data_1DDX
# 
_entry.id   1DDX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DDX         
RCSB  RCSB010002   
WWPDB D_1000010002 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1CVU 'STRUCTURE OF ARACHIDONIC ACID BOUND TO COX-2'  unspecified 
PDB 1DCX 'MODEL OF ARACHIDONIC ACID BOUND TO COX-2'      unspecified 
PDB 1DD0 'MODEL OF PROSTAGLANDIN G2 BOUND TO COX-2'      unspecified 
PDB 6COX 'COX-2 COMPLEXED TO SELECTIVE INHIBITOR SC-558' unspecified 
PDB 5COX 'COX-2 STRUCTURE WITHOUT INHIBITORS BOUND'      unspecified 
PDB 1CQE 'COX-1 STRUCTURE'                               unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DDX 
_pdbx_database_status.recvd_initial_deposition_date   1999-11-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kiefer, J.R.'    1  
'Pawlitz, J.L.'   2  
'Moreland, K.T.'  3  
'Stegeman, R.A.'  4  
'Gierse, J.K.'    5  
'Stevens, A.M.'   6  
'Goodwin, D.C.'   7  
'Rowlinson, S.W.' 8  
'Marnett, L.J.'   9  
'Stallings, W.C.' 10 
'Kurumbail, R.G.' 11 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural insights into the stereochemistry of the cyclooxygenase reaction.'               Nature 405 97  101 2000 
NATUAS UK 0028-0836 0006 ? 10811226 10.1038/35011103 
1       'Structural Basis for Selective Inhibition of Cyclooxygenase-2 by Anti- Inflammatory Agents' Nature 384 644 648 1996 
NATUAS UK 0028-0836 0006 ? ?        10.1038/384644a0 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kiefer, J.R.'    1  ? 
primary 'Pawlitz, J.L.'   2  ? 
primary 'Moreland, K.T.'  3  ? 
primary 'Stegeman, R.A.'  4  ? 
primary 'Hood, W.F.'      5  ? 
primary 'Gierse, J.K.'    6  ? 
primary 'Stevens, A.M.'   7  ? 
primary 'Goodwin, D.C.'   8  ? 
primary 'Rowlinson, S.W.' 9  ? 
primary 'Marnett, L.J.'   10 ? 
primary 'Stallings, W.C.' 11 ? 
primary 'Kurumbail, R.G.' 12 ? 
1       'Kurumbail, R.G.' 13 ? 
1       'Stevens, A.M.'   14 ? 
1       'Gierse, J.K.'    15 ? 
1       'McDonald, J.J.'  16 ? 
1       'Stegeman, R.A.'  17 ? 
1       'Pak, J.Y.'       18 ? 
1       'Gildehaus, D.'   19 ? 
1       'Miyashiro, J.M.' 20 ? 
1       'Penning, T.D.'   21 ? 
1       'Seibert, K.'     22 ? 
1       'Isakson, P.C.'   23 ? 
1       'Stallings, W.C.' 24 ? 
# 
_cell.entry_id           1DDX 
_cell.length_a           180.240 
_cell.length_b           134.800 
_cell.length_c           122.510 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DDX 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'PROTEIN (PROSTAGLANDIN H2 SYNTHASE-2)'                                                   63497.422 4   
1.14.99.1 ? ? ? 
2 branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   4   ? ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                                                  221.208   8   ? ? ? ? 
4 non-polymer syn 'octyl beta-D-glucopyranoside'                                                            292.369   4   ? ? ? ? 
5 non-polymer syn '7-[6-(3-HYDROPEROXY-OCT-1-ENYL)-2,3-DIOXA-BICYCLO[2.2.1]HEPT-5-YL]-HEPT-5-ENOIC ACID'    368.464   4   ? ? ? ? 
6 water       nat water                                                                                     18.015    173 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        COX-2 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSL
IMKYVLTSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDP
QGSNMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQV
EMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQH
LSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIA
GRVAGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKALYSDIDVMELYPALLVEK
PRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQSLICNNVKGCPFTSFNVQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASN n 
1 3   PRO n 
1 4   CYS n 
1 5   CYS n 
1 6   SER n 
1 7   ASN n 
1 8   PRO n 
1 9   CYS n 
1 10  GLN n 
1 11  ASN n 
1 12  ARG n 
1 13  GLY n 
1 14  GLU n 
1 15  CYS n 
1 16  MET n 
1 17  SER n 
1 18  THR n 
1 19  GLY n 
1 20  PHE n 
1 21  ASP n 
1 22  GLN n 
1 23  TYR n 
1 24  LYS n 
1 25  CYS n 
1 26  ASP n 
1 27  CYS n 
1 28  THR n 
1 29  ARG n 
1 30  THR n 
1 31  GLY n 
1 32  PHE n 
1 33  TYR n 
1 34  GLY n 
1 35  GLU n 
1 36  ASN n 
1 37  CYS n 
1 38  THR n 
1 39  THR n 
1 40  PRO n 
1 41  GLU n 
1 42  PHE n 
1 43  LEU n 
1 44  THR n 
1 45  ARG n 
1 46  ILE n 
1 47  LYS n 
1 48  LEU n 
1 49  LEU n 
1 50  LEU n 
1 51  LYS n 
1 52  PRO n 
1 53  THR n 
1 54  PRO n 
1 55  ASN n 
1 56  THR n 
1 57  VAL n 
1 58  HIS n 
1 59  TYR n 
1 60  ILE n 
1 61  LEU n 
1 62  THR n 
1 63  HIS n 
1 64  PHE n 
1 65  LYS n 
1 66  GLY n 
1 67  VAL n 
1 68  TRP n 
1 69  ASN n 
1 70  ILE n 
1 71  VAL n 
1 72  ASN n 
1 73  ASN n 
1 74  ILE n 
1 75  PRO n 
1 76  PHE n 
1 77  LEU n 
1 78  ARG n 
1 79  SER n 
1 80  LEU n 
1 81  ILE n 
1 82  MET n 
1 83  LYS n 
1 84  TYR n 
1 85  VAL n 
1 86  LEU n 
1 87  THR n 
1 88  SER n 
1 89  ARG n 
1 90  SER n 
1 91  TYR n 
1 92  LEU n 
1 93  ILE n 
1 94  ASP n 
1 95  SER n 
1 96  PRO n 
1 97  PRO n 
1 98  THR n 
1 99  TYR n 
1 100 ASN n 
1 101 VAL n 
1 102 HIS n 
1 103 TYR n 
1 104 GLY n 
1 105 TYR n 
1 106 LYS n 
1 107 SER n 
1 108 TRP n 
1 109 GLU n 
1 110 ALA n 
1 111 PHE n 
1 112 SER n 
1 113 ASN n 
1 114 LEU n 
1 115 SER n 
1 116 TYR n 
1 117 TYR n 
1 118 THR n 
1 119 ARG n 
1 120 ALA n 
1 121 LEU n 
1 122 PRO n 
1 123 PRO n 
1 124 VAL n 
1 125 ALA n 
1 126 ASP n 
1 127 ASP n 
1 128 CYS n 
1 129 PRO n 
1 130 THR n 
1 131 PRO n 
1 132 MET n 
1 133 GLY n 
1 134 VAL n 
1 135 LYS n 
1 136 GLY n 
1 137 ASN n 
1 138 LYS n 
1 139 GLU n 
1 140 LEU n 
1 141 PRO n 
1 142 ASP n 
1 143 SER n 
1 144 LYS n 
1 145 GLU n 
1 146 VAL n 
1 147 LEU n 
1 148 GLU n 
1 149 LYS n 
1 150 VAL n 
1 151 LEU n 
1 152 LEU n 
1 153 ARG n 
1 154 ARG n 
1 155 GLU n 
1 156 PHE n 
1 157 ILE n 
1 158 PRO n 
1 159 ASP n 
1 160 PRO n 
1 161 GLN n 
1 162 GLY n 
1 163 SER n 
1 164 ASN n 
1 165 MET n 
1 166 MET n 
1 167 PHE n 
1 168 ALA n 
1 169 PHE n 
1 170 PHE n 
1 171 ALA n 
1 172 GLN n 
1 173 HIS n 
1 174 PHE n 
1 175 THR n 
1 176 HIS n 
1 177 GLN n 
1 178 PHE n 
1 179 PHE n 
1 180 LYS n 
1 181 THR n 
1 182 ASP n 
1 183 HIS n 
1 184 LYS n 
1 185 ARG n 
1 186 GLY n 
1 187 PRO n 
1 188 GLY n 
1 189 PHE n 
1 190 THR n 
1 191 ARG n 
1 192 GLY n 
1 193 LEU n 
1 194 GLY n 
1 195 HIS n 
1 196 GLY n 
1 197 VAL n 
1 198 ASP n 
1 199 LEU n 
1 200 ASN n 
1 201 HIS n 
1 202 ILE n 
1 203 TYR n 
1 204 GLY n 
1 205 GLU n 
1 206 THR n 
1 207 LEU n 
1 208 ASP n 
1 209 ARG n 
1 210 GLN n 
1 211 HIS n 
1 212 LYS n 
1 213 LEU n 
1 214 ARG n 
1 215 LEU n 
1 216 PHE n 
1 217 LYS n 
1 218 ASP n 
1 219 GLY n 
1 220 LYS n 
1 221 LEU n 
1 222 LYS n 
1 223 TYR n 
1 224 GLN n 
1 225 VAL n 
1 226 ILE n 
1 227 GLY n 
1 228 GLY n 
1 229 GLU n 
1 230 VAL n 
1 231 TYR n 
1 232 PRO n 
1 233 PRO n 
1 234 THR n 
1 235 VAL n 
1 236 LYS n 
1 237 ASP n 
1 238 THR n 
1 239 GLN n 
1 240 VAL n 
1 241 GLU n 
1 242 MET n 
1 243 ILE n 
1 244 TYR n 
1 245 PRO n 
1 246 PRO n 
1 247 HIS n 
1 248 ILE n 
1 249 PRO n 
1 250 GLU n 
1 251 ASN n 
1 252 LEU n 
1 253 GLN n 
1 254 PHE n 
1 255 ALA n 
1 256 VAL n 
1 257 GLY n 
1 258 GLN n 
1 259 GLU n 
1 260 VAL n 
1 261 PHE n 
1 262 GLY n 
1 263 LEU n 
1 264 VAL n 
1 265 PRO n 
1 266 GLY n 
1 267 LEU n 
1 268 MET n 
1 269 MET n 
1 270 TYR n 
1 271 ALA n 
1 272 THR n 
1 273 ILE n 
1 274 TRP n 
1 275 LEU n 
1 276 ARG n 
1 277 GLU n 
1 278 HIS n 
1 279 ASN n 
1 280 ARG n 
1 281 VAL n 
1 282 CYS n 
1 283 ASP n 
1 284 ILE n 
1 285 LEU n 
1 286 LYS n 
1 287 GLN n 
1 288 GLU n 
1 289 HIS n 
1 290 PRO n 
1 291 GLU n 
1 292 TRP n 
1 293 GLY n 
1 294 ASP n 
1 295 GLU n 
1 296 GLN n 
1 297 LEU n 
1 298 PHE n 
1 299 GLN n 
1 300 THR n 
1 301 SER n 
1 302 ARG n 
1 303 LEU n 
1 304 ILE n 
1 305 LEU n 
1 306 ILE n 
1 307 GLY n 
1 308 GLU n 
1 309 THR n 
1 310 ILE n 
1 311 LYS n 
1 312 ILE n 
1 313 VAL n 
1 314 ILE n 
1 315 GLU n 
1 316 ASP n 
1 317 TYR n 
1 318 VAL n 
1 319 GLN n 
1 320 HIS n 
1 321 LEU n 
1 322 SER n 
1 323 GLY n 
1 324 TYR n 
1 325 HIS n 
1 326 PHE n 
1 327 LYS n 
1 328 LEU n 
1 329 LYS n 
1 330 PHE n 
1 331 ASP n 
1 332 PRO n 
1 333 GLU n 
1 334 LEU n 
1 335 LEU n 
1 336 PHE n 
1 337 ASN n 
1 338 GLN n 
1 339 GLN n 
1 340 PHE n 
1 341 GLN n 
1 342 TYR n 
1 343 GLN n 
1 344 ASN n 
1 345 ARG n 
1 346 ILE n 
1 347 ALA n 
1 348 SER n 
1 349 GLU n 
1 350 PHE n 
1 351 ASN n 
1 352 THR n 
1 353 LEU n 
1 354 TYR n 
1 355 HIS n 
1 356 TRP n 
1 357 HIS n 
1 358 PRO n 
1 359 LEU n 
1 360 LEU n 
1 361 PRO n 
1 362 ASP n 
1 363 THR n 
1 364 PHE n 
1 365 ASN n 
1 366 ILE n 
1 367 GLU n 
1 368 ASP n 
1 369 GLN n 
1 370 GLU n 
1 371 TYR n 
1 372 SER n 
1 373 PHE n 
1 374 LYS n 
1 375 GLN n 
1 376 PHE n 
1 377 LEU n 
1 378 TYR n 
1 379 ASN n 
1 380 ASN n 
1 381 SER n 
1 382 ILE n 
1 383 LEU n 
1 384 LEU n 
1 385 GLU n 
1 386 HIS n 
1 387 GLY n 
1 388 LEU n 
1 389 THR n 
1 390 GLN n 
1 391 PHE n 
1 392 VAL n 
1 393 GLU n 
1 394 SER n 
1 395 PHE n 
1 396 THR n 
1 397 ARG n 
1 398 GLN n 
1 399 ILE n 
1 400 ALA n 
1 401 GLY n 
1 402 ARG n 
1 403 VAL n 
1 404 ALA n 
1 405 GLY n 
1 406 GLY n 
1 407 ARG n 
1 408 ASN n 
1 409 VAL n 
1 410 PRO n 
1 411 ILE n 
1 412 ALA n 
1 413 VAL n 
1 414 GLN n 
1 415 ALA n 
1 416 VAL n 
1 417 ALA n 
1 418 LYS n 
1 419 ALA n 
1 420 SER n 
1 421 ILE n 
1 422 ASP n 
1 423 GLN n 
1 424 SER n 
1 425 ARG n 
1 426 GLU n 
1 427 MET n 
1 428 LYS n 
1 429 TYR n 
1 430 GLN n 
1 431 SER n 
1 432 LEU n 
1 433 ASN n 
1 434 GLU n 
1 435 TYR n 
1 436 ARG n 
1 437 LYS n 
1 438 ARG n 
1 439 PHE n 
1 440 SER n 
1 441 LEU n 
1 442 LYS n 
1 443 PRO n 
1 444 TYR n 
1 445 THR n 
1 446 SER n 
1 447 PHE n 
1 448 GLU n 
1 449 GLU n 
1 450 LEU n 
1 451 THR n 
1 452 GLY n 
1 453 GLU n 
1 454 LYS n 
1 455 GLU n 
1 456 MET n 
1 457 ALA n 
1 458 ALA n 
1 459 GLU n 
1 460 LEU n 
1 461 LYS n 
1 462 ALA n 
1 463 LEU n 
1 464 TYR n 
1 465 SER n 
1 466 ASP n 
1 467 ILE n 
1 468 ASP n 
1 469 VAL n 
1 470 MET n 
1 471 GLU n 
1 472 LEU n 
1 473 TYR n 
1 474 PRO n 
1 475 ALA n 
1 476 LEU n 
1 477 LEU n 
1 478 VAL n 
1 479 GLU n 
1 480 LYS n 
1 481 PRO n 
1 482 ARG n 
1 483 PRO n 
1 484 ASP n 
1 485 ALA n 
1 486 ILE n 
1 487 PHE n 
1 488 GLY n 
1 489 GLU n 
1 490 THR n 
1 491 MET n 
1 492 VAL n 
1 493 GLU n 
1 494 LEU n 
1 495 GLY n 
1 496 ALA n 
1 497 PRO n 
1 498 PHE n 
1 499 SER n 
1 500 LEU n 
1 501 LYS n 
1 502 GLY n 
1 503 LEU n 
1 504 MET n 
1 505 GLY n 
1 506 ASN n 
1 507 PRO n 
1 508 ILE n 
1 509 CYS n 
1 510 SER n 
1 511 PRO n 
1 512 GLN n 
1 513 TYR n 
1 514 TRP n 
1 515 LYS n 
1 516 PRO n 
1 517 SER n 
1 518 THR n 
1 519 PHE n 
1 520 GLY n 
1 521 GLY n 
1 522 GLU n 
1 523 VAL n 
1 524 GLY n 
1 525 PHE n 
1 526 LYS n 
1 527 ILE n 
1 528 ILE n 
1 529 ASN n 
1 530 THR n 
1 531 ALA n 
1 532 SER n 
1 533 ILE n 
1 534 GLN n 
1 535 SER n 
1 536 LEU n 
1 537 ILE n 
1 538 CYS n 
1 539 ASN n 
1 540 ASN n 
1 541 VAL n 
1 542 LYS n 
1 543 GLY n 
1 544 CYS n 
1 545 PRO n 
1 546 PHE n 
1 547 THR n 
1 548 SER n 
1 549 PHE n 
1 550 ASN n 
1 551 VAL n 
1 552 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'house mouse' 
_entity_src_gen.gene_src_genus                     Mus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PVL1393 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PGH2_MOUSE 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          Q05769 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1DDX A 1 ? 552 ? Q05769 18 ? 569 ? 33   583  
2 1 1DDX B 1 ? 552 ? Q05769 18 ? 569 ? 1033 1583 
3 1 1DDX C 1 ? 552 ? Q05769 18 ? 569 ? 2033 2583 
4 1 1DDX D 1 ? 552 ? Q05769 18 ? 569 ? 3033 3583 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                                                                ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                                               ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                                             ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                                        ? 
'C4 H7 N O4'     133.103 
BOG D-saccharide                 n 'octyl beta-D-glucopyranoside'                                                         ? 
'C14 H28 O6'     292.369 
CYS 'L-peptide linking'          y CYSTEINE                                                                               ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                                                              ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                                        ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                                                ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                                              ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                                                  ? 'H2 O' 
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                                             ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                                                ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                                                 ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                                             ? 
'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                                               ? 
'C8 H15 N O6'    221.208 
PGX non-polymer                  . '7-[6-(3-HYDROPEROXY-OCT-1-ENYL)-2,3-DIOXA-BICYCLO[2.2.1]HEPT-5-YL]-HEPT-5-ENOIC ACID' 
'PROSTAGLANDIN G2' 'C20 H32 O6'     368.464 
PHE 'L-peptide linking'          y PHENYLALANINE                                                                          ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                                                ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                                                 ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                                              ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                                             ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                                               ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                                                 ? 
'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1DDX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   57.99 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            288 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.00 
_exptl_crystal_grow.pdbx_details    
'MONOMETHYL PEG 550, MAGNESIUM SULFATE, ARACHIDNOIC ACID, EPPS, B-OG, pH 8.00, VAPOR DIFFUSION, HANGING DROP, temperature 288K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           130.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-08-07 
_diffrn_detector.details                'DOUBLE-MIRROR OPTICS' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.514 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.514 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DDX 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             40.000 
_reflns.d_resolution_high            3.000 
_reflns.number_obs                   45048 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.2 
_reflns.pdbx_Rmerge_I_obs            0.112 
_reflns.pdbx_Rsym_value              0.112 
_reflns.pdbx_netI_over_sigmaI        3.000 
_reflns.B_iso_Wilson_estimate        16.9 
_reflns.pdbx_redundancy              3.400 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_refine.entry_id                                 1DDX 
_refine.ls_number_reflns_obs                     45794 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          -1.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    76.1 
_refine.ls_R_factor_obs                          0.267 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.267 
_refine.ls_R_factor_R_free                       0.324 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.4 
_refine.ls_number_reflns_R_free                  4324 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               28.3 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1DDX 
_refine_analyze.Luzzati_coordinate_error_obs    0.42 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_d_res_low_obs           20.00 
_refine_analyze.Luzzati_coordinate_error_free   0.52 
_refine_analyze.Luzzati_sigma_a_free            0.65 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        17900 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         404 
_refine_hist.number_atoms_solvent             173 
_refine_hist.number_atoms_total               18477 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.009 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 26.1  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 0.70  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it        2.62  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it       4.12  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it        3.67  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it       5.39  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.19 
_refine_ls_shell.number_reflns_R_work             5106 
_refine_ls_shell.R_factor_R_work                  0.356 
_refine_ls_shell.percent_reflns_obs               57.1 
_refine_ls_shell.R_factor_R_free                  0.447 
_refine_ls_shell.R_factor_R_free_error            0.019 
_refine_ls_shell.percent_reflns_R_free            9.5 
_refine_ls_shell.number_reflns_R_free             537 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM          TOPHCSDX.PRO               'X-RAY DIFFRACTION' 
2 PARAM19.SOL                TOPH19.SOL                 'X-RAY DIFFRACTION' 
3 PARAM19X_MOD.HEME          TOPH19X_MOD.HEME           'X-RAY DIFFRACTION' 
4 PARAM3_MOD.CHO             TOPH3.CHO                  'X-RAY DIFFRACTION' 
5 B-OCTYLGLUCOPYRANOSIDE.PAR B-OCTYLGLUCOPYRANOSIDE.TOP 'X-RAY DIFFRACTION' 
6 GH2.PAR                    GH2.TOP                    'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1DDX 
_struct.title                     
;CRYSTAL STRUCTURE OF A MIXTURE OF ARACHIDONIC ACID AND PROSTAGLANDIN BOUND TO THE CYCLOOXYGENASE ACTIVE SITE OF COX-2: PROSTAGLANDIN STRUCTURE
;
_struct.pdbx_descriptor           'PROSTAGLANDIN H2 SYNTHASE-2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DDX 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'COX-2, CYCLOOXYGENASE, PROSTAGLANDIN, ARACHIDONATE, ENDOPEROXIDE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 2 ? 
G  N N 2 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 5 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 4 ? 
P  N N 5 ? 
Q  N N 3 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 5 ? 
U  N N 3 ? 
V  N N 3 ? 
W  N N 4 ? 
X  N N 5 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLU A 41  ? LEU A 49  ? GLU A 73   LEU A 81   1 ? 9  
HELX_P HELX_P2   2   THR A 53  ? HIS A 63  ? THR A 85   HIS A 95   1 ? 11 
HELX_P HELX_P3   3   PHE A 64  ? ASN A 72  ? PHE A 96   ASN A 104  1 ? 9  
HELX_P HELX_P4   4   ILE A 74  A TYR A 91  ? ILE A 105  TYR A 122  1 ? 18 
HELX_P HELX_P5   5   SER A 107 ? ASN A 113 ? SER A 138  ASN A 144  1 ? 7  
HELX_P HELX_P6   6   ASP A 142 ? LEU A 151 ? ASP A 173  LEU A 182  1 ? 10 
HELX_P HELX_P7   7   ASN A 164 ? HIS A 176 ? ASN A 195  HIS A 207  1 ? 13 
HELX_P HELX_P8   8   LEU A 199 ? GLY A 204 ? LEU A 230  GLY A 235  1 ? 6  
HELX_P HELX_P9   9   THR A 206 ? LEU A 213 ? THR A 237  LEU A 244  1 ? 8  
HELX_P HELX_P10  10  THR A 234 ? GLN A 239 ? THR A 265  GLN A 270  1 ? 6  
HELX_P HELX_P11  11  VAL A 260 ? LEU A 263 ? VAL A 291  LEU A 294  5 ? 4  
HELX_P HELX_P12  12  VAL A 264 ? HIS A 289 ? VAL A 295  HIS A 320  1 ? 26 
HELX_P HELX_P13  13  GLY A 293 ? ASP A 316 ? GLY A 324  ASP A 347  1 ? 24 
HELX_P HELX_P14  14  ASP A 316 ? GLY A 323 ? ASP A 347  GLY A 354  1 ? 8  
HELX_P HELX_P15  15  ASP A 331 ? LEU A 335 ? ASP A 362  LEU A 366  5 ? 5  
HELX_P HELX_P16  16  ALA A 347 ? HIS A 355 ? ALA A 378  HIS A 386  1 ? 9  
HELX_P HELX_P17  17  TRP A 356 ? LEU A 360 ? TRP A 387  LEU A 391  5 ? 5  
HELX_P HELX_P18  18  SER A 372 ? LEU A 377 ? SER A 403  LEU A 408  1 ? 6  
HELX_P HELX_P19  19  ASN A 379 ? GLY A 387 ? ASN A 410  GLY A 418  1 ? 9  
HELX_P HELX_P20  20  GLY A 387 ? THR A 396 ? GLY A 418  THR A 427  1 ? 10 
HELX_P HELX_P21  21  VAL A 413 ? MET A 427 ? VAL A 444  MET A 458  1 ? 15 
HELX_P HELX_P22  22  SER A 431 ? PHE A 439 ? SER A 462  PHE A 470  1 ? 9  
HELX_P HELX_P23  23  SER A 446 ? GLY A 452 ? SER A 477  GLY A 483  1 ? 7  
HELX_P HELX_P24  24  LYS A 454 ? SER A 465 ? LYS A 485  SER A 496  1 ? 12 
HELX_P HELX_P25  25  GLU A 471 ? GLU A 479 ? GLU A 502  GLU A 510  1 ? 9  
HELX_P HELX_P26  26  GLY A 488 ? GLY A 505 ? GLY A 519  GLY A 536  1 ? 18 
HELX_P HELX_P27  27  ASN A 506 ? SER A 510 ? ASN A 537  SER A 541  5 ? 5  
HELX_P HELX_P28  28  LYS A 515 ? GLY A 520 ? LYS A 546  GLY A 551  5 ? 6  
HELX_P HELX_P29  29  GLY A 521 ? THR A 530 ? GLY A 552  THR A 561  1 ? 10 
HELX_P HELX_P30  30  SER A 532 ? VAL A 541 ? SER A 563  VAL A 572  1 ? 10 
HELX_P HELX_P31  31  GLU B 41  ? LEU B 49  ? GLU B 1073 LEU B 1081 1 ? 9  
HELX_P HELX_P32  32  THR B 53  ? HIS B 63  ? THR B 1085 HIS B 1095 1 ? 11 
HELX_P HELX_P33  33  PHE B 64  ? ASN B 72  ? PHE B 1096 ASN B 1104 1 ? 9  
HELX_P HELX_P34  34  ILE B 74  B TYR B 91  ? ILE B 1105 TYR B 1122 1 ? 18 
HELX_P HELX_P35  35  SER B 107 ? ASN B 113 ? SER B 1138 ASN B 1144 1 ? 7  
HELX_P HELX_P36  36  ASP B 142 ? LEU B 151 ? ASP B 1173 LEU B 1182 1 ? 10 
HELX_P HELX_P37  37  ASN B 164 ? HIS B 176 ? ASN B 1195 HIS B 1207 1 ? 13 
HELX_P HELX_P38  38  LEU B 199 ? GLY B 204 ? LEU B 1230 GLY B 1235 1 ? 6  
HELX_P HELX_P39  39  THR B 206 ? LEU B 213 ? THR B 1237 LEU B 1244 1 ? 8  
HELX_P HELX_P40  40  THR B 234 ? GLN B 239 ? THR B 1265 GLN B 1270 1 ? 6  
HELX_P HELX_P41  41  VAL B 260 ? LEU B 263 ? VAL B 1291 LEU B 1294 5 ? 4  
HELX_P HELX_P42  42  VAL B 264 ? HIS B 289 ? VAL B 1295 HIS B 1320 1 ? 26 
HELX_P HELX_P43  43  GLY B 293 ? ASP B 316 ? GLY B 1324 ASP B 1347 1 ? 24 
HELX_P HELX_P44  44  ASP B 316 ? GLY B 323 ? ASP B 1347 GLY B 1354 1 ? 8  
HELX_P HELX_P45  45  ASP B 331 ? LEU B 335 ? ASP B 1362 LEU B 1366 5 ? 5  
HELX_P HELX_P46  46  ALA B 347 ? HIS B 355 ? ALA B 1378 HIS B 1386 1 ? 9  
HELX_P HELX_P47  47  TRP B 356 ? LEU B 360 ? TRP B 1387 LEU B 1391 5 ? 5  
HELX_P HELX_P48  48  SER B 372 ? LEU B 377 ? SER B 1403 LEU B 1408 1 ? 6  
HELX_P HELX_P49  49  ASN B 379 ? GLY B 387 ? ASN B 1410 GLY B 1418 1 ? 9  
HELX_P HELX_P50  50  GLY B 387 ? THR B 396 ? GLY B 1418 THR B 1427 1 ? 10 
HELX_P HELX_P51  51  VAL B 413 ? MET B 427 ? VAL B 1444 MET B 1458 1 ? 15 
HELX_P HELX_P52  52  SER B 431 ? PHE B 439 ? SER B 1462 PHE B 1470 1 ? 9  
HELX_P HELX_P53  53  SER B 446 ? GLY B 452 ? SER B 1477 GLY B 1483 1 ? 7  
HELX_P HELX_P54  54  LYS B 454 ? SER B 465 ? LYS B 1485 SER B 1496 1 ? 12 
HELX_P HELX_P55  55  GLU B 471 ? GLU B 479 ? GLU B 1502 GLU B 1510 1 ? 9  
HELX_P HELX_P56  56  GLY B 488 ? GLY B 505 ? GLY B 1519 GLY B 1536 1 ? 18 
HELX_P HELX_P57  57  ASN B 506 ? SER B 510 ? ASN B 1537 SER B 1541 5 ? 5  
HELX_P HELX_P58  58  LYS B 515 ? GLY B 520 ? LYS B 1546 GLY B 1551 5 ? 6  
HELX_P HELX_P59  59  GLY B 521 ? THR B 530 ? GLY B 1552 THR B 1561 1 ? 10 
HELX_P HELX_P60  60  SER B 532 ? VAL B 541 ? SER B 1563 VAL B 1572 1 ? 10 
HELX_P HELX_P61  61  GLU C 41  ? LEU C 49  ? GLU C 2073 LEU C 2081 1 ? 9  
HELX_P HELX_P62  62  THR C 53  ? HIS C 63  ? THR C 2085 HIS C 2095 1 ? 11 
HELX_P HELX_P63  63  PHE C 64  ? ASN C 72  ? PHE C 2096 ASN C 2104 1 ? 9  
HELX_P HELX_P64  64  ILE C 74  C TYR C 91  ? ILE C 2105 TYR C 2122 1 ? 18 
HELX_P HELX_P65  65  SER C 107 ? ASN C 113 ? SER C 2138 ASN C 2144 1 ? 7  
HELX_P HELX_P66  66  ASP C 142 ? LEU C 151 ? ASP C 2173 LEU C 2182 1 ? 10 
HELX_P HELX_P67  67  ASN C 164 ? HIS C 176 ? ASN C 2195 HIS C 2207 1 ? 13 
HELX_P HELX_P68  68  LEU C 199 ? GLY C 204 ? LEU C 2230 GLY C 2235 1 ? 6  
HELX_P HELX_P69  69  THR C 206 ? LEU C 213 ? THR C 2237 LEU C 2244 1 ? 8  
HELX_P HELX_P70  70  THR C 234 ? GLN C 239 ? THR C 2265 GLN C 2270 1 ? 6  
HELX_P HELX_P71  71  VAL C 260 ? LEU C 263 ? VAL C 2291 LEU C 2294 5 ? 4  
HELX_P HELX_P72  72  VAL C 264 ? HIS C 289 ? VAL C 2295 HIS C 2320 1 ? 26 
HELX_P HELX_P73  73  GLY C 293 ? ASP C 316 ? GLY C 2324 ASP C 2347 1 ? 24 
HELX_P HELX_P74  74  ASP C 316 ? GLY C 323 ? ASP C 2347 GLY C 2354 1 ? 8  
HELX_P HELX_P75  75  ASP C 331 ? LEU C 335 ? ASP C 2362 LEU C 2366 5 ? 5  
HELX_P HELX_P76  76  ALA C 347 ? HIS C 355 ? ALA C 2378 HIS C 2386 1 ? 9  
HELX_P HELX_P77  77  TRP C 356 ? LEU C 360 ? TRP C 2387 LEU C 2391 5 ? 5  
HELX_P HELX_P78  78  SER C 372 ? LEU C 377 ? SER C 2403 LEU C 2408 1 ? 6  
HELX_P HELX_P79  79  ASN C 379 ? GLY C 387 ? ASN C 2410 GLY C 2418 1 ? 9  
HELX_P HELX_P80  80  GLY C 387 ? GLN C 398 ? GLY C 2418 GLN C 2429 1 ? 12 
HELX_P HELX_P81  81  VAL C 413 ? MET C 427 ? VAL C 2444 MET C 2458 1 ? 15 
HELX_P HELX_P82  82  SER C 431 ? PHE C 439 ? SER C 2462 PHE C 2470 1 ? 9  
HELX_P HELX_P83  83  SER C 446 ? GLY C 452 ? SER C 2477 GLY C 2483 1 ? 7  
HELX_P HELX_P84  84  LYS C 454 ? SER C 465 ? LYS C 2485 SER C 2496 1 ? 12 
HELX_P HELX_P85  85  GLU C 471 ? GLU C 479 ? GLU C 2502 GLU C 2510 1 ? 9  
HELX_P HELX_P86  86  GLY C 488 ? GLY C 505 ? GLY C 2519 GLY C 2536 1 ? 18 
HELX_P HELX_P87  87  ASN C 506 ? SER C 510 ? ASN C 2537 SER C 2541 5 ? 5  
HELX_P HELX_P88  88  LYS C 515 ? PHE C 519 ? LYS C 2546 PHE C 2550 5 ? 5  
HELX_P HELX_P89  89  GLY C 520 ? THR C 530 ? GLY C 2551 THR C 2561 1 ? 11 
HELX_P HELX_P90  90  SER C 532 ? VAL C 541 ? SER C 2563 VAL C 2572 1 ? 10 
HELX_P HELX_P91  91  GLU D 41  ? LEU D 49  ? GLU D 3073 LEU D 3081 1 ? 9  
HELX_P HELX_P92  92  THR D 53  ? HIS D 63  ? THR D 3085 HIS D 3095 1 ? 11 
HELX_P HELX_P93  93  PHE D 64  ? ASN D 72  ? PHE D 3096 ASN D 3104 1 ? 9  
HELX_P HELX_P94  94  ILE D 74  D TYR D 91  ? ILE D 3105 TYR D 3122 1 ? 18 
HELX_P HELX_P95  95  SER D 107 ? ASN D 113 ? SER D 3138 ASN D 3144 1 ? 7  
HELX_P HELX_P96  96  ASP D 142 ? LEU D 151 ? ASP D 3173 LEU D 3182 1 ? 10 
HELX_P HELX_P97  97  ASN D 164 ? HIS D 176 ? ASN D 3195 HIS D 3207 1 ? 13 
HELX_P HELX_P98  98  LEU D 199 ? GLY D 204 ? LEU D 3230 GLY D 3235 1 ? 6  
HELX_P HELX_P99  99  THR D 206 ? LEU D 213 ? THR D 3237 LEU D 3244 1 ? 8  
HELX_P HELX_P100 100 THR D 234 ? GLN D 239 ? THR D 3265 GLN D 3270 1 ? 6  
HELX_P HELX_P101 101 VAL D 260 ? LEU D 263 ? VAL D 3291 LEU D 3294 5 ? 4  
HELX_P HELX_P102 102 VAL D 264 ? HIS D 289 ? VAL D 3295 HIS D 3320 1 ? 26 
HELX_P HELX_P103 103 GLY D 293 ? ASP D 316 ? GLY D 3324 ASP D 3347 1 ? 24 
HELX_P HELX_P104 104 ASP D 316 ? GLY D 323 ? ASP D 3347 GLY D 3354 1 ? 8  
HELX_P HELX_P105 105 ASP D 331 ? LEU D 335 ? ASP D 3362 LEU D 3366 5 ? 5  
HELX_P HELX_P106 106 ALA D 347 ? HIS D 355 ? ALA D 3378 HIS D 3386 1 ? 9  
HELX_P HELX_P107 107 TRP D 356 ? LEU D 360 ? TRP D 3387 LEU D 3391 5 ? 5  
HELX_P HELX_P108 108 SER D 372 ? LEU D 377 ? SER D 3403 LEU D 3408 1 ? 6  
HELX_P HELX_P109 109 ASN D 379 ? GLY D 387 ? ASN D 3410 GLY D 3418 1 ? 9  
HELX_P HELX_P110 110 GLY D 387 ? THR D 396 ? GLY D 3418 THR D 3427 1 ? 10 
HELX_P HELX_P111 111 VAL D 413 ? MET D 427 ? VAL D 3444 MET D 3458 1 ? 15 
HELX_P HELX_P112 112 SER D 431 ? PHE D 439 ? SER D 3462 PHE D 3470 1 ? 9  
HELX_P HELX_P113 113 SER D 446 ? GLY D 452 ? SER D 3477 GLY D 3483 1 ? 7  
HELX_P HELX_P114 114 LYS D 454 ? SER D 465 ? LYS D 3485 SER D 3496 1 ? 12 
HELX_P HELX_P115 115 GLU D 471 ? GLU D 479 ? GLU D 3502 GLU D 3510 1 ? 9  
HELX_P HELX_P116 116 GLY D 488 ? GLY D 505 ? GLY D 3519 GLY D 3536 1 ? 18 
HELX_P HELX_P117 117 ASN D 506 ? SER D 510 ? ASN D 3537 SER D 3541 5 ? 5  
HELX_P HELX_P118 118 LYS D 515 ? GLY D 520 ? LYS D 3546 GLY D 3551 5 ? 6  
HELX_P HELX_P119 119 GLY D 521 ? THR D 530 ? GLY D 3552 THR D 3561 1 ? 10 
HELX_P HELX_P120 120 SER D 532 ? VAL D 541 ? SER D 3563 VAL D 3572 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 4   SG  ? ? ? 1_555 A CYS 15  SG ? ? A CYS 36   A CYS 47   1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf2  disulf ?    ? A CYS 5   SG  ? ? ? 1_555 A CYS 128 SG ? ? A CYS 37   A CYS 159  1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf3  disulf ?    ? A CYS 9   SG  ? ? ? 1_555 A CYS 25  SG ? ? A CYS 41   A CYS 57   1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf4  disulf ?    ? A CYS 27  SG  ? ? ? 1_555 A CYS 37  SG ? ? A CYS 59   A CYS 69   1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf5  disulf ?    ? A CYS 538 SG  ? ? ? 1_555 A CYS 544 SG ? ? A CYS 569  A CYS 575  1_555 ? ? ? ? ? ? ? 2.021 ? ? 
disulf6  disulf ?    ? B CYS 4   SG  ? ? ? 1_555 B CYS 15  SG ? ? B CYS 1036 B CYS 1047 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf7  disulf ?    ? B CYS 5   SG  ? ? ? 1_555 B CYS 128 SG ? ? B CYS 1037 B CYS 1159 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
disulf8  disulf ?    ? B CYS 9   SG  ? ? ? 1_555 B CYS 25  SG ? ? B CYS 1041 B CYS 1057 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf9  disulf ?    ? B CYS 27  SG  ? ? ? 1_555 B CYS 37  SG ? ? B CYS 1059 B CYS 1069 1_555 ? ? ? ? ? ? ? 2.043 ? ? 
disulf10 disulf ?    ? B CYS 538 SG  ? ? ? 1_555 B CYS 544 SG ? ? B CYS 1569 B CYS 1575 1_555 ? ? ? ? ? ? ? 2.024 ? ? 
disulf11 disulf ?    ? C CYS 4   SG  ? ? ? 1_555 C CYS 15  SG ? ? C CYS 2036 C CYS 2047 1_555 ? ? ? ? ? ? ? 2.027 ? ? 
disulf12 disulf ?    ? C CYS 5   SG  ? ? ? 1_555 C CYS 128 SG ? ? C CYS 2037 C CYS 2159 1_555 ? ? ? ? ? ? ? 2.023 ? ? 
disulf13 disulf ?    ? C CYS 9   SG  ? ? ? 1_555 C CYS 25  SG ? ? C CYS 2041 C CYS 2057 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf14 disulf ?    ? C CYS 27  SG  ? ? ? 1_555 C CYS 37  SG ? ? C CYS 2059 C CYS 2069 1_555 ? ? ? ? ? ? ? 2.038 ? ? 
disulf15 disulf ?    ? C CYS 538 SG  ? ? ? 1_555 C CYS 544 SG ? ? C CYS 2569 C CYS 2575 1_555 ? ? ? ? ? ? ? 2.030 ? ? 
disulf16 disulf ?    ? D CYS 4   SG  ? ? ? 1_555 D CYS 15  SG ? ? D CYS 3036 D CYS 3047 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf17 disulf ?    ? D CYS 5   SG  ? ? ? 1_555 D CYS 128 SG ? ? D CYS 3037 D CYS 3159 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf18 disulf ?    ? D CYS 9   SG  ? ? ? 1_555 D CYS 25  SG ? ? D CYS 3041 D CYS 3057 1_555 ? ? ? ? ? ? ? 2.037 ? ? 
disulf19 disulf ?    ? D CYS 27  SG  ? ? ? 1_555 D CYS 37  SG ? ? D CYS 3059 D CYS 3069 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf20 disulf ?    ? D CYS 538 SG  ? ? ? 1_555 D CYS 544 SG ? ? D CYS 3569 D CYS 3575 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
covale1  covale one  ? A ASN 36  ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 68   E NAG 1    1_555 ? ? ? ? ? ? ? 1.444 ? 
N-Glycosylation 
covale2  covale one  ? A ASN 113 ND2 ? ? ? 1_555 I NAG .   C1 ? ? A ASN 144  A NAG 671  1_555 ? ? ? ? ? ? ? 1.471 ? 
N-Glycosylation 
covale3  covale one  ? A ASN 379 ND2 ? ? ? 1_555 J NAG .   C1 ? ? A ASN 410  A NAG 681  1_555 ? ? ? ? ? ? ? 1.450 ? 
N-Glycosylation 
covale4  covale one  ? B ASN 36  ND2 ? ? ? 1_555 F NAG .   C1 ? ? B ASN 1068 F NAG 1    1_555 ? ? ? ? ? ? ? 1.461 ? 
N-Glycosylation 
covale5  covale one  ? B ASN 113 ND2 ? ? ? 1_555 M NAG .   C1 ? ? B ASN 1144 B NAG 1671 1_555 ? ? ? ? ? ? ? 1.454 ? 
N-Glycosylation 
covale6  covale one  ? B ASN 379 ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 1410 B NAG 1681 1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale7  covale one  ? C ASN 36  ND2 ? ? ? 1_555 G NAG .   C1 ? ? C ASN 2068 G NAG 1    1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale8  covale one  ? C ASN 113 ND2 ? ? ? 1_555 Q NAG .   C1 ? ? C ASN 2144 C NAG 2671 1_555 ? ? ? ? ? ? ? 1.462 ? 
N-Glycosylation 
covale9  covale one  ? C ASN 379 ND2 ? ? ? 1_555 R NAG .   C1 ? ? C ASN 2410 C NAG 2681 1_555 ? ? ? ? ? ? ? 1.455 ? 
N-Glycosylation 
covale10 covale one  ? D ASN 36  ND2 ? ? ? 1_555 H NAG .   C1 ? ? D ASN 3068 H NAG 1    1_555 ? ? ? ? ? ? ? 1.453 ? 
N-Glycosylation 
covale11 covale one  ? D ASN 113 ND2 ? ? ? 1_555 U NAG .   C1 ? ? D ASN 3144 D NAG 3671 1_555 ? ? ? ? ? ? ? 1.463 ? 
N-Glycosylation 
covale12 covale one  ? D ASN 379 ND2 ? ? ? 1_555 V NAG .   C1 ? ? D ASN 3410 D NAG 3681 1_555 ? ? ? ? ? ? ? 1.444 ? 
N-Glycosylation 
covale13 covale both ? E NAG .   O4  ? ? ? 1_555 E NAG .   C1 ? ? E NAG 1    E NAG 2    1_555 ? ? ? ? ? ? ? 1.395 ? ? 
covale14 covale both ? F NAG .   O4  ? ? ? 1_555 F NAG .   C1 ? ? F NAG 1    F NAG 2    1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale15 covale both ? G NAG .   O4  ? ? ? 1_555 G NAG .   C1 ? ? G NAG 1    G NAG 2    1_555 ? ? ? ? ? ? ? 1.393 ? ? 
covale16 covale both ? H NAG .   O4  ? ? ? 1_555 H NAG .   C1 ? ? H NAG 1    H NAG 2    1_555 ? ? ? ? ? ? ? 1.395 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 95 A . ? SER 126  A PRO 96 A ? PRO 127  A 1 0.36  
2 SER 95 B . ? SER 1126 B PRO 96 B ? PRO 1127 B 1 0.51  
3 SER 95 C . ? SER 2126 C PRO 96 C ? PRO 2127 C 1 0.05  
4 SER 95 D . ? SER 3126 D PRO 96 D ? PRO 3127 D 1 -0.19 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 15  ? MET A 16  ? CYS A 47   MET A 48   
A 2 LYS A 24  ? CYS A 25  ? LYS A 56   CYS A 57   
B 1 GLN A 224 ? ILE A 226 ? GLN A 255  ILE A 257  
B 2 GLU A 229 ? TYR A 231 ? GLU A 260  TYR A 262  
C 1 CYS B 15  ? MET B 16  ? CYS B 1047 MET B 1048 
C 2 LYS B 24  ? CYS B 25  ? LYS B 1056 CYS B 1057 
D 1 GLN B 224 ? ILE B 226 ? GLN B 1255 ILE B 1257 
D 2 GLU B 229 ? TYR B 231 ? GLU B 1260 TYR B 1262 
E 1 CYS C 15  ? MET C 16  ? CYS C 2047 MET C 2048 
E 2 LYS C 24  ? CYS C 25  ? LYS C 2056 CYS C 2057 
F 1 GLN C 224 ? ILE C 226 ? GLN C 2255 ILE C 2257 
F 2 GLU C 229 ? TYR C 231 ? GLU C 2260 TYR C 2262 
G 1 CYS D 15  ? MET D 16  ? CYS D 3047 MET D 3048 
G 2 LYS D 24  ? CYS D 25  ? LYS D 3056 CYS D 3057 
H 1 GLN D 224 ? ILE D 226 ? GLN D 3255 ILE D 3257 
H 2 GLU D 229 ? TYR D 231 ? GLU D 3260 TYR D 3262 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N MET A 16  ? N MET A 48   O LYS A 24  ? O LYS A 56   
B 1 2 N ILE A 226 ? N ILE A 257  O GLU A 229 ? O GLU A 260  
C 1 2 N MET B 16  ? N MET B 1048 O LYS B 24  ? O LYS B 1056 
D 1 2 N ILE B 226 ? N ILE B 1257 O GLU B 229 ? O GLU B 1260 
E 1 2 N MET C 16  ? N MET C 2048 O LYS C 24  ? O LYS C 2056 
F 1 2 N ILE C 226 ? N ILE C 2257 O GLU C 229 ? O GLU C 2260 
G 1 2 N MET D 16  ? N MET D 3048 O LYS D 24  ? O LYS D 3056 
H 1 2 N ILE D 226 ? N ILE D 3257 O GLU D 229 ? O GLU D 3260 
# 
_database_PDB_matrix.entry_id          1DDX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DDX 
_atom_sites.fract_transf_matrix[1][1]   0.005548 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007418 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008163 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ALA A  1 1   ? 29.772  8.209   -18.898 1.00 20.33 ? 33   ALA A N     1 
ATOM   2     C CA    . ALA A  1 1   ? 30.507  6.930   -19.171 1.00 20.46 ? 33   ALA A CA    1 
ATOM   3     C C     . ALA A  1 1   ? 31.372  6.507   -17.971 1.00 19.59 ? 33   ALA A C     1 
ATOM   4     O O     . ALA A  1 1   ? 31.811  5.353   -17.875 1.00 20.21 ? 33   ALA A O     1 
ATOM   5     C CB    . ALA A  1 1   ? 31.377  7.087   -20.442 1.00 17.70 ? 33   ALA A CB    1 
ATOM   6     N N     . ASN A  1 2   ? 31.593  7.440   -17.051 1.00 17.61 ? 34   ASN A N     1 
ATOM   7     C CA    . ASN A  1 2   ? 32.397  7.166   -15.871 1.00 21.73 ? 34   ASN A CA    1 
ATOM   8     C C     . ASN A  1 2   ? 31.839  6.078   -14.958 1.00 20.44 ? 34   ASN A C     1 
ATOM   9     O O     . ASN A  1 2   ? 30.825  6.262   -14.285 1.00 20.73 ? 34   ASN A O     1 
ATOM   10    C CB    . ASN A  1 2   ? 32.588  8.436   -15.053 1.00 24.07 ? 34   ASN A CB    1 
ATOM   11    C CG    . ASN A  1 2   ? 33.607  8.261   -13.939 1.00 27.47 ? 34   ASN A CG    1 
ATOM   12    O OD1   . ASN A  1 2   ? 33.878  7.144   -13.490 1.00 25.66 ? 34   ASN A OD1   1 
ATOM   13    N ND2   . ASN A  1 2   ? 34.176  9.371   -13.489 1.00 26.86 ? 34   ASN A ND2   1 
ATOM   14    N N     . PRO A  1 3   ? 32.528  4.931   -14.906 1.00 19.20 ? 35   PRO A N     1 
ATOM   15    C CA    . PRO A  1 3   ? 32.146  3.781   -14.086 1.00 22.92 ? 35   PRO A CA    1 
ATOM   16    C C     . PRO A  1 3   ? 32.022  4.115   -12.607 1.00 20.90 ? 35   PRO A C     1 
ATOM   17    O O     . PRO A  1 3   ? 31.569  3.292   -11.811 1.00 24.35 ? 35   PRO A O     1 
ATOM   18    C CB    . PRO A  1 3   ? 33.271  2.771   -14.338 1.00 22.13 ? 35   PRO A CB    1 
ATOM   19    C CG    . PRO A  1 3   ? 34.408  3.572   -14.886 1.00 16.20 ? 35   PRO A CG    1 
ATOM   20    C CD    . PRO A  1 3   ? 33.763  4.667   -15.666 1.00 20.48 ? 35   PRO A CD    1 
ATOM   21    N N     . CYS A  1 4   ? 32.432  5.319   -12.229 1.00 21.83 ? 36   CYS A N     1 
ATOM   22    C CA    . CYS A  1 4   ? 32.355  5.696   -10.824 1.00 23.68 ? 36   CYS A CA    1 
ATOM   23    C C     . CYS A  1 4   ? 31.073  6.468   -10.577 1.00 25.37 ? 36   CYS A C     1 
ATOM   24    O O     . CYS A  1 4   ? 30.600  6.559   -9.433  1.00 26.84 ? 36   CYS A O     1 
ATOM   25    C CB    . CYS A  1 4   ? 33.573  6.547   -10.420 1.00 22.46 ? 36   CYS A CB    1 
ATOM   26    S SG    . CYS A  1 4   ? 35.094  5.605   -10.025 1.00 22.67 ? 36   CYS A SG    1 
ATOM   27    N N     . CYS A  1 5   ? 30.523  7.011   -11.664 1.00 24.20 ? 37   CYS A N     1 
ATOM   28    C CA    . CYS A  1 5   ? 29.291  7.798   -11.627 1.00 23.56 ? 37   CYS A CA    1 
ATOM   29    C C     . CYS A  1 5   ? 28.322  7.349   -10.533 1.00 20.20 ? 37   CYS A C     1 
ATOM   30    O O     . CYS A  1 5   ? 27.816  8.167   -9.773  1.00 20.17 ? 37   CYS A O     1 
ATOM   31    C CB    . CYS A  1 5   ? 28.602  7.747   -12.997 1.00 24.81 ? 37   CYS A CB    1 
ATOM   32    S SG    . CYS A  1 5   ? 29.261  8.925   -14.237 1.00 28.27 ? 37   CYS A SG    1 
ATOM   33    N N     . SER A  1 6   ? 28.096  6.043   -10.439 1.00 15.83 ? 38   SER A N     1 
ATOM   34    C CA    . SER A  1 6   ? 27.182  5.477   -9.446  1.00 15.02 ? 38   SER A CA    1 
ATOM   35    C C     . SER A  1 6   ? 27.593  5.585   -7.980  1.00 13.89 ? 38   SER A C     1 
ATOM   36    O O     . SER A  1 6   ? 26.966  4.941   -7.133  1.00 16.23 ? 38   SER A O     1 
ATOM   37    C CB    . SER A  1 6   ? 26.930  3.994   -9.741  1.00 14.01 ? 38   SER A CB    1 
ATOM   38    O OG    . SER A  1 6   ? 28.078  3.359   -10.271 1.00 16.99 ? 38   SER A OG    1 
ATOM   39    N N     . ASN A  1 7   ? 28.629  6.370   -7.675  1.00 11.61 ? 39   ASN A N     1 
ATOM   40    C CA    . ASN A  1 7   ? 29.113  6.517   -6.295  1.00 9.19  ? 39   ASN A CA    1 
ATOM   41    C C     . ASN A  1 7   ? 29.194  5.167   -5.552  1.00 7.44  ? 39   ASN A C     1 
ATOM   42    O O     . ASN A  1 7   ? 28.876  5.083   -4.359  1.00 7.72  ? 39   ASN A O     1 
ATOM   43    C CB    . ASN A  1 7   ? 28.182  7.452   -5.536  1.00 2.00  ? 39   ASN A CB    1 
ATOM   44    C CG    . ASN A  1 7   ? 28.195  8.847   -6.096  1.00 13.20 ? 39   ASN A CG    1 
ATOM   45    O OD1   . ASN A  1 7   ? 28.401  9.820   -5.364  1.00 13.59 ? 39   ASN A OD1   1 
ATOM   46    N ND2   . ASN A  1 7   ? 27.986  8.961   -7.408  1.00 7.95  ? 39   ASN A ND2   1 
ATOM   47    N N     . PRO A  1 8   ? 29.680  4.113   -6.234  1.00 6.73  ? 40   PRO A N     1 
ATOM   48    C CA    . PRO A  1 8   ? 29.788  2.764   -5.649  1.00 10.14 ? 40   PRO A CA    1 
ATOM   49    C C     . PRO A  1 8   ? 30.561  2.579   -4.344  1.00 12.23 ? 40   PRO A C     1 
ATOM   50    O O     . PRO A  1 8   ? 30.105  1.895   -3.427  1.00 10.92 ? 40   PRO A O     1 
ATOM   51    C CB    . PRO A  1 8   ? 30.393  1.916   -6.778  1.00 5.19  ? 40   PRO A CB    1 
ATOM   52    C CG    . PRO A  1 8   ? 31.028  2.902   -7.715  1.00 9.45  ? 40   PRO A CG    1 
ATOM   53    C CD    . PRO A  1 8   ? 30.229  4.172   -7.603  1.00 7.11  ? 40   PRO A CD    1 
ATOM   54    N N     . CYS A  1 9   ? 31.739  3.184   -4.266  1.00 17.48 ? 41   CYS A N     1 
ATOM   55    C CA    . CYS A  1 9   ? 32.585  3.037   -3.091  1.00 17.72 ? 41   CYS A CA    1 
ATOM   56    C C     . CYS A  1 9   ? 31.962  3.632   -1.847  1.00 19.17 ? 41   CYS A C     1 
ATOM   57    O O     . CYS A  1 9   ? 31.616  4.814   -1.815  1.00 18.99 ? 41   CYS A O     1 
ATOM   58    C CB    . CYS A  1 9   ? 33.954  3.657   -3.379  1.00 18.60 ? 41   CYS A CB    1 
ATOM   59    S SG    . CYS A  1 9   ? 34.706  2.966   -4.890  1.00 19.16 ? 41   CYS A SG    1 
ATOM   60    N N     . GLN A  1 10  ? 31.830  2.797   -0.820  1.00 19.93 ? 42   GLN A N     1 
ATOM   61    C CA    . GLN A  1 10  ? 31.231  3.210   0.449   1.00 23.00 ? 42   GLN A CA    1 
ATOM   62    C C     . GLN A  1 10  ? 32.227  3.494   1.578   1.00 25.20 ? 42   GLN A C     1 
ATOM   63    O O     . GLN A  1 10  ? 33.416  3.196   1.470   1.00 27.47 ? 42   GLN A O     1 
ATOM   64    C CB    . GLN A  1 10  ? 30.237  2.140   0.914   1.00 21.15 ? 42   GLN A CB    1 
ATOM   65    C CG    . GLN A  1 10  ? 29.214  1.750   -0.144  1.00 20.57 ? 42   GLN A CG    1 
ATOM   66    C CD    . GLN A  1 10  ? 28.224  2.864   -0.438  1.00 19.40 ? 42   GLN A CD    1 
ATOM   67    O OE1   . GLN A  1 10  ? 27.481  3.303   0.448   1.00 17.53 ? 42   GLN A OE1   1 
ATOM   68    N NE2   . GLN A  1 10  ? 28.208  3.331   -1.689  1.00 18.60 ? 42   GLN A NE2   1 
ATOM   69    N N     . ASN A  1 11  ? 31.716  4.080   2.659   1.00 26.42 ? 43   ASN A N     1 
ATOM   70    C CA    . ASN A  1 11  ? 32.513  4.408   3.841   1.00 29.19 ? 43   ASN A CA    1 
ATOM   71    C C     . ASN A  1 11  ? 33.787  5.186   3.557   1.00 29.19 ? 43   ASN A C     1 
ATOM   72    O O     . ASN A  1 11  ? 34.888  4.746   3.911   1.00 30.68 ? 43   ASN A O     1 
ATOM   73    C CB    . ASN A  1 11  ? 32.884  3.135   4.585   1.00 30.88 ? 43   ASN A CB    1 
ATOM   74    C CG    . ASN A  1 11  ? 31.717  2.204   4.749   1.00 34.10 ? 43   ASN A CG    1 
ATOM   75    O OD1   . ASN A  1 11  ? 31.047  2.216   5.780   1.00 36.12 ? 43   ASN A OD1   1 
ATOM   76    N ND2   . ASN A  1 11  ? 31.461  1.387   3.733   1.00 35.52 ? 43   ASN A ND2   1 
ATOM   77    N N     . ARG A  1 12  ? 33.634  6.347   2.932   1.00 26.83 ? 44   ARG A N     1 
ATOM   78    C CA    . ARG A  1 12  ? 34.774  7.187   2.602   1.00 22.29 ? 44   ARG A CA    1 
ATOM   79    C C     . ARG A  1 12  ? 35.736  6.504   1.635   1.00 19.65 ? 44   ARG A C     1 
ATOM   80    O O     . ARG A  1 12  ? 36.829  7.022   1.391   1.00 19.75 ? 44   ARG A O     1 
ATOM   81    C CB    . ARG A  1 12  ? 35.521  7.601   3.873   1.00 22.73 ? 44   ARG A CB    1 
ATOM   82    C CG    . ARG A  1 12  ? 34.699  8.454   4.815   1.00 24.23 ? 44   ARG A CG    1 
ATOM   83    C CD    . ARG A  1 12  ? 34.604  9.869   4.300   1.00 20.80 ? 44   ARG A CD    1 
ATOM   84    N NE    . ARG A  1 12  ? 35.413  10.768  5.108   1.00 22.27 ? 44   ARG A NE    1 
ATOM   85    C CZ    . ARG A  1 12  ? 36.305  11.618  4.600   1.00 30.57 ? 44   ARG A CZ    1 
ATOM   86    N NH1   . ARG A  1 12  ? 36.498  11.675  3.280   1.00 30.72 ? 44   ARG A NH1   1 
ATOM   87    N NH2   . ARG A  1 12  ? 37.003  12.419  5.405   1.00 27.91 ? 44   ARG A NH2   1 
ATOM   88    N N     . GLY A  1 13  ? 35.327  5.358   1.085   1.00 16.25 ? 45   GLY A N     1 
ATOM   89    C CA    . GLY A  1 13  ? 36.163  4.650   0.129   1.00 18.43 ? 45   GLY A CA    1 
ATOM   90    C C     . GLY A  1 13  ? 36.411  5.551   -1.073  1.00 21.73 ? 45   GLY A C     1 
ATOM   91    O O     . GLY A  1 13  ? 35.689  6.533   -1.264  1.00 22.38 ? 45   GLY A O     1 
ATOM   92    N N     . GLU A  1 14  ? 37.423  5.252   -1.882  1.00 22.78 ? 46   GLU A N     1 
ATOM   93    C CA    . GLU A  1 14  ? 37.694  6.091   -3.042  1.00 23.71 ? 46   GLU A CA    1 
ATOM   94    C C     . GLU A  1 14  ? 37.519  5.323   -4.339  1.00 24.19 ? 46   GLU A C     1 
ATOM   95    O O     . GLU A  1 14  ? 38.100  4.260   -4.524  1.00 26.40 ? 46   GLU A O     1 
ATOM   96    C CB    . GLU A  1 14  ? 39.108  6.660   -2.968  1.00 27.19 ? 46   GLU A CB    1 
ATOM   97    C CG    . GLU A  1 14  ? 39.196  8.137   -3.305  1.00 34.99 ? 46   GLU A CG    1 
ATOM   98    C CD    . GLU A  1 14  ? 40.119  8.887   -2.359  1.00 40.60 ? 46   GLU A CD    1 
ATOM   99    O OE1   . GLU A  1 14  ? 41.211  9.317   -2.807  1.00 44.44 ? 46   GLU A OE1   1 
ATOM   100   O OE2   . GLU A  1 14  ? 39.754  9.045   -1.172  1.00 40.75 ? 46   GLU A OE2   1 
ATOM   101   N N     . CYS A  1 15  ? 36.715  5.862   -5.244  1.00 21.82 ? 47   CYS A N     1 
ATOM   102   C CA    . CYS A  1 15  ? 36.493  5.196   -6.513  1.00 23.23 ? 47   CYS A CA    1 
ATOM   103   C C     . CYS A  1 15  ? 37.502  5.641   -7.571  1.00 19.71 ? 47   CYS A C     1 
ATOM   104   O O     . CYS A  1 15  ? 37.817  6.831   -7.699  1.00 19.86 ? 47   CYS A O     1 
ATOM   105   C CB    . CYS A  1 15  ? 35.066  5.459   -7.006  1.00 22.35 ? 47   CYS A CB    1 
ATOM   106   S SG    . CYS A  1 15  ? 34.558  4.444   -8.440  1.00 28.08 ? 47   CYS A SG    1 
ATOM   107   N N     . MET A  1 16  ? 37.999  4.671   -8.335  1.00 19.27 ? 48   MET A N     1 
ATOM   108   C CA    . MET A  1 16  ? 38.962  4.939   -9.394  1.00 16.65 ? 48   MET A CA    1 
ATOM   109   C C     . MET A  1 16  ? 38.620  4.133   -10.648 1.00 10.62 ? 48   MET A C     1 
ATOM   110   O O     . MET A  1 16  ? 38.367  2.927   -10.586 1.00 5.59  ? 48   MET A O     1 
ATOM   111   C CB    . MET A  1 16  ? 40.383  4.610   -8.906  1.00 26.33 ? 48   MET A CB    1 
ATOM   112   C CG    . MET A  1 16  ? 41.224  3.768   -9.862  1.00 32.78 ? 48   MET A CG    1 
ATOM   113   S SD    . MET A  1 16  ? 42.958  4.278   -9.927  1.00 47.55 ? 48   MET A SD    1 
ATOM   114   C CE    . MET A  1 16  ? 43.782  2.691   -10.122 1.00 50.42 ? 48   MET A CE    1 
ATOM   115   N N     . SER A  1 17  ? 38.608  4.825   -11.783 1.00 6.85  ? 49   SER A N     1 
ATOM   116   C CA    . SER A  1 17  ? 38.302  4.222   -13.082 1.00 7.58  ? 49   SER A CA    1 
ATOM   117   C C     . SER A  1 17  ? 39.397  3.286   -13.555 1.00 7.87  ? 49   SER A C     1 
ATOM   118   O O     . SER A  1 17  ? 40.374  3.723   -14.162 1.00 13.72 ? 49   SER A O     1 
ATOM   119   C CB    . SER A  1 17  ? 38.094  5.306   -14.152 1.00 2.50  ? 49   SER A CB    1 
ATOM   120   O OG    . SER A  1 17  ? 38.733  6.524   -13.810 1.00 10.92 ? 49   SER A OG    1 
ATOM   121   N N     . THR A  1 18  ? 39.223  2.001   -13.297 1.00 2.00  ? 50   THR A N     1 
ATOM   122   C CA    . THR A  1 18  ? 40.213  1.024   -13.708 1.00 6.66  ? 50   THR A CA    1 
ATOM   123   C C     . THR A  1 18  ? 39.945  0.546   -15.119 1.00 8.20  ? 50   THR A C     1 
ATOM   124   O O     . THR A  1 18  ? 39.991  -0.649  -15.412 1.00 8.58  ? 50   THR A O     1 
ATOM   125   C CB    . THR A  1 18  ? 40.236  -0.188  -12.730 1.00 11.22 ? 50   THR A CB    1 
ATOM   126   O OG1   . THR A  1 18  ? 39.078  -1.016  -12.922 1.00 11.99 ? 50   THR A OG1   1 
ATOM   127   C CG2   . THR A  1 18  ? 40.269  0.311   -11.290 1.00 10.05 ? 50   THR A CG2   1 
ATOM   128   N N     . GLY A  1 19  ? 39.688  1.493   -16.006 1.00 12.43 ? 51   GLY A N     1 
ATOM   129   C CA    . GLY A  1 19  ? 39.395  1.142   -17.384 1.00 18.76 ? 51   GLY A CA    1 
ATOM   130   C C     . GLY A  1 19  ? 38.125  1.863   -17.779 1.00 24.93 ? 51   GLY A C     1 
ATOM   131   O O     . GLY A  1 19  ? 37.413  2.360   -16.907 1.00 25.92 ? 51   GLY A O     1 
ATOM   132   N N     . PHE A  1 20  ? 37.846  1.927   -19.079 1.00 26.00 ? 52   PHE A N     1 
ATOM   133   C CA    . PHE A  1 20  ? 36.661  2.615   -19.600 1.00 31.93 ? 52   PHE A CA    1 
ATOM   134   C C     . PHE A  1 20  ? 35.327  2.320   -18.910 1.00 37.79 ? 52   PHE A C     1 
ATOM   135   O O     . PHE A  1 20  ? 34.589  3.246   -18.553 1.00 39.51 ? 52   PHE A O     1 
ATOM   136   C CB    . PHE A  1 20  ? 36.519  2.323   -21.089 1.00 29.20 ? 52   PHE A CB    1 
ATOM   137   C CG    . PHE A  1 20  ? 37.340  3.226   -21.960 1.00 24.75 ? 52   PHE A CG    1 
ATOM   138   C CD1   . PHE A  1 20  ? 38.413  2.725   -22.684 1.00 21.08 ? 52   PHE A CD1   1 
ATOM   139   C CD2   . PHE A  1 20  ? 37.048  4.583   -22.045 1.00 22.97 ? 52   PHE A CD2   1 
ATOM   140   C CE1   . PHE A  1 20  ? 39.180  3.568   -23.476 1.00 17.33 ? 52   PHE A CE1   1 
ATOM   141   C CE2   . PHE A  1 20  ? 37.810  5.425   -22.834 1.00 17.15 ? 52   PHE A CE2   1 
ATOM   142   C CZ    . PHE A  1 20  ? 38.875  4.920   -23.547 1.00 14.88 ? 52   PHE A CZ    1 
ATOM   143   N N     . ASP A  1 21  ? 35.007  1.040   -18.737 1.00 40.77 ? 53   ASP A N     1 
ATOM   144   C CA    . ASP A  1 21  ? 33.748  0.672   -18.099 1.00 43.76 ? 53   ASP A CA    1 
ATOM   145   C C     . ASP A  1 21  ? 33.932  -0.233  -16.882 1.00 44.32 ? 53   ASP A C     1 
ATOM   146   O O     . ASP A  1 21  ? 33.194  -1.201  -16.710 1.00 43.81 ? 53   ASP A O     1 
ATOM   147   C CB    . ASP A  1 21  ? 32.819  -0.002  -19.121 1.00 47.54 ? 53   ASP A CB    1 
ATOM   148   C CG    . ASP A  1 21  ? 32.417  0.935   -20.269 1.00 51.77 ? 53   ASP A CG    1 
ATOM   149   O OD1   . ASP A  1 21  ? 32.104  2.121   -20.011 1.00 51.67 ? 53   ASP A OD1   1 
ATOM   150   O OD2   . ASP A  1 21  ? 32.412  0.484   -21.435 1.00 52.23 ? 53   ASP A OD2   1 
ATOM   151   N N     . GLN A  1 22  ? 34.919  0.093   -16.046 1.00 46.98 ? 54   GLN A N     1 
ATOM   152   C CA    . GLN A  1 22  ? 35.220  -0.653  -14.819 1.00 46.86 ? 54   GLN A CA    1 
ATOM   153   C C     . GLN A  1 22  ? 35.802  0.336   -13.809 1.00 43.40 ? 54   GLN A C     1 
ATOM   154   O O     . GLN A  1 22  ? 36.344  1.369   -14.192 1.00 45.56 ? 54   GLN A O     1 
ATOM   155   C CB    . GLN A  1 22  ? 36.229  -1.769  -15.104 1.00 47.29 ? 54   GLN A CB    1 
ATOM   156   C CG    . GLN A  1 22  ? 36.935  -1.632  -16.441 1.00 52.67 ? 54   GLN A CG    1 
ATOM   157   C CD    . GLN A  1 22  ? 36.729  -2.829  -17.358 1.00 56.95 ? 54   GLN A CD    1 
ATOM   158   O OE1   . GLN A  1 22  ? 37.071  -3.960  -17.011 1.00 53.43 ? 54   GLN A OE1   1 
ATOM   159   N NE2   . GLN A  1 22  ? 36.171  -2.581  -18.540 1.00 56.25 ? 54   GLN A NE2   1 
ATOM   160   N N     . TYR A  1 23  ? 35.694  0.031   -12.523 1.00 38.82 ? 55   TYR A N     1 
ATOM   161   C CA    . TYR A  1 23  ? 36.215  0.933   -11.497 1.00 33.57 ? 55   TYR A CA    1 
ATOM   162   C C     . TYR A  1 23  ? 36.880  0.169   -10.354 1.00 31.02 ? 55   TYR A C     1 
ATOM   163   O O     . TYR A  1 23  ? 37.011  -1.062  -10.393 1.00 27.68 ? 55   TYR A O     1 
ATOM   164   C CB    . TYR A  1 23  ? 35.079  1.780   -10.923 1.00 32.87 ? 55   TYR A CB    1 
ATOM   165   C CG    . TYR A  1 23  ? 34.187  0.987   -9.992  1.00 35.98 ? 55   TYR A CG    1 
ATOM   166   C CD1   . TYR A  1 23  ? 34.119  1.285   -8.629  1.00 33.75 ? 55   TYR A CD1   1 
ATOM   167   C CD2   . TYR A  1 23  ? 33.446  -0.105  -10.467 1.00 35.62 ? 55   TYR A CD2   1 
ATOM   168   C CE1   . TYR A  1 23  ? 33.334  0.510   -7.760  1.00 32.52 ? 55   TYR A CE1   1 
ATOM   169   C CE2   . TYR A  1 23  ? 32.662  -0.882  -9.608  1.00 32.73 ? 55   TYR A CE2   1 
ATOM   170   C CZ    . TYR A  1 23  ? 32.612  -0.571  -8.264  1.00 32.60 ? 55   TYR A CZ    1 
ATOM   171   O OH    . TYR A  1 23  ? 31.847  -1.346  -7.433  1.00 29.58 ? 55   TYR A OH    1 
ATOM   172   N N     . LYS A  1 24  ? 37.286  0.908   -9.326  1.00 30.43 ? 56   LYS A N     1 
ATOM   173   C CA    . LYS A  1 24  ? 37.924  0.298   -8.164  1.00 30.41 ? 56   LYS A CA    1 
ATOM   174   C C     . LYS A  1 24  ? 37.779  1.168   -6.922  1.00 25.81 ? 56   LYS A C     1 
ATOM   175   O O     . LYS A  1 24  ? 37.821  2.400   -6.993  1.00 20.78 ? 56   LYS A O     1 
ATOM   176   C CB    . LYS A  1 24  ? 39.403  0.029   -8.448  1.00 32.44 ? 56   LYS A CB    1 
ATOM   177   C CG    . LYS A  1 24  ? 40.273  -0.113  -7.210  1.00 34.37 ? 56   LYS A CG    1 
ATOM   178   C CD    . LYS A  1 24  ? 40.464  -1.559  -6.806  1.00 31.59 ? 56   LYS A CD    1 
ATOM   179   C CE    . LYS A  1 24  ? 40.784  -1.663  -5.327  1.00 32.29 ? 56   LYS A CE    1 
ATOM   180   N NZ    . LYS A  1 24  ? 41.350  -2.991  -4.977  1.00 31.86 ? 56   LYS A NZ    1 
ATOM   181   N N     . CYS A  1 25  ? 37.629  0.499   -5.782  1.00 25.65 ? 57   CYS A N     1 
ATOM   182   C CA    . CYS A  1 25  ? 37.447  1.163   -4.496  1.00 27.88 ? 57   CYS A CA    1 
ATOM   183   C C     . CYS A  1 25  ? 38.670  1.073   -3.584  1.00 29.26 ? 57   CYS A C     1 
ATOM   184   O O     . CYS A  1 25  ? 39.192  -0.017  -3.314  1.00 29.05 ? 57   CYS A O     1 
ATOM   185   C CB    . CYS A  1 25  ? 36.221  0.577   -3.781  1.00 23.11 ? 57   CYS A CB    1 
ATOM   186   S SG    . CYS A  1 25  ? 34.626  0.953   -4.586  1.00 23.78 ? 57   CYS A SG    1 
ATOM   187   N N     . ASP A  1 26  ? 39.104  2.235   -3.105  1.00 30.02 ? 58   ASP A N     1 
ATOM   188   C CA    . ASP A  1 26  ? 40.257  2.354   -2.225  1.00 32.57 ? 58   ASP A CA    1 
ATOM   189   C C     . ASP A  1 26  ? 39.790  2.369   -0.775  1.00 31.72 ? 58   ASP A C     1 
ATOM   190   O O     . ASP A  1 26  ? 39.726  3.416   -0.133  1.00 34.08 ? 58   ASP A O     1 
ATOM   191   C CB    . ASP A  1 26  ? 41.017  3.649   -2.539  1.00 36.06 ? 58   ASP A CB    1 
ATOM   192   C CG    . ASP A  1 26  ? 42.515  3.533   -2.289  1.00 35.18 ? 58   ASP A CG    1 
ATOM   193   O OD1   . ASP A  1 26  ? 43.289  3.646   -3.263  1.00 33.30 ? 58   ASP A OD1   1 
ATOM   194   O OD2   . ASP A  1 26  ? 42.922  3.336   -1.123  1.00 33.28 ? 58   ASP A OD2   1 
ATOM   195   N N     . CYS A  1 27  ? 39.456  1.195   -0.263  1.00 32.23 ? 59   CYS A N     1 
ATOM   196   C CA    . CYS A  1 27  ? 38.998  1.077   1.114   1.00 32.42 ? 59   CYS A CA    1 
ATOM   197   C C     . CYS A  1 27  ? 40.222  1.086   2.032   1.00 30.64 ? 59   CYS A C     1 
ATOM   198   O O     . CYS A  1 27  ? 40.532  0.098   2.693   1.00 33.39 ? 59   CYS A O     1 
ATOM   199   C CB    . CYS A  1 27  ? 38.190  -0.222  1.280   1.00 31.05 ? 59   CYS A CB    1 
ATOM   200   S SG    . CYS A  1 27  ? 37.229  -0.722  -0.199  1.00 35.90 ? 59   CYS A SG    1 
ATOM   201   N N     . THR A  1 28  ? 40.914  2.218   2.066   1.00 26.95 ? 60   THR A N     1 
ATOM   202   C CA    . THR A  1 28  ? 42.112  2.346   2.874   1.00 28.30 ? 60   THR A CA    1 
ATOM   203   C C     . THR A  1 28  ? 41.840  3.058   4.193   1.00 29.52 ? 60   THR A C     1 
ATOM   204   O O     . THR A  1 28  ? 41.361  4.188   4.222   1.00 28.19 ? 60   THR A O     1 
ATOM   205   C CB    . THR A  1 28  ? 43.202  3.087   2.080   1.00 25.40 ? 60   THR A CB    1 
ATOM   206   O OG1   . THR A  1 28  ? 43.518  2.328   0.905   1.00 18.69 ? 60   THR A OG1   1 
ATOM   207   C CG2   . THR A  1 28  ? 44.465  3.269   2.915   1.00 23.06 ? 60   THR A CG2   1 
ATOM   208   N N     . ARG A  1 29  ? 42.151  2.382   5.291   1.00 32.81 ? 61   ARG A N     1 
ATOM   209   C CA    . ARG A  1 29  ? 41.928  2.943   6.615   1.00 36.74 ? 61   ARG A CA    1 
ATOM   210   C C     . ARG A  1 29  ? 40.443  3.233   6.801   1.00 38.42 ? 61   ARG A C     1 
ATOM   211   O O     . ARG A  1 29  ? 40.041  3.939   7.732   1.00 39.02 ? 61   ARG A O     1 
ATOM   212   C CB    . ARG A  1 29  ? 42.749  4.220   6.793   1.00 36.48 ? 61   ARG A CB    1 
ATOM   213   C CG    . ARG A  1 29  ? 44.079  3.981   7.507   1.00 38.83 ? 61   ARG A CG    1 
