . SER A 1 5  ? 5.333   18.530  1.118   1.00 0.12  ? 5  SER A HB2  1 
ATOM 59   H HB3  . SER A 1 5  ? 4.154   19.186  -0.042  1.00 0.12  ? 5  SER A HB3  1 
ATOM 60   H HG   . SER A 1 5  ? 3.508   17.392  2.063   1.00 0.31  ? 5  SER A HG   1 
ATOM 61   N N    . SER A 1 6  ? 3.018   17.372  -2.151  1.00 -0.46 ? 6  SER A N    1 
ATOM 62   C CA   . SER A 1 6  ? 1.820   17.184  -2.961  1.00 0.03  ? 6  SER A CA   1 
ATOM 63   C C    . SER A 1 6  ? 1.466   15.698  -3.044  1.00 0.62  ? 6  SER A C    1 
ATOM 64   O O    . SER A 1 6  ? 0.320   15.319  -2.808  1.00 -0.50 ? 6  SER A O    1 
ATOM 65   C CB   . SER A 1 6  ? 2.070   17.759  -4.356  1.00 0.02  ? 6  SER A CB   1 
ATOM 66   O OG   . SER A 1 6  ? 3.279   17.240  -4.869  1.00 -0.55 ? 6  SER A OG   1 
ATOM 67   H H    . SER A 1 6  ? 3.748   17.969  -2.516  1.00 0.25  ? 6  SER A H    1 
ATOM 68   H HA   . SER A 1 6  ? 0.990   17.722  -2.499  1.00 0.05  ? 6  SER A HA   1 
ATOM 69   H HB2  . SER A 1 6  ? 1.246   17.485  -5.016  1.00 0.12  ? 6  SER A HB2  1 
ATOM 70   H HB3  . SER A 1 6  ? 2.139   18.846  -4.294  1.00 0.12  ? 6  SER A HB3  1 
ATOM 71   H HG   . SER A 1 6  ? 3.478   17.684  -5.698  1.00 0.31  ? 6  SER A HG   1 
ATOM 72   N N    . GLY A 1 7  ? 2.457   14.861  -3.377  1.00 -0.46 ? 7  GLY A N    1 
ATOM 73   C CA   . GLY A 1 7  ? 2.260   13.424  -3.472  1.00 0.03  ? 7  GLY A CA   1 
ATOM 74   C C    . GLY A 1 7  ? 3.175   12.833  -4.537  1.00 0.62  ? 7  GLY A C    1 
ATOM 75   O O    . GLY A 1 7  ? 2.713   12.128  -5.431  1.00 -0.50 ? 7  GLY A O    1 
ATOM 76   H H    . GLY A 1 7  ? 3.378   15.233  -3.568  1.00 0.25  ? 7  GLY A H    1 
ATOM 77   H HA2  . GLY A 1 7  ? 2.489   12.969  -2.510  1.00 0.03  ? 7  GLY A HA2  1 
ATOM 78   H HA3  . GLY A 1 7  ? 1.222   13.213  -3.733  1.00 0.03  ? 7  GLY A HA3  1 
ATOM 79   N N    . TYR A 1 8  ? 4.478   13.121  -4.436  1.00 -0.46 ? 8  TYR A N    1 
ATOM 80   C CA   . TYR A 1 8  ? 5.461   12.622  -5.393  1.00 0.03  ? 8  TYR A CA   1 
ATOM 81   C C    . TYR A 1 8  ? 5.928   11.214  -5.012  1.00 0.62  ? 8  TYR A C    1 
ATOM 82   O O    . TYR A 1 8  ? 6.708   10.605  -5.733  1.00 -0.50 ? 8  TYR A O    1 
ATOM 83   C CB   . TYR A 1 8  ? 6.642   13.602  -5.432  1.00 -0.10 ? 8  TYR A CB   1 
ATOM 84   C CG   . TYR A 1 8  ? 7.827   13.106  -6.235  1.00 -0.03 ? 8  TYR A CG   1 
ATOM 85   C CD1  . TYR A 1 8  ? 7.744   13.016  -7.636  1.00 0.00  ? 8  TYR A CD1  1 
ATOM 86   C CD2  . TYR A 1 8  ? 9.011   12.727  -5.576  1.00 0.00  ? 8  TYR A CD2  1 
ATOM 87   C CE1  . TYR A 1 8  ? 8.843   12.546  -8.376  1.00 -0.26 ? 8  TYR A CE1  1 
ATOM 88   C CE2  . TYR A 1 8  ? 10.108  12.257  -6.315  1.00 -0.26 ? 8  TYR A CE2  1 
ATOM 89   C CZ   . TYR A 1 8  ? 10.024  12.166  -7.716  1.00 0.46  ? 8  TYR A CZ   1 
ATOM 90   O OH   . TYR A 1 8  ? 11.089  11.708  -8.435  1.00 -0.53 ? 8  TYR A OH   1 
ATOM 91   H H    . TYR A 1 8  ? 4.804   13.706  -3.676  1.00 0.25  ? 8  TYR A H    1 
ATOM 92   H HA   . TYR A 1 8  ? 5.002   12.576  -6.369  1.00 0.05  ? 8  TYR A HA   1 
ATOM 93   H HB2  . TYR A 1 8  ? 6.299   14.544  -5.860  1.00 0.04  ? 8  TYR A HB2  1 
ATOM 94   H HB3  . TYR A 1 8  ? 6.970   13.784  -4.408  1.00 0.04  ? 8  TYR A HB3  1 
ATOM 95   H HD1  . TYR A 1 8  ? 6.835   13.305  -8.144  1.00 0.06  ? 8  TYR A HD1  1 
ATOM 96   H HD2  . TYR A 1 8  ? 9.076   12.793  -4.500  1.00 0.06  ? 8  TYR A HD2  1 
ATOM 97   H HE1  . TYR A 1 8  ? 8.778   12.474  -9.452  1.00 0.10  ? 8  TYR A HE1  1 
ATOM 98   H HE2  . TYR A 1 8  ? 11.015  11.965  -5.807  1.00 0.10  ? 8  TYR A HE2  1 
ATOM 99   H HH   . TYR A 1 8  ? 11.852  11.508  -7.890  1.00 0.33  ? 8  TYR A HH   1 
ATOM 100  N N    . LYS A 1 9  ? 5.446   10.715  -3.877  1.00 -0.46 ? 9  LYS A N    1 
ATOM 101  C CA   . LYS A 1 9  ? 5.826   9.404   -3.351  1.00 0.03  ? 9  LYS A CA   1 
ATOM 102  C C    . LYS A 1 9  ? 5.034   9.141   -2.071  1.00 0.62  ? 9  LYS A C    1 
ATOM 103  O O    . LYS A 1 9  ? 4.344   8.130   -1.948  1.00 -0.50 ? 9  LYS A O    1 
ATOM 104  C CB   . LYS A 1 9  ? 7.343   9.395   -3.049  1.00 -0.10 ? 9  LYS A CB   1 
ATOM 105  C CG   . LYS A 1 9  ? 8.080   8.460   -4.021  1.00 -0.16 ? 9  LYS A CG   1 
ATOM 106  C CD   . LYS A 1 9  ? 9.593   8.515   -3.768  1.00 -0.18 ? 9  LYS A CD   1 
ATOM 107  C CE   . LYS A 1 9  ? 9.904   8.099   -2.324  1.00 -0.04 ? 9  LYS A CE   1 
ATOM 108  N NZ   . LYS A 1 9  ? 11.191  7.381   -2.237  1.00 -0.14 ? 9  LYS A NZ   1 
ATOM 109  H H    . LYS A 1 9  ? 4.793   11.265  -3.353  1.00 0.25  ? 9  LYS A H    1 
ATOM 110  H HA   . LYS A 1 9  ? 5.593   8.625   -4.084  1.00 0.05  ? 9  LYS A HA   1 
ATOM 111  H HB2  . LYS A 1 9  ? 7.742   10.405  -3.147  1.00 0.04  ? 9  LYS A HB2  1 
ATOM 112  H HB3  . LYS A 1 9  ? 7.502   9.047   -2.028  1.00 0.04  ? 9  LYS A HB3  1 
ATOM 113  H HG2  . LYS A 1 9  ? 7.730   7.445   -3.878  1.00 0.12  ? 9  LYS A HG2  1 
ATOM 114  H HG3  . LYS A 1 9  ? 7.879   8.763   -5.044  1.00 0.12  ? 9  LYS A HG3  1 
ATOM 115  H HD2  . LYS A 1 9  ? 10.094  7.835   -4.458  1.00 0.12  ? 9  LYS A HD2  1 
ATOM 116  H HD3  . LYS A 1 9  ? 9.953   9.531   -3.939  1.00 0.12  ? 9  LYS A HD3  1 
ATOM 117  H HE2  . LYS A 1 9  ? 9.948   8.990   -1.696  1.00 0.10  ? 9  LYS A HE2  1 
ATOM 118  H HE3  . LYS A 1 9  ? 9.113   7.449   -1.962  1.00 0.10  ? 9  LYS A HE3  1 
ATOM 119  H HZ1  . LYS A 1 9  ? 11.932  7.973   -2.582  1.00 0.29  ? 9  LYS A HZ1  1 
ATOM 120  H HZ2  . LYS A 1 9  ? 11.376  7.137   -1.273  1.00 0.29  ? 9  LYS A HZ2  1 
ATOM 121  H HZ3  . LYS A 1 9  ? 11.146  6.538   -2.792  1.00 0.29  ? 9  LYS A HZ3  1 
ATOM 122  N N    . PHE A 1 10 ? 5.153   10.068  -1.117  1.00 -0.46 ? 10 PHE A N    1 
ATOM 123  C CA   . PHE A 1 10 ? 4.509   9.956   0.183   1.00 0.03  ? 10 PHE A CA   1 
ATOM 124  C C    . PHE A 1 10 ? 2.989   9.914   0.044   1.00 0.62  ? 10 PHE A C    1 
ATOM 125  O O    . PHE A 1 10 ? 2.341   9.084   0.669   1.00 -0.50 ? 10 PHE A O    1 
ATOM 126  C CB   . PHE A 1 10 ? 4.947   11.141  1.048   1.00 -0.10 ? 10 PHE A CB   1 
ATOM 127  C CG   . PHE A 1 10 ? 6.421   11.458  0.900   1.00 -0.10 ? 10 PHE A CG   1 
ATOM 128  C CD1  . PHE A 1 10 ? 7.385   10.489  1.238   1.00 -0.15 ? 10 PHE A CD1  1 
ATOM 129  C CD2  . PHE A 1 10 ? 6.828   12.708  0.396   1.00 -0.15 ? 10 PHE A CD2  1 
ATOM 130  C CE1  . PHE A 1 10 ? 8.752   10.772  1.074   1.00 -0.15 ? 10 PHE A CE1  1 
ATOM 131  C CE2  . PHE A 1 10 ? 8.195   12.988  0.232   1.00 -0.15 ? 10 PHE A CE2  1 
ATOM 132  C CZ   . PHE A 1 10 ? 9.157   12.021  0.570   1.00 -0.15 ? 10 PHE A CZ   1 
ATOM 133  H H    . PHE A 1 10 ? 5.723   10.883  -1.292  1.00 0.25  ? 10 PHE A H    1 
ATOM 134  H HA   . PHE A 1 10 ? 4.843   9.033   0.659   1.00 0.05  ? 10 PHE A HA   1 
ATOM 135  H HB2  . PHE A 1 10 ? 4.368   12.019  0.761   1.00 0.11  ? 10 PHE A HB2  1 
ATOM 136  H HB3  . PHE A 1 10 ? 4.738   10.911  2.092   1.00 0.11  ? 10 PHE A HB3  1 
ATOM 137  H HD1  . PHE A 1 10 ? 7.073   9.525   1.617   1.00 0.15  ? 10 PHE A HD1  1 
ATOM 138  H HD2  . PHE A 1 10 ? 6.090   13.451  0.129   1.00 0.15  ? 10 PHE A HD2  1 
ATOM 139  H HE1  . PHE A 1 10 ? 9.491   10.027  1.331   1.00 0.15  ? 10 PHE A HE1  1 
ATOM 140  H HE2  . PHE A 1 10 ? 8.507   13.946  -0.157  1.00 0.15  ? 10 PHE A HE2  1 
ATOM 141  H HZ   . PHE A 1 10 ? 10.208  12.236  0.440   1.00 0.15  ? 10 PHE A HZ   1 
ATOM 142  N N    . GLY A 1 11 ? 2.421   10.811  -0.770  1.00 -0.46 ? 11 GLY A N    1 
ATOM 143  C CA   . GLY A 1 11 ? 0.978   10.870  -0.970  1.00 0.03  ? 11 GLY A CA   1 
ATOM 144  C C    . GLY A 1 11 ? 0.456   9.534   -1.496  1.00 0.62  ? 11 GLY A C    1 
ATOM 145  O O    . GLY A 1 11 ? -0.518  8.993   -0.970  1.00 -0.50 ? 11 GLY A O    1 
ATOM 146  H H    . GLY A 1 11 ? 3.000   11.472  -1.264  1.00 0.25  ? 11 GLY A H    1 
ATOM 147  H HA2  . GLY A 1 11 ? 0.492   11.099  -0.021  1.00 0.03  ? 11 GLY A HA2  1 
ATOM 148  H HA3  . GLY A 1 11 ? 0.745   11.654  -1.690  1.00 0.03  ? 11 GLY A HA3  1 
ATOM 149  N N    . VAL A 1 12 ? 1.110   9.005   -2.535  1.00 -0.46 ? 12 VAL A N    1 
ATOM 150  C CA   . VAL A 1 12 ? 0.726   7.736   -3.135  1.00 0.03  ? 12 VAL A CA   1 
ATOM 151  C C    . VAL A 1 12 ? 0.742   6.635   -2.069  1.00 0.62  ? 12 VAL A C    1 
ATOM 152  O O    . VAL A 1 12 ? -0.235  5.902   -1.915  1.00 -0.50 ? 12 VAL A O    1 
ATOM 153  C CB   . VAL A 1 12 ? 1.698   7.420   -4.289  1.00 -0.01 ? 12 VAL A CB   1 
ATOM 154  C CG1  . VAL A 1 12 ? 1.525   5.969   -4.746  1.00 -0.09 ? 12 VAL A CG1  1 
ATOM 155  C CG2  . VAL A 1 12 ? 1.411   8.356   -5.467  1.00 -0.09 ? 12 VAL A CG2  1 
ATOM 156  H H    . VAL A 1 12 ? 1.901   9.495   -2.925  1.00 0.25  ? 12 VAL A H    1 
ATOM 157  H HA   . VAL A 1 12 ? -0.284  7.825   -3.536  1.00 0.05  ? 12 VAL A HA   1 
ATOM 158  H HB   . VAL A 1 12 ? 2.726   7.571   -3.952  1.00 0.02  ? 12 VAL A HB   1 
ATOM 159  H HG11 . VAL A 1 12 ? 1.904   5.296   -3.979  1.00 0.03  ? 12 VAL A HG11 1 
ATOM 160  H HG12 . VAL A 1 12 ? 2.082   5.811   -5.670  1.00 0.03  ? 12 VAL A HG12 1 
ATOM 161  H HG13 . VAL A 1 12 ? 0.471   5.766   -4.921  1.00 0.03  ? 12 VAL A HG13 1 
ATOM 162  H HG21 . VAL A 1 12 ? 0.390   8.198   -5.819  1.00 0.03  ? 12 VAL A HG21 1 
ATOM 163  H HG22 . VAL A 1 12 ? 2.109   8.145   -6.278  1.00 0.03  ? 12 VAL A HG22 1 
ATOM 164  H HG23 . VAL A 1 12 ? 1.529   9.392   -5.149  1.00 0.03  ? 12 VAL A HG23 1 
ATOM 165  N N    . LEU A 1 13 ? 1.854   6.524   -1.338  1.00 -0.46 ? 13 LEU A N    1 
ATOM 166  C CA   . LEU A 1 13 ? 2.011   5.510   -0.304  1.00 0.03  ? 13 LEU A CA   1 
ATOM 167  C C    . LEU A 1 13 ? 0.952   5.677   0.790   1.00 0.62  ? 13 LEU A C    1 
ATOM 168  O O    . LEU A 1 13 ? 0.389   4.692   1.258   1.00 -0.50 ? 13 LEU A O    1 
ATOM 169  C CB   . LEU A 1 13 ? 3.426   5.623   0.273   1.00 -0.06 ? 13 LEU A CB   1 
ATOM 170  C CG   . LEU A 1 13 ? 3.635   4.628   1.424   1.00 -0.01 ? 13 LEU A CG   1 
ATOM 171  C CD1  . LEU A 1 13 ? 3.374   3.199   0.940   1.00 -0.11 ? 13 LEU A CD1  1 
ATOM 172  C CD2  . LEU A 1 13 ? 5.078   4.740   1.920   1.00 -0.11 ? 13 LEU A CD2  1 
ATOM 173  H H    . LEU A 1 13 ? 2.625   7.162   -1.503  1.00 0.25  ? 13 LEU A H    1 
ATOM 174  H HA   . LEU A 1 13 ? 1.895   4.529   -0.760  1.00 0.05  ? 13 LEU A HA   1 
ATOM 175  H HB2  . LEU A 1 13 ? 4.145   5.412   -0.515  1.00 0.03  ? 13 LEU A HB2  1 
ATOM 176  H HB3  . LEU A 1 13 ? 3.585   6.637   0.642   1.00 0.03  ? 13 LEU A HB3  1 
ATOM 177  H HG   . LEU A 1 13 ? 2.954   4.864   2.243   1.00 0.03  ? 13 LEU A HG   1 
ATOM 178  H HD11 . LEU A 1 13 ? 2.304   3.041   0.820   1.00 0.03  ? 13 LEU A HD11 1 
ATOM 179  H HD12 . LEU A 1 13 ? 3.762   2.491   1.673   1.00 0.03  ? 13 LEU A HD12 1 
ATOM 180  H HD13 . LEU A 1 13 ? 3.874   3.042   -0.015  1.00 0.03  ? 13 LEU A HD13 1 
ATOM 181  H HD21 . LEU A 1 13 ? 5.763   4.517   1.101   1.00 0.03  ? 13 LEU A HD21 1 
ATOM 182  H HD22 . LEU A 1 13 ? 5.241   4.032   2.733   1.00 0.03  ? 13 LEU A HD22 1 
ATOM 183  H HD23 . LEU A 1 13 ? 5.261   5.753   2.280   1.00 0.03  ? 13 LEU A HD23 1 
ATOM 184  N N    . ALA A 1 14 ? 0.685   6.918   1.199   1.00 -0.46 ? 14 ALA A N    1 
ATOM 185  C CA   . ALA A 1 14 ? -0.285  7.196   2.247   1.00 0.03  ? 14 ALA A CA   1 
ATOM 186  C C    . ALA A 1 14 ? -1.677  6.733   1.823   1.00 0.62  ? 14 ALA A C    1 
ATOM 187  O O    . ALA A 1 14 ? -2.394  6.130   2.620   1.00 -0.50 ? 14 ALA A O    1 
ATOM 188  C CB   . ALA A 1 14 ? -0.284  8.695   2.553   1.00 -0.10 ? 14 ALA A CB   1 
ATOM 189  H H    . ALA A 1 14 ? 1.170   7.697   0.777   1.00 0.25  ? 14 ALA A H    1 
ATOM 190  H HA   . ALA A 1 14 ? 0.005   6.652   3.151   1.00 0.05  ? 14 ALA A HA   1 
ATOM 191  H HB1  . ALA A 1 14 ? 0.709   8.999   2.883   1.00 0.04  ? 14 ALA A HB1  1 
ATOM 192  H HB2  . ALA A 1 14 ? -1.007  8.905   3.342   1.00 0.04  ? 14 ALA A HB2  1 
ATOM 193  H HB3  . ALA A 1 14 ? -0.555  9.252   1.657   1.00 0.04  ? 14 ALA A HB3  1 
ATOM 194  N N    . LYS A 1 15 ? -2.066  7.011   0.570   1.00 -0.46 ? 15 LYS A N    1 
ATOM 195  C CA   . LYS A 1 15 ? -3.373  6.620   0.077   1.00 0.03  ? 15 LYS A CA   1 
ATOM 196  C C    . LYS A 1 15 ? -3.457  5.099   0.008   1.00 0.62  ? 15 LYS A C    1 
ATOM 197  O O    . LYS A 1 15 ? -4.501  4.527   0.306   1.00 -0.50 ? 15 LYS A O    1 
ATOM 198  C CB   . LYS A 1 15 ? -3.619  7.253   -1.295  1.00 -0.10 ? 15 LYS A CB   1 
ATOM 199  C CG   . LYS A 1 15 ? -5.053  6.954   -1.748  1.00 -0.16 ? 15 LYS A CG   1 
ATOM 200  C CD   . LYS A 1 15 ? -5.471  7.957   -2.827  1.00 -0.18 ? 15 LYS A CD   1 
ATOM 201  C CE   . LYS A 1 15 ? -6.823  7.553   -3.426  1.00 -0.04 ? 15 LYS A CE   1 
ATOM 202  N NZ   . LYS A 1 15 ? -7.901  7.630   -2.424  1.00 -0.14 ? 15 LYS A NZ   1 
ATOM 203  H H    . LYS A 1 15 ? -1.443  7.503   -0.057  1.00 0.25  ? 15 LYS A H    1 
ATOM 204  H HA   . LYS A 1 15 ? -4.131  6.984   0.772   1.00 0.05  ? 15 LYS A HA   1 
ATOM 205  H HB2  . LYS A 1 15 ? -3.479  8.332   -1.224  1.00 0.04  ? 15 LYS A HB2  1 
ATOM 206  H HB3  . LYS A 1 15 ? -2.914  6.843   -2.019  1.00 0.04  ? 15 LYS A HB3  1 
ATOM 207  H HG2  . LYS A 1 15 ? -5.101  5.942   -2.152  1.00 0.12  ? 15 LYS A HG2  1 
ATOM 208  H HG3  . LYS A 1 15 ? -5.727  7.036   -0.895  1.00 0.12  ? 15 LYS A HG3  1 
ATOM 209  H HD2  . LYS A 1 15 ? -5.549  8.953   -2.388  1.00 0.12  ? 15 LYS A HD2  1 
ATOM 210  H HD3  . LYS A 1 15 ? -4.720  7.970   -3.614  1.00 0.12  ? 15 LYS A HD3  1 
ATOM 211  H HE2  . LYS A 1 15 ? -7.059  8.222   -4.255  1.00 0.10  ? 15 LYS A HE2  1 
ATOM 212  H HE3  . LYS A 1 15 ? -6.757  6.533   -3.802  1.00 0.10  ? 15 LYS A HE3  1 
ATOM 213  H HZ1  . LYS A 1 15 ? -7.950  8.568   -2.051  1.00 0.29  ? 15 LYS A HZ1  1 
ATOM 214  H HZ2  . LYS A 1 15 ? -8.782  7.395   -2.859  1.00 0.29  ? 15 LYS A HZ2  1 
ATOM 215  H HZ3  . LYS A 1 15 ? -7.712  6.979   -1.675  1.00 0.29  ? 15 LYS A HZ3  1 
ATOM 216  N N    . ILE A 1 16 ? -2.354  4.446   -0.379  1.00 -0.46 ? 16 ILE A N    1 
ATOM 217  C CA   . ILE A 1 16 ? -2.308  2.996   -0.455  1.00 0.03  ? 16 ILE A CA   1 
ATOM 218  C C    . ILE A 1 16 ? -2.490  2.404   0.942   1.00 0.62  ? 16 ILE A C    1 
ATOM 219  O O    . ILE A 1 16 ? -3.328  1.531   1.135   1.00 -0.50 ? 16 ILE A O    1 
ATOM 220  C CB   . ILE A 1 16 ? -0.975  2.555   -1.083  1.00 -0.01 ? 16 ILE A CB   1 