ATOM   214   C CD    . ARG A  1 29  ? 45.071  5.113   7.271   1.00 40.11 ? 61   ARG A CD    1 
ATOM   215   N NE    . ARG A  1 29  ? 45.760  4.987   5.991   1.00 40.84 ? 61   ARG A NE    1 
ATOM   216   C CZ    . ARG A  1 29  ? 46.001  6.011   5.182   1.00 45.46 ? 61   ARG A CZ    1 
ATOM   217   N NH1   . ARG A  1 29  ? 45.611  7.231   5.524   1.00 46.71 ? 61   ARG A NH1   1 
ATOM   218   N NH2   . ARG A  1 29  ? 46.633  5.820   4.034   1.00 48.83 ? 61   ARG A NH2   1 
ATOM   219   N N     . THR A  1 30  ? 39.637  2.667   5.907   1.00 40.77 ? 62   THR A N     1 
ATOM   220   C CA    . THR A  1 30  ? 38.190  2.833   5.929   1.00 43.13 ? 62   THR A CA    1 
ATOM   221   C C     . THR A  1 30  ? 37.564  1.954   7.007   1.00 43.15 ? 62   THR A C     1 
ATOM   222   O O     . THR A  1 30  ? 36.751  2.413   7.810   1.00 45.65 ? 62   THR A O     1 
ATOM   223   C CB    . THR A  1 30  ? 37.582  2.454   4.566   1.00 42.71 ? 62   THR A CB    1 
ATOM   224   O OG1   . THR A  1 30  ? 38.007  1.133   4.198   1.00 45.17 ? 62   THR A OG1   1 
ATOM   225   C CG2   . THR A  1 30  ? 38.034  3.430   3.503   1.00 45.51 ? 62   THR A CG2   1 
ATOM   226   N N     . GLY A  1 31  ? 37.956  0.686   7.022   1.00 43.42 ? 63   GLY A N     1 
ATOM   227   C CA    . GLY A  1 31  ? 37.421  -0.243  7.996   1.00 42.52 ? 63   GLY A CA    1 
ATOM   228   C C     . GLY A  1 31  ? 36.593  -1.303  7.302   1.00 43.15 ? 63   GLY A C     1 
ATOM   229   O O     . GLY A  1 31  ? 35.966  -2.141  7.951   1.00 42.97 ? 63   GLY A O     1 
ATOM   230   N N     . PHE A  1 32  ? 36.598  -1.270  5.973   1.00 41.28 ? 64   PHE A N     1 
ATOM   231   C CA    . PHE A  1 32  ? 35.833  -2.228  5.186   1.00 40.94 ? 64   PHE A CA    1 
ATOM   232   C C     . PHE A  1 32  ? 36.584  -2.650  3.951   1.00 40.28 ? 64   PHE A C     1 
ATOM   233   O O     . PHE A  1 32  ? 37.254  -1.831  3.329   1.00 40.48 ? 64   PHE A O     1 
ATOM   234   C CB    . PHE A  1 32  ? 34.499  -1.621  4.722   1.00 41.49 ? 64   PHE A CB    1 
ATOM   235   C CG    . PHE A  1 32  ? 33.764  -0.868  5.787   1.00 41.46 ? 64   PHE A CG    1 
ATOM   236   C CD1   . PHE A  1 32  ? 34.171  0.409   6.164   1.00 41.16 ? 64   PHE A CD1   1 
ATOM   237   C CD2   . PHE A  1 32  ? 32.675  -1.445  6.431   1.00 36.89 ? 64   PHE A CD2   1 
ATOM   238   C CE1   . PHE A  1 32  ? 33.504  1.100   7.170   1.00 41.09 ? 64   PHE A CE1   1 
ATOM   239   C CE2   . PHE A  1 32  ? 32.003  -0.767  7.434   1.00 38.27 ? 64   PHE A CE2   1 
ATOM   240   C CZ    . PHE A  1 32  ? 32.416  0.510   7.808   1.00 39.42 ? 64   PHE A CZ    1 
ATOM   241   N N     . TYR A  1 33  ? 36.478  -3.928  3.600   1.00 39.71 ? 65   TYR A N     1 
ATOM   242   C CA    . TYR A  1 33  ? 37.097  -4.414  2.380   1.00 39.21 ? 65   TYR A CA    1 
ATOM   243   C C     . TYR A  1 33  ? 35.974  -4.595  1.364   1.00 38.33 ? 65   TYR A C     1 
ATOM   244   O O     . TYR A  1 33  ? 35.040  -3.801  1.317   1.00 38.45 ? 65   TYR A O     1 
ATOM   245   C CB    . TYR A  1 33  ? 37.846  -5.737  2.586   1.00 39.07 ? 65   TYR A CB    1 
ATOM   246   C CG    . TYR A  1 33  ? 37.387  -6.602  3.735   1.00 39.31 ? 65   TYR A CG    1 
ATOM   247   C CD1   . TYR A  1 33  ? 36.943  -7.909  3.508   1.00 39.26 ? 65   TYR A CD1   1 
ATOM   248   C CD2   . TYR A  1 33  ? 37.471  -6.153  5.057   1.00 37.34 ? 65   TYR A CD2   1 
ATOM   249   C CE1   . TYR A  1 33  ? 36.601  -8.743  4.567   1.00 35.56 ? 65   TYR A CE1   1 
ATOM   250   C CE2   . TYR A  1 33  ? 37.130  -6.979  6.121   1.00 34.17 ? 65   TYR A CE2   1 
ATOM   251   C CZ    . TYR A  1 33  ? 36.698  -8.268  5.870   1.00 36.45 ? 65   TYR A CZ    1 
ATOM   252   O OH    . TYR A  1 33  ? 36.349  -9.084  6.918   1.00 35.89 ? 65   TYR A OH    1 
ATOM   253   N N     . GLY A  1 34  ? 36.051  -5.635  0.554   1.00 38.04 ? 66   GLY A N     1 
ATOM   254   C CA    . GLY A  1 34  ? 35.012  -5.835  -0.432  1.00 39.02 ? 66   GLY A CA    1 
ATOM   255   C C     . GLY A  1 34  ? 35.144  -4.819  -1.549  1.00 40.32 ? 66   GLY A C     1 
ATOM   256   O O     . GLY A  1 34  ? 35.586  -3.690  -1.334  1.00 41.03 ? 66   GLY A O     1 
ATOM   257   N N     . GLU A  1 35  ? 34.758  -5.231  -2.749  1.00 39.32 ? 67   GLU A N     1 
ATOM   258   C CA    . GLU A  1 35  ? 34.829  -4.381  -3.920  1.00 40.37 ? 67   GLU A CA    1 
ATOM   259   C C     . GLU A  1 35  ? 34.240  -2.993  -3.689  1.00 42.56 ? 67   GLU A C     1 
ATOM   260   O O     . GLU A  1 35  ? 34.665  -2.023  -4.320  1.00 43.33 ? 67   GLU A O     1 
ATOM   261   C CB    . GLU A  1 35  ? 34.116  -5.086  -5.076  1.00 40.78 ? 67   GLU A CB    1 
ATOM   262   C CG    . GLU A  1 35  ? 33.511  -4.185  -6.130  1.00 42.14 ? 67   GLU A CG    1 
ATOM   263   C CD    . GLU A  1 35  ? 32.857  -4.978  -7.239  1.00 44.40 ? 67   GLU A CD    1 
ATOM   264   O OE1   . GLU A  1 35  ? 32.739  -6.211  -7.094  1.00 44.04 ? 67   GLU A OE1   1 
ATOM   265   O OE2   . GLU A  1 35  ? 32.461  -4.374  -8.254  1.00 43.62 ? 67   GLU A OE2   1 
ATOM   266   N N     . ASN A  1 36  ? 33.279  -2.886  -2.774  1.00 43.06 ? 68   ASN A N     1 
ATOM   267   C CA    . ASN A  1 36  ? 32.642  -1.596  -2.512  1.00 44.86 ? 68   ASN A CA    1 
ATOM   268   C C     . ASN A  1 36  ? 32.939  -0.962  -1.160  1.00 44.52 ? 68   ASN A C     1 
ATOM   269   O O     . ASN A  1 36  ? 32.315  0.038   -0.795  1.00 44.59 ? 68   ASN A O     1 
ATOM   270   C CB    . ASN A  1 36  ? 31.131  -1.716  -2.682  1.00 47.45 ? 68   ASN A CB    1 
ATOM   271   C CG    . ASN A  1 36  ? 30.731  -2.002  -4.112  1.00 51.64 ? 68   ASN A CG    1 
ATOM   272   O OD1   . ASN A  1 36  ? 31.147  -1.303  -5.035  1.00 46.29 ? 68   ASN A OD1   1 
ATOM   273   N ND2   . ASN A  1 36  ? 29.923  -3.040  -4.287  1.00 53.73 ? 68   ASN A ND2   1 
ATOM   274   N N     . CYS A  1 37  ? 33.890  -1.534  -0.425  1.00 43.81 ? 69   CYS A N     1 
ATOM   275   C CA    . CYS A  1 37  ? 34.282  -1.006  0.885   1.00 41.96 ? 69   CYS A CA    1 
ATOM   276   C C     . CYS A  1 37  ? 33.147  -1.196  1.863   1.00 41.90 ? 69   CYS A C     1 
ATOM   277   O O     . CYS A  1 37  ? 32.870  -0.342  2.708   1.00 42.07 ? 69   CYS A O     1 
ATOM   278   C CB    . CYS A  1 37  ? 34.638  0.480   0.780   1.00 37.83 ? 69   CYS A CB    1 
ATOM   279   S SG    . CYS A  1 37  ? 35.926  0.818   -0.460  1.00 35.89 ? 69   CYS A SG    1 
ATOM   280   N N     . THR A  1 38  ? 32.510  -2.351  1.736   1.00 45.12 ? 70   THR A N     1 
ATOM   281   C CA    . THR A  1 38  ? 31.369  -2.719  2.556   1.00 43.89 ? 70   THR A CA    1 
ATOM   282   C C     . THR A  1 38  ? 31.736  -3.697  3.674   1.00 43.08 ? 70   THR A C     1 
ATOM   283   O O     . THR A  1 38  ? 31.566  -3.384  4.853   1.00 41.22 ? 70   THR A O     1 
ATOM   284   C CB    . THR A  1 38  ? 30.280  -3.325  1.662   1.00 44.70 ? 70   THR A CB    1 
ATOM   285   O OG1   . THR A  1 38  ? 30.901  -3.963  0.535   1.00 42.68 ? 70   THR A OG1   1 
ATOM   286   C CG2   . THR A  1 38  ? 29.355  -2.230  1.150   1.00 45.37 ? 70   THR A CG2   1 
ATOM   287   N N     . THR A  1 39  ? 32.231  -4.876  3.315   1.00 38.98 ? 71   THR A N     1 
ATOM   288   C CA    . THR A  1 39  ? 32.613  -5.846  4.332   1.00 39.49 ? 71   THR A CA    1 
ATOM   289   C C     . THR A  1 39  ? 33.477  -5.140  5.367   1.00 40.92 ? 71   THR A C     1 
ATOM   290   O O     . THR A  1 39  ? 34.530  -4.606  5.046   1.00 43.27 ? 71   THR A O     1 
ATOM   291   C CB    . THR A  1 39  ? 33.417  -7.002  3.744   1.00 37.04 ? 71   THR A CB    1 
ATOM   292   O OG1   . THR A  1 39  ? 32.901  -7.333  2.449   1.00 37.65 ? 71   THR A OG1   1 
ATOM   293   C CG2   . THR A  1 39  ? 33.325  -8.211  4.658   1.00 38.72 ? 71   THR A CG2   1 
ATOM   294   N N     . PRO A  1 40  ? 33.042  -5.131  6.628   1.00 41.94 ? 72   PRO A N     1 
ATOM   295   C CA    . PRO A  1 40  ? 33.826  -4.462  7.662   1.00 43.44 ? 72   PRO A CA    1 
ATOM   296   C C     . PRO A  1 40  ? 34.825  -5.384  8.330   1.00 45.90 ? 72   PRO A C     1 
ATOM   297   O O     . PRO A  1 40  ? 34.786  -6.600  8.144   1.00 45.47 ? 72   PRO A O     1 
ATOM   298   C CB    . PRO A  1 40  ? 32.765  -3.998  8.644   1.00 43.16 ? 72   PRO A CB    1 
ATOM   299   C CG    . PRO A  1 40  ? 31.719  -5.087  8.563   1.00 41.79 ? 72   PRO A CG    1 
ATOM   300   C CD    . PRO A  1 40  ? 31.818  -5.726  7.187   1.00 39.65 ? 72   PRO A CD    1 
ATOM   301   N N     . GLU A  1 41  ? 35.724  -4.795  9.109   1.00 48.66 ? 73   GLU A N     1 
ATOM   302   C CA    . GLU A  1 41  ? 36.709  -5.568  9.846   1.00 50.12 ? 73   GLU A CA    1 
ATOM   303   C C     . GLU A  1 41  ? 36.143  -5.673  11.247  1.00 50.16 ? 73   GLU A C     1 
ATOM   304   O O     . GLU A  1 41  ? 35.164  -5.002  11.574  1.00 47.04 ? 73   GLU A O     1 
ATOM   305   C CB    . GLU A  1 41  ? 38.061  -4.856  9.854   1.00 53.51 ? 73   GLU A CB    1 
ATOM   306   C CG    . GLU A  1 41  ? 38.687  -4.756  8.468   1.00 64.18 ? 73   GLU A CG    1 
ATOM   307   C CD    . GLU A  1 41  ? 39.907  -3.853  8.426   1.00 69.21 ? 73   GLU A CD    1 
ATOM   308   O OE1   . GLU A  1 41  ? 40.786  -4.076  7.559   1.00 72.32 ? 73   GLU A OE1   1 
ATOM   309   O OE2   . GLU A  1 41  ? 39.985  -2.921  9.257   1.00 72.24 ? 73   GLU A OE2   1 
ATOM   310   N N     . PHE A  1 42  ? 36.743  -6.515  12.074  1.00 48.49 ? 74   PHE A N     1 
ATOM   311   C CA    . PHE A  1 42  ? 36.238  -6.689  13.422  1.00 50.84 ? 74   PHE A CA    1 
ATOM   312   C C     . PHE A  1 42  ? 36.116  -5.398  14.230  1.00 50.51 ? 74   PHE A C     1 
ATOM   313   O O     . PHE A  1 42  ? 35.005  -4.942  14.496  1.00 52.57 ? 74   PHE A O     1 
ATOM   314   C CB    . PHE A  1 42  ? 37.089  -7.702  14.186  1.00 50.67 ? 74   PHE A CB    1 
ATOM   315   C CG    . PHE A  1 42  ? 36.314  -8.481  15.214  1.00 51.48 ? 74   PHE A CG    1 
ATOM   316   C CD1   . PHE A  1 42  ? 35.296  -9.343  14.830  1.00 52.00 ? 74   PHE A CD1   1 
ATOM   317   C CD2   . PHE A  1 42  ? 36.593  -8.339  16.570  1.00 52.40 ? 74   PHE A CD2   1 
ATOM   318   C CE1   . PHE A  1 42  ? 34.569  -10.050 15.783  1.00 52.75 ? 74   PHE A CE1   1 
ATOM   319   C CE2   . PHE A  1 42  ? 35.871  -9.042  17.530  1.00 51.32 ? 74   PHE A CE2   1 
ATOM   320   C CZ    . PHE A  1 42  ? 34.860  -9.897  17.138  1.00 51.60 ? 74   PHE A CZ    1 
ATOM   321   N N     . LEU A  1 43  ? 37.237  -4.804  14.627  1.00 48.80 ? 75   LEU A N     1 
ATOM   322   C CA    . LEU A  1 43  ? 37.172  -3.576  15.412  1.00 46.35 ? 75   LEU A CA    1 
ATOM   323   C C     . LEU A  1 43  ? 36.142  -2.637  14.826  1.00 45.14 ? 75   LEU A C     1 
ATOM   324   O O     . LEU A  1 43  ? 35.496  -1.893  15.558  1.00 45.40 ? 75   LEU A O     1 
ATOM   325   C CB    . LEU A  1 43  ? 38.527  -2.862  15.466  1.00 52.28 ? 75   LEU A CB    1 
ATOM   326   C CG    . LEU A  1 43  ? 38.502  -1.499  16.179  1.00 54.33 ? 75   LEU A CG    1 
ATOM   327   C CD1   . LEU A  1 43  ? 37.730  -1.594  17.506  1.00 53.79 ? 75   LEU A CD1   1 
ATOM   328   C CD2   . LEU A  1 43  ? 39.933  -1.029  16.422  1.00 54.90 ? 75   LEU A CD2   1 
ATOM   329   N N     . THR A  1 44  ? 35.992  -2.673  13.505  1.00 42.96 ? 76   THR A N     1 
ATOM   330   C CA    . THR A  1 44  ? 35.010  -1.820  12.843  1.00 42.87 ? 76   THR A CA    1 
ATOM   331   C C     . THR A  1 44  ? 33.648  -2.107  13.471  1.00 43.68 ? 76   THR A C     1 
ATOM   332   O O     . THR A  1 44  ? 32.969  -1.206  13.969  1.00 38.96 ? 76   THR A O     1 
ATOM   333   C CB    . THR A  1 44  ? 34.925  -2.130  11.344  1.00 42.29 ? 76   THR A CB    1 
ATOM   334   O OG1   . THR A  1 44  ? 36.241  -2.347  10.828  1.00 40.21 ? 76   THR A OG1   1 
ATOM   335   C CG2   . THR A  1 44  ? 34.276  -0.981  10.604  1.00 38.69 ? 76   THR A CG2   1 
ATOM   336   N N     . ARG A  1 45  ? 33.275  -3.383  13.441  1.00 45.52 ? 77   ARG A N     1 
ATOM   337   C CA    . ARG A  1 45  ? 32.017  -3.839  14.001  1.00 48.17 ? 77   ARG A CA    1 
ATOM   338   C C     . ARG A  1 45  ? 31.877  -3.333  15.421  1.00 47.98 ? 77   ARG A C     1 
ATOM   339   O O     . ARG A  1 45  ? 30.987  -2.535  15.712  1.00 49.60 ? 77   ARG A O     1 
ATOM   340   C CB    . ARG A  1 45  ? 31.955  -5.367  14.007  1.00 53.82 ? 77   ARG A CB    1 
ATOM   341   C CG    . ARG A  1 45  ? 32.809  -6.028  12.952  1.00 64.89 ? 77   ARG A CG    1 
ATOM   342   C CD    . ARG A  1 45  ? 32.033  -7.096  12.215  1.00 72.13 ? 77   ARG A CD    1 
ATOM   343   N NE    . ARG A  1 45  ? 32.483  -7.228  10.834  1.00 83.82 ? 77   ARG A NE    1 
ATOM   344   C CZ    . ARG A  1 45  ? 32.482  -8.370  10.155  1.00 88.60 ? 77   ARG A CZ    1 
ATOM   345   N NH1   . ARG A  1 45  ? 32.054  -9.488  10.732  1.00 88.46 ? 77   ARG A NH1   1 
ATOM   346   N NH2   . ARG A  1 45  ? 32.907  -8.396  8.898   1.00 90.95 ? 77   ARG A NH2   1 
ATOM   347   N N     . ILE A  1 46  ? 32.758  -3.797  16.302  1.00 44.12 ? 78   ILE A N     1 
ATOM   348   C CA    . ILE A  1 46  ? 32.723  -3.396  17.704  1.00 43.41 ? 78   ILE A CA    1 
ATOM   349   C C     . ILE A  1 46  ? 32.669  -1.877  17.838  1.00 46.25 ? 78   ILE A C     1 
ATOM   350   O O     . ILE A  1 46  ? 32.122  -1.342  18.804  1.00 45.59 ? 78   ILE A O     1 
ATOM   351   C CB    . ILE A  1 46  ? 33.960  -3.910  18.476  1.00 43.95 ? 78   ILE A CB    1 
ATOM   352   C CG1   . ILE A  1 46  ? 34.655  -5.021  17.684  1.00 42.75 ? 78   ILE A CG1   1 
ATOM   353   C CG2   . ILE A  1 46  ? 33.542  -4.402  19.865  1.00 44.01 ? 78   ILE A CG2   1 
ATOM   354   C CD1   . ILE A  1 46  ? 33.822  -6.264  17.494  1.00 37.19 ? 78   ILE A CD1   1 
ATOM   355   N N     . LYS A  1 47  ? 33.238  -1.187  16.858  1.00 48.37 ? 79   LYS A N     1 
ATOM   356   C CA    . LYS A  1 47  ? 33.243  0.270   16.867  1.00 52.56 ? 79   LYS A CA    1 
ATOM   357   C C     . LYS A  1 47  ? 31.837  0.783   16.597  1.00 52.42 ? 79   LYS A C     1 
ATOM   358   O O     . LYS A  1 47  ? 31.397  1.758   17.200  1.00 54.46 ? 79   LYS A O     1 
ATOM   359   C CB    . LYS A  1 47  ? 34.215  0.811   15.807  1.00 55.42 ? 79   LYS A CB    1 
ATOM   360   C CG    . LYS A  1 47  ? 35.631  1.058   16.339  1.00 61.12 ? 79   LYS A CG    1 
ATOM   361   C CD    . LYS A  1 47  ? 36.496  1.856   15.368  1.00 64.24 ? 79   LYS A CD    1 
ATOM   362   C CE    . LYS A  1 47  ? 37.873  2.139   15.971  1.00 67.43 ? 79   LYS A CE    1 
ATOM   363   N NZ    . LYS A  1 47  ? 38.855  2.645   14.967  1.00 68.95 ? 79   LYS A NZ    1 
ATOM   364   N N     . LEU A  1 48  ? 31.135  0.112   15.691  1.00 52.48 ? 80   LEU A N     1 
ATOM   365   C CA    . LEU A  1 48  ? 29.774  0.492   15.326  1.00 51.34 ? 80   LEU A CA    1 
ATOM   366   C C     . LEU A  1 48  ? 28.750  0.043   16.367  1.00 51.82 ? 80   LEU A C     1 
ATOM   367   O O     . LEU A  1 48  ? 27.766  0.741   16.636  1.00 50.52 ? 80   LEU A O     1 
ATOM   368   C CB    . LEU A  1 48  ? 29.429  -0.104  13.961  1.00 49.62 ? 80   LEU A CB    1 
ATOM   369   C CG    . LEU A  1 48  ? 30.539  0.139   12.940  1.00 51.36 ? 80   LEU A CG    1 
ATOM   370   C CD1   . LEU A  1 48  ? 30.153  -0.488  11.609  1.00 48.09 ? 80   LEU A CD1   1 
ATOM   371   C CD2   . LEU A  1 48  ? 30.784  1.648   12.799  1.00 50.22 ? 80   LEU A CD2   1 
ATOM   372   N N     . LEU A  1 49  ? 28.991  -1.125  16.952  1.00 50.66 ? 81   LEU A N     1 
ATOM   373   C CA    . LEU A  1 49  ? 28.108  -1.668  17.969  1.00 51.22 ? 81   LEU A CA    1 
ATOM   374   C C     . LEU A  1 49  ? 28.448  -1.004  19.289  1.00 49.19 ? 81   LEU A C     1 
ATOM   375   O O     . LEU A  1 49  ? 28.417  -1.623  20.344  1.00 48.91 ? 81   LEU A O     1 
ATOM   376   C CB    . LEU A  1 49  ? 28.290  -3.181  18.069  1.00 52.61 ? 81   LEU A CB    1 
ATOM   377   C CG    . LEU A  1 49  ? 28.402  -3.898  16.720  1.00 55.94 ? 81   LEU A CG    1 
ATOM   378   C CD1   . LEU A  1 49  ? 28.243  -5.395  16.930  1.00 58.08 ? 81   LEU A CD1   1 
ATOM   379   C CD2   . LEU A  1 49  ? 27.344  -3.369  15.749  1.00 56.13 ? 81   LEU A CD2   1 
ATOM   380   N N     . LEU A  1 50  ? 28.782  0.274   19.198  1.00 49.13 ? 82   LEU A N     1 
ATOM   381   C CA    . LEU A  1 50  ? 29.135  1.097   20.346  1.00 50.44 ? 82   LEU A CA    1 
ATOM   382   C C     . LEU A  1 50  ? 29.037  2.544   19.866  1.00 51.18 ? 82   LEU A C     1 
ATOM   383   O O     . LEU A  1 50  ? 29.501  3.473   20.537  1.00 50.25 ? 82   LEU A O     1 
ATOM   384   C CB    . LEU A  1 50  ? 30.564  0.790   20.812  1.00 50.99 ? 82   LEU A CB    1 
ATOM   385   C CG    . LEU A  1 50  ? 30.772  -0.525  21.574  1.00 50.83 ? 82   LEU A CG    1 
ATOM   386   C CD1   . LEU A  1 50  ? 32.247  -0.866  21.626  1.00 49.13 ? 82   LEU A CD1   1 
ATOM   387   C CD2   . LEU A  1 50  ? 30.213  -0.399  22.978  1.00 49.88 ? 82   LEU A CD2   1 
ATOM   388   N N     . LYS A  1 51  ? 28.431  2.709   18.687  1.00 50.94 ? 83   LYS A N     1 
ATOM   389   C CA    . LYS A  1 51  ? 28.244  4.020   18.072  1.00 50.38 ? 83   LYS A CA    1 
ATOM   390   C C     . LYS A  1 51  ? 26.787  4.438   18.169  1.00 47.52 ? 83   LYS A C     1 
ATOM   391   O O     . LYS A  1 51  ? 25.962  4.001   17.370  1.00 47.75 ? 83   LYS A O     1 
ATOM   392   C CB    . LYS A  1 51  ? 28.655  3.995   16.596  1.00 53.68 ? 83   LYS A CB    1 
ATOM   393   C CG    . LYS A  1 51  ? 28.691  5.380   15.951  1.00 57.05 ? 83   LYS A CG    1 
ATOM   394   C CD    . LYS A  1 51  ? 28.247  5.333   14.496  1.00 61.87 ? 83   LYS A CD    1 
ATOM   395   C CE    . LYS A  1 51  ? 27.671  6.670   14.044  1.00 64.53 ? 83   LYS A CE    1 
ATOM   396   N NZ    . LYS A  1 51  ? 27.217  6.644   12.621  1.00 66.18 ? 83   LYS A NZ    1 
ATOM   397   N N     . PRO A  1 52  ? 26.458  5.300   19.147  1.00 45.54 ? 84   PRO A N     1 
ATOM   398   C CA    . PRO A  1 52  ? 25.103  5.813   19.395  1.00 41.51 ? 84   PRO A CA    1 
ATOM   399   C C     . PRO A  1 52  ? 24.623  6.815   18.343  1.00 38.66 ? 84   PRO A C     1 
ATOM   400   O O     . PRO A  1 52  ? 25.349  7.736   17.973  1.00 38.11 ? 84   PRO A O     1 
ATOM   401   C CB    . PRO A  1 52  ? 25.220  6.462   20.768  1.00 43.24 ? 84   PRO A CB    1 
ATOM   402   C CG    . PRO A  1 52  ? 26.642  6.915   20.830  1.00 43.68 ? 84   PRO A CG    1 
ATOM   403   C CD    . PRO A  1 52  ? 27.433  5.858   20.103  1.00 42.23 ? 84   PRO A CD    1 
ATOM   404   N N     . THR A  1 53  ? 23.395  6.640   17.869  1.00 37.10 ? 85   THR A N     1 
ATOM   405   C CA    . THR A  1 53  ? 22.848  7.556   16.868  1.00 34.86 ? 85   THR A CA    1 
ATOM   406   C C     . THR A  1 53  ? 22.908  9.028   17.324  1.00 33.70 ? 85   THR A C     1 
ATOM   407   O O     . THR A  1 53  ? 22.671  9.350   18.493  1.00 33.97 ? 85   THR A O     1 
ATOM   408   C CB    . THR A  1 53  ? 21.381  7.215   16.530  1.00 33.41 ? 85   THR A CB    1 
ATOM   409   O OG1   . THR A  1 53  ? 20.510  8.195   17.124  1.00 32.88 ? 85   THR A OG1   1 
ATOM   410   C CG2   . THR A  1 53  ? 21.032  5.821   17.035  1.00 32.73 ? 85   THR A CG2   1 
ATOM   411   N N     . PRO A  1 54  ? 23.208  9.940   16.392  1.00 30.78 ? 86   PRO A N     1 
ATOM   412   C CA    . PRO A  1 54  ? 23.299  11.370  16.700  1.00 31.13 ? 86   PRO A CA    1 
ATOM   413   C C     . PRO A  1 54  ? 22.061  11.870  17.412  1.00 30.82 ? 86   PRO A C     1 
ATOM   414   O O     . PRO A  1 54  ? 22.135  12.725  18.297  1.00 29.99 ? 86   PRO A O     1 
ATOM   415   C CB    . PRO A  1 54  ? 23.459  12.030  15.331  1.00 29.90 ? 86   PRO A CB    1 
ATOM   416   C CG    . PRO A  1 54  ? 23.072  10.968  14.332  1.00 32.41 ? 86   PRO A CG    1 
ATOM   417   C CD    . PRO A  1 54  ? 23.450  9.674   14.967  1.00 31.65 ? 86   PRO A CD    1 
ATOM   418   N N     . ASN A  1 55  ? 20.920  11.331  16.999  1.00 32.31 ? 87   ASN A N     1 
ATOM   419   C CA    . ASN A  1 55  ? 19.636  11.704  17.573  1.00 34.12 ? 87   ASN A CA    1 
ATOM   420   C C     . ASN A  1 55  ? 19.644  11.287  19.029  1.00 33.47 ? 87   ASN A C     1 
ATOM   421   O O     . ASN A  1 55  ? 19.236  12.046  19.912  1.00 33.61 ? 87   ASN A O     1 
ATOM   422   C CB    . ASN A  1 55  ? 18.507  10.997  16.822  1.00 36.45 ? 87   ASN A CB    1 
ATOM   423   C CG    . ASN A  1 55  ? 18.357  11.492  15.395  1.00 40.77 ? 87   ASN A CG    1 
ATOM   424   O OD1   . ASN A  1 55  ? 18.900  12.534  15.026  1.00 42.98 ? 87   ASN A OD1   1 
ATOM   425   N ND2   . ASN A  1 55  ? 17.616  10.748  14.586  1.00 44.19 ? 87   ASN A ND2   1 
ATOM   426   N N     . THR A  1 56  ? 20.116  10.070  19.273  1.00 32.94 ? 88   THR A N     1 
ATOM   427   C CA    . THR A  1 56  ? 20.201  9.566   20.632  1.00 36.32 ? 88   THR A CA    1 
ATOM   428   C C     . THR A  1 56  ? 20.957  10.611  21.448  1.00 34.73 ? 88   THR A C     1 
ATOM   429   O O     . THR A  1 56  ? 20.418  11.230  22.371  1.00 35.16 ? 88   THR A O     1 
ATOM   430   C CB    . THR A  1 56  ? 20.999  8.250   20.685  1.00 36.10 ? 88   THR A CB    1 
ATOM   431   O OG1   . THR A  1 56  ? 20.364  7.269   19.858  1.00 41.48 ? 88   THR A OG1   1 
ATOM   432   C CG2   . THR A  1 56  ? 21.087  7.737   22.119  1.00 40.06 ? 88   THR A CG2   1 
ATOM   433   N N     . VAL A  1 57  ? 22.216  10.801  21.075  1.00 34.14 ? 89   VAL A N     1 
ATOM   434   C CA    . VAL A  1 57  ? 23.092  11.752  21.737  1.00 33.89 ? 89   VAL A CA    1 
ATOM   435   C C     . VAL A  1 57  ? 22.427  13.105  21.894  1.00 33.91 ? 89   VAL A C     1 
ATOM   436   O O     . VAL A  1 57  ? 22.240  13.600  23.008  1.00 33.14 ? 89   VAL A O     1 
ATOM   437   C CB    . VAL A  1 57  ? 24.375  11.927  20.947  1.00 31.41 ? 89   VAL A CB    1 
ATOM   438   C CG1   . VAL A  1 57  ? 25.531  12.145  21.900  1.00 32.71 ? 89   VAL A CG1   1 
ATOM   439   C CG2   . VAL A  1 57  ? 24.614  10.699  20.082  1.00 28.13 ? 89   VAL A CG2   1 
ATOM   440   N N     . HIS A  1 58  ? 22.083  13.700  20.763  1.00 32.45 ? 90   HIS A N     1 
ATOM   441   C CA    . HIS A  1 58  ? 21.422  14.991  20.758  1.00 35.25 ? 90   HIS A CA    1 
ATOM   442   C C     . HIS A  1 58  ? 20.420  14.987  21.899  1.00 34.19 ? 90   HIS A C     1 
ATOM   443   O O     . HIS A  1 58  ? 20.347  15.921  22.701  1.00 32.00 ? 90   HIS A O     1 
ATOM   444   C CB    . HIS A  1 58  ? 20.688  15.214  19.429  1.00 35.97 ? 90   HIS A CB    1 
ATOM   445   C CG    . HIS A  1 58  ? 19.977  16.528  19.353  1.00 39.08 ? 90   HIS A CG    1 
ATOM   446   N ND1   . HIS A  1 58  ? 19.829  17.358  20.444  1.00 39.15 ? 90   HIS A ND1   1 
ATOM   447   C CD2   . HIS A  1 58  ? 19.390  17.167  18.316  1.00 39.32 ? 90   HIS A CD2   1 
ATOM   448   C CE1   . HIS A  1 58  ? 19.183  18.452  20.083  1.00 40.15 ? 90   HIS A CE1   1 
ATOM   449   N NE2   . HIS A  1 58  ? 18.905  18.360  18.796  1.00 41.52 ? 90   HIS A NE2   1 
ATOM   450   N N     . TYR A  1 59  ? 19.653  13.909  21.960  1.00 33.13 ? 91   TYR A N     1 
ATOM   451   C CA    . TYR A  1 59  ? 18.659  13.759  22.993  1.00 34.26 ? 91   TYR A CA    1 
ATOM   452   C C     . TYR A  1 59  ? 19.353  13.935  24.345  1.00 31.26 ? 91   TYR A C     1 
ATOM   453   O O     . TYR A  1 59  ? 19.134  14.929  25.052  1.00 29.29 ? 91   TYR A O     1 
ATOM   454   C CB    . TYR A  1 59  ? 18.013  12.371  22.895  1.00 42.00 ? 91   TYR A CB    1 
ATOM   455   C CG    . TYR A  1 59  ? 17.110  12.054  24.055  1.00 51.68 ? 91   TYR A CG    1 
ATOM   456   C CD1   . TYR A  1 59  ? 15.732  12.195  23.945  1.00 55.52 ? 91   TYR A CD1   1 
ATOM   457   C CD2   . TYR A  1 59  ? 17.638  11.681  25.291  1.00 55.83 ? 91   TYR A CD2   1 
ATOM   458   C CE1   . TYR A  1 59  ? 14.902  11.983  25.038  1.00 59.21 ? 91   TYR A CE1   1 
ATOM   459   C CE2   . TYR A  1 59  ? 16.820  11.467  26.389  1.00 59.96 ? 91   TYR A CE2   1 
ATOM   460   C CZ    . TYR A  1 59  ? 15.453  11.624  26.257  1.00 62.72 ? 91   TYR A CZ    1 
ATOM   461   O OH    . TYR A  1 59  ? 14.644  11.455  27.355  1.00 63.13 ? 91   TYR A OH    1 
ATOM   462   N N     . ILE A  1 60  ? 20.197  12.971  24.691  1.00 24.87 ? 92   ILE A N     1 
ATOM   463   C CA    . ILE A  1 60  ? 20.896  13.020  25.956  1.00 21.22 ? 92   ILE A CA    1 
ATOM   464   C C     . ILE A  1 60  ? 21.498  14.379  26.237  1.00 24.94 ? 92   ILE A C     1 
ATOM   465   O O     . ILE A  1 60  ? 21.573  14.796  27.389  1.00 25.20 ? 92   ILE A O     1 
ATOM   466   C CB    . ILE A  1 60  ? 22.010  11.978  26.027  1.00 18.80 ? 92   ILE A CB    1 
ATOM   467   C CG1   . ILE A  1 60  ? 22.163  11.271  24.676  1.00 15.38 ? 92   ILE A CG1   1 
ATOM   468   C CG2   . ILE A  1 60  ? 21.723  11.008  27.169  1.00 18.88 ? 92   ILE A CG2   1 
ATOM   469   C CD1   . ILE A  1 60  ? 21.878  9.775   24.678  1.00 8.00  ? 92   ILE A CD1   1 
ATOM   470   N N     . LEU A  1 61  ? 21.907  15.073  25.181  1.00 25.74 ? 93   LEU A N     1 
ATOM   471   C CA    . LEU A  1 61  ? 22.524  16.397  25.307  1.00 29.82 ? 93   LEU A CA    1 
ATOM   472   C C     . LEU A  1 61  ? 21.535  17.460  25.735  1.00 28.48 ? 93   LEU A C     1 
ATOM   473   O O     . LEU A  1 61  ? 21.882  18.422  26.424  1.00 25.52 ? 93   LEU A O     1 
ATOM   474   C CB    . LEU A  1 61  ? 23.119  16.839  23.968  1.00 32.48 ? 93   LEU A CB    1 
ATOM   475   C CG    . LEU A  1 61  ? 24.624  16.707  23.722  1.00 35.01 ? 93   LEU A CG    1 
ATOM   476   C CD1   . LEU A  1 61  ? 25.390  16.640  25.053  1.00 33.10 ? 93   LEU A CD1   1 
ATOM   477   C CD2   . LEU A  1 61  ? 24.859  15.454  22.881  1.00 35.01 ? 93   LEU A CD2   1 
ATOM   478   N N     . THR A  1 62  ? 20.299  17.274  25.296  1.00 33.27 ? 94   THR A N     1 
ATOM   479   C CA    . THR A  1 62  ? 19.221  18.216  25.568  1.00 38.97 ? 94   THR A CA    1 
ATOM   480   C C     . THR A  1 62  ? 18.303  17.814  26.715  1.00 36.26 ? 94   THR A C     1 
ATOM   481   O O     . THR A  1 62  ? 17.295  18.477  26.966  1.00 33.48 ? 94   THR A O     1 
ATOM   482   C CB    . THR A  1 62  ? 18.373  18.406  24.306  1.00 37.60 ? 94   THR A CB    1 
ATOM   483   O OG1   . THR A  1 62  ? 18.264  17.149  23.620  1.00 37.74 ? 94   THR A OG1   1 
ATOM   484   C CG2   . THR A  1 62  ? 19.029  19.422  23.382  1.00 37.85 ? 94   THR A CG2   1 
ATOM   485   N N     . HIS A  1 63  ? 18.649  16.735  27.410  1.00 37.85 ? 95   HIS A N     1 
ATOM   486   C CA    . HIS A  1 63  ? 17.829  16.279  28.523  1.00 40.66 ? 95   HIS A CA    1 
ATOM   487   C C     . HIS A  1 63  ? 18.580  16.213  29.844  1.00 36.80 ? 95   HIS A C     1 
ATOM   488   O O     . HIS A  1 63  ? 19.580  16.899  30.022  1.00 38.07 ? 95   HIS A O     1 
ATOM   489   C CB    . HIS A  1 63  ? 17.223  14.922  28.183  1.00 44.58 ? 95   HIS A CB    1 
ATOM   490   C CG    . HIS A  1 63  ? 16.156  15.003  27.140  1.00 50.87 ? 95   HIS A CG    1 
ATOM   491   N ND1   . HIS A  1 63  ? 16.440  15.042  25.792  1.00 55.00 ? 95   HIS A ND1   1 
ATOM   492   C CD2   . HIS A  1 63  ? 14.812  15.117  27.246  1.00 51.86 ? 95   HIS A CD2   1 
ATOM   493   C CE1   . HIS A  1 63  ? 15.316  15.180  25.112  1.00 54.58 ? 95   HIS A CE1   1 
ATOM   494   N NE2   . HIS A  1 63  ? 14.314  15.227  25.971  1.00 53.96 ? 95   HIS A NE2   1 
ATOM   495   N N     . PHE A  1 64  ? 18.075  15.409  30.772  1.00 34.18 ? 96   PHE A N     1 
ATOM   496   C CA    . PHE A  1 64  ? 18.694  15.243  32.082  1.00 30.31 ? 96   PHE A CA    1 
ATOM   497   C C     . PHE A  1 64  ? 19.279  16.539  32.625  1.00 27.82 ? 96   PHE A C     1 
ATOM   498   O O     . PHE A  1 64  ? 20.212  16.509  33.424  1.00 26.27 ? 96   PHE A O     1 
ATOM   499   C CB    . PHE A  1 64  ? 19.787  14.180  32.004  1.00 32.41 ? 96   PHE A CB    1 
ATOM   500   C CG    . PHE A  1 64  ? 19.387  12.959  31.232  1.00 34.82 ? 96   PHE A CG    1 
ATOM   501   C CD1   . PHE A  1 64  ? 19.149  13.028  29.865  1.00 37.64 ? 96   PHE A CD1   1 
ATOM   502   C CD2   . PHE A  1 64  ? 19.233  11.741  31.876  1.00 37.67 ? 96   PHE A CD2   1 
ATOM   503   C CE1   . PHE A  1 64  ? 18.758  11.896  29.147  1.00 40.33 ? 96   PHE A CE1   1 
ATOM   504   C CE2   . PHE A  1 64  ? 18.843  10.599  31.171  1.00 39.25 ? 96   PHE A CE2   1 
ATOM   505   C CZ    . PHE A  1 64  ? 18.604  10.676  29.803  1.00 38.85 ? 96   PHE A CZ    1 
ATOM   506   N N     . LYS A  1 65  ? 18.717  17.667  32.193  1.00 23.54 ? 97   LYS A N     1 
ATOM   507   C CA    . LYS A  1 65  ? 19.172  18.990  32.609  1.00 24.86 ? 97   LYS A CA    1 
ATOM   508   C C     . LYS A  1 65  ? 19.761  19.025  34.026  1.00 26.07 ? 97   LYS A C     1 
ATOM   509   O O     . LYS A  1 65  ? 20.758  19.713  34.283  1.00 28.21 ? 97   LYS A O     1 
ATOM   510   C CB    . LYS A  1 65  ? 18.021  19.993  32.496  1.00 22.91 ? 97   LYS A CB    1 
ATOM   511   C CG    . LYS A  1 65  ? 18.298  21.347  33.145  1.00 20.36 ? 97   LYS A CG    1 
ATOM   512   C CD    . LYS A  1 65  ? 17.248  22.380  32.739  1.00 22.22 ? 97   LYS A CD    1 
ATOM   513   C CE    . LYS A  1 65  ? 17.486  23.744  33.412  1.00 19.50 ? 97   LYS A CE    1 
ATOM   514   N NZ    . LYS A  1 65  ? 16.228  24.369  33.934  1.00 21.21 ? 97   LYS A NZ    1 
ATOM   515   N N     . GLY A  1 66  ? 19.148  18.293  34.947  1.00 27.05 ? 98   GLY A N     1 
ATOM   516   C CA    . GLY A  1 66  ? 19.671  18.270  36.301  1.00 28.28 ? 98   GLY A CA    1 
ATOM   517   C C     . GLY A  1 66  ? 21.124  17.811  36.309  1.00 28.83 ? 98   GLY A C     1 
ATOM   518   O O     . GLY A  1 66  ? 22.011  18.499  36.827  1.00 27.22 ? 98   GLY A O     1 
ATOM   519   N N     . VAL A  1 67  ? 21.359  16.635  35.729  1.00 32.16 ? 99   VAL A N     1 
ATOM   520   C CA    . VAL A  1 67  ? 22.686  16.055  35.643  1.00 33.94 ? 99   VAL A CA    1 
ATOM   521   C C     . VAL A  1 67  ? 23.628  17.017  34.930  1.00 35.31 ? 99   VAL A C     1 
ATOM   522   O O     . VAL A  1 67  ? 24.719  17.305  35.425  1.00 34.01 ? 99   VAL A O     1 
ATOM   523   C CB    . VAL A  1 67  ? 22.632  14.701  34.898  1.00 31.15 ? 99   VAL A CB    1 
ATOM   524   C CG1   . VAL A  1 67  ? 23.672  14.645  33.803  1.00 29.75 ? 99   VAL A CG1   1 
ATOM   525   C CG2   . VAL A  1 67  ? 22.853  13.584  35.867  1.00 29.30 ? 99   VAL A CG2   1 
ATOM   526   N N     . TRP A  1 68  ? 23.201  17.523  33.774  1.00 37.30 ? 100  TRP A N     1 
ATOM   527   C CA    . TRP A  1 68  ? 24.023  18.456  33.010  1.00 40.56 ? 100  TRP A CA    1 
ATOM   528   C C     . TRP A  1 68  ? 24.447  19.620  33.889  1.00 41.43 ? 100  TRP A C     1 
ATOM   529   O O     . TRP A  1 68  ? 25.538  20.158  33.733  1.00 42.19 ? 100  TRP A O     1 
ATOM   530   C CB    . TRP A  1 68  ? 23.261  18.980  31.794  1.00 41.58 ? 100  TRP A CB    1 
ATOM   531   C CG    . TRP A  1 68  ? 23.278  18.031  30.641  1.00 46.60 ? 100  TRP A CG    1 
ATOM   532   C CD1   . TRP A  1 68  ? 22.207  17.620  29.917  1.00 47.47 ? 100  TRP A CD1   1 
ATOM   533   C CD2   . TRP A  1 68  ? 24.419  17.349  30.093  1.00 49.47 ? 100  TRP A CD2   1 
ATOM   534   N NE1   . TRP A  1 68  ? 22.596  16.723  28.951  1.00 49.10 ? 100  TRP A NE1   1 
ATOM   535   C CE2   . TRP A  1 68  ? 23.948  16.536  29.035  1.00 51.05 ? 100  TRP A CE2   1 
ATOM   536   C CE3   . TRP A  1 68  ? 25.790  17.343  30.394  1.00 52.35 ? 100  TRP A CE3   1 
ATOM   537   C CZ2   . TRP A  1 68  ? 24.801  15.724  28.269  1.00 52.34 ? 100  TRP A CZ2   1 
ATOM   538   C CZ3   . TRP A  1 68  ? 26.640  16.532  29.633  1.00 55.65 ? 100  TRP A CZ3   1 
ATOM   539   C CH2   . TRP A  1 68  ? 26.137  15.734  28.582  1.00 55.27 ? 100  TRP A CH2   1 
ATOM   540   N N     . ASN A  1 69  ? 23.579  20.006  34.815  1.00 43.89 ? 101  ASN A N     1 
ATOM   541   C CA    . ASN A  1 69  ? 23.893  21.098  35.720  1.00 44.44 ? 101  ASN A CA    1 
ATOM   542   C C     . ASN A  1 69  ? 25.026  20.677  36.647  1.00 42.96 ? 101  ASN A C     1 
ATOM   543   O O     . ASN A  1 69  ? 25.866  21.489  37.034  1.00 40.18 ? 101  ASN A O     1 
ATOM   544   C CB    . ASN A  1 69  ? 22.668  21.474  36.551  1.00 46.93 ? 101  ASN A CB    1 
ATOM   545   C CG    . ASN A  1 69  ? 22.731  22.907  37.059  1.00 53.73 ? 101  ASN A CG    1 
ATOM   546   O OD1   . ASN A  1 69  ? 22.634  23.859  36.279  1.00 53.95 ? 101  ASN A OD1   1 
ATOM   547   N ND2   . ASN A  1 69  ? 22.899  23.068  38.371  1.00 53.53 ? 101  ASN A ND2   1 
ATOM   548   N N     . ILE A  1 70  ? 25.038  19.400  37.006  1.00 39.96 ? 102  ILE A N     1 
ATOM   549   C CA    . ILE A  1 70  ? 26.080  18.875  37.873  1.00 39.99 ? 102  ILE A CA    1 
ATOM   550   C C     . ILE A  1 70  ? 27.439  19.001  37.185  1.00 40.78 ? 102  ILE A C     1 
ATOM   551   O O     . ILE A  1 70  ? 28.359  19.632  37.714  1.00 38.96 ? 102  ILE A O     1 
ATOM   552   C CB    . ILE A  1 70  ? 25.822  17.399  38.204  1.00 40.63 ? 102  ILE A CB    1 
ATOM   553   C CG1   . ILE A  1 70  ? 24.591  17.293  39.109  1.00 38.58 ? 102  ILE A CG1   1 
ATOM   554   C CG2   . ILE A  1 70  ? 27.065  16.774  38.842  1.00 37.78 ? 102  ILE A CG2   1 
ATOM   555   C CD1   . ILE A  1 70  ? 23.645  16.158  38.722  1.00 38.60 ? 102  ILE A CD1   1 
ATOM   556   N N     . VAL A  1 71  ? 27.551  18.401  36.001  1.00 39.46 ? 103  VAL A N     1 
ATOM   557   C CA    . VAL A  1 71  ? 28.791  18.440  35.230  1.00 37.43 ? 103  VAL A CA    1 
ATOM   558   C C     . VAL A  1 71  ? 29.178  19.866  34.858  1.00 37.71 ? 103  VAL A C     1 
ATOM   559   O O     . VAL A  1 71  ? 30.340  20.231  34.927  1.00 38.28 ? 103  VAL A O     1 
ATOM   560   C CB    . VAL A  1 71  ? 28.674  17.594  33.936  1.00 33.34 ? 103  VAL A CB    1 
ATOM   561   C CG1   . VAL A  1 71  ? 29.053  18.421  32.716  1.00 35.48 ? 103  VAL A CG1   1 
ATOM   562   C CG2   . VAL A  1 71  ? 29.570  16.387  34.036  1.00 32.40 ? 103  VAL A CG2   1 
ATOM   563   N N     . ASN A  1 72  ? 28.197  20.671  34.472  1.00 38.45 ? 104  ASN A N     1 
ATOM   564   C CA    . ASN A  1 72  ? 28.454  22.050  34.079  1.00 40.30 ? 104  ASN A CA    1 
ATOM   565   C C     . ASN A  1 72  ? 29.194  22.836  35.155  1.00 41.89 ? 104  ASN A C     1 
ATOM   566   O O     . ASN A  1 72  ? 29.516  24.011  34.960  1.00 43.80 ? 104  ASN A O     1 
ATOM   567   C CB    . ASN A  1 72  ? 27.134  22.752  33.745  1.00 38.45 ? 104  ASN A CB    1 
ATOM   568   C CG    . ASN A  1 72  ? 26.821  22.714  32.268  1.00 38.07 ? 104  ASN A CG    1 
ATOM   569   O OD1   . ASN A  1 72  ? 27.143  21.745  31.585  1.00 34.45 ? 104  ASN A OD1   1 
ATOM   570   N ND2   . ASN A  1 72  ? 26.196  23.771  31.762  1.00 37.56 ? 104  ASN A ND2   1 
ATOM   571   N N     . ASN A  1 73  ? 29.471  22.182  36.282  1.00 44.57 ? 105  ASN A N     1 
ATOM   572   C CA    . ASN A  1 73  ? 30.158  22.837  37.392  1.00 48.55 ? 105  ASN A CA    1 
ATOM   573   C C     . ASN A  1 73  ? 31.395  22.095  37.917  1.00 45.27 ? 105  ASN A C     1 
ATOM   574   O O     . ASN A  1 73  ? 32.014  22.525  38.885  1.00 41.28 ? 105  ASN A O     1 
ATOM   575   C CB    . ASN A  1 73  ? 29.162  23.073  38.537  1.00 54.72 ? 105  ASN A CB    1 
ATOM   576   C CG    . ASN A  1 73  ? 28.102  24.125  38.192  1.00 62.68 ? 105  ASN A CG    1 
ATOM   577   O OD1   . ASN A  1 73  ? 28.241  25.302  38.542  1.00 65.31 ? 105  ASN A OD1   1 
ATOM   578   N ND2   . ASN A  1 73  ? 27.039  23.701  37.507  1.00 68.58 ? 105  ASN A ND2   1 
ATOM   579   N N     . ILE A  1 74  A 31.745  20.982  37.279  1.00 45.65 ? 105  ILE A N     1 
ATOM   580   C CA    . ILE A  1 74  A 32.917  20.202  37.670  1.00 43.69 ? 105  ILE A CA    1 
ATOM   581   C C     . ILE A  1 74  A 33.925  20.193  36.519  1.00 45.97 ? 105  ILE A C     1 
ATOM   582   O O     . ILE A  1 74  A 33.986  19.252  35.717  1.00 46.76 ? 105  ILE A O     1 
ATOM   583   C CB    . ILE A  1 74  A 32.533  18.764  38.043  1.00 39.49 ? 105  ILE A CB    1 
ATOM   584   C CG1   . ILE A  1 74  A 31.736  18.776  39.357  1.00 36.95 ? 105  ILE A CG1   1 
ATOM   585   C CG2   . ILE A  1 74  A 33.783  17.906  38.138  1.00 34.21 ? 105  ILE A CG2   1 
ATOM   586   C CD1   . ILE A  1 74  A 31.784  17.483  40.169  1.00 33.99 ? 105  ILE A CD1   1 
ATOM   587   N N     . PRO A  1 75  ? 34.738  21.260  36.442  1.00 45.09 ? 106  PRO A N     1 
ATOM   588   C CA    . PRO A  1 75  ? 35.778  21.504  35.447  1.00 45.30 ? 106  PRO A CA    1 
ATOM   589   C C     . PRO A  1 75  ? 36.251  20.280  34.679  1.00 44.93 ? 106  PRO A C     1 
ATOM   590   O O     . PRO A  1 75  ? 35.947  20.146  33.496  1.00 45.70 ? 106  PRO A O     1 
ATOM   591   C CB    . PRO A  1 75  ? 36.882  22.155  36.267  1.00 45.09 ? 106  PRO A CB    1 
ATOM   592   C CG    . PRO A  1 75  ? 36.116  22.951  37.326  1.00 42.31 ? 106  PRO A CG    1 
ATOM   593   C CD    . PRO A  1 75  ? 34.716  22.350  37.436  1.00 44.01 ? 106  PRO A CD    1 
ATOM   594   N N     . PHE A  1 76  ? 36.985  19.384  35.330  1.00 44.41 ? 107  PHE A N     1 
ATOM   595   C CA    . PHE A  1 76  ? 37.462  18.215  34.608  1.00 46.59 ? 107  PHE A CA    1 
ATOM   596   C C     . PHE A  1 76  ? 36.331  17.548  33.852  1.00 45.60 ? 107  PHE A C     1 
ATOM   597   O O     . PHE A  1 76  ? 36.464  17.228  32.670  1.00 46.81 ? 107  PHE A O     1 
ATOM   598   C CB    . PHE A  1 76  ? 38.149  17.195  35.528  1.00 49.50 ? 107  PHE A CB    1 
ATOM   599   C CG    . PHE A  1 76  ? 37.490  17.012  36.861  1.00 54.63 ? 107  PHE A CG    1 
ATOM   600   C CD1   . PHE A  1 76  ? 36.949  15.778  37.207  1.00 56.49 ? 107  PHE A CD1   1 
ATOM   601   C CD2   . PHE A  1 76  ? 37.473  18.044  37.804  1.00 55.80 ? 107  PHE A CD2   1 
ATOM   602   C CE1   . PHE A  1 76  ? 36.406  15.566  38.474  1.00 55.52 ? 107  PHE A CE1   1 
ATOM   603   C CE2   . PHE A  1 76  ? 36.935  17.847  39.073  1.00 55.75 ? 107  PHE A CE2   1 
ATOM   604   C CZ    . PHE A  1 76  ? 36.400  16.603  39.411  1.00 56.34 ? 107  PHE A CZ    1 
ATOM   605   N N     . LEU A  1 77  ? 35.205  17.361  34.525  1.00 43.34 ? 108  LEU A N     1 
ATOM   606   C CA    . LEU A  1 77  ? 34.067  16.734  33.884  1.00 38.72 ? 108  LEU A CA    1 
ATOM   607   C C     . LEU A  1 77  ? 33.681  17.492  32.624  1.00 34.66 ? 108  LEU A C     1 
ATOM   608   O O     . LEU A  1 77  ? 33.746  16.956  31.521  1.00 30.78 ? 108  LEU A O     1 
ATOM   609   C CB    . LEU A  1 77  ? 32.894  16.696  34.849  1.00 41.05 ? 108  LEU A CB    1 
ATOM   610   C CG    . LEU A  1 77  ? 32.835  15.430  35.700  1.00 42.14 ? 108  LEU A CG    1 
ATOM   611   C CD1   . LEU A  1 77  ? 31.675  15.534  36.676  1.00 41.17 ? 108  LEU A CD1   1 
ATOM   612   C CD2   . LEU A  1 77  ? 32.670  14.211  34.797  1.00 43.80 ? 108  LEU A CD2   1 
ATOM   613   N N     . ARG A  1 78  ? 33.293  18.748  32.800  1.00 31.40 ? 109  ARG A N     1 
ATOM   614   C CA    . ARG A  1 78  ? 32.889  19.585  31.675  1.00 31.06 ? 109  ARG A CA    1 
ATOM   615   C C     . ARG A  1 78  ? 33.858  19.399  30.509  1.00 30.62 ? 109  ARG A C     1 
ATOM   616   O O     . ARG A  1 78  ? 33.492  18.935  29.423  1.00 28.74 ? 109  ARG A O     1 
ATOM   617   C CB    . ARG A  1 78  ? 32.850  21.062  32.104  1.00 29.39 ? 109  ARG A CB    1 
ATOM   618   C CG    . ARG A  1 78  ? 32.622  22.039  30.964  1.00 31.22 ? 109  ARG A CG    1 
ATOM   619   C CD    . ARG A  1 78  ? 31.996  23.363  31.432  1.00 30.29 ? 109  ARG A CD    1 
ATOM   620   N NE    . ARG A  1 78  ? 31.731  24.267  30.303  1.00 28.31 ? 109  ARG A NE    1 
ATOM   621   C CZ    . ARG A  1 78  ? 31.840  25.593  30.352  1.00 27.29 ? 109  ARG A CZ    1 
ATOM   622   N NH1   . ARG A  1 78  ? 32.207  26.189  31.474  1.00 23.75 ? 109  ARG A NH1   1 
ATOM   623   N NH2   . ARG A  1 78  ? 31.586  26.326  29.277  1.00 28.01 ? 109  ARG A NH2   1 
ATOM   624   N N     . SER A  1 79  ? 35.106  19.762  30.754  1.00 28.14 ? 110  SER A N     1 
ATOM   625   C CA    . SER A  1 79  ? 36.140  19.644  29.753  1.00 25.42 ? 110  SER A CA    1 
ATOM   626   C C     . SER A  1 79  ? 36.113  18.240  29.178  1.00 25.77 ? 110  SER A C     1 
ATOM   627   O O     . SER A  1 79  ? 35.920  18.050  27.969  1.00 24.71 ? 110  SER A O     1 
ATOM   628   C CB    . SER A  1 79  ? 37.492  19.941  30.394  1.00 23.21 ? 110  SER A CB    1 
ATOM   629   O OG    . SER A  1 79  ? 37.392  21.075  31.241  1.00 17.88 ? 110  SER A OG    1 
ATOM   630   N N     . LEU A  1 80  ? 36.287  17.258  30.055  1.00 24.94 ? 111  LEU A N     1 
ATOM   631   C CA    . LEU A  1 80  ? 36.289  15.856  29.642  1.00 24.94 ? 111  LEU A CA    1 
ATOM   632   C C     . LEU A  1 80  ? 35.218  15.626  28.577  1.00 24.54 ? 111  LEU A C     1 
ATOM   633   O O     . LEU A  1 80  ? 35.433  14.922  27.593  1.00 21.85 ? 111  LEU A O     1 
ATOM   634   C CB    . LEU A  1 80  ? 36.052  14.966  30.865  1.00 24.82 ? 111  LEU A CB    1 
ATOM   635   C CG    . LEU A  1 80  ? 35.112  13.761  30.782  1.00 24.58 ? 111  LEU A CG    1 
ATOM   636   C CD1   . LEU A  1 80  ? 35.918  12.500  30.507  1.00 23.33 ? 111  LEU A CD1   1 
ATOM   637   C CD2   . LEU A  1 80  ? 34.352  13.621  32.102  1.00 20.27 ? 111  LEU A CD2   1 
ATOM   638   N N     . ILE A  1 81  ? 34.072  16.262  28.775  1.00 24.37 ? 112  ILE A N     1 
ATOM   639   C CA    . ILE A  1 81  ? 32.966  16.155  27.841  1.00 21.20 ? 112  ILE A CA    1 
ATOM   640   C C     . ILE A  1 81  ? 33.261  16.970  26.581  1.00 21.53 ? 112  ILE A C     1 
ATOM   641   O O     . ILE A  1 81  ? 33.460  16.409  25.497  1.00 15.51 ? 112  ILE A O     1 
ATOM   642   C CB    . ILE A  1 81  ? 31.658  16.686  28.480  1.00 23.84 ? 112  ILE A CB    1 
ATOM   643   C CG1   . ILE A  1 81  ? 31.397  15.957  29.803  1.00 22.49 ? 112  ILE A CG1   1 
ATOM   644   C CG2   . ILE A  1 81  ? 30.487  16.522  27.507  1.00 19.96 ? 112  ILE A CG2   1 
ATOM   645   C CD1   . ILE A  1 81  ? 31.071  14.476  29.656  1.00 21.95 ? 112  ILE A CD1   1 
ATOM   646   N N     . MET A  1 82  ? 33.276  18.291  26.752  1.00 18.73 ? 113  MET A N     1 
ATOM   647   C CA    . MET A  1 82  ? 33.519  19.231  25.668  1.00 18.94 ? 113  MET A CA    1 
ATOM   648   C C     . MET A  1 82  ? 34.570  18.681  24.724  1.00 21.84 ? 113  MET A C     1 
ATOM   649   O O     . MET A  1 82  ? 34.466  18.769  23.490  1.00 15.80 ? 113  MET A O     1 
ATOM   650   C CB    . MET A  1 82  ? 33.994  20.557  26.241  1.00 19.78 ? 113  MET A CB    1 
ATOM   651   C CG    . MET A  1 82  ? 34.350  21.581  25.188  1.00 21.22 ? 113  MET A CG    1 
ATOM   652   S SD    . MET A  1 82  ? 32.894  22.249  24.306  1.00 31.02 ? 113  MET A SD    1 
ATOM   653   C CE    . MET A  1 82  ? 33.245  21.736  22.579  1.00 25.20 ? 113  MET A CE    1 
ATOM   654   N N     . LYS A  1 83  ? 35.598  18.112  25.340  1.00 29.19 ? 114  LYS A N     1 
ATOM   655   C CA    . LYS A  1 83  ? 36.696  17.504  24.612  1.00 30.92 ? 114  LYS A CA    1 
ATOM   656   C C     . LYS A  1 83  ? 36.087  16.380  23.794  1.00 30.17 ? 114  LYS A C     1 
ATOM   657   O O     . LYS A  1 83  ? 36.173  16.373  22.574  1.00 25.20 ? 114  LYS A O     1 
ATOM   658   C CB    . LYS A  1 83  ? 37.718  16.942  25.601  1.00 35.78 ? 114  LYS A CB    1 
ATOM   659   C CG    . LYS A  1 83  ? 38.394  15.651  25.161  1.00 41.42 ? 114  LYS A CG    1 
ATOM   660   C CD    . LYS A  1 83  ? 39.785  15.520  25.793  1.00 52.44 ? 114  LYS A CD    1 
ATOM   661   C CE    . LYS A  1 83  ? 40.193  14.055  25.973  1.00 59.08 ? 114  LYS A CE    1 
ATOM   662   N NZ    . LYS A  1 83  ? 41.274  13.862  26.993  1.00 61.43 ? 114  LYS A NZ    1 
ATOM   663   N N     . TYR A  1 84  ? 35.450  15.445  24.490  1.00 29.64 ? 115  TYR A N     1 
ATOM   664   C CA    . TYR A  1 84  ? 34.826  14.321  23.830  1.00 29.67 ? 115  TYR A CA    1 
ATOM   665   C C     . TYR A  1 84  ? 34.074  14.827  22.620  1.00 24.84 ? 115  TYR A C     1 
ATOM   666   O O     . TYR A  1 84  ? 34.161  14.269  21.537  1.00 20.90 ? 115  TYR A O     1 
ATOM   667   C CB    . TYR A  1 84  ? 33.826  13.614  24.746  1.00 37.70 ? 115  TYR A CB    1 
ATOM   668   C CG    . TYR A  1 84  ? 32.715  13.002  23.924  1.00 48.37 ? 115  TYR A CG    1 
ATOM   669   C CD1   . TYR A  1 84  ? 32.922  11.809  23.220  1.00 49.94 ? 115  TYR A CD1   1 
ATOM   670   C CD2   . TYR A  1 84  ? 31.507  13.680  23.731  1.00 50.98 ? 115  TYR A CD2   1 
ATOM   671   C CE1   . TYR A  1 84  ? 31.963  11.315  22.335  1.00 55.17 ? 115  TYR A CE1   1 
ATOM   672   C CE2   . TYR A  1 84  ? 30.544  13.193  22.849  1.00 54.69 ? 115  TYR A CE2   1 
ATOM   673   C CZ    . TYR A  1 84  ? 30.779  12.013  22.151  1.00 56.78 ? 115  TYR A CZ    1 
ATOM   674   O OH    . TYR A  1 84  ? 29.848  11.549  21.246  1.00 60.96 ? 115  TYR A OH    1 
ATOM   675   N N     . VAL A  1 85  ? 33.302  15.879  22.827  1.00 21.22 ? 116  VAL A N     1 
ATOM   676   C CA    . VAL A  1 85  ? 32.527  16.444  21.741  1.00 19.74 ? 116  VAL A CA    1 
ATOM   677   C C     . VAL A  1 85  ? 33.485  16.919  20.657  1.00 19.53 ? 116  VAL A C     1 
ATOM   678   O O     . VAL A  1 85  ? 33.292  16.646  19.464  1.00 20.25 ? 116  VAL A O     1 
ATOM   679   C CB    . VAL A  1 85  ? 31.630  17.628  22.228  1.00 19.53 ? 116  VAL A CB    1 
ATOM   680   C CG1   . VAL A  1 85  ? 31.644  17.706  23.741  1.00 16.05 ? 116  VAL A CG1   1 
ATOM   681   C CG2   . VAL A  1 85  ? 32.086  18.945  21.609  1.00 16.13 ? 116  VAL A CG2   1 
ATOM   682   N N     . LEU A  1 86  ? 34.525  17.626  21.080  1.00 18.79 ? 117  LEU A N     1 
ATOM   683   C CA    . LEU A  1 86  ? 35.517  18.127  20.142  1.00 17.51 ? 117  LEU A CA    1 
ATOM   684   C C     . LEU A  1 86  ? 36.044  16.978  19.287  1.00 19.30 ? 117  LEU A C     1 
ATOM   685   O O     . LEU A  1 86  ? 35.937  16.990  18.061  1.00 19.23 ? 117  LEU A O     1 
ATOM   686   C CB    . LEU A  1 86  ? 36.669  18.773  20.910  1.00 10.96 ? 117  LEU A CB    1 
ATOM   687   C CG    . LEU A  1 86  ? 36.732  20.296  20.820  1.00 4.75  ? 117  LEU A CG    1 
ATOM   688   C CD1   . LEU A  1 86  ? 35.805  20.821  19.712  1.00 8.41  ? 117  LEU A CD1   1 
ATOM   689   C CD2   . LEU A  1 86  ? 36.322  20.859  22.148  1.00 6.75  ? 117  LEU A CD2   1 
ATOM   690   N N     . THR A  1 87  ? 36.601  15.982  19.963  1.00 21.53 ? 118  THR A N     1 
ATOM   691   C CA    . THR A  1 87  ? 37.155  14.804  19.321  1.00 24.62 ? 118  THR A CA    1 
ATOM   692   C C     . THR A  1 87  ? 36.140  13.946  18.562  1.00 26.40 ? 118  THR A C     1 
ATOM   693   O O     . THR A  1 87  ? 36.480  13.359  17.534  1.00 25.94 ? 118  THR A O     1 
ATOM   694   C CB    . THR A  1 87  ? 37.860  13.923  20.353  1.00 22.02 ? 118  THR A CB    1 
ATOM   695   O OG1   . THR A  1 87  ? 36.978  13.671  21.452  1.00 22.71 ? 118  THR A OG1   1 
ATOM   696   C CG2   . THR A  1 87  ? 39.099  14.622  20.864  1.00 19.39 ? 118  THR A CG2   1 
ATOM   697   N N     . SER A  1 88  ? 34.909  13.870  19.065  1.00 30.38 ? 119  SER A N     1 
ATOM   698   C CA    . SER A  1 88  ? 33.882  13.068  18.413  1.00 33.96 ? 119  SER A CA    1 
ATOM   699   C C     . SER A  1 88  ? 33.849  13.463  16.957  1.00 36.67 ? 119  SER A C     1 
ATOM   700   O O     . SER A  1 88  ? 33.942  12.609  16.080  1.00 37.91 ? 119  SER A O     1 
ATOM   701   C CB    . SER A  1 88  ? 32.508  13.311  19.040  1.00 33.97 ? 119  SER A CB    1 
ATOM   702   O OG    . SER A  1 88  ? 32.554  14.383  19.959  1.00 31.95 ? 119  SER A OG    1 
ATOM   703   N N     . ARG A  1 89  ? 33.728  14.763  16.706  1.00 40.88 ? 120  ARG A N     1 
ATOM   704   C CA    . ARG A  1 89  ? 33.692  15.272  15.341  1.00 45.76 ? 120  ARG A CA    1 
ATOM   705   C C     . ARG A  1 89  ? 35.054  15.019  14.705  1.00 49.93 ? 120  ARG A C     1 
ATOM   706   O O     . ARG A  1 89  ? 35.270  13.972  14.090  1.00 50.65 ? 120  ARG A O     1 
ATOM   707   C CB    . ARG A  1 89  ? 33.369  16.765  15.348  1.00 48.18 ? 120  ARG A CB    1 
ATOM   708   C CG    . ARG A  1 89  ? 32.174  17.111  16.233  1.00 57.17 ? 120  ARG A CG    1 
ATOM   709   C CD    . ARG A  1 89  ? 30.923  17.445  15.398  1.00 59.07 ? 120  ARG A CD    1 
ATOM   710   N NE    . ARG A  1 89  ? 29.773  16.576  15.677  1.00 56.75 ? 120  ARG A NE    1 
ATOM   711   C CZ    . ARG A  1 89  ? 28.689  16.939  16.367  1.00 54.10 ? 120  ARG A CZ    1 
ATOM   712   N NH1   . ARG A  1 89  ? 28.575  18.165  16.866  1.00 49.55 ? 120  ARG A NH1   1 
ATOM   713   N NH2   . ARG A  1 89  ? 27.707  16.068  16.556  1.00 54.84 ? 120  ARG A NH2   1 
ATOM   714   N N     . SER A  1 90  ? 35.966  15.976  14.873  1.00 50.09 ? 121  SER A N     1 
ATOM   715   C CA    . SER A  1 90  ? 37.333  15.891  14.350  1.00 49.02 ? 121  SER A CA    1 
ATOM   716   C C     . SER A  1 90  ? 37.572  14.911  13.195  1.00 49.42 ? 121  SER A C     1 
ATOM   717   O O     . SER A  1 90  ? 37.691  15.319  12.037  1.00 49.02 ? 121  SER A O     1 
ATOM   718   C CB    . SER A  1 90  ? 38.286  15.558  15.492  1.00 45.09 ? 121  SER A CB    1 
ATOM   719   O OG    . SER A  1 90  ? 37.590  15.570  16.718  1.00 43.98 ? 121  SER A OG    1 
ATOM   720   N N     . TYR A  1 91  ? 37.646  13.624  13.517  1.00 49.60 ? 122  TYR A N     1 
ATOM   721   C CA    . TYR A  1 91  ? 37.893  12.584  12.519  1.00 52.34 ? 122  TYR A CA    1 
ATOM   722   C C     . TYR A  1 91  ? 36.969  12.589  11.295  1.00 48.51 ? 122  TYR A C     1 
ATOM   723   O O     . TYR A  1 91  ? 36.952  11.633  10.518  1.00 49.66 ? 122  TYR A O     1 
ATOM   724   C CB    . TYR A  1 91  ? 37.819  11.213  13.189  1.00 59.29 ? 122  TYR A CB    1 
ATOM   725   C CG    . TYR A  1 91  ? 36.463  10.551  13.062  1.00 66.19 ? 122  TYR A CG    1 
ATOM   726   C CD1   . TYR A  1 91  ? 36.264  9.491   12.173  1.00 68.10 ? 122  TYR A CD1   1 
ATOM   727   C CD2   . TYR A  1 91  ? 35.371  10.997  13.817  1.00 68.12 ? 122  TYR A CD2   1 
ATOM   728   C CE1   . TYR A  1 91  ? 35.008  8.889   12.033  1.00 69.46 ? 122  TYR A CE1   1 
ATOM   729   C CE2   . TYR A  1 91  ? 34.109  10.404  13.686  1.00 68.73 ? 122  TYR A CE2   1 
ATOM   730   C CZ    . TYR A  1 91  ? 33.935  9.349   12.791  1.00 71.93 ? 122  TYR A CZ    1 
ATOM   731   O OH    . TYR A  1 91  ? 32.692  8.763   12.644  1.00 71.45 ? 122  TYR A OH    1 
ATOM   732   N N     . LEU A  1 92  ? 36.207  13.657  11.111  1.00 46.76 ? 123  LEU A N     1 
ATOM   733   C CA    . LEU A  1 92  ? 35.293  13.718  9.991   1.00 43.50 ? 123  LEU A CA    1 
ATOM   734   C C     . LEU A  1 92  ? 35.784  14.471  8.763   1.00 44.52 ? 123  LEU A C     1 
ATOM   735   O O     . LEU A  1 92  ? 35.773  13.918  7.664   1.00 43.15 ? 123  LEU A O     1 
ATOM   736   C CB    . LEU A  1 92  ? 33.965  14.310  10.455  1.00 45.63 ? 123  LEU A CB    1 
ATOM   737   C CG    . LEU A  1 92  ? 32.733  13.450  10.168  1.00 45.95 ? 123  LEU A CG    1 
ATOM   738   C CD1   . LEU A  1 92  ? 32.939  12.036  10.693  1.00 46.51 ? 123  LEU A CD1   1 
ATOM   739   C CD2   . LEU A  1 92  ? 31.523  14.098  10.813  1.00 45.71 ? 123  LEU A CD2   1 
ATOM   740   N N     . ILE A  1 93  ? 36.208  15.721  8.942   1.00 43.27 ? 124  ILE A N     1 
ATOM   741   C CA    . ILE A  1 93  ? 36.673  16.545  7.821   1.00 45.93 ? 124  ILE A CA    1 
ATOM   742   C C     . ILE A  1 93  ? 37.939  16.042  7.134   1.00 46.34 ? 124  ILE A C     1 
ATOM   743   O O     . ILE A  1 93  ? 38.723  15.280  7.706   1.00 46.39 ? 124  ILE A O     1 
ATOM   744   C CB    . ILE A  1 93  ? 36.933  18.010  8.247   1.00 46.63 ? 124  ILE A CB    1 
ATOM   745   C CG1   . ILE A  1 93  ? 35.989  18.411  9.380   1.00 48.65 ? 124  ILE A CG1   1 
ATOM   746   C CG2   . ILE A  1 93  ? 36.778  18.928  7.052   1.00 47.30 ? 124  ILE A CG2   1 
ATOM   747   C CD1   . ILE A  1 93  ? 34.666  18.961  8.915   1.00 46.13 ? 124  ILE A CD1   1 
ATOM   748   N N     . ASP A  1 94  ? 38.131  16.493  5.900   1.00 45.51 ? 125  ASP A N     1 
ATOM   749   C CA    . ASP A  1 94  ? 39.290  16.106  5.117   1.00 45.66 ? 125  ASP A CA    1 
ATOM   750   C C     . ASP A  1 94  ? 40.407  17.153  5.193   1.00 44.39 ? 125  ASP A C     1 
ATOM   751   O O     . ASP A  1 94  ? 40.657  17.863  4.219   1.00 48.13 ? 125  ASP A O     1 
ATOM   752   C CB    . ASP A  1 94  ? 38.880  15.898  3.653   1.00 48.37 ? 125  ASP A CB    1 
ATOM   753   C CG    . ASP A  1 94  ? 38.642  14.437  3.309   1.00 53.85 ? 125  ASP A CG    1 
ATOM   754   O OD1   . ASP A  1 94  ? 38.947  13.564  4.155   1.00 56.51 ? 125  ASP A OD1   1 
ATOM   755   O OD2   . ASP A  1 94  ? 38.150  14.160  2.192   1.00 52.77 ? 125  ASP A OD2   1 
ATOM   756   N N     . SER A  1 95  ? 41.074  17.265  6.341   1.00 40.91 ? 126  SER A N     1 
ATOM   757   C CA    . SER A  1 95  ? 42.174  18.224  6.461   1.00 37.04 ? 126  SER A CA    1 
ATOM   758   C C     . SER A  1 95  ? 43.490  17.492  6.620   1.00 32.16 ? 126  SER A C     1 
ATOM   759   O O     . SER A  1 95  ? 43.632  16.647  7.497   1.00 32.57 ? 126  SER A O     1 
ATOM   760   C CB    . SER A  1 95  ? 41.986  19.155  7.650   1.00 37.27 ? 126  SER A CB    1 
ATOM   761   O OG    . SER A  1 95  ? 42.786  20.313  7.474   1.00 38.29 ? 126  SER A OG    1 
ATOM   762   N N     . PRO A  1 96  ? 44.483  17.823  5.780   1.00 27.71 ? 127  PRO A N     1 
ATOM   763   C CA    . PRO A  1 96  ? 44.424  18.838  4.717   1.00 25.52 ? 127  PRO A CA    1 
ATOM   764   C C     . PRO A  1 96  ? 43.404  18.581  3.581   1.00 20.61 ? 127  PRO A C     1 
ATOM   765   O O     . PRO A  1 96  ? 43.136  17.436  3.207   1.00 17.91 ? 127  PRO A O     1 
ATOM   766   C CB    . PRO A  1 96  ? 45.863  18.886  4.201   1.00 24.56 ? 127  PRO A CB    1 
ATOM   767   C CG    . PRO A  1 96  ? 46.386  17.500  4.466   1.00 24.59 ? 127  PRO A CG    1 
ATOM   768   C CD    . PRO A  1 96  ? 45.788  17.138  5.806   1.00 25.00 ? 127  PRO A CD    1 
ATOM   769   N N     . PRO A  1 97  ? 42.834  19.666  3.020   1.00 16.61 ? 128  PRO A N     1 
ATOM   770   C CA    . PRO A  1 97  ? 41.841  19.697  1.938   1.00 17.16 ? 128  PRO A CA    1 
ATOM   771   C C     . PRO A  1 97  ? 42.078  18.720  0.808   1.00 15.08 ? 128  PRO A C     1 
ATOM   772   O O     . PRO A  1 97  ? 43.204  18.330  0.547   1.00 16.26 ? 128  PRO A O     1 
ATOM   773   C CB    . PRO A  1 97  ? 41.871  21.148  1.443   1.00 12.91 ? 128  PRO A CB    1 
ATOM   774   C CG    . PRO A  1 97  ? 42.894  21.852  2.259   1.00 15.50 ? 128  PRO A CG    1 
ATOM   775   C CD    . PRO A  1 97  ? 43.153  21.028  3.480   1.00 22.22 ? 128  PRO A CD    1 
ATOM   776   N N     . THR A  1 98  ? 40.999  18.338  0.135   1.00 14.92 ? 129  THR A N     1 
ATOM   777   C CA    . THR A  1 98  ? 41.091  17.401  -0.973  1.00 16.33 ? 129  THR A CA    1 
ATOM   778   C C     . THR A  1 98  ? 40.458  17.974  -2.226  1.00 16.52 ? 129  THR A C     1 
ATOM   779   O O     . THR A  1 98  ? 41.047  18.855  -2.862  1.00 18.90 ? 129  THR A O     1 
ATOM   780   C CB    . THR A  1 98  ? 40.418  16.045  -0.644  1.00 14.17 ? 129  THR A CB    1 
ATOM   781   O OG1   . THR A  1 98  ? 39.072  16.276  -0.214  1.00 20.00 ? 129  THR A OG1   1 
ATOM   782   C CG2   . THR A  1 98  ? 41.179  15.320  0.471   1.00 14.33 ? 129  THR A CG2   1 
ATOM   783   N N     . TYR A  1 99  ? 39.256  17.499  -2.568  1.00 18.22 ? 130  TYR A N     1 
ATOM   784   C CA    . TYR A  1 99  ? 38.562  17.951  -3.784  1.00 17.49 ? 130  TYR A CA    1 
ATOM   785   C C     . TYR A  1 99  ? 37.920  19.329  -3.756  1.00 19.23 ? 130  TYR A C     1 
ATOM   786   O O     . TYR A  1 99  ? 37.798  19.971  -2.709  1.00 15.19 ? 130  TYR A O     1 
ATOM   787   C CB    . TYR A  1 99  ? 37.489  16.953  -4.198  1.00 12.48 ? 130  TYR A CB    1 