ATOM 221  C CG1  . ILE A 1 16 ? -1.010  2.834   -2.596  1.00 -0.05 ? 16 ILE A CG1  1 
ATOM 222  C CG2  . ILE A 1 16 ? -0.760  1.057   -0.833  1.00 -0.08 ? 16 ILE A CG2  1 
ATOM 223  C CD1  . ILE A 1 16 ? 0.408   2.831   -3.168  1.00 -0.08 ? 16 ILE A CD1  1 
ATOM 224  H H    . ILE A 1 16 ? -1.521  4.968   -0.624  1.00 0.25  ? 16 ILE A H    1 
ATOM 225  H HA   . ILE A 1 16 ? -3.123  2.650   -1.086  1.00 0.05  ? 16 ILE A HA   1 
ATOM 226  H HB   . ILE A 1 16 ? -0.159  3.116   -0.630  1.00 0.02  ? 16 ILE A HB   1 
ATOM 227  H HG12 . ILE A 1 16 ? -1.599  2.066   -3.093  1.00 0.03  ? 16 ILE A HG12 1 
ATOM 228  H HG13 . ILE A 1 16 ? -1.467  3.810   -2.775  1.00 0.03  ? 16 ILE A HG13 1 
ATOM 229  H HG21 . ILE A 1 16 ? -0.485  0.896   0.210   1.00 0.03  ? 16 ILE A HG21 1 
ATOM 230  H HG22 . ILE A 1 16 ? 0.038   0.687   -1.474  1.00 0.03  ? 16 ILE A HG22 1 
ATOM 231  H HG23 . ILE A 1 16 ? -1.680  0.516   -1.051  1.00 0.03  ? 16 ILE A HG23 1 
ATOM 232  H HD11 . ILE A 1 16 ? 1.028   3.531   -2.611  1.00 0.03  ? 16 ILE A HD11 1 
ATOM 233  H HD12 . ILE A 1 16 ? 0.376   3.131   -4.216  1.00 0.03  ? 16 ILE A HD12 1 
ATOM 234  H HD13 . ILE A 1 16 ? 0.832   1.832   -3.092  1.00 0.03  ? 16 ILE A HD13 1 
ATOM 235  N N    . VAL A 1 17 ? -1.707  2.885   1.912   1.00 -0.46 ? 17 VAL A N    1 
ATOM 236  C CA   . VAL A 1 17 ? -1.792  2.410   3.287   1.00 0.03  ? 17 VAL A CA   1 
ATOM 237  C C    . VAL A 1 17 ? -3.209  2.633   3.827   1.00 0.62  ? 17 VAL A C    1 
ATOM 238  O O    . VAL A 1 17 ? -3.769  1.753   4.480   1.00 -0.50 ? 17 VAL A O    1 
ATOM 239  C CB   . VAL A 1 17 ? -0.735  3.144   4.136   1.00 -0.01 ? 17 VAL A CB   1 
ATOM 240  C CG1  . VAL A 1 17 ? -1.159  3.192   5.607   1.00 -0.09 ? 17 VAL A CG1  1 
ATOM 241  C CG2  . VAL A 1 17 ? 0.604   2.408   4.026   1.00 -0.09 ? 17 VAL A CG2  1 
ATOM 242  H H    . VAL A 1 17 ? -1.030  3.604   1.696   1.00 0.25  ? 17 VAL A H    1 
ATOM 243  H HA   . VAL A 1 17 ? -1.578  1.340   3.304   1.00 0.05  ? 17 VAL A HA   1 
ATOM 244  H HB   . VAL A 1 17 ? -0.618  4.162   3.766   1.00 0.02  ? 17 VAL A HB   1 
ATOM 245  H HG11 . VAL A 1 17 ? -2.008  3.866   5.721   1.00 0.03  ? 17 VAL A HG11 1 
ATOM 246  H HG12 . VAL A 1 17 ? -0.328  3.559   6.210   1.00 0.03  ? 17 VAL A HG12 1 
ATOM 247  H HG13 . VAL A 1 17 ? -1.437  2.192   5.943   1.00 0.03  ? 17 VAL A HG13 1 
ATOM 248  H HG21 . VAL A 1 17 ? 0.519   1.422   4.487   1.00 0.03  ? 17 VAL A HG21 1 
ATOM 249  H HG22 . VAL A 1 17 ? 1.376   2.981   4.539   1.00 0.03  ? 17 VAL A HG22 1 
ATOM 250  H HG23 . VAL A 1 17 ? 0.874   2.296   2.976   1.00 0.03  ? 17 VAL A HG23 1 
ATOM 251  N N    . ASN A 1 18 ? -3.787  3.810   3.554   1.00 -0.46 ? 18 ASN A N    1 
ATOM 252  C CA   . ASN A 1 18 ? -5.128  4.136   4.017   1.00 0.03  ? 18 ASN A CA   1 
ATOM 253  C C    . ASN A 1 18 ? -6.145  3.167   3.414   1.00 0.62  ? 18 ASN A C    1 
ATOM 254  O O    . ASN A 1 18 ? -6.963  2.602   4.134   1.00 -0.50 ? 18 ASN A O    1 
ATOM 255  C CB   . ASN A 1 18 ? -5.465  5.578   3.636   1.00 -0.09 ? 18 ASN A CB   1 
ATOM 256  C CG   . ASN A 1 18 ? -6.845  5.965   4.157   1.00 0.68  ? 18 ASN A CG   1 
ATOM 257  O OD1  . ASN A 1 18 ? -7.852  5.714   3.502   1.00 -0.47 ? 18 ASN A OD1  1 
ATOM 258  N ND2  . ASN A 1 18 ? -6.890  6.577   5.342   1.00 -0.87 ? 18 ASN A ND2  1 
ATOM 259  H H    . ASN A 1 18 ? -3.285  4.502   3.011   1.00 0.25  ? 18 ASN A H    1 
ATOM 260  H HA   . ASN A 1 18 ? -5.156  4.044   5.103   1.00 0.05  ? 18 ASN A HA   1 
ATOM 261  H HB2  . ASN A 1 18 ? -4.718  6.247   4.063   1.00 0.04  ? 18 ASN A HB2  1 
ATOM 262  H HB3  . ASN A 1 18 ? -5.453  5.676   2.550   1.00 0.04  ? 18 ASN A HB3  1 
ATOM 263  H HD21 . ASN A 1 18 ? -6.036  6.759   5.849   1.00 0.34  ? 18 ASN A HD21 1 
ATOM 264  H HD22 . ASN A 1 18 ? -7.779  6.860   5.727   1.00 0.34  ? 18 ASN A HD22 1 
ATOM 265  N N    . TYR A 1 19 ? -6.091  2.981   2.091   1.00 -0.46 ? 19 TYR A N    1 
ATOM 266  C CA   . TYR A 1 19 ? -7.003  2.087   1.394   1.00 0.03  ? 19 TYR A CA   1 
ATOM 267  C C    . TYR A 1 19 ? -6.877  0.670   1.956   1.00 0.62  ? 19 TYR A C    1 
ATOM 268  O O    . TYR A 1 19 ? -7.874  0.070   2.348   1.00 -0.50 ? 19 TYR A O    1 
ATOM 269  C CB   . TYR A 1 19 ? -6.686  2.108   -0.108  1.00 -0.10 ? 19 TYR A CB   1 
ATOM 270  C CG   . TYR A 1 19 ? -6.992  0.797   -0.799  1.00 -0.03 ? 19 TYR A CG   1 
ATOM 271  C CD1  . TYR A 1 19 ? -8.322  0.362   -0.926  1.00 0.00  ? 19 TYR A CD1  1 
ATOM 272  C CD2  . TYR A 1 19 ? -5.942  0.000   -1.286  1.00 0.00  ? 19 TYR A CD2  1 
ATOM 273  C CE1  . TYR A 1 19 ? -8.600  -0.870  -1.535  1.00 -0.26 ? 19 TYR A CE1  1 
ATOM 274  C CE2  . TYR A 1 19 ? -6.223  -1.232  -1.895  1.00 -0.26 ? 19 TYR A CE2  1 
ATOM 275  C CZ   . TYR A 1 19 ? -7.549  -1.669  -2.017  1.00 0.46  ? 19 TYR A CZ   1 
ATOM 276  O OH   . TYR A 1 19 ? -7.815  -2.871  -2.596  1.00 -0.53 ? 19 TYR A OH   1 
ATOM 277  H H    . TYR A 1 19 ? -5.396  3.474   1.546   1.00 0.25  ? 19 TYR A H    1 
ATOM 278  H HA   . TYR A 1 19 ? -8.026  2.435   1.545   1.00 0.05  ? 19 TYR A HA   1 
ATOM 279  H HB2  . TYR A 1 19 ? -7.270  2.899   -0.580  1.00 0.04  ? 19 TYR A HB2  1 
ATOM 280  H HB3  . TYR A 1 19 ? -5.628  2.329   -0.240  1.00 0.04  ? 19 TYR A HB3  1 
ATOM 281  H HD1  . TYR A 1 19 ? -9.129  0.972   -0.547  1.00 0.06  ? 19 TYR A HD1  1 
ATOM 282  H HD2  . TYR A 1 19 ? -4.920  0.331   -1.185  1.00 0.06  ? 19 TYR A HD2  1 
ATOM 283  H HE1  . TYR A 1 19 ? -9.620  -1.206  -1.627  1.00 0.10  ? 19 TYR A HE1  1 
ATOM 284  H HE2  . TYR A 1 19 ? -5.417  -1.848  -2.263  1.00 0.10  ? 19 TYR A HE2  1 
ATOM 285  H HH   . TYR A 1 19 ? -8.110  -2.791  -3.514  1.00 0.33  ? 19 TYR A HH   1 
ATOM 286  N N    . MET A 1 20 ? -5.648  0.142   1.988   1.00 -0.46 ? 20 MET A N    1 
ATOM 287  C CA   . MET A 1 20 ? -5.385  -1.201  2.486   1.00 0.03  ? 20 MET A CA   1 
ATOM 288  C C    . MET A 1 20 ? -5.935  -1.352  3.901   1.00 0.62  ? 20 MET A C    1 
ATOM 289  O O    . MET A 1 20 ? -6.542  -2.371  4.217   1.00 -0.50 ? 20 MET A O    1 
ATOM 290  C CB   . MET A 1 20 ? -3.874  -1.464  2.451   1.00 -0.15 ? 20 MET A CB   1 
ATOM 291  C CG   . MET A 1 20 ? -3.413  -1.708  1.008   1.00 -0.05 ? 20 MET A CG   1 
ATOM 292  S SD   . MET A 1 20 ? -4.093  -3.208  0.246   1.00 0.74  ? 20 MET A SD   1 
ATOM 293  C CE   . MET A 1 20 ? -3.201  -4.465  1.195   1.00 -0.13 ? 20 MET A CE   1 
ATOM 294  H H    . MET A 1 20 ? -4.866  0.687   1.654   1.00 0.25  ? 20 MET A H    1 
ATOM 295  H HA   . MET A 1 20 ? -5.887  -1.925  1.844   1.00 0.05  ? 20 MET A HA   1 
ATOM 296  H HB2  . MET A 1 20 ? -3.345  -0.603  2.860   1.00 0.03  ? 20 MET A HB2  1 
ATOM 297  H HB3  . MET A 1 20 ? -3.647  -2.337  3.049   1.00 0.03  ? 20 MET A HB3  1 
ATOM 298  H HG2  . MET A 1 20 ? -3.707  -0.854  0.402   1.00 0.07  ? 20 MET A HG2  1 
ATOM 299  H HG3  . MET A 1 20 ? -2.325  -1.779  0.999   1.00 0.07  ? 20 MET A HG3  1 
ATOM 300  H HE1  . MET A 1 20 ? -2.128  -4.297  1.105   1.00 0.07  ? 20 MET A HE1  1 
ATOM 301  H HE2  . MET A 1 20 ? -3.448  -5.452  0.806   1.00 0.07  ? 20 MET A HE2  1 
ATOM 302  H HE3  . MET A 1 20 ? -3.492  -4.406  2.241   1.00 0.07  ? 20 MET A HE3  1 
ATOM 303  N N    . LYS A 1 21 ? -5.732  -0.337  4.751   1.00 -0.46 ? 21 LYS A N    1 
ATOM 304  C CA   . LYS A 1 21 ? -6.239  -0.368  6.112   1.00 0.03  ? 21 LYS A CA   1 
ATOM 305  C C    . LYS A 1 21 ? -7.751  -0.496  6.095   1.00 0.62  ? 21 LYS A C    1 
ATOM 306  O O    . LYS A 1 21 ? -8.289  -1.475  6.573   1.00 -0.50 ? 21 LYS A O    1 
ATOM 307  C CB   . LYS A 1 21 ? -5.845  0.911   6.848   1.00 -0.10 ? 21 LYS A CB   1 
ATOM 308  C CG   . LYS A 1 21 ? -6.560  0.950   8.208   1.00 -0.16 ? 21 LYS A CG   1 
ATOM 309  C CD   . LYS A 1 21 ? -6.060  2.130   9.039   1.00 -0.18 ? 21 LYS A CD   1 
ATOM 310  C CE   . LYS A 1 21 ? -6.138  3.429   8.234   1.00 -0.04 ? 21 LYS A CE   1 
ATOM 311  N NZ   . LYS A 1 21 ? -7.479  3.630   7.643   1.00 -0.14 ? 21 LYS A NZ   1 
ATOM 312  H H    . LYS A 1 21 ? -5.217  0.479   4.446   1.00 0.25  ? 21 LYS A H    1 
ATOM 313  H HA   . LYS A 1 21 ? -5.816  -1.227  6.632   1.00 0.05  ? 21 LYS A HA   1 
ATOM 314  H HB2  . LYS A 1 21 ? -4.771  0.932   6.999   1.00 0.04  ? 21 LYS A HB2  1 
ATOM 315  H HB3  . LYS A 1 21 ? -6.141  1.770   6.256   1.00 0.04  ? 21 LYS A HB3  1 
ATOM 316  H HG2  . LYS A 1 21 ? -7.634  1.049   8.057   1.00 0.12  ? 21 LYS A HG2  1 
ATOM 317  H HG3  . LYS A 1 21 ? -6.360  0.023   8.747   1.00 0.12  ? 21 LYS A HG3  1 
ATOM 318  H HD2  . LYS A 1 21 ? -6.675  2.222   9.933   1.00 0.12  ? 21 LYS A HD2  1 
ATOM 319  H HD3  . LYS A 1 21 ? -5.026  1.950   9.330   1.00 0.12  ? 21 LYS A HD3  1 
ATOM 320  H HE2  . LYS A 1 21 ? -5.913  4.263   8.895   1.00 0.10  ? 21 LYS A HE2  1 
ATOM 321  H HE3  . LYS A 1 21 ? -5.394  3.396   7.441   1.00 0.10  ? 21 LYS A HE3  1 
ATOM 322  H HZ1  . LYS A 1 21 ? -8.177  3.611   8.372   1.00 0.29  ? 21 LYS A HZ1  1 
ATOM 323  H HZ2  . LYS A 1 21 ? -7.508  4.525   7.173   1.00 0.29  ? 21 LYS A HZ2  1 
ATOM 324  H HZ3  . LYS A 1 21 ? -7.670  2.896   6.975   1.00 0.29  ? 21 LYS A HZ3  1 
ATOM 325  N N    . THR A 1 22 ? -8.424  0.519   5.554   1.00 -0.46 ? 22 THR A N    1 
ATOM 326  C CA   . THR A 1 22 ? -9.877  0.564   5.503   1.00 0.03  ? 22 THR A CA   1 
ATOM 327  C C    . THR A 1 22 ? -10.453 -0.741  4.933   1.00 0.62  ? 22 THR A C    1 
ATOM 328  O O    . THR A 1 22 ? -11.424 -1.269  5.467   1.00 -0.50 ? 22 THR A O    1 
ATOM 329  C CB   . THR A 1 22 ? -10.297 1.773   4.662   1.00 0.17  ? 22 THR A CB   1 
ATOM 330  O OG1  . THR A 1 22 ? -9.599  2.918   5.114   1.00 -0.55 ? 22 THR A OG1  1 
ATOM 331  C CG2  . THR A 1 22 ? -11.800 2.012   4.804   1.00 -0.19 ? 22 THR A CG2  1 
ATOM 332  H H    . THR A 1 22 ? -7.912  1.304   5.170   1.00 0.25  ? 22 THR A H    1 
ATOM 333  H HA   . THR A 1 22 ? -10.255 0.696   6.520   1.00 0.05  ? 22 THR A HA   1 
ATOM 334  H HB   . THR A 1 22 ? -10.053 1.591   3.613   1.00 0.08  ? 22 THR A HB   1 
ATOM 335  H HG1  . THR A 1 22 ? -9.657  3.598   4.436   1.00 0.31  ? 22 THR A HG1  1 
ATOM 336  H HG21 . THR A 1 22 ? -12.345 1.144   4.434   1.00 0.07  ? 22 THR A HG21 1 
ATOM 337  H HG22 . THR A 1 22 ? -12.084 2.891   4.226   1.00 0.07  ? 22 THR A HG22 1 
ATOM 338  H HG23 . THR A 1 22 ? -12.043 2.174   5.855   1.00 0.07  ? 22 THR A HG23 1 
ATOM 339  N N    . ARG A 1 23 ? -9.858  -1.263  3.855   1.00 -0.46 ? 23 ARG A N    1 
ATOM 340  C CA   . ARG A 1 23 ? -10.329 -2.500  3.247   1.00 0.03  ? 23 ARG A CA   1 
ATOM 341  C C    . ARG A 1 23 ? -10.152 -3.665  4.232   1.00 0.62  ? 23 ARG A C    1 
ATOM 342  O O    . ARG A 1 23 ? -11.068 -4.467  4.425   1.00 -0.50 ? 23 ARG A O    1 
ATOM 343  C CB   . ARG A 1 23 ? -9.568  -2.754  1.940   1.00 -0.08 ? 23 ARG A CB   1 
ATOM 344  C CG   . ARG A 1 23 ? -10.047 -4.075  1.339   1.00 -0.10 ? 23 ARG A CG   1 
ATOM 345  C CD   . ARG A 1 23 ? -9.814  -4.104  -0.171  1.00 -0.23 ? 23 ARG A CD   1 
ATOM 346  N NE   . ARG A 1 23 ? -10.417 -5.312  -0.753  1.00 -0.32 ? 23 ARG A NE   1 
ATOM 347  C CZ   . ARG A 1 23 ? -10.502 -5.536  -2.072  1.00 0.76  ? 23 ARG A CZ   1 
ATOM 348  N NH1  . ARG A 1 23 ? -10.018 -4.644  -2.938  1.00 -0.62 ? 23 ARG A NH1  1 
ATOM 349  N NH2  . ARG A 1 23 ? -11.076 -6.659  -2.518  1.00 -0.62 ? 23 ARG A NH2  1 
ATOM 350  H H    . ARG A 1 23 ? -9.060  -0.797  3.445   1.00 0.25  ? 23 ARG A H    1 
ATOM 351  H HA   . ARG A 1 23 ? -11.389 -2.395  3.017   1.00 0.05  ? 23 ARG A HA   1 
ATOM 352  H HB2  . ARG A 1 23 ? -9.767  -1.940  1.241   1.00 0.06  ? 23 ARG A HB2  1 
ATOM 353  H HB3  . ARG A 1 23 ? -8.497  -2.809  2.140   1.00 0.06  ? 23 ARG A HB3  1 
ATOM 354  H HG2  . ARG A 1 23 ? -9.502  -4.896  1.804   1.00 0.07  ? 23 ARG A HG2  1 
ATOM 355  H HG3  . ARG A 1 23 ? -11.112 -4.188  1.535   1.00 0.07  ? 23 ARG A HG3  1 
ATOM 356  H HD2  . ARG A 1 23 ? -10.268 -3.222  -0.622  1.00 0.13  ? 23 ARG A HD2  1 
ATOM 357  H HD3  . ARG A 1 23 ? -8.741  -4.101  -0.371  1.00 0.13  ? 23 ARG A HD3  1 
ATOM 358  H HE   . ARG A 1 23 ? -10.786 -6.004  -0.116  1.00 0.27  ? 23 ARG A HE   1 
ATOM 359  H HH11 . ARG A 1 23 ? -9.565  -3.804  -2.601  1.00 0.36  ? 23 ARG A HH11 1 
ATOM 360  H HH12 . ARG A 1 23 ? -10.100 -4.801  -3.933  1.00 0.36  ? 23 ARG A HH12 1 
ATOM 361  H HH21 . ARG A 1 23 ? -11.473 -7.323  -1.853  1.00 0.36  ? 23 ARG A HH21 1 
ATOM 362  H HH22 . ARG A 1 23 ? -11.116 -6.850  -3.507  1.00 0.36  ? 23 ARG A HH22 1 
ATOM 363  N N    . HIS A 1 24 ? -8.976  -3.742  4.857   1.00 -0.46 ? 24 HIS A N    1 
ATOM 364  C CA   . HIS A 1 24 ? -8.673  -4.769  5.845   1.00 0.03  ? 24 HIS A CA   1 
ATOM 365  C C    . HIS A 1 24 ? -9.601  -4.606  7.060   1.00 0.62  ? 24 HIS A C    1 
ATOM 366  O O    . HIS A 1 24 ? -9.962  -5.583  7.707   1.00 -0.50 ? 24 HIS A O    1 
ATOM 367  C CB   . HIS A 1 24 ? -7.189  -4.629  6.224   1.00 -0.10 ? 24 HIS A CB   1 
ATOM 368  C CG   . HIS A 1 24 ? -6.754  -5.472  7.396   1.00 -0.03 ? 24 HIS A CG   1 
ATOM 369  N ND1  . HIS A 1 24 ? -5.998  -6.631  7.258   1.00 -0.15 ? 24 HIS A ND1  1 
ATOM 370  C CD2  . HIS A 1 24 ? -6.905  -5.314  8.748   1.00 0.20  ? 24 HIS A CD2  1 
ATOM 371  C CE1  . HIS A 1 24 ? -5.758  -7.090  8.505   1.00 0.24  ? 24 HIS A CE1  1 
ATOM 372  N NE2  . HIS A 1 24 ? -6.284  -6.327  9.461   1.00 -0.50 ? 24 HIS A NE2  1 
ATOM 373  H H    . HIS A 1 24 ? -8.258  -3.059  4.649   1.00 0.25  ? 24 HIS A H    1 
ATOM 374  H HA   . HIS A 1 24 ? -8.837  -5.750  5.403   1.00 0.05  ? 24 HIS A HA   1 
ATOM 375  H HB2  . HIS A 1 24 ? -6.586  -4.905  5.359   1.00 0.04  ? 24 HIS A HB2  1 
ATOM 376  H HB3  . HIS A 1 24 ? -6.989  -3.587  6.465   1.00 0.04  ? 24 HIS A HB3  1 
ATOM 377  H HD1  . HIS A 1 24 ? -5.684  -7.047  6.393   1.00 0.23  ? 24 HIS A HD1  1 
ATOM 378  H HD2  . HIS A 1 24 ? -7.422  -4.492  9.199   1.00 0.02  ? 24 HIS A HD2  1 
ATOM 379  H HE1  . HIS A 1 24 ? -5.184  -7.980  8.710   1.00 0.04  ? 24 HIS A HE1  1 
ATOM 380  N N    . GLN A 1 25 ? -9.992  -3.365  7.356   1.00 -0.46 ? 25 GLN A N    1 
ATOM 381  C CA   . GLN A 1 25 ? -10.873 -3.065  8.469   1.00 0.03  ? 25 GLN A CA   1 
ATOM 382  C C    . GLN A 1 25 ? -12.283 -3.568  8.159   1.00 0.62  ? 25 GLN A C    1 
ATOM 383  O O    . GLN A 1 25 ? -12.968 -4.078  9.042   1.00 -0.50 ? 25 GLN A O    1 