ATOM   788   C CG    . TYR A  1 99  ? 37.782  15.533  -3.819  1.00 8.05  ? 130  TYR A CG    1 
ATOM   789   C CD1   . TYR A  1 99  ? 37.548  15.080  -2.529  1.00 2.00  ? 130  TYR A CD1   1 
ATOM   790   C CD2   . TYR A  1 99  ? 38.264  14.633  -4.757  1.00 2.00  ? 130  TYR A CD2   1 
ATOM   791   C CE1   . TYR A  1 99  ? 37.785  13.758  -2.175  1.00 3.77  ? 130  TYR A CE1   1 
ATOM   792   C CE2   . TYR A  1 99  ? 38.506  13.304  -4.415  1.00 2.00  ? 130  TYR A CE2   1 
ATOM   793   C CZ    . TYR A  1 99  ? 38.263  12.874  -3.123  1.00 5.73  ? 130  TYR A CZ    1 
ATOM   794   O OH    . TYR A  1 99  ? 38.482  11.560  -2.774  1.00 6.49  ? 130  TYR A OH    1 
ATOM   795   N N     . ASN A  1 100 ? 37.516  19.764  -4.946  1.00 16.77 ? 131  ASN A N     1 
ATOM   796   C CA    . ASN A  1 100 ? 36.869  21.053  -5.137  1.00 17.07 ? 131  ASN A CA    1 
ATOM   797   C C     . ASN A  1 100 ? 35.987  20.953  -6.376  1.00 18.30 ? 131  ASN A C     1 
ATOM   798   O O     . ASN A  1 100 ? 35.859  19.876  -6.988  1.00 19.37 ? 131  ASN A O     1 
ATOM   799   C CB    . ASN A  1 100 ? 37.906  22.158  -5.345  1.00 17.76 ? 131  ASN A CB    1 
ATOM   800   C CG    . ASN A  1 100 ? 38.613  22.065  -6.710  1.00 21.30 ? 131  ASN A CG    1 
ATOM   801   O OD1   . ASN A  1 100 ? 38.119  21.439  -7.649  1.00 20.27 ? 131  ASN A OD1   1 
ATOM   802   N ND2   . ASN A  1 100 ? 39.774  22.700  -6.815  1.00 19.60 ? 131  ASN A ND2   1 
ATOM   803   N N     . VAL A  1 101 ? 35.406  22.089  -6.755  1.00 17.15 ? 132  VAL A N     1 
ATOM   804   C CA    . VAL A  1 101 ? 34.534  22.156  -7.914  1.00 16.01 ? 132  VAL A CA    1 
ATOM   805   C C     . VAL A  1 101 ? 35.060  21.348  -9.087  1.00 18.21 ? 132  VAL A C     1 
ATOM   806   O O     . VAL A  1 101 ? 34.488  20.312  -9.441  1.00 18.92 ? 132  VAL A O     1 
ATOM   807   C CB    . VAL A  1 101 ? 34.347  23.600  -8.393  1.00 13.82 ? 132  VAL A CB    1 
ATOM   808   C CG1   . VAL A  1 101 ? 34.066  23.624  -9.878  1.00 13.43 ? 132  VAL A CG1   1 
ATOM   809   C CG2   . VAL A  1 101 ? 33.194  24.241  -7.650  1.00 14.23 ? 132  VAL A CG2   1 
ATOM   810   N N     . HIS A  1 102 ? 36.157  21.815  -9.675  1.00 16.37 ? 133  HIS A N     1 
ATOM   811   C CA    . HIS A  1 102 ? 36.726  21.157  -10.835 1.00 17.71 ? 133  HIS A CA    1 
ATOM   812   C C     . HIS A  1 102 ? 37.463  19.857  -10.618 1.00 16.21 ? 133  HIS A C     1 
ATOM   813   O O     . HIS A  1 102 ? 37.732  19.150  -11.583 1.00 15.56 ? 133  HIS A O     1 
ATOM   814   C CB    . HIS A  1 102 ? 37.655  22.116  -11.544 1.00 22.89 ? 133  HIS A CB    1 
ATOM   815   C CG    . HIS A  1 102 ? 36.970  23.335  -12.060 1.00 28.38 ? 133  HIS A CG    1 
ATOM   816   N ND1   . HIS A  1 102 ? 37.253  24.600  -11.596 1.00 29.02 ? 133  HIS A ND1   1 
ATOM   817   C CD2   . HIS A  1 102 ? 36.018  23.486  -13.010 1.00 30.98 ? 133  HIS A CD2   1 
ATOM   818   C CE1   . HIS A  1 102 ? 36.507  25.481  -12.237 1.00 31.29 ? 133  HIS A CE1   1 
ATOM   819   N NE2   . HIS A  1 102 ? 35.749  24.831  -13.101 1.00 33.14 ? 133  HIS A NE2   1 
ATOM   820   N N     . TYR A  1 103 ? 37.777  19.514  -9.377  1.00 14.05 ? 134  TYR A N     1 
ATOM   821   C CA    . TYR A  1 103 ? 38.535  18.295  -9.177  1.00 15.64 ? 134  TYR A CA    1 
ATOM   822   C C     . TYR A  1 103 ? 37.901  17.216  -8.316  1.00 16.68 ? 134  TYR A C     1 
ATOM   823   O O     . TYR A  1 103 ? 37.708  17.381  -7.098  1.00 16.29 ? 134  TYR A O     1 
ATOM   824   C CB    . TYR A  1 103 ? 39.950  18.632  -8.652  1.00 16.30 ? 134  TYR A CB    1 
ATOM   825   C CG    . TYR A  1 103 ? 40.824  19.385  -9.653  1.00 11.68 ? 134  TYR A CG    1 
ATOM   826   C CD1   . TYR A  1 103 ? 40.910  20.776  -9.614  1.00 8.47  ? 134  TYR A CD1   1 
ATOM   827   C CD2   . TYR A  1 103 ? 41.515  18.707  -10.668 1.00 7.71  ? 134  TYR A CD2   1 
ATOM   828   C CE1   . TYR A  1 103 ? 41.653  21.481  -10.556 1.00 10.35 ? 134  TYR A CE1   1 
ATOM   829   C CE2   . TYR A  1 103 ? 42.267  19.397  -11.623 1.00 5.06  ? 134  TYR A CE2   1 
ATOM   830   C CZ    . TYR A  1 103 ? 42.331  20.794  -11.564 1.00 12.63 ? 134  TYR A CZ    1 
ATOM   831   O OH    . TYR A  1 103 ? 43.049  21.525  -12.509 1.00 10.07 ? 134  TYR A OH    1 
ATOM   832   N N     . GLY A  1 104 ? 37.597  16.100  -8.975  1.00 14.21 ? 135  GLY A N     1 
ATOM   833   C CA    . GLY A  1 104 ? 37.005  14.959  -8.301  1.00 13.56 ? 135  GLY A CA    1 
ATOM   834   C C     . GLY A  1 104 ? 38.037  13.974  -7.768  1.00 11.70 ? 135  GLY A C     1 
ATOM   835   O O     . GLY A  1 104 ? 37.718  13.060  -7.007  1.00 10.07 ? 135  GLY A O     1 
ATOM   836   N N     . TYR A  1 105 ? 39.282  14.138  -8.199  1.00 13.53 ? 136  TYR A N     1 
ATOM   837   C CA    . TYR A  1 105 ? 40.382  13.288  -7.725  1.00 10.77 ? 136  TYR A CA    1 
ATOM   838   C C     . TYR A  1 105 ? 41.294  14.247  -6.967  1.00 10.90 ? 136  TYR A C     1 
ATOM   839   O O     . TYR A  1 105 ? 41.203  15.480  -7.174  1.00 7.69  ? 136  TYR A O     1 
ATOM   840   C CB    . TYR A  1 105 ? 41.142  12.647  -8.901  1.00 6.24  ? 136  TYR A CB    1 
ATOM   841   C CG    . TYR A  1 105 ? 41.416  13.587  -10.041 1.00 5.12  ? 136  TYR A CG    1 
ATOM   842   C CD1   . TYR A  1 105 ? 41.922  14.866  -9.807  1.00 10.52 ? 136  TYR A CD1   1 
ATOM   843   C CD2   . TYR A  1 105 ? 41.157  13.218  -11.347 1.00 2.00  ? 136  TYR A CD2   1 
ATOM   844   C CE1   . TYR A  1 105 ? 42.165  15.755  -10.855 1.00 8.85  ? 136  TYR A CE1   1 
ATOM   845   C CE2   . TYR A  1 105 ? 41.392  14.099  -12.410 1.00 2.00  ? 136  TYR A CE2   1 
ATOM   846   C CZ    . TYR A  1 105 ? 41.896  15.363  -12.154 1.00 5.41  ? 136  TYR A CZ    1 
ATOM   847   O OH    . TYR A  1 105 ? 42.138  16.236  -13.185 1.00 3.54  ? 136  TYR A OH    1 
ATOM   848   N N     . LYS A  1 106 ? 42.140  13.716  -6.079  1.00 10.59 ? 137  LYS A N     1 
ATOM   849   C CA    . LYS A  1 106 ? 43.050  14.594  -5.337  1.00 10.26 ? 137  LYS A CA    1 
ATOM   850   C C     . LYS A  1 106 ? 44.021  15.124  -6.362  1.00 8.63  ? 137  LYS A C     1 
ATOM   851   O O     . LYS A  1 106 ? 44.471  14.392  -7.239  1.00 5.97  ? 137  LYS A O     1 
ATOM   852   C CB    . LYS A  1 106 ? 43.819  13.844  -4.254  1.00 8.31  ? 137  LYS A CB    1 
ATOM   853   C CG    . LYS A  1 106 ? 43.017  13.596  -2.994  1.00 8.94  ? 137  LYS A CG    1 
ATOM   854   C CD    . LYS A  1 106 ? 42.687  12.107  -2.846  1.00 2.00  ? 137  LYS A CD    1 
ATOM   855   C CE    . LYS A  1 106 ? 42.654  11.708  -1.395  1.00 7.04  ? 137  LYS A CE    1 
ATOM   856   N NZ    . LYS A  1 106 ? 43.322  10.407  -1.132  1.00 12.38 ? 137  LYS A NZ    1 
ATOM   857   N N     . SER A  1 107 ? 44.318  16.406  -6.266  1.00 6.62  ? 138  SER A N     1 
ATOM   858   C CA    . SER A  1 107 ? 45.234  17.009  -7.206  1.00 8.58  ? 138  SER A CA    1 
ATOM   859   C C     . SER A  1 107 ? 45.985  18.154  -6.519  1.00 9.03  ? 138  SER A C     1 
ATOM   860   O O     . SER A  1 107 ? 45.501  18.729  -5.521  1.00 2.73  ? 138  SER A O     1 
ATOM   861   C CB    . SER A  1 107 ? 44.458  17.504  -8.436  1.00 5.97  ? 138  SER A CB    1 
ATOM   862   O OG    . SER A  1 107 ? 44.413  18.928  -8.501  1.00 7.60  ? 138  SER A OG    1 
ATOM   863   N N     . TRP A  1 108 ? 47.177  18.463  -7.041  1.00 9.36  ? 139  TRP A N     1 
ATOM   864   C CA    . TRP A  1 108 ? 47.970  19.531  -6.466  1.00 10.61 ? 139  TRP A CA    1 
ATOM   865   C C     . TRP A  1 108 ? 47.235  20.823  -6.701  1.00 6.04  ? 139  TRP A C     1 
ATOM   866   O O     . TRP A  1 108 ? 46.974  21.571  -5.759  1.00 2.00  ? 139  TRP A O     1 
ATOM   867   C CB    . TRP A  1 108 ? 49.374  19.626  -7.081  1.00 7.72  ? 139  TRP A CB    1 
ATOM   868   C CG    . TRP A  1 108 ? 50.183  20.616  -6.297  1.00 7.97  ? 139  TRP A CG    1 
ATOM   869   C CD1   . TRP A  1 108 ? 50.343  21.964  -6.568  1.00 2.00  ? 139  TRP A CD1   1 
ATOM   870   C CD2   . TRP A  1 108 ? 50.742  20.410  -4.984  1.00 5.01  ? 139  TRP A CD2   1 
ATOM   871   N NE1   . TRP A  1 108 ? 50.950  22.595  -5.496  1.00 2.00  ? 139  TRP A NE1   1 
ATOM   872   C CE2   . TRP A  1 108 ? 51.202  21.664  -4.515  1.00 4.65  ? 139  TRP A CE2   1 
ATOM   873   C CE3   . TRP A  1 108 ? 50.887  19.280  -4.158  1.00 2.00  ? 139  TRP A CE3   1 
ATOM   874   C CZ2   . TRP A  1 108 ? 51.800  21.816  -3.254  1.00 2.00  ? 139  TRP A CZ2   1 
ATOM   875   C CZ3   . TRP A  1 108 ? 51.479  19.441  -2.903  1.00 2.00  ? 139  TRP A CZ3   1 
ATOM   876   C CH2   . TRP A  1 108 ? 51.925  20.693  -2.467  1.00 2.00  ? 139  TRP A CH2   1 
ATOM   877   N N     . GLU A  1 109 ? 46.904  21.061  -7.971  1.00 10.02 ? 140  GLU A N     1 
ATOM   878   C CA    . GLU A  1 109 ? 46.187  22.261  -8.387  1.00 11.56 ? 140  GLU A CA    1 
ATOM   879   C C     . GLU A  1 109 ? 45.085  22.457  -7.384  1.00 6.75  ? 140  GLU A C     1 
ATOM   880   O O     . GLU A  1 109 ? 44.797  23.580  -6.983  1.00 2.00  ? 140  GLU A O     1 
ATOM   881   C CB    . GLU A  1 109 ? 45.576  22.084  -9.779  1.00 10.06 ? 140  GLU A CB    1 
ATOM   882   C CG    . GLU A  1 109 ? 44.563  23.146  -10.106 1.00 9.02  ? 140  GLU A CG    1 
ATOM   883   C CD    . GLU A  1 109 ? 45.146  24.540  -9.980  1.00 12.27 ? 140  GLU A CD    1 
ATOM   884   O OE1   . GLU A  1 109 ? 44.418  25.472  -9.568  1.00 11.80 ? 140  GLU A OE1   1 
ATOM   885   O OE2   . GLU A  1 109 ? 46.343  24.704  -10.298 1.00 12.54 ? 140  GLU A OE2   1 
ATOM   886   N N     . ALA A  1 110 ? 44.479  21.336  -6.991  1.00 7.37  ? 141  ALA A N     1 
ATOM   887   C CA    . ALA A  1 110 ? 43.414  21.332  -6.008  1.00 10.49 ? 141  ALA A CA    1 
ATOM   888   C C     . ALA A  1 110 ? 44.002  21.877  -4.715  1.00 13.99 ? 141  ALA A C     1 
ATOM   889   O O     . ALA A  1 110 ? 43.922  23.080  -4.437  1.00 15.05 ? 141  ALA A O     1 
ATOM   890   C CB    . ALA A  1 110 ? 42.915  19.929  -5.797  1.00 5.70  ? 141  ALA A CB    1 
ATOM   891   N N     . PHE A  1 111 ? 44.617  20.991  -3.939  1.00 12.72 ? 142  PHE A N     1 
ATOM   892   C CA    . PHE A  1 111 ? 45.222  21.369  -2.671  1.00 13.27 ? 142  PHE A CA    1 
ATOM   893   C C     . PHE A  1 111 ? 45.935  22.735  -2.634  1.00 13.57 ? 142  PHE A C     1 
ATOM   894   O O     . PHE A  1 111 ? 46.080  23.346  -1.565  1.00 14.53 ? 142  PHE A O     1 
ATOM   895   C CB    . PHE A  1 111 ? 46.221  20.301  -2.248  1.00 15.47 ? 142  PHE A CB    1 
ATOM   896   C CG    . PHE A  1 111 ? 47.156  20.761  -1.180  1.00 15.55 ? 142  PHE A CG    1 
ATOM   897   C CD1   . PHE A  1 111 ? 46.825  20.593  0.155   1.00 17.96 ? 142  PHE A CD1   1 
ATOM   898   C CD2   . PHE A  1 111 ? 48.325  21.443  -1.504  1.00 17.07 ? 142  PHE A CD2   1 
ATOM   899   C CE1   . PHE A  1 111 ? 47.642  21.105  1.161   1.00 20.91 ? 142  PHE A CE1   1 
ATOM   900   C CE2   . PHE A  1 111 ? 49.141  21.956  -0.513  1.00 18.41 ? 142  PHE A CE2   1 
ATOM   901   C CZ    . PHE A  1 111 ? 48.797  21.786  0.826   1.00 20.59 ? 142  PHE A CZ    1 
ATOM   902   N N     . SER A  1 112 ? 46.396  23.201  -3.785  1.00 11.97 ? 143  SER A N     1 
ATOM   903   C CA    . SER A  1 112 ? 47.118  24.455  -3.855  1.00 10.99 ? 143  SER A CA    1 
ATOM   904   C C     . SER A  1 112 ? 46.250  25.704  -3.957  1.00 13.86 ? 143  SER A C     1 
ATOM   905   O O     . SER A  1 112 ? 46.284  26.555  -3.060  1.00 11.12 ? 143  SER A O     1 
ATOM   906   C CB    . SER A  1 112 ? 48.065  24.407  -5.037  1.00 14.04 ? 143  SER A CB    1 
ATOM   907   O OG    . SER A  1 112 ? 47.335  24.239  -6.249  1.00 15.87 ? 143  SER A OG    1 
ATOM   908   N N     . ASN A  1 113 ? 45.500  25.819  -5.061  1.00 15.07 ? 144  ASN A N     1 
ATOM   909   C CA    . ASN A  1 113 ? 44.614  26.970  -5.315  1.00 11.87 ? 144  ASN A CA    1 
ATOM   910   C C     . ASN A  1 113 ? 43.751  27.338  -4.089  1.00 14.71 ? 144  ASN A C     1 
ATOM   911   O O     . ASN A  1 113 ? 42.942  26.548  -3.584  1.00 11.99 ? 144  ASN A O     1 
ATOM   912   C CB    . ASN A  1 113 ? 43.717  26.710  -6.543  1.00 2.00  ? 144  ASN A CB    1 
ATOM   913   C CG    . ASN A  1 113 ? 43.419  27.975  -7.310  1.00 5.74  ? 144  ASN A CG    1 
ATOM   914   O OD1   . ASN A  1 113 ? 43.204  29.003  -6.681  1.00 5.86  ? 144  ASN A OD1   1 
ATOM   915   N ND2   . ASN A  1 113 ? 43.430  27.912  -8.651  1.00 5.98  ? 144  ASN A ND2   1 
ATOM   916   N N     . LEU A  1 114 ? 43.940  28.555  -3.606  1.00 16.14 ? 145  LEU A N     1 
ATOM   917   C CA    . LEU A  1 114 ? 43.210  29.002  -2.439  1.00 16.57 ? 145  LEU A CA    1 
ATOM   918   C C     . LEU A  1 114 ? 41.949  29.780  -2.766  1.00 19.20 ? 145  LEU A C     1 
ATOM   919   O O     . LEU A  1 114 ? 41.184  30.132  -1.869  1.00 20.99 ? 145  LEU A O     1 
ATOM   920   C CB    . LEU A  1 114 ? 44.134  29.836  -1.556  1.00 12.34 ? 145  LEU A CB    1 
ATOM   921   C CG    . LEU A  1 114 ? 45.256  29.018  -0.918  1.00 11.90 ? 145  LEU A CG    1 
ATOM   922   C CD1   . LEU A  1 114 ? 45.749  29.723  0.336   1.00 11.89 ? 145  LEU A CD1   1 
ATOM   923   C CD2   . LEU A  1 114 ? 44.752  27.616  -0.569  1.00 9.23  ? 145  LEU A CD2   1 
ATOM   924   N N     . SER A  1 115 ? 41.731  30.061  -4.044  1.00 20.87 ? 146  SER A N     1 
ATOM   925   C CA    . SER A  1 115 ? 40.544  30.798  -4.440  1.00 21.51 ? 146  SER A CA    1 
ATOM   926   C C     . SER A  1 115 ? 39.367  29.821  -4.513  1.00 25.26 ? 146  SER A C     1 
ATOM   927   O O     . SER A  1 115 ? 38.210  30.239  -4.525  1.00 27.82 ? 146  SER A O     1 
ATOM   928   C CB    . SER A  1 115 ? 40.746  31.481  -5.800  1.00 20.17 ? 146  SER A CB    1 
ATOM   929   O OG    . SER A  1 115 ? 42.018  31.192  -6.354  1.00 25.32 ? 146  SER A OG    1 
ATOM   930   N N     . TYR A  1 116 ? 39.664  28.521  -4.558  1.00 27.28 ? 147  TYR A N     1 
ATOM   931   C CA    . TYR A  1 116 ? 38.614  27.499  -4.612  1.00 24.71 ? 147  TYR A CA    1 
ATOM   932   C C     . TYR A  1 116 ? 37.993  27.313  -3.228  1.00 21.21 ? 147  TYR A C     1 
ATOM   933   O O     . TYR A  1 116 ? 38.480  27.848  -2.241  1.00 21.73 ? 147  TYR A O     1 
ATOM   934   C CB    . TYR A  1 116 ? 39.187  26.148  -5.049  1.00 29.73 ? 147  TYR A CB    1 
ATOM   935   C CG    . TYR A  1 116 ? 39.269  25.920  -6.542  1.00 37.81 ? 147  TYR A CG    1 
ATOM   936   C CD1   . TYR A  1 116 ? 40.275  26.515  -7.304  1.00 41.98 ? 147  TYR A CD1   1 
ATOM   937   C CD2   . TYR A  1 116 ? 38.403  25.033  -7.183  1.00 41.44 ? 147  TYR A CD2   1 
ATOM   938   C CE1   . TYR A  1 116 ? 40.420  26.225  -8.660  1.00 38.44 ? 147  TYR A CE1   1 
ATOM   939   C CE2   . TYR A  1 116 ? 38.544  24.735  -8.545  1.00 38.94 ? 147  TYR A CE2   1 
ATOM   940   C CZ    . TYR A  1 116 ? 39.558  25.335  -9.267  1.00 39.39 ? 147  TYR A CZ    1 
ATOM   941   O OH    . TYR A  1 116 ? 39.733  25.034  -10.591 1.00 38.24 ? 147  TYR A OH    1 
ATOM   942   N N     . TYR A  1 117 ? 36.914  26.545  -3.177  1.00 15.21 ? 148  TYR A N     1 
ATOM   943   C CA    . TYR A  1 117 ? 36.216  26.223  -1.938  1.00 9.87  ? 148  TYR A CA    1 
ATOM   944   C C     . TYR A  1 117 ? 36.426  24.709  -1.936  1.00 9.41  ? 148  TYR A C     1 
ATOM   945   O O     . TYR A  1 117 ? 36.166  24.036  -2.940  1.00 2.00  ? 148  TYR A O     1 
ATOM   946   C CB    . TYR A  1 117 ? 34.712  26.519  -2.068  1.00 10.85 ? 148  TYR A CB    1 
ATOM   947   C CG    . TYR A  1 117 ? 34.191  27.846  -1.535  1.00 6.81  ? 148  TYR A CG    1 
ATOM   948   C CD1   . TYR A  1 117 ? 34.171  28.120  -0.171  1.00 4.85  ? 148  TYR A CD1   1 
ATOM   949   C CD2   . TYR A  1 117 ? 33.605  28.782  -2.397  1.00 6.66  ? 148  TYR A CD2   1 
ATOM   950   C CE1   . TYR A  1 117 ? 33.567  29.305  0.334   1.00 6.83  ? 148  TYR A CE1   1 
ATOM   951   C CE2   . TYR A  1 117 ? 33.001  29.962  -1.912  1.00 5.57  ? 148  TYR A CE2   1 
ATOM   952   C CZ    . TYR A  1 117 ? 32.982  30.218  -0.544  1.00 7.02  ? 148  TYR A CZ    1 
ATOM   953   O OH    . TYR A  1 117 ? 32.382  31.374  -0.057  1.00 5.84  ? 148  TYR A OH    1 
ATOM   954   N N     . THR A  1 118 ? 36.904  24.149  -0.843  1.00 6.37  ? 149  THR A N     1 
ATOM   955   C CA    . THR A  1 118 ? 37.124  22.714  -0.861  1.00 11.93 ? 149  THR A CA    1 
ATOM   956   C C     . THR A  1 118 ? 35.764  22.044  -0.837  1.00 15.57 ? 149  THR A C     1 
ATOM   957   O O     . THR A  1 118 ? 34.801  22.666  -0.413  1.00 21.62 ? 149  THR A O     1 
ATOM   958   C CB    . THR A  1 118 ? 37.972  22.259  0.355   1.00 14.34 ? 149  THR A CB    1 
ATOM   959   O OG1   . THR A  1 118 ? 38.042  20.817  0.384   1.00 18.49 ? 149  THR A OG1   1 
ATOM   960   C CG2   . THR A  1 118 ? 37.374  22.816  1.676   1.00 7.74  ? 149  THR A CG2   1 
ATOM   961   N N     . ARG A  1 119 ? 35.666  20.796  -1.293  1.00 16.39 ? 150  ARG A N     1 
ATOM   962   C CA    . ARG A  1 119 ? 34.377  20.108  -1.279  1.00 17.45 ? 150  ARG A CA    1 
ATOM   963   C C     . ARG A  1 119 ? 34.410  18.808  -0.495  1.00 17.63 ? 150  ARG A C     1 
ATOM   964   O O     . ARG A  1 119 ? 35.162  17.891  -0.825  1.00 21.25 ? 150  ARG A O     1 
ATOM   965   C CB    . ARG A  1 119 ? 33.888  19.852  -2.711  1.00 15.46 ? 150  ARG A CB    1 
ATOM   966   C CG    . ARG A  1 119 ? 33.096  21.026  -3.298  1.00 15.25 ? 150  ARG A CG    1 
ATOM   967   C CD    . ARG A  1 119 ? 31.579  20.862  -3.109  1.00 15.56 ? 150  ARG A CD    1 
ATOM   968   N NE    . ARG A  1 119 ? 31.091  19.646  -3.753  1.00 15.18 ? 150  ARG A NE    1 
ATOM   969   C CZ    . ARG A  1 119 ? 30.717  19.574  -5.025  1.00 12.22 ? 150  ARG A CZ    1 
ATOM   970   N NH1   . ARG A  1 119 ? 30.765  20.657  -5.797  1.00 2.00  ? 150  ARG A NH1   1 
ATOM   971   N NH2   . ARG A  1 119 ? 30.348  18.404  -5.534  1.00 8.86  ? 150  ARG A NH2   1 
ATOM   972   N N     . ALA A  1 120 ? 33.587  18.744  0.547   1.00 18.62 ? 151  ALA A N     1 
ATOM   973   C CA    . ALA A  1 120 ? 33.507  17.561  1.399   1.00 18.95 ? 151  ALA A CA    1 
ATOM   974   C C     . ALA A  1 120 ? 33.221  16.308  0.583   1.00 19.18 ? 151  ALA A C     1 
ATOM   975   O O     . ALA A  1 120 ? 33.529  15.194  1.016   1.00 24.02 ? 151  ALA A O     1 
ATOM   976   C CB    . ALA A  1 120 ? 32.427  17.752  2.450   1.00 24.08 ? 151  ALA A CB    1 
ATOM   977   N N     . LEU A  1 121 ? 32.597  16.493  -0.579  1.00 13.97 ? 152  LEU A N     1 
ATOM   978   C CA    . LEU A  1 121 ? 32.305  15.382  -1.475  1.00 12.19 ? 152  LEU A CA    1 
ATOM   979   C C     . LEU A  1 121 ? 32.600  15.838  -2.888  1.00 9.06  ? 152  LEU A C     1 
ATOM   980   O O     . LEU A  1 121 ? 32.266  16.956  -3.292  1.00 8.07  ? 152  LEU A O     1 
ATOM   981   C CB    . LEU A  1 121 ? 30.859  14.929  -1.356  1.00 13.84 ? 152  LEU A CB    1 
ATOM   982   C CG    . LEU A  1 121 ? 30.497  13.868  -0.298  1.00 13.84 ? 152  LEU A CG    1 
ATOM   983   C CD1   . LEU A  1 121 ? 29.030  13.469  -0.518  1.00 6.75  ? 152  LEU A CD1   1 
ATOM   984   C CD2   . LEU A  1 121 ? 31.423  12.646  -0.379  1.00 8.68  ? 152  LEU A CD2   1 
ATOM   985   N N     . PRO A  1 122 ? 33.220  14.963  -3.674  1.00 10.06 ? 153  PRO A N     1 
ATOM   986   C CA    . PRO A  1 122 ? 33.576  15.292  -5.051  1.00 13.89 ? 153  PRO A CA    1 
ATOM   987   C C     . PRO A  1 122 ? 32.374  15.614  -5.907  1.00 12.76 ? 153  PRO A C     1 
ATOM   988   O O     . PRO A  1 122 ? 31.259  15.159  -5.633  1.00 16.28 ? 153  PRO A O     1 
ATOM   989   C CB    . PRO A  1 122 ? 34.293  14.049  -5.536  1.00 8.22  ? 153  PRO A CB    1 
ATOM   990   C CG    . PRO A  1 122 ? 33.739  12.953  -4.671  1.00 10.69 ? 153  PRO A CG    1 
ATOM   991   C CD    . PRO A  1 122 ? 33.564  13.575  -3.334  1.00 10.57 ? 153  PRO A CD    1 
ATOM   992   N N     . PRO A  1 123 ? 32.577  16.440  -6.943  1.00 10.15 ? 154  PRO A N     1 
ATOM   993   C CA    . PRO A  1 123 ? 31.446  16.771  -7.810  1.00 17.09 ? 154  PRO A CA    1 
ATOM   994   C C     . PRO A  1 123 ? 31.118  15.524  -8.617  1.00 14.04 ? 154  PRO A C     1 
ATOM   995   O O     . PRO A  1 123 ? 31.603  14.426  -8.297  1.00 9.19  ? 154  PRO A O     1 
ATOM   996   C CB    . PRO A  1 123 ? 31.977  17.909  -8.685  1.00 14.19 ? 154  PRO A CB    1 
ATOM   997   C CG    . PRO A  1 123 ? 33.456  17.734  -8.672  1.00 10.46 ? 154  PRO A CG    1 
ATOM   998   C CD    . PRO A  1 123 ? 33.814  17.133  -7.348  1.00 11.49 ? 154  PRO A CD    1 
ATOM   999   N N     . VAL A  1 124 ? 30.299  15.691  -9.654  1.00 16.31 ? 155  VAL A N     1 
ATOM   1000  C CA    . VAL A  1 124 ? 29.927  14.563  -10.500 1.00 16.27 ? 155  VAL A CA    1 
ATOM   1001  C C     . VAL A  1 124 ? 30.426  14.760  -11.923 1.00 18.96 ? 155  VAL A C     1 
ATOM   1002  O O     . VAL A  1 124 ? 30.236  15.819  -12.537 1.00 17.55 ? 155  VAL A O     1 
ATOM   1003  C CB    . VAL A  1 124 ? 28.415  14.364  -10.532 1.00 16.79 ? 155  VAL A CB    1 
ATOM   1004  C CG1   . VAL A  1 124 ? 28.113  12.927  -10.922 1.00 14.50 ? 155  VAL A CG1   1 
ATOM   1005  C CG2   . VAL A  1 124 ? 27.804  14.701  -9.157  1.00 14.21 ? 155  VAL A CG2   1 
ATOM   1006  N N     . ALA A  1 125 ? 31.078  13.734  -12.444 1.00 19.16 ? 156  ALA A N     1 
ATOM   1007  C CA    . ALA A  1 125 ? 31.623  13.802  -13.788 1.00 22.53 ? 156  ALA A CA    1 
ATOM   1008  C C     . ALA A  1 125 ? 30.624  14.402  -14.734 1.00 24.23 ? 156  ALA A C     1 
ATOM   1009  O O     . ALA A  1 125 ? 29.507  13.911  -14.843 1.00 26.48 ? 156  ALA A O     1 
ATOM   1010  C CB    . ALA A  1 125 ? 32.007  12.413  -14.273 1.00 24.55 ? 156  ALA A CB    1 
ATOM   1011  N N     . ASP A  1 126 ? 31.033  15.460  -15.417 1.00 27.33 ? 157  ASP A N     1 
ATOM   1012  C CA    . ASP A  1 126 ? 30.166  16.106  -16.374 1.00 32.50 ? 157  ASP A CA    1 
ATOM   1013  C C     . ASP A  1 126 ? 29.808  15.089  -17.432 1.00 33.69 ? 157  ASP A C     1 
ATOM   1014  O O     . ASP A  1 126 ? 28.886  15.290  -18.214 1.00 40.64 ? 157  ASP A O     1 
ATOM   1015  C CB    . ASP A  1 126 ? 30.886  17.295  -16.986 1.00 36.04 ? 157  ASP A CB    1 
ATOM   1016  C CG    . ASP A  1 126 ? 31.424  18.232  -15.928 1.00 43.27 ? 157  ASP A CG    1 
ATOM   1017  O OD1   . ASP A  1 126 ? 30.883  18.201  -14.798 1.00 43.10 ? 157  ASP A OD1   1 
ATOM   1018  O OD2   . ASP A  1 126 ? 32.380  18.987  -16.211 1.00 45.08 ? 157  ASP A OD2   1 
ATOM   1019  N N     . ASP A  1 127 ? 30.537  13.981  -17.430 1.00 34.91 ? 158  ASP A N     1 
ATOM   1020  C CA    . ASP A  1 127 ? 30.314  12.906  -18.384 1.00 32.70 ? 158  ASP A CA    1 
ATOM   1021  C C     . ASP A  1 127 ? 29.274  11.934  -17.838 1.00 35.82 ? 158  ASP A C     1 
ATOM   1022  O O     . ASP A  1 127 ? 28.769  11.078  -18.570 1.00 34.14 ? 158  ASP A O     1 
ATOM   1023  C CB    . ASP A  1 127 ? 31.644  12.199  -18.675 1.00 34.97 ? 158  ASP A CB    1 
ATOM   1024  C CG    . ASP A  1 127 ? 31.645  10.731  -18.267 1.00 37.34 ? 158  ASP A CG    1 
ATOM   1025  O OD1   . ASP A  1 127 ? 31.413  10.435  -17.072 1.00 36.16 ? 158  ASP A OD1   1 
ATOM   1026  O OD2   . ASP A  1 127 ? 31.890  9.876   -19.150 1.00 39.30 ? 158  ASP A OD2   1 
ATOM   1027  N N     . CYS A  1 128 ? 28.966  12.068  -16.547 1.00 34.88 ? 159  CYS A N     1 
ATOM   1028  C CA    . CYS A  1 128 ? 27.960  11.229  -15.894 1.00 33.40 ? 159  CYS A CA    1 
ATOM   1029  C C     . CYS A  1 128 ? 26.616  11.432  -16.616 1.00 35.87 ? 159  CYS A C     1 
ATOM   1030  O O     . CYS A  1 128 ? 26.344  12.516  -17.150 1.00 37.02 ? 159  CYS A O     1 
ATOM   1031  C CB    . CYS A  1 128 ? 27.840  11.610  -14.425 1.00 29.90 ? 159  CYS A CB    1 
ATOM   1032  S SG    . CYS A  1 128 ? 29.039  10.748  -13.362 1.00 27.75 ? 159  CYS A SG    1 
ATOM   1033  N N     . PRO A  1 129 ? 25.757  10.396  -16.637 1.00 36.38 ? 160  PRO A N     1 
ATOM   1034  C CA    . PRO A  1 129 ? 24.450  10.463  -17.308 1.00 33.35 ? 160  PRO A CA    1 
ATOM   1035  C C     . PRO A  1 129 ? 23.388  11.336  -16.648 1.00 34.41 ? 160  PRO A C     1 
ATOM   1036  O O     . PRO A  1 129 ? 22.769  12.187  -17.297 1.00 32.14 ? 160  PRO A O     1 
ATOM   1037  C CB    . PRO A  1 129 ? 24.017  9.004   -17.383 1.00 33.76 ? 160  PRO A CB    1 
ATOM   1038  C CG    . PRO A  1 129 ? 24.668  8.368   -16.196 1.00 35.58 ? 160  PRO A CG    1 
ATOM   1039  C CD    . PRO A  1 129 ? 25.981  9.083   -16.004 1.00 36.89 ? 160  PRO A CD    1 
ATOM   1040  N N     . THR A  1 130 ? 23.171  11.115  -15.358 1.00 32.86 ? 161  THR A N     1 
ATOM   1041  C CA    . THR A  1 130 ? 22.173  11.879  -14.627 1.00 30.43 ? 161  THR A CA    1 
ATOM   1042  C C     . THR A  1 130 ? 22.820  12.792  -13.603 1.00 31.35 ? 161  THR A C     1 
ATOM   1043  O O     . THR A  1 130 ? 23.861  12.478  -13.041 1.00 30.80 ? 161  THR A O     1 
ATOM   1044  C CB    . THR A  1 130 ? 21.156  10.943  -13.920 1.00 30.78 ? 161  THR A CB    1 
ATOM   1045  O OG1   . THR A  1 130 ? 21.468  10.831  -12.526 1.00 26.53 ? 161  THR A OG1   1 
ATOM   1046  C CG2   . THR A  1 130 ? 21.193  9.569   -14.558 1.00 28.45 ? 161  THR A CG2   1 
ATOM   1047  N N     . PRO A  1 131 ? 22.206  13.952  -13.367 1.00 31.47 ? 162  PRO A N     1 
ATOM   1048  C CA    . PRO A  1 131 ? 22.673  14.964  -12.416 1.00 29.21 ? 162  PRO A CA    1 
ATOM   1049  C C     . PRO A  1 131 ? 23.189  14.415  -11.074 1.00 26.81 ? 162  PRO A C     1 
ATOM   1050  O O     . PRO A  1 131 ? 24.014  15.045  -10.410 1.00 26.65 ? 162  PRO A O     1 
ATOM   1051  C CB    . PRO A  1 131 ? 21.457  15.868  -12.239 1.00 29.09 ? 162  PRO A CB    1 
ATOM   1052  C CG    . PRO A  1 131 ? 20.721  15.757  -13.534 1.00 32.12 ? 162  PRO A CG    1 
ATOM   1053  C CD    . PRO A  1 131 ? 20.973  14.366  -14.061 1.00 31.60 ? 162  PRO A CD    1 
ATOM   1054  N N     . MET A  1 132 ? 22.698  13.258  -10.654 1.00 25.69 ? 163  MET A N     1 
ATOM   1055  C CA    . MET A  1 132 ? 23.171  12.697  -9.393  1.00 25.64 ? 163  MET A CA    1 
ATOM   1056  C C     . MET A  1 132 ? 23.960  11.446  -9.715  1.00 27.66 ? 163  MET A C     1 
ATOM   1057  O O     . MET A  1 132 ? 23.993  10.487  -8.938  1.00 28.69 ? 163  MET A O     1 
ATOM   1058  C CB    . MET A  1 132 ? 22.001  12.347  -8.465  1.00 24.30 ? 163  MET A CB    1 
ATOM   1059  C CG    . MET A  1 132 ? 21.193  13.544  -7.982  1.00 21.39 ? 163  MET A CG    1 
ATOM   1060  S SD    . MET A  1 132 ? 22.084  14.675  -6.870  1.00 16.85 ? 163  MET A SD    1 
ATOM   1061  C CE    . MET A  1 132 ? 22.493  15.958  -7.968  1.00 15.69 ? 163  MET A CE    1 
ATOM   1062  N N     . GLY A  1 133 ? 24.600  11.465  -10.876 1.00 28.87 ? 164  GLY A N     1 
ATOM   1063  C CA    . GLY A  1 133 ? 25.383  10.320  -11.301 1.00 31.54 ? 164  GLY A CA    1 
ATOM   1064  C C     . GLY A  1 133 ? 24.597  9.431   -12.237 1.00 31.96 ? 164  GLY A C     1 
ATOM   1065  O O     . GLY A  1 133 ? 24.740  9.526   -13.457 1.00 30.10 ? 164  GLY A O     1 
ATOM   1066  N N     . VAL A  1 134 ? 23.760  8.570   -11.664 1.00 35.12 ? 165  VAL A N     1 
ATOM   1067  C CA    . VAL A  1 134 ? 22.935  7.655   -12.455 1.00 39.21 ? 165  VAL A CA    1 
ATOM   1068  C C     . VAL A  1 134 ? 21.463  7.643   -12.033 1.00 39.34 ? 165  VAL A C     1 
ATOM   1069  O O     . VAL A  1 134 ? 20.571  7.641   -12.878 1.00 37.74 ? 165  VAL A O     1 
ATOM   1070  C CB    . VAL A  1 134 ? 23.475  6.223   -12.373 1.00 40.35 ? 165  VAL A CB    1 
ATOM   1071  C CG1   . VAL A  1 134 ? 24.525  6.010   -13.457 1.00 40.70 ? 165  VAL A CG1   1 
ATOM   1072  C CG2   . VAL A  1 134 ? 24.045  5.970   -10.978 1.00 41.03 ? 165  VAL A CG2   1 
ATOM   1073  N N     . LYS A  1 135 ? 21.209  7.621   -10.729 1.00 38.44 ? 166  LYS A N     1 
ATOM   1074  C CA    . LYS A  1 135 ? 19.836  7.620   -10.240 1.00 36.27 ? 166  LYS A CA    1 
ATOM   1075  C C     . LYS A  1 135 ? 19.171  8.963   -10.560 1.00 36.93 ? 166  LYS A C     1 
ATOM   1076  O O     . LYS A  1 135 ? 19.774  10.021  -10.393 1.00 37.90 ? 166  LYS A O     1 
ATOM   1077  C CB    . LYS A  1 135 ? 19.815  7.358   -8.730  1.00 33.25 ? 166  LYS A CB    1 
ATOM   1078  C CG    . LYS A  1 135 ? 20.103  5.916   -8.350  1.00 25.63 ? 166  LYS A CG    1 
ATOM   1079  C CD    . LYS A  1 135 ? 19.760  5.669   -6.899  1.00 21.30 ? 166  LYS A CD    1 
ATOM   1080  C CE    . LYS A  1 135 ? 21.019  5.408   -6.083  1.00 22.38 ? 166  LYS A CE    1 
ATOM   1081  N NZ    . LYS A  1 135 ? 20.798  4.508   -4.907  1.00 17.66 ? 166  LYS A NZ    1 
ATOM   1082  N N     . GLY A  1 136 ? 17.931  8.911   -11.034 1.00 38.70 ? 167  GLY A N     1 
ATOM   1083  C CA    . GLY A  1 136 ? 17.216  10.129  -11.371 1.00 40.60 ? 167  GLY A CA    1 
ATOM   1084  C C     . GLY A  1 136 ? 16.954  10.286  -12.859 1.00 39.88 ? 167  GLY A C     1 
ATOM   1085  O O     . GLY A  1 136 ? 17.193  9.373   -13.646 1.00 40.95 ? 167  GLY A O     1 
ATOM   1086  N N     . ASN A  1 137 ? 16.472  11.457  -13.254 1.00 42.18 ? 168  ASN A N     1 
ATOM   1087  C CA    . ASN A  1 137 ? 16.174  11.713  -14.654 1.00 44.53 ? 168  ASN A CA    1 
ATOM   1088  C C     . ASN A  1 137 ? 17.231  12.556  -15.334 1.00 45.46 ? 168  ASN A C     1 
ATOM   1089  O O     . ASN A  1 137 ? 18.164  13.041  -14.693 1.00 44.70 ? 168  ASN A O     1 
ATOM   1090  C CB    . ASN A  1 137 ? 14.824  12.412  -14.781 1.00 49.23 ? 168  ASN A CB    1 
ATOM   1091  C CG    . ASN A  1 137 ? 13.658  11.480  -14.492 1.00 51.97 ? 168  ASN A CG    1 
ATOM   1092  O OD1   . ASN A  1 137 ? 13.173  10.781  -15.386 1.00 53.80 ? 168  ASN A OD1   1 
ATOM   1093  N ND2   . ASN A  1 137 ? 13.205  11.462  -13.238 1.00 52.09 ? 168  ASN A ND2   1 
ATOM   1094  N N     . LYS A  1 138 ? 17.073  12.725  -16.643 1.00 44.39 ? 169  LYS A N     1 
ATOM   1095  C CA    . LYS A  1 138 ? 18.005  13.521  -17.430 1.00 46.55 ? 169  LYS A CA    1 
ATOM   1096  C C     . LYS A  1 138 ? 18.178  14.881  -16.771 1.00 46.45 ? 169  LYS A C     1 
ATOM   1097  O O     . LYS A  1 138 ? 19.097  15.632  -17.095 1.00 47.45 ? 169  LYS A O     1 
ATOM   1098  C CB    . LYS A  1 138 ? 17.479  13.703  -18.855 1.00 50.97 ? 169  LYS A CB    1 
ATOM   1099  C CG    . LYS A  1 138 ? 17.851  12.571  -19.806 1.00 57.32 ? 169  LYS A CG    1 
ATOM   1100  C CD    . LYS A  1 138 ? 16.661  12.137  -20.661 1.00 62.64 ? 169  LYS A CD    1 
ATOM   1101  C CE    . LYS A  1 138 ? 16.795  10.681  -21.090 1.00 63.24 ? 169  LYS A CE    1 
ATOM   1102  N NZ    . LYS A  1 138 ? 16.312  10.464  -22.480 1.00 65.69 ? 169  LYS A NZ    1 
ATOM   1103  N N     . GLU A  1 139 ? 17.281  15.199  -15.846 1.00 45.14 ? 170  GLU A N     1 
ATOM   1104  C CA    . GLU A  1 139 ? 17.362  16.463  -15.144 1.00 44.63 ? 170  GLU A CA    1 
ATOM   1105  C C     . GLU A  1 139 ? 16.809  16.399  -13.740 1.00 40.55 ? 170  GLU A C     1 
ATOM   1106  O O     . GLU A  1 139 ? 16.461  15.322  -13.225 1.00 41.09 ? 170  GLU A O     1 
ATOM   1107  C CB    . GLU A  1 139 ? 16.623  17.547  -15.903 1.00 50.41 ? 170  GLU A CB    1 
ATOM   1108  C CG    . GLU A  1 139 ? 17.387  18.091  -17.071 1.00 56.15 ? 170  GLU A CG    1 
ATOM   1109  C CD    . GLU A  1 139 ? 16.532  18.149  -18.306 1.00 62.24 ? 170  GLU A CD    1 
ATOM   1110  O OE1   . GLU A  1 139 ? 16.058  19.259  -18.636 1.00 62.58 ? 170  GLU A OE1   1 
ATOM   1111  O OE2   . GLU A  1 139 ? 16.328  17.083  -18.934 1.00 60.71 ? 170  GLU A OE2   1 
ATOM   1112  N N     . LEU A  1 140 ? 16.731  17.581  -13.135 1.00 33.97 ? 171  LEU A N     1 
ATOM   1113  C CA    . LEU A  1 140 ? 16.232  17.735  -11.781 1.00 28.52 ? 171  LEU A CA    1 
ATOM   1114  C C     . LEU A  1 140 ? 15.004  18.645  -11.772 1.00 24.53 ? 171  LEU A C     1 
ATOM   1115  O O     . LEU A  1 140 ? 14.843  19.509  -12.645 1.00 22.33 ? 171  LEU A O     1 
ATOM   1116  C CB    . LEU A  1 140 ? 17.325  18.347  -10.884 1.00 28.39 ? 171  LEU A CB    1 
ATOM   1117  C CG    . LEU A  1 140 ? 18.315  17.447  -10.133 1.00 28.41 ? 171  LEU A CG    1 
ATOM   1118  C CD1   . LEU A  1 140 ? 17.785  17.130  -8.741  1.00 27.15 ? 171  LEU A CD1   1 
ATOM   1119  C CD2   . LEU A  1 140 ? 18.539  16.163  -10.911 1.00 31.04 ? 171  LEU A CD2   1 
ATOM   1120  N N     . PRO A  1 141 ? 14.109  18.449  -10.788 1.00 20.19 ? 172  PRO A N     1 
ATOM   1121  C CA    . PRO A  1 141 ? 12.904  19.268  -10.676 1.00 20.35 ? 172  PRO A CA    1 
ATOM   1122  C C     . PRO A  1 141 ? 13.263  20.737  -10.871 1.00 19.86 ? 172  PRO A C     1 
ATOM   1123  O O     . PRO A  1 141 ? 14.285  21.203  -10.368 1.00 22.37 ? 172  PRO A O     1 
ATOM   1124  C CB    . PRO A  1 141 ? 12.417  19.003  -9.245  1.00 13.43 ? 172  PRO A CB    1 
ATOM   1125  C CG    . PRO A  1 141 ? 13.448  18.129  -8.601  1.00 16.32 ? 172  PRO A CG    1 
ATOM   1126  C CD    . PRO A  1 141 ? 14.160  17.440  -9.721  1.00 19.34 ? 172  PRO A CD    1 
ATOM   1127  N N     . ASP A  1 142 ? 12.446  21.468  -11.616 1.00 22.38 ? 173  ASP A N     1 
ATOM   1128  C CA    . ASP A  1 142 ? 12.722  22.876  -11.793 1.00 23.59 ? 173  ASP A CA    1 
ATOM   1129  C C     . ASP A  1 142 ? 12.803  23.426  -10.366 1.00 28.06 ? 173  ASP A C     1 
ATOM   1130  O O     . ASP A  1 142 ? 12.079  22.964  -9.482  1.00 26.42 ? 173  ASP A O     1 
ATOM   1131  C CB    . ASP A  1 142 ? 11.587  23.538  -12.571 1.00 21.25 ? 173  ASP A CB    1 
ATOM   1132  C CG    . ASP A  1 142 ? 11.347  24.975  -12.145 1.00 26.90 ? 173  ASP A CG    1 
ATOM   1133  O OD1   . ASP A  1 142 ? 11.458  25.887  -12.986 1.00 27.57 ? 173  ASP A OD1   1 
ATOM   1134  O OD2   . ASP A  1 142 ? 11.041  25.200  -10.961 1.00 27.84 ? 173  ASP A OD2   1 
ATOM   1135  N N     . SER A  1 143 ? 13.685  24.398  -10.138 1.00 29.67 ? 174  SER A N     1 
ATOM   1136  C CA    . SER A  1 143 ? 13.856  24.981  -8.806  1.00 30.12 ? 174  SER A CA    1 
ATOM   1137  C C     . SER A  1 143 ? 12.660  25.825  -8.374  1.00 31.43 ? 174  SER A C     1 
ATOM   1138  O O     . SER A  1 143 ? 12.184  25.694  -7.243  1.00 27.45 ? 174  SER A O     1 
ATOM   1139  C CB    . SER A  1 143 ? 15.139  25.828  -8.753  1.00 28.49 ? 174  SER A CB    1 
ATOM   1140  O OG    . SER A  1 143 ? 15.238  26.728  -9.847  1.00 22.67 ? 174  SER A OG    1 
ATOM   1141  N N     . LYS A  1 144 ? 12.196  26.690  -9.281  1.00 34.37 ? 175  LYS A N     1 
ATOM   1142  C CA    . LYS A  1 144 ? 11.044  27.563  -9.036  1.00 33.40 ? 175  LYS A CA    1 
ATOM   1143  C C     . LYS A  1 144 ? 9.985   26.762  -8.289  1.00 30.84 ? 175  LYS A C     1 
ATOM   1144  O O     . LYS A  1 144 ? 9.485   27.183  -7.244  1.00 30.97 ? 175  LYS A O     1 
ATOM   1145  C CB    . LYS A  1 144 ? 10.473  28.065  -10.366 1.00 36.06 ? 175  LYS A CB    1 
ATOM   1146  C CG    . LYS A  1 144 ? 9.505   29.233  -10.243 1.00 41.11 ? 175  LYS A CG    1 
ATOM   1147  C CD    . LYS A  1 144 ? 8.437   29.188  -11.329 1.00 45.07 ? 175  LYS A CD    1 
ATOM   1148  C CE    . LYS A  1 144 ? 7.506   30.390  -11.260 1.00 45.01 ? 175  LYS A CE    1 
ATOM   1149  N NZ    . LYS A  1 144 ? 7.859   31.420  -12.282 1.00 45.50 ? 175  LYS A NZ    1 
ATOM   1150  N N     . GLU A  1 145 ? 9.656   25.598  -8.833  1.00 24.78 ? 176  GLU A N     1 
ATOM   1151  C CA    . GLU A  1 145 ? 8.692   24.714  -8.210  1.00 24.92 ? 176  GLU A CA    1 
ATOM   1152  C C     . GLU A  1 145 ? 9.132   24.492  -6.775  1.00 20.03 ? 176  GLU A C     1 
ATOM   1153  O O     . GLU A  1 145 ? 8.712   25.215  -5.884  1.00 19.57 ? 176  GLU A O     1 
ATOM   1154  C CB    . GLU A  1 145 ? 8.649   23.374  -8.948  1.00 32.62 ? 176  GLU A CB    1 
ATOM   1155  C CG    . GLU A  1 145 ? 8.240   23.496  -10.411 1.00 42.64 ? 176  GLU A CG    1 
ATOM   1156  C CD    . GLU A  1 145 ? 6.841   22.970  -10.677 1.00 48.35 ? 176  GLU A CD    1 
ATOM   1157  O OE1   . GLU A  1 145 ? 5.930   23.252  -9.858  1.00 50.94 ? 176  GLU A OE1   1 
ATOM   1158  O OE2   . GLU A  1 145 ? 6.659   22.278  -11.707 1.00 47.80 ? 176  GLU A OE2   1 
ATOM   1159  N N     . VAL A  1 146 ? 9.989   23.495  -6.570  1.00 16.05 ? 177  VAL A N     1 
ATOM   1160  C CA    . VAL A  1 146 ? 10.525  23.169  -5.245  1.00 11.52 ? 177  VAL A CA    1 
ATOM   1161  C C     . VAL A  1 146 ? 10.510  24.399  -4.329  1.00 10.88 ? 177  VAL A C     1 
ATOM   1162  O O     . VAL A  1 146 ? 9.985   24.364  -3.202  1.00 2.00  ? 177  VAL A O     1 
ATOM   1163  C CB    . VAL A  1 146 ? 11.986  22.678  -5.354  1.00 10.47 ? 177  VAL A CB    1 
ATOM   1164  C CG1   . VAL A  1 146 ? 12.272  21.676  -4.246  1.00 9.04  ? 177  VAL A CG1   1 
ATOM   1165  C CG2   . VAL A  1 146 ? 12.252  22.072  -6.737  1.00 2.00  ? 177  VAL A CG2   1 
ATOM   1166  N N     . LEU A  1 147 ? 11.109  25.473  -4.850  1.00 10.59 ? 178  LEU A N     1 
ATOM   1167  C CA    . LEU A  1 147 ? 11.211  26.765  -4.184  1.00 8.69  ? 178  LEU A CA    1 
ATOM   1168  C C     . LEU A  1 147 ? 9.865   27.057  -3.537  1.00 9.76  ? 178  LEU A C     1 
ATOM   1169  O O     . LEU A  1 147 ? 9.741   27.144  -2.300  1.00 2.00  ? 178  LEU A O     1 
ATOM   1170  C CB    . LEU A  1 147 ? 11.536  27.846  -5.230  1.00 9.54  ? 178  LEU A CB    1 
ATOM   1171  C CG    . LEU A  1 147 ? 12.301  29.122  -4.829  1.00 11.73 ? 178  LEU A CG    1 
ATOM   1172  C CD1   . LEU A  1 147 ? 11.885  30.261  -5.732  1.00 8.42  ? 178  LEU A CD1   1 
ATOM   1173  C CD2   . LEU A  1 147 ? 12.042  29.490  -3.362  1.00 11.26 ? 178  LEU A CD2   1 
ATOM   1174  N N     . GLU A  1 148 ? 8.861   27.210  -4.401  1.00 12.09 ? 179  GLU A N     1 
ATOM   1175  C CA    . GLU A  1 148 ? 7.489   27.475  -3.982  1.00 12.85 ? 179  GLU A CA    1 
ATOM   1176  C C     . GLU A  1 148 ? 6.922   26.235  -3.315  1.00 11.94 ? 179  GLU A C     1 
ATOM   1177  O O     . GLU A  1 148 ? 6.659   26.226  -2.118  1.00 12.87 ? 179  GLU A O     1 
ATOM   1178  C CB    . GLU A  1 148 ? 6.636   27.804  -5.185  1.00 10.10 ? 179  GLU A CB    1 
ATOM   1179  C CG    . GLU A  1 148 ? 7.263   28.764  -6.157  1.00 13.41 ? 179  GLU A CG    1 
ATOM   1180  C CD    . GLU A  1 148 ? 6.614   28.649  -7.512  1.00 16.95 ? 179  GLU A CD    1 
ATOM   1181  O OE1   . GLU A  1 148 ? 6.208   27.514  -7.857  1.00 14.43 ? 179  GLU A OE1   1 
ATOM   1182  O OE2   . GLU A  1 148 ? 6.500   29.677  -8.217  1.00 17.71 ? 179  GLU A OE2   1 
ATOM   1183  N N     . LYS A  1 149 ? 6.746   25.193  -4.117  1.00 13.03 ? 180  LYS A N     1 
ATOM   1184  C CA    . LYS A  1 149 ? 6.225   23.910  -3.668  1.00 14.79 ? 180  LYS A CA    1 
ATOM   1185  C C     . LYS A  1 149 ? 6.590   23.482  -2.246  1.00 16.06 ? 180  LYS A C     1 
ATOM   1186  O O     . LYS A  1 149 ? 5.909   22.631  -1.679  1.00 19.38 ? 180  LYS A O     1 
ATOM   1187  C CB    . LYS A  1 149 ? 6.658   22.798  -4.632  1.00 17.65 ? 180  LYS A CB    1 
ATOM   1188  C CG    . LYS A  1 149 ? 6.174   22.954  -6.055  1.00 25.90 ? 180  LYS A CG    1 
ATOM   1189  C CD    . LYS A  1 149 ? 4.727   22.517  -6.191  1.00 31.76 ? 180  LYS A CD    1 
ATOM   1190  C CE    . LYS A  1 149 ? 4.416   22.095  -7.613  1.00 33.70 ? 180  LYS A CE    1 
ATOM   1191  N NZ    . LYS A  1 149 ? 2.987   22.346  -7.952  1.00 36.56 ? 180  LYS A NZ    1 
ATOM   1192  N N     . VAL A  1 150 ? 7.645   24.037  -1.657  1.00 15.33 ? 181  VAL A N     1 
ATOM   1193  C CA    . VAL A  1 150 ? 7.996   23.619  -0.300  1.00 14.97 ? 181  VAL A CA    1 
ATOM   1194  C C     . VAL A  1 150 ? 8.949   24.532  0.448   1.00 14.12 ? 181  VAL A C     1 
ATOM   1195  O O     . VAL A  1 150 ? 9.268   24.271  1.607   1.00 14.52 ? 181  VAL A O     1 
ATOM   1196  C CB    . VAL A  1 150 ? 8.643   22.213  -0.289  1.00 15.51 ? 181  VAL A CB    1 
ATOM   1197  C CG1   . VAL A  1 150 ? 7.592   21.149  -0.058  1.00 18.56 ? 181  VAL A CG1   1 
ATOM   1198  C CG2   . VAL A  1 150 ? 9.391   21.977  -1.593  1.00 20.22 ? 181  VAL A CG2   1 
ATOM   1199  N N     . LEU A  1 151 ? 9.403   25.604  -0.182  1.00 13.95 ? 182  LEU A N     1 
ATOM   1200  C CA    . LEU A  1 151 ? 10.346  26.452  0.517   1.00 16.76 ? 182  LEU A CA    1 
ATOM   1201  C C     . LEU A  1 151 ? 9.822   27.779  0.987   1.00 18.36 ? 182  LEU A C     1 
ATOM   1202  O O     . LEU A  1 151 ? 9.876   28.080  2.174   1.00 18.12 ? 182  LEU A O     1 
ATOM   1203  C CB    . LEU A  1 151 ? 11.587  26.687  -0.341  1.00 19.03 ? 182  LEU A CB    1 
ATOM   1204  C CG    . LEU A  1 151 ? 12.398  25.444  -0.706  1.00 18.50 ? 182  LEU A CG    1 
ATOM   1205  C CD1   . LEU A  1 151 ? 13.513  25.864  -1.640  1.00 16.17 ? 182  LEU A CD1   1 
ATOM   1206  C CD2   . LEU A  1 151 ? 12.956  24.778  0.529   1.00 14.40 ? 182  LEU A CD2   1 
ATOM   1207  N N     . LEU A  1 152 ? 9.336   28.587  0.056   1.00 20.67 ? 183  LEU A N     1 
ATOM   1208  C CA    . LEU A  1 152 ? 8.832   29.902  0.415   1.00 22.41 ? 183  LEU A CA    1 
ATOM   1209  C C     . LEU A  1 152 ? 7.892   29.896  1.612   1.00 22.22 ? 183  LEU A C     1 
ATOM   1210  O O     . LEU A  1 152 ? 6.989   29.077  1.713   1.00 21.76 ? 183  LEU A O     1 
ATOM   1211  C CB    . LEU A  1 152 ? 8.144   30.529  -0.784  1.00 24.85 ? 183  LEU A CB    1 
ATOM   1212  C CG    . LEU A  1 152 ? 9.154   30.984  -1.830  1.00 25.17 ? 183  LEU A CG    1 
ATOM   1213  C CD1   . LEU A  1 152 ? 8.739   30.477  -3.200  1.00 22.28 ? 183  LEU A CD1   1 
ATOM   1214  C CD2   . LEU A  1 152 ? 9.249   32.514  -1.791  1.00 27.03 ? 183  LEU A CD2   1 
ATOM   1215  N N     . ARG A  1 153 ? 8.123   30.823  2.525   1.00 23.91 ? 184  ARG A N     1 
ATOM   1216  C CA    . ARG A  1 153 ? 7.308   30.937  3.725   1.00 24.58 ? 184  ARG A CA    1 
ATOM   1217  C C     . ARG A  1 153 ? 5.913   31.492  3.432   1.00 25.48 ? 184  ARG A C     1 
ATOM   1218  O O     . ARG A  1 153 ? 5.757   32.530  2.768   1.00 21.46 ? 184  ARG A O     1 
ATOM   1219  C CB    . ARG A  1 153 ? 8.017   31.845  4.739   1.00 25.98 ? 184  ARG A CB    1 
ATOM   1220  C CG    . ARG A  1 153 ? 7.149   32.340  5.877   1.00 30.85 ? 184  ARG A CG    1 
ATOM   1221  C CD    . ARG A  1 153 ? 7.804   33.504  6.601   1.00 34.26 ? 184  ARG A CD    1 
ATOM   1222  N NE    . ARG A  1 153 ? 9.195   33.219  6.914   1.00 39.42 ? 184  ARG A NE    1 
ATOM   1223  C CZ    . ARG A  1 153 ? 10.155  34.134  6.964   1.00 44.51 ? 184  ARG A CZ    1 
ATOM   1224  N NH1   . ARG A  1 153 ? 9.884   35.410  6.722   1.00 44.61 ? 184  ARG A NH1   1 
ATOM   1225  N NH2   . ARG A  1 153 ? 11.398  33.769  7.246   1.00 45.04 ? 184  ARG A NH2   1 
ATOM   1226  N N     . ARG A  1 154 ? 4.897   30.795  3.929   1.00 28.66 ? 185  ARG A N     1 
ATOM   1227  C CA    . ARG A  1 154 ? 3.513   31.247  3.761   1.00 29.85 ? 185  ARG A CA    1 
ATOM   1228  C C     . ARG A  1 154 ? 3.229   31.994  5.054   1.00 30.58 ? 185  ARG A C     1 
ATOM   1229  O O     . ARG A  1 154 ? 3.200   33.217  5.088   1.00 29.59 ? 185  ARG A O     1 
ATOM   1230  C CB    . ARG A  1 154 ? 2.569   30.057  3.618   1.00 30.21 ? 185  ARG A CB    1 
ATOM   1231  C CG    . ARG A  1 154 ? 3.272   28.755  3.300   1.00 36.11 ? 185  ARG A CG    1 
ATOM   1232  C CD    . ARG A  1 154 ? 3.169   28.404  1.827   1.00 39.05 ? 185  ARG A CD    1 
ATOM   1233  N NE    . ARG A  1 154 ? 3.572   27.015  1.587   1.00 51.14 ? 185  ARG A NE    1 
ATOM   1234  C CZ    . ARG A  1 154 ? 4.141   26.571  0.467   1.00 50.81 ? 185  ARG A CZ    1 
ATOM   1235  N NH1   . ARG A  1 154 ? 4.387   27.400  -0.542  1.00 50.33 ? 185  ARG A NH1   1 
ATOM   1236  N NH2   . ARG A  1 154 ? 4.478   25.296  0.361   1.00 50.86 ? 185  ARG A NH2   1 
ATOM   1237  N N     . GLU A  1 155 ? 3.046   31.242  6.128   1.00 32.58 ? 186  GLU A N     1 
ATOM   1238  C CA    . GLU A  1 155 ? 2.819   31.835  7.434   1.00 37.29 ? 186  GLU A CA    1 
ATOM   1239  C C     . GLU A  1 155 ? 4.185   31.818  8.111   1.00 34.85 ? 186  GLU A C     1 
ATOM   1240  O O     . GLU A  1 155 ? 4.819   30.761  8.219   1.00 33.05 ? 186  GLU A O     1 
ATOM   1241  C CB    . GLU A  1 155 ? 1.833   30.989  8.249   1.00 43.41 ? 186  GLU A CB    1 
ATOM   1242  C CG    . GLU A  1 155 ? 0.469   31.638  8.468   1.00 54.82 ? 186  GLU A CG    1 
ATOM   1243  C CD    . GLU A  1 155 ? -0.537  30.708  9.146   1.00 62.83 ? 186  GLU A CD    1 
ATOM   1244  O OE1   . GLU A  1 155 ? -0.494  30.590  10.394  1.00 63.37 ? 186  GLU A OE1   1 
ATOM   1245  O OE2   . GLU A  1 155 ? -1.374  30.100  8.434   1.00 64.11 ? 186  GLU A OE2   1 
ATOM   1246  N N     . PHE A  1 156 ? 4.655   32.981  8.547   1.00 33.48 ? 187  PHE A N     1 
ATOM   1247  C CA    . PHE A  1 156 ? 5.948   33.043  9.219   1.00 32.19 ? 187  PHE A CA    1 
ATOM   1248  C C     . PHE A  1 156 ? 6.019   32.000  10.341  1.00 29.70 ? 187  PHE A C     1 
ATOM   1249  O O     . PHE A  1 156 ? 5.140   31.928  11.200  1.00 28.87 ? 187  PHE A O     1 
ATOM   1250  C CB    . PHE A  1 156 ? 6.188   34.449  9.795   1.00 33.91 ? 187  PHE A CB    1 
ATOM   1251  C CG    . PHE A  1 156 ? 7.330   34.520  10.789  1.00 38.89 ? 187  PHE A CG    1 
ATOM   1252  C CD1   . PHE A  1 156 ? 7.185   34.015  12.082  1.00 40.68 ? 187  PHE A CD1   1 
ATOM   1253  C CD2   . PHE A  1 156 ? 8.540   35.110  10.439  1.00 41.73 ? 187  PHE A CD2   1 
ATOM   1254  C CE1   . PHE A  1 156 ? 8.218   34.094  13.007  1.00 42.96 ? 187  PHE A CE1   1 
ATOM   1255  C CE2   . PHE A  1 156 ? 9.582   35.195  11.359  1.00 41.03 ? 187  PHE A CE2   1 
ATOM   1256  C CZ    . PHE A  1 156 ? 9.418   34.685  12.647  1.00 43.24 ? 187  PHE A CZ    1 
ATOM   1257  N N     . ILE A  1 157 ? 7.065   31.186  10.326  1.00 26.57 ? 188  ILE A N     1 
ATOM   1258  C CA    . ILE A  1 157 ? 7.232   30.182  11.357  1.00 26.38 ? 188  ILE A CA    1 
ATOM   1259  C C     . ILE A  1 157 ? 8.343   30.663  12.253  1.00 28.65 ? 188  ILE A C     1 
ATOM   1260  O O     . ILE A  1 157 ? 9.461   30.872  11.795  1.00 30.53 ? 188  ILE A O     1 
ATOM   1261  C CB    . ILE A  1 157 ? 7.641   28.841  10.781  1.00 24.32 ? 188  ILE A CB    1 
ATOM   1262  C CG1   . ILE A  1 157 ? 6.678   28.440  9.666   1.00 28.53 ? 188  ILE A CG1   1 
ATOM   1263  C CG2   . ILE A  1 157 ? 7.661   27.804  11.881  1.00 29.38 ? 188  ILE A CG2   1 
ATOM   1264  C CD1   . ILE A  1 157 ? 7.330   27.607  8.597   1.00 31.18 ? 188  ILE A CD1   1 
ATOM   1265  N N     . PRO A  1 158 ? 8.059   30.838  13.550  1.00 30.25 ? 189  PRO A N     1 
ATOM   1266  C CA    . PRO A  1 158 ? 9.112   31.309  14.447  1.00 29.19 ? 189  PRO A CA    1 
ATOM   1267  C C     . PRO A  1 158 ? 9.974   30.134  14.833  1.00 26.52 ? 189  PRO A C     1 
ATOM   1268  O O     . PRO A  1 158 ? 9.506   28.993  14.866  1.00 26.86 ? 189  PRO A O     1 
ATOM   1269  C CB    . PRO A  1 158 ? 8.340   31.844  15.637  1.00 30.42 ? 189  PRO A CB    1 
ATOM   1270  C CG    . PRO A  1 158 ? 7.172   30.903  15.722  1.00 33.20 ? 189  PRO A CG    1 
ATOM   1271  C CD    . PRO A  1 158 ? 6.804   30.584  14.280  1.00 32.39 ? 189  PRO A CD    1 
ATOM   1272  N N     . ASP A  1 159 ? 11.239  30.396  15.118  1.00 24.40 ? 190  ASP A N     1 
ATOM   1273  C CA    . ASP A  1 159 ? 12.082  29.304  15.523  1.00 20.16 ? 190  ASP A CA    1 
ATOM   1274  C C     . ASP A  1 159 ? 11.676  28.959  16.941  1.00 16.23 ? 190  ASP A C     1 
ATOM   1275  O O     . ASP A  1 159 ? 11.626  29.823  17.809  1.00 12.75 ? 190  ASP A O     1 
ATOM   1276  C CB    . ASP A  1 159 ? 13.550  29.691  15.532  1.00 18.89 ? 190  ASP A CB    1 
ATOM   1277  C CG    . ASP A  1 159 ? 14.309  28.992  16.651  1.00 18.44 ? 190  ASP A CG    1 
ATOM   1278  O OD1   . ASP A  1 159 ? 14.507  27.761  16.553  1.00 14.14 ? 190  ASP A OD1   1 
ATOM   1279  O OD2   . ASP A  1 159 ? 14.686  29.665  17.634  1.00 14.39 ? 190  ASP A OD2   1 
ATOM   1280  N N     . PRO A  1 160 ? 11.318  27.700  17.180  1.00 16.43 ? 191  PRO A N     1 
ATOM   1281  C CA    . PRO A  1 160 ? 10.938  27.316  18.539  1.00 18.57 ? 191  PRO A CA    1 
ATOM   1282  C C     . PRO A  1 160 ? 12.057  27.626  19.537  1.00 19.42 ? 191  PRO A C     1 
ATOM   1283  O O     . PRO A  1 160 ? 11.789  27.887  20.704  1.00 20.54 ? 191  PRO A O     1 
ATOM   1284  C CB    . PRO A  1 160 ? 10.689  25.811  18.437  1.00 17.65 ? 191  PRO A CB    1 
ATOM   1285  C CG    . PRO A  1 160 ? 11.255  25.397  17.121  1.00 17.72 ? 191  PRO A CG    1 
ATOM   1286  C CD    . PRO A  1 160 ? 11.166  26.587  16.233  1.00 16.65 ? 191  PRO A CD    1 
ATOM   1287  N N     . GLN A  1 161 ? 13.306  27.608  19.065  1.00 21.12 ? 192  GLN A N     1 
ATOM   1288  C CA    . GLN A  1 161 ? 14.479  27.856  19.919  1.00 21.55 ? 192  GLN A CA    1 
ATOM   1289  C C     . GLN A  1 161 ? 14.655  29.276  20.468  1.00 21.11 ? 192  GLN A C     1 
ATOM   1290  O O     . GLN A  1 161 ? 15.507  29.505  21.333  1.00 19.60 ? 192  GLN A O     1 
ATOM   1291  C CB    . GLN A  1 161 ? 15.760  27.431  19.193  1.00 20.00 ? 192  GLN A CB    1 
ATOM   1292  C CG    . GLN A  1 161 ? 15.657  26.052  18.554  1.00 26.73 ? 192  GLN A CG    1 
ATOM   1293  C CD    . GLN A  1 161 ? 16.902  25.222  18.752  1.00 24.15 ? 192  GLN A CD    1 
ATOM   1294  O OE1   . GLN A  1 161 ? 17.186  24.312  17.979  1.00 25.06 ? 192  GLN A OE1   1 
ATOM   1295  N NE2   . GLN A  1 161 ? 17.652  25.532  19.797  1.00 26.61 ? 192  GLN A NE2   1 
ATOM   1296  N N     . GLY A  1 162 ? 13.858  30.220  19.976  1.00 20.67 ? 193  GLY A N     1 
ATOM   1297  C CA    . GLY A  1 162 ? 13.945  31.584  20.466  1.00 22.87 ? 193  GLY A CA    1 
ATOM   1298  C C     . GLY A  1 162 ? 14.964  32.470  19.777  1.00 24.87 ? 193  GLY A C     1 
ATOM   1299  O O     . GLY A  1 162 ? 15.235  33.591  20.220  1.00 23.89 ? 193  GLY A O     1 
ATOM   1300  N N     . SER A  1 163 ? 15.521  31.974  18.682  1.00 24.21 ? 194  SER A N     1 
ATOM   1301  C CA    . SER A  1 163 ? 16.525  32.713  17.934  1.00 25.43 ? 194  SER A CA    1 
ATOM   1302  C C     . SER A  1 163 ? 16.073  34.126  17.579  1.00 24.15 ? 194  SER A C     1 
ATOM   1303  O O     . SER A  1 163 ? 15.285  34.301  16.664  1.00 25.35 ? 194  SER A O     1 
ATOM   1304  C CB    . SER A  1 163 ? 16.871  31.940  16.667  1.00 23.40 ? 194  SER A CB    1 
ATOM   1305  O OG    . SER A  1 163 ? 17.169  30.591  16.975  1.00 26.43 ? 194  SER A OG    1 
ATOM   1306  N N     . ASN A  1 164 ? 16.578  35.126  18.299  1.00 22.49 ? 195  ASN A N     1 
ATOM   1307  C CA    . ASN A  1 164 ? 16.210  36.517  18.043  1.00 25.31 ? 195  ASN A CA    1 
ATOM   1308  C C     . ASN A  1 164 ? 16.932  37.048  16.819  1.00 24.53 ? 195  ASN A C     1 
ATOM   1309  O O     . ASN A  1 164 ? 17.636  36.306  16.139  1.00 27.20 ? 195  ASN A O     1 
ATOM   1310  C CB    . ASN A  1 164 ? 16.574  37.392  19.233  1.00 26.63 ? 195  ASN A CB    1 
ATOM   1311  C CG    . ASN A  1 164 ? 17.969  37.108  19.745  1.00 26.90 ? 195  ASN A CG    1 
ATOM   1312  O OD1   . ASN A  1 164 ? 18.914  37.007  18.969  1.00 27.00 ? 195  ASN A OD1   1 
ATOM   1313  N ND2   . ASN A  1 164 ? 18.101  36.966  21.055  1.00 29.06 ? 195  ASN A ND2   1 
ATOM   1314  N N     . MET A  1 165 ? 16.760  38.339  16.549  1.00 22.69 ? 196  MET A N     1 
ATOM   1315  C CA    . MET A  1 165 ? 17.404  38.972  15.403  1.00 22.92 ? 196  MET A CA    1 
ATOM   1316  C C     . MET A  1 165 ? 18.921  39.080  15.614  1.00 24.47 ? 196  MET A C     1 
ATOM   1317  O O     . MET A  1 165 ? 19.707  38.983  14.654  1.00 23.31 ? 196  MET A O     1 
ATOM   1318  C CB    . MET A  1 165 ? 16.800  40.359  15.158  1.00 22.48 ? 196  MET A CB    1 
ATOM   1319  C CG    . MET A  1 165 ? 15.584  40.356  14.241  1.00 23.94 ? 196  MET A CG    1 
ATOM   1320  S SD    . MET A  1 165 ? 15.807  39.507  12.636  1.00 31.58 ? 196  MET A SD    1 
ATOM   1321  C CE    . MET A  1 165 ? 15.413  37.786  13.102  1.00 21.94 ? 196  MET A CE    1 
ATOM   1322  N N     . MET A  1 166 ? 19.326  39.285  16.871  1.00 24.72 ? 197  MET A N     1 
ATOM   1323  C CA    . MET A  1 166 ? 20.741  39.371  17.215  1.00 21.12 ? 197  MET A CA    1 
ATOM   1324  C C     . MET A  1 166 ? 21.385  38.173  16.541  1.00 18.49 ? 197  MET A C     1 
ATOM   1325  O O     . MET A  1 166 ? 22.107  38.316  15.558  1.00 22.50 ? 197  MET A O     1 
ATOM   1326  C CB    . MET A  1 166 ? 20.950  39.250  18.725  1.00 19.33 ? 197  MET A CB    1 
ATOM   1327  C CG    . MET A  1 166 ? 21.043  40.563  19.475  1.00 27.07 ? 197  MET A CG    1 
ATOM   1328  S SD    . MET A  1 166 ? 21.543  41.986  18.487  1.00 37.03 ? 197  MET A SD    1 
ATOM   1329  C CE    . MET A  1 166 ? 22.172  43.043  19.742  1.00 33.30 ? 197  MET A CE    1 
ATOM   1330  N N     . PHE A  1 167 ? 21.090  36.989  17.059  1.00 13.78 ? 198  PHE A N     1 
ATOM   1331  C CA    . PHE A  1 167 ? 21.656  35.785  16.502  1.00 9.43  ? 198  PHE A CA    1 
ATOM   1332  C C     . PHE A  1 167 ? 21.698  35.848  14.994  1.00 13.12 ? 198  PHE A C     1 
ATOM   1333  O O     . PHE A  1 167 ? 22.759  35.747  14.392  1.00 16.13 ? 198  PHE A O     1 
ATOM   1334  C CB    . PHE A  1 167 ? 20.853  34.572  16.919  1.00 7.13  ? 198  PHE A CB    1 
ATOM   1335  C CG    . PHE A  1 167 ? 21.278  33.316  16.224  1.00 2.00  ? 198  PHE A CG    1 
ATOM   1336  C CD1   . PHE A  1 167 ? 22.040  32.371  16.887  1.00 7.69  ? 198  PHE A CD1   1 
ATOM   1337  C CD2   . PHE A  1 167 ? 20.928  33.090  14.900  1.00 2.00  ? 198  PHE A CD2   1 
ATOM   1338  C CE1   . PHE A  1 167 ? 22.455  31.209  16.240  1.00 13.52 ? 198  PHE A CE1   1 
ATOM   1339  C CE2   . PHE A  1 167 ? 21.329  31.946  14.237  1.00 7.25  ? 198  PHE A CE2   1 
ATOM   1340  C CZ    . PHE A  1 167 ? 22.094  30.998  14.902  1.00 14.60 ? 198  PHE A CZ    1 
ATOM   1341  N N     . ALA A  1 168 ? 20.537  35.996  14.377  1.00 12.51 ? 199  ALA A N     1 
ATOM   1342  C CA    . ALA A  1 168 ? 20.478  36.058  12.930  1.00 14.29 ? 199  ALA A CA    1 
ATOM   1343  C C     . ALA A  1 168 ? 21.596  36.929  12.377  1.00 14.28 ? 199  ALA A C     1 
ATOM   1344  O O     . ALA A  1 168 ? 22.525  36.410  11.773  1.00 18.77 ? 199  ALA A O     1 
ATOM   1345  C CB    . ALA A  1 168 ? 19.130  36.597  12.483  1.00 17.84 ? 199  ALA A CB    1 
ATOM   1346  N N     . PHE A  1 169 ? 21.519  38.240  12.588  1.00 12.58 ? 200  PHE A N     1 
ATOM   1347  C CA    . PHE A  1 169 ? 22.547  39.147  12.068  1.00 15.29 ? 200  PHE A CA    1 
ATOM   1348  C C     . PHE A  1 169 ? 23.984  38.754  12.439  1.00 14.47 ? 200  PHE A C     1 
ATOM   1349  O O     . PHE A  1 169 ? 24.920  39.012  11.684  1.00 14.75 ? 200  PHE A O     1 
ATOM   1350  C CB    . PHE A  1 169 ? 22.263  40.589  12.519  1.00 18.03 ? 200  PHE A CB    1 
ATOM   1351  C CG    . PHE A  1 169 ? 21.230  41.278  11.681  1.00 24.72 ? 200  PHE A CG    1 
ATOM   1352  C CD1   . PHE A  1 169 ? 21.309  41.227  10.290  1.00 28.29 ? 200  PHE A CD1   1 
ATOM   1353  C CD2   . PHE A  1 169 ? 20.142  41.920  12.269  1.00 25.88 ? 200  PHE A CD2   1 
ATOM   1354  C CE1   . PHE A  1 169 ? 20.313  41.802  9.491   1.00 30.74 ? 200  PHE A CE1   1 
ATOM   1355  C CE2   . PHE A  1 169 ? 19.148  42.496  11.480  1.00 28.41 ? 200  PHE A CE2   1 
ATOM   1356  C CZ    . PHE A  1 169 ? 19.231  42.436  10.090  1.00 28.10 ? 200  PHE A CZ    1 
ATOM   1357  N N     . PHE A  1 170 ? 24.166  38.153  13.606  1.00 13.71 ? 201  PHE A N     1 
ATOM   1358  C CA    . PHE A  1 170 ? 25.488  37.735  13.999  1.00 12.17 ? 201  PHE A CA    1 
ATOM   1359  C C     . PHE A  1 170 ? 25.818  36.711  12.947  1.00 11.51 ? 201  PHE A C     1 
ATOM   1360  O O     . PHE A  1 170 ? 26.528  37.006  12.006  1.00 13.05 ? 201  PHE A O     1 
ATOM   1361  C CB    . PHE A  1 170 ? 25.456  37.097  15.377  1.00 15.03 ? 201  PHE A CB    1 
ATOM   1362  C CG    . PHE A  1 170 ? 26.811  36.748  15.906  1.00 21.02 ? 201  PHE A CG    1 