ATOM 384  C CB   . GLN A 1 25 ? -10.866 -1.549  8.706   1.00 -0.10 ? 25 GLN A CB   1 
ATOM 385  C CG   . GLN A 1 25 ? -11.415 -1.226  10.095  1.00 -0.10 ? 25 GLN A CG   1 
ATOM 386  C CD   . GLN A 1 25 ? -11.297 0.268   10.385  1.00 0.68  ? 25 GLN A CD   1 
ATOM 387  O OE1  . GLN A 1 25 ? -11.567 1.095   9.517   1.00 -0.47 ? 25 GLN A OE1  1 
ATOM 388  N NE2  . GLN A 1 25 ? -10.888 0.616   11.606  1.00 -0.87 ? 25 GLN A NE2  1 
ATOM 389  H H    . GLN A 1 25 ? -9.669  -2.598  6.788   1.00 0.25  ? 25 GLN A H    1 
ATOM 390  H HA   . GLN A 1 25 ? -10.501 -3.569  9.363   1.00 0.05  ? 25 GLN A HA   1 
ATOM 391  H HB2  . GLN A 1 25 ? -9.843  -1.178  8.632   1.00 0.04  ? 25 GLN A HB2  1 
ATOM 392  H HB3  . GLN A 1 25 ? -11.481 -1.061  7.952   1.00 0.04  ? 25 GLN A HB3  1 
ATOM 393  H HG2  . GLN A 1 25 ? -12.463 -1.520  10.147  1.00 0.06  ? 25 GLN A HG2  1 
ATOM 394  H HG3  . GLN A 1 25 ? -10.849 -1.782  10.841  1.00 0.06  ? 25 GLN A HG3  1 
ATOM 395  H HE21 . GLN A 1 25 ? -10.680 -0.097  12.290  1.00 0.34  ? 25 GLN A HE21 1 
ATOM 396  H HE22 . GLN A 1 25 ? -10.788 1.592   11.843  1.00 0.34  ? 25 GLN A HE22 1 
ATOM 397  N N    . ARG A 1 26 ? -12.712 -3.420  6.896   1.00 -0.46 ? 26 ARG A N    1 
ATOM 398  C CA   . ARG A 1 26 ? -14.031 -3.863  6.468   1.00 0.03  ? 26 ARG A CA   1 
ATOM 399  C C    . ARG A 1 26 ? -14.145 -5.382  6.599   1.00 0.62  ? 26 ARG A C    1 
ATOM 400  O O    . ARG A 1 26 ? -15.109 -5.878  7.179   1.00 -0.50 ? 26 ARG A O    1 
ATOM 401  C CB   . ARG A 1 26 ? -14.275 -3.427  5.020   1.00 -0.08 ? 26 ARG A CB   1 
ATOM 402  C CG   . ARG A 1 26 ? -14.655 -1.943  4.980   1.00 -0.10 ? 26 ARG A CG   1 
ATOM 403  C CD   . ARG A 1 26 ? -14.547 -1.419  3.546   1.00 -0.23 ? 26 ARG A CD   1 
ATOM 404  N NE   . ARG A 1 26 ? -15.364 -2.224  2.626   1.00 -0.32 ? 26 ARG A NE   1 
ATOM 405  C CZ   . ARG A 1 26 ? -15.243 -2.162  1.288   1.00 0.76  ? 26 ARG A CZ   1 
ATOM 406  N NH1  . ARG A 1 26 ? -14.387 -1.298  0.725   1.00 -0.62 ? 26 ARG A NH1  1 
ATOM 407  N NH2  . ARG A 1 26 ? -15.983 -2.968  0.514   1.00 -0.62 ? 26 ARG A NH2  1 
ATOM 408  H H    . ARG A 1 26 ? -12.106 -2.988  6.210   1.00 0.25  ? 26 ARG A H    1 
ATOM 409  H HA   . ARG A 1 26 ? -14.784 -3.399  7.107   1.00 0.05  ? 26 ARG A HA   1 
ATOM 410  H HB2  . ARG A 1 26 ? -13.372 -3.588  4.434   1.00 0.06  ? 26 ARG A HB2  1 
ATOM 411  H HB3  . ARG A 1 26 ? -15.088 -4.018  4.598   1.00 0.06  ? 26 ARG A HB3  1 
ATOM 412  H HG2  . ARG A 1 26 ? -15.678 -1.821  5.336   1.00 0.07  ? 26 ARG A HG2  1 
ATOM 413  H HG3  . ARG A 1 26 ? -13.980 -1.376  5.623   1.00 0.07  ? 26 ARG A HG3  1 
ATOM 414  H HD2  . ARG A 1 26 ? -14.889 -0.384  3.517   1.00 0.13  ? 26 ARG A HD2  1 
ATOM 415  H HD3  . ARG A 1 26 ? -13.504 -1.460  3.231   1.00 0.13  ? 26 ARG A HD3  1 
ATOM 416  H HE   . ARG A 1 26 ? -16.044 -2.851  3.032   1.00 0.27  ? 26 ARG A HE   1 
ATOM 417  H HH11 . ARG A 1 26 ? -13.846 -0.674  1.306   1.00 0.36  ? 26 ARG A HH11 1 
ATOM 418  H HH12 . ARG A 1 26 ? -14.281 -1.270  -0.278  1.00 0.36  ? 26 ARG A HH12 1 
ATOM 419  H HH21 . ARG A 1 26 ? -16.629 -3.621  0.936   1.00 0.36  ? 26 ARG A HH21 1 
ATOM 420  H HH22 . ARG A 1 26 ? -15.896 -2.924  -0.491  1.00 0.36  ? 26 ARG A HH22 1 
ATOM 421  N N    . GLY A 1 27 ? -13.165 -6.124  6.060   1.00 -0.46 ? 27 GLY A N    1 
ATOM 422  C CA   . GLY A 1 27 ? -13.190 -7.580  6.133   1.00 0.03  ? 27 GLY A CA   1 
ATOM 423  C C    . GLY A 1 27 ? -12.166 -8.208  5.185   1.00 0.62  ? 27 GLY A C    1 
ATOM 424  O O    . GLY A 1 27 ? -11.673 -9.303  5.452   1.00 -0.50 ? 27 GLY A O    1 
ATOM 425  H H    . GLY A 1 27 ? -12.388 -5.672  5.593   1.00 0.25  ? 27 GLY A H    1 
ATOM 426  H HA2  . GLY A 1 27 ? -12.966 -7.890  7.154   1.00 0.03  ? 27 GLY A HA2  1 
ATOM 427  H HA3  . GLY A 1 27 ? -14.185 -7.935  5.863   1.00 0.03  ? 27 GLY A HA3  1 
ATOM 428  N N    . ASP A 1 28 ? -11.850 -7.524  4.078   1.00 -0.46 ? 28 ASP A N    1 
ATOM 429  C CA   . ASP A 1 28 ? -10.898 -8.033  3.097   1.00 0.03  ? 28 ASP A CA   1 
ATOM 430  C C    . ASP A 1 28 ? -9.470  -7.860  3.618   1.00 0.62  ? 28 ASP A C    1 
ATOM 431  O O    . ASP A 1 28 ? -8.716  -7.026  3.118   1.00 -0.50 ? 28 ASP A O    1 
ATOM 432  C CB   . ASP A 1 28 ? -11.085 -7.285  1.774   1.00 -0.40 ? 28 ASP A CB   1 
ATOM 433  C CG   . ASP A 1 28 ? -12.210 -7.881  0.939   1.00 0.71  ? 28 ASP A CG   1 
ATOM 434  O OD1  . ASP A 1 28 ? -13.221 -8.293  1.547   1.00 -0.72 ? 28 ASP A OD1  1 
ATOM 435  O OD2  . ASP A 1 28 ? -12.035 -7.908  -0.301  1.00 -0.72 ? 28 ASP A OD2  1 
ATOM 436  H H    . ASP A 1 28 ? -12.281 -6.628  3.904   1.00 0.25  ? 28 ASP A H    1 
ATOM 437  H HA   . ASP A 1 28 ? -11.085 -9.094  2.930   1.00 0.05  ? 28 ASP A HA   1 
ATOM 438  H HB2  . ASP A 1 28 ? -11.317 -6.246  1.986   1.00 0.07  ? 28 ASP A HB2  1 
ATOM 439  H HB3  . ASP A 1 28 ? -10.159 -7.336  1.201   1.00 0.07  ? 28 ASP A HB3  1 
ATOM 440  N N    . THR A 1 29 ? -9.096  -8.660  4.621   1.00 -0.46 ? 29 THR A N    1 
ATOM 441  C CA   . THR A 1 29 ? -7.756  -8.616  5.189   1.00 0.03  ? 29 THR A CA   1 
ATOM 442  C C    . THR A 1 29 ? -6.782  -9.395  4.291   1.00 0.62  ? 29 THR A C    1 
ATOM 443  O O    . THR A 1 29 ? -5.577  -9.402  4.544   1.00 -0.50 ? 29 THR A O    1 
ATOM 444  C CB   . THR A 1 29 ? -7.778  -9.217  6.605   1.00 0.17  ? 29 THR A CB   1 
ATOM 445  O OG1  . THR A 1 29 ? -8.073  -10.596 6.529   1.00 -0.55 ? 29 THR A OG1  1 
ATOM 446  C CG2  . THR A 1 29 ? -8.833  -8.523  7.464   1.00 -0.19 ? 29 THR A CG2  1 
ATOM 447  H H    . THR A 1 29 ? -9.758  -9.325  5.004   1.00 0.25  ? 29 THR A H    1 
ATOM 448  H HA   . THR A 1 29 ? -7.428  -7.579  5.250   1.00 0.05  ? 29 THR A HA   1 
ATOM 449  H HB   . THR A 1 29 ? -6.802  -9.078  7.070   1.00 0.08  ? 29 THR A HB   1 
ATOM 450  H HG1  . THR A 1 29 ? -8.101  -10.952 7.421   1.00 0.31  ? 29 THR A HG1  1 
ATOM 451  H HG21 . THR A 1 29 ? -8.620  -7.462  7.502   1.00 0.07  ? 29 THR A HG21 1 
ATOM 452  H HG22 . THR A 1 29 ? -8.804  -8.932  8.474   1.00 0.07  ? 29 THR A HG22 1 
ATOM 453  H HG23 . THR A 1 29 ? -9.821  -8.682  7.039   1.00 0.07  ? 29 THR A HG23 1 
ATOM 454  N N    . HIS A 1 30 ? -7.314  -10.058 3.248   1.00 -0.46 ? 30 HIS A N    1 
ATOM 455  C CA   . HIS A 1 30 ? -6.516  -10.871 2.341   1.00 0.03  ? 30 HIS A CA   1 
ATOM 456  C C    . HIS A 1 30 ? -5.503  -10.004 1.570   1.00 0.62  ? 30 HIS A C    1 
ATOM 457  O O    . HIS A 1 30 ? -5.705  -8.797  1.423   1.00 -0.50 ? 30 HIS A O    1 
ATOM 458  C CB   . HIS A 1 30 ? -7.463  -11.600 1.372   1.00 -0.10 ? 30 HIS A CB   1 
ATOM 459  C CG   . HIS A 1 30 ? -7.786  -10.791 0.140   1.00 -0.03 ? 30 HIS A CG   1 
ATOM 460  N ND1  . HIS A 1 30 ? -8.184  -9.458  0.193   1.00 -0.15 ? 30 HIS A ND1  1 
ATOM 461  C CD2  . HIS A 1 30 ? -7.766  -11.097 -1.198  1.00 0.20  ? 30 HIS A CD2  1 
ATOM 462  C CE1  . HIS A 1 30 ? -8.371  -9.059  -1.080  1.00 0.24  ? 30 HIS A CE1  1 
ATOM 463  N NE2  . HIS A 1 30 ? -8.135  -10.014 -1.978  1.00 -0.50 ? 30 HIS A NE2  1 
ATOM 464  H H    . HIS A 1 30 ? -8.306  -10.005 3.083   1.00 0.25  ? 30 HIS A H    1 
ATOM 465  H HA   . HIS A 1 30 ? -5.982  -11.611 2.932   1.00 0.05  ? 30 HIS A HA   1 
ATOM 466  H HB2  . HIS A 1 30 ? -6.998  -12.534 1.063   1.00 0.04  ? 30 HIS A HB2  1 
ATOM 467  H HB3  . HIS A 1 30 ? -8.393  -11.832 1.894   1.00 0.04  ? 30 HIS A HB3  1 
ATOM 468  H HD1  . HIS A 1 30 ? -8.305  -8.897  1.024   1.00 0.23  ? 30 HIS A HD1  1 
ATOM 469  H HD2  . HIS A 1 30 ? -7.489  -12.061 -1.595  1.00 0.02  ? 30 HIS A HD2  1 
ATOM 470  H HE1  . HIS A 1 30 ? -8.675  -8.061  -1.348  1.00 0.04  ? 30 HIS A HE1  1 
ATOM 471  N N    . PRO A 1 31 ? -4.411  -10.621 1.070   1.00 -0.23 ? 31 PRO A N    1 
ATOM 472  C CA   . PRO A 1 31 ? -3.400  -9.925  0.299   1.00 0.03  ? 31 PRO A CA   1 
ATOM 473  C C    . PRO A 1 31 ? -3.930  -9.518  -1.077  1.00 0.53  ? 31 PRO A C    1 
ATOM 474  O O    . PRO A 1 31 ? -4.882  -10.110 -1.580  1.00 -0.50 ? 31 PRO A O    1 
ATOM 475  C CB   . PRO A 1 31 ? -2.246  -10.918 0.141   1.00 -0.11 ? 31 PRO A CB   1 
ATOM 476  C CG   . PRO A 1 31 ? -2.735  -12.265 0.680   1.00 -0.12 ? 31 PRO A CG   1 
ATOM 477  C CD   . PRO A 1 31 ? -4.129  -12.031 1.255   1.00 -0.01 ? 31 PRO A CD   1 
ATOM 478  H HA   . PRO A 1 31 ? -3.062  -9.044  0.840   1.00 0.05  ? 31 PRO A HA   1 
ATOM 479  H HB2  . PRO A 1 31 ? -1.987  -11.016 -0.909  1.00 0.06  ? 31 PRO A HB2  1 
ATOM 480  H HB3  . PRO A 1 31 ? -1.379  -10.580 0.706   1.00 0.06  ? 31 PRO A HB3  1 
ATOM 481  H HG2  . PRO A 1 31 ? -2.783  -12.995 -0.129  1.00 0.06  ? 31 PRO A HG2  1 
ATOM 482  H HG3  . PRO A 1 31 ? -2.064  -12.620 1.461   1.00 0.06  ? 31 PRO A HG3  1 
ATOM 483  H HD2  . PRO A 1 31 ? -4.859  -12.636 0.719   1.00 0.06  ? 31 PRO A HD2  1 
ATOM 484  H HD3  . PRO A 1 31 ? -4.135  -12.284 2.315   1.00 0.06  ? 31 PRO A HD3  1 
ATOM 485  N N    . LEU A 1 32 ? -3.284  -8.512  -1.684  1.00 -0.46 ? 32 LEU A N    1 
ATOM 486  C CA   . LEU A 1 32 ? -3.617  -8.048  -3.024  1.00 0.03  ? 32 LEU A CA   1 
ATOM 487  C C    . LEU A 1 32 ? -2.318  -7.774  -3.782  1.00 0.62  ? 32 LEU A C    1 
ATOM 488  O O    . LEU A 1 32 ? -1.355  -7.281  -3.194  1.00 -0.50 ? 32 LEU A O    1 
ATOM 489  C CB   . LEU A 1 32 ? -4.434  -6.751  -2.954  1.00 -0.06 ? 32 LEU A CB   1 
ATOM 490  C CG   . LEU A 1 32 ? -5.923  -7.027  -2.705  1.00 -0.01 ? 32 LEU A CG   1 
ATOM 491  C CD1  . LEU A 1 32 ? -6.675  -5.698  -2.761  1.00 -0.11 ? 32 LEU A CD1  1 
ATOM 492  C CD2  . LEU A 1 32 ? -6.493  -7.960  -3.780  1.00 -0.11 ? 32 LEU A CD2  1 
ATOM 493  H H    . LEU A 1 32 ? -2.519  -8.054  -1.203  1.00 0.25  ? 32 LEU A H    1 
ATOM 494  H HA   . LEU A 1 32 ? -4.187  -8.815  -3.545  1.00 0.05  ? 32 LEU A HA   1 
ATOM 495  H HB2  . LEU A 1 32 ? -4.045  -6.126  -2.149  1.00 0.03  ? 32 LEU A HB2  1 
ATOM 496  H HB3  . LEU A 1 32 ? -4.328  -6.216  -3.898  1.00 0.03  ? 32 LEU A HB3  1 
ATOM 497  H HG   . LEU A 1 32 ? -6.052  -7.478  -1.721  1.00 0.03  ? 32 LEU A HG   1 
ATOM 498  H HD11 . LEU A 1 32 ? -6.236  -5.001  -2.048  1.00 0.03  ? 32 LEU A HD11 1 
ATOM 499  H HD12 . LEU A 1 32 ? -7.720  -5.863  -2.510  1.00 0.03  ? 32 LEU A HD12 1 
ATOM 500  H HD13 . LEU A 1 32 ? -6.602  -5.281  -3.772  1.00 0.03  ? 32 LEU A HD13 1 
ATOM 501  H HD21 . LEU A 1 32 ? -6.075  -7.696  -4.748  1.00 0.03  ? 32 LEU A HD21 1 
ATOM 502  H HD22 . LEU A 1 32 ? -7.577  -7.854  -3.814  1.00 0.03  ? 32 LEU A HD22 1 
ATOM 503  H HD23 . LEU A 1 32 ? -6.241  -8.992  -3.544  1.00 0.03  ? 32 LEU A HD23 1 
ATOM 504  N N    . THR A 1 33 ? -2.286  -8.081  -5.083  1.00 -0.46 ? 33 THR A N    1 
ATOM 505  C CA   . THR A 1 33 ? -1.112  -7.806  -5.906  1.00 0.03  ? 33 THR A CA   1 
ATOM 506  C C    . THR A 1 33 ? -0.889  -6.294  -5.989  1.00 0.62  ? 33 THR A C    1 
ATOM 507  O O    . THR A 1 33 ? -1.748  -5.506  -5.586  1.00 -0.50 ? 33 THR A O    1 
ATOM 508  C CB   . THR A 1 33 ? -1.295  -8.383  -7.318  1.00 0.17  ? 33 THR A CB   1 
ATOM 509  O OG1  . THR A 1 33 ? -2.402  -7.770  -7.940  1.00 -0.55 ? 33 THR A OG1  1 
ATOM 510  C CG2  . THR A 1 33 ? -1.511  -9.896  -7.254  1.00 -0.19 ? 33 THR A CG2  1 
ATOM 511  H H    . THR A 1 33 ? -3.094  -8.508  -5.519  1.00 0.25  ? 33 THR A H    1 
ATOM 512  H HA   . THR A 1 33 ? -0.239  -8.268  -5.445  1.00 0.05  ? 33 THR A HA   1 
ATOM 513  H HB   . THR A 1 33 ? -0.400  -8.177  -7.906  1.00 0.08  ? 33 THR A HB   1 
ATOM 514  H HG1  . THR A 1 33 ? -3.204  -8.056  -7.484  1.00 0.31  ? 33 THR A HG1  1 
ATOM 515  H HG21 . THR A 1 33 ? -0.667  -10.362 -6.750  1.00 0.07  ? 33 THR A HG21 1 
ATOM 516  H HG22 . THR A 1 33 ? -1.590  -10.293 -8.267  1.00 0.07  ? 33 THR A HG22 1 
ATOM 517  H HG23 . THR A 1 33 ? -2.427  -10.115 -6.709  1.00 0.07  ? 33 THR A HG23 1 
ATOM 518  N N    . LEU A 1 34 ? 0.267   -5.892  -6.519  1.00 -0.46 ? 34 LEU A N    1 
ATOM 519  C CA   . LEU A 1 34 ? 0.606   -4.487  -6.664  1.00 0.03  ? 34 LEU A CA   1 
ATOM 520  C C    . LEU A 1 34 ? -0.469  -3.780  -7.498  1.00 0.62  ? 34 LEU A C    1 
ATOM 521  O O    . LEU A 1 34 ? -1.088  -2.831  -7.032  1.00 -0.50 ? 34 LEU A O    1 
ATOM 522  C CB   . LEU A 1 34 ? 1.995   -4.380  -7.335  1.00 -0.06 ? 34 LEU A CB   1 
ATOM 523  C CG   . LEU A 1 34 ? 2.767   -3.125  -6.874  1.00 -0.01 ? 34 LEU A CG   1 
ATOM 524  C CD1  . LEU A 1 34 ? 1.876   -1.882  -6.930  1.00 -0.11 ? 34 LEU A CD1  1 
ATOM 525  C CD2  . LEU A 1 34 ? 3.294   -3.320  -5.450  1.00 -0.11 ? 34 LEU A CD2  1 
ATOM 526  H H    . LEU A 1 34 ? 0.935   -6.579  -6.834  1.00 0.25  ? 34 LEU A H    1 
ATOM 527  H HA   . LEU A 1 34 ? 0.641   -4.032  -5.675  1.00 0.05  ? 34 LEU A HA   1 
ATOM 528  H HB2  . LEU A 1 34 ? 2.582   -5.264  -7.082  1.00 0.03  ? 34 LEU A HB2  1 
ATOM 529  H HB3  . LEU A 1 34 ? 1.869   -4.341  -8.417  1.00 0.03  ? 34 LEU A HB3  1 
ATOM 530  H HG   . LEU A 1 34 ? 3.617   -2.975  -7.541  1.00 0.03  ? 34 LEU A HG   1 
ATOM 531  H HD11 . LEU A 1 34 ? 1.380   -1.835  -7.898  1.00 0.03  ? 34 LEU A HD11 1 
ATOM 532  H HD12 . LEU A 1 34 ? 2.491   -0.991  -6.797  1.00 0.03  ? 34 LEU A HD12 1 
ATOM 533  H HD13 . LEU A 1 34 ? 1.131   -1.925  -6.138  1.00 0.03  ? 34 LEU A HD13 1 
ATOM 534  H HD21 . LEU A 1 34 ? 2.462   -3.479  -4.766  1.00 0.03  ? 34 LEU A HD21 1 
ATOM 535  H HD22 . LEU A 1 34 ? 3.847   -2.431  -5.144  1.00 0.03  ? 34 LEU A HD22 1 
ATOM 536  H HD23 . LEU A 1 34 ? 3.956   -4.183  -5.423  1.00 0.03  ? 34 LEU A HD23 1 
ATOM 537  N N    . ASP A 1 35 ? -0.682  -4.243  -8.733  1.00 -0.46 ? 35 ASP A N    1 
ATOM 538  C CA   . ASP A 1 35 ? -1.635  -3.621  -9.644  1.00 0.03  ? 35 ASP A CA   1 
ATOM 539  C C    . ASP A 1 35 ? -3.048  -3.581  -9.041  1.00 0.62  ? 35 ASP A C    1 
ATOM 540  O O    . ASP A 1 35 ? -3.747  -2.580  -9.198  1.00 -0.50 ? 35 ASP A O    1 
ATOM 541  C CB   . ASP A 1 35 ? -1.613  -4.365  -10.979 1.00 -0.40 ? 35 ASP A CB   1 
ATOM 542  C CG   . ASP A 1 35 ? -0.237  -4.251  -11.637 1.00 0.71  ? 35 ASP A CG   1 
ATOM 543  O OD1  . ASP A 1 35 ? 0.215   -3.095  -11.833 1.00 -0.72 ? 35 ASP A OD1  1 
ATOM 544  O OD2  . ASP A 1 35 ? 0.343   -5.318  -11.927 1.00 -0.72 ? 35 ASP A OD2  1 
ATOM 545  H H    . ASP A 1 35 ? -0.162  -5.044  -9.061  1.00 0.25  ? 35 ASP A H    1 
ATOM 546  H HA   . ASP A 1 35 ? -1.316  -2.595  -9.821  1.00 0.05  ? 35 ASP A HA   1 
ATOM 547  H HB2  . ASP A 1 35 ? -1.847  -5.416  -10.810 1.00 0.07  ? 35 ASP A HB2  1 
ATOM 548  H HB3  . ASP A 1 35 ? -2.362  -3.933  -11.643 1.00 0.07  ? 35 ASP A HB3  1 
ATOM 549  N N    . GLU A 1 36 ? -3.472  -4.653  -8.346  1.00 -0.46 ? 36 GLU A N    1 
ATOM 550  C CA   . GLU A 1 36 ? -4.792  -4.678  -7.709  1.00 0.03  ? 36 GLU A CA   1 
ATOM 551  C C    . GLU A 1 36 ? -4.933  -3.484  -6.762  1.00 0.62  ? 36 GLU A C    1 
ATOM 552  O O    . GLU A 1 36 ? -6.004  -2.887  -6.670  1.00 -0.50 ? 36 GLU A O    1 
ATOM 553  C CB   . GLU A 1 36 ? -4.985  -5.995  -6.954  1.00 -0.18 ? 36 GLU A CB   1 
ATOM 554  C CG   . GLU A 1 36 ? -5.430  -7.088  -7.934  1.00 -0.40 ? 36 GLU A CG   1 
ATOM 555  C CD   . GLU A 1 36 ? -5.519  -8.443  -7.241  1.00 0.71  ? 36 GLU A CD   1 
ATOM 556  O OE1  . GLU A 1 36 ? -4.527  -8.802  -6.568  1.00 -0.72 ? 36 GLU A OE1  1 
ATOM 557  O OE2  . GLU A 1 36 ? -6.573  -9.094  -7.396  1.00 -0.72 ? 36 GLU A OE2  1 
ATOM 558  H H    . GLU A 1 36 ? -2.872  -5.464  -8.249  1.00 0.25  ? 36 GLU A H    1 
ATOM 559  H HA   . GLU A 1 36 ? -5.560  -4.602  -8.474  1.00 0.05  ? 36 GLU A HA   1 
ATOM 560  H HB2  . GLU A 1 36 ? -4.049  -6.285  -6.479  1.00 0.09  ? 36 GLU A HB2  1 
ATOM 561  H HB3  . GLU A 1 36 ? -5.752  -5.865  -6.191  1.00 0.09  ? 36 GLU A HB3  1 
ATOM 562  H HG2  . GLU A 1 36 ? -6.409  -6.829  -8.337  1.00 0.07  ? 36 GLU A HG2  1 
ATOM 563  H HG3  . GLU A 1 36 ? -4.714  -7.152  -8.753  1.00 0.07  ? 36 GLU A HG3  1 
ATOM 564  N N    . ILE A 1 37 ? -3.849  -3.135  -6.065  1.00 -0.46 ? 37 ILE A N    1 
ATOM 565  C CA   . ILE A 1 37 ? -3.853  -2.011  -5.146  1.00 0.03  ? 37 ILE A CA   1 
ATOM 566  C C    . ILE A 1 37 ? -3.910  -0.697  -5.934  1.00 0.62  ? 37 ILE A C    1 
ATOM 567  O O    . ILE A 1 37 ? -4.671  0.201   -5.573  1.00 -0.50 ? 37 ILE A O    1 
ATOM 568  C CB   . ILE A 1 37 ? -2.599  -2.086  -4.253  1.00 -0.01 ? 37 ILE A CB   1 
ATOM 569  C CG1  . ILE A 1 37 ? -2.730  -3.283  -3.297  1.00 -0.05 ? 37 ILE A CG1  1 
ATOM 570  C CG2  . ILE A 1 37 ? -2.453  -0.793  -3.443  1.00 -0.08 ? 37 ILE A CG2  1 
ATOM 571  C CD1  . ILE A 1 37 ? -1.373  -3.619  -2.673  1.00 -0.08 ? 37 ILE A CD1  1 
ATOM 572  H H    . ILE A 1 37 ? -2.991  -3.662  -6.175  1.00 0.25  ? 37 ILE A H    1 
ATOM 573  H HA   . ILE A 1 37 ? -4.742  -2.074  -4.513  1.00 0.05  ? 37 ILE A HA   1 
ATOM 574  H HB   . ILE A 1 37 ? -1.715  -2.219  -4.874  1.00 0.02  ? 37 ILE A HB   1 
ATOM 575  H HG12 . ILE A 1 37 ? -3.441  -3.042  -2.510  1.00 0.03  ? 37 ILE A HG12 1 
ATOM 576  H HG13 . ILE A 1 37 ? -3.090  -4.149  -3.850  1.00 0.03  ? 37 ILE A HG13 1 
ATOM 577  H HG21 . ILE A 1 37 ? -2.310  0.049   -4.120  1.00 0.03  ? 37 ILE A HG21 1 
ATOM 578  H HG22 . ILE A 1 37 ? -1.591  -0.872  -2.786  1.00 0.03  ? 37 ILE A HG22 1 
ATOM 579  H HG23 . ILE A 1 37 ? -3.350  -0.631  -2.847  1.00 0.03  ? 37 ILE A HG23 1 
ATOM 580  H HD11 . ILE A 1 37 ? -0.631  -3.750  -3.460  1.00 0.03  ? 37 ILE A HD11 1 
ATOM 581  H HD12 . ILE A 1 37 ? -1.459  -4.541  -2.099  1.00 0.03  ? 37 ILE A HD12 1 
ATOM 582  H HD13 . ILE A 1 37 ? -1.063  -2.811  -2.012  1.00 0.03  ? 37 ILE A HD13 1 
ATOM 583  N N    . LEU A 1 38 ? -3.106  -0.583  -7.008  1.00 -0.46 ? 38 LEU A N    1 
ATOM 584  C CA   . LEU A 1 38 ? -3.064  0.635   -7.822  1.00 0.03  ? 38 LEU A CA   1 
ATOM 585  C C    . LEU A 1 38 ? -4.461  1.013   -8.305  1.00 0.62  ? 38 LEU A C    1 
ATOM 586  O O    . LEU A 1 38 ? -4.851  2.169   -8.210  1.00 -0.50 ? 38 LEU A O    1 
ATOM 587  C CB   . LEU A 1 38 ? -2.157  0.445   -9.046  1.00 -0.06 ? 38 LEU A CB   1 
ATOM 588  C CG   . LEU A 1 38 ? -0.723  0.086   -8.649  1.00 -0.01 ? 38 LEU A CG   1 
ATOM 589  C CD1  . LEU A 1 38 ? 0.132   0.007   -9.910  1.00 -0.11 ? 38 LEU A CD1  1 
ATOM 590  C CD2  . LEU A 1 38 ? -0.127  1.137   -7.706  1.00 -0.11 ? 38 LEU A CD2  1 
ATOM 591  H H    . LEU A 1 38 ? -2.505  -1.356  -7.267  1.00 0.25  ? 38 LEU A H    1 
ATOM 592  H HA   . LEU A 1 38 ? -2.673  1.449   -7.217  1.00 0.05  ? 38 LEU A HA   1 
ATOM 593  H HB2  . LEU A 1 38 ? -2.562  -0.351  -9.670  1.00 0.03  ? 38 LEU A HB2  1 
ATOM 594  H HB3  . LEU A 1 38 ? -2.145  1.367   -9.617  1.00 0.03  ? 38 LEU A HB3  1 
ATOM 595  H HG   . LEU A 1 38 ? -0.723  -0.875  -8.162  1.00 0.03  ? 38 LEU A HG   1 
ATOM 596  H HD11 . LEU A 1 38 ? -0.291  -0.726  -10.594 1.00 0.03  ? 38 LEU A HD11 1 
ATOM 597  H HD12 . LEU A 1 38 ? 1.143   -0.289  -9.641  1.00 0.03  ? 38 LEU A HD12 1 
ATOM 598  H HD13 . LEU A 1 38 ? 0.155   0.983   -10.396 1.00 0.03  ? 38 LEU A HD13 1 
ATOM 599  H HD21 . LEU A 1 38 ? -0.268  2.129   -8.128  1.00 0.03  ? 38 LEU A HD21 1 
ATOM 600  H HD22 . LEU A 1 38 ? 0.942   0.949   -7.582  1.00 0.03  ? 38 LEU A HD22 1 
ATOM 601  H HD23 . LEU A 1 38 ? -0.616  1.081   -6.734  1.00 0.03  ? 38 LEU A HD23 1 
ATOM 602  N N    . ASP A 1 39 ? -5.201  0.039   -8.843  1.00 -0.46 ? 39 ASP A N    1 
ATOM 603  C CA   . ASP A 1 39 ? -6.525  0.285   -9.402  1.00 0.03  ? 39 ASP A CA   1 
ATOM 604  C C    . ASP A 1 39 ? -7.400  1.086   -8.433  1.00 0.62  ? 39 ASP A C    1 
ATOM 605  O O    . ASP A 1 39 ? -7.841  2.188   -8.760  1.00 -0.50 ? 39 ASP A O    1 
ATOM 606  C CB   . ASP A 1 39 ? -7.182  -1.054  -9.745  1.00 -0.40 ? 39 ASP A CB   1 
ATOM 607  C CG   . ASP A 1 39 ? -8.548  -0.837  -10.383 1.00 0.71  ? 39 ASP A CG   1 
ATOM 608  O OD1  . ASP A 1 39 ? -8.568  -0.572  -11.604 1.00 -0.72 ? 39 ASP A OD1  1 
ATOM 609  O OD2  . ASP A 1 39 ? -9.546  -0.938  -9.638  1.00 -0.72 ? 39 ASP A OD2  1 
ATOM 610  H H    . ASP A 1 39 ? -4.833  -0.905  -8.881  1.00 0.25  ? 39 ASP A H    1 
ATOM 611  H HA   . ASP A 1 39 ? -6.411  0.860   -10.320 1.00 0.05  ? 39 ASP A HA   1 
ATOM 612  H HB2  . ASP A 1 39 ? -6.545  -1.598  -10.441 1.00 0.07  ? 39 ASP A HB2  1 
ATOM 613  H HB3  . ASP A 1 39 ? -7.300  -1.642  -8.834  1.00 0.07  ? 39 ASP A HB3  1 
ATOM 614  N N    . GLU A 1 40 ? -7.658  0.527   -7.250  1.00 -0.46 ? 40 GLU A N    1 
ATOM 615  C CA   . GLU A 1 40 ? -8.529  1.154   -6.265  1.00 0.03  ? 40 GLU A CA   1 
ATOM 616  C C    . GLU A 1 40 ? -7.960  2.490   -5.766  1.00 0.62  ? 40 GLU A C    1 
ATOM 617  O O    . GLU A 1 40 ? -8.723  3.422   -5.515  1.00 -0.50 ? 40 GLU A O    1 
ATOM 618  C CB   . GLU A 1 40 ? -8.756  0.171   -5.114  1.00 -0.18 ? 40 GLU A CB   1 
ATOM 619  C CG   . GLU A 1 40 ? -9.991  -0.680  -5.432  1.00 -0.40 ? 40 GLU A CG   1 
ATOM 620  C CD   . GLU A 1 40 ? -10.057 -1.912  -4.548  1.00 0.71  ? 40 GLU A CD   1 
ATOM 621  O OE1  . GLU A 1 40 ? -9.258  -2.837  -4.808  1.00 -0.72 ? 40 GLU A OE1  1 
ATOM 622  O OE2  . GLU A 1 40 ? -10.901 -1.912  -3.627  1.00 -0.72 ? 40 GLU A OE2  1 
ATOM 623  H H    . GLU A 1 40 ? -7.251  -0.371  -7.026  1.00 0.25  ? 40 GLU A H    1 
ATOM 624  H HA   . GLU A 1 40 ? -9.491  1.354   -6.738  1.00 0.05  ? 40 GLU A HA   1 
ATOM 625  H HB2  . GLU A 1 40 ? -7.883  -0.475  -5.006  1.00 0.09  ? 40 GLU A HB2  1 
ATOM 626  H HB3  . GLU A 1 40 ? -8.917  0.717   -4.186  1.00 0.09  ? 40 GLU A HB3  1 
ATOM 627  H HG2  . GLU A 1 40 ? -10.889 -0.081  -5.280  1.00 0.07  ? 40 GLU A HG2  1 
ATOM 628  H HG3  . GLU A 1 40 ? -9.948  -0.997  -6.476  1.00 0.07  ? 40 GLU A HG3  1 
ATOM 629  N N    . THR A 1 41 ? -6.634  2.598   -5.623  1.00 -0.46 ? 41 THR A N    1 
ATOM 630  C CA   . THR A 1 41 ? -6.013  3.843   -5.166  1.00 0.03  ? 41 THR A CA   1 
ATOM 631  C C    . THR A 1 41 ? -5.936  4.859   -6.311  1.00 0.62  ? 41 THR A C    1 
ATOM 632  O O    . THR A 1 41 ? -5.593  6.013   -6.078  1.00 -0.50 ? 41 THR A O    1 
ATOM 633  C CB   . THR A 1 41 ? -4.626  3.550   -4.597  1.00 0.17  ? 41 THR A CB   1 
ATOM 634  O OG1  . THR A 1 41 ? -3.854  2.863   -5.553  1.00 -0.55 ? 41 THR A OG1  1 
ATOM 635  C CG2  . THR A 1 41 ? -4.751  2.705   -3.330  1.00 -0.19 ? 41 THR A CG2  1 
ATOM 636  H H    . THR A 1 41 ? -6.034  1.809   -5.836  1.00 0.25  ? 41 THR A H    1 
ATOM 637  H HA   . THR A 1 41 ? -6.616  4.274   -4.373  1.00 0.05  ? 41 THR A HA   1 
ATOM 638  H HB   . THR A 1 41 ? -4.140  4.486   -4.346  1.00 0.08  ? 41 THR A HB   1 
ATOM 639  H HG1  . THR A 1 41 ? -3.048  2.556   -5.133  1.00 0.31  ? 41 THR A HG1  1 
ATOM 640  H HG21 . THR A 1 41 ? -5.085  3.336   -2.504  1.00 0.07  ? 41 THR A HG21 1 
ATOM 641  H HG22 . THR A 1 41 ? -3.784  2.276   -3.086  1.00 0.07  ? 41 THR A HG22 1 
ATOM 642  H HG23 . THR A 1 41 ? -5.471  1.903   -3.490  1.00 0.07  ? 41 THR A HG23 1 
ATOM 643  N N    . GLN A 1 42 ? -6.259  4.430   -7.543  1.00 -0.46 ? 42 GLN A N    1 
ATOM 644  C CA   . GLN A 1 42 ? -6.216  5.294   -8.717  1.00 0.03  ? 42 GLN A CA   1 
ATOM 645  C C    . GLN A 1 42 ? -4.767  5.693   -9.004  1.00 0.62  ? 42 GLN A C    1 
ATOM 646  O O    . GLN A 1 42 ? -4.469  6.867   -9.233  1.00 -0.50 ? 42 GLN A O    1 
ATOM 647  C CB   . GLN A 1 42 ? -7.110  6.526   -8.496  1.00 -0.10 ? 42 GLN A CB   1 
ATOM 648  C CG   . GLN A 1 42 ? -7.465  7.158   -9.845  1.00 -0.10 ? 42 GLN A CG   1 
ATOM 649  C CD   . GLN A 1 42 ? -8.269  8.437   -9.648  1.00 0.68  ? 42 GLN A CD   1 
ATOM 650  O OE1  . GLN A 1 42 ? -9.473  8.460   -9.886  1.00 -0.47 ? 42 GLN A OE1  1 
ATOM 651  N NE2  . GLN A 1 42 ? -7.599  9.504   -9.212  1.00 -0.87 ? 42 GLN A NE2  1 
ATOM 652  H H    . GLN A 1 42 ? -6.539  3.467   -7.677  1.00 0.25  ? 42 GLN A H    1 
ATOM 653  H HA   . GLN A 1 42 ? -6.598  4.734   -9.571  1.00 0.05  ? 42 GLN A HA   1 
ATOM 654  H HB2  . GLN A 1 42 ? -8.028  6.221   -7.991  1.00 0.04  ? 42 GLN A HB2  1 
ATOM 655  H HB3  . GLN A 1 42 ? -6.586  7.257   -7.882  1.00 0.04  ? 42 GLN A HB3  1 
ATOM 656  H HG2  . GLN A 1 42 ? -6.549  7.393   -10.387 1.00 0.06  ? 42 GLN A HG2  1 
ATOM 657  H HG3  . GLN A 1 42 ? -8.054  6.451   -10.429 1.00 0.06  ? 42 GLN A HG3  1 
ATOM 658  H HE21 . GLN A 1 42 ? -6.608  9.437   -9.029  1.00 0.34  ? 42 GLN A HE21 1 
ATOM 659  H HE22 . GLN A 1 42 ? -8.084  10.377  -9.066  1.00 0.34  ? 42 GLN A HE22 1 
ATOM 660  N N    . HIS A 1 43 ? -3.868  4.702   -8.988  1.00 -0.46 ? 43 HIS A N    1 
ATOM 661  C CA   . HIS A 1 43 ? -2.452  4.917   -9.248  1.00 0.03  ? 43 HIS A CA   1 
ATOM 662  C C    . HIS A 1 43 ? -1.964  3.913   -10.293 1.00 0.62  ? 43 HIS A C    1 
ATOM 663  O O    . HIS A 1 43 ? -0.835  3.452   -10.219 1.00 -0.50 ? 43 HIS A O    1 
ATOM 664  C CB   . HIS A 1 43 ? -1.655  4.736   -7.946  1.00 -0.10 ? 43 HIS A CB   1 
ATOM 665  C CG   . HIS A 1 43 ? -2.140  5.584   -6.800  1.00 -0.03 ? 43 HIS A CG   1 
ATOM 666  N ND1  . HIS A 1 43 ? -2.801  6.793   -6.969  1.00 -0.15 ? 43 HIS A ND1  1 
ATOM 667  C CD2  . HIS A 1 43 ? -2.069  5.412   -5.443  1.00 0.20  ? 43 HIS A CD2  1 
ATOM 668  C CE1  . HIS A 1 43 ? -3.080  7.256   -5.734  1.00 0.24  ? 43 HIS A CE1  1 
ATOM 669  N NE2  . HIS A 1 43 ? -2.658  6.459   -4.758  1.00 -0.50 ? 43 HIS A NE2  1 
ATOM 670  H H    . HIS A 1 43 ? -4.175  3.760   -8.789  1.00 0.25  ? 43 HIS A H    1 
ATOM 671  H HA   . HIS A 1 43 ? -2.297  5.928   -9.626  1.00 0.05  ? 43 HIS A HA   1 
ATOM 672  H HB2  . HIS A 1 43 ? -1.717  3.692   -7.646  1.00 0.04  ? 43 HIS A HB2  1 
ATOM 673  H HB3  . HIS A 1 43 ? -0.611  4.982   -8.138  1.00 0.04  ? 43 HIS A HB3  1 
ATOM 674  H HD1  . HIS A 1 43 ? -3.034  7.237   -7.848  1.00 0.23  ? 43 HIS A HD1  1 
ATOM 675  H HD2  . HIS A 1 43 ? -1.619  4.557   -4.966  1.00 0.02  ? 43 HIS A HD2  1 
ATOM 676  H HE1  . HIS A 1 43 ? -3.606  8.174   -5.553  1.00 0.04  ? 43 HIS A HE1  1 
ATOM 677  N N    . LEU A 1 44 ? -2.811  3.563   -11.267 1.00 -0.46 ? 44 LEU A N    1 
ATOM 678  C CA   . LEU A 1 44 ? -2.427  2.599   -12.295 1.00 0.03  ? 44 LEU A CA   1 
ATOM 679  C C    . LEU A 1 44 ? -1.317  3.178   -13.171 1.00 0.62  ? 44 LEU A C    1 
ATOM 680  O O    . LEU A 1 44 ? -0.444  2.438   -13.623 1.00 -0.50 ? 44 LEU A O    1 
ATOM 681  C CB   . LEU A 1 44 ? -3.652  2.201   -13.122 1.00 -0.06 ? 44 LEU A CB   1 
ATOM 682  C CG   . LEU A 1 44 ? -4.186  0.850   -12.618 1.00 -0.01 ? 44 LEU A CG   1 
ATOM 683  C CD1  . LEU A 1 44 ? -5.653  0.696   -13.026 1.00 -0.11 ? 44 LEU A CD1  1 
ATOM 684  C CD2  . LEU A 1 44 ? -3.367  -0.291  -13.231 1.00 -0.11 ? 44 LEU A CD2  1 
ATOM 685  H H    . LEU A 1 44 ? -3.736  3.965   -11.300 1.00 0.25  ? 44 LEU A H    1 
ATOM 686  H HA   . LEU A 1 44 ? -2.039  1.709   -11.803 1.00 0.05  ? 44 LEU A HA   1 
ATOM 687  H HB2  . LEU A 1 44 ? -4.426  2.962   -13.018 1.00 0.03  ? 44 LEU A HB2  1 
ATOM 688  H HB3  . LEU A 1 44 ? -3.372  2.112   -14.172 1.00 0.03  ? 44 LEU A HB3  1 
ATOM 689  H HG   . LEU A 1 44 ? -4.104  0.807   -11.527 1.00 0.03  ? 44 LEU A HG   1 
ATOM 690  H HD11 . LEU A 1 44 ? -6.241  1.500   -12.582 1.00 0.03  ? 44 LEU A HD11 1 
ATOM 691  H HD12 . LEU A 1 44 ? -6.029  -0.265  -12.675 1.00 0.03  ? 44 LEU A HD12 1 
ATOM 692  H HD13 . LEU A 1 44 ? -5.736  0.744   -14.112 1.00 0.03  ? 44 LEU A HD13 1 
ATOM 693  H HD21 . LEU A 1 44 ? -3.464  -0.268  -14.317 1.00 0.03  ? 44 LEU A HD21 1 
ATOM 694  H HD22 . LEU A 1 44 ? -3.737  -1.246  -12.855 1.00 0.03  ? 44 LEU A HD22 1 
ATOM 695  H HD23 . LEU A 1 44 ? -2.318  -0.178  -12.958 1.00 0.03  ? 44 LEU A HD23 1 
ATOM 696  N N    . ASP A 1 45 ? -1.337  4.499   -13.395 1.00 -0.46 ? 45 ASP A N    1 
ATOM 697  C CA   . ASP A 1 45 ? -0.288  5.164   -14.152 1.00 0.03  ? 45 ASP A CA   1 
ATOM 698  C C    . ASP A 1 45 ? 0.997   5.121   -13.325 1.00 0.62  ? 45 ASP A C    1 
ATOM 699  O O    . ASP A 1 45 ? 1.985   4.538   -13.757 1.00 -0.50 ? 45 ASP A O    1 
ATOM 700  C CB   . ASP A 1 45 ? -0.707  6.607   -14.448 1.00 -0.40 ? 45 ASP A CB   1 
ATOM 701  C CG   . ASP A 1 45 ? 0.437   7.382   -15.089 1.00 0.71  ? 45 ASP A CG   1 
ATOM 702  O OD1  . ASP A 1 45 ? 0.564   7.283   -16.328 1.00 -0.72 ? 45 ASP A OD1  1 
ATOM 703  O OD2  . ASP A 1 45 ? 1.161   8.058   -14.328 1.00 -0.72 ? 45 ASP A OD2  1 
ATOM 704  H H    . ASP A 1 45 ? -2.088  5.059   -13.021 1.00 0.25  ? 45 ASP A H    1 
ATOM 705  H HA   . ASP A 1 45 ? -0.129  4.636   -15.093 1.00 0.05  ? 45 ASP A HA   1 
ATOM 706  H HB2  . ASP A 1 45 ? -1.560  6.600   -15.126 1.00 0.07  ? 45 ASP A HB2  1 
ATOM 707  H HB3  . ASP A 1 45 ? -0.994  7.098   -13.518 1.00 0.07  ? 45 ASP A HB3  1 
ATOM 708  N N    . ILE A 1 46 ? 0.931   5.736   -12.124 1.00 -0.46 ? 46 ILE A N    1 
ATOM 709  C CA   . ILE A 1 46 ? 2.009   5.787   -11.118 1.00 0.03  ? 46 ILE A CA   1 