ATOM   1363  C CD1   . PHE A  1 170 ? 27.385  37.498  16.930  1.00 23.12 ? 201  PHE A CD1   1 
ATOM   1364  C CD2   . PHE A  1 170 ? 27.524  35.672  15.381  1.00 21.10 ? 201  PHE A CD2   1 
ATOM   1365  C CE1   . PHE A  1 170 ? 28.653  37.179  17.424  1.00 21.34 ? 201  PHE A CE1   1 
ATOM   1366  C CE2   . PHE A  1 170 ? 28.793  35.346  15.866  1.00 21.15 ? 201  PHE A CE2   1 
ATOM   1367  C CZ    . PHE A  1 170 ? 29.357  36.099  16.890  1.00 21.16 ? 201  PHE A CZ    1 
ATOM   1368  N N     . ALA A  1 171 ? 25.276  35.509  13.098  1.00 11.54 ? 202  ALA A N     1 
ATOM   1369  C CA    . ALA A  1 171 ? 25.485  34.440  12.129  1.00 12.49 ? 202  ALA A CA    1 
ATOM   1370  C C     . ALA A  1 171 ? 25.741  35.046  10.754  1.00 14.72 ? 202  ALA A C     1 
ATOM   1371  O O     . ALA A  1 171 ? 26.744  34.759  10.105  1.00 19.17 ? 202  ALA A O     1 
ATOM   1372  C CB    . ALA A  1 171 ? 24.259  33.558  12.078  1.00 2.00  ? 202  ALA A CB    1 
ATOM   1373  N N     . GLN A  1 172 ? 24.830  35.901  10.317  1.00 18.21 ? 203  GLN A N     1 
ATOM   1374  C CA    . GLN A  1 172 ? 24.960  36.552  9.023   1.00 21.13 ? 203  GLN A CA    1 
ATOM   1375  C C     . GLN A  1 172 ? 26.309  37.239  8.932   1.00 22.85 ? 203  GLN A C     1 
ATOM   1376  O O     . GLN A  1 172 ? 27.155  36.872  8.122   1.00 21.70 ? 203  GLN A O     1 
ATOM   1377  C CB    . GLN A  1 172 ? 23.851  37.590  8.843   1.00 27.88 ? 203  GLN A CB    1 
ATOM   1378  C CG    . GLN A  1 172 ? 24.174  38.664  7.824   1.00 34.44 ? 203  GLN A CG    1 
ATOM   1379  C CD    . GLN A  1 172 ? 23.264  38.610  6.606   1.00 41.05 ? 203  GLN A CD    1 
ATOM   1380  O OE1   . GLN A  1 172 ? 23.257  37.628  5.863   1.00 43.06 ? 203  GLN A OE1   1 
ATOM   1381  N NE2   . GLN A  1 172 ? 22.493  39.670  6.398   1.00 41.59 ? 203  GLN A NE2   1 
ATOM   1382  N N     . HIS A  1 173 ? 26.489  38.247  9.780   1.00 24.93 ? 204  HIS A N     1 
ATOM   1383  C CA    . HIS A  1 173 ? 27.716  39.039  9.860   1.00 25.93 ? 204  HIS A CA    1 
ATOM   1384  C C     . HIS A  1 173 ? 28.951  38.149  9.994   1.00 24.97 ? 204  HIS A C     1 
ATOM   1385  O O     . HIS A  1 173 ? 29.858  38.204  9.164   1.00 28.05 ? 204  HIS A O     1 
ATOM   1386  C CB    . HIS A  1 173 ? 27.613  39.988  11.056  1.00 26.85 ? 204  HIS A CB    1 
ATOM   1387  C CG    . HIS A  1 173 ? 28.852  40.783  11.323  1.00 31.15 ? 204  HIS A CG    1 
ATOM   1388  N ND1   . HIS A  1 173 ? 29.886  40.310  12.102  1.00 32.22 ? 204  HIS A ND1   1 
ATOM   1389  C CD2   . HIS A  1 173 ? 29.181  42.057  10.993  1.00 30.95 ? 204  HIS A CD2   1 
ATOM   1390  C CE1   . HIS A  1 173 ? 30.796  41.258  12.244  1.00 34.49 ? 204  HIS A CE1   1 
ATOM   1391  N NE2   . HIS A  1 173 ? 30.390  42.328  11.580  1.00 31.93 ? 204  HIS A NE2   1 
ATOM   1392  N N     . PHE A  1 174 ? 28.977  37.329  11.038  1.00 24.51 ? 205  PHE A N     1 
ATOM   1393  C CA    . PHE A  1 174 ? 30.094  36.431  11.290  1.00 24.08 ? 205  PHE A CA    1 
ATOM   1394  C C     . PHE A  1 174 ? 30.424  35.555  10.080  1.00 22.91 ? 205  PHE A C     1 
ATOM   1395  O O     . PHE A  1 174 ? 31.484  35.699  9.489   1.00 25.64 ? 205  PHE A O     1 
ATOM   1396  C CB    . PHE A  1 174 ? 29.782  35.555  12.504  1.00 25.67 ? 205  PHE A CB    1 
ATOM   1397  C CG    . PHE A  1 174 ? 30.741  34.413  12.698  1.00 28.17 ? 205  PHE A CG    1 
ATOM   1398  C CD1   . PHE A  1 174 ? 32.073  34.648  13.010  1.00 28.55 ? 205  PHE A CD1   1 
ATOM   1399  C CD2   . PHE A  1 174 ? 30.295  33.097  12.620  1.00 29.88 ? 205  PHE A CD2   1 
ATOM   1400  C CE1   . PHE A  1 174 ? 32.943  33.582  13.249  1.00 30.62 ? 205  PHE A CE1   1 
ATOM   1401  C CE2   . PHE A  1 174 ? 31.160  32.026  12.859  1.00 30.89 ? 205  PHE A CE2   1 
ATOM   1402  C CZ    . PHE A  1 174 ? 32.482  32.265  13.174  1.00 28.76 ? 205  PHE A CZ    1 
ATOM   1403  N N     . THR A  1 175 ? 29.527  34.654  9.701   1.00 20.02 ? 206  THR A N     1 
ATOM   1404  C CA    . THR A  1 175 ? 29.795  33.786  8.560   1.00 19.79 ? 206  THR A CA    1 
ATOM   1405  C C     . THR A  1 175 ? 30.261  34.533  7.314   1.00 21.96 ? 206  THR A C     1 
ATOM   1406  O O     . THR A  1 175 ? 30.816  33.927  6.399   1.00 21.89 ? 206  THR A O     1 
ATOM   1407  C CB    . THR A  1 175 ? 28.549  32.976  8.152   1.00 19.07 ? 206  THR A CB    1 
ATOM   1408  O OG1   . THR A  1 175 ? 27.513  33.877  7.749   1.00 11.28 ? 206  THR A OG1   1 
ATOM   1409  C CG2   . THR A  1 175 ? 28.055  32.105  9.316   1.00 19.04 ? 206  THR A CG2   1 
ATOM   1410  N N     . HIS A  1 176 ? 30.051  35.844  7.274   1.00 25.95 ? 207  HIS A N     1 
ATOM   1411  C CA    . HIS A  1 176 ? 30.429  36.605  6.092   1.00 30.07 ? 207  HIS A CA    1 
ATOM   1412  C C     . HIS A  1 176 ? 31.906  36.857  5.857   1.00 27.39 ? 207  HIS A C     1 
ATOM   1413  O O     . HIS A  1 176 ? 32.275  37.575  4.918   1.00 27.70 ? 207  HIS A O     1 
ATOM   1414  C CB    . HIS A  1 176 ? 29.661  37.923  6.038   1.00 36.37 ? 207  HIS A CB    1 
ATOM   1415  C CG    . HIS A  1 176 ? 28.520  37.896  5.072   1.00 45.24 ? 207  HIS A CG    1 
ATOM   1416  N ND1   . HIS A  1 176 ? 27.661  36.820  4.973   1.00 48.47 ? 207  HIS A ND1   1 
ATOM   1417  C CD2   . HIS A  1 176 ? 28.124  38.781  4.127   1.00 48.42 ? 207  HIS A CD2   1 
ATOM   1418  C CE1   . HIS A  1 176 ? 26.786  37.043  4.009   1.00 50.99 ? 207  HIS A CE1   1 
ATOM   1419  N NE2   . HIS A  1 176 ? 27.045  38.226  3.479   1.00 51.44 ? 207  HIS A NE2   1 
ATOM   1420  N N     . GLN A  1 177 ? 32.750  36.290  6.713   1.00 26.14 ? 208  GLN A N     1 
ATOM   1421  C CA    . GLN A  1 177 ? 34.180  36.426  6.520   1.00 21.18 ? 208  GLN A CA    1 
ATOM   1422  C C     . GLN A  1 177 ? 34.568  35.190  5.714   1.00 21.08 ? 208  GLN A C     1 
ATOM   1423  O O     . GLN A  1 177 ? 35.081  35.319  4.610   1.00 20.52 ? 208  GLN A O     1 
ATOM   1424  C CB    . GLN A  1 177 ? 34.947  36.471  7.851   1.00 16.31 ? 208  GLN A CB    1 
ATOM   1425  C CG    . GLN A  1 177 ? 34.302  35.722  8.979   1.00 14.90 ? 208  GLN A CG    1 
ATOM   1426  C CD    . GLN A  1 177 ? 35.000  35.942  10.310  1.00 19.76 ? 208  GLN A CD    1 
ATOM   1427  O OE1   . GLN A  1 177 ? 36.219  35.824  10.405  1.00 23.16 ? 208  GLN A OE1   1 
ATOM   1428  N NE2   . GLN A  1 177 ? 34.223  36.257  11.354  1.00 21.55 ? 208  GLN A NE2   1 
ATOM   1429  N N     . PHE A  1 178 ? 34.285  33.995  6.232   1.00 20.23 ? 209  PHE A N     1 
ATOM   1430  C CA    . PHE A  1 178 ? 34.664  32.807  5.493   1.00 24.50 ? 209  PHE A CA    1 
ATOM   1431  C C     . PHE A  1 178 ? 33.954  32.746  4.154   1.00 24.29 ? 209  PHE A C     1 
ATOM   1432  O O     . PHE A  1 178 ? 34.599  32.739  3.102   1.00 28.22 ? 209  PHE A O     1 
ATOM   1433  C CB    . PHE A  1 178 ? 34.404  31.498  6.261   1.00 29.48 ? 209  PHE A CB    1 
ATOM   1434  C CG    . PHE A  1 178 ? 33.600  31.648  7.502   1.00 33.54 ? 209  PHE A CG    1 
ATOM   1435  C CD1   . PHE A  1 178 ? 34.029  32.462  8.538   1.00 38.79 ? 209  PHE A CD1   1 
ATOM   1436  C CD2   . PHE A  1 178 ? 32.429  30.927  7.657   1.00 37.15 ? 209  PHE A CD2   1 
ATOM   1437  C CE1   . PHE A  1 178 ? 33.298  32.554  9.718   1.00 41.20 ? 209  PHE A CE1   1 
ATOM   1438  C CE2   . PHE A  1 178 ? 31.693  31.010  8.830   1.00 42.01 ? 209  PHE A CE2   1 
ATOM   1439  C CZ    . PHE A  1 178 ? 32.127  31.825  9.864   1.00 40.87 ? 209  PHE A CZ    1 
ATOM   1440  N N     . PHE A  1 179 ? 32.630  32.685  4.173   1.00 22.37 ? 210  PHE A N     1 
ATOM   1441  C CA    . PHE A  1 179 ? 31.903  32.636  2.913   1.00 21.95 ? 210  PHE A CA    1 
ATOM   1442  C C     . PHE A  1 179 ? 32.032  34.019  2.311   1.00 22.13 ? 210  PHE A C     1 
ATOM   1443  O O     . PHE A  1 179 ? 31.755  35.018  2.980   1.00 24.11 ? 210  PHE A O     1 
ATOM   1444  C CB    . PHE A  1 179 ? 30.426  32.312  3.142   1.00 20.83 ? 210  PHE A CB    1 
ATOM   1445  C CG    . PHE A  1 179 ? 30.192  31.166  4.085   1.00 22.61 ? 210  PHE A CG    1 
ATOM   1446  C CD1   . PHE A  1 179 ? 30.682  29.892  3.790   1.00 21.86 ? 210  PHE A CD1   1 
ATOM   1447  C CD2   . PHE A  1 179 ? 29.488  31.363  5.273   1.00 23.37 ? 210  PHE A CD2   1 
ATOM   1448  C CE1   . PHE A  1 179 ? 30.477  28.831  4.663   1.00 21.59 ? 210  PHE A CE1   1 
ATOM   1449  C CE2   . PHE A  1 179 ? 29.276  30.309  6.157   1.00 23.81 ? 210  PHE A CE2   1 
ATOM   1450  C CZ    . PHE A  1 179 ? 29.773  29.038  5.848   1.00 24.54 ? 210  PHE A CZ    1 
ATOM   1451  N N     . LYS A  1 180 ? 32.466  34.085  1.061   1.00 22.24 ? 211  LYS A N     1 
ATOM   1452  C CA    . LYS A  1 180 ? 32.623  35.370  0.401   1.00 23.68 ? 211  LYS A CA    1 
ATOM   1453  C C     . LYS A  1 180 ? 32.741  35.132  -1.081  1.00 25.57 ? 211  LYS A C     1 
ATOM   1454  O O     . LYS A  1 180 ? 33.405  35.875  -1.791  1.00 24.87 ? 211  LYS A O     1 
ATOM   1455  C CB    . LYS A  1 180 ? 33.870  36.080  0.913   1.00 18.81 ? 211  LYS A CB    1 
ATOM   1456  C CG    . LYS A  1 180 ? 33.605  37.012  2.067   1.00 18.94 ? 211  LYS A CG    1 
ATOM   1457  C CD    . LYS A  1 180 ? 34.897  37.446  2.740   1.00 18.03 ? 211  LYS A CD    1 
ATOM   1458  C CE    . LYS A  1 180 ? 35.706  38.349  1.834   1.00 19.85 ? 211  LYS A CE    1 
ATOM   1459  N NZ    . LYS A  1 180 ? 37.137  38.352  2.208   1.00 18.20 ? 211  LYS A NZ    1 
ATOM   1460  N N     . THR A  1 181 ? 32.076  34.079  -1.533  1.00 28.39 ? 212  THR A N     1 
ATOM   1461  C CA    . THR A  1 181 ? 32.081  33.687  -2.935  1.00 30.59 ? 212  THR A CA    1 
ATOM   1462  C C     . THR A  1 181 ? 32.349  34.807  -3.930  1.00 34.60 ? 212  THR A C     1 
ATOM   1463  O O     . THR A  1 181 ? 31.689  35.854  -3.924  1.00 34.67 ? 212  THR A O     1 
ATOM   1464  C CB    . THR A  1 181 ? 30.763  33.021  -3.306  1.00 26.27 ? 212  THR A CB    1 
ATOM   1465  O OG1   . THR A  1 181 ? 30.365  32.172  -2.231  1.00 28.55 ? 212  THR A OG1   1 
ATOM   1466  C CG2   . THR A  1 181 ? 30.912  32.188  -4.571  1.00 23.45 ? 212  THR A CG2   1 
ATOM   1467  N N     . ASP A  1 182 ? 33.344  34.576  -4.777  1.00 40.48 ? 213  ASP A N     1 
ATOM   1468  C CA    . ASP A  1 182 ? 33.703  35.534  -5.800  1.00 46.40 ? 213  ASP A CA    1 
ATOM   1469  C C     . ASP A  1 182 ? 32.961  35.079  -7.038  1.00 50.19 ? 213  ASP A C     1 
ATOM   1470  O O     . ASP A  1 182 ? 33.367  34.132  -7.705  1.00 51.26 ? 213  ASP A O     1 
ATOM   1471  C CB    . ASP A  1 182 ? 35.204  35.510  -6.058  1.00 48.55 ? 213  ASP A CB    1 
ATOM   1472  C CG    . ASP A  1 182 ? 35.575  36.218  -7.332  1.00 53.75 ? 213  ASP A CG    1 
ATOM   1473  O OD1   . ASP A  1 182 ? 34.795  37.092  -7.778  1.00 54.76 ? 213  ASP A OD1   1 
ATOM   1474  O OD2   . ASP A  1 182 ? 36.647  35.898  -7.885  1.00 54.82 ? 213  ASP A OD2   1 
ATOM   1475  N N     . HIS A  1 183 ? 31.864  35.761  -7.336  1.00 52.34 ? 214  HIS A N     1 
ATOM   1476  C CA    . HIS A  1 183 ? 31.038  35.409  -8.479  1.00 52.18 ? 214  HIS A CA    1 
ATOM   1477  C C     . HIS A  1 183 ? 31.682  35.681  -9.830  1.00 49.63 ? 214  HIS A C     1 
ATOM   1478  O O     . HIS A  1 183 ? 31.436  34.951  -10.791 1.00 48.33 ? 214  HIS A O     1 
ATOM   1479  C CB    . HIS A  1 183 ? 29.691  36.118  -8.368  1.00 58.30 ? 214  HIS A CB    1 
ATOM   1480  C CG    . HIS A  1 183 ? 28.918  35.724  -7.149  1.00 62.82 ? 214  HIS A CG    1 
ATOM   1481  N ND1   . HIS A  1 183 ? 28.998  36.422  -5.962  1.00 65.03 ? 214  HIS A ND1   1 
ATOM   1482  C CD2   . HIS A  1 183 ? 28.093  34.677  -6.917  1.00 63.61 ? 214  HIS A CD2   1 
ATOM   1483  C CE1   . HIS A  1 183 ? 28.254  35.819  -5.051  1.00 67.24 ? 214  HIS A CE1   1 
ATOM   1484  N NE2   . HIS A  1 183 ? 27.695  34.758  -5.605  1.00 66.01 ? 214  HIS A NE2   1 
ATOM   1485  N N     . LYS A  1 184 ? 32.502  36.724  -9.911  1.00 47.18 ? 215  LYS A N     1 
ATOM   1486  C CA    . LYS A  1 184 ? 33.178  37.028  -11.166 1.00 43.67 ? 215  LYS A CA    1 
ATOM   1487  C C     . LYS A  1 184 ? 33.845  35.738  -11.616 1.00 40.80 ? 215  LYS A C     1 
ATOM   1488  O O     . LYS A  1 184 ? 33.891  35.421  -12.801 1.00 38.05 ? 215  LYS A O     1 
ATOM   1489  C CB    . LYS A  1 184 ? 34.239  38.111  -10.965 1.00 45.43 ? 215  LYS A CB    1 
ATOM   1490  C CG    . LYS A  1 184 ? 33.953  39.053  -9.815  1.00 50.76 ? 215  LYS A CG    1 
ATOM   1491  C CD    . LYS A  1 184 ? 33.436  40.390  -10.319 1.00 53.91 ? 215  LYS A CD    1 
ATOM   1492  C CE    . LYS A  1 184 ? 33.750  41.504  -9.334  1.00 55.83 ? 215  LYS A CE    1 
ATOM   1493  N NZ    . LYS A  1 184 ? 34.415  42.662  -9.991  1.00 57.88 ? 215  LYS A NZ    1 
ATOM   1494  N N     . ARG A  1 185 ? 34.344  34.990  -10.641 1.00 35.69 ? 216  ARG A N     1 
ATOM   1495  C CA    . ARG A  1 185 ? 35.011  33.728  -10.910 1.00 32.29 ? 216  ARG A CA    1 
ATOM   1496  C C     . ARG A  1 185 ? 33.991  32.601  -11.043 1.00 26.85 ? 216  ARG A C     1 
ATOM   1497  O O     . ARG A  1 185 ? 33.919  31.916  -12.064 1.00 23.64 ? 216  ARG A O     1 
ATOM   1498  C CB    . ARG A  1 185 ? 36.010  33.410  -9.781  1.00 34.29 ? 216  ARG A CB    1 
ATOM   1499  C CG    . ARG A  1 185 ? 37.421  33.947  -10.043 1.00 40.80 ? 216  ARG A CG    1 
ATOM   1500  C CD    . ARG A  1 185 ? 38.462  33.484  -9.020  1.00 45.45 ? 216  ARG A CD    1 
ATOM   1501  N NE    . ARG A  1 185 ? 39.759  34.140  -9.230  1.00 50.95 ? 216  ARG A NE    1 
ATOM   1502  C CZ    . ARG A  1 185 ? 40.591  33.872  -10.239 1.00 55.04 ? 216  ARG A CZ    1 
ATOM   1503  N NH1   . ARG A  1 185 ? 40.276  32.958  -11.149 1.00 57.79 ? 216  ARG A NH1   1 
ATOM   1504  N NH2   . ARG A  1 185 ? 41.744  34.522  -10.344 1.00 58.35 ? 216  ARG A NH2   1 
ATOM   1505  N N     . GLY A  1 186 ? 33.188  32.423  -10.006 1.00 23.68 ? 217  GLY A N     1 
ATOM   1506  C CA    . GLY A  1 186 ? 32.210  31.357  -10.028 1.00 20.52 ? 217  GLY A CA    1 
ATOM   1507  C C     . GLY A  1 186 ? 31.667  31.078  -8.647  1.00 17.49 ? 217  GLY A C     1 
ATOM   1508  O O     . GLY A  1 186 ? 32.074  31.700  -7.662  1.00 14.76 ? 217  GLY A O     1 
ATOM   1509  N N     . PRO A  1 187 ? 30.732  30.132  -8.545  1.00 17.23 ? 218  PRO A N     1 
ATOM   1510  C CA    . PRO A  1 187 ? 30.115  29.769  -7.261  1.00 14.68 ? 218  PRO A CA    1 
ATOM   1511  C C     . PRO A  1 187 ? 31.074  29.040  -6.333  1.00 15.17 ? 218  PRO A C     1 
ATOM   1512  O O     . PRO A  1 187 ? 31.016  29.192  -5.106  1.00 13.05 ? 218  PRO A O     1 
ATOM   1513  C CB    . PRO A  1 187 ? 28.922  28.880  -7.659  1.00 13.95 ? 218  PRO A CB    1 
ATOM   1514  C CG    . PRO A  1 187 ? 28.820  28.979  -9.178  1.00 15.08 ? 218  PRO A CG    1 
ATOM   1515  C CD    . PRO A  1 187 ? 30.194  29.345  -9.665  1.00 17.76 ? 218  PRO A CD    1 
ATOM   1516  N N     . GLY A  1 188 ? 31.955  28.249  -6.941  1.00 15.94 ? 219  GLY A N     1 
ATOM   1517  C CA    . GLY A  1 188 ? 32.910  27.471  -6.178  1.00 12.54 ? 219  GLY A CA    1 
ATOM   1518  C C     . GLY A  1 188 ? 34.077  28.235  -5.582  1.00 12.02 ? 219  GLY A C     1 
ATOM   1519  O O     . GLY A  1 188 ? 34.736  27.730  -4.686  1.00 9.81  ? 219  GLY A O     1 
ATOM   1520  N N     . PHE A  1 189 ? 34.324  29.452  -6.050  1.00 10.34 ? 220  PHE A N     1 
ATOM   1521  C CA    . PHE A  1 189 ? 35.457  30.230  -5.564  1.00 11.06 ? 220  PHE A CA    1 
ATOM   1522  C C     . PHE A  1 189 ? 35.181  31.240  -4.460  1.00 11.49 ? 220  PHE A C     1 
ATOM   1523  O O     . PHE A  1 189 ? 34.234  32.014  -4.537  1.00 10.10 ? 220  PHE A O     1 
ATOM   1524  C CB    . PHE A  1 189 ? 36.123  30.966  -6.735  1.00 12.73 ? 220  PHE A CB    1 
ATOM   1525  C CG    . PHE A  1 189 ? 36.331  30.112  -7.948  1.00 13.69 ? 220  PHE A CG    1 
ATOM   1526  C CD1   . PHE A  1 189 ? 35.660  30.388  -9.123  1.00 11.64 ? 220  PHE A CD1   1 
ATOM   1527  C CD2   . PHE A  1 189 ? 37.206  29.025  -7.912  1.00 19.58 ? 220  PHE A CD2   1 
ATOM   1528  C CE1   . PHE A  1 189 ? 35.845  29.603  -10.256 1.00 16.46 ? 220  PHE A CE1   1 
ATOM   1529  C CE2   . PHE A  1 189 ? 37.404  28.223  -9.044  1.00 18.68 ? 220  PHE A CE2   1 
ATOM   1530  C CZ    . PHE A  1 189 ? 36.720  28.516  -10.218 1.00 18.44 ? 220  PHE A CZ    1 
ATOM   1531  N N     . THR A  1 190 ? 36.035  31.237  -3.440  1.00 9.75  ? 221  THR A N     1 
ATOM   1532  C CA    . THR A  1 190 ? 35.920  32.185  -2.342  1.00 11.59 ? 221  THR A CA    1 
ATOM   1533  C C     . THR A  1 190 ? 36.937  33.308  -2.552  1.00 13.05 ? 221  THR A C     1 
ATOM   1534  O O     . THR A  1 190 ? 37.902  33.158  -3.298  1.00 12.78 ? 221  THR A O     1 
ATOM   1535  C CB    . THR A  1 190 ? 36.194  31.520  -0.977  1.00 10.73 ? 221  THR A CB    1 
ATOM   1536  O OG1   . THR A  1 190 ? 36.863  32.455  -0.115  1.00 4.03  ? 221  THR A OG1   1 
ATOM   1537  C CG2   . THR A  1 190 ? 37.046  30.281  -1.149  1.00 7.98  ? 221  THR A CG2   1 
ATOM   1538  N N     . ARG A  1 191 ? 36.704  34.438  -1.903  1.00 16.91 ? 222  ARG A N     1 
ATOM   1539  C CA    . ARG A  1 191 ? 37.598  35.579  -2.016  1.00 19.73 ? 222  ARG A CA    1 
ATOM   1540  C C     . ARG A  1 191 ? 38.297  35.723  -0.680  1.00 19.51 ? 222  ARG A C     1 
ATOM   1541  O O     . ARG A  1 191 ? 39.274  36.449  -0.541  1.00 19.03 ? 222  ARG A O     1 
ATOM   1542  C CB    . ARG A  1 191 ? 36.800  36.843  -2.320  1.00 27.46 ? 222  ARG A CB    1 
ATOM   1543  C CG    . ARG A  1 191 ? 37.183  37.520  -3.613  1.00 36.97 ? 222  ARG A CG    1 
ATOM   1544  C CD    . ARG A  1 191 ? 36.547  38.896  -3.707  1.00 43.59 ? 222  ARG A CD    1 
ATOM   1545  N NE    . ARG A  1 191 ? 35.094  38.802  -3.707  1.00 55.08 ? 222  ARG A NE    1 
ATOM   1546  C CZ    . ARG A  1 191 ? 34.338  39.004  -2.636  1.00 61.23 ? 222  ARG A CZ    1 
ATOM   1547  N NH1   . ARG A  1 191 ? 34.908  39.316  -1.476  1.00 61.79 ? 222  ARG A NH1   1 
ATOM   1548  N NH2   . ARG A  1 191 ? 33.015  38.879  -2.720  1.00 63.22 ? 222  ARG A NH2   1 
ATOM   1549  N N     . GLY A  1 192 ? 37.754  35.040  0.312   1.00 15.82 ? 223  GLY A N     1 
ATOM   1550  C CA    . GLY A  1 192 ? 38.342  35.078  1.628   1.00 14.55 ? 223  GLY A CA    1 
ATOM   1551  C C     . GLY A  1 192 ? 39.373  33.967  1.685   1.00 14.84 ? 223  GLY A C     1 
ATOM   1552  O O     . GLY A  1 192 ? 39.070  32.826  2.083   1.00 16.94 ? 223  GLY A O     1 
ATOM   1553  N N     . LEU A  1 193 ? 40.595  34.282  1.268   1.00 11.30 ? 224  LEU A N     1 
ATOM   1554  C CA    . LEU A  1 193 ? 41.658  33.287  1.291   1.00 10.81 ? 224  LEU A CA    1 
ATOM   1555  C C     . LEU A  1 193 ? 41.989  32.937  2.745   1.00 10.50 ? 224  LEU A C     1 
ATOM   1556  O O     . LEU A  1 193 ? 42.607  31.897  3.032   1.00 5.06  ? 224  LEU A O     1 
ATOM   1557  C CB    . LEU A  1 193 ? 42.866  33.827  0.541   1.00 8.44  ? 224  LEU A CB    1 
ATOM   1558  C CG    . LEU A  1 193 ? 42.367  34.217  -0.855  1.00 9.21  ? 224  LEU A CG    1 
ATOM   1559  C CD1   . LEU A  1 193 ? 43.199  35.347  -1.392  1.00 6.35  ? 224  LEU A CD1   1 
ATOM   1560  C CD2   . LEU A  1 193 ? 42.383  33.011  -1.796  1.00 7.36  ? 224  LEU A CD2   1 
ATOM   1561  N N     . GLY A  1 194 ? 41.552  33.804  3.660   1.00 3.93  ? 225  GLY A N     1 
ATOM   1562  C CA    . GLY A  1 194 ? 41.765  33.546  5.064   1.00 6.08  ? 225  GLY A CA    1 
ATOM   1563  C C     . GLY A  1 194 ? 41.169  32.190  5.414   1.00 6.49  ? 225  GLY A C     1 
ATOM   1564  O O     . GLY A  1 194 ? 41.562  31.554  6.400   1.00 8.27  ? 225  GLY A O     1 
ATOM   1565  N N     . HIS A  1 195 ? 40.225  31.737  4.596   1.00 2.00  ? 226  HIS A N     1 
ATOM   1566  C CA    . HIS A  1 195 ? 39.570  30.462  4.828   1.00 2.00  ? 226  HIS A CA    1 
ATOM   1567  C C     . HIS A  1 195 ? 39.341  30.187  6.302   1.00 6.59  ? 226  HIS A C     1 
ATOM   1568  O O     . HIS A  1 195 ? 39.680  29.105  6.807   1.00 8.46  ? 226  HIS A O     1 
ATOM   1569  C CB    . HIS A  1 195 ? 40.378  29.321  4.222   1.00 4.16  ? 226  HIS A CB    1 
ATOM   1570  C CG    . HIS A  1 195 ? 40.240  29.233  2.742   1.00 13.66 ? 226  HIS A CG    1 
ATOM   1571  N ND1   . HIS A  1 195 ? 39.919  28.060  2.092   1.00 14.57 ? 226  HIS A ND1   1 
ATOM   1572  C CD2   . HIS A  1 195 ? 40.330  30.188  1.784   1.00 12.21 ? 226  HIS A CD2   1 
ATOM   1573  C CE1   . HIS A  1 195 ? 39.817  28.297  0.793   1.00 12.59 ? 226  HIS A CE1   1 
ATOM   1574  N NE2   . HIS A  1 195 ? 40.062  29.579  0.582   1.00 13.57 ? 226  HIS A NE2   1 
ATOM   1575  N N     . GLY A  1 196 ? 38.767  31.163  6.993   1.00 2.00  ? 227  GLY A N     1 
ATOM   1576  C CA    . GLY A  1 196 ? 38.497  30.959  8.397   1.00 2.00  ? 227  GLY A CA    1 
ATOM   1577  C C     . GLY A  1 196 ? 38.332  32.234  9.192   1.00 2.00  ? 227  GLY A C     1 
ATOM   1578  O O     . GLY A  1 196 ? 38.390  33.348  8.654   1.00 3.76  ? 227  GLY A O     1 
ATOM   1579  N N     . VAL A  1 197 ? 38.127  32.061  10.490  1.00 2.34  ? 228  VAL A N     1 
ATOM   1580  C CA    . VAL A  1 197 ? 37.940  33.186  11.393  1.00 9.01  ? 228  VAL A CA    1 
ATOM   1581  C C     . VAL A  1 197 ? 39.196  34.048  11.449  1.00 9.76  ? 228  VAL A C     1 
ATOM   1582  O O     . VAL A  1 197 ? 40.127  33.761  12.210  1.00 13.62 ? 228  VAL A O     1 
ATOM   1583  C CB    . VAL A  1 197 ? 37.601  32.707  12.834  1.00 5.89  ? 228  VAL A CB    1 
ATOM   1584  C CG1   . VAL A  1 197 ? 36.744  33.749  13.520  1.00 2.00  ? 228  VAL A CG1   1 
ATOM   1585  C CG2   . VAL A  1 197 ? 36.905  31.334  12.807  1.00 2.00  ? 228  VAL A CG2   1 
ATOM   1586  N N     . ASP A  1 198 ? 39.221  35.104  10.650  1.00 5.16  ? 229  ASP A N     1 
ATOM   1587  C CA    . ASP A  1 198 ? 40.366  35.980  10.620  1.00 2.00  ? 229  ASP A CA    1 
ATOM   1588  C C     . ASP A  1 198 ? 39.914  37.425  10.658  1.00 4.60  ? 229  ASP A C     1 
ATOM   1589  O O     . ASP A  1 198 ? 40.705  38.332  10.416  1.00 10.47 ? 229  ASP A O     1 
ATOM   1590  C CB    . ASP A  1 198 ? 41.183  35.716  9.358   1.00 6.46  ? 229  ASP A CB    1 
ATOM   1591  C CG    . ASP A  1 198 ? 40.475  36.182  8.087   1.00 14.13 ? 229  ASP A CG    1 
ATOM   1592  O OD1   . ASP A  1 198 ? 40.879  35.725  6.971   1.00 11.42 ? 229  ASP A OD1   1 
ATOM   1593  O OD2   . ASP A  1 198 ? 39.521  37.004  8.211   1.00 11.57 ? 229  ASP A OD2   1 
ATOM   1594  N N     . LEU A  1 199 ? 38.636  37.638  10.961  1.00 7.05  ? 230  LEU A N     1 
ATOM   1595  C CA    . LEU A  1 199 ? 38.042  38.983  11.048  1.00 6.15  ? 230  LEU A CA    1 
ATOM   1596  C C     . LEU A  1 199 ? 38.446  39.876  9.902   1.00 6.50  ? 230  LEU A C     1 
ATOM   1597  O O     . LEU A  1 199 ? 38.623  41.105  10.065  1.00 8.33  ? 230  LEU A O     1 
ATOM   1598  C CB    . LEU A  1 199 ? 38.407  39.678  12.365  1.00 2.00  ? 230  LEU A CB    1 
ATOM   1599  C CG    . LEU A  1 199 ? 38.240  38.774  13.587  1.00 10.95 ? 230  LEU A CG    1 
ATOM   1600  C CD1   . LEU A  1 199 ? 38.612  39.545  14.850  1.00 12.28 ? 230  LEU A CD1   1 
ATOM   1601  C CD2   . LEU A  1 199 ? 36.814  38.243  13.658  1.00 6.06  ? 230  LEU A CD2   1 
ATOM   1602  N N     . ASN A  1 200 ? 38.586  39.267  8.730   1.00 2.00  ? 231  ASN A N     1 
ATOM   1603  C CA    . ASN A  1 200 ? 38.955  40.058  7.574   1.00 6.50  ? 231  ASN A CA    1 
ATOM   1604  C C     . ASN A  1 200 ? 37.822  41.034  7.271   1.00 2.00  ? 231  ASN A C     1 
ATOM   1605  O O     . ASN A  1 200 ? 38.021  42.030  6.598   1.00 2.00  ? 231  ASN A O     1 
ATOM   1606  C CB    . ASN A  1 200 ? 39.217  39.151  6.377   1.00 5.54  ? 231  ASN A CB    1 
ATOM   1607  C CG    . ASN A  1 200 ? 37.979  38.917  5.542   1.00 8.81  ? 231  ASN A CG    1 
ATOM   1608  O OD1   . ASN A  1 200 ? 37.393  39.857  4.997   1.00 7.82  ? 231  ASN A OD1   1 
ATOM   1609  N ND2   . ASN A  1 200 ? 37.572  37.659  5.430   1.00 6.46  ? 231  ASN A ND2   1 
ATOM   1610  N N     . HIS A  1 201 ? 36.631  40.739  7.783   1.00 6.70  ? 232  HIS A N     1 
ATOM   1611  C CA    . HIS A  1 201 ? 35.471  41.585  7.549   1.00 9.37  ? 232  HIS A CA    1 
ATOM   1612  C C     . HIS A  1 201 ? 35.585  42.860  8.352   1.00 9.79  ? 232  HIS A C     1 
ATOM   1613  O O     . HIS A  1 201 ? 34.917  43.852  8.070   1.00 2.10  ? 232  HIS A O     1 
ATOM   1614  C CB    . HIS A  1 201 ? 34.191  40.842  7.917   1.00 10.85 ? 232  HIS A CB    1 
ATOM   1615  C CG    . HIS A  1 201 ? 34.252  40.149  9.241   1.00 14.56 ? 232  HIS A CG    1 
ATOM   1616  N ND1   . HIS A  1 201 ? 33.744  40.702  10.397  1.00 17.37 ? 232  HIS A ND1   1 
ATOM   1617  C CD2   . HIS A  1 201 ? 34.722  38.928  9.587   1.00 16.74 ? 232  HIS A CD2   1 
ATOM   1618  C CE1   . HIS A  1 201 ? 33.893  39.851  11.396  1.00 18.09 ? 232  HIS A CE1   1 
ATOM   1619  N NE2   . HIS A  1 201 ? 34.486  38.766  10.932  1.00 16.54 ? 232  HIS A NE2   1 
ATOM   1620  N N     . ILE A  1 202 ? 36.446  42.836  9.356   1.00 9.12  ? 233  ILE A N     1 
ATOM   1621  C CA    . ILE A  1 202 ? 36.636  44.021  10.177  1.00 9.91  ? 233  ILE A CA    1 
ATOM   1622  C C     . ILE A  1 202 ? 37.830  44.804  9.694   1.00 10.28 ? 233  ILE A C     1 
ATOM   1623  O O     . ILE A  1 202 ? 37.820  46.029  9.752   1.00 11.98 ? 233  ILE A O     1 
ATOM   1624  C CB    . ILE A  1 202 ? 36.908  43.678  11.635  1.00 8.14  ? 233  ILE A CB    1 
ATOM   1625  C CG1   . ILE A  1 202 ? 35.750  42.873  12.203  1.00 9.96  ? 233  ILE A CG1   1 
ATOM   1626  C CG2   . ILE A  1 202 ? 37.115  44.945  12.417  1.00 2.00  ? 233  ILE A CG2   1 
ATOM   1627  C CD1   . ILE A  1 202 ? 36.170  41.949  13.317  1.00 11.73 ? 233  ILE A CD1   1 
ATOM   1628  N N     . TYR A  1 203 ? 38.858  44.097  9.221   1.00 11.76 ? 234  TYR A N     1 
ATOM   1629  C CA    . TYR A  1 203 ? 40.068  44.769  8.759   1.00 9.35  ? 234  TYR A CA    1 
ATOM   1630  C C     . TYR A  1 203 ? 40.381  44.653  7.275   1.00 10.18 ? 234  TYR A C     1 
ATOM   1631  O O     . TYR A  1 203 ? 41.470  45.031  6.855   1.00 9.39  ? 234  TYR A O     1 
ATOM   1632  C CB    . TYR A  1 203 ? 41.278  44.246  9.528   1.00 6.72  ? 234  TYR A CB    1 
ATOM   1633  C CG    . TYR A  1 203 ? 41.073  44.060  11.009  1.00 5.04  ? 234  TYR A CG    1 
ATOM   1634  C CD1   . TYR A  1 203 ? 41.147  45.147  11.889  1.00 2.00  ? 234  TYR A CD1   1 
ATOM   1635  C CD2   . TYR A  1 203 ? 40.860  42.788  11.543  1.00 7.91  ? 234  TYR A CD2   1 
ATOM   1636  C CE1   . TYR A  1 203 ? 41.016  44.971  13.268  1.00 2.00  ? 234  TYR A CE1   1 
ATOM   1637  C CE2   . TYR A  1 203 ? 40.728  42.595  12.926  1.00 3.82  ? 234  TYR A CE2   1 
ATOM   1638  C CZ    . TYR A  1 203 ? 40.809  43.690  13.780  1.00 7.77  ? 234  TYR A CZ    1 
ATOM   1639  O OH    . TYR A  1 203 ? 40.696  43.498  15.138  1.00 9.46  ? 234  TYR A OH    1 
ATOM   1640  N N     . GLY A  1 204 ? 39.450  44.134  6.479   1.00 13.15 ? 235  GLY A N     1 
ATOM   1641  C CA    . GLY A  1 204 ? 39.709  43.960  5.049   1.00 14.20 ? 235  GLY A CA    1 
ATOM   1642  C C     . GLY A  1 204 ? 40.556  42.716  4.767   1.00 15.80 ? 235  GLY A C     1 
ATOM   1643  O O     . GLY A  1 204 ? 41.168  42.155  5.681   1.00 10.80 ? 235  GLY A O     1 
ATOM   1644  N N     . GLU A  1 205 ? 40.593  42.257  3.520   1.00 16.08 ? 236  GLU A N     1 
ATOM   1645  C CA    . GLU A  1 205 ? 41.413  41.088  3.208   1.00 21.17 ? 236  GLU A CA    1 
ATOM   1646  C C     . GLU A  1 205 ? 42.839  41.525  2.880   1.00 23.81 ? 236  GLU A C     1 
ATOM   1647  O O     . GLU A  1 205 ? 43.806  40.959  3.391   1.00 23.24 ? 236  GLU A O     1 
ATOM   1648  C CB    . GLU A  1 205 ? 40.839  40.301  2.030   1.00 23.79 ? 236  GLU A CB    1 
ATOM   1649  C CG    . GLU A  1 205 ? 40.073  39.057  2.451   1.00 32.16 ? 236  GLU A CG    1 
ATOM   1650  C CD    . GLU A  1 205 ? 40.822  37.760  2.180   1.00 38.60 ? 236  GLU A CD    1 
ATOM   1651  O OE1   . GLU A  1 205 ? 40.518  36.752  2.861   1.00 37.72 ? 236  GLU A OE1   1 
ATOM   1652  O OE2   . GLU A  1 205 ? 41.710  37.741  1.291   1.00 38.42 ? 236  GLU A OE2   1 
ATOM   1653  N N     . THR A  1 206 ? 42.967  42.543  2.035   1.00 23.10 ? 237  THR A N     1 
ATOM   1654  C CA    . THR A  1 206 ? 44.277  43.043  1.654   1.00 23.53 ? 237  THR A CA    1 
ATOM   1655  C C     . THR A  1 206 ? 44.785  44.072  2.642   1.00 26.02 ? 237  THR A C     1 
ATOM   1656  O O     . THR A  1 206 ? 43.996  44.793  3.264   1.00 24.95 ? 237  THR A O     1 
ATOM   1657  C CB    . THR A  1 206 ? 44.256  43.709  0.275   1.00 23.17 ? 237  THR A CB    1 
ATOM   1658  O OG1   . THR A  1 206 ? 43.482  44.915  0.342   1.00 21.39 ? 237  THR A OG1   1 
ATOM   1659  C CG2   . THR A  1 206 ? 43.684  42.760  -0.766  1.00 23.42 ? 237  THR A CG2   1 
ATOM   1660  N N     . LEU A  1 207 ? 46.111  44.130  2.766   1.00 29.71 ? 238  LEU A N     1 
ATOM   1661  C CA    . LEU A  1 207 ? 46.775  45.068  3.657   1.00 31.31 ? 238  LEU A CA    1 
ATOM   1662  C C     . LEU A  1 207 ? 46.384  46.479  3.255   1.00 32.89 ? 238  LEU A C     1 
ATOM   1663  O O     . LEU A  1 207 ? 46.066  47.318  4.097   1.00 34.06 ? 238  LEU A O     1 
ATOM   1664  C CB    . LEU A  1 207 ? 48.281  44.921  3.531   1.00 32.06 ? 238  LEU A CB    1 
ATOM   1665  C CG    . LEU A  1 207 ? 49.044  44.325  4.707   1.00 33.51 ? 238  LEU A CG    1 
ATOM   1666  C CD1   . LEU A  1 207 ? 50.486  44.050  4.268   1.00 32.66 ? 238  LEU A CD1   1 
ATOM   1667  C CD2   . LEU A  1 207 ? 49.000  45.279  5.885   1.00 34.72 ? 238  LEU A CD2   1 
ATOM   1668  N N     . ASP A  1 208 ? 46.428  46.730  1.954   1.00 34.28 ? 239  ASP A N     1 
ATOM   1669  C CA    . ASP A  1 208 ? 46.076  48.033  1.412   1.00 38.75 ? 239  ASP A CA    1 
ATOM   1670  C C     . ASP A  1 208 ? 44.797  48.523  2.074   1.00 38.54 ? 239  ASP A C     1 
ATOM   1671  O O     . ASP A  1 208 ? 44.742  49.625  2.633   1.00 40.03 ? 239  ASP A O     1 
ATOM   1672  C CB    . ASP A  1 208 ? 45.863  47.916  -0.092  1.00 43.84 ? 239  ASP A CB    1 
ATOM   1673  C CG    . ASP A  1 208 ? 46.360  49.124  -0.839  1.00 52.98 ? 239  ASP A CG    1 
ATOM   1674  O OD1   . ASP A  1 208 ? 47.213  48.955  -1.739  1.00 57.70 ? 239  ASP A OD1   1 
ATOM   1675  O OD2   . ASP A  1 208 ? 45.894  50.240  -0.523  1.00 54.37 ? 239  ASP A OD2   1 
ATOM   1676  N N     . ARG A  1 209 ? 43.772  47.680  2.006   1.00 37.32 ? 240  ARG A N     1 
ATOM   1677  C CA    . ARG A  1 209 ? 42.483  47.979  2.597   1.00 34.48 ? 240  ARG A CA    1 
ATOM   1678  C C     . ARG A  1 209 ? 42.696  48.243  4.078   1.00 32.17 ? 240  ARG A C     1 
ATOM   1679  O O     . ARG A  1 209 ? 42.455  49.347  4.574   1.00 28.54 ? 240  ARG A O     1 
ATOM   1680  C CB    . ARG A  1 209 ? 41.562  46.781  2.400   1.00 38.60 ? 240  ARG A CB    1 
ATOM   1681  C CG    . ARG A  1 209 ? 40.253  46.845  3.158   1.00 44.41 ? 240  ARG A CG    1 
ATOM   1682  C CD    . ARG A  1 209 ? 39.184  46.013  2.453   1.00 49.73 ? 240  ARG A CD    1 
ATOM   1683  N NE    . ARG A  1 209 ? 37.825  46.425  2.800   1.00 56.58 ? 240  ARG A NE    1 
ATOM   1684  C CZ    . ARG A  1 209 ? 37.005  47.072  1.979   1.00 58.75 ? 240  ARG A CZ    1 
ATOM   1685  N NH1   . ARG A  1 209 ? 37.400  47.388  0.750   1.00 61.92 ? 240  ARG A NH1   1 
ATOM   1686  N NH2   . ARG A  1 209 ? 35.785  47.400  2.390   1.00 59.66 ? 240  ARG A NH2   1 
ATOM   1687  N N     . GLN A  1 210 ? 43.178  47.212  4.764   1.00 28.55 ? 241  GLN A N     1 
ATOM   1688  C CA    . GLN A  1 210 ? 43.443  47.265  6.195   1.00 25.81 ? 241  GLN A CA    1 
ATOM   1689  C C     . GLN A  1 210 ? 44.064  48.571  6.642   1.00 23.35 ? 241  GLN A C     1 
ATOM   1690  O O     . GLN A  1 210 ? 43.640  49.161  7.626   1.00 22.50 ? 241  GLN A O     1 
ATOM   1691  C CB    . GLN A  1 210 ? 44.358  46.105  6.596   1.00 26.54 ? 241  GLN A CB    1 
ATOM   1692  C CG    . GLN A  1 210 ? 45.700  46.525  7.165   1.00 27.31 ? 241  GLN A CG    1 
ATOM   1693  C CD    . GLN A  1 210 ? 45.990  45.895  8.517   1.00 29.89 ? 241  GLN A CD    1 
ATOM   1694  O OE1   . GLN A  1 210 ? 46.661  46.497  9.364   1.00 29.92 ? 241  GLN A OE1   1 
ATOM   1695  N NE2   . GLN A  1 210 ? 45.488  44.678  8.728   1.00 25.18 ? 241  GLN A NE2   1 
ATOM   1696  N N     . HIS A  1 211 ? 45.067  49.023  5.909   1.00 23.04 ? 242  HIS A N     1 
ATOM   1697  C CA    . HIS A  1 211 ? 45.757  50.245  6.268   1.00 23.97 ? 242  HIS A CA    1 
ATOM   1698  C C     . HIS A  1 211 ? 44.872  51.463  6.178   1.00 20.83 ? 242  HIS A C     1 
ATOM   1699  O O     . HIS A  1 211 ? 45.021  52.407  6.959   1.00 18.00 ? 242  HIS A O     1 
ATOM   1700  C CB    . HIS A  1 211 ? 47.001  50.417  5.399   1.00 30.84 ? 242  HIS A CB    1 
ATOM   1701  C CG    . HIS A  1 211 ? 48.139  49.536  5.815   1.00 37.18 ? 242  HIS A CG    1 
ATOM   1702  N ND1   . HIS A  1 211 ? 48.360  49.180  7.130   1.00 38.45 ? 242  HIS A ND1   1 
ATOM   1703  C CD2   . HIS A  1 211 ? 49.088  48.897  5.091   1.00 37.75 ? 242  HIS A CD2   1 
ATOM   1704  C CE1   . HIS A  1 211 ? 49.392  48.359  7.199   1.00 36.80 ? 242  HIS A CE1   1 
ATOM   1705  N NE2   . HIS A  1 211 ? 49.851  48.171  5.975   1.00 39.59 ? 242  HIS A NE2   1 
ATOM   1706  N N     . LYS A  1 212 ? 43.951  51.450  5.224   1.00 18.96 ? 243  LYS A N     1 
ATOM   1707  C CA    . LYS A  1 212 ? 43.042  52.570  5.078   1.00 18.71 ? 243  LYS A CA    1 
ATOM   1708  C C     . LYS A  1 212 ? 42.037  52.562  6.225   1.00 17.67 ? 243  LYS A C     1 
ATOM   1709  O O     . LYS A  1 212 ? 41.557  53.624  6.640   1.00 17.16 ? 243  LYS A O     1 
ATOM   1710  C CB    . LYS A  1 212 ? 42.334  52.482  3.742   1.00 13.85 ? 243  LYS A CB    1 
ATOM   1711  C CG    . LYS A  1 212 ? 43.307  52.340  2.606   1.00 15.00 ? 243  LYS A CG    1 
ATOM   1712  C CD    . LYS A  1 212 ? 42.638  51.718  1.389   1.00 18.05 ? 243  LYS A CD    1 
ATOM   1713  C CE    . LYS A  1 212 ? 42.371  52.751  0.301   1.00 15.91 ? 243  LYS A CE    1 
ATOM   1714  N NZ    . LYS A  1 212 ? 42.629  52.176  -1.048  1.00 21.05 ? 243  LYS A NZ    1 
ATOM   1715  N N     . LEU A  1 213 ? 41.736  51.364  6.736   1.00 15.36 ? 244  LEU A N     1 
ATOM   1716  C CA    . LEU A  1 213 ? 40.803  51.217  7.849   1.00 14.96 ? 244  LEU A CA    1 
ATOM   1717  C C     . LEU A  1 213 ? 41.533  51.441  9.168   1.00 16.49 ? 244  LEU A C     1 
ATOM   1718  O O     . LEU A  1 213 ? 40.936  51.393  10.249  1.00 16.03 ? 244  LEU A O     1 
ATOM   1719  C CB    . LEU A  1 213 ? 40.200  49.823  7.872   1.00 13.21 ? 244  LEU A CB    1 
ATOM   1720  C CG    . LEU A  1 213 ? 39.505  49.283  6.635   1.00 11.47 ? 244  LEU A CG    1 
ATOM   1721  C CD1   . LEU A  1 213 ? 39.025  47.850  6.926   1.00 4.99  ? 244  LEU A CD1   1 
ATOM   1722  C CD2   . LEU A  1 213 ? 38.348  50.196  6.269   1.00 3.98  ? 244  LEU A CD2   1 
ATOM   1723  N N     . ARG A  1 214 ? 42.838  51.664  9.065   1.00 21.17 ? 245  ARG A N     1 
ATOM   1724  C CA    . ARG A  1 214 ? 43.674  51.897  10.231  1.00 21.96 ? 245  ARG A CA    1 
ATOM   1725  C C     . ARG A  1 214 ? 43.916  53.379  10.440  1.00 20.22 ? 245  ARG A C     1 
ATOM   1726  O O     . ARG A  1 214 ? 44.027  54.162  9.486   1.00 21.22 ? 245  ARG A O     1 
ATOM   1727  C CB    . ARG A  1 214 ? 45.013  51.189  10.073  1.00 23.40 ? 245  ARG A CB    1 
ATOM   1728  C CG    . ARG A  1 214 ? 45.011  49.782  10.617  1.00 28.05 ? 245  ARG A CG    1 
ATOM   1729  C CD    . ARG A  1 214 ? 46.374  49.127  10.470  1.00 32.72 ? 245  ARG A CD    1 
ATOM   1730  N NE    . ARG A  1 214 ? 47.344  49.663  11.428  1.00 38.91 ? 245  ARG A NE    1 
ATOM   1731  C CZ    . ARG A  1 214 ? 48.546  49.137  11.659  1.00 33.61 ? 245  ARG A CZ    1 
ATOM   1732  N NH1   . ARG A  1 214 ? 48.936  48.053  11.002  1.00 35.72 ? 245  ARG A NH1   1 
ATOM   1733  N NH2   . ARG A  1 214 ? 49.358  49.700  12.544  1.00 30.82 ? 245  ARG A NH2   1 
ATOM   1734  N N     . LEU A  1 215 ? 44.010  53.756  11.704  1.00 17.98 ? 246  LEU A N     1 
ATOM   1735  C CA    . LEU A  1 215 ? 44.224  55.145  12.056  1.00 15.11 ? 246  LEU A CA    1 
ATOM   1736  C C     . LEU A  1 215 ? 45.721  55.391  12.297  1.00 17.26 ? 246  LEU A C     1 
ATOM   1737  O O     . LEU A  1 215 ? 46.209  56.537  12.216  1.00 15.89 ? 246  LEU A O     1 
ATOM   1738  C CB    . LEU A  1 215 ? 43.397  55.462  13.296  1.00 7.76  ? 246  LEU A CB    1 
ATOM   1739  C CG    . LEU A  1 215 ? 43.923  56.521  14.252  1.00 10.16 ? 246  LEU A CG    1 
ATOM   1740  C CD1   . LEU A  1 215 ? 43.550  57.923  13.764  1.00 3.82  ? 246  LEU A CD1   1 
ATOM   1741  C CD2   . LEU A  1 215 ? 43.362  56.237  15.634  1.00 3.02  ? 246  LEU A CD2   1 
ATOM   1742  N N     . PHE A  1 216 ? 46.440  54.302  12.583  1.00 16.17 ? 247  PHE A N     1 
ATOM   1743  C CA    . PHE A  1 216 ? 47.881  54.347  12.831  1.00 11.52 ? 247  PHE A CA    1 
ATOM   1744  C C     . PHE A  1 216 ? 48.195  55.233  14.010  1.00 13.27 ? 247  PHE A C     1 
ATOM   1745  O O     . PHE A  1 216 ? 48.913  56.224  13.906  1.00 14.10 ? 247  PHE A O     1 
ATOM   1746  C CB    . PHE A  1 216 ? 48.609  54.838  11.587  1.00 3.80  ? 247  PHE A CB    1 
ATOM   1747  C CG    . PHE A  1 216 ? 48.573  53.867  10.466  1.00 2.00  ? 247  PHE A CG    1 
ATOM   1748  C CD1   . PHE A  1 216 ? 48.068  54.235  9.228   1.00 2.00  ? 247  PHE A CD1   1 
ATOM   1749  C CD2   . PHE A  1 216 ? 49.028  52.560  10.651  1.00 2.00  ? 247  PHE A CD2   1 
ATOM   1750  C CE1   . PHE A  1 216 ? 48.010  53.309  8.172   1.00 6.37  ? 247  PHE A CE1   1 
ATOM   1751  C CE2   . PHE A  1 216 ? 48.978  51.625  9.609   1.00 2.00  ? 247  PHE A CE2   1 
ATOM   1752  C CZ    . PHE A  1 216 ? 48.467  52.000  8.366   1.00 2.00  ? 247  PHE A CZ    1 
ATOM   1753  N N     . LYS A  1 217 ? 47.613  54.866  15.135  1.00 17.31 ? 248  LYS A N     1 
ATOM   1754  C CA    . LYS A  1 217 ? 47.797  55.574  16.383  1.00 23.22 ? 248  LYS A CA    1 
ATOM   1755  C C     . LYS A  1 217 ? 47.191  54.622  17.381  1.00 23.82 ? 248  LYS A C     1 
ATOM   1756  O O     . LYS A  1 217 ? 46.033  54.254  17.259  1.00 26.05 ? 248  LYS A O     1 
ATOM   1757  C CB    . LYS A  1 217 ? 47.016  56.885  16.390  1.00 24.81 ? 248  LYS A CB    1 
ATOM   1758  C CG    . LYS A  1 217 ? 47.884  58.126  16.297  1.00 33.95 ? 248  LYS A CG    1 
ATOM   1759  C CD    . LYS A  1 217 ? 47.236  59.197  15.418  1.00 37.17 ? 248  LYS A CD    1 
ATOM   1760  C CE    . LYS A  1 217 ? 47.265  58.813  13.945  1.00 39.21 ? 248  LYS A CE    1 
ATOM   1761  N NZ    . LYS A  1 217 ? 46.931  59.972  13.084  1.00 40.89 ? 248  LYS A NZ    1 
ATOM   1762  N N     . ASP A  1 218 ? 47.981  54.188  18.349  1.00 24.99 ? 249  ASP A N     1 
ATOM   1763  C CA    . ASP A  1 218 ? 47.476  53.274  19.355  1.00 25.46 ? 249  ASP A CA    1 
ATOM   1764  C C     . ASP A  1 218 ? 46.859  52.046  18.708  1.00 25.96 ? 249  ASP A C     1 
ATOM   1765  O O     . ASP A  1 218 ? 46.006  51.390  19.303  1.00 24.61 ? 249  ASP A O     1 
ATOM   1766  C CB    . ASP A  1 218 ? 46.452  54.002  20.218  1.00 23.05 ? 249  ASP A CB    1 
ATOM   1767  C CG    . ASP A  1 218 ? 46.851  55.444  20.483  1.00 27.89 ? 249  ASP A CG    1 
ATOM   1768  O OD1   . ASP A  1 218 ? 47.243  55.761  21.625  1.00 28.92 ? 249  ASP A OD1   1 
ATOM   1769  O OD2   . ASP A  1 218 ? 46.789  56.271  19.545  1.00 30.71 ? 249  ASP A OD2   1 
ATOM   1770  N N     . GLY A  1 219 ? 47.302  51.747  17.487  1.00 27.56 ? 250  GLY A N     1 
ATOM   1771  C CA    . GLY A  1 219 ? 46.800  50.598  16.742  1.00 26.65 ? 250  GLY A CA    1 
ATOM   1772  C C     . GLY A  1 219 ? 45.291  50.588  16.558  1.00 26.83 ? 250  GLY A C     1 
ATOM   1773  O O     . GLY A  1 219 ? 44.683  49.535  16.407  1.00 27.40 ? 250  GLY A O     1 
ATOM   1774  N N     . LYS A  1 220 ? 44.685  51.766  16.567  1.00 24.56 ? 251  LYS A N     1 
ATOM   1775  C CA    . LYS A  1 220 ? 43.248  51.878  16.422  1.00 25.19 ? 251  LYS A CA    1 
ATOM   1776  C C     . LYS A  1 220 ? 42.758  51.969  14.974  1.00 26.91 ? 251  LYS A C     1 
ATOM   1777  O O     . LYS A  1 220 ? 43.451  52.500  14.079  1.00 25.29 ? 251  LYS A O     1 
ATOM   1778  C CB    . LYS A  1 220 ? 42.752  53.103  17.189  1.00 25.33 ? 251  LYS A CB    1 
ATOM   1779  C CG    . LYS A  1 220 ? 42.584  52.874  18.682  1.00 30.76 ? 251  LYS A CG    1 
ATOM   1780  C CD    . LYS A  1 220 ? 42.593  54.212  19.428  1.00 31.86 ? 251  LYS A CD    1 
ATOM   1781  C CE    . LYS A  1 220 ? 42.080  54.085  20.868  1.00 31.30 ? 251  LYS A CE    1 
ATOM   1782  N NZ    . LYS A  1 220 ? 42.288  55.372  21.617  1.00 27.81 ? 251  LYS A NZ    1 
ATOM   1783  N N     . LEU A  1 221 ? 41.545  51.452  14.766  1.00 23.55 ? 252  LEU A N     1 
ATOM   1784  C CA    . LEU A  1 221 ? 40.904  51.485  13.466  1.00 18.04 ? 252  LEU A CA    1 
ATOM   1785  C C     . LEU A  1 221 ? 40.284  52.858  13.325  1.00 14.51 ? 252  LEU A C     1 
ATOM   1786  O O     . LEU A  1 221 ? 39.698  53.380  14.273  1.00 14.94 ? 252  LEU A O     1 
ATOM   1787  C CB    . LEU A  1 221 ? 39.816  50.423  13.391  1.00 18.73 ? 252  LEU A CB    1 
ATOM   1788  C CG    . LEU A  1 221 ? 40.292  49.062  12.896  1.00 20.61 ? 252  LEU A CG    1 
ATOM   1789  C CD1   . LEU A  1 221 ? 39.526  47.967  13.618  1.00 18.76 ? 252  LEU A CD1   1 
ATOM   1790  C CD2   . LEU A  1 221 ? 40.110  48.972  11.378  1.00 17.55 ? 252  LEU A CD2   1 
ATOM   1791  N N     . LYS A  1 222 ? 40.440  53.457  12.155  1.00 17.13 ? 253  LYS A N     1 
ATOM   1792  C CA    . LYS A  1 222 ? 39.870  54.766  11.905  1.00 20.70 ? 253  LYS A CA    1 
ATOM   1793  C C     . LYS A  1 222 ? 38.381  54.692  12.219  1.00 24.11 ? 253  LYS A C     1 
ATOM   1794  O O     . LYS A  1 222 ? 37.698  53.737  11.835  1.00 24.77 ? 253  LYS A O     1 
ATOM   1795  C CB    . LYS A  1 222 ? 40.050  55.138  10.438  1.00 21.65 ? 253  LYS A CB    1 
ATOM   1796  C CG    . LYS A  1 222 ? 41.450  55.538  10.071  1.00 24.01 ? 253  LYS A CG    1 
ATOM   1797  C CD    . LYS A  1 222 ? 41.430  56.704  9.093   1.00 26.81 ? 253  LYS A CD    1 
ATOM   1798  C CE    . LYS A  1 222 ? 42.010  56.299  7.741   1.00 28.37 ? 253  LYS A CE    1 
ATOM   1799  N NZ    . LYS A  1 222 ? 42.285  57.487  6.888   1.00 29.83 ? 253  LYS A NZ    1 
ATOM   1800  N N     . TYR A  1 223 ? 37.870  55.693  12.922  1.00 24.47 ? 254  TYR A N     1 
ATOM   1801  C CA    . TYR A  1 223 ? 36.455  55.710  13.256  1.00 24.00 ? 254  TYR A CA    1 
ATOM   1802  C C     . TYR A  1 223 ? 35.867  57.094  12.983  1.00 25.91 ? 254  TYR A C     1 
ATOM   1803  O O     . TYR A  1 223 ? 36.479  57.901  12.292  1.00 25.83 ? 254  TYR A O     1 
ATOM   1804  C CB    . TYR A  1 223 ? 36.259  55.300  14.725  1.00 23.98 ? 254  TYR A CB    1 
ATOM   1805  C CG    . TYR A  1 223 ? 36.869  56.224  15.768  1.00 27.82 ? 254  TYR A CG    1 
ATOM   1806  C CD1   . TYR A  1 223 ? 36.776  57.612  15.652  1.00 28.67 ? 254  TYR A CD1   1 
ATOM   1807  C CD2   . TYR A  1 223 ? 37.478  55.701  16.911  1.00 29.92 ? 254  TYR A CD2   1 
ATOM   1808  C CE1   . TYR A  1 223 ? 37.267  58.452  16.642  1.00 31.07 ? 254  TYR A CE1   1 
ATOM   1809  C CE2   . TYR A  1 223 ? 37.973  56.533  17.909  1.00 29.98 ? 254  TYR A CE2   1 
ATOM   1810  C CZ    . TYR A  1 223 ? 37.863  57.906  17.767  1.00 30.21 ? 254  TYR A CZ    1 
ATOM   1811  O OH    . TYR A  1 223 ? 38.349  58.736  18.746  1.00 29.43 ? 254  TYR A OH    1 
ATOM   1812  N N     . GLN A  1 224 ? 34.679  57.363  13.521  1.00 29.59 ? 255  GLN A N     1 
ATOM   1813  C CA    . GLN A  1 224 ? 34.025  58.654  13.343  1.00 27.83 ? 255  GLN A CA    1 
ATOM   1814  C C     . GLN A  1 224 ? 32.926  58.837  14.374  1.00 27.42 ? 255  GLN A C     1 
ATOM   1815  O O     . GLN A  1 224 ? 32.240  57.883  14.728  1.00 27.69 ? 255  GLN A O     1 
ATOM   1816  C CB    . GLN A  1 224 ? 33.446  58.753  11.942  1.00 25.90 ? 255  GLN A CB    1 
ATOM   1817  C CG    . GLN A  1 224 ? 32.083  58.162  11.796  1.00 20.76 ? 255  GLN A CG    1 
ATOM   1818  C CD    . GLN A  1 224 ? 31.424  58.626  10.527  1.00 22.76 ? 255  GLN A CD    1 
ATOM   1819  O OE1   . GLN A  1 224 ? 31.423  59.819  10.220  1.00 20.09 ? 255  GLN A OE1   1 
ATOM   1820  N NE2   . GLN A  1 224 ? 30.863  57.686  9.773   1.00 22.54 ? 255  GLN A NE2   1 
ATOM   1821  N N     . VAL A  1 225 ? 32.765  60.064  14.862  1.00 29.34 ? 256  VAL A N     1 
ATOM   1822  C CA    . VAL A  1 225 ? 31.745  60.342  15.875  1.00 30.74 ? 256  VAL A CA    1 
ATOM   1823  C C     . VAL A  1 225 ? 30.566  61.130  15.328  1.00 28.44 ? 256  VAL A C     1 
ATOM   1824  O O     . VAL A  1 225 ? 30.708  62.272  14.889  1.00 28.71 ? 256  VAL A O     1 
ATOM   1825  C CB    . VAL A  1 225 ? 32.334  61.111  17.091  1.00 28.36 ? 256  VAL A CB    1 
ATOM   1826  C CG1   . VAL A  1 225 ? 31.219  61.686  17.942  1.00 29.29 ? 256  VAL A CG1   1 
ATOM   1827  C CG2   . VAL A  1 225 ? 33.182  60.177  17.925  1.00 29.88 ? 256  VAL A CG2   1 
ATOM   1828  N N     . ILE A  1 226 ? 29.400  60.503  15.350  1.00 29.76 ? 257  ILE A N     1 
ATOM   1829  C CA    . ILE A  1 226 ? 28.197  61.152  14.876  1.00 30.45 ? 257  ILE A CA    1 
ATOM   1830  C C     . ILE A  1 226 ? 27.268  61.239  16.056  1.00 28.69 ? 257  ILE A C     1 
ATOM   1831  O O     . ILE A  1 226 ? 27.011  60.235  16.731  1.00 28.18 ? 257  ILE A O     1 
ATOM   1832  C CB    . ILE A  1 226 ? 27.507  60.354  13.751  1.00 30.24 ? 257  ILE A CB    1 
ATOM   1833  C CG1   . ILE A  1 226 ? 28.558  59.728  12.826  1.00 30.46 ? 257  ILE A CG1   1 
ATOM   1834  C CG2   . ILE A  1 226 ? 26.593  61.279  12.962  1.00 31.01 ? 257  ILE A CG2   1 
ATOM   1835  C CD1   . ILE A  1 226 ? 28.083  59.470  11.403  1.00 26.57 ? 257  ILE A CD1   1 
ATOM   1836  N N     . GLY A  1 227 ? 26.786  62.450  16.311  1.00 26.45 ? 258  GLY A N     1 
ATOM   1837  C CA    . GLY A  1 227 ? 25.877  62.654  17.417  1.00 27.62 ? 258  GLY A CA    1 
ATOM   1838  C C     . GLY A  1 227 ? 26.400  62.041  18.697  1.00 30.40 ? 258  GLY A C     1 
ATOM   1839  O O     . GLY A  1 227 ? 25.660  61.383  19.430  1.00 30.65 ? 258  GLY A O     1 
ATOM   1840  N N     . GLY A  1 228 ? 27.682  62.250  18.968  1.00 28.11 ? 259  GLY A N     1 
ATOM   1841  C CA    . GLY A  1 228 ? 28.263  61.707  20.181  1.00 28.29 ? 259  GLY A CA    1 
ATOM   1842  C C     . GLY A  1 228 ? 28.413  60.195  20.202  1.00 28.39 ? 259  GLY A C     1 
ATOM   1843  O O     . GLY A  1 228 ? 28.646  59.618  21.258  1.00 28.98 ? 259  GLY A O     1 
ATOM   1844  N N     . GLU A  1 229 ? 28.287  59.542  19.055  1.00 25.40 ? 260  GLU A N     1 
ATOM   1845  C CA    . GLU A  1 229 ? 28.431  58.095  19.024  1.00 30.32 ? 260  GLU A CA    1 
ATOM   1846  C C     . GLU A  1 229 ? 29.555  57.647  18.099  1.00 31.48 ? 260  GLU A C     1 
ATOM   1847  O O     . GLU A  1 229 ? 29.864  58.308  17.106  1.00 32.57 ? 260  GLU A O     1 
ATOM   1848  C CB    . GLU A  1 229 ? 27.125  57.442  18.592  1.00 28.63 ? 260  GLU A CB    1 
ATOM   1849  C CG    . GLU A  1 229 ? 26.045  57.449  19.671  1.00 31.94 ? 260  GLU A CG    1 
ATOM   1850  C CD    . GLU A  1 229 ? 26.376  56.560  20.880  1.00 33.93 ? 260  GLU A CD    1 
ATOM   1851  O OE1   . GLU A  1 229 ? 27.008  57.059  21.844  1.00 32.00 ? 260  GLU A OE1   1 
ATOM   1852  O OE2   . GLU A  1 229 ? 25.997  55.365  20.873  1.00 31.86 ? 260  GLU A OE2   1 
ATOM   1853  N N     . VAL A  1 230 ? 30.162  56.512  18.438  1.00 35.14 ? 261  VAL A N     1 
ATOM   1854  C CA    . VAL A  1 230 ? 31.265  55.947  17.657  1.00 37.21 ? 261  VAL A CA    1 
ATOM   1855  C C     . VAL A  1 230 ? 30.749  55.116  16.494  1.00 34.29 ? 261  VAL A C     1 
ATOM   1856  O O     . VAL A  1 230 ? 30.040  54.133  16.696  1.00 36.03 ? 261  VAL A O     1 
ATOM   1857  C CB    . VAL A  1 230 ? 32.163  55.037  18.530  1.00 35.34 ? 261  VAL A CB    1 
ATOM   1858  C CG1   . VAL A  1 230 ? 33.269  54.427  17.681  1.00 34.74 ? 261  VAL A CG1   1 
ATOM   1859  C CG2   . VAL A  1 230 ? 32.761  55.838  19.678  1.00 32.72 ? 261  VAL A CG2   1 
ATOM   1860  N N     . TYR A  1 231 ? 31.129  55.497  15.281  1.00 34.47 ? 262  TYR A N     1 
ATOM   1861  C CA    . TYR A  1 231 ? 30.687  54.778  14.096  1.00 38.78 ? 262  TYR A CA    1 
ATOM   1862  C C     . TYR A  1 231 ? 31.811  54.558  13.092  1.00 33.20 ? 262  TYR A C     1 
ATOM   1863  O O     . TYR A  1 231 ? 32.808  55.277  13.088  1.00 30.89 ? 262  TYR A O     1 
ATOM   1864  C CB    . TYR A  1 231 ? 29.572  55.556  13.403  1.00 45.88 ? 262  TYR A CB    1 
ATOM   1865  C CG    . TYR A  1 231 ? 28.232  55.439  14.076  1.00 53.44 ? 262  TYR A CG    1 
ATOM   1866  C CD1   . TYR A  1 231 ? 27.704  56.501  14.815  1.00 54.23 ? 262  TYR A CD1   1 
ATOM   1867  C CD2   . TYR A  1 231 ? 27.484  54.262  13.976  1.00 55.23 ? 262  TYR A CD2   1 
ATOM   1868  C CE1   . TYR A  1 231 ? 26.459  56.392  15.441  1.00 57.38 ? 262  TYR A CE1   1 
ATOM   1869  C CE2   . TYR A  1 231 ? 26.237  54.142  14.597  1.00 56.65 ? 262  TYR A CE2   1 
ATOM   1870  C CZ    . TYR A  1 231 ? 25.729  55.206  15.327  1.00 57.57 ? 262  TYR A CZ    1 
ATOM   1871  O OH    . TYR A  1 231 ? 24.497  55.071  15.936  1.00 53.99 ? 262  TYR A OH    1 
ATOM   1872  N N     . PRO A  1 232 ? 31.671  53.538  12.235  1.00 23.81 ? 263  PRO A N     1 
ATOM   1873  C CA    . PRO A  1 232 ? 32.713  53.294  11.239  1.00 29.62 ? 263  PRO A CA    1 
ATOM   1874  C C     . PRO A  1 232 ? 32.920  54.610  10.503  1.00 24.59 ? 263  PRO A C     1 
ATOM   1875  O O     . PRO A  1 232 ? 32.074  55.501  10.579  1.00 21.14 ? 263  PRO A O     1 
ATOM   1876  C CB    . PRO A  1 232 ? 32.108  52.225  10.346  1.00 23.71 ? 263  PRO A CB    1 
ATOM   1877  C CG    . PRO A  1 232 ? 31.145  51.498  11.245  1.00 26.84 ? 263  PRO A CG    1 
ATOM   1878  C CD    . PRO A  1 232 ? 30.582  52.550  12.157  1.00 29.17 ? 263  PRO A CD    1 
ATOM   1879  N N     . PRO A  1 233 ? 34.042  54.751  9.777   1.00 17.84 ? 264  PRO A N     1 
ATOM   1880  C CA    . PRO A  1 233 ? 34.301  55.998  9.058   1.00 27.47 ? 264  PRO A CA    1 
ATOM   1881  C C     . PRO A  1 233 ? 33.835  55.959  7.604   1.00 23.39 ? 264  PRO A C     1 
ATOM   1882  O O     . PRO A  1 233 ? 33.514  54.885  7.064   1.00 20.29 ? 264  PRO A O     1 
ATOM   1883  C CB    . PRO A  1 233 ? 35.810  56.161  9.196   1.00 22.33 ? 264  PRO A CB    1 
ATOM   1884  C CG    . PRO A  1 233 ? 36.334  54.716  9.352   1.00 20.29 ? 264  PRO A CG    1 
ATOM   1885  C CD    . PRO A  1 233 ? 35.146  53.800  9.574   1.00 24.00 ? 264  PRO A CD    1 
ATOM   1886  N N     . THR A  1 234 ? 33.822  57.135  6.979   1.00 19.52 ? 265  THR A N     1 
ATOM   1887  C CA    . THR A  1 234 ? 33.365  57.270  5.603   1.00 22.96 ? 265  THR A CA    1 
ATOM   1888  C C     . THR A  1 234 ? 34.304  56.796  4.510   1.00 22.18 ? 265  THR A C     1 
ATOM   1889  O O     . THR A  1 234 ? 35.520  56.778  4.665   1.00 23.00 ? 265  THR A O     1 
ATOM   1890  C CB    . THR A  1 234 ? 33.007  58.732  5.251   1.00 25.41 ? 265  THR A CB    1 
ATOM   1891  O OG1   . THR A  1 234 ? 33.916  59.213  4.247   1.00 26.77 ? 265  THR A OG1   1 
ATOM   1892  C CG2   . THR A  1 234 ? 33.084  59.624  6.481   1.00 26.16 ? 265  THR A CG2   1 
ATOM   1893  N N     . VAL A  1 235 ? 33.702  56.449  3.380   1.00 24.91 ? 266  VAL A N     1 
ATOM   1894  C CA    . VAL A  1 235 ? 34.434  56.002  2.206   1.00 27.18 ? 266  VAL A CA    1 
ATOM   1895  C C     . VAL A  1 235 ? 35.172  57.185  1.595   1.00 30.94 ? 266  VAL A C     1 
ATOM   1896  O O     . VAL A  1 235 ? 36.215  57.024  0.958   1.00 33.21 ? 266  VAL A O     1 
ATOM   1897  C CB    . VAL A  1 235 ? 33.487  55.455  1.135   1.00 25.48 ? 266  VAL A CB    1 
ATOM   1898  C CG1   . VAL A  1 235 ? 34.262  55.183  -0.149  1.00 28.74 ? 266  VAL A CG1   1 
ATOM   1899  C CG2   . VAL A  1 235 ? 32.796  54.197  1.648   1.00 29.26 ? 266  VAL A CG2   1 
ATOM   1900  N N     . LYS A  1 236 ? 34.623  58.376  1.786   1.00 30.36 ? 267  LYS A N     1 
ATOM   1901  C CA    . LYS A  1 236 ? 35.225  59.573  1.231   1.00 35.53 ? 267  LYS A CA    1 
ATOM   1902  C C     . LYS A  1 236 ? 36.454  60.011  2.011   1.00 37.25 ? 267  LYS A C     1 
ATOM   1903  O O     . LYS A  1 236 ? 37.177  60.902  1.582   1.00 40.80 ? 267  LYS A O     1 
ATOM   1904  C CB    . LYS A  1 236 ? 34.190  60.690  1.202   1.00 35.70 ? 267  LYS A CB    1 
ATOM   1905  C CG    . LYS A  1 236 ? 34.714  62.032  0.745   1.00 37.67 ? 267  LYS A CG    1 
ATOM   1906  C CD    . LYS A  1 236 ? 34.103  63.139  1.577   1.00 36.79 ? 267  LYS A CD    1 
ATOM   1907  C CE    . LYS A  1 236 ? 34.867  64.439  1.430   1.00 36.03 ? 267  LYS A CE    1 
ATOM   1908  N NZ    . LYS A  1 236 ? 33.931  65.597  1.440   1.00 35.64 ? 267  LYS A NZ    1 
ATOM   1909  N N     . ASP A  1 237 ? 36.705  59.377  3.150   1.00 39.17 ? 268  ASP A N     1 
ATOM   1910  C CA    . ASP A  1 237 ? 37.861  59.740  3.962   1.00 39.69 ? 268  ASP A CA    1 
ATOM   1911  C C     . ASP A  1 237 ? 38.907  58.635  4.019   1.00 35.14 ? 268  ASP A C     1 
ATOM   1912  O O     . ASP A  1 237 ? 40.048  58.866  4.424   1.00 38.34 ? 268  ASP A O     1 
ATOM   1913  C CB    . ASP A  1 237 ? 37.407  60.092  5.374   1.00 44.97 ? 268  ASP A CB    1 
ATOM   1914  C CG    . ASP A  1 237 ? 36.128  60.890  5.380   1.00 53.48 ? 268  ASP A CG    1 
ATOM   1915  O OD1   . ASP A  1 237 ? 35.758  61.425  4.314   1.00 57.90 ? 268  ASP A OD1   1 
ATOM   1916  O OD2   . ASP A  1 237 ? 35.490  60.984  6.447   1.00 56.49 ? 268  ASP A OD2   1 
ATOM   1917  N N     . THR A  1 238 ? 38.524  57.436  3.610   1.00 30.75 ? 269  THR A N     1 
ATOM   1918  C CA    . THR A  1 238 ? 39.453  56.321  3.634   1.00 29.00 ? 269  THR A CA    1 
ATOM   1919  C C     . THR A  1 238 ? 39.631  55.736  2.244   1.00 29.31 ? 269  THR A C     1 
ATOM   1920  O O     . THR A  1 238 ? 40.505  54.903  2.020   1.00 29.24 ? 269  THR A O     1 
ATOM   1921  C CB    . THR A  1 238 ? 38.947  55.219  4.577   1.00 26.72 ? 269  THR A CB    1 
ATOM   1922  O OG1   . THR A  1 238 ? 37.885  54.483  3.945   1.00 26.07 ? 269  THR A OG1   1 
ATOM   1923  C CG2   . THR A  1 238 ? 38.429  55.839  5.859   1.00 22.62 ? 269  THR A CG2   1 
ATOM   1924  N N     . GLN A  1 239 ? 38.789  56.175  1.317   1.00 28.52 ? 270  GLN A N     1 
ATOM   1925  C CA    . GLN A  1 239 ? 38.838  55.685  -0.051  1.00 30.73 ? 270  GLN A CA    1 
ATOM   1926  C C     . GLN A  1 239 ? 38.647  54.163  -0.095  1.00 31.10 ? 270  GLN A C     1 
ATOM   1927  O O     . GLN A  1 239 ? 38.804  53.527  -1.146  1.00 28.69 ? 270  GLN A O     1 
ATOM   1928  C CB    . GLN A  1 239 ? 40.166  56.075  -0.698  1.00 35.38 ? 270  GLN A CB    1 
ATOM   1929  C CG    . GLN A  1 239 ? 40.170  57.479  -1.283  1.00 41.14 ? 270  GLN A CG    1 
ATOM   1930  C CD    . GLN A  1 239 ? 39.625  58.511  -0.311  1.00 46.64 ? 270  GLN A CD    1 
ATOM   1931  O OE1   . GLN A  1 239 ? 39.777  58.378  0.910   1.00 45.35 ? 270  GLN A OE1   1 
ATOM   1932  N NE2   . GLN A  1 239 ? 38.986  59.549  -0.845  1.00 42.37 ? 270  GLN A NE2   1 
ATOM   1933  N N     . VAL A  1 240 ? 38.294  53.586  1.048   1.00 26.46 ? 271  VAL A N     1 
ATOM   1934  C CA    . VAL A  1 240 ? 38.084  52.159  1.121   1.00 30.28 ? 271  VAL A CA    1 
ATOM   1935  C C     . VAL A  1 240 ? 37.009  51.738  0.132   1.00 32.77 ? 271  VAL A C     1 
ATOM   1936  O O     . VAL A  1 240 ? 36.108  52.514  -0.174  1.00 35.10 ? 271  VAL A O     1 
ATOM   1937  C CB    . VAL A  1 240 ? 37.659  51.748  2.535   1.00 29.42 ? 271  VAL A CB    1 