ATOM 710  C C    . ILE A 1 46 ? 3.400   6.138   -11.700 1.00 0.62  ? 46 ILE A C    1 
ATOM 711  O O    . ILE A 1 46 ? 3.907   7.231   -11.447 1.00 -0.50 ? 46 ILE A O    1 
ATOM 712  C CB   . ILE A 1 46 ? 2.024   4.490   -10.254 1.00 -0.01 ? 46 ILE A CB   1 
ATOM 713  C CG1  . ILE A 1 46 ? 3.271   4.474   -9.380  1.00 -0.05 ? 46 ILE A CG1  1 
ATOM 714  C CG2  . ILE A 1 46 ? 1.988   3.201   -11.097 1.00 -0.08 ? 46 ILE A CG2  1 
ATOM 715  C CD1  . ILE A 1 46 ? 3.117   3.445   -8.264  1.00 -0.08 ? 46 ILE A CD1  1 
ATOM 716  H H    . ILE A 1 46 ? 0.067   6.195   -11.880 1.00 0.25  ? 46 ILE A H    1 
ATOM 717  H HA   . ILE A 1 46 ? 1.750   6.598   -10.439 1.00 0.05  ? 46 ILE A HA   1 
ATOM 718  H HB   . ILE A 1 46 ? 1.153   4.505   -9.605  1.00 0.02  ? 46 ILE A HB   1 
ATOM 719  H HG12 . ILE A 1 46 ? 4.130   4.212   -9.988  1.00 0.03  ? 46 ILE A HG12 1 
ATOM 720  H HG13 . ILE A 1 46 ? 3.418   5.462   -8.943  1.00 0.03  ? 46 ILE A HG13 1 
ATOM 721  H HG21 . ILE A 1 46 ? 1.153   3.229   -11.784 1.00 0.03  ? 46 ILE A HG21 1 
ATOM 722  H HG22 . ILE A 1 46 ? 1.869   2.348   -10.434 1.00 0.03  ? 46 ILE A HG22 1 
ATOM 723  H HG23 . ILE A 1 46 ? 2.915   3.089   -11.649 1.00 0.03  ? 46 ILE A HG23 1 
ATOM 724  H HD11 . ILE A 1 46 ? 2.174   3.609   -7.742  1.00 0.03  ? 46 ILE A HD11 1 
ATOM 725  H HD12 . ILE A 1 46 ? 3.942   3.549   -7.563  1.00 0.03  ? 46 ILE A HD12 1 
ATOM 726  H HD13 . ILE A 1 46 ? 3.129   2.442   -8.689  1.00 0.03  ? 46 ILE A HD13 1 
ATOM 727  N N    . GLY A 1 47 ? 4.019   5.221   -12.441 1.00 -0.46 ? 47 GLY A N    1 
ATOM 728  C CA   . GLY A 1 47 ? 5.357   5.398   -12.974 1.00 0.03  ? 47 GLY A CA   1 
ATOM 729  C C    . GLY A 1 47 ? 6.191   4.189   -12.572 1.00 0.62  ? 47 GLY A C    1 
ATOM 730  O O    . GLY A 1 47 ? 6.106   3.737   -11.436 1.00 -0.50 ? 47 GLY A O    1 
ATOM 731  H H    . GLY A 1 47 ? 3.550   4.359   -12.641 1.00 0.25  ? 47 GLY A H    1 
ATOM 732  H HA2  . GLY A 1 47 ? 5.311   5.469   -14.061 1.00 0.03  ? 47 GLY A HA2  1 
ATOM 733  H HA3  . GLY A 1 47 ? 5.808   6.303   -12.567 1.00 0.03  ? 47 GLY A HA3  1 
ATOM 734  N N    . LEU A 1 48 ? 6.987   3.656   -13.500 1.00 -0.46 ? 48 LEU A N    1 
ATOM 735  C CA   . LEU A 1 48 ? 7.792   2.471   -13.234 1.00 0.03  ? 48 LEU A CA   1 
ATOM 736  C C    . LEU A 1 48 ? 8.642   2.664   -11.975 1.00 0.62  ? 48 LEU A C    1 
ATOM 737  O O    . LEU A 1 48 ? 8.719   1.768   -11.143 1.00 -0.50 ? 48 LEU A O    1 
ATOM 738  C CB   . LEU A 1 48 ? 8.675   2.180   -14.457 1.00 -0.06 ? 48 LEU A CB   1 
ATOM 739  C CG   . LEU A 1 48 ? 9.549   0.936   -14.217 1.00 -0.01 ? 48 LEU A CG   1 
ATOM 740  C CD1  . LEU A 1 48 ? 8.667   -0.304  -14.026 1.00 -0.11 ? 48 LEU A CD1  1 
ATOM 741  C CD2  . LEU A 1 48 ? 10.465  0.723   -15.424 1.00 -0.11 ? 48 LEU A CD2  1 
ATOM 742  H H    . LEU A 1 48 ? 7.034   4.072   -14.419 1.00 0.25  ? 48 LEU A H    1 
ATOM 743  H HA   . LEU A 1 48 ? 7.117   1.629   -13.072 1.00 0.05  ? 48 LEU A HA   1 
ATOM 744  H HB2  . LEU A 1 48 ? 8.040   2.011   -15.328 1.00 0.03  ? 48 LEU A HB2  1 
ATOM 745  H HB3  . LEU A 1 48 ? 9.320   3.039   -14.647 1.00 0.03  ? 48 LEU A HB3  1 
ATOM 746  H HG   . LEU A 1 48 ? 10.162  1.084   -13.327 1.00 0.03  ? 48 LEU A HG   1 
ATOM 747  H HD11 . LEU A 1 48 ? 8.175   -0.258  -13.055 1.00 0.03  ? 48 LEU A HD11 1 
ATOM 748  H HD12 . LEU A 1 48 ? 9.286   -1.200  -14.073 1.00 0.03  ? 48 LEU A HD12 1 
ATOM 749  H HD13 . LEU A 1 48 ? 7.915   -0.342  -14.814 1.00 0.03  ? 48 LEU A HD13 1 
ATOM 750  H HD21 . LEU A 1 48 ? 9.861   0.559   -16.316 1.00 0.03  ? 48 LEU A HD21 1 
ATOM 751  H HD22 . LEU A 1 48 ? 11.100  -0.147  -15.251 1.00 0.03  ? 48 LEU A HD22 1 
ATOM 752  H HD23 . LEU A 1 48 ? 11.091  1.604   -15.567 1.00 0.03  ? 48 LEU A HD23 1 
ATOM 753  N N    . LYS A 1 49 ? 9.278   3.833   -11.840 1.00 -0.46 ? 49 LYS A N    1 
ATOM 754  C CA   . LYS A 1 49 ? 10.128  4.122   -10.691 1.00 0.03  ? 49 LYS A CA   1 
ATOM 755  C C    . LYS A 1 49 ? 9.321   4.035   -9.391  1.00 0.62  ? 49 LYS A C    1 
ATOM 756  O O    . LYS A 1 49 ? 9.778   3.439   -8.418  1.00 -0.50 ? 49 LYS A O    1 
ATOM 757  C CB   . LYS A 1 49 ? 10.741  5.517   -10.850 1.00 -0.10 ? 49 LYS A CB   1 
ATOM 758  C CG   . LYS A 1 49 ? 11.744  5.514   -12.012 1.00 -0.16 ? 49 LYS A CG   1 
ATOM 759  C CD   . LYS A 1 49 ? 12.218  6.946   -12.315 1.00 -0.18 ? 49 LYS A CD   1 
ATOM 760  C CE   . LYS A 1 49 ? 12.920  7.564   -11.095 1.00 -0.04 ? 49 LYS A CE   1 
ATOM 761  N NZ   . LYS A 1 49 ? 14.028  6.714   -10.619 1.00 -0.14 ? 49 LYS A NZ   1 
ATOM 762  H H    . LYS A 1 49 ? 9.177   4.541   -12.552 1.00 0.25  ? 49 LYS A H    1 
ATOM 763  H HA   . LYS A 1 49 ? 10.932  3.386   -10.653 1.00 0.05  ? 49 LYS A HA   1 
ATOM 764  H HB2  . LYS A 1 49 ? 9.951   6.242   -11.051 1.00 0.04  ? 49 LYS A HB2  1 
ATOM 765  H HB3  . LYS A 1 49 ? 11.254  5.788   -9.928  1.00 0.04  ? 49 LYS A HB3  1 
ATOM 766  H HG2  . LYS A 1 49 ? 12.599  4.890   -11.753 1.00 0.12  ? 49 LYS A HG2  1 
ATOM 767  H HG3  . LYS A 1 49 ? 11.263  5.106   -12.902 1.00 0.12  ? 49 LYS A HG3  1 
ATOM 768  H HD2  . LYS A 1 49 ? 12.913  6.923   -13.155 1.00 0.12  ? 49 LYS A HD2  1 
ATOM 769  H HD3  . LYS A 1 49 ? 11.357  7.561   -12.582 1.00 0.12  ? 49 LYS A HD3  1 
ATOM 770  H HE2  . LYS A 1 49 ? 13.319  8.540   -11.375 1.00 0.10  ? 49 LYS A HE2  1 
ATOM 771  H HE3  . LYS A 1 49 ? 12.198  7.696   -10.290 1.00 0.10  ? 49 LYS A HE3  1 
ATOM 772  H HZ1  . LYS A 1 49 ? 14.672  6.541   -11.379 1.00 0.29  ? 49 LYS A HZ1  1 
ATOM 773  H HZ2  . LYS A 1 49 ? 14.514  7.184   -9.868  1.00 0.29  ? 49 LYS A HZ2  1 
ATOM 774  H HZ3  . LYS A 1 49 ? 13.660  5.836   -10.283 1.00 0.29  ? 49 LYS A HZ3  1 
ATOM 775  N N    . GLN A 1 50 ? 8.125   4.633   -9.377  1.00 -0.46 ? 50 GLN A N    1 
ATOM 776  C CA   . GLN A 1 50 ? 7.275   4.633   -8.194  1.00 0.03  ? 50 GLN A CA   1 
ATOM 777  C C    . GLN A 1 50 ? 6.787   3.210   -7.889  1.00 0.62  ? 50 GLN A C    1 
ATOM 778  O O    . GLN A 1 50 ? 6.931   2.744   -6.765  1.00 -0.50 ? 50 GLN A O    1 
ATOM 779  C CB   . GLN A 1 50 ? 6.096   5.580   -8.417  1.00 -0.10 ? 50 GLN A CB   1 
ATOM 780  C CG   . GLN A 1 50 ? 6.560   7.035   -8.350  1.00 -0.10 ? 50 GLN A CG   1 
ATOM 781  C CD   . GLN A 1 50 ? 5.406   7.949   -7.949  1.00 0.68  ? 50 GLN A CD   1 
ATOM 782  O OE1  . GLN A 1 50 ? 5.278   8.312   -6.784  1.00 -0.47 ? 50 GLN A OE1  1 
ATOM 783  N NE2  . GLN A 1 50 ? 4.564   8.318   -8.913  1.00 -0.87 ? 50 GLN A NE2  1 
ATOM 784  H H    . GLN A 1 50 ? 7.791   5.103   -10.205 1.00 0.25  ? 50 GLN A H    1 
ATOM 785  H HA   . GLN A 1 50 ? 7.854   4.990   -7.341  1.00 0.05  ? 50 GLN A HA   1 
ATOM 786  H HB2  . GLN A 1 50 ? 5.666   5.394   -9.394  1.00 0.04  ? 50 GLN A HB2  1 
ATOM 787  H HB3  . GLN A 1 50 ? 5.344   5.406   -7.647  1.00 0.04  ? 50 GLN A HB3  1 
ATOM 788  H HG2  . GLN A 1 50 ? 7.359   7.128   -7.615  1.00 0.06  ? 50 GLN A HG2  1 
ATOM 789  H HG3  . GLN A 1 50 ? 6.936   7.336   -9.329  1.00 0.06  ? 50 GLN A HG3  1 
ATOM 790  H HE21 . GLN A 1 50 ? 4.688   7.971   -9.858  1.00 0.34  ? 50 GLN A HE21 1 
ATOM 791  H HE22 . GLN A 1 50 ? 3.800   8.942   -8.701  1.00 0.34  ? 50 GLN A HE22 1 
ATOM 792  N N    . LYS A 1 51 ? 6.213   2.518   -8.887  1.00 -0.46 ? 51 LYS A N    1 
ATOM 793  C CA   . LYS A 1 51 ? 5.734   1.152   -8.700  1.00 0.03  ? 51 LYS A CA   1 
ATOM 794  C C    . LYS A 1 51 ? 6.868   0.284   -8.154  1.00 0.62  ? 51 LYS A C    1 
ATOM 795  O O    . LYS A 1 51 ? 6.670   -0.475  -7.208  1.00 -0.50 ? 51 LYS A O    1 
ATOM 796  C CB   . LYS A 1 51 ? 5.208   0.593   -10.033 1.00 -0.10 ? 51 LYS A CB   1 
ATOM 797  C CG   . LYS A 1 51 ? 4.420   -0.700  -9.768  1.00 -0.16 ? 51 LYS A CG   1 
ATOM 798  C CD   . LYS A 1 51 ? 4.028   -1.378  -11.091 1.00 -0.18 ? 51 LYS A CD   1 
ATOM 799  C CE   . LYS A 1 51 ? 3.075   -0.481  -11.893 1.00 -0.04 ? 51 LYS A CE   1 
ATOM 800  N NZ   . LYS A 1 51 ? 2.098   -1.286  -12.660 1.00 -0.14 ? 51 LYS A NZ   1 
ATOM 801  H H    . LYS A 1 51 ? 6.105   2.944   -9.796  1.00 0.25  ? 51 LYS A H    1 
ATOM 802  H HA   . LYS A 1 51 ? 4.920   1.161   -7.976  1.00 0.05  ? 51 LYS A HA   1 
ATOM 803  H HB2  . LYS A 1 51 ? 4.554   1.328   -10.501 1.00 0.04  ? 51 LYS A HB2  1 
ATOM 804  H HB3  . LYS A 1 51 ? 6.048   0.381   -10.696 1.00 0.04  ? 51 LYS A HB3  1 
ATOM 805  H HG2  . LYS A 1 51 ? 5.038   -1.386  -9.188  1.00 0.12  ? 51 LYS A HG2  1 
ATOM 806  H HG3  . LYS A 1 51 ? 3.519   -0.464  -9.201  1.00 0.12  ? 51 LYS A HG3  1 
ATOM 807  H HD2  . LYS A 1 51 ? 4.925   -1.573  -11.680 1.00 0.12  ? 51 LYS A HD2  1 
ATOM 808  H HD3  . LYS A 1 51 ? 3.532   -2.325  -10.870 1.00 0.12  ? 51 LYS A HD3  1 
ATOM 809  H HE2  . LYS A 1 51 ? 2.537   0.173   -11.212 1.00 0.10  ? 51 LYS A HE2  1 
ATOM 810  H HE3  . LYS A 1 51 ? 3.656   0.129   -12.585 1.00 0.10  ? 51 LYS A HE3  1 
ATOM 811  H HZ1  . LYS A 1 51 ? 1.536   -1.848  -12.023 1.00 0.29  ? 51 LYS A HZ1  1 
ATOM 812  H HZ2  . LYS A 1 51 ? 1.493   -0.671  -13.185 1.00 0.29  ? 51 LYS A HZ2  1 
ATOM 813  H HZ3  . LYS A 1 51 ? 2.589   -1.897  -13.296 1.00 0.29  ? 51 LYS A HZ3  1 
ATOM 814  N N    . GLN A 1 52 ? 8.058   0.406   -8.751  1.00 -0.46 ? 52 GLN A N    1 
ATOM 815  C CA   . GLN A 1 52 ? 9.224   -0.348  -8.318  1.00 0.03  ? 52 GLN A CA   1 
ATOM 816  C C    . GLN A 1 52 ? 9.531   -0.026  -6.855  1.00 0.62  ? 52 GLN A C    1 
ATOM 817  O O    . GLN A 1 52 ? 9.717   -0.935  -6.049  1.00 -0.50 ? 52 GLN A O    1 
ATOM 818  C CB   . GLN A 1 52 ? 10.414  -0.001  -9.220  1.00 -0.10 ? 52 GLN A CB   1 
ATOM 819  C CG   . GLN A 1 52 ? 11.637  -0.835  -8.824  1.00 -0.10 ? 52 GLN A CG   1 
ATOM 820  C CD   . GLN A 1 52 ? 12.815  -0.557  -9.753  1.00 0.68  ? 52 GLN A CD   1 
ATOM 821  O OE1  . GLN A 1 52 ? 12.799  0.407   -10.515 1.00 -0.47 ? 52 GLN A OE1  1 
ATOM 822  N NE2  . GLN A 1 52 ? 13.841  -1.406  -9.689  1.00 -0.87 ? 52 GLN A NE2  1 
ATOM 823  H H    . GLN A 1 52 ? 8.162   1.044   -9.530  1.00 0.25  ? 52 GLN A H    1 
ATOM 824  H HA   . GLN A 1 52 ? 9.009   -1.414  -8.410  1.00 0.05  ? 52 GLN A HA   1 
ATOM 825  H HB2  . GLN A 1 52 ? 10.154  -0.215  -10.257 1.00 0.04  ? 52 GLN A HB2  1 
ATOM 826  H HB3  . GLN A 1 52 ? 10.650  1.059   -9.119  1.00 0.04  ? 52 GLN A HB3  1 
ATOM 827  H HG2  . GLN A 1 52 ? 11.925  -0.590  -7.801  1.00 0.06  ? 52 GLN A HG2  1 
ATOM 828  H HG3  . GLN A 1 52 ? 11.380  -1.894  -8.879  1.00 0.06  ? 52 GLN A HG3  1 
ATOM 829  H HE21 . GLN A 1 52 ? 13.813  -2.183  -9.046  1.00 0.34  ? 52 GLN A HE21 1 
ATOM 830  H HE22 . GLN A 1 52 ? 14.644  -1.268  -10.284 1.00 0.34  ? 52 GLN A HE22 1 
ATOM 831  N N    . TRP A 1 53 ? 9.581   1.272   -6.515  1.00 -0.46 ? 53 TRP A N    1 
ATOM 832  C CA   . TRP A 1 53 ? 9.857   1.706   -5.153  1.00 0.03  ? 53 TRP A CA   1 
ATOM 833  C C    . TRP A 1 53 ? 8.875   1.051   -4.185  1.00 0.62  ? 53 TRP A C    1 
ATOM 834  O O    . TRP A 1 53 ? 9.280   0.533   -3.151  1.00 -0.50 ? 53 TRP A O    1 
ATOM 835  C CB   . TRP A 1 53 ? 9.759   3.232   -5.062  1.00 -0.10 ? 53 TRP A CB   1 
ATOM 836  C CG   . TRP A 1 53 ? 9.598   3.755   -3.667  1.00 -0.14 ? 53 TRP A CG   1 
ATOM 837  C CD1  . TRP A 1 53 ? 10.489  3.608   -2.674  1.00 0.04  ? 53 TRP A CD1  1 
ATOM 838  C CD2  . TRP A 1 53 ? 8.481   4.494   -3.076  1.00 0.15  ? 53 TRP A CD2  1 
ATOM 839  N NE1  . TRP A 1 53 ? 10.036  4.187   -1.515  1.00 -0.35 ? 53 TRP A NE1  1 
ATOM 840  C CE2  . TRP A 1 53 ? 8.792   4.755   -1.703  1.00 0.15  ? 53 TRP A CE2  1 
ATOM 841  C CE3  . TRP A 1 53 ? 7.233   4.973   -3.547  1.00 -0.17 ? 53 TRP A CE3  1 
ATOM 842  C CZ2  . TRP A 1 53 ? 7.926   5.448   -0.855  1.00 -0.17 ? 53 TRP A CZ2  1 
ATOM 843  C CZ3  . TRP A 1 53 ? 6.358   5.673   -2.693  1.00 -0.07 ? 53 TRP A CZ3  1 
ATOM 844  C CH2  . TRP A 1 53 ? 6.707   5.916   -1.354  1.00 -0.08 ? 53 TRP A CH2  1 
ATOM 845  H H    . TRP A 1 53 ? 9.421   1.981   -7.221  1.00 0.25  ? 53 TRP A H    1 
ATOM 846  H HA   . TRP A 1 53 ? 10.870  1.402   -4.884  1.00 0.05  ? 53 TRP A HA   1 
ATOM 847  H HB2  . TRP A 1 53 ? 10.663  3.664   -5.492  1.00 0.04  ? 53 TRP A HB2  1 
ATOM 848  H HB3  . TRP A 1 53 ? 8.907   3.562   -5.650  1.00 0.04  ? 53 TRP A HB3  1 
ATOM 849  H HD1  . TRP A 1 53 ? 11.435  3.091   -2.769  1.00 0.09  ? 53 TRP A HD1  1 
ATOM 850  H HE1  . TRP A 1 53 ? 10.533  4.204   -0.629  1.00 0.27  ? 53 TRP A HE1  1 
ATOM 851  H HE3  . TRP A 1 53 ? 6.947   4.805   -4.571  1.00 0.09  ? 53 TRP A HE3  1 
ATOM 852  H HZ2  . TRP A 1 53 ? 8.196   5.624   0.176   1.00 0.08  ? 53 TRP A HZ2  1 
ATOM 853  H HZ3  . TRP A 1 53 ? 5.412   6.028   -3.075  1.00 0.06  ? 53 TRP A HZ3  1 
ATOM 854  H HH2  . TRP A 1 53 ? 6.039   6.469   -0.713  1.00 0.07  ? 53 TRP A HH2  1 
ATOM 855  N N    . LEU A 1 54 ? 7.584   1.074   -4.515  1.00 -0.46 ? 54 LEU A N    1 
ATOM 856  C CA   . LEU A 1 54 ? 6.571   0.481   -3.662  1.00 0.03  ? 54 LEU A CA   1 
ATOM 857  C C    . LEU A 1 54 ? 6.824   -1.018  -3.511  1.00 0.62  ? 54 LEU A C    1 
ATOM 858  O O    . LEU A 1 54 ? 6.675   -1.568  -2.424  1.00 -0.50 ? 54 LEU A O    1 
ATOM 859  C CB   . LEU A 1 54 ? 5.176   0.708   -4.264  1.00 -0.06 ? 54 LEU A CB   1 
ATOM 860  C CG   . LEU A 1 54 ? 4.794   2.195   -4.237  1.00 -0.01 ? 54 LEU A CG   1 
ATOM 861  C CD1  . LEU A 1 54 ? 3.495   2.384   -5.020  1.00 -0.11 ? 54 LEU A CD1  1 
ATOM 862  C CD2  . LEU A 1 54 ? 4.585   2.667   -2.795  1.00 -0.11 ? 54 LEU A CD2  1 
ATOM 863  H H    . LEU A 1 54 ? 7.293   1.514   -5.380  1.00 0.25  ? 54 LEU A H    1 
ATOM 864  H HA   . LEU A 1 54 ? 6.619   0.945   -2.685  1.00 0.05  ? 54 LEU A HA   1 
ATOM 865  H HB2  . LEU A 1 54 ? 5.171   0.356   -5.295  1.00 0.03  ? 54 LEU A HB2  1 
ATOM 866  H HB3  . LEU A 1 54 ? 4.442   0.140   -3.691  1.00 0.03  ? 54 LEU A HB3  1 
ATOM 867  H HG   . LEU A 1 54 ? 5.582   2.785   -4.700  1.00 0.03  ? 54 LEU A HG   1 
ATOM 868  H HD11 . LEU A 1 54 ? 3.609   1.965   -6.018  1.00 0.03  ? 54 LEU A HD11 1 
ATOM 869  H HD12 . LEU A 1 54 ? 3.266   3.447   -5.096  1.00 0.03  ? 54 LEU A HD12 1 
ATOM 870  H HD13 . LEU A 1 54 ? 2.683   1.874   -4.505  1.00 0.03  ? 54 LEU A HD13 1 
ATOM 871  H HD21 . LEU A 1 54 ? 4.006   1.924   -2.247  1.00 0.03  ? 54 LEU A HD21 1 
ATOM 872  H HD22 . LEU A 1 54 ? 4.047   3.615   -2.798  1.00 0.03  ? 54 LEU A HD22 1 
ATOM 873  H HD23 . LEU A 1 54 ? 5.550   2.805   -2.314  1.00 0.03  ? 54 LEU A HD23 1 
ATOM 874  N N    . MET A 1 55 ? 7.188   -1.672  -4.615  1.00 -0.46 ? 55 MET A N    1 
ATOM 875  C CA   . MET A 1 55 ? 7.367   -3.112  -4.652  1.00 0.03  ? 55 MET A CA   1 
ATOM 876  C C    . MET A 1 55 ? 8.556   -3.591  -3.804  1.00 0.62  ? 55 MET A C    1 
ATOM 877  O O    . MET A 1 55 ? 8.467   -4.655  -3.198  1.00 -0.50 ? 55 MET A O    1 
ATOM 878  C CB   . MET A 1 55 ? 7.549   -3.537  -6.116  1.00 -0.15 ? 55 MET A CB   1 
ATOM 879  C CG   . MET A 1 55 ? 7.344   -5.045  -6.257  1.00 -0.05 ? 55 MET A CG   1 
ATOM 880  S SD   . MET A 1 55 ? 7.609   -5.664  -7.937  1.00 0.74  ? 55 MET A SD   1 
ATOM 881  C CE   . MET A 1 55 ? 7.294   -7.422  -7.646  1.00 -0.13 ? 55 MET A CE   1 
ATOM 882  H H    . MET A 1 55 ? 7.326   -1.154  -5.474  1.00 0.25  ? 55 MET A H    1 
ATOM 883  H HA   . MET A 1 55 ? 6.459   -3.577  -4.265  1.00 0.05  ? 55 MET A HA   1 
ATOM 884  H HB2  . MET A 1 55 ? 6.817   -3.018  -6.737  1.00 0.03  ? 55 MET A HB2  1 
ATOM 885  H HB3  . MET A 1 55 ? 8.554   -3.275  -6.449  1.00 0.03  ? 55 MET A HB3  1 
ATOM 886  H HG2  . MET A 1 55 ? 8.034   -5.557  -5.588  1.00 0.07  ? 55 MET A HG2  1 
ATOM 887  H HG3  . MET A 1 55 ? 6.325   -5.285  -5.960  1.00 0.07  ? 55 MET A HG3  1 
ATOM 888  H HE1  . MET A 1 55 ? 7.999   -7.799  -6.905  1.00 0.07  ? 55 MET A HE1  1 
ATOM 889  H HE2  . MET A 1 55 ? 7.418   -7.972  -8.578  1.00 0.07  ? 55 MET A HE2  1 
ATOM 890  H HE3  . MET A 1 55 ? 6.277   -7.553  -7.279  1.00 0.07  ? 55 MET A HE3  1 
ATOM 891  N N    . THR A 1 56 ? 9.673   -2.839  -3.778  1.00 -0.46 ? 56 THR A N    1 
ATOM 892  C CA   . THR A 1 56 ? 10.887  -3.291  -3.078  1.00 0.03  ? 56 THR A CA   1 
ATOM 893  C C    . THR A 1 56 ? 11.150  -2.535  -1.768  1.00 0.62  ? 56 THR A C    1 
ATOM 894  O O    . THR A 1 56 ? 11.857  -3.055  -0.907  1.00 -0.50 ? 56 THR A O    1 
ATOM 895  C CB   . THR A 1 56 ? 12.088  -3.160  -4.020  1.00 0.17  ? 56 THR A CB   1 
ATOM 896  O OG1  . THR A 1 56 ? 13.195  -3.844  -3.474  1.00 -0.55 ? 56 THR A OG1  1 
ATOM 897  C CG2  . THR A 1 56 ? 12.457  -1.685  -4.224  1.00 -0.19 ? 56 THR A CG2  1 
ATOM 898  H H    . THR A 1 56 ? 9.696   -1.952  -4.267  1.00 0.25  ? 56 THR A H    1 
ATOM 899  H HA   . THR A 1 56 ? 10.773  -4.347  -2.840  1.00 0.05  ? 56 THR A HA   1 
ATOM 900  H HB   . THR A 1 56 ? 11.834  -3.607  -4.975  1.00 0.08  ? 56 THR A HB   1 
ATOM 901  H HG1  . THR A 1 56 ? 13.939  -3.749  -4.072  1.00 0.31  ? 56 THR A HG1  1 
ATOM 902  H HG21 . THR A 1 56 ? 11.562  -1.109  -4.446  1.00 0.07  ? 56 THR A HG21 1 
ATOM 903  H HG22 . THR A 1 56 ? 13.157  -1.598  -5.055  1.00 0.07  ? 56 THR A HG22 1 
ATOM 904  H HG23 . THR A 1 56 ? 12.923  -1.296  -3.319  1.00 0.07  ? 56 THR A HG23 1 
ATOM 905  N N    . GLU A 1 57 ? 10.611  -1.319  -1.613  1.00 -0.46 ? 57 GLU A N    1 
ATOM 906  C CA   . GLU A 1 57 ? 10.881  -0.511  -0.426  1.00 0.03  ? 57 GLU A CA   1 
ATOM 907  C C    . GLU A 1 57 ? 9.629   -0.348  0.439   1.00 0.62  ? 57 GLU A C    1 
ATOM 908  O O    . GLU A 1 57 ? 9.541   -0.937  1.514   1.00 -0.50 ? 57 GLU A O    1 
ATOM 909  C CB   . GLU A 1 57 ? 11.431  0.853   -0.859  1.00 -0.18 ? 57 GLU A CB   1 
ATOM 910  C CG   . GLU A 1 57 ? 11.943  1.622   0.364   1.00 -0.40 ? 57 GLU A CG   1 
ATOM 911  C CD   . GLU A 1 57 ? 12.511  2.977   -0.041  1.00 0.71  ? 57 GLU A CD   1 
ATOM 912  O OE1  . GLU A 1 57 ? 13.495  2.975   -0.809  1.00 -0.72 ? 57 GLU A OE1  1 
ATOM 913  O OE2  . GLU A 1 57 ? 11.945  3.992   0.423   1.00 -0.72 ? 57 GLU A OE2  1 
ATOM 914  H H    . GLU A 1 57 ? 10.017  -0.935  -2.333  1.00 0.25  ? 57 GLU A H    1 
ATOM 915  H HA   . GLU A 1 57 ? 11.644  -1.004  0.169   1.00 0.05  ? 57 GLU A HA   1 
ATOM 916  H HB2  . GLU A 1 57 ? 12.252  0.706   -1.561  1.00 0.09  ? 57 GLU A HB2  1 
ATOM 917  H HB3  . GLU A 1 57 ? 10.645  1.426   -1.340  1.00 0.09  ? 57 GLU A HB3  1 
ATOM 918  H HG2  . GLU A 1 57 ? 11.121  1.775   1.062   1.00 0.07  ? 57 GLU A HG2  1 
ATOM 919  H HG3  . GLU A 1 57 ? 12.724  1.040   0.853   1.00 0.07  ? 57 GLU A HG3  1 
ATOM 920  N N    . ALA A 1 58 ? 8.675   0.471   -0.017  1.00 -0.46 ? 58 ALA A N    1 
ATOM 921  C CA   . ALA A 1 58 ? 7.490   0.797   0.768   1.00 0.03  ? 58 ALA A CA   1 
ATOM 922  C C    . ALA A 1 58 ? 6.769   -0.456  1.262   1.00 0.62  ? 58 ALA A C    1 
ATOM 923  O O    . ALA A 1 58 ? 6.722   -0.704  2.462   1.00 -0.50 ? 58 ALA A O    1 
ATOM 924  C CB   . ALA A 1 58 ? 6.550   1.663   -0.063  1.00 -0.10 ? 58 ALA A CB   1 
ATOM 925  H H    . ALA A 1 58 ? 8.779   0.899   -0.927  1.00 0.25  ? 58 ALA A H    1 
ATOM 926  H HA   . ALA A 1 58 ? 7.808   1.376   1.637   1.00 0.05  ? 58 ALA A HA   1 
ATOM 927  H HB1  . ALA A 1 58 ? 7.131   2.376   -0.649  1.00 0.04  ? 58 ALA A HB1  1 
ATOM 928  H HB2  . ALA A 1 58 ? 5.880   2.203   0.600   1.00 0.04  ? 58 ALA A HB2  1 
ATOM 929  H HB3  . ALA A 1 58 ? 5.965   1.034   -0.730  1.00 0.04  ? 58 ALA A HB3  1 
ATOM 930  N N    . LEU A 1 59 ? 6.200   -1.244  0.347   1.00 -0.46 ? 59 LEU A N    1 
ATOM 931  C CA   . LEU A 1 59 ? 5.424   -2.423  0.716   1.00 0.03  ? 59 LEU A CA   1 
ATOM 932  C C    . LEU A 1 59 ? 6.349   -3.584  1.092   1.00 0.62  ? 59 LEU A C    1 
ATOM 933  O O    . LEU A 1 59 ? 6.003   -4.743  0.884   1.00 -0.50 ? 59 LEU A O    1 
ATOM 934  C CB   . LEU A 1 59 ? 4.504   -2.815  -0.451  1.00 -0.06 ? 59 LEU A CB   1 
ATOM 935  C CG   . LEU A 1 59 ? 3.700   -1.598  -0.948  1.00 -0.01 ? 59 LEU A CG   1 
ATOM 936  C CD1  . LEU A 1 59 ? 2.739   -2.051  -2.044  1.00 -0.11 ? 59 LEU A CD1  1 
ATOM 937  C CD2  . LEU A 1 59 ? 2.896   -0.981  0.200   1.00 -0.11 ? 59 LEU A CD2  1 
ATOM 938  H H    . LEU A 1 59 ? 6.295   -1.022  -0.632  1.00 0.25  ? 59 LEU A H    1 
ATOM 939  H HA   . LEU A 1 59 ? 4.809   -2.181  1.581   1.00 0.05  ? 59 LEU A HA   1 
ATOM 940  H HB2  . LEU A 1 59 ? 5.108   -3.204  -1.270  1.00 0.03  ? 59 LEU A HB2  1 
ATOM 941  H HB3  . LEU A 1 59 ? 3.813   -3.589  -0.120  1.00 0.03  ? 59 LEU A HB3  1 
ATOM 942  H HG   . LEU A 1 59 ? 4.379   -0.851  -1.356  1.00 0.03  ? 59 LEU A HG   1 
ATOM 943  H HD11 . LEU A 1 59 ? 3.302   -2.541  -2.836  1.00 0.03  ? 59 LEU A HD11 1 
ATOM 944  H HD12 . LEU A 1 59 ? 2.217   -1.186  -2.451  1.00 0.03  ? 59 LEU A HD12 1 
ATOM 945  H HD13 . LEU A 1 59 ? 2.014   -2.751  -1.627  1.00 0.03  ? 59 LEU A HD13 1 
ATOM 946  H HD21 . LEU A 1 59 ? 2.335   -1.761  0.712   1.00 0.03  ? 59 LEU A HD21 1 
ATOM 947  H HD22 . LEU A 1 59 ? 2.203   -0.240  -0.200  1.00 0.03  ? 59 LEU A HD22 1 
ATOM 948  H HD23 . LEU A 1 59 ? 3.573   -0.496  0.903   1.00 0.03  ? 59 LEU A HD23 1 
ATOM 949  N N    . VAL A 1 60 ? 7.522   -3.263  1.649   1.00 -0.46 ? 60 VAL A N    1 
ATOM 950  C CA   . VAL A 1 60 ? 8.499   -4.257  2.056   1.00 0.03  ? 60 VAL A CA   1 
ATOM 951  C C    . VAL A 1 60 ? 9.007   -3.932  3.465   1.00 0.62  ? 60 VAL A C    1 
ATOM 952  O O    . VAL A 1 60 ? 9.241   -4.844  4.255   1.00 -0.50 ? 60 VAL A O    1 
ATOM 953  C CB   . VAL A 1 60 ? 9.638   -4.274  1.026   1.00 -0.01 ? 60 VAL A CB   1 
ATOM 954  C CG1  . VAL A 1 60 ? 10.669  -5.349  1.371   1.00 -0.09 ? 60 VAL A CG1  1 
ATOM 955  C CG2  . VAL A 1 60 ? 9.058   -4.573  -0.355  1.00 -0.09 ? 60 VAL A CG2  1 
ATOM 956  H H    . VAL A 1 60 ? 7.749   -2.292  1.793   1.00 0.25  ? 60 VAL A H    1 
ATOM 957  H HA   . VAL A 1 60 ? 8.026   -5.240  2.075   1.00 0.05  ? 60 VAL A HA   1 
ATOM 958  H HB   . VAL A 1 60 ? 10.127  -3.302  1.009   1.00 0.02  ? 60 VAL A HB   1 
ATOM 959  H HG11 . VAL A 1 60 ? 11.163  -5.096  2.308   1.00 0.03  ? 60 VAL A HG11 1 
ATOM 960  H HG12 . VAL A 1 60 ? 11.414  -5.402  0.570   1.00 0.03  ? 60 VAL A HG12 1 
ATOM 961  H HG13 . VAL A 1 60 ? 10.173  -6.313  1.468   1.00 0.03  ? 60 VAL A HG13 1 
ATOM 962  H HG21 . VAL A 1 60 ? 8.318   -5.369  -0.276  1.00 0.03  ? 60 VAL A HG21 1 
ATOM 963  H HG22 . VAL A 1 60 ? 9.855   -4.891  -1.019  1.00 0.03  ? 60 VAL A HG22 1 
ATOM 964  H HG23 . VAL A 1 60 ? 8.586   -3.675  -0.755  1.00 0.03  ? 60 VAL A HG23 1 
ATOM 965  N N    . ASN A 1 61 ? 9.174   -2.631  3.781   1.00 -0.46 ? 61 ASN A N    1 
ATOM 966  C CA   . ASN A 1 61 ? 9.649   -2.206  5.097   1.00 0.03  ? 61 ASN A CA   1 
ATOM 967  C C    . ASN A 1 61 ? 8.543   -1.494  5.894   1.00 0.62  ? 61 ASN A C    1 
ATOM 968  O O    . ASN A 1 61 ? 8.703   -1.280  7.094   1.00 -0.50 ? 61 ASN A O    1 
ATOM 969  C CB   . ASN A 1 61 ? 10.885  -1.303  4.938   1.00 -0.09 ? 61 ASN A CB   1 
ATOM 970  C CG   . ASN A 1 61 ? 10.585  -0.021  4.155   1.00 0.68  ? 61 ASN A CG   1 
ATOM 971  O OD1  . ASN A 1 61 ? 9.442   0.415   4.063   1.00 -0.47 ? 61 ASN A OD1  1 
ATOM 972  N ND2  . ASN A 1 61 ? 11.629  0.586   3.591   1.00 -0.87 ? 61 ASN A ND2  1 
ATOM 973  H H    . ASN A 1 61 ? 8.970   -1.917  3.093   1.00 0.25  ? 61 ASN A H    1 
ATOM 974  H HA   . ASN A 1 61 ? 9.951   -3.089  5.660   1.00 0.05  ? 61 ASN A HA   1 
ATOM 975  H HB2  . ASN A 1 61 ? 11.253  -1.032  5.928   1.00 0.04  ? 61 ASN A HB2  1 
ATOM 976  H HB3  . ASN A 1 61 ? 11.662  -1.862  4.415   1.00 0.04  ? 61 ASN A HB3  1 
ATOM 977  H HD21 . ASN A 1 61 ? 12.553  0.193   3.688   1.00 0.34  ? 61 ASN A HD21 1 
ATOM 978  H HD22 . ASN A 1 61 ? 11.492  1.437   3.067   1.00 0.34  ? 61 ASN A HD22 1 
ATOM 979  N N    . ASN A 1 62 ? 7.424   -1.123  5.242   1.00 -0.46 ? 62 ASN A N    1 
ATOM 980  C CA   . ASN A 1 62 ? 6.332   -0.442  5.931   1.00 0.03  ? 62 ASN A CA   1 
ATOM 981  C C    . ASN A 1 62 ? 5.728   -1.390  6.984   1.00 0.62  ? 62 ASN A C    1 
ATOM 982  O O    . ASN A 1 62 ? 5.322   -2.501  6.644   1.00 -0.50 ? 62 ASN A O    1 
ATOM 983  C CB   . ASN A 1 62 ? 5.278   0.007   4.914   1.00 -0.09 ? 62 ASN A CB   1 
ATOM 984  C CG   . ASN A 1 62 ? 4.214   0.875   5.575   1.00 0.68  ? 62 ASN A CG   1 
ATOM 985  O OD1  . ASN A 1 62 ? 3.386   0.379   6.327   1.00 -0.47 ? 62 ASN A OD1  1 
ATOM 986  N ND2  . ASN A 1 62 ? 4.239   2.177   5.291   1.00 -0.87 ? 62 ASN A ND2  1 
ATOM 987  H H    . ASN A 1 62 ? 7.327   -1.314  4.253   1.00 0.25  ? 62 ASN A H    1 
ATOM 988  H HA   . ASN A 1 62 ? 6.735   0.440   6.420   1.00 0.05  ? 62 ASN A HA   1 
ATOM 989  H HB2  . ASN A 1 62 ? 5.763   0.586   4.131   1.00 0.04  ? 62 ASN A HB2  1 
ATOM 990  H HB3  . ASN A 1 62 ? 4.805   -0.870  4.471   1.00 0.04  ? 62 ASN A HB3  1 
ATOM 991  H HD21 . ASN A 1 62 ? 4.944   2.544   4.669   1.00 0.34  ? 62 ASN A HD21 1 
ATOM 992  H HD22 . ASN A 1 62 ? 3.553   2.794   5.700   1.00 0.34  ? 62 ASN A HD22 1 
ATOM 993  N N    . PRO A 1 63 ? 5.675   -0.964  8.268   1.00 -0.23 ? 63 PRO A N    1 
ATOM 994  C CA   . PRO A 1 63 ? 5.182   -1.796  9.354   1.00 0.03  ? 63 PRO A CA   1 
ATOM 995  C C    . PRO A 1 63 ? 3.710   -2.185  9.175   1.00 0.53  ? 63 PRO A C    1 
ATOM 996  O O    . PRO A 1 63 ? 3.272   -3.176  9.748   1.00 -0.50 ? 63 PRO A O    1 
ATOM 997  C CB   . PRO A 1 63 ? 5.375   -0.972  10.632  1.00 -0.11 ? 63 PRO A CB   1 
ATOM 998  C CG   . PRO A 1 63 ? 5.851   0.419   10.200  1.00 -0.12 ? 63 PRO A CG   1 
ATOM 999  C CD   . PRO A 1 63 ? 6.120   0.348   8.699   1.00 -0.01 ? 63 PRO A CD   1 
ATOM 1000 H HA   . PRO A 1 63 ? 5.787   -2.702  9.416   1.00 0.05  ? 63 PRO A HA   1 
ATOM 1001 H HB2  . PRO A 1 63 ? 4.433   -0.893  11.176  1.00 0.06  ? 63 PRO A HB2  1 
ATOM 1002 H HB3  . PRO A 1 63 ? 6.129   -1.442  11.264  1.00 0.06  ? 63 PRO A HB3  1 
ATOM 1003 H HG2  . PRO A 1 63 ? 5.074   1.157   10.404  1.00 0.06  ? 63 PRO A HG2  1 
ATOM 1004 H HG3  . PRO A 1 63 ? 6.765   0.684   10.733  1.00 0.06  ? 63 PRO A HG3  1 
ATOM 1005 H HD2  . PRO A 1 63 ? 5.558   1.127   8.182   1.00 0.06  ? 63 PRO A HD2  1 
ATOM 1006 H HD3  . PRO A 1 63 ? 7.188   0.464   8.509   1.00 0.06  ? 63 PRO A HD3  1 
ATOM 1007 N N    . LYS A 1 64 ? 2.945   -1.409  8.396   1.00 -0.46 ? 64 LYS A N    1 
ATOM 1008 C CA   . LYS A 1 64 ? 1.524   -1.680  8.196   1.00 0.03  ? 64 LYS A CA   1 
ATOM 1009 C C    . LYS A 1 64 ? 1.297   -2.577  6.975   1.00 0.62  ? 64 LYS A C    1 
ATOM 1010 O O    . LYS A 1 64 ? 0.166   -2.689  6.505   1.00 -0.50 ? 64 LYS A O    1 
ATOM 1011 C CB   . LYS A 1 64 ? 0.771   -0.355  8.037   1.00 -0.10 ? 64 LYS A CB   1 
ATOM 1012 C CG   . LYS A 1 64 ? 1.151   0.593   9.181   1.00 -0.16 ? 64 LYS A CG   1 
ATOM 1013 C CD   . LYS A 1 64 ? 0.081   1.683   9.347   1.00 -0.18 ? 64 LYS A CD   1 
ATOM 1014 C CE   . LYS A 1 64 ? -1.158  1.128   10.069  1.00 -0.04 ? 64 LYS A CE   1 
ATOM 1015 N NZ   . LYS A 1 64 ? -0.828  0.645   11.423  1.00 -0.14 ? 64 LYS A NZ   1 
ATOM 1016 H H    . LYS A 1 64 ? 3.350   -0.607  7.932   1.00 0.25  ? 64 LYS A H    1 
ATOM 1017 H HA   . LYS A 1 64 ? 1.135   -2.189  9.074   1.00 0.05  ? 64 LYS A HA   1 
ATOM 1018 H HB2  . LYS A 1 64 ? 1.033   0.103   7.083   1.00 0.04  ? 64 LYS A HB2  1 
ATOM 1019 H HB3  . LYS A 1 64 ? -0.299  -0.549  8.059   1.00 0.04  ? 64 LYS A HB3  1 
ATOM 1020 H HG2  . LYS A 1 64 ? 1.247   0.027   10.106  1.00 0.12  ? 64 LYS A HG2  1 
ATOM 1021 H HG3  . LYS A 1 64 ? 2.108   1.064   8.951   1.00 0.12  ? 64 LYS A HG3  1 
ATOM 1022 H HD2  . LYS A 1 64 ? 0.497   2.507   9.930   1.00 0.12  ? 64 LYS A HD2  1 
ATOM 1023 H HD3  . LYS A 1 64 ? -0.210  2.053   8.363   1.00 0.12  ? 64 LYS A HD3  1 
ATOM 1024 H HE2  . LYS A 1 64 ? -1.903  1.921   10.149  1.00 0.10  ? 64 LYS A HE2  1 
ATOM 1025 H HE3  . LYS A 1 64 ? -1.577  0.307   9.491   1.00 0.10  ? 64 LYS A HE3  1 
ATOM 1026 H HZ1  . LYS A 1 64 ? -0.342  1.370   11.931  1.00 0.29  ? 64 LYS A HZ1  1 
ATOM 1027 H HZ2  . LYS A 1 64 ? -1.679  0.404   11.911  1.00 0.29  ? 64 LYS A HZ2  1 
ATOM 1028 H HZ3  . LYS A 1 64 ? -0.238  -0.173  11.356  1.00 0.29  ? 64 LYS A HZ3  1 
ATOM 1029 N N    . ILE A 1 65 ? 2.362   -3.217  6.462   1.00 -0.46 ? 65 ILE A N    1 
ATOM 1030 C CA   . ILE A 1 65 ? 2.255   -4.086  5.295   1.00 0.03  ? 65 ILE A CA   1 
ATOM 1031 C C    . ILE A 1 65 ? 2.854   -5.457  5.611   1.00 0.62  ? 65 ILE A C    1 
ATOM 1032 O O    . ILE A 1 65 ? 3.830   -5.557  6.353   1.00 -0.50 ? 65 ILE A O    1 
ATOM 1033 C CB   . ILE A 1 65 ? 2.982   -3.433  4.106   1.00 -0.01 ? 65 ILE A CB   1 
ATOM 1034 C CG1  . ILE A 1 65 ? 2.323   -2.083  3.741   1.00 -0.05 ? 65 ILE A CG1  1 
ATOM 1035 C CG2  . ILE A 1 65 ? 2.957   -4.374  2.895   1.00 -0.08 ? 65 ILE A CG2  1 