ATOM   1938  C CG1   . VAL A  1 240 ? 37.234  50.274  2.562   1.00 28.94 ? 271  VAL A CG1   1 
ATOM   1939  C CG2   . VAL A  1 240 ? 38.806  51.963  3.487   1.00 28.38 ? 271  VAL A CG2   1 
ATOM   1940  N N     . GLU A  1 241 ? 37.104  50.507  -0.357  1.00 37.19 ? 272  GLU A N     1 
ATOM   1941  C CA    . GLU A  1 241 ? 36.131  49.982  -1.307  1.00 42.00 ? 272  GLU A CA    1 
ATOM   1942  C C     . GLU A  1 241 ? 34.869  49.474  -0.614  1.00 44.14 ? 272  GLU A C     1 
ATOM   1943  O O     . GLU A  1 241 ? 34.914  48.503  0.140   1.00 43.14 ? 272  GLU A O     1 
ATOM   1944  C CB    . GLU A  1 241 ? 36.762  48.843  -2.109  1.00 52.79 ? 272  GLU A CB    1 
ATOM   1945  C CG    . GLU A  1 241 ? 37.739  49.298  -3.182  1.00 61.68 ? 272  GLU A CG    1 
ATOM   1946  C CD    . GLU A  1 241 ? 37.065  50.112  -4.274  1.00 69.61 ? 272  GLU A CD    1 
ATOM   1947  O OE1   . GLU A  1 241 ? 36.708  51.285  -4.016  1.00 71.48 ? 272  GLU A OE1   1 
ATOM   1948  O OE2   . GLU A  1 241 ? 36.890  49.579  -5.390  1.00 72.04 ? 272  GLU A OE2   1 
ATOM   1949  N N     . MET A  1 242 ? 33.741  50.125  -0.877  1.00 40.62 ? 273  MET A N     1 
ATOM   1950  C CA    . MET A  1 242 ? 32.464  49.721  -0.277  1.00 40.36 ? 273  MET A CA    1 
ATOM   1951  C C     . MET A  1 242 ? 31.373  49.596  -1.337  1.00 39.28 ? 273  MET A C     1 
ATOM   1952  O O     . MET A  1 242 ? 31.236  50.476  -2.196  1.00 39.86 ? 273  MET A O     1 
ATOM   1953  C CB    . MET A  1 242 ? 32.032  50.741  0.783   1.00 37.50 ? 273  MET A CB    1 
ATOM   1954  C CG    . MET A  1 242 ? 32.709  50.555  2.131   1.00 35.90 ? 273  MET A CG    1 
ATOM   1955  S SD    . MET A  1 242 ? 32.640  48.840  2.709   1.00 37.57 ? 273  MET A SD    1 
ATOM   1956  C CE    . MET A  1 242 ? 31.900  49.045  4.280   1.00 29.94 ? 273  MET A CE    1 
ATOM   1957  N N     . ILE A  1 243 ? 30.607  48.506  -1.283  1.00 40.11 ? 274  ILE A N     1 
ATOM   1958  C CA    . ILE A  1 243 ? 29.517  48.278  -2.249  1.00 37.63 ? 274  ILE A CA    1 
ATOM   1959  C C     . ILE A  1 243 ? 28.244  49.020  -1.830  1.00 36.36 ? 274  ILE A C     1 
ATOM   1960  O O     . ILE A  1 243 ? 27.557  48.614  -0.898  1.00 34.79 ? 274  ILE A O     1 
ATOM   1961  C CB    . ILE A  1 243 ? 29.191  46.784  -2.387  1.00 36.56 ? 274  ILE A CB    1 
ATOM   1962  C CG1   . ILE A  1 243 ? 30.388  45.951  -1.933  1.00 37.02 ? 274  ILE A CG1   1 
ATOM   1963  C CG2   . ILE A  1 243 ? 28.870  46.459  -3.823  1.00 35.93 ? 274  ILE A CG2   1 
ATOM   1964  C CD1   . ILE A  1 243 ? 30.106  44.466  -1.867  1.00 37.50 ? 274  ILE A CD1   1 
ATOM   1965  N N     . TYR A  1 244 ? 27.942  50.106  -2.535  1.00 35.69 ? 275  TYR A N     1 
ATOM   1966  C CA    . TYR A  1 244 ? 26.784  50.933  -2.225  1.00 36.30 ? 275  TYR A CA    1 
ATOM   1967  C C     . TYR A  1 244 ? 25.988  51.354  -3.464  1.00 41.68 ? 275  TYR A C     1 
ATOM   1968  O O     . TYR A  1 244 ? 26.523  51.426  -4.576  1.00 39.99 ? 275  TYR A O     1 
ATOM   1969  C CB    . TYR A  1 244 ? 27.238  52.200  -1.494  1.00 36.35 ? 275  TYR A CB    1 
ATOM   1970  C CG    . TYR A  1 244 ? 27.528  52.023  -0.022  1.00 37.75 ? 275  TYR A CG    1 
ATOM   1971  C CD1   . TYR A  1 244 ? 26.957  50.978  0.701   1.00 41.82 ? 275  TYR A CD1   1 
ATOM   1972  C CD2   . TYR A  1 244 ? 28.359  52.914  0.658   1.00 36.84 ? 275  TYR A CD2   1 
ATOM   1973  C CE1   . TYR A  1 244 ? 27.198  50.830  2.066   1.00 38.80 ? 275  TYR A CE1   1 
ATOM   1974  C CE2   . TYR A  1 244 ? 28.604  52.770  2.019   1.00 34.52 ? 275  TYR A CE2   1 
ATOM   1975  C CZ    . TYR A  1 244 ? 28.020  51.730  2.715   1.00 36.56 ? 275  TYR A CZ    1 
ATOM   1976  O OH    . TYR A  1 244 ? 28.235  51.601  4.064   1.00 39.31 ? 275  TYR A OH    1 
ATOM   1977  N N     . PRO A  1 245 ? 24.684  51.628  -3.284  1.00 43.57 ? 276  PRO A N     1 
ATOM   1978  C CA    . PRO A  1 245 ? 23.796  52.054  -4.368  1.00 39.96 ? 276  PRO A CA    1 
ATOM   1979  C C     . PRO A  1 245 ? 23.879  53.573  -4.550  1.00 43.00 ? 276  PRO A C     1 
ATOM   1980  O O     . PRO A  1 245 ? 23.870  54.324  -3.573  1.00 41.00 ? 276  PRO A O     1 
ATOM   1981  C CB    . PRO A  1 245 ? 22.414  51.590  -3.909  1.00 43.10 ? 276  PRO A CB    1 
ATOM   1982  C CG    . PRO A  1 245 ? 22.506  51.511  -2.416  1.00 43.23 ? 276  PRO A CG    1 
ATOM   1983  C CD    . PRO A  1 245 ? 23.963  51.502  -2.006  1.00 44.26 ? 276  PRO A CD    1 
ATOM   1984  N N     . PRO A  1 246 ? 23.949  54.034  -5.812  1.00 45.18 ? 277  PRO A N     1 
ATOM   1985  C CA    . PRO A  1 246 ? 24.048  55.427  -6.260  1.00 43.27 ? 277  PRO A CA    1 
ATOM   1986  C C     . PRO A  1 246 ? 23.519  56.556  -5.366  1.00 45.42 ? 277  PRO A C     1 
ATOM   1987  O O     . PRO A  1 246 ? 24.205  57.553  -5.166  1.00 48.16 ? 277  PRO A O     1 
ATOM   1988  C CB    . PRO A  1 246 ? 23.360  55.403  -7.617  1.00 43.54 ? 277  PRO A CB    1 
ATOM   1989  C CG    . PRO A  1 246 ? 23.650  54.036  -8.144  1.00 44.80 ? 277  PRO A CG    1 
ATOM   1990  C CD    . PRO A  1 246 ? 23.892  53.115  -6.965  1.00 43.82 ? 277  PRO A CD    1 
ATOM   1991  N N     . HIS A  1 247 ? 22.314  56.415  -4.828  1.00 49.49 ? 278  HIS A N     1 
ATOM   1992  C CA    . HIS A  1 247 ? 21.742  57.472  -3.997  1.00 50.62 ? 278  HIS A CA    1 
ATOM   1993  C C     . HIS A  1 247 ? 22.443  57.765  -2.670  1.00 50.61 ? 278  HIS A C     1 
ATOM   1994  O O     . HIS A  1 247 ? 22.560  58.926  -2.276  1.00 52.71 ? 278  HIS A O     1 
ATOM   1995  C CB    . HIS A  1 247 ? 20.266  57.186  -3.721  1.00 55.52 ? 278  HIS A CB    1 
ATOM   1996  C CG    . HIS A  1 247 ? 19.950  55.734  -3.550  1.00 61.47 ? 278  HIS A CG    1 
ATOM   1997  N ND1   . HIS A  1 247 ? 19.981  54.836  -4.598  1.00 62.53 ? 278  HIS A ND1   1 
ATOM   1998  C CD2   . HIS A  1 247 ? 19.589  55.022  -2.456  1.00 60.55 ? 278  HIS A CD2   1 
ATOM   1999  C CE1   . HIS A  1 247 ? 19.654  53.634  -4.156  1.00 62.67 ? 278  HIS A CE1   1 
ATOM   2000  N NE2   . HIS A  1 247 ? 19.411  53.720  -2.861  1.00 63.20 ? 278  HIS A NE2   1 
ATOM   2001  N N     . ILE A  1 248 ? 22.904  56.727  -1.981  1.00 49.82 ? 279  ILE A N     1 
ATOM   2002  C CA    . ILE A  1 248 ? 23.564  56.902  -0.688  1.00 46.64 ? 279  ILE A CA    1 
ATOM   2003  C C     . ILE A  1 248 ? 24.463  58.122  -0.588  1.00 49.51 ? 279  ILE A C     1 
ATOM   2004  O O     . ILE A  1 248 ? 25.336  58.339  -1.429  1.00 49.51 ? 279  ILE A O     1 
ATOM   2005  C CB    . ILE A  1 248 ? 24.417  55.687  -0.313  1.00 44.51 ? 279  ILE A CB    1 
ATOM   2006  C CG1   . ILE A  1 248 ? 23.676  54.396  -0.663  1.00 44.42 ? 279  ILE A CG1   1 
ATOM   2007  C CG2   . ILE A  1 248 ? 24.775  55.757  1.161   1.00 44.32 ? 279  ILE A CG2   1 
ATOM   2008  C CD1   . ILE A  1 248 ? 22.421  54.147  0.138   1.00 43.27 ? 279  ILE A CD1   1 
ATOM   2009  N N     . PRO A  1 249 ? 24.262  58.936  0.455   1.00 53.50 ? 280  PRO A N     1 
ATOM   2010  C CA    . PRO A  1 249 ? 25.087  60.134  0.633   1.00 53.71 ? 280  PRO A CA    1 
ATOM   2011  C C     . PRO A  1 249 ? 26.439  59.760  1.242   1.00 55.09 ? 280  PRO A C     1 
ATOM   2012  O O     . PRO A  1 249 ? 26.528  58.846  2.066   1.00 51.64 ? 280  PRO A O     1 
ATOM   2013  C CB    . PRO A  1 249 ? 24.251  61.006  1.563   1.00 53.58 ? 280  PRO A CB    1 
ATOM   2014  C CG    . PRO A  1 249 ? 23.474  60.025  2.383   1.00 54.07 ? 280  PRO A CG    1 
ATOM   2015  C CD    . PRO A  1 249 ? 23.258  58.792  1.527   1.00 53.64 ? 280  PRO A CD    1 
ATOM   2016  N N     . GLU A  1 250 ? 27.486  60.462  0.826   1.00 56.55 ? 281  GLU A N     1 
ATOM   2017  C CA    . GLU A  1 250 ? 28.823  60.192  1.334   1.00 57.34 ? 281  GLU A CA    1 
ATOM   2018  C C     . GLU A  1 250 ? 28.838  60.139  2.856   1.00 56.42 ? 281  GLU A C     1 
ATOM   2019  O O     . GLU A  1 250 ? 29.475  59.268  3.448   1.00 59.00 ? 281  GLU A O     1 
ATOM   2020  C CB    . GLU A  1 250 ? 29.795  61.262  0.849   1.00 58.65 ? 281  GLU A CB    1 
ATOM   2021  C CG    . GLU A  1 250 ? 30.292  61.040  -0.565  1.00 61.22 ? 281  GLU A CG    1 
ATOM   2022  C CD    . GLU A  1 250 ? 30.815  62.313  -1.190  1.00 64.70 ? 281  GLU A CD    1 
ATOM   2023  O OE1   . GLU A  1 250 ? 30.943  63.325  -0.458  1.00 63.86 ? 281  GLU A OE1   1 
ATOM   2024  O OE2   . GLU A  1 250 ? 31.096  62.299  -2.409  1.00 63.06 ? 281  GLU A OE2   1 
ATOM   2025  N N     . ASN A  1 251 ? 28.130  61.069  3.487   1.00 53.59 ? 282  ASN A N     1 
ATOM   2026  C CA    . ASN A  1 251 ? 28.069  61.124  4.943   1.00 51.34 ? 282  ASN A CA    1 
ATOM   2027  C C     . ASN A  1 251 ? 27.505  59.833  5.514   1.00 50.07 ? 282  ASN A C     1 
ATOM   2028  O O     . ASN A  1 251 ? 27.539  59.602  6.728   1.00 51.93 ? 282  ASN A O     1 
ATOM   2029  C CB    . ASN A  1 251 ? 27.188  62.286  5.393   1.00 48.78 ? 282  ASN A CB    1 
ATOM   2030  C CG    . ASN A  1 251 ? 25.740  62.099  4.996   1.00 48.95 ? 282  ASN A CG    1 
ATOM   2031  O OD1   . ASN A  1 251 ? 25.364  62.359  3.859   1.00 45.29 ? 282  ASN A OD1   1 
ATOM   2032  N ND2   . ASN A  1 251 ? 24.919  61.644  5.935   1.00 46.83 ? 282  ASN A ND2   1 
ATOM   2033  N N     . LEU A  1 252 ? 26.980  58.992  4.635   1.00 45.67 ? 283  LEU A N     1 
ATOM   2034  C CA    . LEU A  1 252 ? 26.398  57.735  5.068   1.00 43.41 ? 283  LEU A CA    1 
ATOM   2035  C C     . LEU A  1 252 ? 27.173  56.536  4.557   1.00 39.53 ? 283  LEU A C     1 
ATOM   2036  O O     . LEU A  1 252 ? 27.049  55.436  5.093   1.00 41.39 ? 283  LEU A O     1 
ATOM   2037  C CB    . LEU A  1 252 ? 24.942  57.647  4.613   1.00 46.00 ? 283  LEU A CB    1 
ATOM   2038  C CG    . LEU A  1 252 ? 23.959  58.526  5.395   1.00 50.21 ? 283  LEU A CG    1 
ATOM   2039  C CD1   . LEU A  1 252 ? 22.549  58.205  4.970   1.00 49.94 ? 283  LEU A CD1   1 
ATOM   2040  C CD2   . LEU A  1 252 ? 24.124  58.299  6.894   1.00 52.37 ? 283  LEU A CD2   1 
ATOM   2041  N N     . GLN A  1 253 ? 27.971  56.751  3.519   1.00 38.32 ? 284  GLN A N     1 
ATOM   2042  C CA    . GLN A  1 253 ? 28.774  55.676  2.948   1.00 38.65 ? 284  GLN A CA    1 
ATOM   2043  C C     . GLN A  1 253 ? 29.819  55.172  3.937   1.00 39.03 ? 284  GLN A C     1 
ATOM   2044  O O     . GLN A  1 253 ? 30.916  55.729  4.038   1.00 37.59 ? 284  GLN A O     1 
ATOM   2045  C CB    . GLN A  1 253 ? 29.480  56.163  1.702   1.00 36.25 ? 284  GLN A CB    1 
ATOM   2046  C CG    . GLN A  1 253 ? 28.574  56.813  0.706   1.00 34.98 ? 284  GLN A CG    1 
ATOM   2047  C CD    . GLN A  1 253 ? 29.182  56.768  -0.658  1.00 33.65 ? 284  GLN A CD    1 
ATOM   2048  O OE1   . GLN A  1 253 ? 29.587  55.706  -1.130  1.00 33.16 ? 284  GLN A OE1   1 
ATOM   2049  N NE2   . GLN A  1 253 ? 29.274  57.920  -1.300  1.00 32.86 ? 284  GLN A NE2   1 
ATOM   2050  N N     . PHE A  1 254 ? 29.488  54.101  4.648   1.00 36.92 ? 285  PHE A N     1 
ATOM   2051  C CA    . PHE A  1 254 ? 30.395  53.555  5.642   1.00 33.68 ? 285  PHE A CA    1 
ATOM   2052  C C     . PHE A  1 254 ? 31.478  52.661  5.074   1.00 32.59 ? 285  PHE A C     1 
ATOM   2053  O O     . PHE A  1 254 ? 31.270  51.930  4.097   1.00 32.51 ? 285  PHE A O     1 
ATOM   2054  C CB    . PHE A  1 254 ? 29.591  52.825  6.715   1.00 33.78 ? 285  PHE A CB    1 
ATOM   2055  C CG    . PHE A  1 254 ? 28.951  53.757  7.699   1.00 35.92 ? 285  PHE A CG    1 
ATOM   2056  C CD1   . PHE A  1 254 ? 28.469  53.290  8.910   1.00 36.12 ? 285  PHE A CD1   1 
ATOM   2057  C CD2   . PHE A  1 254 ? 28.860  55.126  7.419   1.00 35.41 ? 285  PHE A CD2   1 
ATOM   2058  C CE1   . PHE A  1 254 ? 27.908  54.169  9.832   1.00 36.38 ? 285  PHE A CE1   1 
ATOM   2059  C CE2   . PHE A  1 254 ? 28.304  56.011  8.327   1.00 33.22 ? 285  PHE A CE2   1 
ATOM   2060  C CZ    . PHE A  1 254 ? 27.826  55.536  9.538   1.00 34.22 ? 285  PHE A CZ    1 
ATOM   2061  N N     . ALA A  1 255 ? 32.651  52.742  5.690   1.00 28.45 ? 286  ALA A N     1 
ATOM   2062  C CA    . ALA A  1 255 ? 33.784  51.949  5.259   1.00 22.89 ? 286  ALA A CA    1 
ATOM   2063  C C     . ALA A  1 255 ? 34.128  50.972  6.366   1.00 17.34 ? 286  ALA A C     1 
ATOM   2064  O O     . ALA A  1 255 ? 34.353  51.370  7.502   1.00 21.23 ? 286  ALA A O     1 
ATOM   2065  C CB    . ALA A  1 255 ? 34.958  52.865  4.965   1.00 22.49 ? 286  ALA A CB    1 
ATOM   2066  N N     . VAL A  1 256 ? 34.158  49.691  6.042   1.00 14.01 ? 287  VAL A N     1 
ATOM   2067  C CA    . VAL A  1 256 ? 34.469  48.674  7.036   1.00 11.98 ? 287  VAL A CA    1 
ATOM   2068  C C     . VAL A  1 256 ? 35.139  47.478  6.384   1.00 13.31 ? 287  VAL A C     1 
ATOM   2069  O O     . VAL A  1 256 ? 35.134  47.342  5.161   1.00 10.73 ? 287  VAL A O     1 
ATOM   2070  C CB    . VAL A  1 256 ? 33.208  48.168  7.754   1.00 12.52 ? 287  VAL A CB    1 
ATOM   2071  C CG1   . VAL A  1 256 ? 32.265  49.327  8.046   1.00 12.05 ? 287  VAL A CG1   1 
ATOM   2072  C CG2   . VAL A  1 256 ? 32.516  47.110  6.905   1.00 6.49  ? 287  VAL A CG2   1 
ATOM   2073  N N     . GLY A  1 257 ? 35.698  46.605  7.215   1.00 14.69 ? 288  GLY A N     1 
ATOM   2074  C CA    . GLY A  1 257 ? 36.388  45.435  6.707   1.00 15.55 ? 288  GLY A CA    1 
ATOM   2075  C C     . GLY A  1 257 ? 35.700  44.831  5.501   1.00 16.25 ? 288  GLY A C     1 
ATOM   2076  O O     . GLY A  1 257 ? 36.338  44.559  4.478   1.00 13.62 ? 288  GLY A O     1 
ATOM   2077  N N     . GLN A  1 258 ? 34.387  44.639  5.602   1.00 20.07 ? 289  GLN A N     1 
ATOM   2078  C CA    . GLN A  1 258 ? 33.632  44.046  4.501   1.00 21.35 ? 289  GLN A CA    1 
ATOM   2079  C C     . GLN A  1 258 ? 32.932  45.062  3.599   1.00 23.77 ? 289  GLN A C     1 
ATOM   2080  O O     . GLN A  1 258 ? 32.156  45.897  4.050   1.00 23.86 ? 289  GLN A O     1 
ATOM   2081  C CB    . GLN A  1 258 ? 32.640  43.039  5.056   1.00 17.30 ? 289  GLN A CB    1 
ATOM   2082  C CG    . GLN A  1 258 ? 32.953  41.634  4.607   1.00 10.96 ? 289  GLN A CG    1 
ATOM   2083  C CD    . GLN A  1 258 ? 32.573  41.415  3.157   1.00 13.04 ? 289  GLN A CD    1 
ATOM   2084  O OE1   . GLN A  1 258 ? 32.505  42.374  2.355   1.00 7.01  ? 289  GLN A OE1   1 
ATOM   2085  N NE2   . GLN A  1 258 ? 32.315  40.149  2.804   1.00 2.00  ? 289  GLN A NE2   1 
ATOM   2086  N N     . GLU A  1 259 ? 33.210  44.978  2.310   1.00 28.42 ? 290  GLU A N     1 
ATOM   2087  C CA    . GLU A  1 259 ? 32.648  45.923  1.362   1.00 33.43 ? 290  GLU A CA    1 
ATOM   2088  C C     . GLU A  1 259 ? 31.138  45.860  1.174   1.00 31.21 ? 290  GLU A C     1 
ATOM   2089  O O     . GLU A  1 259 ? 30.508  46.857  0.816   1.00 29.83 ? 290  GLU A O     1 
ATOM   2090  C CB    . GLU A  1 259 ? 33.327  45.744  0.011   1.00 42.65 ? 290  GLU A CB    1 
ATOM   2091  C CG    . GLU A  1 259 ? 33.510  44.293  -0.387  1.00 50.71 ? 290  GLU A CG    1 
ATOM   2092  C CD    . GLU A  1 259 ? 34.360  44.158  -1.630  1.00 60.92 ? 290  GLU A CD    1 
ATOM   2093  O OE1   . GLU A  1 259 ? 33.913  43.486  -2.589  1.00 62.71 ? 290  GLU A OE1   1 
ATOM   2094  O OE2   . GLU A  1 259 ? 35.474  44.733  -1.647  1.00 61.70 ? 290  GLU A OE2   1 
ATOM   2095  N N     . VAL A  1 260 ? 30.558  44.693  1.416   1.00 27.26 ? 291  VAL A N     1 
ATOM   2096  C CA    . VAL A  1 260 ? 29.127  44.524  1.229   1.00 27.01 ? 291  VAL A CA    1 
ATOM   2097  C C     . VAL A  1 260 ? 28.281  45.003  2.422   1.00 26.34 ? 291  VAL A C     1 
ATOM   2098  O O     . VAL A  1 260 ? 27.191  45.540  2.242   1.00 28.12 ? 291  VAL A O     1 
ATOM   2099  C CB    . VAL A  1 260 ? 28.819  43.027  0.901   1.00 24.89 ? 291  VAL A CB    1 
ATOM   2100  C CG1   . VAL A  1 260 ? 28.737  42.212  2.183   1.00 26.61 ? 291  VAL A CG1   1 
ATOM   2101  C CG2   . VAL A  1 260 ? 27.532  42.915  0.096   1.00 25.55 ? 291  VAL A CG2   1 
ATOM   2102  N N     . PHE A  1 261 ? 28.813  44.822  3.627   1.00 26.63 ? 292  PHE A N     1 
ATOM   2103  C CA    . PHE A  1 261 ? 28.158  45.175  4.893   1.00 26.10 ? 292  PHE A CA    1 
ATOM   2104  C C     . PHE A  1 261 ? 27.389  46.486  5.048   1.00 28.13 ? 292  PHE A C     1 
ATOM   2105  O O     . PHE A  1 261 ? 26.735  46.703  6.079   1.00 29.01 ? 292  PHE A O     1 
ATOM   2106  C CB    . PHE A  1 261 ? 29.180  45.091  6.024   1.00 25.32 ? 292  PHE A CB    1 
ATOM   2107  C CG    . PHE A  1 261 ? 29.489  43.688  6.453   1.00 19.08 ? 292  PHE A CG    1 
ATOM   2108  C CD1   . PHE A  1 261 ? 29.172  42.602  5.621   1.00 17.75 ? 292  PHE A CD1   1 
ATOM   2109  C CD2   . PHE A  1 261 ? 30.069  43.444  7.699   1.00 16.12 ? 292  PHE A CD2   1 
ATOM   2110  C CE1   . PHE A  1 261 ? 29.423  41.289  6.028   1.00 17.02 ? 292  PHE A CE1   1 
ATOM   2111  C CE2   . PHE A  1 261 ? 30.328  42.134  8.127   1.00 16.75 ? 292  PHE A CE2   1 
ATOM   2112  C CZ    . PHE A  1 261 ? 30.005  41.049  7.292   1.00 16.95 ? 292  PHE A CZ    1 
ATOM   2113  N N     . GLY A  1 262 ? 27.481  47.368  4.062   1.00 25.88 ? 293  GLY A N     1 
ATOM   2114  C CA    . GLY A  1 262 ? 26.744  48.615  4.147   1.00 25.47 ? 293  GLY A CA    1 
ATOM   2115  C C     . GLY A  1 262 ? 25.259  48.460  3.802   1.00 27.22 ? 293  GLY A C     1 
ATOM   2116  O O     . GLY A  1 262 ? 24.411  49.236  4.257   1.00 27.21 ? 293  GLY A O     1 
ATOM   2117  N N     . LEU A  1 263 ? 24.942  47.445  3.001   1.00 28.59 ? 294  LEU A N     1 
ATOM   2118  C CA    . LEU A  1 263 ? 23.572  47.183  2.566   1.00 28.20 ? 294  LEU A CA    1 
ATOM   2119  C C     . LEU A  1 263 ? 22.655  46.573  3.625   1.00 26.53 ? 294  LEU A C     1 
ATOM   2120  O O     . LEU A  1 263 ? 21.505  46.223  3.337   1.00 27.61 ? 294  LEU A O     1 
ATOM   2121  C CB    . LEU A  1 263 ? 23.593  46.263  1.345   1.00 27.72 ? 294  LEU A CB    1 
ATOM   2122  C CG    . LEU A  1 263 ? 24.570  46.655  0.242   1.00 33.56 ? 294  LEU A CG    1 
ATOM   2123  C CD1   . LEU A  1 263 ? 24.670  45.506  -0.753  1.00 34.38 ? 294  LEU A CD1   1 
ATOM   2124  C CD2   . LEU A  1 263 ? 24.109  47.956  -0.447  1.00 32.19 ? 294  LEU A CD2   1 
ATOM   2125  N N     . VAL A  1 264 ? 23.147  46.450  4.847   1.00 22.38 ? 295  VAL A N     1 
ATOM   2126  C CA    . VAL A  1 264 ? 22.334  45.854  5.885   1.00 20.54 ? 295  VAL A CA    1 
ATOM   2127  C C     . VAL A  1 264 ? 22.556  46.484  7.232   1.00 21.94 ? 295  VAL A C     1 
ATOM   2128  O O     . VAL A  1 264 ? 23.481  46.100  7.954   1.00 22.78 ? 295  VAL A O     1 
ATOM   2129  C CB    . VAL A  1 264 ? 22.635  44.368  6.037   1.00 21.38 ? 295  VAL A CB    1 
ATOM   2130  C CG1   . VAL A  1 264 ? 21.760  43.779  7.149   1.00 22.46 ? 295  VAL A CG1   1 
ATOM   2131  C CG2   . VAL A  1 264 ? 22.422  43.663  4.717   1.00 20.11 ? 295  VAL A CG2   1 
ATOM   2132  N N     . PRO A  1 265 ? 21.711  47.459  7.596   1.00 20.87 ? 296  PRO A N     1 
ATOM   2133  C CA    . PRO A  1 265 ? 21.853  48.126  8.897   1.00 18.23 ? 296  PRO A CA    1 
ATOM   2134  C C     . PRO A  1 265 ? 22.056  47.107  10.026  1.00 16.96 ? 296  PRO A C     1 
ATOM   2135  O O     . PRO A  1 265 ? 22.563  47.437  11.097  1.00 17.40 ? 296  PRO A O     1 
ATOM   2136  C CB    . PRO A  1 265 ? 20.550  48.903  9.046   1.00 19.33 ? 296  PRO A CB    1 
ATOM   2137  C CG    . PRO A  1 265 ? 20.119  49.170  7.619   1.00 17.38 ? 296  PRO A CG    1 
ATOM   2138  C CD    . PRO A  1 265 ? 20.587  47.994  6.805   1.00 17.12 ? 296  PRO A CD    1 
ATOM   2139  N N     . GLY A  1 266 ? 21.657  45.865  9.778   1.00 16.10 ? 297  GLY A N     1 
ATOM   2140  C CA    . GLY A  1 266 ? 21.842  44.844  10.790  1.00 16.99 ? 297  GLY A CA    1 
ATOM   2141  C C     . GLY A  1 266 ? 23.325  44.570  10.894  1.00 15.09 ? 297  GLY A C     1 
ATOM   2142  O O     . GLY A  1 266 ? 23.897  44.580  11.987  1.00 12.65 ? 297  GLY A O     1 
ATOM   2143  N N     . LEU A  1 267 ? 23.935  44.331  9.731   1.00 14.53 ? 298  LEU A N     1 
ATOM   2144  C CA    . LEU A  1 267 ? 25.360  44.073  9.611   1.00 11.80 ? 298  LEU A CA    1 
ATOM   2145  C C     . LEU A  1 267 ? 26.111  45.265  10.171  1.00 14.30 ? 298  LEU A C     1 
ATOM   2146  O O     . LEU A  1 267 ? 26.780  45.170  11.202  1.00 16.23 ? 298  LEU A O     1 
ATOM   2147  C CB    . LEU A  1 267 ? 25.719  43.887  8.141   1.00 8.07  ? 298  LEU A CB    1 
ATOM   2148  C CG    . LEU A  1 267 ? 25.803  42.429  7.677   1.00 11.00 ? 298  LEU A CG    1 
ATOM   2149  C CD1   . LEU A  1 267 ? 25.140  41.524  8.720   1.00 13.08 ? 298  LEU A CD1   1 
ATOM   2150  C CD2   . LEU A  1 267 ? 25.138  42.269  6.311   1.00 8.91  ? 298  LEU A CD2   1 
ATOM   2151  N N     . MET A  1 268 ? 25.985  46.393  9.483   1.00 12.37 ? 299  MET A N     1 
ATOM   2152  C CA    . MET A  1 268 ? 26.637  47.620  9.909   1.00 14.71 ? 299  MET A CA    1 
ATOM   2153  C C     . MET A  1 268 ? 26.676  47.793  11.426  1.00 14.22 ? 299  MET A C     1 
ATOM   2154  O O     . MET A  1 268 ? 27.701  48.185  11.996  1.00 13.33 ? 299  MET A O     1 
ATOM   2155  C CB    . MET A  1 268 ? 25.920  48.814  9.318   1.00 13.62 ? 299  MET A CB    1 
ATOM   2156  C CG    . MET A  1 268 ? 26.679  50.095  9.560   1.00 12.20 ? 299  MET A CG    1 
ATOM   2157  S SD    . MET A  1 268 ? 28.240  49.983  8.703   1.00 23.33 ? 299  MET A SD    1 
ATOM   2158  C CE    . MET A  1 268 ? 27.728  49.180  7.084   1.00 7.93  ? 299  MET A CE    1 
ATOM   2159  N N     . MET A  1 269 ? 25.539  47.523  12.062  1.00 14.09 ? 300  MET A N     1 
ATOM   2160  C CA    . MET A  1 269 ? 25.409  47.638  13.514  1.00 15.14 ? 300  MET A CA    1 
ATOM   2161  C C     . MET A  1 269 ? 26.505  46.811  14.186  1.00 11.56 ? 300  MET A C     1 
ATOM   2162  O O     . MET A  1 269 ? 27.287  47.326  14.980  1.00 10.88 ? 300  MET A O     1 
ATOM   2163  C CB    . MET A  1 269 ? 24.006  47.153  13.952  1.00 17.85 ? 300  MET A CB    1 
ATOM   2164  C CG    . MET A  1 269 ? 23.825  46.805  15.448  1.00 17.53 ? 300  MET A CG    1 
ATOM   2165  S SD    . MET A  1 269 ? 22.990  45.169  15.698  1.00 24.75 ? 300  MET A SD    1 
ATOM   2166  C CE    . MET A  1 269 ? 22.406  45.291  17.428  1.00 25.09 ? 300  MET A CE    1 
ATOM   2167  N N     . TYR A  1 270 ? 26.557  45.529  13.851  1.00 9.82  ? 301  TYR A N     1 
ATOM   2168  C CA    . TYR A  1 270 ? 27.549  44.648  14.418  1.00 10.90 ? 301  TYR A CA    1 
ATOM   2169  C C     . TYR A  1 270 ? 28.948  45.189  14.166  1.00 11.61 ? 301  TYR A C     1 
ATOM   2170  O O     . TYR A  1 270 ? 29.773  45.260  15.083  1.00 12.81 ? 301  TYR A O     1 
ATOM   2171  C CB    . TYR A  1 270 ? 27.404  43.268  13.811  1.00 10.83 ? 301  TYR A CB    1 
ATOM   2172  C CG    . TYR A  1 270 ? 26.631  42.331  14.689  1.00 16.80 ? 301  TYR A CG    1 
ATOM   2173  C CD1   . TYR A  1 270 ? 26.911  42.228  16.053  1.00 15.44 ? 301  TYR A CD1   1 
ATOM   2174  C CD2   . TYR A  1 270 ? 25.630  41.523  14.155  1.00 21.32 ? 301  TYR A CD2   1 
ATOM   2175  C CE1   . TYR A  1 270 ? 26.213  41.334  16.863  1.00 19.34 ? 301  TYR A CE1   1 
ATOM   2176  C CE2   . TYR A  1 270 ? 24.923  40.623  14.955  1.00 21.38 ? 301  TYR A CE2   1 
ATOM   2177  C CZ    . TYR A  1 270 ? 25.216  40.525  16.306  1.00 22.26 ? 301  TYR A CZ    1 
ATOM   2178  O OH    . TYR A  1 270 ? 24.532  39.593  17.075  1.00 17.35 ? 301  TYR A OH    1 
ATOM   2179  N N     . ALA A  1 271 ? 29.216  45.569  12.921  1.00 8.32  ? 302  ALA A N     1 
ATOM   2180  C CA    . ALA A  1 271 ? 30.519  46.122  12.581  1.00 7.43  ? 302  ALA A CA    1 
ATOM   2181  C C     . ALA A  1 271 ? 30.811  47.135  13.683  1.00 8.83  ? 302  ALA A C     1 
ATOM   2182  O O     . ALA A  1 271 ? 31.567  46.870  14.626  1.00 5.66  ? 302  ALA A O     1 
ATOM   2183  C CB    . ALA A  1 271 ? 30.463  46.817  11.221  1.00 2.00  ? 302  ALA A CB    1 
ATOM   2184  N N     . THR A  1 272 ? 30.171  48.287  13.557  1.00 5.70  ? 303  THR A N     1 
ATOM   2185  C CA    . THR A  1 272 ? 30.302  49.348  14.522  1.00 2.00  ? 303  THR A CA    1 
ATOM   2186  C C     . THR A  1 272 ? 30.608  48.813  15.896  1.00 3.49  ? 303  THR A C     1 
ATOM   2187  O O     . THR A  1 272 ? 31.456  49.350  16.590  1.00 5.49  ? 303  THR A O     1 
ATOM   2188  C CB    . THR A  1 272 ? 29.023  50.134  14.602  1.00 7.72  ? 303  THR A CB    1 
ATOM   2189  O OG1   . THR A  1 272 ? 28.492  50.283  13.279  1.00 3.76  ? 303  THR A OG1   1 
ATOM   2190  C CG2   . THR A  1 272 ? 29.281  51.495  15.262  1.00 6.50  ? 303  THR A CG2   1 
ATOM   2191  N N     . ILE A  1 273 ? 29.912  47.759  16.305  1.00 3.26  ? 304  ILE A N     1 
ATOM   2192  C CA    . ILE A  1 273 ? 30.165  47.189  17.623  1.00 8.48  ? 304  ILE A CA    1 
ATOM   2193  C C     . ILE A  1 273 ? 31.612  46.738  17.669  1.00 7.36  ? 304  ILE A C     1 
ATOM   2194  O O     . ILE A  1 273 ? 32.440  47.355  18.343  1.00 6.84  ? 304  ILE A O     1 
ATOM   2195  C CB    . ILE A  1 273 ? 29.291  45.965  17.904  1.00 12.23 ? 304  ILE A CB    1 
ATOM   2196  C CG1   . ILE A  1 273 ? 27.807  46.348  17.794  1.00 17.11 ? 304  ILE A CG1   1 
ATOM   2197  C CG2   . ILE A  1 273 ? 29.633  45.396  19.285  1.00 14.88 ? 304  ILE A CG2   1 
ATOM   2198  C CD1   . ILE A  1 273 ? 26.880  45.162  17.541  1.00 15.09 ? 304  ILE A CD1   1 
ATOM   2199  N N     . TRP A  1 274 ? 31.901  45.666  16.935  1.00 7.86  ? 305  TRP A N     1 
ATOM   2200  C CA    . TRP A  1 274 ? 33.245  45.102  16.856  1.00 7.60  ? 305  TRP A CA    1 
ATOM   2201  C C     . TRP A  1 274 ? 34.300  46.182  16.686  1.00 9.06  ? 305  TRP A C     1 
ATOM   2202  O O     . TRP A  1 274 ? 35.291  46.212  17.420  1.00 8.33  ? 305  TRP A O     1 
ATOM   2203  C CB    . TRP A  1 274 ? 33.326  44.143  15.688  1.00 7.25  ? 305  TRP A CB    1 
ATOM   2204  C CG    . TRP A  1 274 ? 32.803  42.819  16.023  1.00 10.43 ? 305  TRP A CG    1 
ATOM   2205  C CD1   . TRP A  1 274 ? 31.758  42.170  15.421  1.00 13.75 ? 305  TRP A CD1   1 
ATOM   2206  C CD2   . TRP A  1 274 ? 33.323  41.924  17.009  1.00 9.56  ? 305  TRP A CD2   1 
ATOM   2207  N NE1   . TRP A  1 274 ? 31.602  40.913  15.973  1.00 14.23 ? 305  TRP A NE1   1 
ATOM   2208  C CE2   . TRP A  1 274 ? 32.549  40.735  16.948  1.00 8.05  ? 305  TRP A CE2   1 
ATOM   2209  C CE3   . TRP A  1 274 ? 34.367  42.002  17.934  1.00 5.44  ? 305  TRP A CE3   1 
ATOM   2210  C CZ2   . TRP A  1 274 ? 32.791  39.638  17.777  1.00 2.00  ? 305  TRP A CZ2   1 
ATOM   2211  C CZ3   . TRP A  1 274 ? 34.608  40.898  18.761  1.00 6.67  ? 305  TRP A CZ3   1 
ATOM   2212  C CH2   . TRP A  1 274 ? 33.823  39.736  18.673  1.00 2.00  ? 305  TRP A CH2   1 
ATOM   2213  N N     . LEU A  1 275 ? 34.103  47.059  15.707  1.00 8.03  ? 306  LEU A N     1 
ATOM   2214  C CA    . LEU A  1 275 ? 35.052  48.138  15.489  1.00 7.36  ? 306  LEU A CA    1 
ATOM   2215  C C     . LEU A  1 275 ? 35.299  48.784  16.844  1.00 8.90  ? 306  LEU A C     1 
ATOM   2216  O O     . LEU A  1 275 ? 36.439  48.939  17.266  1.00 13.84 ? 306  LEU A O     1 
ATOM   2217  C CB    . LEU A  1 275 ? 34.482  49.166  14.517  1.00 2.00  ? 306  LEU A CB    1 
ATOM   2218  C CG    . LEU A  1 275 ? 35.243  50.497  14.507  1.00 3.84  ? 306  LEU A CG    1 
ATOM   2219  C CD1   . LEU A  1 275 ? 34.987  51.209  13.170  1.00 5.72  ? 306  LEU A CD1   1 
ATOM   2220  C CD2   . LEU A  1 275 ? 34.810  51.383  15.696  1.00 4.78  ? 306  LEU A CD2   1 
ATOM   2221  N N     . ARG A  1 276 ? 34.218  49.142  17.526  1.00 9.29  ? 307  ARG A N     1 
ATOM   2222  C CA    . ARG A  1 276 ? 34.319  49.751  18.840  1.00 12.34 ? 307  ARG A CA    1 
ATOM   2223  C C     . ARG A  1 276 ? 35.098  48.827  19.782  1.00 10.47 ? 307  ARG A C     1 
ATOM   2224  O O     . ARG A  1 276 ? 35.894  49.279  20.586  1.00 4.98  ? 307  ARG A O     1 
ATOM   2225  C CB    . ARG A  1 276 ? 32.915  50.007  19.402  1.00 17.99 ? 307  ARG A CB    1 
ATOM   2226  C CG    . ARG A  1 276 ? 32.171  51.120  18.686  1.00 27.40 ? 307  ARG A CG    1 
ATOM   2227  C CD    . ARG A  1 276 ? 30.697  51.179  19.073  1.00 35.12 ? 307  ARG A CD    1 
ATOM   2228  N NE    . ARG A  1 276 ? 30.355  52.431  19.750  1.00 42.68 ? 307  ARG A NE    1 
ATOM   2229  C CZ    . ARG A  1 276 ? 29.388  53.255  19.366  1.00 44.23 ? 307  ARG A CZ    1 
ATOM   2230  N NH1   . ARG A  1 276 ? 28.659  52.965  18.304  1.00 47.54 ? 307  ARG A NH1   1 
ATOM   2231  N NH2   . ARG A  1 276 ? 29.149  54.367  20.045  1.00 48.73 ? 307  ARG A NH2   1 
ATOM   2232  N N     . GLU A  1 277 ? 34.860  47.525  19.664  1.00 12.19 ? 308  GLU A N     1 
ATOM   2233  C CA    . GLU A  1 277 ? 35.528  46.530  20.499  1.00 12.37 ? 308  GLU A CA    1 
ATOM   2234  C C     . GLU A  1 277 ? 37.039  46.622  20.329  1.00 15.59 ? 308  GLU A C     1 
ATOM   2235  O O     . GLU A  1 277 ? 37.786  46.759  21.309  1.00 15.41 ? 308  GLU A O     1 
ATOM   2236  C CB    . GLU A  1 277 ? 35.070  45.117  20.120  1.00 13.32 ? 308  GLU A CB    1 
ATOM   2237  C CG    . GLU A  1 277 ? 35.937  43.999  20.685  1.00 12.38 ? 308  GLU A CG    1 
ATOM   2238  C CD    . GLU A  1 277 ? 36.071  44.056  22.203  1.00 15.96 ? 308  GLU A CD    1 
ATOM   2239  O OE1   . GLU A  1 277 ? 36.577  43.058  22.766  1.00 14.35 ? 308  GLU A OE1   1 
ATOM   2240  O OE2   . GLU A  1 277 ? 35.680  45.085  22.830  1.00 11.18 ? 308  GLU A OE2   1 
ATOM   2241  N N     . HIS A  1 278 ? 37.476  46.536  19.078  1.00 15.87 ? 309  HIS A N     1 
ATOM   2242  C CA    . HIS A  1 278 ? 38.888  46.621  18.746  1.00 18.12 ? 309  HIS A CA    1 
ATOM   2243  C C     . HIS A  1 278 ? 39.544  47.771  19.507  1.00 16.89 ? 309  HIS A C     1 
ATOM   2244  O O     . HIS A  1 278 ? 40.295  47.547  20.466  1.00 13.46 ? 309  HIS A O     1 
ATOM   2245  C CB    . HIS A  1 278 ? 39.044  46.852  17.243  1.00 23.22 ? 309  HIS A CB    1 
ATOM   2246  C CG    . HIS A  1 278 ? 40.463  47.022  16.804  1.00 26.84 ? 309  HIS A CG    1 
ATOM   2247  N ND1   . HIS A  1 278 ? 41.233  45.969  16.356  1.00 21.60 ? 309  HIS A ND1   1 
ATOM   2248  C CD2   . HIS A  1 278 ? 41.261  48.116  16.769  1.00 24.15 ? 309  HIS A CD2   1 
ATOM   2249  C CE1   . HIS A  1 278 ? 42.443  46.407  16.063  1.00 25.52 ? 309  HIS A CE1   1 
ATOM   2250  N NE2   . HIS A  1 278 ? 42.484  47.705  16.306  1.00 28.54 ? 309  HIS A NE2   1 
ATOM   2251  N N     . ASN A  1 279 ? 39.246  48.994  19.072  1.00 13.50 ? 310  ASN A N     1 
ATOM   2252  C CA    . ASN A  1 279 ? 39.787  50.196  19.698  1.00 17.35 ? 310  ASN A CA    1 
ATOM   2253  C C     . ASN A  1 279 ? 39.636  50.159  21.215  1.00 21.04 ? 310  ASN A C     1 
ATOM   2254  O O     . ASN A  1 279 ? 40.462  50.704  21.948  1.00 26.17 ? 310  ASN A O     1 
ATOM   2255  C CB    . ASN A  1 279 ? 39.103  51.429  19.116  1.00 13.49 ? 310  ASN A CB    1 
ATOM   2256  C CG    . ASN A  1 279 ? 39.350  51.555  17.617  1.00 18.88 ? 310  ASN A CG    1 
ATOM   2257  O OD1   . ASN A  1 279 ? 39.803  50.596  16.973  1.00 16.71 ? 310  ASN A OD1   1 
ATOM   2258  N ND2   . ASN A  1 279 ? 39.071  52.731  17.055  1.00 12.66 ? 310  ASN A ND2   1 
ATOM   2259  N N     . ARG A  1 280 ? 38.586  49.506  21.690  1.00 20.56 ? 311  ARG A N     1 
ATOM   2260  C CA    . ARG A  1 280 ? 38.381  49.396  23.121  1.00 20.33 ? 311  ARG A CA    1 
ATOM   2261  C C     . ARG A  1 280 ? 39.575  48.643  23.659  1.00 21.84 ? 311  ARG A C     1 
ATOM   2262  O O     . ARG A  1 280 ? 40.218  49.082  24.618  1.00 21.48 ? 311  ARG A O     1 
ATOM   2263  C CB    . ARG A  1 280 ? 37.106  48.606  23.436  1.00 18.19 ? 311  ARG A CB    1 
ATOM   2264  C CG    . ARG A  1 280 ? 36.839  48.430  24.937  1.00 15.77 ? 311  ARG A CG    1 
ATOM   2265  C CD    . ARG A  1 280 ? 36.044  47.164  25.218  1.00 13.04 ? 311  ARG A CD    1 
ATOM   2266  N NE    . ARG A  1 280 ? 36.507  46.487  26.422  1.00 5.49  ? 311  ARG A NE    1 
ATOM   2267  C CZ    . ARG A  1 280 ? 36.813  45.192  26.473  1.00 12.22 ? 311  ARG A CZ    1 
ATOM   2268  N NH1   . ARG A  1 280 ? 36.701  44.436  25.376  1.00 2.00  ? 311  ARG A NH1   1 
ATOM   2269  N NH2   . ARG A  1 280 ? 37.233  44.651  27.619  1.00 9.79  ? 311  ARG A NH2   1 
ATOM   2270  N N     . VAL A  1 281 ? 39.859  47.506  23.025  1.00 23.66 ? 312  VAL A N     1 
ATOM   2271  C CA    . VAL A  1 281 ? 40.984  46.660  23.408  1.00 28.83 ? 312  VAL A CA    1 
ATOM   2272  C C     . VAL A  1 281 ? 42.283  47.444  23.324  1.00 27.37 ? 312  VAL A C     1 
ATOM   2273  O O     . VAL A  1 281 ? 43.101  47.408  24.238  1.00 27.93 ? 312  VAL A O     1 
ATOM   2274  C CB    . VAL A  1 281 ? 41.071  45.405  22.500  1.00 31.62 ? 312  VAL A CB    1 
ATOM   2275  C CG1   . VAL A  1 281 ? 42.526  45.011  22.244  1.00 31.78 ? 312  VAL A CG1   1 
ATOM   2276  C CG2   . VAL A  1 281 ? 40.324  44.257  23.164  1.00 34.67 ? 312  VAL A CG2   1 
ATOM   2277  N N     . CYS A  1 282 ? 42.463  48.157  22.224  1.00 25.19 ? 313  CYS A N     1 
ATOM   2278  C CA    . CYS A  1 282 ? 43.662  48.945  22.052  1.00 27.84 ? 313  CYS A CA    1 
ATOM   2279  C C     . CYS A  1 282 ? 43.966  49.727  23.328  1.00 28.71 ? 313  CYS A C     1 
ATOM   2280  O O     . CYS A  1 282 ? 45.085  49.687  23.842  1.00 33.05 ? 313  CYS A O     1 
ATOM   2281  C CB    . CYS A  1 282 ? 43.497  49.896  20.868  1.00 26.57 ? 313  CYS A CB    1 
ATOM   2282  S SG    . CYS A  1 282 ? 43.665  49.071  19.272  1.00 35.27 ? 313  CYS A SG    1 
ATOM   2283  N N     . ASP A  1 283 ? 42.973  50.424  23.857  1.00 29.51 ? 314  ASP A N     1 
ATOM   2284  C CA    . ASP A  1 283 ? 43.196  51.200  25.062  1.00 28.57 ? 314  ASP A CA    1 
ATOM   2285  C C     . ASP A  1 283 ? 43.701  50.337  26.200  1.00 27.02 ? 314  ASP A C     1 
ATOM   2286  O O     . ASP A  1 283 ? 44.675  50.679  26.869  1.00 27.90 ? 314  ASP A O     1 
ATOM   2287  C CB    . ASP A  1 283 ? 41.912  51.904  25.469  1.00 30.02 ? 314  ASP A CB    1 
ATOM   2288  C CG    . ASP A  1 283 ? 41.514  52.966  24.477  1.00 34.35 ? 314  ASP A CG    1 
ATOM   2289  O OD1   . ASP A  1 283 ? 40.373  53.452  24.537  1.00 38.97 ? 314  ASP A OD1   1 
ATOM   2290  O OD2   . ASP A  1 283 ? 42.352  53.311  23.621  1.00 34.55 ? 314  ASP A OD2   1 
ATOM   2291  N N     . ILE A  1 284 ? 43.039  49.210  26.421  1.00 27.37 ? 315  ILE A N     1 
ATOM   2292  C CA    . ILE A  1 284 ? 43.436  48.309  27.492  1.00 27.69 ? 315  ILE A CA    1 
ATOM   2293  C C     . ILE A  1 284 ? 44.894  47.905  27.321  1.00 25.38 ? 315  ILE A C     1 
ATOM   2294  O O     . ILE A  1 284 ? 45.631  47.827  28.308  1.00 25.48 ? 315  ILE A O     1 
ATOM   2295  C CB    . ILE A  1 284 ? 42.561  47.041  27.515  1.00 29.25 ? 315  ILE A CB    1 
ATOM   2296  C CG1   . ILE A  1 284 ? 41.129  47.398  27.129  1.00 31.85 ? 315  ILE A CG1   1 
ATOM   2297  C CG2   . ILE A  1 284 ? 42.587  46.408  28.898  1.00 30.88 ? 315  ILE A CG2   1 
ATOM   2298  C CD1   . ILE A  1 284 ? 40.416  46.283  26.425  1.00 33.65 ? 315  ILE A CD1   1 
ATOM   2299  N N     . LEU A  1 285 ? 45.305  47.646  26.078  1.00 18.34 ? 316  LEU A N     1 
ATOM   2300  C CA    . LEU A  1 285 ? 46.692  47.268  25.797  1.00 18.04 ? 316  LEU A CA    1 
ATOM   2301  C C     . LEU A  1 285 ? 47.612  48.460  26.078  1.00 18.07 ? 316  LEU A C     1 
ATOM   2302  O O     . LEU A  1 285 ? 48.520  48.362  26.898  1.00 17.49 ? 316  LEU A O     1 
ATOM   2303  C CB    . LEU A  1 285 ? 46.843  46.818  24.345  1.00 10.67 ? 316  LEU A CB    1 
ATOM   2304  C CG    . LEU A  1 285 ? 46.272  45.428  24.022  1.00 11.14 ? 316  LEU A CG    1 
ATOM   2305  C CD1   . LEU A  1 285 ? 46.674  45.025  22.613  1.00 7.16  ? 316  LEU A CD1   1 
ATOM   2306  C CD2   . LEU A  1 285 ? 46.750  44.383  25.028  1.00 2.00  ? 316  LEU A CD2   1 
ATOM   2307  N N     . LYS A  1 286 ? 47.372  49.585  25.410  1.00 21.08 ? 317  LYS A N     1 
ATOM   2308  C CA    . LYS A  1 286 ? 48.175  50.793  25.629  1.00 24.67 ? 317  LYS A CA    1 
ATOM   2309  C C     . LYS A  1 286 ? 48.332  51.111  27.123  1.00 26.58 ? 317  LYS A C     1 
ATOM   2310  O O     . LYS A  1 286 ? 49.209  51.882  27.522  1.00 25.60 ? 317  LYS A O     1 
ATOM   2311  C CB    . LYS A  1 286 ? 47.534  51.990  24.915  1.00 23.88 ? 317  LYS A CB    1 
ATOM   2312  C CG    . LYS A  1 286 ? 48.163  53.341  25.248  1.00 21.17 ? 317  LYS A CG    1 
ATOM   2313  C CD    . LYS A  1 286 ? 48.058  54.311  24.071  1.00 22.05 ? 317  LYS A CD    1 
ATOM   2314  C CE    . LYS A  1 286 ? 48.314  55.759  24.496  1.00 22.87 ? 317  LYS A CE    1 
ATOM   2315  N NZ    . LYS A  1 286 ? 47.173  56.694  24.219  1.00 21.68 ? 317  LYS A NZ    1 
ATOM   2316  N N     . GLN A  1 287 ? 47.461  50.536  27.944  1.00 29.49 ? 318  GLN A N     1 
ATOM   2317  C CA    . GLN A  1 287 ? 47.525  50.737  29.380  1.00 32.92 ? 318  GLN A CA    1 
ATOM   2318  C C     . GLN A  1 287 ? 48.607  49.798  29.877  1.00 32.19 ? 318  GLN A C     1 
ATOM   2319  O O     . GLN A  1 287 ? 49.511  50.192  30.605  1.00 33.03 ? 318  GLN A O     1 
ATOM   2320  C CB    . GLN A  1 287 ? 46.192  50.366  30.025  1.00 39.79 ? 318  GLN A CB    1 
ATOM   2321  C CG    . GLN A  1 287 ? 46.032  50.885  31.442  1.00 46.79 ? 318  GLN A CG    1 
ATOM   2322  C CD    . GLN A  1 287 ? 46.122  52.396  31.498  1.00 53.32 ? 318  GLN A CD    1 
ATOM   2323  O OE1   . GLN A  1 287 ? 46.244  53.060  30.465  1.00 54.92 ? 318  GLN A OE1   1 
ATOM   2324  N NE2   . GLN A  1 287 ? 46.064  52.951  32.706  1.00 56.76 ? 318  GLN A NE2   1 
ATOM   2325  N N     . GLU A  1 288 ? 48.492  48.546  29.459  1.00 30.93 ? 319  GLU A N     1 
ATOM   2326  C CA    . GLU A  1 288 ? 49.435  47.504  29.819  1.00 31.75 ? 319  GLU A CA    1 
ATOM   2327  C C     . GLU A  1 288 ? 50.841  47.822  29.296  1.00 29.65 ? 319  GLU A C     1 
ATOM   2328  O O     . GLU A  1 288 ? 51.829  47.704  30.024  1.00 27.30 ? 319  GLU A O     1 
ATOM   2329  C CB    . GLU A  1 288 ? 48.954  46.152  29.248  1.00 34.97 ? 319  GLU A CB    1 
ATOM   2330  C CG    . GLU A  1 288 ? 48.603  45.088  30.289  1.00 39.58 ? 319  GLU A CG    1 
ATOM   2331  C CD    . GLU A  1 288 ? 48.029  45.686  31.564  1.00 45.91 ? 319  GLU A CD    1 
ATOM   2332  O OE1   . GLU A  1 288 ? 48.159  45.048  32.627  1.00 44.85 ? 319  GLU A OE1   1 
ATOM   2333  O OE2   . GLU A  1 288 ? 47.448  46.795  31.509  1.00 47.28 ? 319  GLU A OE2   1 
ATOM   2334  N N     . HIS A  1 289 ? 50.922  48.237  28.037  1.00 25.72 ? 320  HIS A N     1 
ATOM   2335  C CA    . HIS A  1 289 ? 52.205  48.529  27.413  1.00 21.24 ? 320  HIS A CA    1 
ATOM   2336  C C     . HIS A  1 289 ? 52.309  49.954  26.902  1.00 19.89 ? 320  HIS A C     1 
ATOM   2337  O O     . HIS A  1 289 ? 52.133  50.222  25.704  1.00 18.13 ? 320  HIS A O     1 
ATOM   2338  C CB    . HIS A  1 289 ? 52.449  47.552  26.265  1.00 20.67 ? 320  HIS A CB    1 
ATOM   2339  C CG    . HIS A  1 289 ? 52.170  46.130  26.623  1.00 17.59 ? 320  HIS A CG    1 
ATOM   2340  N ND1   . HIS A  1 289 ? 52.688  45.537  27.754  1.00 16.01 ? 320  HIS A ND1   1 
ATOM   2341  C CD2   . HIS A  1 289 ? 51.444  45.177  25.994  1.00 20.07 ? 320  HIS A CD2   1 
ATOM   2342  C CE1   . HIS A  1 289 ? 52.295  44.277  27.805  1.00 18.41 ? 320  HIS A CE1   1 
ATOM   2343  N NE2   . HIS A  1 289 ? 51.540  44.032  26.749  1.00 20.01 ? 320  HIS A NE2   1 
ATOM   2344  N N     . PRO A  1 290 ? 52.607  50.892  27.807  1.00 19.23 ? 321  PRO A N     1 
ATOM   2345  C CA    . PRO A  1 290 ? 52.725  52.291  27.383  1.00 17.65 ? 321  PRO A CA    1 
ATOM   2346  C C     . PRO A  1 290 ? 53.909  52.400  26.424  1.00 19.28 ? 321  PRO A C     1 
ATOM   2347  O O     . PRO A  1 290 ? 54.142  53.430  25.796  1.00 15.11 ? 321  PRO A O     1 
ATOM   2348  C CB    . PRO A  1 290 ? 52.957  53.056  28.691  1.00 13.20 ? 321  PRO A CB    1 
ATOM   2349  C CG    . PRO A  1 290 ? 53.450  52.035  29.645  1.00 17.75 ? 321  PRO A CG    1 
ATOM   2350  C CD    . PRO A  1 290 ? 52.860  50.717  29.244  1.00 17.06 ? 321  PRO A CD    1 
ATOM   2351  N N     . GLU A  1 291 ? 54.627  51.292  26.300  1.00 18.59 ? 322  GLU A N     1 
ATOM   2352  C CA    . GLU A  1 291 ? 55.817  51.211  25.467  1.00 19.33 ? 322  GLU A CA    1 
ATOM   2353  C C     . GLU A  1 291 ? 55.618  50.434  24.171  1.00 20.66 ? 322  GLU A C     1 
ATOM   2354  O O     . GLU A  1 291 ? 56.591  49.951  23.578  1.00 23.81 ? 322  GLU A O     1 
ATOM   2355  C CB    . GLU A  1 291 ? 56.929  50.550  26.279  1.00 16.21 ? 322  GLU A CB    1 
ATOM   2356  C CG    . GLU A  1 291 ? 56.394  49.814  27.497  1.00 14.76 ? 322  GLU A CG    1 
ATOM   2357  C CD    . GLU A  1 291 ? 55.955  48.390  27.197  1.00 14.31 ? 322  GLU A CD    1 
ATOM   2358  O OE1   . GLU A  1 291 ? 56.426  47.793  26.195  1.00 12.49 ? 322  GLU A OE1   1 
ATOM   2359  O OE2   . GLU A  1 291 ? 55.136  47.871  27.981  1.00 13.28 ? 322  GLU A OE2   1 
ATOM   2360  N N     . TRP A  1 292 ? 54.373  50.289  23.732  1.00 21.67 ? 323  TRP A N     1 
ATOM   2361  C CA    . TRP A  1 292 ? 54.135  49.563  22.498  1.00 20.04 ? 323  TRP A CA    1 
ATOM   2362  C C     . TRP A  1 292 ? 53.872  50.495  21.312  1.00 19.76 ? 323  TRP A C     1 
ATOM   2363  O O     . TRP A  1 292 ? 53.560  51.674  21.470  1.00 18.18 ? 323  TRP A O     1 
ATOM   2364  C CB    . TRP A  1 292 ? 52.979  48.591  22.687  1.00 22.19 ? 323  TRP A CB    1 
ATOM   2365  C CG    . TRP A  1 292 ? 53.426  47.268  23.189  1.00 24.16 ? 323  TRP A CG    1 
ATOM   2366  C CD1   . TRP A  1 292 ? 54.604  46.990  23.795  1.00 25.54 ? 323  TRP A CD1   1 
ATOM   2367  C CD2   . TRP A  1 292 ? 52.714  46.023  23.094  1.00 28.41 ? 323  TRP A CD2   1 
ATOM   2368  N NE1   . TRP A  1 292 ? 54.683  45.647  24.084  1.00 28.61 ? 323  TRP A NE1   1 
ATOM   2369  C CE2   . TRP A  1 292 ? 53.536  45.028  23.664  1.00 28.29 ? 323  TRP A CE2   1 
ATOM   2370  C CE3   . TRP A  1 292 ? 51.461  45.652  22.581  1.00 31.27 ? 323  TRP A CE3   1 
ATOM   2371  C CZ2   . TRP A  1 292 ? 53.154  43.685  23.738  1.00 30.22 ? 323  TRP A CZ2   1 
ATOM   2372  C CZ3   . TRP A  1 292 ? 51.078  44.312  22.656  1.00 31.16 ? 323  TRP A CZ3   1 
ATOM   2373  C CH2   . TRP A  1 292 ? 51.926  43.347  23.231  1.00 32.24 ? 323  TRP A CH2   1 
ATOM   2374  N N     . GLY A  1 293 ? 54.017  49.955  20.111  1.00 20.07 ? 324  GLY A N     1 
ATOM   2375  C CA    . GLY A  1 293 ? 53.801  50.760  18.925  1.00 19.16 ? 324  GLY A CA    1 
ATOM   2376  C C     . GLY A  1 293 ? 52.436  50.591  18.281  1.00 17.17 ? 324  GLY A C     1 
ATOM   2377  O O     . GLY A  1 293 ? 51.723  49.614  18.533  1.00 13.93 ? 324  GLY A O     1 
ATOM   2378  N N     . ASP A  1 294 ? 52.071  51.559  17.445  1.00 15.25 ? 325  ASP A N     1 
ATOM   2379  C CA    . ASP A  1 294 ? 50.792  51.524  16.764  1.00 14.98 ? 325  ASP A CA    1 
ATOM   2380  C C     . ASP A  1 294 ? 50.624  50.167  16.126  1.00 13.81 ? 325  ASP A C     1 
ATOM   2381  O O     . ASP A  1 294 ? 49.700  49.438  16.454  1.00 21.32 ? 325  ASP A O     1 
ATOM   2382  C CB    . ASP A  1 294 ? 50.725  52.612  15.698  1.00 15.87 ? 325  ASP A CB    1 
ATOM   2383  C CG    . ASP A  1 294 ? 49.576  52.417  14.738  1.00 18.69 ? 325  ASP A CG    1 
ATOM   2384  O OD1   . ASP A  1 294 ? 48.422  52.490  15.195  1.00 23.33 ? 325  ASP A OD1   1 
ATOM   2385  O OD2   . ASP A  1 294 ? 49.817  52.194  13.531  1.00 19.95 ? 325  ASP A OD2   1 
ATOM   2386  N N     . GLU A  1 295 ? 51.543  49.805  15.247  1.00 11.62 ? 326  GLU A N     1 
ATOM   2387  C CA    . GLU A  1 295 ? 51.445  48.524  14.563  1.00 13.57 ? 326  GLU A CA    1 
ATOM   2388  C C     . GLU A  1 295 ? 51.476  47.289  15.453  1.00 13.17 ? 326  GLU A C     1 
ATOM   2389  O O     . GLU A  1 295 ? 51.087  46.216  15.014  1.00 16.92 ? 326  GLU A O     1 
ATOM   2390  C CB    . GLU A  1 295 ? 52.529  48.395  13.492  1.00 12.13 ? 326  GLU A CB    1 
ATOM   2391  C CG    . GLU A  1 295 ? 51.975  48.204  12.076  1.00 11.10 ? 326  GLU A CG    1 
ATOM   2392  C CD    . GLU A  1 295 ? 51.846  46.737  11.671  1.00 15.73 ? 326  GLU A CD    1 
ATOM   2393  O OE1   . GLU A  1 295 ? 51.489  46.479  10.497  1.00 17.53 ? 326  GLU A OE1   1 
ATOM   2394  O OE2   . GLU A  1 295 ? 52.102  45.844  12.516  1.00 9.71  ? 326  GLU A OE2   1 
ATOM   2395  N N     . GLN A  1 296 ? 51.935  47.407  16.693  1.00 15.50 ? 327  GLN A N     1 
ATOM   2396  C CA    . GLN A  1 296 ? 51.948  46.217  17.536  1.00 15.86 ? 327  GLN A CA    1 
ATOM   2397  C C     . GLN A  1 296 ? 50.605  46.111  18.227  1.00 15.78 ? 327  GLN A C     1 
ATOM   2398  O O     . GLN A  1 296 ? 50.037  45.017  18.332  1.00 15.38 ? 327  GLN A O     1 
ATOM   2399  C CB    . GLN A  1 296 ? 53.061  46.265  18.589  1.00 17.58 ? 327  GLN A CB    1 
ATOM   2400  C CG    . GLN A  1 296 ? 52.958  45.118  19.588  1.00 20.45 ? 327  GLN A CG    1 
ATOM   2401  C CD    . GLN A  1 296 ? 54.222  44.897  20.378  1.00 22.82 ? 327  GLN A CD    1 
ATOM   2402  O OE1   . GLN A  1 296 ? 54.989  45.833  20.617  1.00 25.66 ? 327  GLN A OE1   1 
ATOM   2403  N NE2   . GLN A  1 296 ? 54.447  43.653  20.801  1.00 25.00 ? 327  GLN A NE2   1 
ATOM   2404  N N     . LEU A  1 297 ? 50.106  47.256  18.700  1.00 17.21 ? 328  LEU A N     1 
ATOM   2405  C CA    . LEU A  1 297 ? 48.808  47.329  19.378  1.00 13.05 ? 328  LEU A CA    1 
ATOM   2406  C C     . LEU A  1 297 ? 47.802  46.787  18.387  1.00 12.43 ? 328  LEU A C     1 
ATOM   2407  O O     . LEU A  1 297 ? 47.149  45.753  18.615  1.00 10.07 ? 328  LEU A O     1 
ATOM   2408  C CB    . LEU A  1 297 ? 48.459  48.784  19.701  1.00 11.42 ? 328  LEU A CB    1 
ATOM   2409  C CG    . LEU A  1 297 ? 49.221  49.360  20.897  1.00 14.04 ? 328  LEU A CG    1 
ATOM   2410  C CD1   . LEU A  1 297 ? 49.115  50.867  20.847  1.00 12.52 ? 328  LEU A CD1   1 
ATOM   2411  C CD2   . LEU A  1 297 ? 48.663  48.808  22.216  1.00 11.13 ? 328  LEU A CD2   1 
ATOM   2412  N N     . PHE A  1 298 ? 47.704  47.491  17.265  1.00 9.38  ? 329  PHE A N     1 
ATOM   2413  C CA    . PHE A  1 298 ? 46.804  47.085  16.214  1.00 9.91  ? 329  PHE A CA    1 
ATOM   2414  C C     . PHE A  1 298 ? 46.810  45.587  15.985  1.00 11.93 ? 329  PHE A C     1 
ATOM   2415  O O     . PHE A  1 298 ? 45.753  44.985  15.810  1.00 17.86 ? 329  PHE A O     1 
ATOM   2416  C CB    . PHE A  1 298 ? 47.163  47.737  14.898  1.00 4.68  ? 329  PHE A CB    1 
ATOM   2417  C CG    . PHE A  1 298 ? 46.520  47.064  13.725  1.00 8.46  ? 329  PHE A CG    1 
ATOM   2418  C CD1   . PHE A  1 298 ? 45.322  47.547  13.200  1.00 7.56  ? 329  PHE A CD1   1 
ATOM   2419  C CD2   . PHE A  1 298 ? 47.070  45.909  13.182  1.00 9.56  ? 329  PHE A CD2   1 
ATOM   2420  C CE1   . PHE A  1 298 ? 44.678  46.889  12.157  1.00 7.97  ? 329  PHE A CE1   1 
ATOM   2421  C CE2   . PHE A  1 298 ? 46.437  45.238  12.138  1.00 8.63  ? 329  PHE A CE2   1 
ATOM   2422  C CZ    . PHE A  1 298 ? 45.233  45.734  11.626  1.00 10.05 ? 329  PHE A CZ    1 
ATOM   2423  N N     . GLN A  1 299 ? 47.992  44.986  15.946  1.00 15.65 ? 330  GLN A N     1 
ATOM   2424  C CA    . GLN A  1 299 ? 48.080  43.550  15.695  1.00 18.53 ? 330  GLN A CA    1 
ATOM   2425  C C     . GLN A  1 299 ? 47.730  42.693  16.897  1.00 18.50 ? 330  GLN A C     1 
ATOM   2426  O O     . GLN A  1 299 ? 47.173  41.611  16.744  1.00 20.91 ? 330  GLN A O     1 
ATOM   2427  C CB    . GLN A  1 299 ? 49.474  43.175  15.185  1.00 19.18 ? 330  GLN A CB    1 
ATOM   2428  C CG    . GLN A  1 299 ? 49.842  43.823  13.850  1.00 17.05 ? 330  GLN A CG    1 
ATOM   2429  C CD    . GLN A  1 299 ? 49.548  42.940  12.645  1.00 17.50 ? 330  GLN A CD    1 
ATOM   2430  O OE1   . GLN A  1 299 ? 49.148  41.775  12.776  1.00 18.49 ? 330  GLN A OE1   1 
ATOM   2431  N NE2   . GLN A  1 299 ? 49.749  43.495  11.459  1.00 12.45 ? 330  GLN A NE2   1 
ATOM   2432  N N     . THR A  1 300 ? 48.060  43.156  18.094  1.00 20.07 ? 331  THR A N     1 
ATOM   2433  C CA    . THR A  1 300 ? 47.727  42.366  19.270  1.00 21.72 ? 331  THR A CA    1 
ATOM   2434  C C     . THR A  1 300 ? 46.209  42.366  19.387  1.00 21.58 ? 331  THR A C     1 
ATOM   2435  O O     . THR A  1 300 ? 45.591  41.326  19.620  1.00 18.11 ? 331  THR A O     1 
ATOM   2436  C CB    . THR A  1 300 ? 48.338  42.963  20.563  1.00 25.48 ? 331  THR A CB    1 
ATOM   2437  O OG1   . THR A  1 300 ? 49.645  43.489  20.278  1.00 22.29 ? 331  THR A OG1   1 
ATOM   2438  C CG2   . THR A  1 300 ? 48.422  41.888  21.666  1.00 22.10 ? 331  THR A CG2   1 
ATOM   2439  N N     . SER A  1 301 ? 45.616  43.541  19.202  1.00 20.84 ? 332  SER A N     1 
ATOM   2440  C CA    . SER A  1 301 ? 44.168  43.678  19.282  1.00 21.49 ? 332  SER A CA    1 
ATOM   2441  C C     . SER A  1 301 ? 43.553  42.609  18.393  1.00 18.23 ? 332  SER A C     1 
ATOM   2442  O O     . SER A  1 301 ? 42.935  41.676  18.872  1.00 21.26 ? 332  SER A O     1 
ATOM   2443  C CB    . SER A  1 301 ? 43.732  45.068  18.811  1.00 21.59 ? 332  SER A CB    1 
ATOM   2444  O OG    . SER A  1 301 ? 44.105  46.072  19.744  1.00 16.29 ? 332  SER A OG    1 
ATOM   2445  N N     . ARG A  1 302 ? 43.748  42.739  17.095  1.00 14.81 ? 333  ARG A N     1 
ATOM   2446  C CA    . ARG A  1 302 ? 43.214  41.769  16.162  1.00 15.41 ? 333  ARG A CA    1 
ATOM   2447  C C     . ARG A  1 302 ? 43.398  40.324  16.623  1.00 17.52 ? 333  ARG A C     1 
ATOM   2448  O O     . ARG A  1 302 ? 42.613  39.453  16.281  1.00 19.73 ? 333  ARG A O     1 
ATOM   2449  C CB    . ARG A  1 302 ? 43.872  41.952  14.803  1.00 15.05 ? 333  ARG A CB    1 
ATOM   2450  C CG    . ARG A  1 302 ? 43.513  40.883  13.800  1.00 12.58 ? 333  ARG A CG    1 
ATOM   2451  C CD    . ARG A  1 302 ? 43.806  41.363  12.393  1.00 12.28 ? 333  ARG A CD    1 
ATOM   2452  N NE    . ARG A  1 302 ? 43.413  40.372  11.402  1.00 13.75 ? 333  ARG A NE    1 
ATOM   2453  C CZ    . ARG A  1 302 ? 43.171  40.652  10.122  1.00 16.18 ? 333  ARG A CZ    1 
ATOM   2454  N NH1   . ARG A  1 302 ? 43.285  41.902  9.672   1.00 9.93  ? 333  ARG A NH1   1 
ATOM   2455  N NH2   . ARG A  1 302 ? 42.815  39.674  9.287   1.00 15.77 ? 333  ARG A NH2   1 
ATOM   2456  N N     . LEU A  1 303 ? 44.440  40.055  17.395  1.00 19.24 ? 334  LEU A N     1 
ATOM   2457  C CA    . LEU A  1 303 ? 44.655  38.698  17.858  1.00 21.73 ? 334  LEU A CA    1 
ATOM   2458  C C     . LEU A  1 303 ? 43.679  38.401  18.974  1.00 21.89 ? 334  LEU A C     1 
ATOM   2459  O O     . LEU A  1 303 ? 43.026  37.360  18.973  1.00 23.37 ? 334  LEU A O     1 
ATOM   2460  C CB    . LEU A  1 303 ? 46.086  38.517  18.346  1.00 22.54 ? 334  LEU A CB    1 
ATOM   2461  C CG    . LEU A  1 303 ? 47.134  38.168  17.285  1.00 22.31 ? 334  LEU A CG    1 
ATOM   2462  C CD1   . LEU A  1 303 ? 48.087  37.145  17.866  1.00 24.55 ? 334  LEU A CD1   1 
ATOM   2463  C CD2   . LEU A  1 303 ? 46.488  37.613  16.029  1.00 24.83 ? 334  LEU A CD2   1 
ATOM   2464  N N     . ILE A  1 304 ? 43.581  39.329  19.923  1.00 24.31 ? 335  ILE A N     1 
ATOM   2465  C CA    . ILE A  1 304 ? 42.657  39.203  21.051  1.00 24.68 ? 335  ILE A CA    1 
ATOM   2466  C C     . ILE A  1 304 ? 41.216  39.102  20.529  1.00 22.55 ? 335  ILE A C     1 
ATOM   2467  O O     . ILE A  1 304 ? 40.487  38.166  20.859  1.00 21.15 ? 335  ILE A O     1 
ATOM   2468  C CB    . ILE A  1 304 ? 42.768  40.426  21.986  1.00 26.07 ? 335  ILE A CB    1 
ATOM   2469  C CG1   . ILE A  1 304 ? 44.074  40.354  22.769  1.00 28.84 ? 335  ILE A CG1   1 
ATOM   2470  C CG2   . ILE A  1 304 ? 41.581  40.486  22.925  1.00 29.26 ? 335  ILE A CG2   1 
ATOM   2471  C CD1   . ILE A  1 304 ? 44.949  41.586  22.594  1.00 30.92 ? 335  ILE A CD1   1 
ATOM   2472  N N     . LEU A  1 305 ? 40.818  40.071  19.707  1.00 20.05 ? 336  LEU A N     1 
ATOM   2473  C CA    . LEU A  1 305 ? 39.476  40.087  19.145  1.00 15.90 ? 336  LEU A CA    1 
ATOM   2474  C C     . LEU A  1 305 ? 39.177  38.741  18.488  1.00 15.98 ? 336  LEU A C     1 
ATOM   2475  O O     . LEU A  1 305 ? 38.175  38.115  18.833  1.00 20.98 ? 336  LEU A O     1 
ATOM   2476  C CB    . LEU A  1 305 ? 39.326  41.232  18.136  1.00 8.91  ? 336  LEU A CB    1 
ATOM   2477  C CG    . LEU A  1 305 ? 38.403  42.387  18.534  1.00 2.00  ? 336  LEU A CG    1 
ATOM   2478  C CD1   . LEU A  1 305 ? 38.875  43.087  19.801  1.00 2.27  ? 336  LEU A CD1   1 
ATOM   2479  C CD2   . LEU A  1 305 ? 38.369  43.355  17.403  1.00 2.00  ? 336  LEU A CD2   1 
ATOM   2480  N N     . ILE A  1 306 ? 40.037  38.287  17.570  1.00 13.24 ? 337  ILE A N     1 
ATOM   2481  C CA    . ILE A  1 306 ? 39.808  36.990  16.920  1.00 12.23 ? 337  ILE A CA    1 
ATOM   2482  C C     . ILE A  1 306 ? 39.536  35.955  18.005  1.00 9.61  ? 337  ILE A C     1 
ATOM   2483  O O     . ILE A  1 306 ? 38.669  35.091  17.861  1.00 11.41 ? 337  ILE A O     1 
ATOM   2484  C CB    . ILE A  1 306 ? 41.028  36.505  16.087  1.00 12.45 ? 337  ILE A CB    1 
ATOM   2485  C CG1   . ILE A  1 306 ? 40.733  36.653  14.594  1.00 13.61 ? 337  ILE A CG1   1 
ATOM   2486  C CG2   . ILE A  1 306 ? 41.308  35.015  16.356  1.00 15.49 ? 337  ILE A CG2   1 
ATOM   2487  C CD1   . ILE A  1 306 ? 41.982  36.819  13.743  1.00 10.14 ? 337  ILE A CD1   1 
ATOM   2488  N N     . GLY A  1 307 ? 40.281  36.047  19.096  1.00 7.01  ? 338  GLY A N     1 
ATOM   2489  C CA    . GLY A  1 307 ? 40.064  35.113  20.173  1.00 6.69  ? 338  GLY A CA    1 
ATOM   2490  C C     . GLY A  1 307 ? 38.626  35.220  20.647  1.00 7.23  ? 338  GLY A C     1 
ATOM   2491  O O     . GLY A  1 307 ? 37.886  34.234  20.618  1.00 4.76  ? 338  GLY A O     1 
ATOM   2492  N N     . GLU A  1 308 ? 38.233  36.424  21.069  1.00 10.42 ? 339  GLU A N     1 
ATOM   2493  C CA    . GLU A  1 308 ? 36.879  36.693  21.568  1.00 14.24 ? 339  GLU A CA    1 
ATOM   2494  C C     . GLU A  1 308 ? 35.855  36.050  20.645  1.00 14.49 ? 339  GLU A C     1 
ATOM   2495  O O     . GLU A  1 308 ? 35.047  35.223  21.061  1.00 16.11 ? 339  GLU A O     1 
ATOM   2496  C CB    . GLU A  1 308 ? 36.624  38.196  21.629  1.00 13.18 ? 339  GLU A CB    1 
ATOM   2497  C CG    . GLU A  1 308 ? 37.038  38.864  22.914  1.00 15.45 ? 339  GLU A CG    1 
ATOM   2498  C CD    . GLU A  1 308 ? 37.290  40.348  22.713  1.00 19.11 ? 339  GLU A CD    1 
ATOM   2499  O OE1   . GLU A  1 308 ? 37.131  40.835  21.574  1.00 17.41 ? 339  GLU A OE1   1 
ATOM   2500  O OE2   . GLU A  1 308 ? 37.651  41.040  23.688  1.00 22.06 ? 339  GLU A OE2   1 
ATOM   2501  N N     . THR A  1 309 ? 35.902  36.456  19.385  1.00 11.66 ? 340  THR A N     1 
ATOM   2502  C CA    . THR A  1 309 ? 35.029  35.925  18.372  1.00 10.02 ? 340  THR A CA    1 
ATOM   2503  C C     . THR A  1 309 ? 34.959  34.405  18.491  1.00 11.15 ? 340  THR A C     1 
ATOM   2504  O O     . THR A  1 309 ? 33.901  33.860  18.789  1.00 12.27 ? 340  THR A O     1 
ATOM   2505  C CB    . THR A  1 309 ? 35.543  36.305  16.989  1.00 8.24  ? 340  THR A CB    1 
ATOM   2506  O OG1   . THR A  1 309 ? 35.391  37.718  16.806  1.00 11.38 ? 340  THR A OG1   1 
ATOM   2507  C CG2   . THR A  1 309 ? 34.768  35.572  15.917  1.00 11.60 ? 340  THR A CG2   1 
ATOM   2508  N N     . ILE A  1 310 ? 36.079  33.715  18.278  1.00 12.03 ? 341  ILE A N     1 
ATOM   2509  C CA    . ILE A  1 310 ? 36.082  32.248  18.383  1.00 13.10 ? 341  ILE A CA    1 
ATOM   2510  C C     . ILE A  1 310 ? 35.376  31.794  19.675  1.00 14.33 ? 341  ILE A C     1 
ATOM   2511  O O     . ILE A  1 310 ? 34.722  30.746  19.717  1.00 12.99 ? 341  ILE A O     1 
ATOM   2512  C CB    . ILE A  1 310 ? 37.533  31.672  18.376  1.00 13.28 ? 341  ILE A CB    1 
ATOM   2513  C CG1   . ILE A  1 310 ? 38.221  32.003  17.044  1.00 15.62 ? 341  ILE A CG1   1 
ATOM   2514  C CG2   . ILE A  1 310 ? 37.502  30.156  18.619  1.00 12.97 ? 341  ILE A CG2   1 
ATOM   2515  C CD1   . ILE A  1 310 ? 38.056  30.943  15.943  1.00 16.55 ? 341  ILE A CD1   1 
ATOM   2516  N N     . LYS A  1 311 ? 35.512  32.595  20.725  1.00 10.94 ? 342  LYS A N     1 
ATOM   2517  C CA    . LYS A  1 311 ? 34.895  32.282  22.001  1.00 11.31 ? 342  LYS A CA    1 
ATOM   2518  C C     . LYS A  1 311 ? 33.386  32.486  21.891  1.00 13.30 ? 342  LYS A C     1 
ATOM   2519  O O     . LYS A  1 311 ? 32.605  31.514  21.930  1.00 11.29 ? 342  LYS A O     1 
ATOM   2520  C CB    . LYS A  1 311 ? 35.463  33.195  23.093  1.00 10.57 ? 342  LYS A CB    1 
ATOM   2521  C CG    . LYS A  1 311 ? 34.655  33.231  24.379  1.00 5.56  ? 342  LYS A CG    1 
ATOM   2522  C CD    . LYS A  1 311 ? 35.127  32.152  25.334  1.00 7.31  ? 342  LYS A CD    1 
ATOM   2523  C CE    . LYS A  1 311 ? 35.205  32.681  26.762  1.00 2.00  ? 342  LYS A CE    1 
ATOM   2524  N NZ    . LYS A  1 311 ? 35.093  31.582  27.776  1.00 6.65  ? 342  LYS A NZ    1 
ATOM   2525  N N     . ILE A  1 312 ? 32.994  33.756  21.754  1.00 13.40 ? 343  ILE A N     1 
ATOM   2526  C CA    . ILE A  1 312 ? 31.588  34.148  21.647  1.00 12.51 ? 343  ILE A CA    1 
ATOM   2527  C C     . ILE A  1 312 ? 30.801  33.270  20.674  1.00 14.87 ? 343  ILE A C     1 
ATOM   2528  O O     . ILE A  1 312 ? 29.608  33.068  20.864  1.00 15.41 ? 343  ILE A O     1 
ATOM   2529  C CB    . ILE A  1 312 ? 31.446  35.633  21.222  1.00 13.39 ? 343  ILE A CB    1 
ATOM   2530  C CG1   . ILE A  1 312 ? 31.892  36.545  22.361  1.00 11.10 ? 343  ILE A CG1   1 
ATOM   2531  C CG2   . ILE A  1 312 ? 29.997  35.947  20.841  1.00 11.92 ? 343  ILE A CG2   1 
ATOM   2532  C CD1   . ILE A  1 312 ? 31.729  38.020  22.027  1.00 13.36 ? 343  ILE A CD1   1 
ATOM   2533  N N     . VAL A  1 313 ? 31.452  32.748  19.637  1.00 14.56 ? 344  VAL A N     1 
ATOM   2534  C CA    . VAL A  1 313 ? 30.745  31.882  18.704  1.00 11.24 ? 344  VAL A CA    1 
ATOM   2535  C C     . VAL A  1 313 ? 30.539  30.536  19.386  1.00 16.35 ? 344  VAL A C     1 
ATOM   2536  O O     . VAL A  1 313 ? 29.420  30.179  19.727  1.00 14.84 ? 344  VAL A O     1 
ATOM   2537  C CB    . VAL A  1 313 ? 31.525  31.693  17.392  1.00 9.58  ? 344  VAL A CB    1 
ATOM   2538  C CG1   . VAL A  1 313 ? 31.115  30.395  16.715  1.00 2.00  ? 344  VAL A CG1   1 
ATOM   2539  C CG2   . VAL A  1 313 ? 31.261  32.881  16.463  1.00 8.83  ? 344  VAL A CG2   1 
ATOM   2540  N N     . ILE A  1 314 ? 31.624  29.808  19.617  1.00 20.55 ? 345  ILE A N     1 
ATOM   2541  C CA    . ILE A  1 314 ? 31.539  28.498  20.255  1.00 24.75 ? 345  ILE A CA    1 
ATOM   2542  C C     . ILE A  1 314 ? 30.692  28.452  21.525  1.00 27.36 ? 345  ILE A C     1 
ATOM   2543  O O     . ILE A  1 314 ? 29.782  27.625  21.638  1.00 26.04 ? 345  ILE A O     1 
ATOM   2544  C CB    . ILE A  1 314 ? 32.936  27.961  20.627  1.00 28.68 ? 345  ILE A CB    1 
ATOM   2545  C CG1   . ILE A  1 314 ? 33.715  27.613  19.364  1.00 28.99 ? 345  ILE A CG1   1 
ATOM   2546  C CG2   . ILE A  1 314 ? 32.808  26.722  21.515  1.00 25.94 ? 345  ILE A CG2   1 
ATOM   2547  C CD1   . ILE A  1 314 ? 35.226  27.670  19.561  1.00 30.75 ? 345  ILE A CD1   1 
ATOM   2548  N N     . GLU A  1 315 ? 30.999  29.330  22.477  1.00 25.94 ? 346  GLU A N     1 
ATOM   2549  C CA    . GLU A  1 315 ? 30.290  29.353  23.757  1.00 29.10 ? 346  GLU A CA    1 
ATOM   2550  C C     . GLU A  1 315 ? 28.864  29.957  23.809  1.00 29.03 ? 346  GLU A C     1 
ATOM   2551  O O     . GLU A  1 315 ? 28.048  29.567  24.659  1.00 26.05 ? 346  GLU A O     1 
ATOM   2552  C CB    . GLU A  1 315 ? 31.186  30.025  24.794  1.00 32.96 ? 346  GLU A CB    1 
ATOM   2553  C CG    . GLU A  1 315 ? 32.565  29.407  24.866  1.00 39.41 ? 346  GLU A CG    1 
ATOM   2554  C CD    . GLU A  1 315 ? 33.135  29.410  26.270  1.00 42.60 ? 346  GLU A CD    1 
ATOM   2555  O OE1   . GLU A  1 315 ? 32.343  29.393  27.237  1.00 44.12 ? 346  GLU A OE1   1 
ATOM   2556  O OE2   . GLU A  1 315 ? 34.379  29.429  26.400  1.00 43.62 ? 346  GLU A OE2   1 
ATOM   2557  N N     . ASP A  1 316 ? 28.575  30.911  22.927  1.00 25.09 ? 347  ASP A N     1 
ATOM   2558  C CA    . ASP A  1 316 ? 27.249  31.516  22.869  1.00 22.03 ? 347  ASP A CA    1 
ATOM   2559  C C     . ASP A  1 316 ? 26.619  30.947  21.618  1.00 19.21 ? 347  ASP A C     1 
ATOM   2560  O O     . ASP A  1 316 ? 26.165  29.806  21.623  1.00 22.10 ? 347  ASP A O     1 
ATOM   2561  C CB    . ASP A  1 316 ? 27.341  33.032  22.755  1.00 19.87 ? 347  ASP A CB    1 
ATOM   2562  C CG    . ASP A  1 316 ? 27.677  33.682  24.067  1.00 22.88 ? 347  ASP A CG    1 
ATOM   2563  O OD1   . ASP A  1 316 ? 27.489  33.014  25.102  1.00 25.88 ? 347  ASP A OD1   1 
ATOM   2564  O OD2   . ASP A  1 316 ? 28.126  34.852  24.070  1.00 23.18 ? 347  ASP A OD2   1 
ATOM   2565  N N     . TYR A  1 317 ? 26.596  31.747  20.555  1.00 14.32 ? 348  TYR A N     1 
ATOM   2566  C CA    . TYR A  1 317 ? 26.075  31.319  19.256  1.00 9.44  ? 348  TYR A CA    1 
ATOM   2567  C C     . TYR A  1 317 ? 25.927  29.785  19.233  1.00 6.49  ? 348  TYR A C     1 
ATOM   2568  O O     . TYR A  1 317 ? 24.893  29.252  19.651  1.00 2.42  ? 348  TYR A O     1 
ATOM   2569  C CB    . TYR A  1 317 ? 27.042  31.805  18.170  1.00 2.00  ? 348  TYR A CB    1 
ATOM   2570  C CG    . TYR A  1 317 ? 26.608  31.620  16.737  1.00 3.16  ? 348  TYR A CG    1 
ATOM   2571  C CD1   . TYR A  1 317 ? 26.243  32.720  15.949  1.00 2.00  ? 348  TYR A CD1   1 
ATOM   2572  C CD2   . TYR A  1 317 ? 26.659  30.360  16.131  1.00 4.24  ? 348  TYR A CD2   1 
ATOM   2573  C CE1   . TYR A  1 317 ? 25.951  32.565  14.592  1.00 2.00  ? 348  TYR A CE1   1 
ATOM   2574  C CE2   . TYR A  1 317 ? 26.370  30.198  14.775  1.00 5.47  ? 348  TYR A CE2   1 
ATOM   2575  C CZ    . TYR A  1 317 ? 26.023  31.296  14.008  1.00 2.00  ? 348  TYR A CZ    1 
ATOM   2576  O OH    . TYR A  1 317 ? 25.821  31.113  12.652  1.00 7.67  ? 348  TYR A OH    1 
ATOM   2577  N N     . VAL A  1 318 ? 26.957  29.070  18.796  1.00 8.01  ? 349  VAL A N     1 
ATOM   2578  C CA    . VAL A  1 318 ? 26.892  27.601  18.753  1.00 12.74 ? 349  VAL A CA    1 
ATOM   2579  C C     . VAL A  1 318 ? 26.169  26.945  19.937  1.00 14.32 ? 349  VAL A C     1 
ATOM   2580  O O     . VAL A  1 318 ? 25.388  26.000  19.766  1.00 13.39 ? 349  VAL A O     1 
ATOM   2581  C CB    . VAL A  1 318 ? 28.292  26.967  18.702  1.00 9.58  ? 349  VAL A CB    1 
ATOM   2582  C CG1   . VAL A  1 318 ? 28.160  25.440  18.600  1.00 2.00  ? 349  VAL A CG1   1 
ATOM   2583  C CG2   . VAL A  1 318 ? 29.074  27.547  17.546  1.00 5.85  ? 349  VAL A CG2   1 
ATOM   2584  N N     . GLN A  1 319 ? 26.463  27.417  21.142  1.00 19.83 ? 350  GLN A N     1 
ATOM   2585  C CA    . GLN A  1 319 ? 25.832  26.856  22.333  1.00 25.61 ? 350  GLN A CA    1 
ATOM   2586  C C     . GLN A  1 319 ? 24.319  26.854  22.120  1.00 28.21 ? 350  GLN A C     1 
ATOM   2587  O O     . GLN A  1 319 ? 23.690  25.791  22.034  1.00 24.87 ? 350  GLN A O     1 
ATOM   2588  C CB    . GLN A  1 319 ? 26.198  27.691  23.571  1.00 26.43 ? 350  GLN A CB    1 
ATOM   2589  C CG    . GLN A  1 319 ? 25.351  27.395  24.793  1.00 31.83 ? 350  GLN A CG    1 
ATOM   2590  C CD    . GLN A  1 319 ? 25.575  26.001  25.339  1.00 35.66 ? 350  GLN A CD    1 
ATOM   2591  O OE1   . GLN A  1 319 ? 25.117  25.014  24.766  1.00 36.60 ? 350  GLN A OE1   1 
ATOM   2592  N NE2   . GLN A  1 319 ? 26.281  25.915  26.455  1.00 38.41 ? 350  GLN A NE2   1 
ATOM   2593  N N     . HIS A  1 320 ? 23.762  28.059  22.026  1.00 25.92 ? 351  HIS A N     1 
ATOM   2594  C CA    . HIS A  1 320 ? 22.345  28.261  21.807  1.00 28.69 ? 351  HIS A CA    1 
ATOM   2595  C C     . HIS A  1 320 ? 21.853  27.385  20.656  1.00 26.14 ? 351  HIS A C     1 
ATOM   2596  O O     . HIS A  1 320 ? 20.951  26.561  20.819  1.00 27.61 ? 351  HIS A O     1 
ATOM   2597  C CB    . HIS A  1 320 ? 22.105  29.739  21.490  1.00 35.09 ? 351  HIS A CB    1 
ATOM   2598  C CG    . HIS A  1 320 ? 20.900  29.995  20.639  1.00 42.49 ? 351  HIS A CG    1 
ATOM   2599  N ND1   . HIS A  1 320 ? 19.658  30.271  21.169  1.00 46.42 ? 351  HIS A ND1   1 
ATOM   2600  C CD2   . HIS A  1 320 ? 20.751  30.029  19.294  1.00 45.40 ? 351  HIS A CD2   1 
ATOM   2601  C CE1   . HIS A  1 320 ? 18.796  30.464  20.189  1.00 48.07 ? 351  HIS A CE1   1 
ATOM   2602  N NE2   . HIS A  1 320 ? 19.433  30.324  19.041  1.00 46.46 ? 351  HIS A NE2   1 
ATOM   2603  N N     . LEU A  1 321 ? 22.459  27.573  19.493  1.00 22.19 ? 352  LEU A N     1 
ATOM   2604  C CA    . LEU A  1 321 ? 22.108  26.811  18.311  1.00 19.24 ? 352  LEU A CA    1 
ATOM   2605  C C     . LEU A  1 321 ? 21.935  25.320  18.591  1.00 18.60 ? 352  LEU A C     1 
ATOM   2606  O O     . LEU A  1 321 ? 21.227  24.623  17.875  1.00 17.18 ? 352  LEU A O     1 
ATOM   2607  C CB    . LEU A  1 321 ? 23.182  27.004  17.239  1.00 19.49 ? 352  LEU A CB    1 
ATOM   2608  C CG    . LEU A  1 321 ? 22.698  27.190  15.807  1.00 19.62 ? 352  LEU A CG    1 
ATOM   2609  C CD1   . LEU A  1 321 ? 21.419  28.028  15.810  1.00 16.09 ? 352  LEU A CD1   1 
ATOM   2610  C CD2   . LEU A  1 321 ? 23.775  27.873  14.993  1.00 19.35 ? 352  LEU A CD2   1 
ATOM   2611  N N     . SER A  1 322 ? 22.577  24.829  19.638  1.00 16.75 ? 353  SER A N     1 
ATOM   2612  C CA    . SER A  1 322 ? 22.485  23.411  19.953  1.00 21.24 ? 353  SER A CA    1 
ATOM   2613  C C     . SER A  1 322 ? 21.422  23.076  20.984  1.00 24.00 ? 353  SER A C     1 
ATOM   2614  O O     . SER A  1 322 ? 20.943  21.940  21.059  1.00 20.72 ? 353  SER A O     1 
ATOM   2615  C CB    . SER A  1 322 ? 23.839  22.894  20.447  1.00 22.05 ? 353  SER A CB    1 
ATOM   2616  O OG    . SER A  1 322 ? 23.858  22.791  21.858  1.00 15.89 ? 353  SER A OG    1 
ATOM   2617  N N     . GLY A  1 323 ? 21.067  24.069  21.788  1.00 27.67 ? 354  GLY A N     1 
ATOM   2618  C CA    . GLY A  1 323 ? 20.077  23.850  22.816  1.00 30.21 ? 354  GLY A CA    1 
ATOM   2619  C C     . GLY A  1 323 ? 20.482  22.731  23.757  1.00 32.27 ? 354  GLY A C     1 
ATOM   2620  O O     . GLY A  1 323 ? 19.638  22.152  24.438  1.00 34.47 ? 354  GLY A O     1 
ATOM   2621  N N     . TYR A  1 324 ? 21.767  22.403  23.797  1.00 34.64 ? 355  TYR A N     1 
ATOM   2622  C CA    . TYR A  1 324 ? 22.218  21.357  24.702  1.00 39.90 ? 355  TYR A CA    1 
ATOM   2623  C C     . TYR A  1 324 ? 22.176  21.947  26.096  1.00 41.84 ? 355  TYR A C     1 
ATOM   2624  O O     . TYR A  1 324 ? 22.152  23.167  26.257  1.00 40.72 ? 355  TYR A O     1 
ATOM   2625  C CB    . TYR A  1 324 ? 23.653  20.936  24.388  1.00 41.00 ? 355  TYR A CB    1 
ATOM   2626  C CG    . TYR A  1 324 ? 23.825  20.250  23.061  1.00 44.17 ? 355  TYR A CG    1 
ATOM   2627  C CD1   . TYR A  1 324 ? 22.727  19.839  22.315  1.00 46.00 ? 355  TYR A CD1   1 
ATOM   2628  C CD2   . TYR A  1 324 ? 25.090  20.008  22.548  1.00 45.47 ? 355  TYR A CD2   1 
ATOM   2629  C CE1   . TYR A  1 324 ? 22.892  19.204  21.095  1.00 46.02 ? 355  TYR A CE1   1 
ATOM   2630  C CE2   . TYR A  1 324 ? 25.262  19.375  21.327  1.00 46.09 ? 355  TYR A CE2   1 
ATOM   2631  C CZ    . TYR A  1 324 ? 24.162  18.974  20.611  1.00 46.00 ? 355  TYR A CZ    1 
ATOM   2632  O OH    . TYR A  1 324 ? 24.331  18.334  19.414  1.00 48.22 ? 355  TYR A OH    1 
ATOM   2633  N N     . HIS A  1 325 ? 22.165  21.086  27.104  1.00 41.44 ? 356  HIS A N     1 
ATOM   2634  C CA    . HIS A  1 325 ? 22.149  21.562  28.473  1.00 46.62 ? 356  HIS A CA    1 
ATOM   2635  C C     . HIS A  1 325 ? 23.577  21.717  28.953  1.00 46.30 ? 356  HIS A C     1 
ATOM   2636  O O     . HIS A  1 325 ? 23.864  22.515  29.841  1.00 45.50 ? 356  HIS A O     1 
ATOM   2637  C CB    . HIS A  1 325 ? 21.382  20.594  29.361  1.00 48.69 ? 356  HIS A CB    1 
ATOM   2638  C CG    . HIS A  1 325 ? 19.916  20.883  29.419  1.00 52.53 ? 356  HIS A CG    1 
ATOM   2639  N ND1   . HIS A  1 325 ? 18.955  19.925  29.175  1.00 52.55 ? 356  HIS A ND1   1 
ATOM   2640  C CD2   . HIS A  1 325 ? 19.248  22.034  29.663  1.00 49.29 ? 356  HIS A CD2   1 
ATOM   2641  C CE1   . HIS A  1 325 ? 17.758  20.473  29.265  1.00 51.38 ? 356  HIS A CE1   1 
ATOM   2642  N NE2   . HIS A  1 325 ? 17.909  21.752  29.561  1.00 52.25 ? 356  HIS A NE2   1 
ATOM   2643  N N     . PHE A  1 326 ? 24.468  20.941  28.348  1.00 49.99 ? 357  PHE A N     1 
ATOM   2644  C CA    . PHE A  1 326 ? 25.892  20.992  28.663  1.00 50.37 ? 357  PHE A CA    1 
ATOM   2645  C C     . PHE A  1 326 ? 26.416  22.341  28.159  1.00 49.75 ? 357  PHE A C     1 
ATOM   2646  O O     . PHE A  1 326 ? 26.159  22.724  27.012  1.00 47.83 ? 357  PHE A O     1 
ATOM   2647  C CB    . PHE A  1 326 ? 26.619  19.839  27.953  1.00 54.54 ? 357  PHE A CB    1 
ATOM   2648  C CG    . PHE A  1 326 ? 28.109  20.027  27.837  1.00 58.82 ? 357  PHE A CG    1 
ATOM   2649  C CD1   . PHE A  1 326 ? 28.956  19.568  28.835  1.00 59.99 ? 357  PHE A CD1   1 
ATOM   2650  C CD2   . PHE A  1 326 ? 28.665  20.647  26.721  1.00 59.76 ? 357  PHE A CD2   1 
ATOM   2651  C CE1   . PHE A  1 326 ? 30.329  19.719  28.727  1.00 62.19 ? 357  PHE A CE1   1 
ATOM   2652  C CE2   . PHE A  1 326 ? 30.039  20.804  26.603  1.00 59.73 ? 357  PHE A CE2   1 
ATOM   2653  C CZ    . PHE A  1 326 ? 30.872  20.339  27.607  1.00 63.06 ? 357  PHE A CZ    1 
ATOM   2654  N N     . LYS A  1 327 ? 27.136  23.069  29.009  1.00 44.94 ? 358  LYS A N     1 
ATOM   2655  C CA    . LYS A  1 327 ? 27.672  24.358  28.597  1.00 42.62 ? 358  LYS A CA    1 
ATOM   2656  C C     . LYS A  1 327 ? 28.933  24.176  27.766  1.00 41.62 ? 358  LYS A C     1 
ATOM   2657  O O     . LYS A  1 327 ? 29.975  23.775  28.279  1.00 40.98 ? 358  LYS A O     1 
ATOM   2658  C CB    . LYS A  1 327 ? 27.969  25.238  29.808  1.00 40.94 ? 358  LYS A CB    1 
ATOM   2659  C CG    . LYS A  1 327 ? 27.119  26.492  29.841  1.00 41.97 ? 358  LYS A CG    1 
ATOM   2660  C CD    . LYS A  1 327 ? 27.797  27.633  30.594  1.00 43.33 ? 358  LYS A CD    1 
ATOM   2661  C CE    . LYS A  1 327 ? 26.977  28.927  30.497  1.00 42.78 ? 358  LYS A CE    1 
ATOM   2662  N NZ    . LYS A  1 327 ? 26.586  29.482  31.831  1.00 45.92 ? 358  LYS A NZ    1 
ATOM   2663  N N     . LEU A  1 328 ? 28.816  24.465  26.473  1.00 40.33 ? 359  LEU A N     1 
ATOM   2664  C CA    . LEU A  1 328 ? 29.930  24.340  25.551  1.00 36.86 ? 359  LEU A CA    1 
ATOM   2665  C C     . LEU A  1 328 ? 31.066  25.259  25.976  1.00 38.27 ? 359  LEU A C     1 
ATOM   2666  O O     . LEU A  1 328 ? 30.851  26.437  26.269  1.00 35.86 ? 359  LEU A O     1 
ATOM   2667  C CB    . LEU A  1 328 ? 29.475  24.678  24.130  1.00 32.95 ? 359  LEU A CB    1 
ATOM   2668  C CG    . LEU A  1 328 ? 28.708  23.564  23.407  1.00 31.91 ? 359  LEU A CG    1 
ATOM   2669  C CD1   . LEU A  1 328 ? 28.680  23.862  21.927  1.00 32.26 ? 359  LEU A CD1   1 
ATOM   2670  C CD2   . LEU A  1 328 ? 29.351  22.207  23.663  1.00 28.86 ? 359  LEU A CD2   1 
ATOM   2671  N N     . LYS A  1 329 ? 32.274  24.704  26.005  1.00 38.63 ? 360  LYS A N     1 
ATOM   2672  C CA    . LYS A  1 329 ? 33.456  25.446  26.413  1.00 39.27 ? 360  LYS A CA    1 
ATOM   2673  C C     . LYS A  1 329 ? 34.474  25.567  25.290  1.00 39.99 ? 360  LYS A C     1 
ATOM   2674  O O     . LYS A  1 329 ? 34.674  24.637  24.509  1.00 39.91 ? 360  LYS A O     1 
ATOM   2675  C CB    . LYS A  1 329 ? 34.106  24.747  27.612  1.00 41.20 ? 360  LYS A CB    1 
ATOM   2676  C CG    . LYS A  1 329 ? 35.111  25.595  28.375  1.00 40.72 ? 360  LYS A CG    1 
ATOM   2677  C CD    . LYS A  1 329 ? 35.553  24.889  29.664  1.00 41.63 ? 360  LYS A CD    1 
ATOM   2678  C CE    . LYS A  1 329 ? 36.981  25.249  30.065  1.00 40.56 ? 360  LYS A CE    1 
ATOM   2679  N NZ    . LYS A  1 329 ? 37.746  24.050  30.488  1.00 38.92 ? 360  LYS A NZ    1 
ATOM   2680  N N     . PHE A  1 330 ? 35.113  26.726  25.209  1.00 40.23 ? 361  PHE A N     1 
ATOM   2681  C CA    . PHE A  1 330 ? 36.133  26.944  24.202  1.00 41.18 ? 361  PHE A CA    1 
ATOM   2682  C C     . PHE A  1 330 ? 37.487  27.015  24.911  1.00 40.74 ? 361  PHE A C     1 
ATOM   2683  O O     . PHE A  1 330 ? 37.825  28.022  25.527  1.00 38.41 ? 361  PHE A O     1 
ATOM   2684  C CB    . PHE A  1 330 ? 35.875  28.241  23.432  1.00 41.07 ? 361  PHE A CB    1 
ATOM   2685  C CG    . PHE A  1 330 ? 37.086  28.743  22.684  1.00 40.42 ? 361  PHE A CG    1 
ATOM   2686  C CD1   . PHE A  1 330 ? 37.858  27.865  21.909  1.00 35.15 ? 361  PHE A CD1   1 
ATOM   2687  C CD2   . PHE A  1 330 ? 37.479  30.079  22.779  1.00 37.16 ? 361  PHE A CD2   1 
ATOM   2688  C CE1   . PHE A  1 330 ? 38.989  28.316  21.253  1.00 32.51 ? 361  PHE A CE1   1 
ATOM   2689  C CE2   . PHE A  1 330 ? 38.616  30.533  22.121  1.00 29.25 ? 361  PHE A CE2   1 
ATOM   2690  C CZ    . PHE A  1 330 ? 39.366  29.655  21.363  1.00 30.06 ? 361  PHE A CZ    1 
ATOM   2691  N N     . ASP A  1 331 ? 38.249  25.930  24.814  1.00 41.19 ? 362  ASP A N     1 
ATOM   2692  C CA    . ASP A  1 331 ? 39.563  25.814  25.444  1.00 39.30 ? 362  ASP A CA    1 
ATOM   2693  C C     . ASP A  1 331 ? 40.438  24.905  24.568  1.00 37.33 ? 362  ASP A C     1 
ATOM   2694  O O     . ASP A  1 331 ? 40.309  23.674  24.612  1.00 36.54 ? 362  ASP A O     1 
ATOM   2695  C CB    . ASP A  1 331 ? 39.396  25.210  26.838  1.00 38.97 ? 362  ASP A CB    1 
ATOM   2696  C CG    . ASP A  1 331 ? 40.697  24.745  27.421  1.00 44.15 ? 362  ASP A CG    1 
ATOM   2697  O OD1   . ASP A  1 331 ? 41.718  25.435  27.202  1.00 48.87 ? 362  ASP A OD1   1 
ATOM   2698  O OD2   . ASP A  1 331 ? 40.703  23.694  28.092  1.00 45.13 ? 362  ASP A OD2   1 
ATOM   2699  N N     . PRO A  1 332 ? 41.351  25.502  23.773  1.00 35.60 ? 363  PRO A N     1 
ATOM   2700  C CA    . PRO A  1 332 ? 42.238  24.744  22.878  1.00 32.26 ? 363  PRO A CA    1 
ATOM   2701  C C     . PRO A  1 332 ? 43.103  23.739  23.608  1.00 31.69 ? 363  PRO A C     1 
ATOM   2702  O O     . PRO A  1 332 ? 43.536  22.737  23.039  1.00 28.64 ? 363  PRO A O     1 
ATOM   2703  C CB    . PRO A  1 332 ? 43.060  25.828  22.171  1.00 33.38 ? 363  PRO A CB    1 
ATOM   2704  C CG    . PRO A  1 332 ? 42.287  27.100  22.370  1.00 31.67 ? 363  PRO A CG    1 
ATOM   2705  C CD    . PRO A  1 332 ? 41.618  26.948  23.705  1.00 32.20 ? 363  PRO A CD    1 
ATOM   2706  N N     . GLU A  1 333 ? 43.331  24.021  24.882  1.00 31.70 ? 364  GLU A N     1 
ATOM   2707  C CA    . GLU A  1 333 ? 44.134  23.172  25.743  1.00 35.49 ? 364  GLU A CA    1 
ATOM   2708  C C     . GLU A  1 333 ? 43.585  21.766  25.785  1.00 33.06 ? 364  GLU A C     1 
ATOM   2709  O O     . GLU A  1 333 ? 44.150  20.896  26.456  1.00 33.49 ? 364  GLU A O     1 
ATOM   2710  C CB    . GLU A  1 333 ? 44.142  23.727  27.160  1.00 40.13 ? 364  GLU A CB    1 
ATOM   2711  C CG    . GLU A  1 333 ? 45.152  24.817  27.393  1.00 44.87 ? 364  GLU A CG    1 
ATOM   2712  C CD    . GLU A  1 333 ? 45.842  24.657  28.732  1.00 49.66 ? 364  GLU A CD    1 
ATOM   2713  O OE1   . GLU A  1 333 ? 46.293  25.671  29.308  1.00 49.55 ? 364  GLU A OE1   1 
ATOM   2714  O OE2   . GLU A  1 333 ? 45.929  23.507  29.211  1.00 50.10 ? 364  GLU A OE2   1 
ATOM   2715  N N     . LEU A  1 334 ? 42.475  21.555  25.083  1.00 33.04 ? 365  LEU A N     1 
ATOM   2716  C CA    . LEU A  1 334 ? 41.827  20.254  25.039  1.00 30.90 ? 365  LEU A CA    1 
ATOM   2717  C C     . LEU A  1 334 ? 42.386  19.393  23.918  1.00 31.36 ? 365  LEU A C     1 
ATOM   2718  O O     . LEU A  1 334 ? 42.313  18.166  23.968  1.00 29.55 ? 365  LEU A O     1 
ATOM   2719  C CB    . LEU A  1 334 ? 40.329  20.435  24.827  1.00 33.52 ? 365  LEU A CB    1 
ATOM   2720  C CG    . LEU A  1 334 ? 39.531  21.238  25.855  1.00 37.01 ? 365  LEU A CG    1 
ATOM   2721  C CD1   . LEU A  1 334 ? 38.060  21.226  25.468  1.00 39.72 ? 365  LEU A CD1   1 
ATOM   2722  C CD2   . LEU A  1 334 ? 39.697  20.633  27.233  1.00 38.14 ? 365  LEU A CD2   1 
ATOM   2723  N N     . LEU A  1 335 ? 42.946  20.045  22.908  1.00 28.76 ? 366  LEU A N     1 
ATOM   2724  C CA    . LEU A  1 335 ? 43.490  19.339  21.757  1.00 34.21 ? 366  LEU A CA    1 
ATOM   2725  C C     . LEU A  1 335 ? 45.003  19.177  21.834  1.00 33.00 ? 366  LEU A C     1 
ATOM   2726  O O     . LEU A  1 335 ? 45.638  18.579  20.953  1.00 34.31 ? 366  LEU A O     1 
ATOM   2727  C CB    . LEU A  1 335 ? 43.105  20.099  20.484  1.00 34.70 ? 366  LEU A CB    1 
ATOM   2728  C CG    . LEU A  1 335 ? 41.599  20.360  20.388  1.00 37.40 ? 366  LEU A CG    1 
ATOM   2729  C CD1   . LEU A  1 335 ? 41.277  21.268  19.196  1.00 36.13 ? 366  LEU A CD1   1 
ATOM   2730  C CD2   . LEU A  1 335 ? 40.885  19.010  20.270  1.00 34.60 ? 366  LEU A CD2   1 
ATOM   2731  N N     . PHE A  1 336 ? 45.572  19.701  22.908  1.00 32.32 ? 367  PHE A N     1 
ATOM   2732  C CA    . PHE A  1 336 ? 47.006  19.660  23.097  1.00 29.39 ? 367  PHE A CA    1 
ATOM   2733  C C     . PHE A  1 336 ? 47.586  18.268  23.306  1.00 31.71 ? 367  PHE A C     1 
ATOM   2734  O O     . PHE A  1 336 ? 48.682  18.117  23.834  1.00 35.69 ? 367  PHE A O     1 
ATOM   2735  C CB    . PHE A  1 336 ? 47.387  20.586  24.252  1.00 24.48 ? 367  PHE A CB    1 
ATOM   2736  C CG    . PHE A  1 336 ? 47.298  22.046  23.910  1.00 18.65 ? 367  PHE A CG    1 
ATOM   2737  C CD1   . PHE A  1 336 ? 47.406  23.014  24.905  1.00 18.24 ? 367  PHE A CD1   1 
ATOM   2738  C CD2   . PHE A  1 336 ? 47.115  22.455  22.594  1.00 18.99 ? 367  PHE A CD2   1 
ATOM   2739  C CE1   . PHE A  1 336 ? 47.334  24.378  24.598  1.00 16.98 ? 367  PHE A CE1   1 
ATOM   2740  C CE2   . PHE A  1 336 ? 47.042  23.819  22.272  1.00 19.04 ? 367  PHE A CE2   1 
ATOM   2741  C CZ    . PHE A  1 336 ? 47.151  24.783  23.277  1.00 16.10 ? 367  PHE A CZ    1 
ATOM   2742  N N     . ASN A  1 337 ? 46.848  17.249  22.893  1.00 32.17 ? 368  ASN A N     1 
ATOM   2743  C CA    . ASN A  1 337 ? 47.315  15.873  23.004  1.00 36.38 ? 368  ASN A CA    1 
ATOM   2744  C C     . ASN A  1 337 ? 46.380  15.107  22.109  1.00 38.07 ? 368  ASN A C     1 
ATOM   2745  O O     . ASN A  1 337 ? 46.200  13.902  22.231  1.00 41.16 ? 368  ASN A O     1 
ATOM   2746  C CB    . ASN A  1 337 ? 47.224  15.360  24.441  1.00 36.98 ? 368  ASN A CB    1 
ATOM   2747  C CG    . ASN A  1 337 ? 45.885  15.648  25.080  1.00 42.85 ? 368  ASN A CG    1 
ATOM   2748  O OD1   . ASN A  1 337 ? 45.205  16.612  24.723  1.00 43.85 ? 368  ASN A OD1   1 
ATOM   2749  N ND2   . ASN A  1 337 ? 45.498  14.813  26.037  1.00 43.56 ? 368  ASN A ND2   1 
ATOM   2750  N N     . GLN A  1 338 ? 45.783  15.856  21.197  1.00 40.82 ? 369  GLN A N     1 
ATOM   2751  C CA    . GLN A  1 338 ? 44.847  15.314  20.243  1.00 41.33 ? 369  GLN A CA    1 
ATOM   2752  C C     . GLN A  1 338 ? 45.409  15.538  18.859  1.00 39.78 ? 369  GLN A C     1 
ATOM   2753  O O     . GLN A  1 338 ? 45.850  16.643  18.530  1.00 37.06 ? 369  GLN A O     1 
ATOM   2754  C CB    . GLN A  1 338 ? 43.513  16.027  20.394  1.00 47.61 ? 369  GLN A CB    1 
ATOM   2755  C CG    . GLN A  1 338 ? 42.950  15.918  21.794  1.00 52.20 ? 369  GLN A CG    1 
ATOM   2756  C CD    . GLN A  1 338 ? 42.943  14.481  22.293  1.00 59.04 ? 369  GLN A CD    1 
ATOM   2757  O OE1   . GLN A  1 338 ? 42.946  13.532  21.498  1.00 60.00 ? 369  GLN A OE1   1 
ATOM   2758  N NE2   . GLN A  1 338 ? 42.935  14.312  23.610  1.00 59.88 ? 369  GLN A NE2   1 
ATOM   2759  N N     . GLN A  1 339 ? 45.404  14.481  18.057  1.00 38.23 ? 370  GLN A N     1 
ATOM   2760  C CA    . GLN A  1 339 ? 45.909  14.560  16.698  1.00 37.92 ? 370  GLN A CA    1 
ATOM   2761  C C     . GLN A  1 339 ? 45.002  15.471  15.872  1.00 36.70 ? 370  GLN A C     1 
ATOM   2762  O O     . GLN A  1 339 ? 44.208  15.017  15.046  1.00 34.57 ? 370  GLN A O     1 
ATOM   2763  C CB    . GLN A  1 339 ? 45.972  13.164  16.092  1.00 39.39 ? 370  GLN A CB    1 
ATOM   2764  C CG    . GLN A  1 339 ? 47.386  12.627  15.955  1.00 47.16 ? 370  GLN A CG    1 
ATOM   2765  C CD    . GLN A  1 339 ? 47.424  11.265  15.290  1.00 50.32 ? 370  GLN A CD    1 
ATOM   2766  O OE1   . GLN A  1 339 ? 46.727  10.343  15.708  1.00 50.46 ? 370  GLN A OE1   1 
ATOM   2767  N NE2   . GLN A  1 339 ? 48.237  11.134  14.246  1.00 52.06 ? 370  GLN A NE2   1 
ATOM   2768  N N     . PHE A  1 340 ? 45.148  16.771  16.097  1.00 35.42 ? 371  PHE A N     1 
ATOM   2769  C CA    . PHE A  1 340 ? 44.339  17.762  15.417  1.00 33.96 ? 371  PHE A CA    1 
ATOM   2770  C C     . PHE A  1 340 ? 45.166  18.637  14.484  1.00 32.25 ? 371  PHE A C     1 
ATOM   2771  O O     . PHE A  1 340 ? 46.217  19.159  14.858  1.00 33.02 ? 371  PHE A O     1 
ATOM   2772  C CB    . PHE A  1 340 ? 43.625  18.632  16.461  1.00 36.09 ? 371  PHE A CB    1 
ATOM   2773  C CG    . PHE A  1 340 ? 42.891  19.805  15.878  1.00 36.73 ? 371  PHE A CG    1 
ATOM   2774  C CD1   . PHE A  1 340 ? 41.760  19.611  15.104  1.00 36.84 ? 371  PHE A CD1   1 
ATOM   2775  C CD2   . PHE A  1 340 ? 43.338  21.105  16.101  1.00 36.76 ? 371  PHE A CD2   1 
ATOM   2776  C CE1   . PHE A  1 340 ? 41.080  20.690  14.559  1.00 36.39 ? 371  PHE A CE1   1 
ATOM   2777  C CE2   . PHE A  1 340 ? 42.661  22.192  15.556  1.00 36.85 ? 371  PHE A CE2   1 
ATOM   2778  C CZ    . PHE A  1 340 ? 41.530  21.978  14.783  1.00 35.88 ? 371  PHE A CZ    1 
ATOM   2779  N N     . GLN A  1 341 ? 44.665  18.803  13.268  1.00 30.67 ? 372  GLN A N     1 
ATOM   2780  C CA    . GLN A  1 341 ? 45.336  19.605  12.262  1.00 28.62 ? 372  GLN A CA    1 
ATOM   2781  C C     . GLN A  1 341 ? 44.949  21.077  12.373  1.00 27.08 ? 372  GLN A C     1 
ATOM   2782  O O     . GLN A  1 341 ? 43.933  21.493  11.821  1.00 29.22 ? 372  GLN A O     1 
ATOM   2783  C CB    . GLN A  1 341 ? 44.974  19.075  10.879  1.00 30.31 ? 372  GLN A CB    1 
ATOM   2784  C CG    . GLN A  1 341 ? 45.694  17.799  10.528  1.00 34.93 ? 372  GLN A CG    1 
ATOM   2785  C CD    . GLN A  1 341 ? 47.176  18.026  10.407  1.00 41.29 ? 372  GLN A CD    1 
ATOM   2786  O OE1   . GLN A  1 341 ? 47.627  19.171  10.304  1.00 43.19 ? 372  GLN A OE1   1 
ATOM   2787  N NE2   . GLN A  1 341 ? 47.952  16.944  10.418  1.00 44.69 ? 372  GLN A NE2   1 
ATOM   2788  N N     . TYR A  1 342 ? 45.762  21.857  13.084  1.00 24.29 ? 373  TYR A N     1 
ATOM   2789  C CA    . TYR A  1 342 ? 45.513  23.281  13.259  1.00 22.10 ? 373  TYR A CA    1 
ATOM   2790  C C     . TYR A  1 342 ? 45.593  24.038  11.938  1.00 22.11 ? 373  TYR A C     1 
ATOM   2791  O O     . TYR A  1 342 ? 46.487  24.842  11.725  1.00 25.50 ? 373  TYR A O     1 
ATOM   2792  C CB    . TYR A  1 342 ? 46.512  23.855  14.257  1.00 18.60 ? 373  TYR A CB    1 
ATOM   2793  C CG    . TYR A  1 342 ? 46.128  23.547  15.680  1.00 21.47 ? 373  TYR A CG    1 
ATOM   2794  C CD1   . TYR A  1 342 ? 46.660  22.443  16.347  1.00 22.35 ? 373  TYR A CD1   1 
ATOM   2795  C CD2   . TYR A  1 342 ? 45.201  24.338  16.354  1.00 22.66 ? 373  TYR A CD2   1 
ATOM   2796  C CE1   . TYR A  1 342 ? 46.276  22.133  17.655  1.00 21.12 ? 373  TYR A CE1   1 
ATOM   2797  C CE2   . TYR A  1 342 ? 44.813  24.040  17.652  1.00 19.32 ? 373  TYR A CE2   1 
ATOM   2798  C CZ    . TYR A  1 342 ? 45.351  22.940  18.303  1.00 20.53 ? 373  TYR A CZ    1 
ATOM   2799  O OH    . TYR A  1 342 ? 44.958  22.659  19.601  1.00 21.70 ? 373  TYR A OH    1 
ATOM   2800  N N     . GLN A  1 343 ? 44.634  23.783  11.059  1.00 25.20 ? 374  GLN A N     1 
ATOM   2801  C CA    . GLN A  1 343 ? 44.578  24.422  9.752   1.00 27.05 ? 374  GLN A CA    1 
ATOM   2802  C C     . GLN A  1 343 ? 43.166  24.239  9.205   1.00 24.91 ? 374  GLN A C     1 
ATOM   2803  O O     . GLN A  1 343 ? 42.428  23.372  9.672   1.00 21.74 ? 374  GLN A O     1 
ATOM   2804  C CB    . GLN A  1 343 ? 45.584  23.768  8.804   1.00 31.11 ? 374  GLN A CB    1 
ATOM   2805  C CG    . GLN A  1 343 ? 45.031  22.563  8.057   1.00 34.59 ? 374  GLN A CG    1 
ATOM   2806  C CD    . GLN A  1 343 ? 46.117  21.686  7.480   1.00 37.46 ? 374  GLN A CD    1 
ATOM   2807  O OE1   . GLN A  1 343 ? 46.267  21.592  6.258   1.00 40.94 ? 374  GLN A OE1   1 
ATOM   2808  N NE2   . GLN A  1 343 ? 46.883  21.032  8.353   1.00 35.62 ? 374  GLN A NE2   1 
ATOM   2809  N N     . ASN A  1 344 ? 42.798  25.031  8.204   1.00 23.40 ? 375  ASN A N     1 
ATOM   2810  C CA    . ASN A  1 344 ? 41.455  24.921  7.652   1.00 25.10 ? 375  ASN A CA    1 
ATOM   2811  C C     . ASN A  1 344 ? 41.197  25.487  6.259   1.00 25.28 ? 375  ASN A C     1 
ATOM   2812  O O     . ASN A  1 344 ? 41.687  26.563  5.896   1.00 27.44 ? 375  ASN A O     1 
ATOM   2813  C CB    . ASN A  1 344 ? 40.453  25.563  8.617   1.00 26.56 ? 375  ASN A CB    1 
ATOM   2814  C CG    . ASN A  1 344 ? 39.019  25.323  8.208   1.00 19.16 ? 375  ASN A CG    1 
ATOM   2815  O OD1   . ASN A  1 344 ? 38.363  24.416  8.716   1.00 16.34 ? 375  ASN A OD1   1 
ATOM   2816  N ND2   . ASN A  1 344 ? 38.526  26.135  7.288   1.00 15.71 ? 375  ASN A ND2   1 
ATOM   2817  N N     . ARG A  1 345 ? 40.396  24.750  5.497   1.00 25.01 ? 376  ARG A N     1 
ATOM   2818  C CA    . ARG A  1 345 ? 40.001  25.165  4.156   1.00 25.32 ? 376  ARG A CA    1 
ATOM   2819  C C     . ARG A  1 345 ? 38.480  25.099  4.147   1.00 23.18 ? 376  ARG A C     1 
ATOM   2820  O O     . ARG A  1 345 ? 37.905  24.078  4.536   1.00 26.23 ? 376  ARG A O     1 
ATOM   2821  C CB    . ARG A  1 345 ? 40.560  24.221  3.101   1.00 25.35 ? 376  ARG A CB    1 
ATOM   2822  C CG    . ARG A  1 345 ? 40.519  24.807  1.718   1.00 28.37 ? 376  ARG A CG    1 
ATOM   2823  C CD    . ARG A  1 345 ? 41.675  25.761  1.501   1.00 31.99 ? 376  ARG A CD    1 
ATOM   2824  N NE    . ARG A  1 345 ? 42.374  25.447  0.261   1.00 32.41 ? 376  ARG A NE    1 
ATOM   2825  C CZ    . ARG A  1 345 ? 43.443  24.662  0.195   1.00 29.79 ? 376  ARG A CZ    1 
ATOM   2826  N NH1   . ARG A  1 345 ? 43.931  24.117  1.297   1.00 30.90 ? 376  ARG A NH1   1 
ATOM   2827  N NH2   . ARG A  1 345 ? 44.009  24.408  -0.974  1.00 26.67 ? 376  ARG A NH2   1 
ATOM   2828  N N     . ILE A  1 346 ? 37.832  26.179  3.705   1.00 20.81 ? 377  ILE A N     1 
ATOM   2829  C CA    . ILE A  1 346 ? 36.372  26.251  3.690   1.00 15.67 ? 377  ILE A CA    1 
ATOM   2830  C C     . ILE A  1 346 ? 35.680  25.508  2.550   1.00 16.66 ? 377  ILE A C     1 
ATOM   2831  O O     . ILE A  1 346 ? 35.955  25.744  1.367   1.00 13.32 ? 377  ILE A O     1 
ATOM   2832  C CB    . ILE A  1 346 ? 35.917  27.720  3.711   1.00 13.52 ? 377  ILE A CB    1 
ATOM   2833  C CG1   . ILE A  1 346 ? 35.627  28.140  5.153   1.00 11.67 ? 377  ILE A CG1   1 
ATOM   2834  C CG2   . ILE A  1 346 ? 34.659  27.900  2.899   1.00 14.78 ? 377  ILE A CG2   1 
ATOM   2835  C CD1   . ILE A  1 346 ? 36.508  29.210  5.655   1.00 10.13 ? 377  ILE A CD1   1 
ATOM   2836  N N     . ALA A  1 347 ? 34.764  24.615  2.937   1.00 15.73 ? 378  ALA A N     1 
ATOM   2837  C CA    . ALA A  1 347 ? 33.984  23.787  1.999   1.00 18.36 ? 378  ALA A CA    1 
ATOM   2838  C C     . ALA A  1 347 ? 32.749  24.457  1.384   1.00 16.97 ? 378  ALA A C     1 
ATOM   2839  O O     . ALA A  1 347 ? 32.076  25.273  2.022   1.00 20.38 ? 378  ALA A O     1 
ATOM   2840  C CB    . ALA A  1 347 ? 33.549  22.487  2.680   1.00 15.25 ? 378  ALA A CB    1 
ATOM   2841  N N     . SER A  1 348 ? 32.440  24.085  0.144   1.00 18.37 ? 379  SER A N     1 
ATOM   2842  C CA    . SER A  1 348 ? 31.284  24.632  -0.559  1.00 14.88 ? 379  SER A CA    1 
ATOM   2843  C C     . SER A  1 348 ? 30.043  24.305  0.258   1.00 16.49 ? 379  SER A C     1 
ATOM   2844  O O     . SER A  1 348 ? 29.255  25.191  0.603   1.00 15.13 ? 379  SER A O     1 
ATOM   2845  C CB    . SER A  1 348 ? 31.173  24.000  -1.946  1.00 10.67 ? 379  SER A CB    1 
ATOM   2846  O OG    . SER A  1 348 ? 30.413  24.828  -2.803  1.00 9.76  ? 379  SER A OG    1 
ATOM   2847  N N     . GLU A  1 349 ? 29.890  23.016  0.551   1.00 13.16 ? 380  GLU A N     1 
ATOM   2848  C CA    . GLU A  1 349 ? 28.780  22.514  1.332   1.00 13.26 ? 380  GLU A CA    1 
ATOM   2849  C C     . GLU A  1 349 ? 28.514  23.451  2.499   1.00 14.36 ? 380  GLU A C     1 
ATOM   2850  O O     . GLU A  1 349 ? 27.487  24.122  2.550   1.00 14.86 ? 380  GLU A O     1 
ATOM   2851  C CB    . GLU A  1 349 ? 29.109  21.115  1.858   1.00 14.45 ? 380  GLU A CB    1 
ATOM   2852  C CG    . GLU A  1 349 ? 29.065  20.015  0.795   1.00 17.88 ? 380  GLU A CG    1 
ATOM   2853  C CD    . GLU A  1 349 ? 30.297  19.989  -0.098  1.00 20.09 ? 380  GLU A CD    1 
ATOM   2854  O OE1   . GLU A  1 349 ? 31.126  20.925  -0.006  1.00 18.54 ? 380  GLU A OE1   1 
ATOM   2855  O OE2   . GLU A  1 349 ? 30.430  19.028  -0.892  1.00 16.60 ? 380  GLU A OE2   1 
ATOM   2856  N N     . PHE A  1 350 ? 29.449  23.488  3.439   1.00 15.47 ? 381  PHE A N     1 
ATOM   2857  C CA    . PHE A  1 350 ? 29.328  24.345  4.609   1.00 17.57 ? 381  PHE A CA    1 
ATOM   2858  C C     . PHE A  1 350 ? 28.760  25.698  4.199   1.00 17.30 ? 381  PHE A C     1 
ATOM   2859  O O     . PHE A  1 350 ? 27.971  26.286  4.929   1.00 19.92 ? 381  PHE A O     1 
ATOM   2860  C CB    . PHE A  1 350 ? 30.699  24.523  5.261   1.00 20.45 ? 381  PHE A CB    1 
ATOM   2861  C CG    . PHE A  1 350 ? 30.659  25.182  6.611   1.00 25.41 ? 381  PHE A CG    1 
ATOM   2862  C CD1   . PHE A  1 350 ? 30.059  24.547  7.694   1.00 27.70 ? 381  PHE A CD1   1 
ATOM   2863  C CD2   . PHE A  1 350 ? 31.263  26.422  6.813   1.00 23.79 ? 381  PHE A CD2   1 
ATOM   2864  C CE1   . PHE A  1 350 ? 30.065  25.133  8.970   1.00 28.28 ? 381  PHE A CE1   1 
ATOM   2865  C CE2   . PHE A  1 350 ? 31.271  27.019  8.078   1.00 25.99 ? 381  PHE A CE2   1 
ATOM   2866  C CZ    . PHE A  1 350 ? 30.674  26.373  9.160   1.00 27.25 ? 381  PHE A CZ    1 
ATOM   2867  N N     . ASN A  1 351 ? 29.155  26.197  3.034   1.00 17.61 ? 382  ASN A N     1 
ATOM   2868  C CA    . ASN A  1 351 ? 28.639  27.484  2.589   1.00 17.17 ? 382  ASN A CA    1 
ATOM   2869  C C     . ASN A  1 351 ? 27.153  27.425  2.307   1.00 17.09 ? 382  ASN A C     1 
ATOM   2870  O O     . ASN A  1 351 ? 26.404  28.296  2.723   1.00 18.42 ? 382  ASN A O     1 
ATOM   2871  C CB    . ASN A  1 351 ? 29.350  27.958  1.327   1.00 18.35 ? 382  ASN A CB    1 
ATOM   2872  C CG    . ASN A  1 351 ? 28.759  29.249  0.788   1.00 21.24 ? 382  ASN A CG    1 
ATOM   2873  O OD1   . ASN A  1 351 ? 28.477  29.368  -0.403  1.00 22.55 ? 382  ASN A OD1   1 
ATOM   2874  N ND2   . ASN A  1 351 ? 28.558  30.221  1.671   1.00 24.26 ? 382  ASN A ND2   1 
ATOM   2875  N N     . THR A  1 352 ? 26.730  26.405  1.573   1.00 19.43 ? 383  THR A N     1 
ATOM   2876  C CA    . THR A  1 352 ? 25.323  26.254  1.246   1.00 21.94 ? 383  THR A CA    1 
ATOM   2877  C C     . THR A  1 352 ? 24.504  26.080  2.516   1.00 24.15 ? 383  THR A C     1 
ATOM   2878  O O     . THR A  1 352 ? 23.601  26.869  2.778   1.00 25.38 ? 383  THR A O     1 
ATOM   2879  C CB    . THR A  1 352 ? 25.082  25.049  0.323   1.00 21.65 ? 383  THR A CB    1 
ATOM   2880  O OG1   . THR A  1 352 ? 26.087  25.010  -0.695  1.00 23.13 ? 383  THR A OG1   1 
ATOM   2881  C CG2   . THR A  1 352 ? 23.728  25.174  -0.347  1.00 22.63 ? 383  THR A CG2   1 
ATOM   2882  N N     . LEU A  1 353 ? 24.813  25.059  3.313   1.00 25.87 ? 384  LEU A N     1 
ATOM   2883  C CA    . LEU A  1 353 ? 24.074  24.846  4.558   1.00 28.41 ? 384  LEU A CA    1 
ATOM   2884  C C     . LEU A  1 353 ? 23.830  26.161  5.261   1.00 28.93 ? 384  LEU A C     1 
ATOM   2885  O O     . LEU A  1 353 ? 22.891  26.285  6.028   1.00 31.76 ? 384  LEU A O     1 
ATOM   2886  C CB    . LEU A  1 353 ? 24.839  23.949  5.534   1.00 29.91 ? 384  LEU A CB    1 
ATOM   2887  C CG    . LEU A  1 353 ? 25.755  22.840  5.029   1.00 35.21 ? 384  LEU A CG    1 
ATOM   2888  C CD1   . LEU A  1 353 ? 26.422  22.192  6.238   1.00 32.96 ? 384  LEU A CD1   1 
ATOM   2889  C CD2   . LEU A  1 353 ? 24.966  21.805  4.237   1.00 32.81 ? 384  LEU A CD2   1 
ATOM   2890  N N     . TYR A  1 354 ? 24.690  27.137  5.003   1.00 32.84 ? 385  TYR A N     1 
ATOM   2891  C CA    . TYR A  1 354 ? 24.574  28.435  5.642   1.00 38.15 ? 385  TYR A CA    1 
ATOM   2892  C C     . TYR A  1 354 ? 23.310  29.149  5.243   1.00 33.05 ? 385  TYR A C     1 
ATOM   2893  O O     . TYR A  1 354 ? 22.687  29.775  6.086   1.00 35.17 ? 385  TYR A O     1 
ATOM   2894  C CB    . TYR A  1 354 ? 25.791  29.310  5.320   1.00 51.73 ? 385  TYR A CB    1 
ATOM   2895  C CG    . TYR A  1 354 ? 25.442  30.722  4.874   1.00 62.70 ? 385  TYR A CG    1 
ATOM   2896  C CD1   . TYR A  1 354 ? 24.907  31.649  5.776   1.00 68.06 ? 385  TYR A CD1   1 
ATOM   2897  C CD2   . TYR A  1 354 ? 25.618  31.118  3.546   1.00 65.99 ? 385  TYR A CD2   1 
ATOM   2898  C CE1   . TYR A  1 354 ? 24.552  32.931  5.369   1.00 69.30 ? 385  TYR A CE1   1 
ATOM   2899  C CE2   . TYR A  1 354 ? 25.269  32.394  3.128   1.00 69.98 ? 385  TYR A CE2   1 
ATOM   2900  C CZ    . TYR A  1 354 ? 24.734  33.300  4.043   1.00 72.92 ? 385  TYR A CZ    1 
ATOM   2901  O OH    . TYR A  1 354 ? 24.378  34.570  3.630   1.00 74.78 ? 385  TYR A OH    1 
ATOM   2902  N N     . HIS A  1 355 ? 22.954  29.073  3.962   1.00 29.70 ? 386  HIS A N     1 
ATOM   2903  C CA    . HIS A  1 355 ? 21.757  29.730  3.420   1.00 25.95 ? 386  HIS A CA    1 
ATOM   2904  C C     . HIS A  1 355 ? 20.534  29.502  4.316   1.00 24.18 ? 386  HIS A C     1 
ATOM   2905  O O     . HIS A  1 355 ? 19.597  28.771  3.981   1.00 24.93 ? 386  HIS A O     1 
ATOM   2906  C CB    . HIS A  1 355 ? 21.522  29.228  1.994   1.00 29.42 ? 386  HIS A CB    1 
ATOM   2907  C CG    . HIS A  1 355 ? 22.739  29.330  1.126   1.00 37.24 ? 386  HIS A CG    1 
ATOM   2908  N ND1   . HIS A  1 355 ? 23.791  30.169  1.424   1.00 41.58 ? 386  HIS A ND1   1 
ATOM   2909  C CD2   . HIS A  1 355 ? 23.083  28.694  -0.020  1.00 41.21 ? 386  HIS A CD2   1 
ATOM   2910  C CE1   . HIS A  1 355 ? 24.729  30.049  0.502   1.00 40.63 ? 386  HIS A CE1   1 
ATOM   2911  N NE2   . HIS A  1 355 ? 24.324  29.159  -0.386  1.00 41.58 ? 386  HIS A NE2   1 
ATOM   2912  N N     . TRP A  1 356 ? 20.571  30.195  5.449   1.00 17.82 ? 387  TRP A N     1 
ATOM   2913  C CA    . TRP A  1 356 ? 19.589  30.137  6.512   1.00 17.34 ? 387  TRP A CA    1 
ATOM   2914  C C     . TRP A  1 356 ? 18.547  31.220  6.428   1.00 21.20 ? 387  TRP A C     1 
ATOM   2915  O O     . TRP A  1 356 ? 18.184  31.801  7.458   1.00 21.37 ? 387  TRP A O     1 
ATOM   2916  C CB    . TRP A  1 356 ? 20.305  30.316  7.832   1.00 14.61 ? 387  TRP A CB    1 
ATOM   2917  C CG    . TRP A  1 356 ? 21.121  29.169  8.262   1.00 7.91  ? 387  TRP A CG    1 
ATOM   2918  C CD1   . TRP A  1 356 ? 21.183  27.938  7.678   1.00 2.69  ? 387  TRP A CD1   1 
ATOM   2919  C CD2   . TRP A  1 356 ? 21.874  29.085  9.471   1.00 2.00  ? 387  TRP A CD2   1 
ATOM   2920  N NE1   . TRP A  1 356 ? 21.917  27.088  8.464   1.00 2.00  ? 387  TRP A NE1   1 
ATOM   2921  C CE2   . TRP A  1 356 ? 22.352  27.765  9.572   1.00 2.00  ? 387  TRP A CE2   1 
ATOM   2922  C CE3   . TRP A  1 356 ? 22.177  29.997  10.487  1.00 3.09  ? 387  TRP A CE3   1 
ATOM   2923  C CZ2   . TRP A  1 356 ? 23.116  27.328  10.646  1.00 2.00  ? 387  TRP A CZ2   1 
ATOM   2924  C CZ3   . TRP A  1 356 ? 22.944  29.558  11.568  1.00 5.96  ? 387  TRP A CZ3   1 
ATOM   2925  C CH2   . TRP A  1 356 ? 23.402  28.236  11.633  1.00 2.00  ? 387  TRP A CH2   1 
ATOM   2926  N N     . HIS A  1 357 ? 18.066  31.490  5.221   1.00 26.57 ? 388  HIS A N     1 
ATOM   2927  C CA    . HIS A  1 357 ? 17.062  32.534  4.990   1.00 28.59 ? 388  HIS A CA    1 
ATOM   2928  C C     . HIS A  1 357 ? 15.870  32.504  5.962   1.00 23.91 ? 388  HIS A C     1 
ATOM   2929  O O     . HIS A  1 357 ? 15.482  33.537  6.514   1.00 19.84 ? 388  HIS A O     1 
ATOM   2930  C CB    . HIS A  1 357 ? 16.610  32.442  3.538   1.00 39.61 ? 388  HIS A CB    1 
ATOM   2931  C CG    . HIS A  1 357 ? 17.737  32.170  2.589   1.00 46.89 ? 388  HIS A CG    1 
ATOM   2932  N ND1   . HIS A  1 357 ? 17.807  31.034  1.809   1.00 48.62 ? 388  HIS A ND1   1 
ATOM   2933  C CD2   . HIS A  1 357 ? 18.855  32.884  2.314   1.00 46.88 ? 388  HIS A CD2   1 
ATOM   2934  C CE1   . HIS A  1 357 ? 18.916  31.060  1.095   1.00 51.09 ? 388  HIS A CE1   1 
ATOM   2935  N NE2   . HIS A  1 357 ? 19.569  32.172  1.384   1.00 52.67 ? 388  HIS A NE2   1 
ATOM   2936  N N     . PRO A  1 358 ? 15.266  31.321  6.165   1.00 20.97 ? 389  PRO A N     1 
ATOM   2937  C CA    . PRO A  1 358 ? 14.133  31.204  7.088   1.00 23.22 ? 389  PRO A CA    1 
ATOM   2938  C C     . PRO A  1 358 ? 14.278  32.070  8.343   1.00 25.51 ? 389  PRO A C     1 
ATOM   2939  O O     . PRO A  1 358 ? 13.285  32.537  8.903   1.00 26.68 ? 389  PRO A O     1 
ATOM   2940  C CB    . PRO A  1 358 ? 14.093  29.707  7.431   1.00 19.00 ? 389  PRO A CB    1 
ATOM   2941  C CG    . PRO A  1 358 ? 15.136  29.035  6.531   1.00 16.68 ? 389  PRO A CG    1 
ATOM   2942  C CD    . PRO A  1 358 ? 15.562  30.035  5.506   1.00 17.92 ? 389  PRO A CD    1 
ATOM   2943  N N     . LEU A  1 359 ? 15.512  32.283  8.788   1.00 27.76 ? 390  LEU A N     1 
ATOM   2944  C CA    . LEU A  1 359 ? 15.754  33.097  9.987   1.00 30.92 ? 390  LEU A CA    1 
ATOM   2945  C C     . LEU A  1 359 ? 15.155  34.479  9.818   1.00 29.50 ? 390  LEU A C     1 
ATOM   2946  O O     . LEU A  1 359 ? 14.551  35.050  10.725  1.00 31.15 ? 390  LEU A O     1 
ATOM   2947  C CB    . LEU A  1 359 ? 17.252  33.250  10.227  1.00 32.72 ? 390  LEU A CB    1 
ATOM   2948  C CG    . LEU A  1 359 ? 18.022  32.010  10.669  1.00 35.18 ? 390  LEU A CG    1 
ATOM   2949  C CD1   . LEU A  1 359 ? 19.393  32.438  11.160  1.00 34.67 ? 390  LEU A CD1   1 
ATOM   2950  C CD2   . LEU A  1 359 ? 17.267  31.288  11.776  1.00 36.49 ? 390  LEU A CD2   1 
ATOM   2951  N N     . LEU A  1 360 ? 15.359  35.008  8.628   1.00 27.97 ? 391  LEU A N     1 
ATOM   2952  C CA    . LEU A  1 360 ? 14.880  36.317  8.259   1.00 30.70 ? 391  LEU A CA    1 
ATOM   2953  C C     . LEU A  1 360 ? 13.399  36.560  8.552   1.00 32.43 ? 391  LEU A C     1 
ATOM   2954  O O     . LEU A  1 360 ? 12.531  35.791  8.125   1.00 29.57 ? 391  LEU A O     1 
ATOM   2955  C CB    . LEU A  1 360 ? 15.133  36.516  6.771   1.00 30.28 ? 391  LEU A CB    1 
ATOM   2956  C CG    . LEU A  1 360 ? 16.142  37.590  6.412   1.00 27.06 ? 391  LEU A CG    1 
ATOM   2957  C CD1   . LEU A  1 360 ? 16.373  37.554  4.921   1.00 26.56 ? 391  LEU A CD1   1 
ATOM   2958  C CD2   . LEU A  1 360 ? 15.622  38.950  6.850   1.00 25.79 ? 391  LEU A CD2   1 
ATOM   2959  N N     . PRO A  1 361 ? 13.091  37.648  9.278   1.00 33.37 ? 392  PRO A N     1 
ATOM   2960  C CA    . PRO A  1 361 ? 11.697  37.976  9.604   1.00 36.15 ? 392  PRO A CA    1 
ATOM   2961  C C     . PRO A  1 361 ? 10.980  38.520  8.366   1.00 38.24 ? 392  PRO A C     1 
ATOM   2962  O O     . PRO A  1 361 ? 11.536  38.498  7.268   1.00 38.45 ? 392  PRO A O     1 
ATOM   2963  C CB    . PRO A  1 361 ? 11.826  39.030  10.699  1.00 34.91 ? 392  PRO A CB    1 
ATOM   2964  C CG    . PRO A  1 361 ? 13.130  39.695  10.408  1.00 34.19 ? 392  PRO A CG    1 
ATOM   2965  C CD    . PRO A  1 361 ? 14.036  38.628  9.846   1.00 31.96 ? 392  PRO A CD    1 
ATOM   2966  N N     . ASP A  1 362 ? 9.754   39.008  8.536   1.00 42.20 ? 393  ASP A N     1 
ATOM   2967  C CA    . ASP A  1 362 ? 9.001   39.554  7.410   1.00 42.52 ? 393  ASP A CA    1 
ATOM   2968  C C     . ASP A  1 362 ? 9.122   41.063  7.422   1.00 40.33 ? 393  ASP A C     1 
ATOM   2969  O O     . ASP A  1 362 ? 8.988   41.727  6.397   1.00 40.08 ? 393  ASP A O     1 
ATOM   2970  C CB    . ASP A  1 362 ? 7.540   39.135  7.506   1.00 50.36 ? 393  ASP A CB    1 
ATOM   2971  C CG    . ASP A  1 362 ? 7.368   37.636  7.428   1.00 58.14 ? 393  ASP A CG    1 
ATOM   2972  O OD1   . ASP A  1 362 ? 7.068   37.022  8.476   1.00 62.76 ? 393  ASP A OD1   1 
ATOM   2973  O OD2   . ASP A  1 362 ? 7.538   37.076  6.321   1.00 62.15 ? 393  ASP A OD2   1 
ATOM   2974  N N     . THR A  1 363 ? 9.371   41.593  8.608   1.00 35.09 ? 394  THR A N     1 
ATOM   2975  C CA    . THR A  1 363 ? 9.557   43.018  8.790   1.00 33.60 ? 394  THR A CA    1 
ATOM   2976  C C     . THR A  1 363 ? 10.633  43.119  9.830   1.00 31.09 ? 394  THR A C     1 
ATOM   2977  O O     . THR A  1 363 ? 10.980  42.125  10.463  1.00 28.77 ? 394  THR A O     1 
ATOM   2978  C CB    . THR A  1 363 ? 8.321   43.718  9.340   1.00 33.17 ? 394  THR A CB    1 
ATOM   2979  O OG1   . THR A  1 363 ? 8.101   43.296  10.691  1.00 36.77 ? 394  THR A OG1   1 
ATOM   2980  C CG2   . THR A  1 363 ? 7.109   43.399  8.488   1.00 34.88 ? 394  THR A CG2   1 
ATOM   2981  N N     . PHE A  1 364 ? 11.162  44.319  10.009  1.00 30.02 ? 395  PHE A N     1 
ATOM   2982  C CA    . PHE A  1 364 ? 12.216  44.534  10.974  1.00 25.69 ? 395  PHE A CA    1 
ATOM   2983  C C     . PHE A  1 364 ? 11.710  45.568  11.923  1.00 28.49 ? 395  PHE A C     1 
ATOM   2984  O O     . PHE A  1 364 ? 11.609  46.747  11.596  1.00 27.31 ? 395  PHE A O     1 
ATOM   2985  C CB    . PHE A  1 364 ? 13.476  45.000  10.264  1.00 22.28 ? 395  PHE A CB    1 
ATOM   2986  C CG    . PHE A  1 364 ? 14.047  43.965  9.341   1.00 18.81 ? 395  PHE A CG    1 
ATOM   2987  C CD1   . PHE A  1 364 ? 13.840  44.059  7.962   1.00 15.86 ? 395  PHE A CD1   1 
ATOM   2988  C CD2   . PHE A  1 364 ? 14.760  42.873  9.851   1.00 10.51 ? 395  PHE A CD2   1 
ATOM   2989  C CE1   . PHE A  1 364 ? 14.335  43.076  7.103   1.00 17.29 ? 395  PHE A CE1   1 
ATOM   2990  C CE2   . PHE A  1 364 ? 15.255  41.891  9.008   1.00 8.02  ? 395  PHE A CE2   1 
ATOM   2991  C CZ    . PHE A  1 364 ? 15.046  41.985  7.628   1.00 12.24 ? 395  PHE A CZ    1 
ATOM   2992  N N     . ASN A  1 365 ? 11.365  45.102  13.107  1.00 28.40 ? 396  ASN A N     1 
ATOM   2993  C CA    . ASN A  1 365 ? 10.835  45.975  14.123  1.00 34.44 ? 396  ASN A CA    1 
ATOM   2994  C C     . ASN A  1 365 ? 11.912  46.535  15.029  1.00 34.87 ? 396  ASN A C     1 
ATOM   2995  O O     . ASN A  1 365 ? 12.457  45.846  15.892  1.00 35.60 ? 396  ASN A O     1 
ATOM   2996  C CB    . ASN A  1 365 ? 9.777   45.228  14.928  1.00 33.80 ? 396  ASN A CB    1 
ATOM   2997  C CG    . ASN A  1 365 ? 9.150   44.103  14.139  1.00 35.15 ? 396  ASN A CG    1 
ATOM   2998  O OD1   . ASN A  1 365 ? 8.746   43.093  14.703  1.00 34.45 ? 396  ASN A OD1   1 
ATOM   2999  N ND2   . ASN A  1 365 ? 9.078   44.268  12.822  1.00 36.48 ? 396  ASN A ND2   1 
ATOM   3000  N N     . ILE A  1 366 ? 12.217  47.804  14.803  1.00 38.00 ? 397  ILE A N     1 
ATOM   3001  C CA    . ILE A  1 366 ? 13.208  48.508  15.592  1.00 41.91 ? 397  ILE A CA    1 
ATOM   3002  C C     . ILE A  1 366 ? 12.413  49.443  16.471  1.00 43.73 ? 397  ILE A C     1 
ATOM   3003  O O     . ILE A  1 366 ? 11.867  50.430  15.986  1.00 43.98 ? 397  ILE A O     1 
ATOM   3004  C CB    . ILE A  1 366 ? 14.154  49.343  14.701  1.00 40.86 ? 397  ILE A CB    1 
ATOM   3005  C CG1   . ILE A  1 366 ? 14.624  48.507  13.509  1.00 40.40 ? 397  ILE A CG1   1 
ATOM   3006  C CG2   . ILE A  1 366 ? 15.352  49.810  15.510  1.00 38.65 ? 397  ILE A CG2   1 
ATOM   3007  C CD1   . ILE A  1 366 ? 15.426  47.283  13.896  1.00 35.61 ? 397  ILE A CD1   1 
ATOM   3008  N N     . GLU A  1 367 ? 12.334  49.128  17.759  1.00 50.20 ? 398  GLU A N     1 
ATOM   3009  C CA    . GLU A  1 367 ? 11.579  49.969  18.679  1.00 53.12 ? 398  GLU A CA    1 
ATOM   3010  C C     . GLU A  1 367 ? 10.130  49.943  18.201  1.00 55.24 ? 398  GLU A C     1 
ATOM   3011  O O     . GLU A  1 367 ? 9.572   48.870  17.945  1.00 55.07 ? 398  GLU A O     1 
ATOM   3012  C CB    . GLU A  1 367 ? 12.111  51.401  18.625  1.00 56.79 ? 398  GLU A CB    1 
ATOM   3013  C CG    . GLU A  1 367 ? 12.277  52.074  19.960  1.00 58.81 ? 398  GLU A CG    1 
ATOM   3014  C CD    . GLU A  1 367 ? 13.072  53.358  19.838  1.00 63.84 ? 398  GLU A CD    1 
ATOM   3015  O OE1   . GLU A  1 367 ? 13.332  53.787  18.689  1.00 63.14 ? 398  GLU A OE1   1 
ATOM   3016  O OE2   . GLU A  1 367 ? 13.440  53.938  20.885  1.00 64.28 ? 398  GLU A OE2   1 
ATOM   3017  N N     . ASP A  1 368 ? 9.533   51.126  18.066  1.00 54.85 ? 399  ASP A N     1 
ATOM   3018  C CA    . ASP A  1 368 ? 8.162   51.236  17.600  1.00 55.70 ? 399  ASP A CA    1 
ATOM   3019  C C     . ASP A  1 368 ? 8.085   50.671  16.199  1.00 55.34 ? 399  ASP A C     1 
ATOM   3020  O O     . ASP A  1 368 ? 7.533   49.599  15.978  1.00 58.36 ? 399  ASP A O     1 
ATOM   3021  C CB    . ASP A  1 368 ? 7.739   52.697  17.575  1.00 56.89 ? 399  ASP A CB    1 
ATOM   3022  C CG    . ASP A  1 368 ? 7.844   53.345  18.929  1.00 63.48 ? 399  ASP A CG    1 
ATOM   3023  O OD1   . ASP A  1 368 ? 8.133   52.618  19.906  1.00 63.57 ? 399  ASP A OD1   1 
ATOM   3024  O OD2   . ASP A  1 368 ? 7.636   54.572  19.019  1.00 65.60 ? 399  ASP A OD2   1 
ATOM   3025  N N     . GLN A  1 369 ? 8.664   51.412  15.263  1.00 52.68 ? 400  GLN A N     1 
ATOM   3026  C CA    . GLN A  1 369 ? 8.697   51.047  13.857  1.00 48.47 ? 400  GLN A CA    1 
ATOM   3027  C C     . GLN A  1 369 ? 8.777   49.570  13.495  1.00 45.71 ? 400  GLN A C     1 
ATOM   3028  O O     . GLN A  1 369 ? 9.092   48.701  14.307  1.00 43.55 ? 400  GLN A O     1 
ATOM   3029  C CB    . GLN A  1 369 ? 9.858   51.766  13.182  1.00 53.40 ? 400  GLN A CB    1 
ATOM   3030  C CG    . GLN A  1 369 ? 9.607   53.227  12.973  1.00 58.36 ? 400  GLN A CG    1 
ATOM   3031  C CD    . GLN A  1 369 ? 8.351   53.455  12.183  1.00 63.35 ? 400  GLN A CD    1 
ATOM   3032  O OE1   . GLN A  1 369 ? 7.964   52.615  11.364  1.00 60.90 ? 400  GLN A OE1   1 
ATOM   3033  N NE2   . GLN A  1 369 ? 7.697   54.590  12.418  1.00 64.28 ? 400  GLN A NE2   1 
ATOM   3034  N N     . GLU A  1 370 ? 8.471   49.317  12.232  1.00 41.27 ? 401  GLU A N     1 
ATOM   3035  C CA    . GLU A  1 370 ? 8.507   47.994  11.640  1.00 38.33 ? 401  GLU A CA    1 
ATOM   3036  C C     . GLU A  1 370 ? 8.940   48.309  10.217  1.00 34.18 ? 401  GLU A C     1 
ATOM   3037  O O     . GLU A  1 370 ? 8.396   49.235  9.589   1.00 31.25 ? 401  GLU A O     1 
ATOM   3038  C CB    . GLU A  1 370 ? 7.118   47.362  11.636  1.00 36.63 ? 401  GLU A CB    1 
ATOM   3039  C CG    . GLU A  1 370 ? 6.956   46.243  12.645  1.00 46.95 ? 401  GLU A CG    1 
ATOM   3040  C CD    . GLU A  1 370 ? 5.672   45.454  12.449  1.00 49.83 ? 401  GLU A CD    1 
ATOM   3041  O OE1   . GLU A  1 370 ? 5.406   45.047  11.300  1.00 51.50 ? 401  GLU A OE1   1 
ATOM   3042  O OE2   . GLU A  1 370 ? 4.931   45.241  13.437  1.00 48.82 ? 401  GLU A OE2   1 
ATOM   3043  N N     . TYR A  1 371 ? 9.922   47.569  9.709   1.00 29.03 ? 402  TYR A N     1 
ATOM   3044  C CA    . TYR A  1 371 ? 10.399  47.829  8.364   1.00 22.77 ? 402  TYR A CA    1 
ATOM   3045  C C     . TYR A  1 371 ? 10.274  46.647  7.436   1.00 19.77 ? 402  TYR A C     1 
ATOM   3046  O O     . TYR A  1 371 ? 10.103  45.506  7.852   1.00 19.46 ? 402  TYR A O     1 
ATOM   3047  C CB    . TYR A  1 371 ? 11.850  48.289  8.394   1.00 24.26 ? 402  TYR A CB    1 
ATOM   3048  C CG    . TYR A  1 371 ? 12.091  49.489  9.272   1.00 25.31 ? 402  TYR A CG    1 
ATOM   3049  C CD1   . TYR A  1 371 ? 12.053  50.776  8.741   1.00 22.38 ? 402  TYR A CD1   1 
ATOM   3050  C CD2   . TYR A  1 371 ? 12.382  49.338  10.632  1.00 24.52 ? 402  TYR A CD2   1 
ATOM   3051  C CE1   . TYR A  1 371 ? 12.305  51.888  9.536   1.00 23.95 ? 402  TYR A CE1   1 
ATOM   3052  C CE2   . TYR A  1 371 ? 12.635  50.444  11.441  1.00 26.13 ? 402  TYR A CE2   1 
ATOM   3053  C CZ    . TYR A  1 371 ? 12.599  51.721  10.883  1.00 25.45 ? 402  TYR A CZ    1 
ATOM   3054  O OH    . TYR A  1 371 ? 12.876  52.830  11.653  1.00 21.50 ? 402  TYR A OH    1 
ATOM   3055  N N     . SER A  1 372 ? 10.372  46.944  6.155   1.00 16.95 ? 403  SER A N     1 
ATOM   3056  C CA    . SER A  1 372 ? 10.281  45.920  5.142   1.00 18.47 ? 403  SER A CA    1 
ATOM   3057  C C     . SER A  1 372 ? 11.670  45.752  4.559   1.00 20.96 ? 403  SER A C     1 
ATOM   3058  O O     . SER A  1 372 ? 12.523  46.627  4.690   1.00 19.82 ? 403  SER A O     1 
ATOM   3059  C CB    . SER A  1 372 ? 9.324   46.357  4.039   1.00 15.52 ? 403  SER A CB    1 
ATOM   3060  O OG    . SER A  1 372 ? 9.921   47.349  3.234   1.00 2.00  ? 403  SER A OG    1 
ATOM   3061  N N     . PHE A  1 373 ? 11.904  44.619  3.922   1.00 24.50 ? 404  PHE A N     1 
ATOM   3062  C CA    . PHE A  1 373 ? 13.186  44.398  3.311   1.00 27.79 ? 404  PHE A CA    1 
ATOM   3063  C C     . PHE A  1 373 ? 13.397  45.611  2.425   1.00 32.03 ? 404  PHE A C     1 
ATOM   3064  O O     . PHE A  1 373 ? 14.399  46.304  2.538   1.00 34.73 ? 404  PHE A O     1 
ATOM   3065  C CB    . PHE A  1 373 ? 13.153  43.117  2.487   1.00 28.08 ? 404  PHE A CB    1 
ATOM   3066  C CG    . PHE A  1 373 ? 13.085  41.885  3.322   1.00 32.14 ? 404  PHE A CG    1 
ATOM   3067  C CD1   . PHE A  1 373 ? 12.265  41.840  4.450   1.00 34.68 ? 404  PHE A CD1   1 
ATOM   3068  C CD2   . PHE A  1 373 ? 13.860  40.777  3.012   1.00 35.29 ? 404  PHE A CD2   1 
ATOM   3069  C CE1   . PHE A  1 373 ? 12.221  40.705  5.264   1.00 34.20 ? 404  PHE A CE1   1 
ATOM   3070  C CE2   . PHE A  1 373 ? 13.825  39.632  3.820   1.00 35.81 ? 404  PHE A CE2   1 
ATOM   3071  C CZ    . PHE A  1 373 ? 13.004  39.597  4.949   1.00 34.97 ? 404  PHE A CZ    1 
ATOM   3072  N N     . LYS A  1 374 ? 12.425  45.877  1.566   1.00 34.54 ? 405  LYS A N     1 
ATOM   3073  C CA    . LYS A  1 374 ? 12.479  47.014  0.659   1.00 40.88 ? 405  LYS A CA    1 
ATOM   3074  C C     . LYS A  1 374 ? 12.885  48.282  1.409   1.00 42.86 ? 405  LYS A C     1 
ATOM   3075  O O     . LYS A  1 374 ? 13.498  49.189  0.842   1.00 44.49 ? 405  LYS A O     1 
ATOM   3076  C CB    . LYS A  1 374 ? 11.113  47.206  0.000   1.00 43.89 ? 405  LYS A CB    1 
ATOM   3077  C CG    . LYS A  1 374 ? 10.419  45.896  -0.363  1.00 46.99 ? 405  LYS A CG    1 
ATOM   3078  C CD    . LYS A  1 374 ? 9.636   45.326  0.816   1.00 50.29 ? 405  LYS A CD    1 
ATOM   3079  C CE    . LYS A  1 374 ? 10.031  43.880  1.136   1.00 53.13 ? 405  LYS A CE    1 
ATOM   3080  N NZ    . LYS A  1 374 ? 9.568   43.435  2.502   1.00 54.53 ? 405  LYS A NZ    1 
ATOM   3081  N N     . GLN A  1 375 ? 12.542  48.330  2.692   1.00 43.72 ? 406  GLN A N     1 
ATOM   3082  C CA    . GLN A  1 375 ? 12.865  49.470  3.544   1.00 44.14 ? 406  GLN A CA    1 
ATOM   3083  C C     . GLN A  1 375 ? 14.288  49.352  4.079   1.00 41.60 ? 406  GLN A C     1 
ATOM   3084  O O     . GLN A  1 375 ? 15.166  50.131  3.709   1.00 43.90 ? 406  GLN A O     1 
ATOM   3085  C CB    . GLN A  1 375 ? 11.890  49.544  4.726   1.00 49.93 ? 406  GLN A CB    1 
ATOM   3086  C CG    . GLN A  1 375 ? 10.443  49.835  4.351   1.00 52.57 ? 406  GLN A CG    1 
ATOM   3087  C CD    . GLN A  1 375 ? 9.571   50.033  5.569   1.00 57.01 ? 406  GLN A CD    1 