ATOM 1036 C CD1  . ILE A 1 65 ? 0.916   -2.284  3.158   1.00 -0.08 ? 65 ILE A CD1  1 
ATOM 1037 H H    . ILE A 1 65 ? 3.273   -3.098  6.886   1.00 0.25  ? 65 ILE A H    1 
ATOM 1038 H HA   . ILE A 1 65 ? 1.208   -4.219  5.042   1.00 0.05  ? 65 ILE A HA   1 
ATOM 1039 H HB   . ILE A 1 65 ? 4.021   -3.250  4.385   1.00 0.02  ? 65 ILE A HB   1 
ATOM 1040 H HG12 . ILE A 1 65 ? 2.255   -1.460  4.631   1.00 0.03  ? 65 ILE A HG12 1 
ATOM 1041 H HG13 . ILE A 1 65 ? 2.942   -1.574  3.003   1.00 0.03  ? 65 ILE A HG13 1 
ATOM 1042 H HG21 . ILE A 1 65 ? 3.684   -5.174  3.040   1.00 0.03  ? 65 ILE A HG21 1 
ATOM 1043 H HG22 . ILE A 1 65 ? 3.212   -3.818  1.997   1.00 0.03  ? 65 ILE A HG22 1 
ATOM 1044 H HG23 . ILE A 1 65 ? 1.964   -4.805  2.784   1.00 0.03  ? 65 ILE A HG23 1 
ATOM 1045 H HD11 . ILE A 1 65 ? 0.968   -2.921  2.277   1.00 0.03  ? 65 ILE A HD11 1 
ATOM 1046 H HD12 . ILE A 1 65 ? 0.502   -1.316  2.877   1.00 0.03  ? 65 ILE A HD12 1 
ATOM 1047 H HD13 . ILE A 1 65 ? 0.270   -2.746  3.901   1.00 0.03  ? 65 ILE A HD13 1 
ATOM 1048 N N    . GLU A 1 66 ? 2.253   -6.509  5.033   1.00 -0.46 ? 66 GLU A N    1 
ATOM 1049 C CA   . GLU A 1 66 ? 2.704   -7.882  5.216   1.00 0.03  ? 66 GLU A CA   1 
ATOM 1050 C C    . GLU A 1 66 ? 2.810   -8.553  3.846   1.00 0.62  ? 66 GLU A C    1 
ATOM 1051 O O    . GLU A 1 66 ? 1.804   -8.729  3.165   1.00 -0.50 ? 66 GLU A O    1 
ATOM 1052 C CB   . GLU A 1 66 ? 1.699   -8.625  6.106   1.00 -0.18 ? 66 GLU A CB   1 
ATOM 1053 C CG   . GLU A 1 66 ? 2.310   -9.935  6.615   1.00 -0.40 ? 66 GLU A CG   1 
ATOM 1054 C CD   . GLU A 1 66 ? 2.859   -9.761  8.023   1.00 0.71  ? 66 GLU A CD   1 
ATOM 1055 O OE1  . GLU A 1 66 ? 4.046   -9.382  8.135   1.00 -0.72 ? 66 GLU A OE1  1 
ATOM 1056 O OE2  . GLU A 1 66 ? 2.080   -10.006 8.971   1.00 -0.72 ? 66 GLU A OE2  1 
ATOM 1057 H H    . GLU A 1 66 ? 1.450   -6.353  4.439   1.00 0.25  ? 66 GLU A H    1 
ATOM 1058 H HA   . GLU A 1 66 ? 3.682   -7.884  5.698   1.00 0.05  ? 66 GLU A HA   1 
ATOM 1059 H HB2  . GLU A 1 66 ? 1.433   -7.998  6.956   1.00 0.09  ? 66 GLU A HB2  1 
ATOM 1060 H HB3  . GLU A 1 66 ? 0.801   -8.846  5.531   1.00 0.09  ? 66 GLU A HB3  1 
ATOM 1061 H HG2  . GLU A 1 66 ? 1.541   -10.707 6.626   1.00 0.07  ? 66 GLU A HG2  1 
ATOM 1062 H HG3  . GLU A 1 66 ? 3.116   -10.245 5.949   1.00 0.07  ? 66 GLU A HG3  1 
ATOM 1063 N N    . VAL A 1 67 ? 4.027   -8.926  3.440   1.00 -0.46 ? 67 VAL A N    1 
ATOM 1064 C CA   . VAL A 1 67 ? 4.244   -9.570  2.151   1.00 0.03  ? 67 VAL A CA   1 
ATOM 1065 C C    . VAL A 1 67 ? 3.801   -11.030 2.235   1.00 0.62  ? 67 VAL A C    1 
ATOM 1066 O O    . VAL A 1 67 ? 4.270   -11.768 3.100   1.00 -0.50 ? 67 VAL A O    1 
ATOM 1067 C CB   . VAL A 1 67 ? 5.726   -9.465  1.768   1.00 -0.01 ? 67 VAL A CB   1 
ATOM 1068 C CG1  . VAL A 1 67 ? 5.927   -9.981  0.339   1.00 -0.09 ? 67 VAL A CG1  1 
ATOM 1069 C CG2  . VAL A 1 67 ? 6.176   -8.003  1.847   1.00 -0.09 ? 67 VAL A CG2  1 
ATOM 1070 H H    . VAL A 1 67 ? 4.825   -8.763  4.036   1.00 0.25  ? 67 VAL A H    1 
ATOM 1071 H HA   . VAL A 1 67 ? 3.647   -9.058  1.395   1.00 0.05  ? 67 VAL A HA   1 
ATOM 1072 H HB   . VAL A 1 67 ? 6.324   -10.065 2.456   1.00 0.02  ? 67 VAL A HB   1 
ATOM 1073 H HG11 . VAL A 1 67 ? 5.645   -11.033 0.287   1.00 0.03  ? 67 VAL A HG11 1 
ATOM 1074 H HG12 . VAL A 1 67 ? 6.974   -9.874  0.056   1.00 0.03  ? 67 VAL A HG12 1 
ATOM 1075 H HG13 . VAL A 1 67 ? 5.305   -9.406  -0.348  1.00 0.03  ? 67 VAL A HG13 1 
ATOM 1076 H HG21 . VAL A 1 67 ? 5.476   -7.379  1.296   1.00 0.03  ? 67 VAL A HG21 1 
ATOM 1077 H HG22 . VAL A 1 67 ? 7.171   -7.903  1.415   1.00 0.03  ? 67 VAL A HG22 1 
ATOM 1078 H HG23 . VAL A 1 67 ? 6.202   -7.684  2.889   1.00 0.03  ? 67 VAL A HG23 1 
ATOM 1079 N N    . ILE A 1 68 ? 2.891   -11.444 1.337   1.00 -0.46 ? 68 ILE A N    1 
ATOM 1080 C CA   . ILE A 1 68 ? 2.373   -12.807 1.328   1.00 0.03  ? 68 ILE A CA   1 
ATOM 1081 C C    . ILE A 1 68 ? 2.249   -13.299 -0.114  1.00 0.62  ? 68 ILE A C    1 
ATOM 1082 O O    . ILE A 1 68 ? 1.517   -12.712 -0.909  1.00 -0.50 ? 68 ILE A O    1 
ATOM 1083 C CB   . ILE A 1 68 ? 1.003   -12.847 2.034   1.00 -0.01 ? 68 ILE A CB   1 
ATOM 1084 C CG1  . ILE A 1 68 ? 1.149   -12.359 3.487   1.00 -0.05 ? 68 ILE A CG1  1 
ATOM 1085 C CG2  . ILE A 1 68 ? 0.463   -14.286 2.023   1.00 -0.08 ? 68 ILE A CG2  1 
ATOM 1086 C CD1  . ILE A 1 68 ? -0.200  -12.418 4.208   1.00 -0.08 ? 68 ILE A CD1  1 
ATOM 1087 H H    . ILE A 1 68 ? 2.543   -10.795 0.640   1.00 0.25  ? 68 ILE A H    1 
ATOM 1088 H HA   . ILE A 1 68 ? 3.065   -13.458 1.864   1.00 0.05  ? 68 ILE A HA   1 
ATOM 1089 H HB   . ILE A 1 68 ? 0.307   -12.197 1.504   1.00 0.02  ? 68 ILE A HB   1 
ATOM 1090 H HG12 . ILE A 1 68 ? 1.868   -12.988 4.013   1.00 0.03  ? 68 ILE A HG12 1 
ATOM 1091 H HG13 . ILE A 1 68 ? 1.504   -11.330 3.488   1.00 0.03  ? 68 ILE A HG13 1 
ATOM 1092 H HG21 . ILE A 1 68 ? 0.417   -14.653 0.998   1.00 0.03  ? 68 ILE A HG21 1 
ATOM 1093 H HG22 . ILE A 1 68 ? -0.538  -14.305 2.452   1.00 0.03  ? 68 ILE A HG22 1 
ATOM 1094 H HG23 . ILE A 1 68 ? 1.121   -14.927 2.608   1.00 0.03  ? 68 ILE A HG23 1 
ATOM 1095 H HD11 . ILE A 1 68 ? -0.975  -11.994 3.570   1.00 0.03  ? 68 ILE A HD11 1 
ATOM 1096 H HD12 . ILE A 1 68 ? -0.140  -11.845 5.133   1.00 0.03  ? 68 ILE A HD12 1 
ATOM 1097 H HD13 . ILE A 1 68 ? -0.446  -13.453 4.442   1.00 0.03  ? 68 ILE A HD13 1 
ATOM 1098 N N    . ASP A 1 69 ? 2.967   -14.389 -0.438  1.00 -0.46 ? 69 ASP A N    1 
ATOM 1099 C CA   . ASP A 1 69 ? 2.930   -14.998 -1.767  1.00 0.03  ? 69 ASP A CA   1 
ATOM 1100 C C    . ASP A 1 69 ? 3.199   -13.946 -2.850  1.00 0.62  ? 69 ASP A C    1 
ATOM 1101 O O    . ASP A 1 69 ? 2.509   -13.901 -3.866  1.00 -0.50 ? 69 ASP A O    1 
ATOM 1102 C CB   . ASP A 1 69 ? 1.564   -15.673 -1.968  1.00 -0.40 ? 69 ASP A CB   1 
ATOM 1103 C CG   . ASP A 1 69 ? 1.512   -16.441 -3.285  1.00 0.71  ? 69 ASP A CG   1 
ATOM 1104 O OD1  . ASP A 1 69 ? 2.390   -17.308 -3.472  1.00 -0.72 ? 69 ASP A OD1  1 
ATOM 1105 O OD2  . ASP A 1 69 ? 0.591   -16.143 -4.078  1.00 -0.72 ? 69 ASP A OD2  1 
ATOM 1106 H H    . ASP A 1 69 ? 3.555   -14.818 0.261   1.00 0.25  ? 69 ASP A H    1 
ATOM 1107 H HA   . ASP A 1 69 ? 3.708   -15.759 -1.821  1.00 0.05  ? 69 ASP A HA   1 
ATOM 1108 H HB2  . ASP A 1 69 ? 1.385   -16.368 -1.147  1.00 0.07  ? 69 ASP A HB2  1 
ATOM 1109 H HB3  . ASP A 1 69 ? 0.782   -14.914 -1.968  1.00 0.07  ? 69 ASP A HB3  1 
ATOM 1110 N N    . GLY A 1 70 ? 4.206   -13.092 -2.630  1.00 -0.46 ? 70 GLY A N    1 
ATOM 1111 C CA   . GLY A 1 70 ? 4.558   -12.050 -3.588  1.00 0.03  ? 70 GLY A CA   1 
ATOM 1112 C C    . GLY A 1 70 ? 3.599   -10.861 -3.478  1.00 0.62  ? 70 GLY A C    1 
ATOM 1113 O O    . GLY A 1 70 ? 4.019   -9.714  -3.623  1.00 -0.50 ? 70 GLY A O    1 
ATOM 1114 H H    . GLY A 1 70 ? 4.743   -13.162 -1.779  1.00 0.25  ? 70 GLY A H    1 
ATOM 1115 H HA2  . GLY A 1 70 ? 5.574   -11.710 -3.387  1.00 0.03  ? 70 GLY A HA2  1 
ATOM 1116 H HA3  . GLY A 1 70 ? 4.511   -12.457 -4.598  1.00 0.03  ? 70 GLY A HA3  1 
ATOM 1117 N N    . LYS A 1 71 ? 2.310   -11.136 -3.222  1.00 -0.46 ? 71 LYS A N    1 
ATOM 1118 C CA   . LYS A 1 71 ? 1.307   -10.093 -3.087  1.00 0.03  ? 71 LYS A CA   1 
ATOM 1119 C C    . LYS A 1 71 ? 1.544   -9.333  -1.779  1.00 0.62  ? 71 LYS A C    1 
ATOM 1120 O O    . LYS A 1 71 ? 2.445   -9.683  -1.010  1.00 -0.50 ? 71 LYS A O    1 
ATOM 1121 C CB   . LYS A 1 71 ? -0.102  -10.704 -3.117  1.00 -0.10 ? 71 LYS A CB   1 
ATOM 1122 C CG   . LYS A 1 71 ? -0.180  -11.847 -4.136  1.00 -0.16 ? 71 LYS A CG   1 
ATOM 1123 C CD   . LYS A 1 71 ? -1.649  -12.188 -4.404  1.00 -0.18 ? 71 LYS A CD   1 
ATOM 1124 C CE   . LYS A 1 71 ? -1.745  -13.327 -5.425  1.00 -0.04 ? 71 LYS A CE   1 
ATOM 1125 N NZ   . LYS A 1 71 ? -1.424  -14.631 -4.811  1.00 -0.14 ? 71 LYS A NZ   1 
ATOM 1126 H H    . LYS A 1 71 ? 2.018   -12.094 -3.113  1.00 0.25  ? 71 LYS A H    1 
ATOM 1127 H HA   . LYS A 1 71 ? 1.406   -9.398  -3.922  1.00 0.05  ? 71 LYS A HA   1 
ATOM 1128 H HB2  . LYS A 1 71 ? -0.347  -11.088 -2.137  1.00 0.04  ? 71 LYS A HB2  1 
ATOM 1129 H HB3  . LYS A 1 71 ? -0.819  -9.933  -3.387  1.00 0.04  ? 71 LYS A HB3  1 
ATOM 1130 H HG2  . LYS A 1 71 ? 0.300   -11.541 -5.066  1.00 0.12  ? 71 LYS A HG2  1 
ATOM 1131 H HG3  . LYS A 1 71 ? 0.325   -12.725 -3.738  1.00 0.12  ? 71 LYS A HG3  1 
ATOM 1132 H HD2  . LYS A 1 71 ? -2.127  -12.492 -3.472  1.00 0.12  ? 71 LYS A HD2  1 
ATOM 1133 H HD3  . LYS A 1 71 ? -2.157  -11.307 -4.797  1.00 0.12  ? 71 LYS A HD3  1 
ATOM 1134 H HE2  . LYS A 1 71 ? -2.762  -13.363 -5.820  1.00 0.10  ? 71 LYS A HE2  1 
ATOM 1135 H HE3  . LYS A 1 71 ? -1.052  -13.136 -6.245  1.00 0.10  ? 71 LYS A HE3  1 
ATOM 1136 H HZ1  . LYS A 1 71 ? -2.003  -14.773 -3.997  1.00 0.29  ? 71 LYS A HZ1  1 
ATOM 1137 H HZ2  . LYS A 1 71 ? -1.597  -15.369 -5.478  1.00 0.29  ? 71 LYS A HZ2  1 
ATOM 1138 H HZ3  . LYS A 1 71 ? -0.445  -14.654 -4.536  1.00 0.29  ? 71 LYS A HZ3  1 
ATOM 1139 N N    . TYR A 1 72 ? 0.746   -8.288  -1.530  1.00 -0.46 ? 72 TYR A N    1 
ATOM 1140 C CA   . TYR A 1 72 ? 0.920   -7.448  -0.355  1.00 0.03  ? 72 TYR A CA   1 
ATOM 1141 C C    . TYR A 1 72 ? -0.388  -7.314  0.415   1.00 0.62  ? 72 TYR A C    1 
ATOM 1142 O O    . TYR A 1 72 ? -1.414  -6.943  -0.150  1.00 -0.50 ? 72 TYR A O    1 
ATOM 1143 C CB   . TYR A 1 72 ? 1.440   -6.085  -0.811  1.00 -0.10 ? 72 TYR A CB   1 
ATOM 1144 C CG   . TYR A 1 72 ? 2.709   -6.208  -1.626  1.00 -0.03 ? 72 TYR A CG   1 
ATOM 1145 C CD1  . TYR A 1 72 ? 3.952   -6.267  -0.978  1.00 0.00  ? 72 TYR A CD1  1 
ATOM 1146 C CD2  . TYR A 1 72 ? 2.642   -6.308  -3.028  1.00 0.00  ? 72 TYR A CD2  1 
ATOM 1147 C CE1  . TYR A 1 72 ? 5.129   -6.427  -1.726  1.00 -0.26 ? 72 TYR A CE1  1 
ATOM 1148 C CE2  . TYR A 1 72 ? 3.819   -6.472  -3.776  1.00 -0.26 ? 72 TYR A CE2  1 
ATOM 1149 C CZ   . TYR A 1 72 ? 5.063   -6.535  -3.124  1.00 0.46  ? 72 TYR A CZ   1 
ATOM 1150 O OH   . TYR A 1 72 ? 6.204   -6.709  -3.846  1.00 -0.53 ? 72 TYR A OH   1 
ATOM 1151 H H    . TYR A 1 72 ? 0.004   -8.054  -2.180  1.00 0.25  ? 72 TYR A H    1 
ATOM 1152 H HA   . TYR A 1 72 ? 1.664   -7.901  0.301   1.00 0.05  ? 72 TYR A HA   1 
ATOM 1153 H HB2  . TYR A 1 72 ? 0.675   -5.598  -1.417  1.00 0.04  ? 72 TYR A HB2  1 
ATOM 1154 H HB3  . TYR A 1 72 ? 1.640   -5.469  0.067   1.00 0.04  ? 72 TYR A HB3  1 
ATOM 1155 H HD1  . TYR A 1 72 ? 4.001   -6.198  0.098   1.00 0.06  ? 72 TYR A HD1  1 
ATOM 1156 H HD2  . TYR A 1 72 ? 1.685   -6.272  -3.528  1.00 0.06  ? 72 TYR A HD2  1 
ATOM 1157 H HE1  . TYR A 1 72 ? 6.084   -6.478  -1.225  1.00 0.10  ? 72 TYR A HE1  1 
ATOM 1158 H HE2  . TYR A 1 72 ? 3.768   -6.558  -4.851  1.00 0.10  ? 72 TYR A HE2  1 
ATOM 1159 H HH   . TYR A 1 72 ? 6.037   -6.971  -4.752  1.00 0.33  ? 72 TYR A HH   1 
ATOM 1160 N N    . ALA A 1 73 ? -0.330  -7.619  1.717   1.00 -0.46 ? 73 ALA A N    1 
ATOM 1161 C CA   . ALA A 1 73 ? -1.473  -7.526  2.610   1.00 0.03  ? 73 ALA A CA   1 
ATOM 1162 C C    . ALA A 1 73 ? -1.235  -6.401  3.609   1.00 0.62  ? 73 ALA A C    1 
ATOM 1163 O O    . ALA A 1 73 ? -0.158  -5.811  3.636   1.00 -0.50 ? 73 ALA A O    1 
ATOM 1164 C CB   . ALA A 1 73 ? -1.645  -8.858  3.344   1.00 -0.10 ? 73 ALA A CB   1 
ATOM 1165 H H    . ALA A 1 73 ? 0.548   -7.925  2.111   1.00 0.25  ? 73 ALA A H    1 
ATOM 1166 H HA   . ALA A 1 73 ? -2.374  -7.311  2.037   1.00 0.05  ? 73 ALA A HA   1 
ATOM 1167 H HB1  . ALA A 1 73 ? -1.798  -9.656  2.624   1.00 0.04  ? 73 ALA A HB1  1 
ATOM 1168 H HB2  . ALA A 1 73 ? -2.508  -8.801  4.008   1.00 0.04  ? 73 ALA A HB2  1 
ATOM 1169 H HB3  . ALA A 1 73 ? -0.750  -9.068  3.929   1.00 0.04  ? 73 ALA A HB3  1 
ATOM 1170 N N    . PHE A 1 74 ? -2.243  -6.112  4.433   1.00 -0.46 ? 74 PHE A N    1 
ATOM 1171 C CA   . PHE A 1 74 ? -2.144  -5.076  5.446   1.00 0.03  ? 74 PHE A CA   1 
ATOM 1172 C C    . PHE A 1 74 ? -1.882  -5.725  6.798   1.00 0.62  ? 74 PHE A C    1 
ATOM 1173 O O    . PHE A 1 74 ? -2.625  -6.613  7.212   1.00 -0.50 ? 74 PHE A O    1 
ATOM 1174 C CB   . PHE A 1 74 ? -3.441  -4.274  5.464   1.00 -0.10 ? 74 PHE A CB   1 
ATOM 1175 C CG   . PHE A 1 74 ? -3.545  -3.292  6.611   1.00 -0.10 ? 74 PHE A CG   1 
ATOM 1176 C CD1  . PHE A 1 74 ? -4.115  -3.696  7.827   1.00 -0.15 ? 74 PHE A CD1  1 
ATOM 1177 C CD2  . PHE A 1 74 ? -3.095  -1.970  6.455   1.00 -0.15 ? 74 PHE A CD2  1 
ATOM 1178 C CE1  . PHE A 1 74 ? -4.272  -2.780  8.874   1.00 -0.15 ? 74 PHE A CE1  1 
ATOM 1179 C CE2  . PHE A 1 74 ? -3.237  -1.054  7.510   1.00 -0.15 ? 74 PHE A CE2  1 
ATOM 1180 C CZ   . PHE A 1 74 ? -3.844  -1.457  8.715   1.00 -0.15 ? 74 PHE A CZ   1 
ATOM 1181 H H    . PHE A 1 74 ? -3.108  -6.628  4.362   1.00 0.25  ? 74 PHE A H    1 
ATOM 1182 H HA   . PHE A 1 74 ? -1.319  -4.407  5.203   1.00 0.05  ? 74 PHE A HA   1 
ATOM 1183 H HB2  . PHE A 1 74 ? -3.516  -3.726  4.533   1.00 0.11  ? 74 PHE A HB2  1 
ATOM 1184 H HB3  . PHE A 1 74 ? -4.280  -4.966  5.522   1.00 0.11  ? 74 PHE A HB3  1 
ATOM 1185 H HD1  . PHE A 1 74 ? -4.443  -4.710  7.953   1.00 0.15  ? 74 PHE A HD1  1 
ATOM 1186 H HD2  . PHE A 1 74 ? -2.649  -1.656  5.522   1.00 0.15  ? 74 PHE A HD2  1 
ATOM 1187 H HE1  . PHE A 1 74 ? -4.730  -3.092  9.800   1.00 0.15  ? 74 PHE A HE1  1 
ATOM 1188 H HE2  . PHE A 1 74 ? -2.896  -0.037  7.388   1.00 0.15  ? 74 PHE A HE2  1 
ATOM 1189 H HZ   . PHE A 1 74 ? -3.986  -0.749  9.515   1.00 0.15  ? 74 PHE A HZ   1 
ATOM 1190 N N    . LYS A 1 75 ? -0.824  -5.278  7.479   1.00 -0.46 ? 75 LYS A N    1 
ATOM 1191 C CA   . LYS A 1 75 ? -0.457  -5.812  8.778   1.00 0.03  ? 75 LYS A CA   1 
ATOM 1192 C C    . LYS A 1 75 ? -1.168  -5.006  9.873   1.00 0.62  ? 75 LYS A C    1 
ATOM 1193 O O    . LYS A 1 75 ? -0.943  -3.799  9.983   1.00 -0.50 ? 75 LYS A O    1 
ATOM 1194 C CB   . LYS A 1 75 ? 1.065   -5.722  8.939   1.00 -0.10 ? 75 LYS A CB   1 
ATOM 1195 C CG   . LYS A 1 75 ? 1.528   -6.638  10.076  1.00 -0.16 ? 75 LYS A CG   1 
ATOM 1196 C CD   . LYS A 1 75 ? 3.040   -6.484  10.268  1.00 -0.18 ? 75 LYS A CD   1 
ATOM 1197 C CE   . LYS A 1 75 ? 3.544   -7.483  11.316  1.00 -0.04 ? 75 LYS A CE   1 
ATOM 1198 N NZ   . LYS A 1 75 ? 3.654   -8.840  10.753  1.00 -0.14 ? 75 LYS A NZ   1 