ATOM   3088  O OE1   . GLN A  1 375 ? 9.302   49.093  6.309   1.00 54.32 ? 406  GLN A OE1   1 
ATOM   3089  N NE2   . GLN A  1 375 ? 9.127   51.262  5.786   1.00 59.97 ? 406  GLN A NE2   1 
ATOM   3090  N N     . PHE A  1 376 ? 14.491  48.373  4.958   1.00 36.48 ? 407  PHE A N     1 
ATOM   3091  C CA    . PHE A  1 376 ? 15.780  48.089  5.594   1.00 33.72 ? 407  PHE A CA    1 
ATOM   3092  C C     . PHE A  1 376 ? 16.997  48.227  4.682   1.00 34.52 ? 407  PHE A C     1 
ATOM   3093  O O     . PHE A  1 376 ? 17.923  48.999  4.958   1.00 35.94 ? 407  PHE A O     1 
ATOM   3094  C CB    . PHE A  1 376 ? 15.766  46.668  6.151   1.00 29.41 ? 407  PHE A CB    1 
ATOM   3095  C CG    . PHE A  1 376 ? 16.285  46.555  7.548   1.00 25.94 ? 407  PHE A CG    1 
ATOM   3096  C CD1   . PHE A  1 376 ? 16.343  47.670  8.378   1.00 27.98 ? 407  PHE A CD1   1 
ATOM   3097  C CD2   . PHE A  1 376 ? 16.680  45.324  8.052   1.00 24.30 ? 407  PHE A CD2   1 
ATOM   3098  C CE1   . PHE A  1 376 ? 16.784  47.559  9.705   1.00 27.30 ? 407  PHE A CE1   1 
ATOM   3099  C CE2   . PHE A  1 376 ? 17.121  45.199  9.370   1.00 22.36 ? 407  PHE A CE2   1 
ATOM   3100  C CZ    . PHE A  1 376 ? 17.172  46.323  10.201  1.00 23.34 ? 407  PHE A CZ    1 
ATOM   3101  N N     . LEU A  1 377 ? 16.991  47.448  3.608   1.00 33.10 ? 408  LEU A N     1 
ATOM   3102  C CA    . LEU A  1 377 ? 18.071  47.438  2.644   1.00 32.34 ? 408  LEU A CA    1 
ATOM   3103  C C     . LEU A  1 377 ? 18.761  48.764  2.364   1.00 36.31 ? 408  LEU A C     1 
ATOM   3104  O O     . LEU A  1 377 ? 18.129  49.746  1.962   1.00 35.74 ? 408  LEU A O     1 
ATOM   3105  C CB    . LEU A  1 377 ? 17.570  46.846  1.334   1.00 28.15 ? 408  LEU A CB    1 
ATOM   3106  C CG    . LEU A  1 377 ? 17.506  45.318  1.326   1.00 26.55 ? 408  LEU A CG    1 
ATOM   3107  C CD1   . LEU A  1 377 ? 17.806  44.815  -0.073  1.00 26.17 ? 408  LEU A CD1   1 
ATOM   3108  C CD2   . LEU A  1 377 ? 18.506  44.734  2.318   1.00 25.71 ? 408  LEU A CD2   1 
ATOM   3109  N N     . TYR A  1 378 ? 20.076  48.755  2.570   1.00 41.23 ? 409  TYR A N     1 
ATOM   3110  C CA    . TYR A  1 378 ? 20.945  49.901  2.340   1.00 44.95 ? 409  TYR A CA    1 
ATOM   3111  C C     . TYR A  1 378 ? 20.500  51.160  3.052   1.00 45.52 ? 409  TYR A C     1 
ATOM   3112  O O     . TYR A  1 378 ? 20.890  52.260  2.672   1.00 44.47 ? 409  TYR A O     1 
ATOM   3113  C CB    . TYR A  1 378 ? 21.065  50.206  0.843   1.00 48.86 ? 409  TYR A CB    1 
ATOM   3114  C CG    . TYR A  1 378 ? 20.624  49.105  -0.102  1.00 55.21 ? 409  TYR A CG    1 
ATOM   3115  C CD1   . TYR A  1 378 ? 20.031  49.418  -1.324  1.00 56.53 ? 409  TYR A CD1   1 
ATOM   3116  C CD2   . TYR A  1 378 ? 20.843  47.757  0.197   1.00 57.90 ? 409  TYR A CD2   1 
ATOM   3117  C CE1   . TYR A  1 378 ? 19.673  48.422  -2.230  1.00 58.58 ? 409  TYR A CE1   1 
ATOM   3118  C CE2   . TYR A  1 378 ? 20.488  46.751  -0.701  1.00 58.63 ? 409  TYR A CE2   1 
ATOM   3119  C CZ    . TYR A  1 378 ? 19.907  47.088  -1.915  1.00 59.51 ? 409  TYR A CZ    1 
ATOM   3120  O OH    . TYR A  1 378 ? 19.587  46.096  -2.819  1.00 59.47 ? 409  TYR A OH    1 
ATOM   3121  N N     . ASN A  1 379 ? 19.688  51.015  4.086   1.00 47.58 ? 410  ASN A N     1 
ATOM   3122  C CA    . ASN A  1 379 ? 19.226  52.196  4.792   1.00 50.82 ? 410  ASN A CA    1 
ATOM   3123  C C     . ASN A  1 379 ? 19.873  52.309  6.144   1.00 50.04 ? 410  ASN A C     1 
ATOM   3124  O O     . ASN A  1 379 ? 19.216  52.164  7.166   1.00 49.89 ? 410  ASN A O     1 
ATOM   3125  C CB    . ASN A  1 379 ? 17.707  52.179  4.959   1.00 54.59 ? 410  ASN A CB    1 
ATOM   3126  C CG    . ASN A  1 379 ? 17.159  53.539  5.317   1.00 58.56 ? 410  ASN A CG    1 
ATOM   3127  O OD1   . ASN A  1 379 ? 17.743  54.250  6.142   1.00 56.92 ? 410  ASN A OD1   1 
ATOM   3128  N ND2   . ASN A  1 379 ? 16.043  53.903  4.688   1.00 64.51 ? 410  ASN A ND2   1 
ATOM   3129  N N     . ASN A  1 380 ? 21.168  52.573  6.154   1.00 50.54 ? 411  ASN A N     1 
ATOM   3130  C CA    . ASN A  1 380 ? 21.864  52.697  7.420   1.00 51.55 ? 411  ASN A CA    1 
ATOM   3131  C C     . ASN A  1 380 ? 21.362  53.945  8.132   1.00 48.52 ? 411  ASN A C     1 
ATOM   3132  O O     . ASN A  1 380 ? 21.601  54.139  9.325   1.00 45.45 ? 411  ASN A O     1 
ATOM   3133  C CB    . ASN A  1 380 ? 23.371  52.750  7.179   1.00 55.28 ? 411  ASN A CB    1 
ATOM   3134  C CG    . ASN A  1 380 ? 23.920  51.437  6.637   1.00 58.35 ? 411  ASN A CG    1 
ATOM   3135  O OD1   . ASN A  1 380 ? 25.096  51.344  6.282   1.00 61.20 ? 411  ASN A OD1   1 
ATOM   3136  N ND2   . ASN A  1 380 ? 23.064  50.413  6.570   1.00 60.23 ? 411  ASN A ND2   1 
ATOM   3137  N N     . SER A  1 381 ? 20.649  54.787  7.389   1.00 44.87 ? 412  SER A N     1 
ATOM   3138  C CA    . SER A  1 381 ? 20.080  55.996  7.964   1.00 39.29 ? 412  SER A CA    1 
ATOM   3139  C C     . SER A  1 381 ? 19.262  55.521  9.152   1.00 36.96 ? 412  SER A C     1 
ATOM   3140  O O     . SER A  1 381 ? 19.173  56.188  10.179  1.00 33.80 ? 412  SER A O     1 
ATOM   3141  C CB    . SER A  1 381 ? 19.177  56.695  6.950   1.00 34.56 ? 412  SER A CB    1 
ATOM   3142  O OG    . SER A  1 381 ? 19.304  58.098  7.057   1.00 30.41 ? 412  SER A OG    1 
ATOM   3143  N N     . ILE A  1 382 ? 18.666  54.345  8.982   1.00 34.87 ? 413  ILE A N     1 
ATOM   3144  C CA    . ILE A  1 382 ? 17.868  53.704  10.018  1.00 31.23 ? 413  ILE A CA    1 
ATOM   3145  C C     . ILE A  1 382 ? 18.743  53.603  11.256  1.00 31.54 ? 413  ILE A C     1 
ATOM   3146  O O     . ILE A  1 382 ? 18.452  54.205  12.283  1.00 29.68 ? 413  ILE A O     1 
ATOM   3147  C CB    . ILE A  1 382 ? 17.456  52.264  9.601   1.00 31.04 ? 413  ILE A CB    1 
ATOM   3148  C CG1   . ILE A  1 382 ? 16.446  52.311  8.450   1.00 31.59 ? 413  ILE A CG1   1 
ATOM   3149  C CG2   . ILE A  1 382 ? 16.883  51.509  10.792  1.00 27.97 ? 413  ILE A CG2   1 
ATOM   3150  C CD1   . ILE A  1 382 ? 16.164  50.933  7.811   1.00 30.23 ? 413  ILE A CD1   1 
ATOM   3151  N N     . LEU A  1 383 ? 19.820  52.831  11.135  1.00 31.36 ? 414  LEU A N     1 
ATOM   3152  C CA    . LEU A  1 383 ? 20.765  52.620  12.221  1.00 29.65 ? 414  LEU A CA    1 
ATOM   3153  C C     . LEU A  1 383 ? 21.063  53.920  12.939  1.00 29.41 ? 414  LEU A C     1 
ATOM   3154  O O     . LEU A  1 383 ? 20.905  54.024  14.151  1.00 27.32 ? 414  LEU A O     1 
ATOM   3155  C CB    . LEU A  1 383 ? 22.066  52.028  11.673  1.00 33.79 ? 414  LEU A CB    1 
ATOM   3156  C CG    . LEU A  1 383 ? 23.189  51.778  12.689  1.00 35.07 ? 414  LEU A CG    1 
ATOM   3157  C CD1   . LEU A  1 383 ? 22.588  51.218  13.980  1.00 34.33 ? 414  LEU A CD1   1 
ATOM   3158  C CD2   . LEU A  1 383 ? 24.223  50.811  12.099  1.00 35.28 ? 414  LEU A CD2   1 
ATOM   3159  N N     . LEU A  1 384 ? 21.496  54.907  12.168  1.00 30.46 ? 415  LEU A N     1 
ATOM   3160  C CA    . LEU A  1 384 ? 21.826  56.209  12.699  1.00 34.27 ? 415  LEU A CA    1 
ATOM   3161  C C     . LEU A  1 384 ? 20.657  56.807  13.451  1.00 40.01 ? 415  LEU A C     1 
ATOM   3162  O O     . LEU A  1 384 ? 20.807  57.363  14.535  1.00 37.82 ? 415  LEU A O     1 
ATOM   3163  C CB    . LEU A  1 384 ? 22.205  57.147  11.557  1.00 34.18 ? 415  LEU A CB    1 
ATOM   3164  C CG    . LEU A  1 384 ? 23.693  57.297  11.238  1.00 33.03 ? 415  LEU A CG    1 
ATOM   3165  C CD1   . LEU A  1 384 ? 23.921  58.631  10.549  1.00 31.58 ? 415  LEU A CD1   1 
ATOM   3166  C CD2   . LEU A  1 384 ? 24.515  57.203  12.518  1.00 32.31 ? 415  LEU A CD2   1 
ATOM   3167  N N     . GLU A  1 385 ? 19.485  56.690  12.849  1.00 46.92 ? 416  GLU A N     1 
ATOM   3168  C CA    . GLU A  1 385 ? 18.262  57.232  13.419  1.00 53.83 ? 416  GLU A CA    1 
ATOM   3169  C C     . GLU A  1 385 ? 17.952  56.756  14.839  1.00 52.75 ? 416  GLU A C     1 
ATOM   3170  O O     . GLU A  1 385 ? 17.853  57.566  15.762  1.00 53.34 ? 416  GLU A O     1 
ATOM   3171  C CB    . GLU A  1 385 ? 17.094  56.898  12.496  1.00 59.69 ? 416  GLU A CB    1 
ATOM   3172  C CG    . GLU A  1 385 ? 16.345  58.109  11.986  1.00 67.08 ? 416  GLU A CG    1 
ATOM   3173  C CD    . GLU A  1 385 ? 14.853  58.011  12.246  1.00 75.24 ? 416  GLU A CD    1 
ATOM   3174  O OE1   . GLU A  1 385 ? 14.212  57.099  11.678  1.00 78.10 ? 416  GLU A OE1   1 
ATOM   3175  O OE2   . GLU A  1 385 ? 14.322  58.840  13.020  1.00 75.79 ? 416  GLU A OE2   1 
ATOM   3176  N N     . HIS A  1 386 ? 17.807  55.445  15.008  1.00 50.61 ? 417  HIS A N     1 
ATOM   3177  C CA    . HIS A  1 386 ? 17.475  54.863  16.308  1.00 50.79 ? 417  HIS A CA    1 
ATOM   3178  C C     . HIS A  1 386 ? 18.632  54.745  17.293  1.00 47.56 ? 417  HIS A C     1 
ATOM   3179  O O     . HIS A  1 386 ? 18.456  54.962  18.488  1.00 48.95 ? 417  HIS A O     1 
ATOM   3180  C CB    . HIS A  1 386 ? 16.853  53.474  16.117  1.00 54.10 ? 417  HIS A CB    1 
ATOM   3181  C CG    . HIS A  1 386 ? 15.559  53.487  15.359  1.00 60.78 ? 417  HIS A CG    1 
ATOM   3182  N ND1   . HIS A  1 386 ? 15.364  54.251  14.229  1.00 61.85 ? 417  HIS A ND1   1 
ATOM   3183  C CD2   . HIS A  1 386 ? 14.394  52.827  15.571  1.00 61.03 ? 417  HIS A CD2   1 
ATOM   3184  C CE1   . HIS A  1 386 ? 14.137  54.063  13.777  1.00 60.22 ? 417  HIS A CE1   1 
ATOM   3185  N NE2   . HIS A  1 386 ? 13.529  53.203  14.573  1.00 61.73 ? 417  HIS A NE2   1 
ATOM   3186  N N     . GLY A  1 387 ? 19.811  54.390  16.798  1.00 43.83 ? 418  GLY A N     1 
ATOM   3187  C CA    . GLY A  1 387 ? 20.951  54.233  17.681  1.00 37.25 ? 418  GLY A CA    1 
ATOM   3188  C C     . GLY A  1 387 ? 21.242  52.765  17.930  1.00 34.12 ? 418  GLY A C     1 
ATOM   3189  O O     . GLY A  1 387 ? 20.350  51.915  17.876  1.00 32.29 ? 418  GLY A O     1 
ATOM   3190  N N     . LEU A  1 388 ? 22.502  52.468  18.212  1.00 33.25 ? 419  LEU A N     1 
ATOM   3191  C CA    . LEU A  1 388 ? 22.924  51.095  18.441  1.00 30.84 ? 419  LEU A CA    1 
ATOM   3192  C C     . LEU A  1 388 ? 22.174  50.429  19.576  1.00 29.70 ? 419  LEU A C     1 
ATOM   3193  O O     . LEU A  1 388 ? 21.691  49.307  19.438  1.00 26.45 ? 419  LEU A O     1 
ATOM   3194  C CB    . LEU A  1 388 ? 24.429  51.049  18.728  1.00 29.05 ? 419  LEU A CB    1 
ATOM   3195  C CG    . LEU A  1 388 ? 25.324  50.456  17.624  1.00 27.28 ? 419  LEU A CG    1 
ATOM   3196  C CD1   . LEU A  1 388 ? 25.274  48.933  17.668  1.00 23.60 ? 419  LEU A CD1   1 
ATOM   3197  C CD2   . LEU A  1 388 ? 24.872  50.959  16.261  1.00 25.75 ? 419  LEU A CD2   1 
ATOM   3198  N N     . THR A  1 389 ? 22.087  51.136  20.696  1.00 32.26 ? 420  THR A N     1 
ATOM   3199  C CA    . THR A  1 389 ? 21.417  50.640  21.895  1.00 29.96 ? 420  THR A CA    1 
ATOM   3200  C C     . THR A  1 389 ? 20.016  50.099  21.635  1.00 32.86 ? 420  THR A C     1 
ATOM   3201  O O     . THR A  1 389 ? 19.693  48.980  22.055  1.00 29.13 ? 420  THR A O     1 
ATOM   3202  C CB    . THR A  1 389 ? 21.322  51.744  22.943  1.00 27.20 ? 420  THR A CB    1 
ATOM   3203  O OG1   . THR A  1 389 ? 21.947  52.929  22.437  1.00 24.35 ? 420  THR A OG1   1 
ATOM   3204  C CG2   . THR A  1 389 ? 22.014  51.315  24.206  1.00 26.93 ? 420  THR A CG2   1 
ATOM   3205  N N     . GLN A  1 390 ? 19.186  50.896  20.956  1.00 33.28 ? 421  GLN A N     1 
ATOM   3206  C CA    . GLN A  1 390 ? 17.826  50.466  20.645  1.00 33.91 ? 421  GLN A CA    1 
ATOM   3207  C C     . GLN A  1 390 ? 17.960  49.220  19.804  1.00 29.64 ? 421  GLN A C     1 
ATOM   3208  O O     . GLN A  1 390 ? 17.534  48.138  20.203  1.00 28.45 ? 421  GLN A O     1 
ATOM   3209  C CB    . GLN A  1 390 ? 17.073  51.545  19.870  1.00 42.04 ? 421  GLN A CB    1 
ATOM   3210  C CG    . GLN A  1 390 ? 16.108  52.370  20.732  1.00 57.58 ? 421  GLN A CG    1 
ATOM   3211  C CD    . GLN A  1 390 ? 15.162  51.515  21.569  1.00 67.50 ? 421  GLN A CD    1 
ATOM   3212  O OE1   . GLN A  1 390 ? 14.720  50.447  21.138  1.00 70.85 ? 421  GLN A OE1   1 
ATOM   3213  N NE2   . GLN A  1 390 ? 14.846  51.988  22.774  1.00 72.69 ? 421  GLN A NE2   1 
ATOM   3214  N N     . PHE A  1 391 ? 18.578  49.388  18.643  1.00 24.62 ? 422  PHE A N     1 
ATOM   3215  C CA    . PHE A  1 391 ? 18.825  48.289  17.720  1.00 21.94 ? 422  PHE A CA    1 
ATOM   3216  C C     . PHE A  1 391 ? 19.074  46.996  18.458  1.00 21.53 ? 422  PHE A C     1 
ATOM   3217  O O     . PHE A  1 391 ? 18.470  45.969  18.156  1.00 22.46 ? 422  PHE A O     1 
ATOM   3218  C CB    . PHE A  1 391 ? 20.048  48.589  16.891  1.00 14.41 ? 422  PHE A CB    1 
ATOM   3219  C CG    . PHE A  1 391 ? 19.735  48.966  15.503  1.00 9.22  ? 422  PHE A CG    1 
ATOM   3220  C CD1   . PHE A  1 391 ? 19.454  50.296  15.182  1.00 7.27  ? 422  PHE A CD1   1 
ATOM   3221  C CD2   . PHE A  1 391 ? 19.750  47.998  14.499  1.00 2.39  ? 422  PHE A CD2   1 
ATOM   3222  C CE1   . PHE A  1 391 ? 19.195  50.655  13.869  1.00 11.29 ? 422  PHE A CE1   1 
ATOM   3223  C CE2   . PHE A  1 391 ? 19.498  48.331  13.181  1.00 2.00  ? 422  PHE A CE2   1 
ATOM   3224  C CZ    . PHE A  1 391 ? 19.219  49.662  12.856  1.00 12.40 ? 422  PHE A CZ    1 
ATOM   3225  N N     . VAL A  1 392 ? 19.996  47.061  19.413  1.00 23.82 ? 423  VAL A N     1 
ATOM   3226  C CA    . VAL A  1 392 ? 20.348  45.914  20.231  1.00 23.25 ? 423  VAL A CA    1 
ATOM   3227  C C     . VAL A  1 392 ? 19.062  45.407  20.843  1.00 20.68 ? 423  VAL A C     1 
ATOM   3228  O O     . VAL A  1 392 ? 18.518  44.401  20.400  1.00 20.63 ? 423  VAL A O     1 
ATOM   3229  C CB    . VAL A  1 392 ? 21.297  46.310  21.376  1.00 25.67 ? 423  VAL A CB    1 
ATOM   3230  C CG1   . VAL A  1 392 ? 21.692  45.073  22.175  1.00 24.75 ? 423  VAL A CG1   1 
ATOM   3231  C CG2   . VAL A  1 392 ? 22.524  47.027  20.818  1.00 22.34 ? 423  VAL A CG2   1 
ATOM   3232  N N     . GLU A  1 393 ? 18.587  46.121  21.860  1.00 21.13 ? 424  GLU A N     1 
ATOM   3233  C CA    . GLU A  1 393 ? 17.352  45.777  22.558  1.00 21.78 ? 424  GLU A CA    1 
ATOM   3234  C C     . GLU A  1 393 ? 16.309  45.203  21.598  1.00 21.07 ? 424  GLU A C     1 
ATOM   3235  O O     . GLU A  1 393 ? 15.887  44.040  21.734  1.00 17.38 ? 424  GLU A O     1 
ATOM   3236  C CB    . GLU A  1 393 ? 16.797  47.025  23.247  1.00 22.44 ? 424  GLU A CB    1 
ATOM   3237  C CG    . GLU A  1 393 ? 17.724  47.567  24.325  1.00 24.73 ? 424  GLU A CG    1 
ATOM   3238  C CD    . GLU A  1 393 ? 17.298  48.926  24.851  1.00 29.02 ? 424  GLU A CD    1 
ATOM   3239  O OE1   . GLU A  1 393 ? 16.973  49.803  24.018  1.00 28.10 ? 424  GLU A OE1   1 
ATOM   3240  O OE2   . GLU A  1 393 ? 17.286  49.115  26.095  1.00 27.58 ? 424  GLU A OE2   1 
ATOM   3241  N N     . SER A  1 394 ? 15.906  46.028  20.630  1.00 18.85 ? 425  SER A N     1 
ATOM   3242  C CA    . SER A  1 394 ? 14.931  45.623  19.629  1.00 19.80 ? 425  SER A CA    1 
ATOM   3243  C C     . SER A  1 394 ? 15.268  44.251  19.065  1.00 21.21 ? 425  SER A C     1 
ATOM   3244  O O     . SER A  1 394 ? 14.550  43.280  19.295  1.00 22.86 ? 425  SER A O     1 
ATOM   3245  C CB    . SER A  1 394 ? 14.896  46.648  18.506  1.00 19.58 ? 425  SER A CB    1 
ATOM   3246  O OG    . SER A  1 394 ? 14.728  47.947  19.042  1.00 19.04 ? 425  SER A OG    1 
ATOM   3247  N N     . PHE A  1 395 ? 16.372  44.176  18.335  1.00 23.35 ? 426  PHE A N     1 
ATOM   3248  C CA    . PHE A  1 395 ? 16.806  42.922  17.748  1.00 24.66 ? 426  PHE A CA    1 
ATOM   3249  C C     . PHE A  1 395 ? 16.949  41.802  18.771  1.00 23.37 ? 426  PHE A C     1 
ATOM   3250  O O     . PHE A  1 395 ? 16.814  40.624  18.447  1.00 23.89 ? 426  PHE A O     1 
ATOM   3251  C CB    . PHE A  1 395 ? 18.131  43.133  17.029  1.00 32.63 ? 426  PHE A CB    1 
ATOM   3252  C CG    . PHE A  1 395 ? 17.992  43.789  15.683  1.00 37.18 ? 426  PHE A CG    1 
ATOM   3253  C CD1   . PHE A  1 395 ? 16.778  43.750  15.000  1.00 36.56 ? 426  PHE A CD1   1 
ATOM   3254  C CD2   . PHE A  1 395 ? 19.079  44.421  15.083  1.00 37.73 ? 426  PHE A CD2   1 
ATOM   3255  C CE1   . PHE A  1 395 ? 16.648  44.324  13.740  1.00 39.20 ? 426  PHE A CE1   1 
ATOM   3256  C CE2   . PHE A  1 395 ? 18.963  44.998  13.825  1.00 38.16 ? 426  PHE A CE2   1 
ATOM   3257  C CZ    . PHE A  1 395 ? 17.744  44.951  13.149  1.00 39.86 ? 426  PHE A CZ    1 
ATOM   3258  N N     . THR A  1 396 ? 17.213  42.172  20.017  1.00 24.69 ? 427  THR A N     1 
ATOM   3259  C CA    . THR A  1 396 ? 17.383  41.182  21.073  1.00 23.31 ? 427  THR A CA    1 
ATOM   3260  C C     . THR A  1 396 ? 16.096  40.422  21.334  1.00 23.84 ? 427  THR A C     1 
ATOM   3261  O O     . THR A  1 396 ? 16.105  39.427  22.061  1.00 24.00 ? 427  THR A O     1 
ATOM   3262  C CB    . THR A  1 396 ? 17.813  41.819  22.414  1.00 21.82 ? 427  THR A CB    1 
ATOM   3263  O OG1   . THR A  1 396 ? 18.859  42.775  22.194  1.00 19.40 ? 427  THR A OG1   1 
ATOM   3264  C CG2   . THR A  1 396 ? 18.293  40.730  23.374  1.00 16.42 ? 427  THR A CG2   1 
ATOM   3265  N N     . ARG A  1 397 ? 14.990  40.895  20.762  1.00 25.55 ? 428  ARG A N     1 
ATOM   3266  C CA    . ARG A  1 397 ? 13.706  40.226  20.970  1.00 29.19 ? 428  ARG A CA    1 
ATOM   3267  C C     . ARG A  1 397 ? 13.013  39.738  19.695  1.00 23.89 ? 428  ARG A C     1 
ATOM   3268  O O     . ARG A  1 397 ? 12.512  38.610  19.670  1.00 26.08 ? 428  ARG A O     1 
ATOM   3269  C CB    . ARG A  1 397 ? 12.750  41.128  21.767  1.00 30.94 ? 428  ARG A CB    1 
ATOM   3270  C CG    . ARG A  1 397 ? 12.488  42.478  21.139  1.00 43.28 ? 428  ARG A CG    1 
ATOM   3271  C CD    . ARG A  1 397 ? 11.948  43.466  22.167  1.00 49.00 ? 428  ARG A CD    1 
ATOM   3272  N NE    . ARG A  1 397 ? 12.023  44.846  21.690  1.00 55.20 ? 428  ARG A NE    1 
ATOM   3273  C CZ    . ARG A  1 397 ? 12.145  45.907  22.482  1.00 60.28 ? 428  ARG A CZ    1 
ATOM   3274  N NH1   . ARG A  1 397 ? 12.204  45.747  23.796  1.00 60.93 ? 428  ARG A NH1   1 
ATOM   3275  N NH2   . ARG A  1 397 ? 12.221  47.129  21.963  1.00 58.60 ? 428  ARG A NH2   1 
ATOM   3276  N N     . GLN A  1 398 ? 12.996  40.557  18.643  1.00 15.45 ? 429  GLN A N     1 
ATOM   3277  C CA    . GLN A  1 398 ? 12.334  40.155  17.408  1.00 12.40 ? 429  GLN A CA    1 
ATOM   3278  C C     . GLN A  1 398 ? 12.700  38.755  16.905  1.00 10.06 ? 429  GLN A C     1 
ATOM   3279  O O     . GLN A  1 398 ? 13.536  38.611  16.032  1.00 9.53  ? 429  GLN A O     1 
ATOM   3280  C CB    . GLN A  1 398 ? 12.607  41.157  16.292  1.00 9.25  ? 429  GLN A CB    1 
ATOM   3281  C CG    . GLN A  1 398 ? 12.098  40.631  14.950  1.00 7.96  ? 429  GLN A CG    1 
ATOM   3282  C CD    . GLN A  1 398 ? 11.889  41.715  13.944  1.00 9.27  ? 429  GLN A CD    1 
ATOM   3283  O OE1   . GLN A  1 398 ? 12.110  42.893  14.227  1.00 11.97 ? 429  GLN A OE1   1 
ATOM   3284  N NE2   . GLN A  1 398 ? 11.462  41.329  12.752  1.00 2.00  ? 429  GLN A NE2   1 
ATOM   3285  N N     . ILE A  1 399 ? 12.042  37.734  17.443  1.00 10.46 ? 430  ILE A N     1 
ATOM   3286  C CA    . ILE A  1 399 ? 12.284  36.344  17.063  1.00 9.22  ? 430  ILE A CA    1 
ATOM   3287  C C     . ILE A  1 399 ? 12.516  36.162  15.566  1.00 10.14 ? 430  ILE A C     1 
ATOM   3288  O O     . ILE A  1 399 ? 11.949  36.865  14.735  1.00 11.76 ? 430  ILE A O     1 
ATOM   3289  C CB    . ILE A  1 399 ? 11.102  35.461  17.450  1.00 11.77 ? 430  ILE A CB    1 
ATOM   3290  C CG1   . ILE A  1 399 ? 11.266  34.053  16.853  1.00 10.71 ? 430  ILE A CG1   1 
ATOM   3291  C CG2   . ILE A  1 399 ? 9.828   36.091  16.918  1.00 8.90  ? 430  ILE A CG2   1 
ATOM   3292  C CD1   . ILE A  1 399 ? 11.579  32.971  17.868  1.00 5.77  ? 430  ILE A CD1   1 
ATOM   3293  N N     . ALA A  1 400 ? 13.340  35.182  15.238  1.00 9.09  ? 431  ALA A N     1 
ATOM   3294  C CA    . ALA A  1 400 ? 13.677  34.880  13.862  1.00 13.09 ? 431  ALA A CA    1 
ATOM   3295  C C     . ALA A  1 400 ? 12.976  33.593  13.450  1.00 14.12 ? 431  ALA A C     1 
ATOM   3296  O O     . ALA A  1 400 ? 12.665  32.730  14.287  1.00 13.67 ? 431  ALA A O     1 
ATOM   3297  C CB    . ALA A  1 400 ? 15.190  34.718  13.717  1.00 14.50 ? 431  ALA A CB    1 
ATOM   3298  N N     . GLY A  1 401 ? 12.756  33.461  12.148  1.00 16.82 ? 432  GLY A N     1 
ATOM   3299  C CA    . GLY A  1 401 ? 12.069  32.297  11.635  1.00 17.89 ? 432  GLY A CA    1 
ATOM   3300  C C     . GLY A  1 401 ? 12.814  30.991  11.756  1.00 20.47 ? 432  GLY A C     1 
ATOM   3301  O O     . GLY A  1 401 ? 14.022  30.944  11.562  1.00 21.33 ? 432  GLY A O     1 
ATOM   3302  N N     . ARG A  1 402 ? 12.080  29.934  12.094  1.00 20.16 ? 433  ARG A N     1 
ATOM   3303  C CA    . ARG A  1 402 ? 12.639  28.595  12.194  1.00 21.13 ? 433  ARG A CA    1 
ATOM   3304  C C     . ARG A  1 402 ? 13.196  28.296  10.803  1.00 22.29 ? 433  ARG A C     1 
ATOM   3305  O O     . ARG A  1 402 ? 12.818  28.944  9.827   1.00 19.50 ? 433  ARG A O     1 
ATOM   3306  C CB    . ARG A  1 402 ? 11.540  27.593  12.544  1.00 23.83 ? 433  ARG A CB    1 
ATOM   3307  C CG    . ARG A  1 402 ? 12.047  26.299  13.125  1.00 26.01 ? 433  ARG A CG    1 
ATOM   3308  C CD    . ARG A  1 402 ? 11.305  25.092  12.561  1.00 29.41 ? 433  ARG A CD    1 
ATOM   3309  N NE    . ARG A  1 402 ? 11.562  23.895  13.361  1.00 33.68 ? 433  ARG A NE    1 
ATOM   3310  C CZ    . ARG A  1 402 ? 10.846  23.540  14.422  1.00 37.20 ? 433  ARG A CZ    1 
ATOM   3311  N NH1   . ARG A  1 402 ? 9.821   24.290  14.811  1.00 41.44 ? 433  ARG A NH1   1 
ATOM   3312  N NH2   . ARG A  1 402 ? 11.172  22.455  15.116  1.00 38.57 ? 433  ARG A NH2   1 
ATOM   3313  N N     . VAL A  1 403 ? 14.068  27.303  10.692  1.00 23.02 ? 434  VAL A N     1 
ATOM   3314  C CA    . VAL A  1 403 ? 14.669  27.033  9.401   1.00 23.59 ? 434  VAL A CA    1 
ATOM   3315  C C     . VAL A  1 403 ? 14.516  25.630  8.830   1.00 25.97 ? 434  VAL A C     1 
ATOM   3316  O O     . VAL A  1 403 ? 14.474  25.455  7.610   1.00 26.57 ? 434  VAL A O     1 
ATOM   3317  C CB    . VAL A  1 403 ? 16.162  27.407  9.450   1.00 25.24 ? 434  VAL A CB    1 
ATOM   3318  C CG1   . VAL A  1 403 ? 16.839  27.009  8.168   1.00 26.63 ? 434  VAL A CG1   1 
ATOM   3319  C CG2   . VAL A  1 403 ? 16.312  28.905  9.677   1.00 23.06 ? 434  VAL A CG2   1 
ATOM   3320  N N     . ALA A  1 404 ? 14.434  24.627  9.689   1.00 26.33 ? 435  ALA A N     1 
ATOM   3321  C CA    . ALA A  1 404 ? 14.300  23.256  9.198   1.00 32.34 ? 435  ALA A CA    1 
ATOM   3322  C C     . ALA A  1 404 ? 12.852  22.817  8.935   1.00 32.30 ? 435  ALA A C     1 
ATOM   3323  O O     . ALA A  1 404 ? 12.606  21.944  8.101   1.00 34.21 ? 435  ALA A O     1 
ATOM   3324  C CB    . ALA A  1 404 ? 14.975  22.283  10.174  1.00 34.39 ? 435  ALA A CB    1 
ATOM   3325  N N     . GLY A  1 405 ? 11.903  23.430  9.637   1.00 30.55 ? 436  GLY A N     1 
ATOM   3326  C CA    . GLY A  1 405 ? 10.501  23.076  9.476   1.00 32.60 ? 436  GLY A CA    1 
ATOM   3327  C C     . GLY A  1 405 ? 9.996   22.853  8.060   1.00 33.77 ? 436  GLY A C     1 
ATOM   3328  O O     . GLY A  1 405 ? 9.409   21.807  7.754   1.00 32.02 ? 436  GLY A O     1 
ATOM   3329  N N     . GLY A  1 406 ? 10.211  23.836  7.190   1.00 30.62 ? 437  GLY A N     1 
ATOM   3330  C CA    . GLY A  1 406 ? 9.751   23.713  5.822   1.00 30.73 ? 437  GLY A CA    1 
ATOM   3331  C C     . GLY A  1 406 ? 9.037   24.978  5.399   1.00 31.51 ? 437  GLY A C     1 
ATOM   3332  O O     . GLY A  1 406 ? 8.575   25.751  6.246   1.00 31.10 ? 437  GLY A O     1 
ATOM   3333  N N     . ARG A  1 407 ? 8.963   25.192  4.085   1.00 29.18 ? 438  ARG A N     1 
ATOM   3334  C CA    . ARG A  1 407 ? 8.313   26.368  3.506   1.00 25.38 ? 438  ARG A CA    1 
ATOM   3335  C C     . ARG A  1 407 ? 8.321   27.606  4.412   1.00 21.73 ? 438  ARG A C     1 
ATOM   3336  O O     . ARG A  1 407 ? 7.271   28.113  4.782   1.00 21.96 ? 438  ARG A O     1 
ATOM   3337  C CB    . ARG A  1 407 ? 6.873   26.030  3.126   1.00 27.23 ? 438  ARG A CB    1 
ATOM   3338  C CG    . ARG A  1 407 ? 6.490   24.588  3.402   1.00 33.82 ? 438  ARG A CG    1 
ATOM   3339  C CD    . ARG A  1 407 ? 5.023   24.332  3.077   1.00 38.88 ? 438  ARG A CD    1 
ATOM   3340  N NE    . ARG A  1 407 ? 4.854   23.328  2.028   1.00 47.94 ? 438  ARG A NE    1 
ATOM   3341  C CZ    . ARG A  1 407 ? 3.690   22.771  1.708   1.00 51.67 ? 438  ARG A CZ    1 
ATOM   3342  N NH1   . ARG A  1 407 ? 2.588   23.123  2.361   1.00 53.18 ? 438  ARG A NH1   1 
ATOM   3343  N NH2   . ARG A  1 407 ? 3.627   21.860  0.739   1.00 53.70 ? 438  ARG A NH2   1 
ATOM   3344  N N     . ASN A  1 408 ? 9.504   28.090  4.769   1.00 19.52 ? 439  ASN A N     1 
ATOM   3345  C CA    . ASN A  1 408 ? 9.602   29.265  5.619   1.00 16.14 ? 439  ASN A CA    1 
ATOM   3346  C C     . ASN A  1 408 ? 10.608  30.294  5.093   1.00 16.63 ? 439  ASN A C     1 
ATOM   3347  O O     . ASN A  1 408 ? 11.235  31.035  5.873   1.00 10.52 ? 439  ASN A O     1 
ATOM   3348  C CB    . ASN A  1 408 ? 9.981   28.870  7.041   1.00 14.37 ? 439  ASN A CB    1 
ATOM   3349  C CG    . ASN A  1 408 ? 9.677   29.974  8.052   1.00 18.09 ? 439  ASN A CG    1 
ATOM   3350  O OD1   . ASN A  1 408 ? 8.892   30.889  7.774   1.00 19.41 ? 439  ASN A OD1   1 
ATOM   3351  N ND2   . ASN A  1 408 ? 10.294  29.893  9.228   1.00 16.89 ? 439  ASN A ND2   1 
ATOM   3352  N N     . VAL A  1 409 ? 10.735  30.354  3.767   1.00 11.65 ? 440  VAL A N     1 
ATOM   3353  C CA    . VAL A  1 409 ? 11.659  31.284  3.136   1.00 7.53  ? 440  VAL A CA    1 
ATOM   3354  C C     . VAL A  1 409 ? 11.008  32.575  2.642   1.00 11.02 ? 440  VAL A C     1 
ATOM   3355  O O     . VAL A  1 409 ? 10.193  32.559  1.713   1.00 9.64  ? 440  VAL A O     1 
ATOM   3356  C CB    . VAL A  1 409 ? 12.351  30.636  1.943   1.00 9.93  ? 440  VAL A CB    1 
ATOM   3357  C CG1   . VAL A  1 409 ? 13.344  31.618  1.335   1.00 4.67  ? 440  VAL A CG1   1 
ATOM   3358  C CG2   . VAL A  1 409 ? 13.026  29.347  2.374   1.00 7.87  ? 440  VAL A CG2   1 
ATOM   3359  N N     . PRO A  1 410 ? 11.355  33.711  3.271   1.00 10.57 ? 441  PRO A N     1 
ATOM   3360  C CA    . PRO A  1 410 ? 10.803  35.008  2.876   1.00 9.30  ? 441  PRO A CA    1 
ATOM   3361  C C     . PRO A  1 410 ? 10.732  35.119  1.355   1.00 11.66 ? 441  PRO A C     1 
ATOM   3362  O O     . PRO A  1 410 ? 11.584  34.601  0.642   1.00 11.81 ? 441  PRO A O     1 
ATOM   3363  C CB    . PRO A  1 410 ? 11.778  36.001  3.480   1.00 9.51  ? 441  PRO A CB    1 
ATOM   3364  C CG    . PRO A  1 410 ? 12.262  35.309  4.726   1.00 11.12 ? 441  PRO A CG    1 
ATOM   3365  C CD    . PRO A  1 410 ? 12.269  33.827  4.422   1.00 9.70  ? 441  PRO A CD    1 
ATOM   3366  N N     . ILE A  1 411 ? 9.704   35.792  0.860   1.00 15.84 ? 442  ILE A N     1 
ATOM   3367  C CA    . ILE A  1 411 ? 9.517   35.928  -0.578  1.00 14.54 ? 442  ILE A CA    1 
ATOM   3368  C C     . ILE A  1 411 ? 10.508  36.935  -1.151  1.00 13.05 ? 442  ILE A C     1 
ATOM   3369  O O     . ILE A  1 411 ? 10.909  36.837  -2.313  1.00 12.54 ? 442  ILE A O     1 
ATOM   3370  C CB    . ILE A  1 411 ? 8.041   36.342  -0.895  1.00 17.27 ? 442  ILE A CB    1 
ATOM   3371  C CG1   . ILE A  1 411 ? 7.101   35.161  -0.604  1.00 14.68 ? 442  ILE A CG1   1 
ATOM   3372  C CG2   . ILE A  1 411 ? 7.890   36.747  -2.350  1.00 14.99 ? 442  ILE A CG2   1 
ATOM   3373  C CD1   . ILE A  1 411 ? 6.985   34.809  0.888   1.00 18.93 ? 442  ILE A CD1   1 
ATOM   3374  N N     . ALA A  1 412 ? 10.907  37.908  -0.342  1.00 13.82 ? 443  ALA A N     1 
ATOM   3375  C CA    . ALA A  1 412 ? 11.865  38.884  -0.820  1.00 15.40 ? 443  ALA A CA    1 
ATOM   3376  C C     . ALA A  1 412 ? 13.120  38.092  -1.150  1.00 16.44 ? 443  ALA A C     1 
ATOM   3377  O O     . ALA A  1 412 ? 13.730  38.267  -2.201  1.00 20.14 ? 443  ALA A O     1 
ATOM   3378  C CB    . ALA A  1 412 ? 12.142  39.910  0.259   1.00 15.09 ? 443  ALA A CB    1 
ATOM   3379  N N     . VAL A  1 413 ? 13.467  37.185  -0.246  1.00 16.23 ? 444  VAL A N     1 
ATOM   3380  C CA    . VAL A  1 413 ? 14.639  36.317  -0.378  1.00 18.86 ? 444  VAL A CA    1 
ATOM   3381  C C     . VAL A  1 413 ? 14.491  35.291  -1.517  1.00 19.90 ? 444  VAL A C     1 
ATOM   3382  O O     . VAL A  1 413 ? 15.410  34.518  -1.816  1.00 20.89 ? 444  VAL A O     1 
ATOM   3383  C CB    . VAL A  1 413 ? 14.876  35.590  0.975   1.00 17.58 ? 444  VAL A CB    1 
ATOM   3384  C CG1   . VAL A  1 413 ? 15.641  34.286  0.786   1.00 16.68 ? 444  VAL A CG1   1 
ATOM   3385  C CG2   . VAL A  1 413 ? 15.615  36.518  1.908   1.00 14.03 ? 444  VAL A CG2   1 
ATOM   3386  N N     . GLN A  1 414 ? 13.324  35.306  -2.148  1.00 22.06 ? 445  GLN A N     1 
ATOM   3387  C CA    . GLN A  1 414 ? 13.013  34.402  -3.246  1.00 23.78 ? 445  GLN A CA    1 
ATOM   3388  C C     . GLN A  1 414 ? 14.223  34.081  -4.100  1.00 23.45 ? 445  GLN A C     1 
ATOM   3389  O O     . GLN A  1 414 ? 14.779  32.969  -4.029  1.00 25.16 ? 445  GLN A O     1 
ATOM   3390  C CB    . GLN A  1 414 ? 11.945  35.022  -4.135  1.00 24.65 ? 445  GLN A CB    1 
ATOM   3391  C CG    . GLN A  1 414 ? 10.708  34.162  -4.330  1.00 24.34 ? 445  GLN A CG    1 
ATOM   3392  C CD    . GLN A  1 414 ? 9.993   34.494  -5.618  1.00 23.10 ? 445  GLN A CD    1 
ATOM   3393  O OE1   . GLN A  1 414 ? 9.548   33.603  -6.335  1.00 25.06 ? 445  GLN A OE1   1 
ATOM   3394  N NE2   . GLN A  1 414 ? 9.892   35.787  -5.926  1.00 21.78 ? 445  GLN A NE2   1 
ATOM   3395  N N     . ALA A  1 415 ? 14.622  35.069  -4.902  1.00 22.95 ? 446  ALA A N     1 
ATOM   3396  C CA    . ALA A  1 415 ? 15.765  34.944  -5.807  1.00 18.73 ? 446  ALA A CA    1 
ATOM   3397  C C     . ALA A  1 415 ? 16.896  34.133  -5.210  1.00 17.23 ? 446  ALA A C     1 
ATOM   3398  O O     . ALA A  1 415 ? 17.307  33.112  -5.761  1.00 18.04 ? 446  ALA A O     1 
ATOM   3399  C CB    . ALA A  1 415 ? 16.271  36.310  -6.173  1.00 20.06 ? 446  ALA A CB    1 
ATOM   3400  N N     . VAL A  1 416 ? 17.386  34.603  -4.071  1.00 14.68 ? 447  VAL A N     1 
ATOM   3401  C CA    . VAL A  1 416 ? 18.482  33.956  -3.384  1.00 13.33 ? 447  VAL A CA    1 
ATOM   3402  C C     . VAL A  1 416 ? 18.284  32.453  -3.255  1.00 14.95 ? 447  VAL A C     1 
ATOM   3403  O O     . VAL A  1 416 ? 18.917  31.670  -3.972  1.00 17.58 ? 447  VAL A O     1 
ATOM   3404  C CB    . VAL A  1 416 ? 18.672  34.571  -1.994  1.00 9.86  ? 447  VAL A CB    1 
ATOM   3405  C CG1   . VAL A  1 416 ? 19.469  33.650  -1.120  1.00 10.96 ? 447  VAL A CG1   1 
ATOM   3406  C CG2   . VAL A  1 416 ? 19.380  35.900  -2.122  1.00 5.93  ? 447  VAL A CG2   1 
ATOM   3407  N N     . ALA A  1 417 ? 17.403  32.052  -2.343  1.00 13.86 ? 448  ALA A N     1 
ATOM   3408  C CA    . ALA A  1 417 ? 17.147  30.637  -2.096  1.00 12.53 ? 448  ALA A CA    1 
ATOM   3409  C C     . ALA A  1 417 ? 17.092  29.819  -3.363  1.00 12.34 ? 448  ALA A C     1 
ATOM   3410  O O     . ALA A  1 417 ? 17.494  28.661  -3.358  1.00 12.44 ? 448  ALA A O     1 
ATOM   3411  C CB    . ALA A  1 417 ? 15.861  30.469  -1.327  1.00 14.23 ? 448  ALA A CB    1 
ATOM   3412  N N     . LYS A  1 418 ? 16.584  30.403  -4.443  1.00 12.11 ? 449  LYS A N     1 
ATOM   3413  C CA    . LYS A  1 418 ? 16.518  29.661  -5.701  1.00 12.82 ? 449  LYS A CA    1 
ATOM   3414  C C     . LYS A  1 418 ? 17.934  29.385  -6.126  1.00 14.11 ? 449  LYS A C     1 
ATOM   3415  O O     . LYS A  1 418 ? 18.324  28.236  -6.369  1.00 11.31 ? 449  LYS A O     1 
ATOM   3416  C CB    . LYS A  1 418 ? 15.829  30.466  -6.802  1.00 15.22 ? 449  LYS A CB    1 
ATOM   3417  C CG    . LYS A  1 418 ? 15.371  29.588  -7.982  1.00 16.13 ? 449  LYS A CG    1 
ATOM   3418  C CD    . LYS A  1 418 ? 15.251  30.367  -9.289  1.00 14.72 ? 449  LYS A CD    1 
ATOM   3419  C CE    . LYS A  1 418 ? 14.795  29.460  -10.418 1.00 15.11 ? 449  LYS A CE    1 
ATOM   3420  N NZ    . LYS A  1 418 ? 15.674  29.603  -11.610 1.00 16.82 ? 449  LYS A NZ    1 
ATOM   3421  N N     . ALA A  1 419 ? 18.701  30.465  -6.217  1.00 13.96 ? 450  ALA A N     1 
ATOM   3422  C CA    . ALA A  1 419 ? 20.097  30.358  -6.591  1.00 12.41 ? 450  ALA A CA    1 
ATOM   3423  C C     . ALA A  1 419 ? 20.669  29.212  -5.755  1.00 10.26 ? 450  ALA A C     1 
ATOM   3424  O O     . ALA A  1 419 ? 21.091  28.200  -6.302  1.00 4.68  ? 450  ALA A O     1 
ATOM   3425  C CB    . ALA A  1 419 ? 20.826  31.675  -6.297  1.00 3.55  ? 450  ALA A CB    1 
ATOM   3426  N N     . SER A  1 420 ? 20.625  29.367  -4.434  1.00 8.69  ? 451  SER A N     1 
ATOM   3427  C CA    . SER A  1 420 ? 21.146  28.357  -3.522  1.00 11.02 ? 451  SER A CA    1 
ATOM   3428  C C     . SER A  1 420 ? 20.933  26.960  -4.077  1.00 17.93 ? 451  SER A C     1 
ATOM   3429  O O     . SER A  1 420 ? 21.757  26.074  -3.867  1.00 20.92 ? 451  SER A O     1 
ATOM   3430  C CB    . SER A  1 420 ? 20.491  28.482  -2.148  1.00 9.34  ? 451  SER A CB    1 
ATOM   3431  O OG    . SER A  1 420 ? 20.346  29.844  -1.772  1.00 4.03  ? 451  SER A OG    1 
ATOM   3432  N N     . ILE A  1 421 ? 19.830  26.760  -4.787  1.00 22.77 ? 452  ILE A N     1 
ATOM   3433  C CA    . ILE A  1 421 ? 19.564  25.461  -5.396  1.00 27.46 ? 452  ILE A CA    1 
ATOM   3434  C C     . ILE A  1 421 ? 20.243  25.368  -6.758  1.00 26.15 ? 452  ILE A C     1 
ATOM   3435  O O     . ILE A  1 421 ? 21.002  24.437  -7.014  1.00 28.37 ? 452  ILE A O     1 
ATOM   3436  C CB    . ILE A  1 421 ? 18.079  25.225  -5.629  1.00 31.03 ? 452  ILE A CB    1 
ATOM   3437  C CG1   . ILE A  1 421 ? 17.294  25.547  -4.363  1.00 31.32 ? 452  ILE A CG1   1 
ATOM   3438  C CG2   . ILE A  1 421 ? 17.860  23.789  -6.078  1.00 31.64 ? 452  ILE A CG2   1 
ATOM   3439  C CD1   . ILE A  1 421 ? 16.190  26.550  -4.611  1.00 30.81 ? 452  ILE A CD1   1 
ATOM   3440  N N     . ASP A  1 422 ? 19.945  26.327  -7.631  1.00 27.90 ? 453  ASP A N     1 
ATOM   3441  C CA    . ASP A  1 422 ? 20.542  26.366  -8.959  1.00 30.26 ? 453  ASP A CA    1 
ATOM   3442  C C     . ASP A  1 422 ? 22.046  26.068  -8.856  1.00 30.51 ? 453  ASP A C     1 
ATOM   3443  O O     . ASP A  1 422 ? 22.555  25.146  -9.503  1.00 27.63 ? 453  ASP A O     1 
ATOM   3444  C CB    . ASP A  1 422 ? 20.344  27.752  -9.585  1.00 35.91 ? 453  ASP A CB    1 
ATOM   3445  C CG    . ASP A  1 422 ? 18.899  28.233  -9.524  1.00 41.81 ? 453  ASP A CG    1 
ATOM   3446  O OD1   . ASP A  1 422 ? 18.680  29.401  -9.121  1.00 42.42 ? 453  ASP A OD1   1 
ATOM   3447  O OD2   . ASP A  1 422 ? 17.990  27.449  -9.888  1.00 41.73 ? 453  ASP A OD2   1 
ATOM   3448  N N     . GLN A  1 423 ? 22.740  26.858  -8.032  1.00 26.05 ? 454  GLN A N     1 
ATOM   3449  C CA    . GLN A  1 423 ? 24.180  26.724  -7.806  1.00 19.31 ? 454  GLN A CA    1 
ATOM   3450  C C     . GLN A  1 423 ? 24.637  25.302  -7.561  1.00 17.30 ? 454  GLN A C     1 
ATOM   3451  O O     . GLN A  1 423 ? 25.276  24.679  -8.414  1.00 18.62 ? 454  GLN A O     1 
ATOM   3452  C CB    . GLN A  1 423 ? 24.595  27.564  -6.618  1.00 19.47 ? 454  GLN A CB    1 
ATOM   3453  C CG    . GLN A  1 423 ? 23.888  28.883  -6.561  1.00 23.31 ? 454  GLN A CG    1 
ATOM   3454  C CD    . GLN A  1 423 ? 24.825  30.026  -6.249  1.00 25.47 ? 454  GLN A CD    1 
ATOM   3455  O OE1   . GLN A  1 423 ? 25.530  30.517  -7.139  1.00 25.81 ? 454  GLN A OE1   1 
ATOM   3456  N NE2   . GLN A  1 423 ? 24.841  30.465  -4.983  1.00 22.03 ? 454  GLN A NE2   1 
ATOM   3457  N N     . SER A  1 424 ? 24.318  24.795  -6.380  1.00 14.59 ? 455  SER A N     1 
ATOM   3458  C CA    . SER A  1 424 ? 24.713  23.442  -6.018  1.00 14.01 ? 455  SER A CA    1 
ATOM   3459  C C     . SER A  1 424 ? 24.613  22.524  -7.224  1.00 12.66 ? 455  SER A C     1 
ATOM   3460  O O     . SER A  1 424 ? 25.408  21.604  -7.389  1.00 12.25 ? 455  SER A O     1 
ATOM   3461  C CB    . SER A  1 424 ? 23.821  22.917  -4.887  1.00 13.52 ? 455  SER A CB    1 
ATOM   3462  O OG    . SER A  1 424 ? 22.824  23.868  -4.549  1.00 14.05 ? 455  SER A OG    1 
ATOM   3463  N N     . ARG A  1 425 ? 23.631  22.799  -8.073  1.00 10.80 ? 456  ARG A N     1 
ATOM   3464  C CA    . ARG A  1 425 ? 23.414  21.996  -9.257  1.00 12.45 ? 456  ARG A CA    1 
ATOM   3465  C C     . ARG A  1 425 ? 24.568  22.201  -10.217 1.00 12.28 ? 456  ARG A C     1 
ATOM   3466  O O     . ARG A  1 425 ? 25.136  21.229  -10.724 1.00 6.75  ? 456  ARG A O     1 
ATOM   3467  C CB    . ARG A  1 425 ? 22.076  22.368  -9.909  1.00 13.57 ? 456  ARG A CB    1 
ATOM   3468  C CG    . ARG A  1 425 ? 20.872  21.577  -9.367  1.00 16.40 ? 456  ARG A CG    1 
ATOM   3469  C CD    . ARG A  1 425 ? 19.578  22.413  -9.348  1.00 22.66 ? 456  ARG A CD    1 
ATOM   3470  N NE    . ARG A  1 425 ? 18.509  21.748  -8.603  1.00 24.73 ? 456  ARG A NE    1 
ATOM   3471  C CZ    . ARG A  1 425 ? 17.394  21.273  -9.148  1.00 25.35 ? 456  ARG A CZ    1 
ATOM   3472  N NH1   . ARG A  1 425 ? 17.192  21.387  -10.449 1.00 27.99 ? 456  ARG A NH1   1 
ATOM   3473  N NH2   . ARG A  1 425 ? 16.487  20.673  -8.393  1.00 25.13 ? 456  ARG A NH2   1 
ATOM   3474  N N     . GLU A  1 426 ? 24.914  23.465  -10.462 1.00 14.56 ? 457  GLU A N     1 
ATOM   3475  C CA    . GLU A  1 426 ? 26.025  23.784  -11.350 1.00 19.38 ? 457  GLU A CA    1 
ATOM   3476  C C     . GLU A  1 426 ? 27.255  23.083  -10.802 1.00 20.38 ? 457  GLU A C     1 
ATOM   3477  O O     . GLU A  1 426 ? 27.941  22.352  -11.522 1.00 20.64 ? 457  GLU A O     1 
ATOM   3478  C CB    . GLU A  1 426 ? 26.298  25.275  -11.383 1.00 23.78 ? 457  GLU A CB    1 
ATOM   3479  C CG    . GLU A  1 426 ? 25.172  26.143  -10.939 1.00 35.00 ? 457  GLU A CG    1 
ATOM   3480  C CD    . GLU A  1 426 ? 25.572  27.602  -10.900 1.00 43.67 ? 457  GLU A CD    1 
ATOM   3481  O OE1   . GLU A  1 426 ? 26.230  28.059  -11.860 1.00 43.81 ? 457  GLU A OE1   1 
ATOM   3482  O OE2   . GLU A  1 426 ? 25.233  28.292  -9.910  1.00 46.77 ? 457  GLU A OE2   1 
ATOM   3483  N N     . MET A  1 427 ? 27.528  23.310  -9.517  1.00 17.22 ? 458  MET A N     1 
ATOM   3484  C CA    . MET A  1 427 ? 28.662  22.679  -8.851  1.00 11.83 ? 458  MET A CA    1 
ATOM   3485  C C     . MET A  1 427 ? 28.438  21.173  -8.723  1.00 11.16 ? 458  MET A C     1 
ATOM   3486  O O     . MET A  1 427 ? 28.979  20.532  -7.829  1.00 9.58  ? 458  MET A O     1 
ATOM   3487  C CB    . MET A  1 427 ? 28.835  23.237  -7.452  1.00 12.83 ? 458  MET A CB    1 
ATOM   3488  C CG    . MET A  1 427 ? 28.950  24.735  -7.333  1.00 13.63 ? 458  MET A CG    1 
ATOM   3489  S SD    . MET A  1 427 ? 28.948  25.123  -5.551  1.00 25.80 ? 458  MET A SD    1 
ATOM   3490  C CE    . MET A  1 427 ? 30.033  26.520  -5.495  1.00 11.70 ? 458  MET A CE    1 
ATOM   3491  N N     . LYS A  1 428 ? 27.636  20.613  -9.612  1.00 10.93 ? 459  LYS A N     1 
ATOM   3492  C CA    . LYS A  1 428 ? 27.348  19.196  -9.582  1.00 15.45 ? 459  LYS A CA    1 
ATOM   3493  C C     . LYS A  1 428 ? 27.387  18.597  -8.186  1.00 12.52 ? 459  LYS A C     1 
ATOM   3494  O O     . LYS A  1 428 ? 27.952  17.525  -8.003  1.00 13.10 ? 459  LYS A O     1 
ATOM   3495  C CB    . LYS A  1 428 ? 28.327  18.435  -10.474 1.00 24.68 ? 459  LYS A CB    1 
ATOM   3496  C CG    . LYS A  1 428 ? 28.563  19.097  -11.807 1.00 32.15 ? 459  LYS A CG    1 
ATOM   3497  C CD    . LYS A  1 428 ? 27.451  18.767  -12.792 1.00 39.17 ? 459  LYS A CD    1 
ATOM   3498  C CE    . LYS A  1 428 ? 27.122  19.971  -13.676 1.00 45.48 ? 459  LYS A CE    1 
ATOM   3499  N NZ    . LYS A  1 428 ? 26.674  19.559  -15.035 1.00 52.14 ? 459  LYS A NZ    1 
ATOM   3500  N N     . TYR A  1 429 ? 26.794  19.277  -7.208  1.00 10.91 ? 460  TYR A N     1 
ATOM   3501  C CA    . TYR A  1 429 ? 26.764  18.759  -5.838  1.00 13.17 ? 460  TYR A CA    1 
ATOM   3502  C C     . TYR A  1 429 ? 26.258  17.328  -5.881  1.00 13.46 ? 460  TYR A C     1 
ATOM   3503  O O     . TYR A  1 429 ? 25.685  16.904  -6.880  1.00 15.91 ? 460  TYR A O     1 
ATOM   3504  C CB    . TYR A  1 429 ? 25.824  19.583  -4.970  1.00 10.17 ? 460  TYR A CB    1 
ATOM   3505  C CG    . TYR A  1 429 ? 26.516  20.536  -4.037  1.00 10.07 ? 460  TYR A CG    1 
ATOM   3506  C CD1   . TYR A  1 429 ? 27.044  21.741  -4.503  1.00 16.89 ? 460  TYR A CD1   1 
ATOM   3507  C CD2   . TYR A  1 429 ? 26.611  20.260  -2.684  1.00 13.85 ? 460  TYR A CD2   1 
ATOM   3508  C CE1   . TYR A  1 429 ? 27.650  22.656  -3.635  1.00 14.29 ? 460  TYR A CE1   1 
ATOM   3509  C CE2   . TYR A  1 429 ? 27.212  21.159  -1.803  1.00 15.09 ? 460  TYR A CE2   1 
ATOM   3510  C CZ    . TYR A  1 429 ? 27.727  22.353  -2.285  1.00 19.09 ? 460  TYR A CZ    1 
ATOM   3511  O OH    . TYR A  1 429 ? 28.315  23.237  -1.409  1.00 19.43 ? 460  TYR A OH    1 
ATOM   3512  N N     . GLN A  1 430 ? 26.460  16.579  -4.807  1.00 14.99 ? 461  GLN A N     1 
ATOM   3513  C CA    . GLN A  1 430 ? 25.997  15.195  -4.795  1.00 22.91 ? 461  GLN A CA    1 
ATOM   3514  C C     . GLN A  1 430 ? 24.608  15.037  -4.163  1.00 24.68 ? 461  GLN A C     1 
ATOM   3515  O O     . GLN A  1 430 ? 23.974  16.027  -3.761  1.00 24.11 ? 461  GLN A O     1 
ATOM   3516  C CB    . GLN A  1 430 ? 27.008  14.309  -4.065  1.00 25.59 ? 461  GLN A CB    1 
ATOM   3517  C CG    . GLN A  1 430 ? 28.036  13.682  -4.985  1.00 32.95 ? 461  GLN A CG    1 
ATOM   3518  C CD    . GLN A  1 430 ? 28.879  12.626  -4.292  1.00 37.33 ? 461  GLN A CD    1 
ATOM   3519  O OE1   . GLN A  1 430 ? 28.358  11.786  -3.554  1.00 37.61 ? 461  GLN A OE1   1 
ATOM   3520  N NE2   . GLN A  1 430 ? 30.192  12.661  -4.531  1.00 38.70 ? 461  GLN A NE2   1 
ATOM   3521  N N     . SER A  1 431 ? 24.136  13.793  -4.087  1.00 25.99 ? 462  SER A N     1 
ATOM   3522  C CA    . SER A  1 431 ? 22.831  13.514  -3.508  1.00 26.80 ? 462  SER A CA    1 
ATOM   3523  C C     . SER A  1 431 ? 22.855  13.788  -2.011  1.00 28.14 ? 462  SER A C     1 
ATOM   3524  O O     . SER A  1 431 ? 23.902  13.654  -1.369  1.00 28.68 ? 462  SER A O     1 
ATOM   3525  C CB    . SER A  1 431 ? 22.446  12.056  -3.770  1.00 27.03 ? 462  SER A CB    1 
ATOM   3526  O OG    . SER A  1 431 ? 22.164  11.369  -2.563  1.00 27.72 ? 462  SER A OG    1 
ATOM   3527  N N     . LEU A  1 432 ? 21.707  14.179  -1.460  1.00 30.43 ? 463  LEU A N     1 
ATOM   3528  C CA    . LEU A  1 432 ? 21.611  14.466  -0.033  1.00 32.30 ? 463  LEU A CA    1 
ATOM   3529  C C     . LEU A  1 432 ? 21.855  13.201  0.782   1.00 30.91 ? 463  LEU A C     1 
ATOM   3530  O O     . LEU A  1 432 ? 22.298  13.264  1.925   1.00 28.78 ? 463  LEU A O     1 
ATOM   3531  C CB    . LEU A  1 432 ? 20.234  15.032  0.319   1.00 35.63 ? 463  LEU A CB    1 
ATOM   3532  C CG    . LEU A  1 432 ? 19.943  14.923  1.819   1.00 41.33 ? 463  LEU A CG    1 
ATOM   3533  C CD1   . LEU A  1 432 ? 19.860  16.312  2.425   1.00 38.61 ? 463  LEU A CD1   1 
ATOM   3534  C CD2   . LEU A  1 432 ? 18.665  14.134  2.045   1.00 40.01 ? 463  LEU A CD2   1 
ATOM   3535  N N     . ASN A  1 433 ? 21.550  12.052  0.194   1.00 28.30 ? 464  ASN A N     1 
ATOM   3536  C CA    . ASN A  1 433 ? 21.758  10.789  0.878   1.00 28.36 ? 464  ASN A CA    1 
ATOM   3537  C C     . ASN A  1 433 ? 23.262  10.536  0.865   1.00 24.97 ? 464  ASN A C     1 
ATOM   3538  O O     . ASN A  1 433 ? 23.816  9.900   1.759   1.00 25.24 ? 464  ASN A O     1 
ATOM   3539  C CB    . ASN A  1 433 ? 21.007  9.659   0.156   1.00 32.62 ? 464  ASN A CB    1 
ATOM   3540  C CG    . ASN A  1 433 ? 19.544  9.546   0.597   1.00 35.95 ? 464  ASN A CG    1 
ATOM   3541  O OD1   . ASN A  1 433 ? 18.651  9.350   -0.232  1.00 36.72 ? 464  ASN A OD1   1 
ATOM   3542  N ND2   . ASN A  1 433 ? 19.295  9.669   1.903   1.00 34.26 ? 464  ASN A ND2   1 
ATOM   3543  N N     . GLU A  1 434 ? 23.925  11.044  -0.165  1.00 23.42 ? 465  GLU A N     1 
ATOM   3544  C CA    . GLU A  1 434 ? 25.359  10.889  -0.263  1.00 19.81 ? 465  GLU A CA    1 
ATOM   3545  C C     . GLU A  1 434 ? 25.962  11.679  0.890   1.00 20.88 ? 465  GLU A C     1 
ATOM   3546  O O     . GLU A  1 434 ? 26.617  11.109  1.768   1.00 19.02 ? 465  GLU A O     1 
ATOM   3547  C CB    . GLU A  1 434 ? 25.856  11.431  -1.602  1.00 17.78 ? 465  GLU A CB    1 
ATOM   3548  C CG    . GLU A  1 434 ? 25.310  10.690  -2.817  1.00 16.67 ? 465  GLU A CG    1 
ATOM   3549  C CD    . GLU A  1 434 ? 25.577  9.187   -2.771  1.00 15.49 ? 465  GLU A CD    1 
ATOM   3550  O OE1   . GLU A  1 434 ? 25.781  8.574   -3.844  1.00 17.25 ? 465  GLU A OE1   1 
ATOM   3551  O OE2   . GLU A  1 434 ? 25.577  8.613   -1.669  1.00 10.32 ? 465  GLU A OE2   1 
ATOM   3552  N N     . TYR A  1 435 ? 25.711  12.988  0.896   1.00 17.90 ? 466  TYR A N     1 
ATOM   3553  C CA    . TYR A  1 435 ? 26.232  13.852  1.942   1.00 18.84 ? 466  TYR A CA    1 
ATOM   3554  C C     . TYR A  1 435 ? 25.802  13.384  3.319   1.00 19.73 ? 466  TYR A C     1 
ATOM   3555  O O     . TYR A  1 435 ? 26.392  13.748  4.327   1.00 22.02 ? 466  TYR A O     1 
ATOM   3556  C CB    . TYR A  1 435 ? 25.769  15.279  1.712   1.00 19.74 ? 466  TYR A CB    1 
ATOM   3557  C CG    . TYR A  1 435 ? 26.521  15.968  0.593   1.00 28.71 ? 466  TYR A CG    1 
ATOM   3558  C CD1   . TYR A  1 435 ? 27.819  16.458  0.797   1.00 28.61 ? 466  TYR A CD1   1 
ATOM   3559  C CD2   . TYR A  1 435 ? 25.950  16.120  -0.678  1.00 25.95 ? 466  TYR A CD2   1 
ATOM   3560  C CE1   . TYR A  1 435 ? 28.527  17.075  -0.235  1.00 24.87 ? 466  TYR A CE1   1 
ATOM   3561  C CE2   . TYR A  1 435 ? 26.652  16.736  -1.716  1.00 23.83 ? 466  TYR A CE2   1 
ATOM   3562  C CZ    . TYR A  1 435 ? 27.940  17.210  -1.490  1.00 26.61 ? 466  TYR A CZ    1 
ATOM   3563  O OH    . TYR A  1 435 ? 28.648  17.798  -2.522  1.00 26.71 ? 466  TYR A OH    1 
ATOM   3564  N N     . ARG A  1 436 ? 24.758  12.572  3.358   1.00 19.89 ? 467  ARG A N     1 
ATOM   3565  C CA    . ARG A  1 436 ? 24.255  12.049  4.622   1.00 18.33 ? 467  ARG A CA    1 
ATOM   3566  C C     . ARG A  1 436 ? 25.186  10.915  4.997   1.00 17.88 ? 467  ARG A C     1 
ATOM   3567  O O     . ARG A  1 436 ? 25.783  10.913  6.073   1.00 19.00 ? 467  ARG A O     1 
ATOM   3568  C CB    . ARG A  1 436 ? 22.825  11.502  4.459   1.00 17.07 ? 467  ARG A CB    1 
ATOM   3569  C CG    . ARG A  1 436 ? 21.714  12.441  4.931   1.00 19.96 ? 467  ARG A CG    1 
ATOM   3570  C CD    . ARG A  1 436 ? 20.371  11.706  5.002   1.00 21.64 ? 467  ARG A CD    1 
ATOM   3571  N NE    . ARG A  1 436 ? 20.203  10.997  6.268   1.00 18.83 ? 467  ARG A NE    1 
ATOM   3572  C CZ    . ARG A  1 436 ? 20.144  11.602  7.450   1.00 15.91 ? 467  ARG A CZ    1 
ATOM   3573  N NH1   . ARG A  1 436 ? 20.239  12.932  7.510   1.00 2.00  ? 467  ARG A NH1   1 
ATOM   3574  N NH2   . ARG A  1 436 ? 20.003  10.877  8.562   1.00 12.56 ? 467  ARG A NH2   1 
ATOM   3575  N N     . LYS A  1 437 ? 25.289  9.957   4.080   1.00 15.08 ? 468  LYS A N     1 
ATOM   3576  C CA    . LYS A  1 437 ? 26.132  8.787   4.237   1.00 16.31 ? 468  LYS A CA    1 
ATOM   3577  C C     . LYS A  1 437 ? 27.531  9.262   4.630   1.00 19.09 ? 468  LYS A C     1 
ATOM   3578  O O     . LYS A  1 437 ? 28.148  8.741   5.571   1.00 16.98 ? 468  LYS A O     1 
ATOM   3579  C CB    . LYS A  1 437 ? 26.206  8.034   2.910   1.00 10.21 ? 468  LYS A CB    1 
ATOM   3580  C CG    . LYS A  1 437 ? 25.108  7.015   2.698   1.00 6.40  ? 468  LYS A CG    1 
ATOM   3581  C CD    . LYS A  1 437 ? 25.447  6.069   1.542   1.00 8.96  ? 468  LYS A CD    1 
ATOM   3582  C CE    . LYS A  1 437 ? 25.771  6.840   0.261   1.00 10.86 ? 468  LYS A CE    1 
ATOM   3583  N NZ    . LYS A  1 437 ? 26.111  5.998   -0.941  1.00 7.70  ? 468  LYS A NZ    1 
ATOM   3584  N N     . ARG A  1 438 ? 28.005  10.266  3.889   1.00 21.47 ? 469  ARG A N     1 
ATOM   3585  C CA    . ARG A  1 438 ? 29.315  10.864  4.085   1.00 17.82 ? 469  ARG A CA    1 
ATOM   3586  C C     . ARG A  1 438 ? 29.570  11.056  5.553   1.00 17.20 ? 469  ARG A C     1 
ATOM   3587  O O     . ARG A  1 438 ? 30.525  10.510  6.093   1.00 20.71 ? 469  ARG A O     1 
ATOM   3588  C CB    . ARG A  1 438 ? 29.385  12.217  3.381   1.00 19.87 ? 469  ARG A CB    1 
ATOM   3589  C CG    . ARG A  1 438 ? 30.793  12.788  3.159   1.00 24.52 ? 469  ARG A CG    1 
ATOM   3590  C CD    . ARG A  1 438 ? 31.897  11.895  3.722   1.00 27.78 ? 469  ARG A CD    1 
ATOM   3591  N NE    . ARG A  1 438 ? 32.673  12.583  4.752   1.00 27.91 ? 469  ARG A NE    1 
ATOM   3592  C CZ    . ARG A  1 438 ? 33.616  13.484  4.493   1.00 27.56 ? 469  ARG A CZ    1 
ATOM   3593  N NH1   . ARG A  1 438 ? 33.904  13.805  3.234   1.00 28.45 ? 469  ARG A NH1   1 
ATOM   3594  N NH2   . ARG A  1 438 ? 34.265  14.064  5.493   1.00 25.89 ? 469  ARG A NH2   1 
ATOM   3595  N N     . PHE A  1 439 ? 28.710  11.821  6.210   1.00 15.57 ? 470  PHE A N     1 
ATOM   3596  C CA    . PHE A  1 439 ? 28.902  12.067  7.629   1.00 14.12 ? 470  PHE A CA    1 
ATOM   3597  C C     . PHE A  1 439 ? 28.310  10.987  8.498   1.00 14.39 ? 470  PHE A C     1 
ATOM   3598  O O     . PHE A  1 439 ? 27.779  11.256  9.565   1.00 15.42 ? 470  PHE A O     1 
ATOM   3599  C CB    . PHE A  1 439 ? 28.349  13.431  7.997   1.00 9.80  ? 470  PHE A CB    1 
ATOM   3600  C CG    . PHE A  1 439 ? 29.096  14.558  7.351   1.00 6.51  ? 470  PHE A CG    1 
ATOM   3601  C CD1   . PHE A  1 439 ? 29.649  15.576  8.126   1.00 7.30  ? 470  PHE A CD1   1 
ATOM   3602  C CD2   . PHE A  1 439 ? 29.244  14.613  5.964   1.00 2.00  ? 470  PHE A CD2   1 
ATOM   3603  C CE1   . PHE A  1 439 ? 30.339  16.649  7.523   1.00 5.61  ? 470  PHE A CE1   1 
ATOM   3604  C CE2   . PHE A  1 439 ? 29.925  15.665  5.356   1.00 2.00  ? 470  PHE A CE2   1 
ATOM   3605  C CZ    . PHE A  1 439 ? 30.476  16.693  6.132   1.00 2.00  ? 470  PHE A CZ    1 
ATOM   3606  N N     . SER A  1 440 ? 28.434  9.751   8.025   1.00 17.59 ? 471  SER A N     1 
ATOM   3607  C CA    . SER A  1 440 ? 27.946  8.571   8.728   1.00 20.79 ? 471  SER A CA    1 
ATOM   3608  C C     . SER A  1 440 ? 26.518  8.735   9.246   1.00 23.60 ? 471  SER A C     1 
ATOM   3609  O O     . SER A  1 440 ? 26.236  8.541   10.439  1.00 20.71 ? 471  SER A O     1 
ATOM   3610  C CB    . SER A  1 440 ? 28.895  8.222   9.885   1.00 22.15 ? 471  SER A CB    1 
ATOM   3611  O OG    . SER A  1 440 ? 29.736  9.320   10.235  1.00 20.49 ? 471  SER A OG    1 
ATOM   3612  N N     . LEU A  1 441 ? 25.627  9.099   8.330   1.00 23.31 ? 472  LEU A N     1 
ATOM   3613  C CA    . LEU A  1 441 ? 24.222  9.281   8.641   1.00 23.94 ? 472  LEU A CA    1 
ATOM   3614  C C     . LEU A  1 441 ? 23.441  8.281   7.815   1.00 27.71 ? 472  LEU A C     1 
ATOM   3615  O O     . LEU A  1 441 ? 23.686  8.145   6.622   1.00 28.50 ? 472  LEU A O     1 
ATOM   3616  C CB    . LEU A  1 441 ? 23.776  10.697  8.278   1.00 22.70 ? 472  LEU A CB    1 
ATOM   3617  C CG    . LEU A  1 441 ? 24.421  11.840  9.065   1.00 25.52 ? 472  LEU A CG    1 
ATOM   3618  C CD1   . LEU A  1 441 ? 23.886  13.162  8.553   1.00 27.75 ? 472  LEU A CD1   1 
ATOM   3619  C CD2   . LEU A  1 441 ? 24.133  11.677  10.561  1.00 24.38 ? 472  LEU A CD2   1 
ATOM   3620  N N     . LYS A  1 442 ? 22.519  7.563   8.448   1.00 31.10 ? 473  LYS A N     1 
ATOM   3621  C CA    . LYS A  1 442 ? 21.697  6.606   7.725   1.00 31.08 ? 473  LYS A CA    1 
ATOM   3622  C C     . LYS A  1 442 ? 20.934  7.467   6.737   1.00 31.45 ? 473  LYS A C     1 
ATOM   3623  O O     . LYS A  1 442 ? 20.364  8.498   7.114   1.00 31.51 ? 473  LYS A O     1 
ATOM   3624  C CB    . LYS A  1 442 ? 20.715  5.925   8.674   1.00 36.81 ? 473  LYS A CB    1 
ATOM   3625  C CG    . LYS A  1 442 ? 21.380  5.111   9.762   1.00 44.12 ? 473  LYS A CG    1 
ATOM   3626  C CD    . LYS A  1 442 ? 21.800  3.747   9.226   1.00 51.72 ? 473  LYS A CD    1 
ATOM   3627  C CE    . LYS A  1 442 ? 22.645  2.985   10.233  1.00 54.79 ? 473  LYS A CE    1 
ATOM   3628  N NZ    . LYS A  1 442 ? 21.843  2.535   11.406  1.00 58.43 ? 473  LYS A NZ    1 
ATOM   3629  N N     . PRO A  1 443 ? 20.911  7.068   5.460   1.00 31.37 ? 474  PRO A N     1 
ATOM   3630  C CA    . PRO A  1 443 ? 20.185  7.881   4.474   1.00 26.10 ? 474  PRO A CA    1 
ATOM   3631  C C     . PRO A  1 443 ? 18.655  7.835   4.665   1.00 29.71 ? 474  PRO A C     1 
ATOM   3632  O O     . PRO A  1 443 ? 18.110  6.890   5.263   1.00 25.53 ? 474  PRO A O     1 
ATOM   3633  C CB    . PRO A  1 443 ? 20.630  7.303   3.127   1.00 24.47 ? 474  PRO A CB    1 
ATOM   3634  C CG    . PRO A  1 443 ? 21.040  5.916   3.434   1.00 27.46 ? 474  PRO A CG    1 
ATOM   3635  C CD    . PRO A  1 443 ? 21.512  5.866   4.868   1.00 25.20 ? 474  PRO A CD    1 
ATOM   3636  N N     . TYR A  1 444 ? 17.968  8.869   4.178   1.00 30.13 ? 475  TYR A N     1 
ATOM   3637  C CA    . TYR A  1 444 ? 16.518  8.917   4.290   1.00 27.60 ? 475  TYR A CA    1 
ATOM   3638  C C     . TYR A  1 444 ? 15.887  8.008   3.250   1.00 29.34 ? 475  TYR A C     1 
ATOM   3639  O O     . TYR A  1 444 ? 16.096  8.158   2.045   1.00 26.68 ? 475  TYR A O     1 
ATOM   3640  C CB    . TYR A  1 444 ? 16.022  10.345  4.131   1.00 24.33 ? 475  TYR A CB    1 
ATOM   3641  C CG    . TYR A  1 444 ? 16.214  11.140  5.386   1.00 22.58 ? 475  TYR A CG    1 
ATOM   3642  C CD1   . TYR A  1 444 ? 16.472  12.504  5.343   1.00 23.99 ? 475  TYR A CD1   1 
ATOM   3643  C CD2   . TYR A  1 444 ? 16.154  10.520  6.629   1.00 25.21 ? 475  TYR A CD2   1 
ATOM   3644  C CE1   . TYR A  1 444 ? 16.667  13.236  6.515   1.00 23.60 ? 475  TYR A CE1   1 
ATOM   3645  C CE2   . TYR A  1 444 ? 16.346  11.234  7.808   1.00 23.00 ? 475  TYR A CE2   1 
ATOM   3646  C CZ    . TYR A  1 444 ? 16.604  12.589  7.748   1.00 24.56 ? 475  TYR A CZ    1 
ATOM   3647  O OH    . TYR A  1 444 ? 16.815  13.281  8.923   1.00 23.54 ? 475  TYR A OH    1 
ATOM   3648  N N     . THR A  1 445 ? 15.119  7.048   3.750   1.00 33.21 ? 476  THR A N     1 
ATOM   3649  C CA    . THR A  1 445 ? 14.446  6.051   2.924   1.00 34.36 ? 476  THR A CA    1 
ATOM   3650  C C     . THR A  1 445 ? 13.165  6.530   2.224   1.00 33.54 ? 476  THR A C     1 
ATOM   3651  O O     . THR A  1 445 ? 12.696  5.892   1.282   1.00 32.19 ? 476  THR A O     1 
ATOM   3652  C CB    . THR A  1 445 ? 14.106  4.811   3.783   1.00 34.18 ? 476  THR A CB    1 
ATOM   3653  O OG1   . THR A  1 445 ? 12.851  5.018   4.442   1.00 39.17 ? 476  THR A OG1   1 
ATOM   3654  C CG2   . THR A  1 445 ? 15.182  4.583   4.846   1.00 37.30 ? 476  THR A CG2   1 
ATOM   3655  N N     . SER A  1 446 ? 12.611  7.649   2.688   1.00 33.10 ? 477  SER A N     1 
ATOM   3656  C CA    . SER A  1 446 ? 11.380  8.204   2.131   1.00 33.81 ? 477  SER A CA    1 
ATOM   3657  C C     . SER A  1 446 ? 11.307  9.689   2.433   1.00 33.56 ? 477  SER A C     1 
ATOM   3658  O O     . SER A  1 446 ? 11.766  10.141  3.486   1.00 32.39 ? 477  SER A O     1 
ATOM   3659  C CB    . SER A  1 446 ? 10.167  7.533   2.766   1.00 33.91 ? 477  SER A CB    1 
ATOM   3660  O OG    . SER A  1 446 ? 9.783   8.219   3.952   1.00 34.68 ? 477  SER A OG    1 
ATOM   3661  N N     . PHE A  1 447 ? 10.712  10.449  1.523   1.00 33.40 ? 478  PHE A N     1 
ATOM   3662  C CA    . PHE A  1 447 ? 10.598  11.884  1.740   1.00 35.19 ? 478  PHE A CA    1 