ATOM 1199 H H    . LYS A 1 75 ? -0.253  -4.541  7.086   1.00 0.25  ? 75 LYS A H    1 
ATOM 1200 H HA   . LYS A 1 75 ? -0.753  -6.856  8.831   1.00 0.05  ? 75 LYS A HA   1 
ATOM 1201 H HB2  . LYS A 1 75 ? 1.545   -6.029  8.012   1.00 0.04  ? 75 LYS A HB2  1 
ATOM 1202 H HB3  . LYS A 1 75 ? 1.345   -4.694  9.163   1.00 0.04  ? 75 LYS A HB3  1 
ATOM 1203 H HG2  . LYS A 1 75 ? 1.015   -6.364  10.998  1.00 0.12  ? 75 LYS A HG2  1 
ATOM 1204 H HG3  . LYS A 1 75 ? 1.295   -7.673  9.824   1.00 0.12  ? 75 LYS A HG3  1 
ATOM 1205 H HD2  . LYS A 1 75 ? 3.550   -6.663  9.319   1.00 0.12  ? 75 LYS A HD2  1 
ATOM 1206 H HD3  . LYS A 1 75 ? 3.257   -5.472  10.607  1.00 0.12  ? 75 LYS A HD3  1 
ATOM 1207 H HE2  . LYS A 1 75 ? 4.527   -7.165  11.666  1.00 0.10  ? 75 LYS A HE2  1 
ATOM 1208 H HE3  . LYS A 1 75 ? 2.853   -7.499  12.160  1.00 0.10  ? 75 LYS A HE3  1 
ATOM 1209 H HZ1  . LYS A 1 75 ? 4.255   -8.823  9.934   1.00 0.29  ? 75 LYS A HZ1  1 
ATOM 1210 H HZ2  . LYS A 1 75 ? 4.044   -9.464  11.443  1.00 0.29  ? 75 LYS A HZ2  1 
ATOM 1211 H HZ3  . LYS A 1 75 ? 2.735   -9.173  10.478  1.00 0.29  ? 75 LYS A HZ3  1 
ATOM 1212 N N    . PRO A 1 76 ? -2.027  -5.651  10.692  1.00 -0.23 ? 76 PRO A N    1 
ATOM 1213 C CA   . PRO A 1 76 ? -2.729  -4.969  11.757  1.00 0.03  ? 76 PRO A CA   1 
ATOM 1214 C C    . PRO A 1 76 ? -1.731  -4.464  12.800  1.00 0.53  ? 76 PRO A C    1 
ATOM 1215 O O    . PRO A 1 76 ? -0.682  -5.075  13.001  1.00 -0.50 ? 76 PRO A O    1 
ATOM 1216 C CB   . PRO A 1 76 ? -3.692  -5.998  12.353  1.00 -0.11 ? 76 PRO A CB   1 
ATOM 1217 C CG   . PRO A 1 76 ? -3.367  -7.344  11.695  1.00 -0.12 ? 76 PRO A CG   1 
ATOM 1218 C CD   . PRO A 1 76 ? -2.335  -7.065  10.602  1.00 -0.01 ? 76 PRO A CD   1 
ATOM 1219 H HA   . PRO A 1 76 ? -3.295  -4.134  11.346  1.00 0.05  ? 76 PRO A HA   1 
ATOM 1220 H HB2  . PRO A 1 76 ? -3.552  -6.064  13.433  1.00 0.06  ? 76 PRO A HB2  1 
ATOM 1221 H HB3  . PRO A 1 76 ? -4.721  -5.714  12.129  1.00 0.06  ? 76 PRO A HB3  1 
ATOM 1222 H HG2  . PRO A 1 76 ? -2.949  -8.029  12.435  1.00 0.06  ? 76 PRO A HG2  1 
ATOM 1223 H HG3  . PRO A 1 76 ? -4.268  -7.774  11.258  1.00 0.06  ? 76 PRO A HG3  1 
ATOM 1224 H HD2  . PRO A 1 76 ? -1.436  -7.658  10.777  1.00 0.06  ? 76 PRO A HD2  1 
ATOM 1225 H HD3  . PRO A 1 76 ? -2.757  -7.298  9.625   1.00 0.06  ? 76 PRO A HD3  1 
ATOM 1226 N N    . LYS A 1 77 ? -2.056  -3.345  13.461  1.00 -0.46 ? 77 LYS A N    1 
ATOM 1227 C CA   . LYS A 1 77 ? -1.181  -2.766  14.471  1.00 0.03  ? 77 LYS A CA   1 
ATOM 1228 C C    . LYS A 1 77 ? -1.066  -3.715  15.663  1.00 0.62  ? 77 LYS A C    1 
ATOM 1229 O O    . LYS A 1 77 ? 0.016   -4.217  15.958  1.00 -0.50 ? 77 LYS A O    1 
ATOM 1230 C CB   . LYS A 1 77 ? -1.742  -1.404  14.910  1.00 -0.10 ? 77 LYS A CB   1 
ATOM 1231 C CG   . LYS A 1 77 ? -0.776  -0.734  15.896  1.00 -0.16 ? 77 LYS A CG   1 
ATOM 1232 C CD   . LYS A 1 77 ? -1.385  0.577   16.401  1.00 -0.18 ? 77 LYS A CD   1 
ATOM 1233 C CE   . LYS A 1 77 ? -0.454  1.207   17.442  1.00 -0.04 ? 77 LYS A CE   1 
ATOM 1234 N NZ   . LYS A 1 77 ? -1.035  2.443   17.999  1.00 -0.14 ? 77 LYS A NZ   1 
ATOM 1235 H H    . LYS A 1 77 ? -2.930  -2.882  13.260  1.00 0.25  ? 77 LYS A H    1 
ATOM 1236 H HA   . LYS A 1 77 ? -0.191  -2.618  14.038  1.00 0.05  ? 77 LYS A HA   1 
ATOM 1237 H HB2  . LYS A 1 77 ? -1.865  -0.765  14.036  1.00 0.04  ? 77 LYS A HB2  1 
ATOM 1238 H HB3  . LYS A 1 77 ? -2.710  -1.547  15.392  1.00 0.04  ? 77 LYS A HB3  1 
ATOM 1239 H HG2  . LYS A 1 77 ? -0.599  -1.398  16.742  1.00 0.12  ? 77 LYS A HG2  1 
ATOM 1240 H HG3  . LYS A 1 77 ? 0.170   -0.527  15.394  1.00 0.12  ? 77 LYS A HG3  1 
ATOM 1241 H HD2  . LYS A 1 77 ? -1.515  1.264   15.564  1.00 0.12  ? 77 LYS A HD2  1 
ATOM 1242 H HD3  . LYS A 1 77 ? -2.355  0.374   16.858  1.00 0.12  ? 77 LYS A HD3  1 
ATOM 1243 H HE2  . LYS A 1 77 ? -0.288  0.495   18.251  1.00 0.10  ? 77 LYS A HE2  1 
ATOM 1244 H HE3  . LYS A 1 77 ? 0.503   1.442   16.972  1.00 0.10  ? 77 LYS A HE3  1 
ATOM 1245 H HZ1  . LYS A 1 77 ? -1.918  2.232   18.442  1.00 0.29  ? 77 LYS A HZ1  1 
ATOM 1246 H HZ2  . LYS A 1 77 ? -0.402  2.835   18.683  1.00 0.29  ? 77 LYS A HZ2  1 
ATOM 1247 H HZ3  . LYS A 1 77 ? -1.182  3.112   17.256  1.00 0.29  ? 77 LYS A HZ3  1 
ATOM 1248 N N    . TYR A 1 78 ? -2.190  -3.948  16.348  1.00 -0.46 ? 78 TYR A N    1 
ATOM 1249 C CA   . TYR A 1 78 ? -2.227  -4.813  17.521  1.00 0.03  ? 78 TYR A CA   1 
ATOM 1250 C C    . TYR A 1 78 ? -3.645  -5.408  17.692  1.00 0.62  ? 78 TYR A C    1 
ATOM 1251 O O    . TYR A 1 78 ? -3.954  -5.991  18.727  1.00 -0.50 ? 78 TYR A O    1 
ATOM 1252 C CB   . TYR A 1 78 ? -1.763  -3.970  18.739  1.00 -0.10 ? 78 TYR A CB   1 
ATOM 1253 C CG   . TYR A 1 78 ? -2.569  -4.157  20.008  1.00 -0.03 ? 78 TYR A CG   1 
ATOM 1254 C CD1  . TYR A 1 78 ? -3.718  -3.377  20.228  1.00 0.00  ? 78 TYR A CD1  1 
ATOM 1255 C CD2  . TYR A 1 78 ? -2.170  -5.106  20.967  1.00 0.00  ? 78 TYR A CD2  1 
ATOM 1256 C CE1  . TYR A 1 78 ? -4.467  -3.546  21.402  1.00 -0.26 ? 78 TYR A CE1  1 
ATOM 1257 C CE2  . TYR A 1 78 ? -2.921  -5.274  22.142  1.00 -0.26 ? 78 TYR A CE2  1 
ATOM 1258 C CZ   . TYR A 1 78 ? -4.071  -4.495  22.359  1.00 0.46  ? 78 TYR A CZ   1 
ATOM 1259 O OH   . TYR A 1 78 ? -4.800  -4.659  23.500  1.00 -0.53 ? 78 TYR A OH   1 
ATOM 1260 H H    . TYR A 1 78 ? -3.046  -3.505  16.055  1.00 0.25  ? 78 TYR A H    1 
ATOM 1261 H HA   . TYR A 1 78 ? -1.524  -5.634  17.376  1.00 0.05  ? 78 TYR A HA   1 
ATOM 1262 H HB2  . TYR A 1 78 ? -0.724  -4.222  18.951  1.00 0.04  ? 78 TYR A HB2  1 
ATOM 1263 H HB3  . TYR A 1 78 ? -1.808  -2.916  18.464  1.00 0.04  ? 78 TYR A HB3  1 
ATOM 1264 H HD1  . TYR A 1 78 ? -4.025  -2.648  19.493  1.00 0.06  ? 78 TYR A HD1  1 
ATOM 1265 H HD2  . TYR A 1 78 ? -1.287  -5.705  20.799  1.00 0.06  ? 78 TYR A HD2  1 
ATOM 1266 H HE1  . TYR A 1 78 ? -5.350  -2.947  21.568  1.00 0.10  ? 78 TYR A HE1  1 
ATOM 1267 H HE2  . TYR A 1 78 ? -2.614  -6.002  22.877  1.00 0.10  ? 78 TYR A HE2  1 
ATOM 1268 H HH   . TYR A 1 78 ? -4.456  -5.350  24.070  1.00 0.33  ? 78 TYR A HH   1 
ATOM 1269 N N    . ASN A 1 79 ? -4.498  -5.260  16.655  1.00 -0.46 ? 79 ASN A N    1 
ATOM 1270 C CA   . ASN A 1 79 ? -5.882  -5.737  16.676  1.00 0.03  ? 79 ASN A CA   1 
ATOM 1271 C C    . ASN A 1 79 ? -6.751  -4.722  17.422  1.00 0.62  ? 79 ASN A C    1 
ATOM 1272 O O    . ASN A 1 79 ? -6.332  -4.173  18.440  1.00 -0.50 ? 79 ASN A O    1 
ATOM 1273 C CB   . ASN A 1 79 ? -5.975  -7.132  17.323  1.00 -0.09 ? 79 ASN A CB   1 
ATOM 1274 C CG   . ASN A 1 79 ? -7.188  -7.902  16.807  1.00 0.68  ? 79 ASN A CG   1 
ATOM 1275 O OD1  . ASN A 1 79 ? -8.256  -7.330  16.609  1.00 -0.47 ? 79 ASN A OD1  1 
ATOM 1276 N ND2  . ASN A 1 79 ? -7.021  -9.207  16.588  1.00 -0.87 ? 79 ASN A ND2  1 
ATOM 1277 H H    . ASN A 1 79 ? -4.181  -4.796  15.821  1.00 0.25  ? 79 ASN A H    1 
ATOM 1278 H HA   . ASN A 1 79 ? -6.235  -5.808  15.646  1.00 0.05  ? 79 ASN A HA   1 
ATOM 1279 H HB2  . ASN A 1 79 ? -5.071  -7.696  17.088  1.00 0.04  ? 79 ASN A HB2  1 
ATOM 1280 H HB3  . ASN A 1 79 ? -6.060  -7.025  18.404  1.00 0.04  ? 79 ASN A HB3  1 
ATOM 1281 H HD21 . ASN A 1 79 ? -6.131  -9.641  16.786  1.00 0.34  ? 79 ASN A HD21 1 
ATOM 1282 H HD22 . ASN A 1 79 ? -7.783  -9.757  16.224  1.00 0.34  ? 79 ASN A HD22 1 
ATOM 1283 N N    . VAL A 1 80 ? -7.959  -4.468  16.907  1.00 -0.46 ? 80 VAL A N    1 
ATOM 1284 C CA   . VAL A 1 80 ? -8.873  -3.511  17.513  1.00 0.03  ? 80 VAL A CA   1 
ATOM 1285 C C    . VAL A 1 80 ? -9.528  -4.151  18.737  1.00 0.62  ? 80 VAL A C    1 
ATOM 1286 O O    . VAL A 1 80 ? -10.647 -4.659  18.655  1.00 -0.50 ? 80 VAL A O    1 
ATOM 1287 C CB   . VAL A 1 80 ? -9.923  -3.074  16.476  1.00 -0.01 ? 80 VAL A CB   1 
ATOM 1288 C CG1  . VAL A 1 80 ? -10.791 -1.953  17.057  1.00 -0.09 ? 80 VAL A CG1  1 
ATOM 1289 C CG2  . VAL A 1 80 ? -9.222  -2.561  15.213  1.00 -0.09 ? 80 VAL A CG2  1 
ATOM 1290 H H    . VAL A 1 80 ? -8.256  -4.950  16.072  1.00 0.25  ? 80 VAL A H    1 
ATOM 1291 H HA   . VAL A 1 80 ? -8.308  -2.634  17.832  1.00 0.05  ? 80 VAL A HA   1 
ATOM 1292 H HB   . VAL A 1 80 ? -10.555 -3.924  16.216  1.00 0.02  ? 80 VAL A HB   1 
ATOM 1293 H HG11 . VAL A 1 80 ? -11.334 -2.321  17.927  1.00 0.03  ? 80 VAL A HG11 1 
ATOM 1294 H HG12 . VAL A 1 80 ? -11.504 -1.618  16.304  1.00 0.03  ? 80 VAL A HG12 1 
ATOM 1295 H HG13 . VAL A 1 80 ? -10.157 -1.117  17.353  1.00 0.03  ? 80 VAL A HG13 1 
ATOM 1296 H HG21 . VAL A 1 80 ? -8.500  -1.790  15.484  1.00 0.03  ? 80 VAL A HG21 1 
ATOM 1297 H HG22 . VAL A 1 80 ? -9.962  -2.141  14.532  1.00 0.03  ? 80 VAL A HG22 1 
ATOM 1298 H HG23 . VAL A 1 80 ? -8.705  -3.384  14.720  1.00 0.03  ? 80 VAL A HG23 1 
ATOM 1299 N N    . ARG A 1 81 ? -8.817  -4.128  19.872  1.00 -0.46 ? 81 ARG A N    1 
ATOM 1300 C CA   . ARG A 1 81 ? -9.303  -4.707  21.116  1.00 0.03  ? 81 ARG A CA   1 
ATOM 1301 C C    . ARG A 1 81 ? -8.877  -3.825  22.286  1.00 0.52  ? 81 ARG A C    1 
ATOM 1302 O O    . ARG A 1 81 ? -7.943  -3.018  22.079  1.00 -0.71 ? 81 ARG A O    1 
ATOM 1303 C CB   . ARG A 1 81 ? -8.735  -6.124  21.276  1.00 -0.08 ? 81 ARG A CB   1 
ATOM 1304 C CG   . ARG A 1 81 ? -9.198  -7.006  20.113  1.00 -0.10 ? 81 ARG A CG   1 
ATOM 1305 C CD   . ARG A 1 81 ? -8.768  -8.452  20.354  1.00 -0.23 ? 81 ARG A CD   1 
ATOM 1306 N NE   . ARG A 1 81 ? -9.166  -9.303  19.226  1.00 -0.32 ? 81 ARG A NE   1 
ATOM 1307 C CZ   . ARG A 1 81 ? -8.957  -10.629 19.197  1.00 0.76  ? 81 ARG A CZ   1 
ATOM 1308 N NH1  . ARG A 1 81 ? -8.319  -11.233 20.209  1.00 -0.62 ? 81 ARG A NH1  1 
ATOM 1309 N NH2  . ARG A 1 81 ? -9.388  -11.349 18.153  1.00 -0.62 ? 81 ARG A NH2  1 
ATOM 1310 O OXT  . ARG A 1 81 ? -9.414  -4.055  23.391  1.00 -0.71 ? 81 ARG A OXT  1 
ATOM 1311 H H    . ARG A 1 81 ? -7.902  -3.695  19.877  1.00 0.25  ? 81 ARG A H    1 
ATOM 1312 H HA   . ARG A 1 81 ? -10.392 -4.759  21.091  1.00 0.05  ? 81 ARG A HA   1 
ATOM 1313 H HB2  . ARG A 1 81 ? -7.645  -6.079  21.287  1.00 0.06  ? 81 ARG A HB2  1 
ATOM 1314 H HB3  . ARG A 1 81 ? -9.088  -6.549  22.216  1.00 0.06  ? 81 ARG A HB3  1 
ATOM 1315 H HG2  . ARG A 1 81 ? -10.285 -6.961  20.032  1.00 0.07  ? 81 ARG A HG2  1 
ATOM 1316 H HG3  . ARG A 1 81 ? -8.751  -6.649  19.185  1.00 0.07  ? 81 ARG A HG3  1 
ATOM 1317 H HD2  . ARG A 1 81 ? -7.684  -8.489  20.468  1.00 0.13  ? 81 ARG A HD2  1 
ATOM 1318 H HD3  . ARG A 1 81 ? -9.239  -8.819  21.267  1.00 0.13  ? 81 ARG A HD3  1 
ATOM 1319 H HE   . ARG A 1 81 ? -9.619  -8.856  18.440  1.00 0.27  ? 81 ARG A HE   1 
ATOM 1320 H HH11 . ARG A 1 81 ? -7.992  -10.690 20.995  1.00 0.36  ? 81 ARG A HH11 1 
ATOM 1321 H HH12 . ARG A 1 81 ? -8.165  -12.231 20.188  1.00 0.36  ? 81 ARG A HH12 1 
ATOM 1322 H HH21 . ARG A 1 81 ? -9.883  -10.897 17.397  1.00 0.36  ? 81 ARG A HH21 1 
ATOM 1323 H HH22 . ARG A 1 81 ? -9.220  -12.344 18.119  1.00 0.36  ? 81 ARG A HH22 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  LEU 2  2  2  LEU LEU A . n 
A 1 3  SER 3  3  3  SER SER A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  SER 6  6  6  SER SER A . n 
A 1 7  GLY 7  7  7  GLY GLY A . n 
A 1 8  TYR 8  8  8  TYR TYR A . n 
A 1 9  LYS 9  9  9  LYS LYS A . n 
A 1 10 PHE 10 10 10 PHE PHE A . n 
A 1 11 GLY 11 11 11 GLY GLY A . n 
A 1 12 VAL 12 12 12 VAL VAL A . n 
A 1 13 LEU 13 13 13 LEU LEU A . n 
A 1 14 ALA 14 14 14 ALA ALA A . n 
A 1 15 LYS 15 15 15 LYS LYS A . n 
A 1 16 ILE 16 16 16 ILE ILE A . n 
A 1 17 VAL 17 17 17 VAL VAL A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 MET 20 20 20 MET MET A . n 
A 1 21 LYS 21 21 21 LYS LYS A . n 
A 1 22 THR 22 22 22 THR THR A . n 
A 1 23 ARG 23 23 23 ARG ARG A . n 
A 1 24 HIS 24 24 24 HIS HIS A . n 
A 1 25 GLN 25 25 25 GLN GLN A . n 
A 1 26 ARG 26 26 26 ARG ARG A . n 
A 1 27 GLY 27 27 27 GLY GLY A . n 
A 1 28 ASP 28 28 28 ASP ASP A . n 
A 1 29 THR 29 29 29 THR THR A . n 
A 1 30 HIS 30 30 30 HIS HIS A . n 
A 1 31 PRO 31 31 31 PRO PRO A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 THR 33 33 33 THR THR A . n 
A 1 34 LEU 34 34 34 LEU LEU A . n 
A 1 35 ASP 35 35 35 ASP ASP A . n 
A 1 36 GLU 36 36 36 GLU GLU A . n 
A 1 37 ILE 37 37 37 ILE ILE A . n 
A 1 38 LEU 38 38 38 LEU LEU A . n 
A 1 39 ASP 39 39 39 ASP ASP A . n 
A 1 40 GLU 40 40 40 GLU GLU A . n 
A 1 41 THR 41 41 41 THR THR A . n 
A 1 42 GLN 42 42 42 GLN GLN A . n 
A 1 43 HIS 43 43 43 HIS HIS A . n 
A 1 44 LEU 44 44 44 LEU LEU A . n 
A 1 45 ASP 45 45 45 ASP ASP A . n 
A 1 46 ILE 46 46 46 ILE ILE A . n 
A 1 47 GLY 47 47 47 GLY GLY A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 LYS 49 49 49 LYS LYS A . n 
A 1 50 GLN 50 50 50 GLN GLN A . n 
A 1 51 LYS 51 51 51 LYS LYS A . n 
A 1 52 GLN 52 52 52 GLN GLN A . n 
A 1 53 TRP 53 53 53 TRP TRP A . n 
A 1 54 LEU 54 54 54 LEU LEU A . n 
A 1 55 MET 55 55 55 MET MET A . n 
A 1 56 THR 56 56 56 THR THR A . n 
A 1 57 GLU 57 57 57 GLU GLU A . n 
A 1 58 ALA 58 58 58 ALA ALA A . n 
A 1 59 LEU 59 59 59 LEU LEU A . n 
A 1 60 VAL 60 60 60 VAL VAL A . n 
A 1 61 ASN 61 61 61 ASN ASN A . n 
A 1 62 ASN 62 62 62 ASN ASN A . n 
A 1 63 PRO 63 63 63 PRO PRO A . n 
A 1 64 LYS 64 64 64 LYS LYS A . n 
A 1 65 ILE 65 65 65 ILE ILE A . n 
A 1 66 GLU 66 66 66 GLU GLU A . n 
A 1 67 VAL 67 67 67 VAL VAL A . n 
A 1 68 ILE 68 68 68 ILE ILE A . n 
A 1 69 ASP 69 69 69 ASP ASP A . n 
A 1 70 GLY 70 70 70 GLY GLY A . n 
A 1 71 LYS 71 71 71 LYS LYS A . n 
A 1 72 TYR 72 72 72 TYR TYR A . n 
A 1 73 ALA 73 73 73 ALA ALA A . n 
A 1 74 PHE 74 74 74 PHE PHE A . n 
A 1 75 LYS 75 75 75 LYS LYS A . n 
A 1 76 PRO 76 76 76 PRO PRO A . n 
A 1 77 LYS 77 77 77 LYS LYS A . n 
A 1 78 TYR 78 78 78 TYR TYR A . n 
A 1 79 ASN 79 79 79 ASN ASN A . n 
A 1 80 VAL 80 80 80 VAL VAL A . n 
A 1 81 ARG 81 81 81 ARG ARG A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'RIKEN Structural Genomics/Proteomics Initiative' 
_pdbx_SG_project.initial_of_center     RSGI 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-04-26 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 9  ? ? -177.59 -55.72 
2 1 ILE A 46 ? ? 45.97   -71.50 
3 1 GLU A 57 ? ? -112.21 -73.33 
4 1 LEU A 59 ? ? -77.94  31.25  
5 1 VAL A 60 ? ? -133.26 -37.21 
6 1 TYR A 78 ? ? -153.77 12.07  
7 1 ASN A 79 ? ? 81.01   139.23 
#