ATOM   3663  C C     . PHE A  1 447 ? 9.833   12.129  3.031   1.00 34.88 ? 478  PHE A C     1 
ATOM   3664  O O     . PHE A  1 447 ? 10.058  13.127  3.718   1.00 36.94 ? 478  PHE A O     1 
ATOM   3665  C CB    . PHE A  1 447 ? 9.869   12.559  0.582   1.00 34.57 ? 478  PHE A CB    1 
ATOM   3666  C CG    . PHE A  1 447 ? 10.550  12.387  -0.741  1.00 34.97 ? 478  PHE A CG    1 
ATOM   3667  C CD1   . PHE A  1 447 ? 10.606  11.135  -1.353  1.00 33.13 ? 478  PHE A CD1   1 
ATOM   3668  C CD2   . PHE A  1 447 ? 11.112  13.481  -1.397  1.00 33.99 ? 478  PHE A CD2   1 
ATOM   3669  C CE1   . PHE A  1 447 ? 11.213  10.976  -2.607  1.00 32.53 ? 478  PHE A CE1   1 
ATOM   3670  C CE2   . PHE A  1 447 ? 11.722  13.333  -2.651  1.00 30.98 ? 478  PHE A CE2   1 
ATOM   3671  C CZ    . PHE A  1 447 ? 11.772  12.081  -3.257  1.00 31.10 ? 478  PHE A CZ    1 
ATOM   3672  N N     . GLU A  1 448 ? 8.936   11.207  3.361   1.00 34.59 ? 479  GLU A N     1 
ATOM   3673  C CA    . GLU A  1 448 ? 8.144   11.332  4.572   1.00 37.27 ? 479  GLU A CA    1 
ATOM   3674  C C     . GLU A  1 448 ? 9.033   11.241  5.801   1.00 35.47 ? 479  GLU A C     1 
ATOM   3675  O O     . GLU A  1 448 ? 8.731   11.813  6.845   1.00 32.95 ? 479  GLU A O     1 
ATOM   3676  C CB    . GLU A  1 448 ? 7.091   10.230  4.623   1.00 42.25 ? 479  GLU A CB    1 
ATOM   3677  C CG    . GLU A  1 448 ? 5.793   10.638  5.327   1.00 50.35 ? 479  GLU A CG    1 
ATOM   3678  C CD    . GLU A  1 448 ? 4.575   9.979   4.712   1.00 51.33 ? 479  GLU A CD    1 
ATOM   3679  O OE1   . GLU A  1 448 ? 4.367   8.769   4.957   1.00 53.81 ? 479  GLU A OE1   1 
ATOM   3680  O OE2   . GLU A  1 448 ? 3.831   10.673  3.983   1.00 53.54 ? 479  GLU A OE2   1 
ATOM   3681  N N     . GLU A  1 449 ? 10.125  10.501  5.668   1.00 33.60 ? 480  GLU A N     1 
ATOM   3682  C CA    . GLU A  1 449 ? 11.071  10.336  6.763   1.00 32.35 ? 480  GLU A CA    1 
ATOM   3683  C C     . GLU A  1 449 ? 11.853  11.631  6.942   1.00 30.66 ? 480  GLU A C     1 
ATOM   3684  O O     . GLU A  1 449 ? 12.075  12.088  8.064   1.00 29.91 ? 480  GLU A O     1 
ATOM   3685  C CB    . GLU A  1 449 ? 12.032  9.193   6.452   1.00 32.11 ? 480  GLU A CB    1 
ATOM   3686  C CG    . GLU A  1 449 ? 13.138  9.027   7.468   1.00 34.01 ? 480  GLU A CG    1 
ATOM   3687  C CD    . GLU A  1 449 ? 13.816  7.666   7.372   1.00 37.68 ? 480  GLU A CD    1 
ATOM   3688  O OE1   . GLU A  1 449 ? 13.955  7.145   6.246   1.00 35.85 ? 480  GLU A OE1   1 
ATOM   3689  O OE2   . GLU A  1 449 ? 14.213  7.113   8.422   1.00 37.71 ? 480  GLU A OE2   1 
ATOM   3690  N N     . LEU A  1 450 ? 12.261  12.218  5.820   1.00 29.03 ? 481  LEU A N     1 
ATOM   3691  C CA    . LEU A  1 450 ? 13.021  13.459  5.830   1.00 25.42 ? 481  LEU A CA    1 
ATOM   3692  C C     . LEU A  1 450 ? 12.216  14.611  6.409   1.00 27.68 ? 481  LEU A C     1 
ATOM   3693  O O     . LEU A  1 450 ? 12.787  15.543  6.978   1.00 27.54 ? 481  LEU A O     1 
ATOM   3694  C CB    . LEU A  1 450 ? 13.468  13.812  4.404   1.00 22.66 ? 481  LEU A CB    1 
ATOM   3695  C CG    . LEU A  1 450 ? 13.714  15.286  4.027   1.00 22.31 ? 481  LEU A CG    1 
ATOM   3696  C CD1   . LEU A  1 450 ? 14.850  15.868  4.862   1.00 16.06 ? 481  LEU A CD1   1 
ATOM   3697  C CD2   . LEU A  1 450 ? 14.042  15.388  2.540   1.00 17.36 ? 481  LEU A CD2   1 
ATOM   3698  N N     . THR A  1 451 ? 10.892  14.540  6.276   1.00 28.72 ? 482  THR A N     1 
ATOM   3699  C CA    . THR A  1 451 ? 10.021  15.611  6.759   1.00 30.76 ? 482  THR A CA    1 
ATOM   3700  C C     . THR A  1 451 ? 9.164   15.258  7.959   1.00 28.89 ? 482  THR A C     1 
ATOM   3701  O O     . THR A  1 451 ? 8.867   16.118  8.780   1.00 30.02 ? 482  THR A O     1 
ATOM   3702  C CB    . THR A  1 451 ? 9.075   16.072  5.646   1.00 28.99 ? 482  THR A CB    1 
ATOM   3703  O OG1   . THR A  1 451 ? 9.090   15.097  4.606   1.00 27.53 ? 482  THR A OG1   1 
ATOM   3704  C CG2   . THR A  1 451 ? 9.510   17.403  5.067   1.00 27.72 ? 482  THR A CG2   1 
ATOM   3705  N N     . GLY A  1 452 ? 8.780   13.993  8.061   1.00 29.76 ? 483  GLY A N     1 
ATOM   3706  C CA    . GLY A  1 452 ? 7.911   13.563  9.149   1.00 28.65 ? 483  GLY A CA    1 
ATOM   3707  C C     . GLY A  1 452 ? 6.484   13.734  8.647   1.00 28.54 ? 483  GLY A C     1 
ATOM   3708  O O     . GLY A  1 452 ? 5.728   12.761  8.519   1.00 27.95 ? 483  GLY A O     1 
ATOM   3709  N N     . GLU A  1 453 ? 6.131   14.984  8.341   1.00 24.73 ? 484  GLU A N     1 
ATOM   3710  C CA    . GLU A  1 453 ? 4.818   15.325  7.804   1.00 24.11 ? 484  GLU A CA    1 
ATOM   3711  C C     . GLU A  1 453 ? 4.658   14.630  6.437   1.00 24.87 ? 484  GLU A C     1 
ATOM   3712  O O     . GLU A  1 453 ? 5.648   14.279  5.784   1.00 22.72 ? 484  GLU A O     1 
ATOM   3713  C CB    . GLU A  1 453 ? 4.706   16.841  7.634   1.00 19.19 ? 484  GLU A CB    1 
ATOM   3714  C CG    . GLU A  1 453 ? 5.738   17.400  6.686   1.00 17.55 ? 484  GLU A CG    1 
ATOM   3715  C CD    . GLU A  1 453 ? 5.279   17.396  5.243   1.00 13.49 ? 484  GLU A CD    1 
ATOM   3716  O OE1   . GLU A  1 453 ? 5.585   16.437  4.497   1.00 2.00  ? 484  GLU A OE1   1 
ATOM   3717  O OE2   . GLU A  1 453 ? 4.607   18.370  4.863   1.00 13.88 ? 484  GLU A OE2   1 
ATOM   3718  N N     . LYS A  1 454 ? 3.415   14.443  6.002   1.00 24.36 ? 485  LYS A N     1 
ATOM   3719  C CA    . LYS A  1 454 ? 3.155   13.776  4.725   1.00 24.36 ? 485  LYS A CA    1 
ATOM   3720  C C     . LYS A  1 454 ? 2.916   14.757  3.572   1.00 21.13 ? 485  LYS A C     1 
ATOM   3721  O O     . LYS A  1 454 ? 3.103   14.419  2.388   1.00 11.60 ? 485  LYS A O     1 
ATOM   3722  C CB    . LYS A  1 454 ? 1.946   12.836  4.855   1.00 30.98 ? 485  LYS A CB    1 
ATOM   3723  C CG    . LYS A  1 454 ? 1.959   11.929  6.085   1.00 36.39 ? 485  LYS A CG    1 
ATOM   3724  C CD    . LYS A  1 454 ? 0.827   10.907  6.046   1.00 36.04 ? 485  LYS A CD    1 
ATOM   3725  C CE    . LYS A  1 454 ? 0.968   9.884   7.171   1.00 42.13 ? 485  LYS A CE    1 
ATOM   3726  N NZ    . LYS A  1 454 ? 1.154   8.477   6.678   1.00 44.73 ? 485  LYS A NZ    1 
ATOM   3727  N N     . GLU A  1 455 ? 2.503   15.970  3.926   1.00 18.24 ? 486  GLU A N     1 
ATOM   3728  C CA    . GLU A  1 455 ? 2.231   16.993  2.929   1.00 20.13 ? 486  GLU A CA    1 
ATOM   3729  C C     . GLU A  1 455 ? 3.400   17.156  1.968   1.00 15.65 ? 486  GLU A C     1 
ATOM   3730  O O     . GLU A  1 455 ? 3.466   16.468  0.948   1.00 14.22 ? 486  GLU A O     1 
ATOM   3731  C CB    . GLU A  1 455 ? 1.921   18.333  3.610   1.00 29.38 ? 486  GLU A CB    1 
ATOM   3732  C CG    . GLU A  1 455 ? 0.582   18.954  3.190   1.00 43.21 ? 486  GLU A CG    1 
ATOM   3733  C CD    . GLU A  1 455 ? 0.675   19.834  1.936   1.00 51.53 ? 486  GLU A CD    1 
ATOM   3734  O OE1   . GLU A  1 455 ? 1.329   19.417  0.943   1.00 56.86 ? 486  GLU A OE1   1 
ATOM   3735  O OE2   . GLU A  1 455 ? 0.082   20.942  1.951   1.00 53.29 ? 486  GLU A OE2   1 
ATOM   3736  N N     . MET A  1 456 ? 4.304   18.076  2.308   1.00 14.33 ? 487  MET A N     1 
ATOM   3737  C CA    . MET A  1 456 ? 5.494   18.386  1.514   1.00 11.22 ? 487  MET A CA    1 
ATOM   3738  C C     . MET A  1 456 ? 6.117   17.121  0.942   1.00 10.16 ? 487  MET A C     1 
ATOM   3739  O O     . MET A  1 456 ? 6.354   17.018  -0.263  1.00 2.00  ? 487  MET A O     1 
ATOM   3740  C CB    . MET A  1 456 ? 6.507   19.130  2.388   1.00 8.88  ? 487  MET A CB    1 
ATOM   3741  C CG    . MET A  1 456 ? 5.978   20.462  2.881   1.00 2.00  ? 487  MET A CG    1 
ATOM   3742  S SD    . MET A  1 456 ? 7.056   21.382  3.970   1.00 15.58 ? 487  MET A SD    1 
ATOM   3743  C CE    . MET A  1 456 ? 7.165   20.232  5.458   1.00 9.20  ? 487  MET A CE    1 
ATOM   3744  N N     . ALA A  1 457 ? 6.367   16.162  1.826   1.00 11.57 ? 488  ALA A N     1 
ATOM   3745  C CA    . ALA A  1 457 ? 6.936   14.878  1.443   1.00 12.50 ? 488  ALA A CA    1 
ATOM   3746  C C     . ALA A  1 457 ? 6.308   14.436  0.129   1.00 15.16 ? 488  ALA A C     1 
ATOM   3747  O O     . ALA A  1 457 ? 6.967   14.369  -0.908  1.00 8.09  ? 488  ALA A O     1 
ATOM   3748  C CB    . ALA A  1 457 ? 6.648   13.841  2.535   1.00 9.12  ? 488  ALA A CB    1 
ATOM   3749  N N     . ALA A  1 458 ? 5.014   14.143  0.192   1.00 20.74 ? 489  ALA A N     1 
ATOM   3750  C CA    . ALA A  1 458 ? 4.259   13.707  -0.977  1.00 22.51 ? 489  ALA A CA    1 
ATOM   3751  C C     . ALA A  1 458 ? 4.494   14.681  -2.123  1.00 23.98 ? 489  ALA A C     1 
ATOM   3752  O O     . ALA A  1 458 ? 4.760   14.271  -3.252  1.00 23.08 ? 489  ALA A O     1 
ATOM   3753  C CB    . ALA A  1 458 ? 2.770   13.644  -0.631  1.00 19.77 ? 489  ALA A CB    1 
ATOM   3754  N N     . GLU A  1 459 ? 4.395   15.970  -1.814  1.00 27.72 ? 490  GLU A N     1 
ATOM   3755  C CA    . GLU A  1 459 ? 4.587   17.020  -2.802  1.00 31.22 ? 490  GLU A CA    1 
ATOM   3756  C C     . GLU A  1 459 ? 5.963   16.895  -3.474  1.00 30.70 ? 490  GLU A C     1 
ATOM   3757  O O     . GLU A  1 459 ? 6.107   17.099  -4.689  1.00 30.16 ? 490  GLU A O     1 
ATOM   3758  C CB    . GLU A  1 459 ? 4.450   18.385  -2.118  1.00 39.84 ? 490  GLU A CB    1 
ATOM   3759  C CG    . GLU A  1 459 ? 4.963   19.565  -2.931  1.00 48.13 ? 490  GLU A CG    1 
ATOM   3760  C CD    . GLU A  1 459 ? 4.078   19.874  -4.119  1.00 54.31 ? 490  GLU A CD    1 
ATOM   3761  O OE1   . GLU A  1 459 ? 3.432   20.949  -4.119  1.00 55.82 ? 490  GLU A OE1   1 
ATOM   3762  O OE2   . GLU A  1 459 ? 4.031   19.039  -5.050  1.00 57.41 ? 490  GLU A OE2   1 
ATOM   3763  N N     . LEU A  1 460 ? 6.969   16.540  -2.683  1.00 25.61 ? 491  LEU A N     1 
ATOM   3764  C CA    . LEU A  1 460 ? 8.326   16.391  -3.197  1.00 23.08 ? 491  LEU A CA    1 
ATOM   3765  C C     . LEU A  1 460 ? 8.442   15.120  -4.021  1.00 22.30 ? 491  LEU A C     1 
ATOM   3766  O O     . LEU A  1 460 ? 8.929   15.154  -5.155  1.00 19.61 ? 491  LEU A O     1 
ATOM   3767  C CB    . LEU A  1 460 ? 9.333   16.340  -2.045  1.00 19.79 ? 491  LEU A CB    1 
ATOM   3768  C CG    . LEU A  1 460 ? 9.751   17.716  -1.517  1.00 21.04 ? 491  LEU A CG    1 
ATOM   3769  C CD1   . LEU A  1 460 ? 10.170  17.628  -0.064  1.00 16.29 ? 491  LEU A CD1   1 
ATOM   3770  C CD2   . LEU A  1 460 ? 10.886  18.261  -2.382  1.00 19.04 ? 491  LEU A CD2   1 
ATOM   3771  N N     . LYS A  1 461 ? 7.988   14.009  -3.434  1.00 21.41 ? 492  LYS A N     1 
ATOM   3772  C CA    . LYS A  1 461 ? 8.021   12.695  -4.073  1.00 18.00 ? 492  LYS A CA    1 
ATOM   3773  C C     . LYS A  1 461 ? 7.462   12.823  -5.477  1.00 17.89 ? 492  LYS A C     1 
ATOM   3774  O O     . LYS A  1 461 ? 7.778   12.052  -6.378  1.00 18.42 ? 492  LYS A O     1 
ATOM   3775  C CB    . LYS A  1 461 ? 7.184   11.704  -3.271  1.00 19.40 ? 492  LYS A CB    1 
ATOM   3776  C CG    . LYS A  1 461 ? 6.905   10.411  -4.014  1.00 19.71 ? 492  LYS A CG    1 
ATOM   3777  C CD    . LYS A  1 461 ? 8.153   9.546   -4.111  1.00 19.59 ? 492  LYS A CD    1 
ATOM   3778  C CE    . LYS A  1 461 ? 7.793   8.061   -4.203  1.00 19.86 ? 492  LYS A CE    1 
ATOM   3779  N NZ    . LYS A  1 461 ? 7.412   7.500   -2.871  1.00 20.07 ? 492  LYS A NZ    1 
ATOM   3780  N N     . ALA A  1 462 ? 6.616   13.818  -5.650  1.00 19.72 ? 493  ALA A N     1 
ATOM   3781  C CA    . ALA A  1 462 ? 6.037   14.068  -6.943  1.00 21.63 ? 493  ALA A CA    1 
ATOM   3782  C C     . ALA A  1 462 ? 7.191   14.498  -7.827  1.00 23.96 ? 493  ALA A C     1 
ATOM   3783  O O     . ALA A  1 462 ? 7.420   13.929  -8.894  1.00 23.49 ? 493  ALA A O     1 
ATOM   3784  C CB    . ALA A  1 462 ? 5.029   15.180  -6.837  1.00 20.79 ? 493  ALA A CB    1 
ATOM   3785  N N     . LEU A  1 463 ? 7.922   15.496  -7.334  1.00 26.25 ? 494  LEU A N     1 
ATOM   3786  C CA    . LEU A  1 463 ? 9.060   16.110  -8.018  1.00 27.74 ? 494  LEU A CA    1 
ATOM   3787  C C     . LEU A  1 463 ? 10.365  15.316  -8.190  1.00 33.21 ? 494  LEU A C     1 
ATOM   3788  O O     . LEU A  1 463 ? 10.968  15.338  -9.271  1.00 33.81 ? 494  LEU A O     1 
ATOM   3789  C CB    . LEU A  1 463 ? 9.401   17.416  -7.316  1.00 23.34 ? 494  LEU A CB    1 
ATOM   3790  C CG    . LEU A  1 463 ? 8.490   18.612  -7.544  1.00 19.78 ? 494  LEU A CG    1 
ATOM   3791  C CD1   . LEU A  1 463 ? 8.760   19.645  -6.472  1.00 16.83 ? 494  LEU A CD1   1 
ATOM   3792  C CD2   . LEU A  1 463 ? 8.740   19.192  -8.923  1.00 17.66 ? 494  LEU A CD2   1 
ATOM   3793  N N     . TYR A  1 464 ? 10.812  14.635  -7.139  1.00 35.92 ? 495  TYR A N     1 
ATOM   3794  C CA    . TYR A  1 464 ? 12.073  13.896  -7.212  1.00 40.32 ? 495  TYR A CA    1 
ATOM   3795  C C     . TYR A  1 464 ? 11.940  12.407  -7.483  1.00 42.54 ? 495  TYR A C     1 
ATOM   3796  O O     . TYR A  1 464 ? 12.866  11.795  -8.004  1.00 44.42 ? 495  TYR A O     1 
ATOM   3797  C CB    . TYR A  1 464 ? 12.881  14.086  -5.918  1.00 38.81 ? 495  TYR A CB    1 
ATOM   3798  C CG    . TYR A  1 464 ? 13.517  15.455  -5.755  1.00 36.56 ? 495  TYR A CG    1 
ATOM   3799  C CD1   . TYR A  1 464 ? 12.736  16.590  -5.534  1.00 35.71 ? 495  TYR A CD1   1 
ATOM   3800  C CD2   . TYR A  1 464 ? 14.893  15.612  -5.807  1.00 34.58 ? 495  TYR A CD2   1 
ATOM   3801  C CE1   . TYR A  1 464 ? 13.310  17.842  -5.371  1.00 32.72 ? 495  TYR A CE1   1 
ATOM   3802  C CE2   . TYR A  1 464 ? 15.476  16.862  -5.645  1.00 34.61 ? 495  TYR A CE2   1 
ATOM   3803  C CZ    . TYR A  1 464 ? 14.679  17.974  -5.427  1.00 33.11 ? 495  TYR A CZ    1 
ATOM   3804  O OH    . TYR A  1 464 ? 15.247  19.220  -5.258  1.00 32.40 ? 495  TYR A OH    1 
ATOM   3805  N N     . SER A  1 465 ? 10.802  11.824  -7.129  1.00 44.36 ? 496  SER A N     1 
ATOM   3806  C CA    . SER A  1 465 ? 10.589  10.391  -7.323  1.00 45.65 ? 496  SER A CA    1 
ATOM   3807  C C     . SER A  1 465 ? 11.470  9.591   -6.361  1.00 45.34 ? 496  SER A C     1 
ATOM   3808  O O     . SER A  1 465 ? 10.996  9.146   -5.314  1.00 46.03 ? 496  SER A O     1 
ATOM   3809  C CB    . SER A  1 465 ? 10.896  9.994   -8.765  1.00 48.20 ? 496  SER A CB    1 
ATOM   3810  O OG    . SER A  1 465 ? 10.589  11.060  -9.642  1.00 51.28 ? 496  SER A OG    1 
ATOM   3811  N N     . ASP A  1 466 ? 12.748  9.410   -6.703  1.00 41.90 ? 497  ASP A N     1 
ATOM   3812  C CA    . ASP A  1 466 ? 13.657  8.664   -5.829  1.00 36.88 ? 497  ASP A CA    1 
ATOM   3813  C C     . ASP A  1 466 ? 14.195  9.526   -4.700  1.00 32.16 ? 497  ASP A C     1 
ATOM   3814  O O     . ASP A  1 466 ? 14.864  10.526  -4.935  1.00 32.45 ? 497  ASP A O     1 
ATOM   3815  C CB    . ASP A  1 466 ? 14.840  8.083   -6.611  1.00 38.12 ? 497  ASP A CB    1 
ATOM   3816  C CG    . ASP A  1 466 ? 15.589  7.003   -5.822  1.00 40.48 ? 497  ASP A CG    1 
ATOM   3817  O OD1   . ASP A  1 466 ? 16.478  6.342   -6.400  1.00 39.89 ? 497  ASP A OD1   1 
ATOM   3818  O OD2   . ASP A  1 466 ? 15.291  6.804   -4.623  1.00 40.16 ? 497  ASP A OD2   1 
ATOM   3819  N N     . ILE A  1 467 ? 13.894  9.128   -3.472  1.00 25.26 ? 498  ILE A N     1 
ATOM   3820  C CA    . ILE A  1 467 ? 14.354  9.850   -2.294  1.00 18.97 ? 498  ILE A CA    1 
ATOM   3821  C C     . ILE A  1 467 ? 15.825  10.214  -2.480  1.00 18.08 ? 498  ILE A C     1 
ATOM   3822  O O     . ILE A  1 467 ? 16.231  11.362  -2.241  1.00 13.88 ? 498  ILE A O     1 
ATOM   3823  C CB    . ILE A  1 467 ? 14.169  8.975   -1.003  1.00 18.82 ? 498  ILE A CB    1 
ATOM   3824  C CG1   . ILE A  1 467 ? 14.493  9.794   0.256   1.00 11.70 ? 498  ILE A CG1   1 
ATOM   3825  C CG2   . ILE A  1 467 ? 15.046  7.725   -1.076  1.00 17.70 ? 498  ILE A CG2   1 
ATOM   3826  C CD1   . ILE A  1 467 ? 13.891  11.184  0.279   1.00 2.00  ? 498  ILE A CD1   1 
ATOM   3827  N N     . ASP A  1 468 ? 16.602  9.227   -2.924  1.00 15.30 ? 499  ASP A N     1 
ATOM   3828  C CA    . ASP A  1 468 ? 18.023  9.398   -3.168  1.00 14.31 ? 499  ASP A CA    1 
ATOM   3829  C C     . ASP A  1 468 ? 18.258  10.695  -3.938  1.00 13.63 ? 499  ASP A C     1 
ATOM   3830  O O     . ASP A  1 468 ? 18.942  11.614  -3.462  1.00 15.85 ? 499  ASP A O     1 
ATOM   3831  C CB    . ASP A  1 468 ? 18.562  8.213   -3.977  1.00 14.81 ? 499  ASP A CB    1 
ATOM   3832  C CG    . ASP A  1 468 ? 18.312  6.877   -3.293  1.00 18.47 ? 499  ASP A CG    1 
ATOM   3833  O OD1   . ASP A  1 468 ? 18.213  6.851   -2.043  1.00 20.02 ? 499  ASP A OD1   1 
ATOM   3834  O OD2   . ASP A  1 468 ? 18.212  5.858   -4.009  1.00 13.59 ? 499  ASP A OD2   1 
ATOM   3835  N N     . VAL A  1 469 ? 17.666  10.781  -5.122  1.00 9.07  ? 500  VAL A N     1 
ATOM   3836  C CA    . VAL A  1 469 ? 17.838  11.967  -5.955  1.00 7.32  ? 500  VAL A CA    1 
ATOM   3837  C C     . VAL A  1 469 ? 17.446  13.293  -5.296  1.00 6.02  ? 500  VAL A C     1 
ATOM   3838  O O     . VAL A  1 469 ? 17.421  14.341  -5.949  1.00 2.00  ? 500  VAL A O     1 
ATOM   3839  C CB    . VAL A  1 469 ? 17.072  11.819  -7.250  1.00 2.81  ? 500  VAL A CB    1 
ATOM   3840  C CG1   . VAL A  1 469 ? 17.640  12.754  -8.275  1.00 5.19  ? 500  VAL A CG1   1 
ATOM   3841  C CG2   . VAL A  1 469 ? 17.169  10.380  -7.735  1.00 2.00  ? 500  VAL A CG2   1 
ATOM   3842  N N     . MET A  1 470 ? 17.139  13.242  -4.004  1.00 6.95  ? 501  MET A N     1 
ATOM   3843  C CA    . MET A  1 470 ? 16.780  14.442  -3.267  1.00 8.37  ? 501  MET A CA    1 
ATOM   3844  C C     . MET A  1 470 ? 18.031  15.320  -3.091  1.00 10.15 ? 501  MET A C     1 
ATOM   3845  O O     . MET A  1 470 ? 19.093  14.849  -2.685  1.00 16.46 ? 501  MET A O     1 
ATOM   3846  C CB    . MET A  1 470 ? 16.188  14.063  -1.899  1.00 2.00  ? 501  MET A CB    1 
ATOM   3847  C CG    . MET A  1 470 ? 15.469  15.201  -1.209  1.00 2.00  ? 501  MET A CG    1 
ATOM   3848  S SD    . MET A  1 470 ? 14.993  16.492  -2.385  1.00 10.19 ? 501  MET A SD    1 
ATOM   3849  C CE    . MET A  1 470 ? 15.022  17.986  -1.318  1.00 2.00  ? 501  MET A CE    1 
ATOM   3850  N N     . GLU A  1 471 ? 17.906  16.595  -3.417  1.00 8.98  ? 502  GLU A N     1 
ATOM   3851  C CA    . GLU A  1 471 ? 19.018  17.512  -3.268  1.00 8.05  ? 502  GLU A CA    1 
ATOM   3852  C C     . GLU A  1 471 ? 19.184  17.895  -1.812  1.00 12.16 ? 502  GLU A C     1 
ATOM   3853  O O     . GLU A  1 471 ? 18.203  18.016  -1.072  1.00 14.54 ? 502  GLU A O     1 
ATOM   3854  C CB    . GLU A  1 471 ? 18.773  18.756  -4.103  1.00 6.20  ? 502  GLU A CB    1 
ATOM   3855  C CG    . GLU A  1 471 ? 18.559  18.437  -5.568  1.00 7.75  ? 502  GLU A CG    1 
ATOM   3856  C CD    . GLU A  1 471 ? 18.672  19.662  -6.462  1.00 14.91 ? 502  GLU A CD    1 
ATOM   3857  O OE1   . GLU A  1 471 ? 18.538  20.803  -5.950  1.00 13.28 ? 502  GLU A OE1   1 
ATOM   3858  O OE2   . GLU A  1 471 ? 18.895  19.481  -7.681  1.00 14.75 ? 502  GLU A OE2   1 
ATOM   3859  N N     . LEU A  1 472 ? 20.438  18.095  -1.416  1.00 15.30 ? 503  LEU A N     1 
ATOM   3860  C CA    . LEU A  1 472 ? 20.792  18.463  -0.042  1.00 16.19 ? 503  LEU A CA    1 
ATOM   3861  C C     . LEU A  1 472 ? 20.187  19.785  0.427   1.00 14.46 ? 503  LEU A C     1 
ATOM   3862  O O     . LEU A  1 472 ? 19.251  19.795  1.227   1.00 13.59 ? 503  LEU A O     1 
ATOM   3863  C CB    . LEU A  1 472 ? 22.318  18.527  0.101   1.00 18.07 ? 503  LEU A CB    1 
ATOM   3864  C CG    . LEU A  1 472 ? 22.888  19.170  1.373   1.00 20.73 ? 503  LEU A CG    1 
ATOM   3865  C CD1   . LEU A  1 472 ? 22.530  18.321  2.571   1.00 21.70 ? 503  LEU A CD1   1 
ATOM   3866  C CD2   . LEU A  1 472 ? 24.408  19.312  1.258   1.00 20.02 ? 503  LEU A CD2   1 
ATOM   3867  N N     . TYR A  1 473 ? 20.722  20.894  -0.074  1.00 14.95 ? 504  TYR A N     1 
ATOM   3868  C CA    . TYR A  1 473 ? 20.237  22.212  0.329   1.00 17.34 ? 504  TYR A CA    1 
ATOM   3869  C C     . TYR A  1 473 ? 18.738  22.223  0.589   1.00 18.02 ? 504  TYR A C     1 
ATOM   3870  O O     . TYR A  1 473 ? 18.276  22.604  1.671   1.00 14.63 ? 504  TYR A O     1 
ATOM   3871  C CB    . TYR A  1 473 ? 20.543  23.282  -0.726  1.00 19.27 ? 504  TYR A CB    1 
ATOM   3872  C CG    . TYR A  1 473 ? 19.964  24.618  -0.313  1.00 23.12 ? 504  TYR A CG    1 
ATOM   3873  C CD1   . TYR A  1 473 ? 20.319  25.189  0.907   1.00 21.45 ? 504  TYR A CD1   1 
ATOM   3874  C CD2   . TYR A  1 473 ? 19.036  25.292  -1.110  1.00 24.14 ? 504  TYR A CD2   1 
ATOM   3875  C CE1   . TYR A  1 473 ? 19.775  26.387  1.333   1.00 21.11 ? 504  TYR A CE1   1 
ATOM   3876  C CE2   . TYR A  1 473 ? 18.476  26.510  -0.685  1.00 21.80 ? 504  TYR A CE2   1 
ATOM   3877  C CZ    . TYR A  1 473 ? 18.854  27.049  0.540   1.00 22.75 ? 504  TYR A CZ    1 
ATOM   3878  O OH    . TYR A  1 473 ? 18.312  28.241  0.992   1.00 23.73 ? 504  TYR A OH    1 
ATOM   3879  N N     . PRO A  1 474 ? 17.959  21.797  -0.412  1.00 16.94 ? 505  PRO A N     1 
ATOM   3880  C CA    . PRO A  1 474 ? 16.507  21.780  -0.235  1.00 15.90 ? 505  PRO A CA    1 
ATOM   3881  C C     . PRO A  1 474 ? 16.188  20.949  1.003   1.00 18.31 ? 505  PRO A C     1 
ATOM   3882  O O     . PRO A  1 474 ? 15.722  21.467  2.031   1.00 17.15 ? 505  PRO A O     1 
ATOM   3883  C CB    . PRO A  1 474 ? 15.990  21.107  -1.500  1.00 17.30 ? 505  PRO A CB    1 
ATOM   3884  C CG    . PRO A  1 474 ? 17.131  21.110  -2.472  1.00 18.92 ? 505  PRO A CG    1 
ATOM   3885  C CD    . PRO A  1 474 ? 18.391  21.262  -1.718  1.00 16.05 ? 505  PRO A CD    1 
ATOM   3886  N N     . ALA A  1 475 ? 16.467  19.652  0.883   1.00 16.27 ? 506  ALA A N     1 
ATOM   3887  C CA    . ALA A  1 475 ? 16.226  18.698  1.947   1.00 15.16 ? 506  ALA A CA    1 
ATOM   3888  C C     . ALA A  1 475 ? 16.576  19.270  3.316   1.00 15.21 ? 506  ALA A C     1 
ATOM   3889  O O     . ALA A  1 475 ? 16.003  18.875  4.327   1.00 16.27 ? 506  ALA A O     1 
ATOM   3890  C CB    . ALA A  1 475 ? 17.017  17.451  1.690   1.00 12.97 ? 506  ALA A CB    1 
ATOM   3891  N N     . LEU A  1 476 ? 17.502  20.216  3.351   1.00 14.39 ? 507  LEU A N     1 
ATOM   3892  C CA    . LEU A  1 476 ? 17.904  20.801  4.622   1.00 16.43 ? 507  LEU A CA    1 
ATOM   3893  C C     . LEU A  1 476 ? 16.850  21.725  5.220   1.00 19.40 ? 507  LEU A C     1 
ATOM   3894  O O     . LEU A  1 476 ? 16.517  21.625  6.408   1.00 18.83 ? 507  LEU A O     1 
ATOM   3895  C CB    . LEU A  1 476 ? 19.211  21.578  4.459   1.00 12.70 ? 507  LEU A CB    1 
ATOM   3896  C CG    . LEU A  1 476 ? 20.465  20.721  4.470   1.00 10.71 ? 507  LEU A CG    1 
ATOM   3897  C CD1   . LEU A  1 476 ? 21.498  21.306  3.510   1.00 5.56  ? 507  LEU A CD1   1 
ATOM   3898  C CD2   . LEU A  1 476 ? 20.991  20.632  5.883   1.00 8.98  ? 507  LEU A CD2   1 
ATOM   3899  N N     . LEU A  1 477 ? 16.338  22.631  4.395   1.00 20.68 ? 508  LEU A N     1 
ATOM   3900  C CA    . LEU A  1 477 ? 15.348  23.598  4.844   1.00 24.09 ? 508  LEU A CA    1 
ATOM   3901  C C     . LEU A  1 477 ? 14.005  22.926  5.099   1.00 26.91 ? 508  LEU A C     1 
ATOM   3902  O O     . LEU A  1 477 ? 13.209  23.368  5.936   1.00 27.24 ? 508  LEU A O     1 
ATOM   3903  C CB    . LEU A  1 477 ? 15.187  24.691  3.782   1.00 21.91 ? 508  LEU A CB    1 
ATOM   3904  C CG    . LEU A  1 477 ? 16.273  25.769  3.766   1.00 22.27 ? 508  LEU A CG    1 
ATOM   3905  C CD1   . LEU A  1 477 ? 15.931  26.875  2.777   1.00 19.56 ? 508  LEU A CD1   1 
ATOM   3906  C CD2   . LEU A  1 477 ? 16.404  26.340  5.155   1.00 24.22 ? 508  LEU A CD2   1 
ATOM   3907  N N     . VAL A  1 478 ? 13.761  21.848  4.367   1.00 29.25 ? 509  VAL A N     1 
ATOM   3908  C CA    . VAL A  1 478 ? 12.512  21.123  4.484   1.00 32.15 ? 509  VAL A CA    1 
ATOM   3909  C C     . VAL A  1 478 ? 12.671  20.013  5.505   1.00 32.32 ? 509  VAL A C     1 
ATOM   3910  O O     . VAL A  1 478 ? 11.686  19.513  6.046   1.00 36.66 ? 509  VAL A O     1 
ATOM   3911  C CB    . VAL A  1 478 ? 12.108  20.521  3.112   1.00 34.48 ? 509  VAL A CB    1 
ATOM   3912  C CG1   . VAL A  1 478 ? 10.889  19.636  3.254   1.00 37.88 ? 509  VAL A CG1   1 
ATOM   3913  C CG2   . VAL A  1 478 ? 11.825  21.637  2.116   1.00 37.20 ? 509  VAL A CG2   1 
ATOM   3914  N N     . GLU A  1 479 ? 13.917  19.639  5.773   1.00 31.15 ? 510  GLU A N     1 
ATOM   3915  C CA    . GLU A  1 479 ? 14.215  18.577  6.727   1.00 29.30 ? 510  GLU A CA    1 
ATOM   3916  C C     . GLU A  1 479 ? 13.247  18.595  7.896   1.00 26.05 ? 510  GLU A C     1 
ATOM   3917  O O     . GLU A  1 479 ? 12.622  19.607  8.168   1.00 27.70 ? 510  GLU A O     1 
ATOM   3918  C CB    . GLU A  1 479 ? 15.647  18.725  7.236   1.00 34.70 ? 510  GLU A CB    1 
ATOM   3919  C CG    . GLU A  1 479 ? 16.405  17.413  7.368   1.00 39.96 ? 510  GLU A CG    1 
ATOM   3920  C CD    . GLU A  1 479 ? 17.494  17.490  8.418   1.00 45.62 ? 510  GLU A CD    1 
ATOM   3921  O OE1   . GLU A  1 479 ? 17.919  18.625  8.760   1.00 46.96 ? 510  GLU A OE1   1 
ATOM   3922  O OE2   . GLU A  1 479 ? 17.916  16.412  8.898   1.00 45.52 ? 510  GLU A OE2   1 
ATOM   3923  N N     . LYS A  1 480 ? 13.140  17.477  8.599   1.00 23.12 ? 511  LYS A N     1 
ATOM   3924  C CA    . LYS A  1 480 ? 12.214  17.373  9.725   1.00 20.71 ? 511  LYS A CA    1 
ATOM   3925  C C     . LYS A  1 480 ? 12.834  17.751  11.055  1.00 14.82 ? 511  LYS A C     1 
ATOM   3926  O O     . LYS A  1 480 ? 13.419  16.907  11.717  1.00 17.95 ? 511  LYS A O     1 
ATOM   3927  C CB    . LYS A  1 480 ? 11.668  15.947  9.816   1.00 25.57 ? 511  LYS A CB    1 
ATOM   3928  C CG    . LYS A  1 480 ? 10.790  15.691  11.031  1.00 28.72 ? 511  LYS A CG    1 
ATOM   3929  C CD    . LYS A  1 480 ? 11.248  14.451  11.753  1.00 32.07 ? 511  LYS A CD    1 
ATOM   3930  C CE    . LYS A  1 480 ? 11.100  14.584  13.256  1.00 32.96 ? 511  LYS A CE    1 
ATOM   3931  N NZ    . LYS A  1 480 ? 10.953  13.226  13.884  1.00 33.37 ? 511  LYS A NZ    1 
ATOM   3932  N N     . PRO A  1 481 ? 12.685  19.014  11.477  1.00 11.63 ? 512  PRO A N     1 
ATOM   3933  C CA    . PRO A  1 481 ? 13.242  19.507  12.741  1.00 12.46 ? 512  PRO A CA    1 
ATOM   3934  C C     . PRO A  1 481 ? 13.321  18.564  13.931  1.00 13.83 ? 512  PRO A C     1 
ATOM   3935  O O     . PRO A  1 481 ? 12.614  17.556  14.028  1.00 17.11 ? 512  PRO A O     1 
ATOM   3936  C CB    . PRO A  1 481 ? 12.396  20.734  13.051  1.00 6.93  ? 512  PRO A CB    1 
ATOM   3937  C CG    . PRO A  1 481 ? 12.081  21.273  11.711  1.00 10.70 ? 512  PRO A CG    1 
ATOM   3938  C CD    . PRO A  1 481 ? 11.971  20.082  10.763  1.00 7.25  ? 512  PRO A CD    1 
ATOM   3939  N N     . ARG A  1 482 ? 14.224  18.905  14.833  1.00 19.07 ? 513  ARG A N     1 
ATOM   3940  C CA    . ARG A  1 482 ? 14.397  18.132  16.033  1.00 24.05 ? 513  ARG A CA    1 
ATOM   3941  C C     . ARG A  1 482 ? 13.359  18.693  16.986  1.00 23.68 ? 513  ARG A C     1 
ATOM   3942  O O     . ARG A  1 482 ? 12.925  19.837  16.838  1.00 21.93 ? 513  ARG A O     1 
ATOM   3943  C CB    . ARG A  1 482 ? 15.801  18.334  16.601  1.00 27.70 ? 513  ARG A CB    1 
ATOM   3944  C CG    . ARG A  1 482 ? 16.725  17.149  16.391  1.00 35.79 ? 513  ARG A CG    1 
ATOM   3945  C CD    . ARG A  1 482 ? 17.747  17.392  15.278  1.00 43.27 ? 513  ARG A CD    1 
ATOM   3946  N NE    . ARG A  1 482 ? 18.564  16.200  15.074  1.00 53.67 ? 513  ARG A NE    1 
ATOM   3947  C CZ    . ARG A  1 482 ? 19.886  16.186  15.132  1.00 57.77 ? 513  ARG A CZ    1 
ATOM   3948  N NH1   . ARG A  1 482 ? 20.549  17.308  15.382  1.00 60.68 ? 513  ARG A NH1   1 
ATOM   3949  N NH2   . ARG A  1 482 ? 20.539  15.048  14.945  1.00 61.94 ? 513  ARG A NH2   1 
ATOM   3950  N N     . PRO A  1 483 ? 12.931  17.883  17.960  1.00 23.23 ? 514  PRO A N     1 
ATOM   3951  C CA    . PRO A  1 483 ? 11.934  18.279  18.957  1.00 24.93 ? 514  PRO A CA    1 
ATOM   3952  C C     . PRO A  1 483 ? 12.045  19.733  19.407  1.00 28.95 ? 514  PRO A C     1 
ATOM   3953  O O     . PRO A  1 483 ? 12.671  20.017  20.422  1.00 31.88 ? 514  PRO A O     1 
ATOM   3954  C CB    . PRO A  1 483 ? 12.188  17.320  20.107  1.00 23.26 ? 514  PRO A CB    1 
ATOM   3955  C CG    . PRO A  1 483 ? 12.784  16.089  19.461  1.00 22.17 ? 514  PRO A CG    1 
ATOM   3956  C CD    . PRO A  1 483 ? 13.392  16.493  18.149  1.00 21.76 ? 514  PRO A CD    1 
ATOM   3957  N N     . ASP A  1 484 ? 11.442  20.646  18.652  1.00 31.87 ? 515  ASP A N     1 
ATOM   3958  C CA    . ASP A  1 484 ? 11.451  22.069  18.986  1.00 34.39 ? 515  ASP A CA    1 
ATOM   3959  C C     . ASP A  1 484 ? 12.728  22.767  18.566  1.00 33.76 ? 515  ASP A C     1 
ATOM   3960  O O     . ASP A  1 484 ? 12.924  23.954  18.848  1.00 32.59 ? 515  ASP A O     1 
ATOM   3961  C CB    . ASP A  1 484 ? 11.244  22.265  20.486  1.00 39.64 ? 515  ASP A CB    1 
ATOM   3962  C CG    . ASP A  1 484 ? 10.007  21.550  21.001  1.00 46.33 ? 515  ASP A CG    1 
ATOM   3963  O OD1   . ASP A  1 484 ? 8.886   21.954  20.625  1.00 47.48 ? 515  ASP A OD1   1 
ATOM   3964  O OD2   . ASP A  1 484 ? 10.149  20.583  21.781  1.00 49.51 ? 515  ASP A OD2   1 
ATOM   3965  N N     . ALA A  1 485 ? 13.601  22.022  17.898  1.00 31.47 ? 516  ALA A N     1 
ATOM   3966  C CA    . ALA A  1 485 ? 14.866  22.567  17.429  1.00 30.97 ? 516  ALA A CA    1 
ATOM   3967  C C     . ALA A  1 485 ? 14.612  23.422  16.213  1.00 27.87 ? 516  ALA A C     1 
ATOM   3968  O O     . ALA A  1 485 ? 13.507  23.437  15.690  1.00 30.14 ? 516  ALA A O     1 
ATOM   3969  C CB    . ALA A  1 485 ? 15.818  21.448  17.076  1.00 30.88 ? 516  ALA A CB    1 
ATOM   3970  N N     . ILE A  1 486 ? 15.643  24.128  15.771  1.00 26.06 ? 517  ILE A N     1 
ATOM   3971  C CA    . ILE A  1 486 ? 15.547  24.989  14.599  1.00 25.91 ? 517  ILE A CA    1 
ATOM   3972  C C     . ILE A  1 486 ? 16.136  24.298  13.365  1.00 24.76 ? 517  ILE A C     1 
ATOM   3973  O O     . ILE A  1 486 ? 15.851  24.690  12.228  1.00 26.41 ? 517  ILE A O     1 
ATOM   3974  C CB    . ILE A  1 486 ? 16.291  26.316  14.824  1.00 23.75 ? 517  ILE A CB    1 
ATOM   3975  C CG1   . ILE A  1 486 ? 16.481  27.048  13.504  1.00 21.18 ? 517  ILE A CG1   1 
ATOM   3976  C CG2   . ILE A  1 486 ? 17.630  26.056  15.451  1.00 25.78 ? 517  ILE A CG2   1 
ATOM   3977  C CD1   . ILE A  1 486 ? 16.512  28.537  13.665  1.00 15.98 ? 517  ILE A CD1   1 
ATOM   3978  N N     . PHE A  1 487 ? 16.946  23.266  13.597  1.00 24.13 ? 518  PHE A N     1 
ATOM   3979  C CA    . PHE A  1 487 ? 17.568  22.511  12.514  1.00 20.62 ? 518  PHE A CA    1 
ATOM   3980  C C     . PHE A  1 487 ? 17.211  21.051  12.603  1.00 19.49 ? 518  PHE A C     1 
ATOM   3981  O O     . PHE A  1 487 ? 16.813  20.568  13.662  1.00 15.85 ? 518  PHE A O     1 
ATOM   3982  C CB    . PHE A  1 487 ? 19.092  22.590  12.582  1.00 21.41 ? 518  PHE A CB    1 
ATOM   3983  C CG    . PHE A  1 487 ? 19.643  23.966  12.389  1.00 19.50 ? 518  PHE A CG    1 
ATOM   3984  C CD1   . PHE A  1 487 ? 19.363  24.691  11.231  1.00 15.40 ? 518  PHE A CD1   1 
ATOM   3985  C CD2   . PHE A  1 487 ? 20.431  24.547  13.375  1.00 15.92 ? 518  PHE A CD2   1 
ATOM   3986  C CE1   . PHE A  1 487 ? 19.857  25.980  11.063  1.00 14.17 ? 518  PHE A CE1   1 
ATOM   3987  C CE2   . PHE A  1 487 ? 20.931  25.836  13.216  1.00 15.42 ? 518  PHE A CE2   1 
ATOM   3988  C CZ    . PHE A  1 487 ? 20.642  26.552  12.063  1.00 14.14 ? 518  PHE A CZ    1 
ATOM   3989  N N     . GLY A  1 488 ? 17.374  20.350  11.484  1.00 16.97 ? 519  GLY A N     1 
ATOM   3990  C CA    . GLY A  1 488 ? 17.121  18.921  11.468  1.00 15.75 ? 519  GLY A CA    1 
ATOM   3991  C C     . GLY A  1 488 ? 18.417  18.267  11.923  1.00 17.32 ? 519  GLY A C     1 
ATOM   3992  O O     . GLY A  1 488 ? 19.294  18.931  12.481  1.00 17.63 ? 519  GLY A O     1 
ATOM   3993  N N     . GLU A  1 489 ? 18.565  16.975  11.688  1.00 15.24 ? 520  GLU A N     1 
ATOM   3994  C CA    . GLU A  1 489 ? 19.788  16.304  12.094  1.00 15.81 ? 520  GLU A CA    1 
ATOM   3995  C C     . GLU A  1 489 ? 20.843  16.586  11.044  1.00 15.94 ? 520  GLU A C     1 
ATOM   3996  O O     . GLU A  1 489 ? 21.961  17.003  11.357  1.00 17.51 ? 520  GLU A O     1 
ATOM   3997  C CB    . GLU A  1 489 ? 19.533  14.804  12.239  1.00 14.74 ? 520  GLU A CB    1 
ATOM   3998  C CG    . GLU A  1 489 ? 20.700  13.893  11.945  1.00 11.26 ? 520  GLU A CG    1 
ATOM   3999  C CD    . GLU A  1 489 ? 20.285  12.748  11.040  1.00 15.35 ? 520  GLU A CD    1 
ATOM   4000  O OE1   . GLU A  1 489 ? 19.843  13.060  9.910   1.00 12.92 ? 520  GLU A OE1   1 
ATOM   4001  O OE2   . GLU A  1 489 ? 20.388  11.560  11.454  1.00 10.04 ? 520  GLU A OE2   1 
ATOM   4002  N N     . THR A  1 490 ? 20.470  16.379  9.790   1.00 17.29 ? 521  THR A N     1 
ATOM   4003  C CA    . THR A  1 490 ? 21.377  16.623  8.676   1.00 16.43 ? 521  THR A CA    1 
ATOM   4004  C C     . THR A  1 490 ? 22.187  17.923  8.821   1.00 17.05 ? 521  THR A C     1 
ATOM   4005  O O     . THR A  1 490 ? 23.418  17.877  8.946   1.00 17.20 ? 521  THR A O     1 
ATOM   4006  C CB    . THR A  1 490 ? 20.592  16.622  7.342   1.00 17.46 ? 521  THR A CB    1 
ATOM   4007  O OG1   . THR A  1 490 ? 20.476  15.268  6.869   1.00 20.48 ? 521  THR A OG1   1 
ATOM   4008  C CG2   . THR A  1 490 ? 21.293  17.471  6.293   1.00 13.55 ? 521  THR A CG2   1 
ATOM   4009  N N     . MET A  1 491 ? 21.513  19.071  8.823   1.00 15.50 ? 522  MET A N     1 
ATOM   4010  C CA    . MET A  1 491 ? 22.223  20.343  8.942   1.00 13.02 ? 522  MET A CA    1 
ATOM   4011  C C     . MET A  1 491 ? 23.136  20.381  10.154  1.00 15.43 ? 522  MET A C     1 
ATOM   4012  O O     . MET A  1 491 ? 24.242  20.916  10.084  1.00 17.66 ? 522  MET A O     1 
ATOM   4013  C CB    . MET A  1 491 ? 21.249  21.509  9.028   1.00 12.66 ? 522  MET A CB    1 
ATOM   4014  C CG    . MET A  1 491 ? 21.892  22.801  9.479   1.00 7.45  ? 522  MET A CG    1 
ATOM   4015  S SD    . MET A  1 491 ? 21.606  24.171  8.343   1.00 19.26 ? 522  MET A SD    1 
ATOM   4016  C CE    . MET A  1 491 ? 21.852  23.388  6.748   1.00 2.00  ? 522  MET A CE    1 
ATOM   4017  N N     . VAL A  1 492 ? 22.691  19.821  11.271  1.00 13.27 ? 523  VAL A N     1 
ATOM   4018  C CA    . VAL A  1 492 ? 23.541  19.839  12.452  1.00 15.08 ? 523  VAL A CA    1 
ATOM   4019  C C     . VAL A  1 492 ? 24.796  18.999  12.248  1.00 18.63 ? 523  VAL A C     1 
ATOM   4020  O O     . VAL A  1 492 ? 25.911  19.502  12.369  1.00 21.69 ? 523  VAL A O     1 
ATOM   4021  C CB    . VAL A  1 492 ? 22.792  19.333  13.689  1.00 15.25 ? 523  VAL A CB    1 
ATOM   4022  C CG1   . VAL A  1 492 ? 23.749  18.638  14.644  1.00 16.49 ? 523  VAL A CG1   1 
ATOM   4023  C CG2   . VAL A  1 492 ? 22.122  20.509  14.381  1.00 19.85 ? 523  VAL A CG2   1 
ATOM   4024  N N     . GLU A  1 493 ? 24.615  17.727  11.918  1.00 18.85 ? 524  GLU A N     1 
ATOM   4025  C CA    . GLU A  1 493 ? 25.740  16.826  11.711  1.00 24.68 ? 524  GLU A CA    1 
ATOM   4026  C C     . GLU A  1 493 ? 26.715  17.175  10.576  1.00 22.59 ? 524  GLU A C     1 
ATOM   4027  O O     . GLU A  1 493 ? 27.709  16.478  10.383  1.00 24.37 ? 524  GLU A O     1 
ATOM   4028  C CB    . GLU A  1 493 ? 25.220  15.400  11.516  1.00 30.20 ? 524  GLU A CB    1 
ATOM   4029  C CG    . GLU A  1 493 ? 25.061  14.610  12.812  1.00 37.78 ? 524  GLU A CG    1 
ATOM   4030  C CD    . GLU A  1 493 ? 25.862  15.197  13.969  1.00 44.75 ? 524  GLU A CD    1 
ATOM   4031  O OE1   . GLU A  1 493 ? 26.666  14.449  14.573  1.00 43.91 ? 524  GLU A OE1   1 
ATOM   4032  O OE2   . GLU A  1 493 ? 25.689  16.401  14.275  1.00 44.08 ? 524  GLU A OE2   1 
ATOM   4033  N N     . LEU A  1 494 ? 26.445  18.233  9.820   1.00 18.67 ? 525  LEU A N     1 
ATOM   4034  C CA    . LEU A  1 494 ? 27.354  18.607  8.754   1.00 14.29 ? 525  LEU A CA    1 
ATOM   4035  C C     . LEU A  1 494 ? 28.135  19.812  9.236   1.00 17.45 ? 525  LEU A C     1 
ATOM   4036  O O     . LEU A  1 494 ? 29.362  19.839  9.180   1.00 19.15 ? 525  LEU A O     1 
ATOM   4037  C CB    . LEU A  1 494 ? 26.593  18.989  7.483   1.00 11.04 ? 525  LEU A CB    1 
ATOM   4038  C CG    . LEU A  1 494 ? 25.992  17.896  6.612   1.00 2.00  ? 525  LEU A CG    1 
ATOM   4039  C CD1   . LEU A  1 494 ? 26.172  18.235  5.162   1.00 2.00  ? 525  LEU A CD1   1 
ATOM   4040  C CD2   . LEU A  1 494 ? 26.635  16.591  6.940   1.00 2.00  ? 525  LEU A CD2   1 
ATOM   4041  N N     . GLY A  1 495 ? 27.412  20.812  9.716   1.00 16.03 ? 526  GLY A N     1 
ATOM   4042  C CA    . GLY A  1 495 ? 28.071  22.018  10.171  1.00 20.14 ? 526  GLY A CA    1 
ATOM   4043  C C     . GLY A  1 495 ? 28.827  21.842  11.465  1.00 19.64 ? 526  GLY A C     1 
ATOM   4044  O O     . GLY A  1 495 ? 29.706  22.638  11.788  1.00 20.46 ? 526  GLY A O     1 
ATOM   4045  N N     . ALA A  1 496 ? 28.482  20.806  12.217  1.00 20.33 ? 527  ALA A N     1 
ATOM   4046  C CA    . ALA A  1 496 ? 29.160  20.562  13.482  1.00 23.00 ? 527  ALA A CA    1 
ATOM   4047  C C     . ALA A  1 496 ? 30.651  20.372  13.224  1.00 22.40 ? 527  ALA A C     1 
ATOM   4048  O O     . ALA A  1 496 ? 31.489  21.090  13.795  1.00 23.23 ? 527  ALA A O     1 
ATOM   4049  C CB    . ALA A  1 496 ? 28.570  19.335  14.173  1.00 22.36 ? 527  ALA A CB    1 
ATOM   4050  N N     . PRO A  1 497 ? 31.004  19.420  12.339  1.00 21.68 ? 528  PRO A N     1 
ATOM   4051  C CA    . PRO A  1 497 ? 32.416  19.180  12.038  1.00 23.69 ? 528  PRO A CA    1 
ATOM   4052  C C     . PRO A  1 497 ? 32.976  20.414  11.353  1.00 23.93 ? 528  PRO A C     1 
ATOM   4053  O O     . PRO A  1 497 ? 33.810  21.125  11.914  1.00 22.65 ? 528  PRO A O     1 
ATOM   4054  C CB    . PRO A  1 497 ? 32.392  17.972  11.100  1.00 22.52 ? 528  PRO A CB    1 
ATOM   4055  C CG    . PRO A  1 497 ? 31.043  17.399  11.229  1.00 22.58 ? 528  PRO A CG    1 
ATOM   4056  C CD    . PRO A  1 497 ? 30.135  18.534  11.553  1.00 22.67 ? 528  PRO A CD    1 
ATOM   4057  N N     . PHE A  1 498 ? 32.485  20.650  10.141  1.00 26.41 ? 529  PHE A N     1 
ATOM   4058  C CA    . PHE A  1 498 ? 32.873  21.792  9.322   1.00 30.00 ? 529  PHE A CA    1 
ATOM   4059  C C     . PHE A  1 498 ? 33.204  22.996  10.182  1.00 32.23 ? 529  PHE A C     1 
ATOM   4060  O O     . PHE A  1 498 ? 34.222  23.654  9.984   1.00 35.33 ? 529  PHE A O     1 
ATOM   4061  C CB    . PHE A  1 498 ? 31.726  22.194  8.407   1.00 31.71 ? 529  PHE A CB    1 
ATOM   4062  C CG    . PHE A  1 498 ? 31.657  21.431  7.122   1.00 34.56 ? 529  PHE A CG    1 
ATOM   4063  C CD1   . PHE A  1 498 ? 30.486  21.447  6.366   1.00 34.50 ? 529  PHE A CD1   1 
ATOM   4064  C CD2   . PHE A  1 498 ? 32.750  20.713  6.653   1.00 35.32 ? 529  PHE A CD2   1 
ATOM   4065  C CE1   . PHE A  1 498 ? 30.406  20.762  5.166   1.00 35.79 ? 529  PHE A CE1   1 
ATOM   4066  C CE2   . PHE A  1 498 ? 32.680  20.019  5.448   1.00 36.50 ? 529  PHE A CE2   1 
ATOM   4067  C CZ    . PHE A  1 498 ? 31.508  20.044  4.702   1.00 37.47 ? 529  PHE A CZ    1 
ATOM   4068  N N     . SER A  1 499 ? 32.331  23.280  11.137  1.00 31.75 ? 530  SER A N     1 
ATOM   4069  C CA    . SER A  1 499 ? 32.512  24.418  12.012  1.00 33.45 ? 530  SER A CA    1 
ATOM   4070  C C     . SER A  1 499 ? 33.658  24.302  12.999  1.00 35.27 ? 530  SER A C     1 
ATOM   4071  O O     . SER A  1 499 ? 34.625  25.062  12.917  1.00 40.29 ? 530  SER A O     1 
ATOM   4072  C CB    . SER A  1 499 ? 31.241  24.677  12.798  1.00 36.48 ? 530  SER A CB    1 
ATOM   4073  O OG    . SER A  1 499 ? 31.526  25.475  13.934  1.00 36.97 ? 530  SER A OG    1 
ATOM   4074  N N     . LEU A  1 500 ? 33.552  23.360  13.934  1.00 35.79 ? 531  LEU A N     1 
ATOM   4075  C CA    . LEU A  1 500 ? 34.586  23.209  14.951  1.00 37.97 ? 531  LEU A CA    1 
ATOM   4076  C C     . LEU A  1 500 ? 35.990  23.055  14.389  1.00 34.28 ? 531  LEU A C     1 
ATOM   4077  O O     . LEU A  1 500 ? 36.968  23.008  15.139  1.00 35.11 ? 531  LEU A O     1 
ATOM   4078  C CB    . LEU A  1 500 ? 34.234  22.065  15.916  1.00 46.73 ? 531  LEU A CB    1 
ATOM   4079  C CG    . LEU A  1 500 ? 33.745  22.540  17.311  1.00 54.36 ? 531  LEU A CG    1 
ATOM   4080  C CD1   . LEU A  1 500 ? 32.981  23.867  17.204  1.00 54.41 ? 531  LEU A CD1   1 
ATOM   4081  C CD2   . LEU A  1 500 ? 32.837  21.488  17.933  1.00 56.77 ? 531  LEU A CD2   1 
ATOM   4082  N N     . LYS A  1 501 ? 36.083  22.982  13.066  1.00 30.12 ? 532  LYS A N     1 
ATOM   4083  C CA    . LYS A  1 501 ? 37.371  22.904  12.408  1.00 26.23 ? 532  LYS A CA    1 
ATOM   4084  C C     . LYS A  1 501 ? 37.807  24.354  12.378  1.00 24.26 ? 532  LYS A C     1 
ATOM   4085  O O     . LYS A  1 501 ? 38.413  24.841  13.326  1.00 25.52 ? 532  LYS A O     1 
ATOM   4086  C CB    . LYS A  1 501 ? 37.237  22.383  10.980  1.00 32.40 ? 532  LYS A CB    1 
ATOM   4087  C CG    . LYS A  1 501 ? 38.174  21.224  10.625  1.00 37.83 ? 532  LYS A CG    1 
ATOM   4088  C CD    . LYS A  1 501 ? 39.619  21.494  11.017  1.00 44.15 ? 532  LYS A CD    1 
ATOM   4089  C CE    . LYS A  1 501 ? 40.359  20.184  11.269  1.00 47.21 ? 532  LYS A CE    1 
ATOM   4090  N NZ    . LYS A  1 501 ? 41.724  20.154  10.666  1.00 48.57 ? 532  LYS A NZ    1 
ATOM   4091  N N     . GLY A  1 502 ? 37.451  25.055  11.308  1.00 21.16 ? 533  GLY A N     1 
ATOM   4092  C CA    . GLY A  1 502 ? 37.815  26.456  11.177  1.00 16.46 ? 533  GLY A CA    1 
ATOM   4093  C C     . GLY A  1 502 ? 37.705  27.242  12.462  1.00 13.77 ? 533  GLY A C     1 
ATOM   4094  O O     . GLY A  1 502 ? 38.208  28.352  12.564  1.00 13.86 ? 533  GLY A O     1 
ATOM   4095  N N     . LEU A  1 503 ? 37.015  26.680  13.441  1.00 12.22 ? 534  LEU A N     1 
ATOM   4096  C CA    . LEU A  1 503 ? 36.878  27.332  14.736  1.00 14.63 ? 534  LEU A CA    1 
ATOM   4097  C C     . LEU A  1 503 ? 38.129  27.022  15.556  1.00 14.06 ? 534  LEU A C     1 
ATOM   4098  O O     . LEU A  1 503 ? 38.812  27.927  16.041  1.00 11.31 ? 534  LEU A O     1 
ATOM   4099  C CB    . LEU A  1 503 ? 35.640  26.811  15.471  1.00 15.72 ? 534  LEU A CB    1 
ATOM   4100  C CG    . LEU A  1 503 ? 34.626  27.838  16.006  1.00 15.03 ? 534  LEU A CG    1 
ATOM   4101  C CD1   . LEU A  1 503 ? 35.152  29.271  15.893  1.00 14.23 ? 534  LEU A CD1   1 
ATOM   4102  C CD2   . LEU A  1 503 ? 33.334  27.685  15.230  1.00 15.69 ? 534  LEU A CD2   1 
ATOM   4103  N N     . MET A  1 504 ? 38.412  25.729  15.696  1.00 13.69 ? 535  MET A N     1 
ATOM   4104  C CA    . MET A  1 504 ? 39.572  25.260  16.434  1.00 13.91 ? 535  MET A CA    1 
ATOM   4105  C C     . MET A  1 504 ? 40.837  25.352  15.585  1.00 16.21 ? 535  MET A C     1 
ATOM   4106  O O     . MET A  1 504 ? 41.854  25.917  16.018  1.00 17.16 ? 535  MET A O     1 
ATOM   4107  C CB    . MET A  1 504 ? 39.353  23.815  16.884  1.00 10.12 ? 535  MET A CB    1 
ATOM   4108  C CG    . MET A  1 504 ? 38.575  23.695  18.175  1.00 2.00  ? 535  MET A CG    1 
ATOM   4109  S SD    . MET A  1 504 ? 38.433  25.283  19.037  1.00 9.65  ? 535  MET A SD    1 
ATOM   4110  C CE    . MET A  1 504 ? 38.717  24.774  20.745  1.00 2.00  ? 535  MET A CE    1 
ATOM   4111  N N     . GLY A  1 505 ? 40.763  24.788  14.376  1.00 19.30 ? 536  GLY A N     1 
ATOM   4112  C CA    . GLY A  1 505 ? 41.885  24.784  13.441  1.00 14.65 ? 536  GLY A CA    1 
ATOM   4113  C C     . GLY A  1 505 ? 42.512  26.139  13.187  1.00 14.62 ? 536  GLY A C     1 
ATOM   4114  O O     . GLY A  1 505 ? 43.433  26.252  12.387  1.00 16.12 ? 536  GLY A O     1 
ATOM   4115  N N     . ASN A  1 506 ? 42.009  27.175  13.848  1.00 16.53 ? 537  ASN A N     1 
ATOM   4116  C CA    . ASN A  1 506 ? 42.589  28.491  13.670  1.00 18.13 ? 537  ASN A CA    1 
ATOM   4117  C C     . ASN A  1 506 ? 43.927  28.512  14.382  1.00 16.53 ? 537  ASN A C     1 
ATOM   4118  O O     . ASN A  1 506 ? 44.088  27.922  15.452  1.00 17.12 ? 537  ASN A O     1 
ATOM   4119  C CB    . ASN A  1 506 ? 41.709  29.574  14.265  1.00 17.22 ? 537  ASN A CB    1 
ATOM   4120  C CG    . ASN A  1 506 ? 42.474  30.855  14.514  1.00 22.48 ? 537  ASN A CG    1 
ATOM   4121  O OD1   . ASN A  1 506 ? 43.296  30.939  15.433  1.00 20.57 ? 537  ASN A OD1   1 
ATOM   4122  N ND2   . ASN A  1 506 ? 42.214  31.866  13.688  1.00 24.09 ? 537  ASN A ND2   1 
ATOM   4123  N N     . PRO A  1 507 ? 44.910  29.201  13.793  1.00 15.63 ? 538  PRO A N     1 
ATOM   4124  C CA    . PRO A  1 507 ? 46.258  29.324  14.351  1.00 15.90 ? 538  PRO A CA    1 
ATOM   4125  C C     . PRO A  1 507 ? 46.248  29.526  15.862  1.00 14.55 ? 538  PRO A C     1 
ATOM   4126  O O     . PRO A  1 507 ? 46.667  28.653  16.606  1.00 15.34 ? 538  PRO A O     1 
ATOM   4127  C CB    . PRO A  1 507 ? 46.839  30.553  13.633  1.00 18.14 ? 538  PRO A CB    1 
ATOM   4128  C CG    . PRO A  1 507 ? 45.710  31.108  12.746  1.00 11.90 ? 538  PRO A CG    1 
ATOM   4129  C CD    . PRO A  1 507 ? 44.786  29.943  12.527  1.00 17.67 ? 538  PRO A CD    1 
ATOM   4130  N N     . ILE A  1 508 ? 45.754  30.686  16.292  1.00 11.34 ? 539  ILE A N     1 
ATOM   4131  C CA    . ILE A  1 508 ? 45.694  31.062  17.704  1.00 9.66  ? 539  ILE A CA    1 
ATOM   4132  C C     . ILE A  1 508 ? 45.220  29.982  18.669  1.00 8.85  ? 539  ILE A C     1 
ATOM   4133  O O     . ILE A  1 508 ? 45.303  30.155  19.882  1.00 11.37 ? 539  ILE A O     1 
ATOM   4134  C CB    . ILE A  1 508 ? 44.809  32.341  17.912  1.00 8.03  ? 539  ILE A CB    1 
ATOM   4135  C CG1   . ILE A  1 508 ? 43.454  31.964  18.502  1.00 8.84  ? 539  ILE A CG1   1 
ATOM   4136  C CG2   . ILE A  1 508 ? 44.572  33.058  16.590  1.00 2.31  ? 539  ILE A CG2   1 
ATOM   4137  C CD1   . ILE A  1 508 ? 43.304  32.391  19.939  1.00 6.28  ? 539  ILE A CD1   1 
ATOM   4138  N N     . CYS A  1 509 ? 44.702  28.880  18.148  1.00 8.54  ? 540  CYS A N     1 
ATOM   4139  C CA    . CYS A  1 509 ? 44.248  27.806  19.021  1.00 14.04 ? 540  CYS A CA    1 
ATOM   4140  C C     . CYS A  1 509 ? 45.313  26.729  19.156  1.00 15.70 ? 540  CYS A C     1 
ATOM   4141  O O     . CYS A  1 509 ? 45.158  25.772  19.923  1.00 16.67 ? 540  CYS A O     1 
ATOM   4142  C CB    . CYS A  1 509 ? 42.949  27.205  18.486  1.00 13.23 ? 540  CYS A CB    1 
ATOM   4143  S SG    . CYS A  1 509 ? 41.604  28.392  18.564  1.00 26.25 ? 540  CYS A SG    1 
ATOM   4144  N N     . SER A  1 510 ? 46.392  26.908  18.398  1.00 18.62 ? 541  SER A N     1 
ATOM   4145  C CA    . SER A  1 510 ? 47.529  25.991  18.384  1.00 20.09 ? 541  SER A CA    1 
ATOM   4146  C C     . SER A  1 510 ? 48.432  26.251  19.585  1.00 19.35 ? 541  SER A C     1 
ATOM   4147  O O     . SER A  1 510 ? 48.522  27.379  20.089  1.00 20.59 ? 541  SER A O     1 
ATOM   4148  C CB    . SER A  1 510 ? 48.328  26.160  17.100  1.00 17.55 ? 541  SER A CB    1 
ATOM   4149  O OG    . SER A  1 510 ? 48.818  27.482  17.007  1.00 16.72 ? 541  SER A OG    1 
ATOM   4150  N N     . PRO A  1 511 ? 49.154  25.216  20.024  1.00 20.90 ? 542  PRO A N     1 
ATOM   4151  C CA    . PRO A  1 511 ? 50.054  25.285  21.176  1.00 23.04 ? 542  PRO A CA    1 
ATOM   4152  C C     . PRO A  1 511 ? 50.977  26.496  21.221  1.00 26.92 ? 542  PRO A C     1 
ATOM   4153  O O     . PRO A  1 511 ? 50.942  27.292  22.167  1.00 29.50 ? 542  PRO A O     1 
ATOM   4154  C CB    . PRO A  1 511 ? 50.826  23.978  21.106  1.00 24.43 ? 542  PRO A CB    1 
ATOM   4155  C CG    . PRO A  1 511 ? 49.936  23.046  20.321  1.00 23.17 ? 542  PRO A CG    1 
ATOM   4156  C CD    . PRO A  1 511 ? 49.191  23.903  19.355  1.00 21.54 ? 542  PRO A CD    1 
ATOM   4157  N N     . GLN A  1 512 ? 51.806  26.642  20.199  1.00 28.39 ? 543  GLN A N     1 
ATOM   4158  C CA    . GLN A  1 512 ? 52.737  27.761  20.160  1.00 29.91 ? 543  GLN A CA    1 
ATOM   4159  C C     . GLN A  1 512 ? 52.028  29.089  19.889  1.00 24.97 ? 543  GLN A C     1 
ATOM   4160  O O     . GLN A  1 512 ? 52.550  29.940  19.176  1.00 27.17 ? 543  GLN A O     1 
ATOM   4161  C CB    . GLN A  1 512 ? 53.821  27.514  19.096  1.00 38.98 ? 543  GLN A CB    1 
ATOM   4162  C CG    . GLN A  1 512 ? 53.597  26.298  18.193  1.00 52.93 ? 543  GLN A CG    1 
ATOM   4163  C CD    . GLN A  1 512 ? 52.316  26.389  17.360  1.00 62.63 ? 543  GLN A CD    1 
ATOM   4164  O OE1   . GLN A  1 512 ? 51.333  25.694  17.637  1.00 64.67 ? 543  GLN A OE1   1 
ATOM   4165  N NE2   . GLN A  1 512 ? 52.326  27.241  16.337  1.00 66.65 ? 543  GLN A NE2   1 
ATOM   4166  N N     . TYR A  1 513 ? 50.844  29.273  20.456  1.00 19.05 ? 544  TYR A N     1 
ATOM   4167  C CA    . TYR A  1 513 ? 50.102  30.510  20.230  1.00 13.93 ? 544  TYR A CA    1 
ATOM   4168  C C     . TYR A  1 513 ? 49.232  30.810  21.432  1.00 14.03 ? 544  TYR A C     1 
ATOM   4169  O O     . TYR A  1 513 ? 49.051  31.969  21.834  1.00 2.00  ? 544  TYR A O     1 
ATOM   4170  C CB    . TYR A  1 513 ? 49.220  30.361  18.997  1.00 7.11  ? 544  TYR A CB    1 
ATOM   4171  C CG    . TYR A  1 513 ? 49.801  30.988  17.759  1.00 2.00  ? 544  TYR A CG    1 
ATOM   4172  C CD1   . TYR A  1 513 ? 49.620  32.350  17.493  1.00 2.00  ? 544  TYR A CD1   1 
ATOM   4173  C CD2   . TYR A  1 513 ? 50.507  30.225  16.837  1.00 2.00  ? 544  TYR A CD2   1 
ATOM   4174  C CE1   . TYR A  1 513 ? 50.120  32.938  16.341  1.00 2.00  ? 544  TYR A CE1   1 
ATOM   4175  C CE2   . TYR A  1 513 ? 51.017  30.803  15.675  1.00 9.27  ? 544  TYR A CE2   1 
ATOM   4176  C CZ    . TYR A  1 513 ? 50.815  32.168  15.433  1.00 6.21  ? 544  TYR A CZ    1 
ATOM   4177  O OH    . TYR A  1 513 ? 51.307  32.762  14.282  1.00 6.96  ? 544  TYR A OH    1 
ATOM   4178  N N     . TRP A  1 514 ? 48.707  29.729  21.998  1.00 14.28 ? 545  TRP A N     1 
ATOM   4179  C CA    . TRP A  1 514 ? 47.840  29.812  23.148  1.00 16.44 ? 545  TRP A CA    1 
ATOM   4180  C C     . TRP A  1 514 ? 48.581  30.201  24.421  1.00 12.81 ? 545  TRP A C     1 
ATOM   4181  O O     . TRP A  1 514 ? 48.903  29.339  25.232  1.00 9.30  ? 545  TRP A O     1 
ATOM   4182  C CB    . TRP A  1 514 ? 47.115  28.472  23.338  1.00 20.88 ? 545  TRP A CB    1 
ATOM   4183  C CG    . TRP A  1 514 ? 45.803  28.609  24.055  1.00 26.57 ? 545  TRP A CG    1 
ATOM   4184  C CD1   . TRP A  1 514 ? 45.331  27.814  25.063  1.00 27.75 ? 545  TRP A CD1   1 
ATOM   4185  C CD2   . TRP A  1 514 ? 44.840  29.669  23.895  1.00 29.78 ? 545  TRP A CD2   1 
ATOM   4186  N NE1   . TRP A  1 514 ? 44.144  28.321  25.545  1.00 33.36 ? 545  TRP A NE1   1 
ATOM   4187  C CE2   . TRP A  1 514 ? 43.823  29.454  24.846  1.00 29.41 ? 545  TRP A CE2   1 
ATOM   4188  C CE3   . TRP A  1 514 ? 44.748  30.778  23.040  1.00 34.58 ? 545  TRP A CE3   1 
ATOM   4189  C CZ2   . TRP A  1 514 ? 42.724  30.309  24.968  1.00 31.96 ? 545  TRP A CZ2   1 
ATOM   4190  C CZ3   . TRP A  1 514 ? 43.653  31.629  23.164  1.00 34.70 ? 545  TRP A CZ3   1 
ATOM   4191  C CH2   . TRP A  1 514 ? 42.658  31.387  24.121  1.00 34.00 ? 545  TRP A CH2   1 
ATOM   4192  N N     . LYS A  1 515 ? 48.847  31.498  24.586  1.00 9.97  ? 546  LYS A N     1 
ATOM   4193  C CA    . LYS A  1 515 ? 49.531  32.005  25.781  1.00 9.59  ? 546  LYS A CA    1 
ATOM   4194  C C     . LYS A  1 515 ? 49.475  33.531  25.910  1.00 3.00  ? 546  LYS A C     1 
ATOM   4195  O O     . LYS A  1 515 ? 49.550  34.262  24.929  1.00 2.00  ? 546  LYS A O     1 
ATOM   4196  C CB    . LYS A  1 515 ? 50.997  31.527  25.829  1.00 21.97 ? 546  LYS A CB    1 
ATOM   4197  C CG    . LYS A  1 515 ? 51.718  31.454  24.482  1.00 24.95 ? 546  LYS A CG    1 
ATOM   4198  C CD    . LYS A  1 515 ? 53.057  30.739  24.602  1.00 26.03 ? 546  LYS A CD    1 
ATOM   4199  C CE    . LYS A  1 515 ? 53.520  30.174  23.265  1.00 32.21 ? 546  LYS A CE    1 
ATOM   4200  N NZ    . LYS A  1 515 ? 54.980  30.404  23.033  1.00 39.83 ? 546  LYS A NZ    1 
ATOM   4201  N N     . PRO A  1 516 ? 49.363  34.023  27.144  1.00 2.00  ? 547  PRO A N     1 
ATOM   4202  C CA    . PRO A  1 516 ? 49.287  35.463  27.463  1.00 8.09  ? 547  PRO A CA    1 
ATOM   4203  C C     . PRO A  1 516 ? 50.097  36.335  26.516  1.00 11.87 ? 547  PRO A C     1 
ATOM   4204  O O     . PRO A  1 516 ? 49.598  37.316  25.941  1.00 10.66 ? 547  PRO A O     1 
ATOM   4205  C CB    . PRO A  1 516 ? 49.823  35.558  28.888  1.00 2.00  ? 547  PRO A CB    1 
ATOM   4206  C CG    . PRO A  1 516 ? 49.917  34.084  29.387  1.00 7.07  ? 547  PRO A CG    1 
ATOM   4207  C CD    . PRO A  1 516 ? 49.342  33.176  28.347  1.00 2.00  ? 547  PRO A CD    1 
ATOM   4208  N N     . SER A  1 517 ? 51.364  35.961  26.385  1.00 13.10 ? 548  SER A N     1 
ATOM   4209  C CA    . SER A  1 517 ? 52.313  36.645  25.527  1.00 11.48 ? 548  SER A CA    1 
ATOM   4210  C C     . SER A  1 517 ? 51.633  37.011  24.220  1.00 10.07 ? 548  SER A C     1 
ATOM   4211  O O     . SER A  1 517 ? 51.455  38.198  23.905  1.00 12.38 ? 548  SER A O     1 
ATOM   4212  C CB    . SER A  1 517 ? 53.475  35.707  25.233  1.00 12.65 ? 548  SER A CB    1 
ATOM   4213  O OG    . SER A  1 517 ? 52.969  34.405  24.954  1.00 9.00  ? 548  SER A OG    1 
ATOM   4214  N N     . THR A  1 518 ? 51.252  35.969  23.479  1.00 2.27  ? 549  THR A N     1 
ATOM   4215  C CA    . THR A  1 518 ? 50.604  36.112  22.193  1.00 2.00  ? 549  THR A CA    1 
ATOM   4216  C C     . THR A  1 518 ? 49.615  37.243  22.161  1.00 6.82  ? 549  THR A C     1 
ATOM   4217  O O     . THR A  1 518 ? 49.329  37.787  21.097  1.00 7.14  ? 549  THR A O     1 
ATOM   4218  C CB    . THR A  1 518 ? 49.849  34.860  21.816  1.00 3.43  ? 549  THR A CB    1 
ATOM   4219  O OG1   . THR A  1 518 ? 50.405  33.737  22.506  1.00 4.97  ? 549  THR A OG1   1 
ATOM   4220  C CG2   . THR A  1 518 ? 49.935  34.626  20.325  1.00 6.02  ? 549  THR A CG2   1 
ATOM   4221  N N     . PHE A  1 519 ? 49.092  37.602  23.334  1.00 10.02 ? 550  PHE A N     1 
ATOM   4222  C CA    . PHE A  1 519 ? 48.086  38.666  23.438  1.00 9.68  ? 550  PHE A CA    1 
ATOM   4223  C C     . PHE A  1 519 ? 48.429  39.819  24.374  1.00 9.74  ? 550  PHE A C     1 
ATOM   4224  O O     . PHE A  1 519 ? 47.527  40.431  24.947  1.00 12.72 ? 550  PHE A O     1 
ATOM   4225  C CB    . PHE A  1 519 ? 46.735  38.063  23.878  1.00 8.68  ? 550  PHE A CB    1 
ATOM   4226  C CG    . PHE A  1 519 ? 46.422  36.733  23.234  1.00 5.68  ? 550  PHE A CG    1 
ATOM   4227  C CD1   . PHE A  1 519 ? 46.746  35.541  23.864  1.00 2.00  ? 550  PHE A CD1   1 
ATOM   4228  C CD2   . PHE A  1 519 ? 45.845  36.682  21.967  1.00 4.07  ? 550  PHE A CD2   1 
ATOM   4229  C CE1   . PHE A  1 519 ? 46.504  34.324  23.240  1.00 2.00  ? 550  PHE A CE1   1 
ATOM   4230  C CE2   . PHE A  1 519 ? 45.604  35.461  21.340  1.00 2.00  ? 550  PHE A CE2   1 
ATOM   4231  C CZ    . PHE A  1 519 ? 45.934  34.285  21.977  1.00 2.00  ? 550  PHE A CZ    1 
ATOM   4232  N N     . GLY A  1 520 ? 49.703  40.140  24.539  1.00 9.14  ? 551  GLY A N     1 
ATOM   4233  C CA    . GLY A  1 520 ? 50.005  41.244  25.429  1.00 4.72  ? 551  GLY A CA    1 
ATOM   4234  C C     . GLY A  1 520 ? 49.862  40.773  26.861  1.00 4.88  ? 551  GLY A C     1 
ATOM   4235  O O     . GLY A  1 520 ? 49.675  41.575  27.777  1.00 2.00  ? 551  GLY A O     1 
ATOM   4236  N N     . GLY A  1 521 ? 49.933  39.454  27.036  1.00 7.68  ? 552  GLY A N     1 
ATOM   4237  C CA    . GLY A  1 521 ? 49.866  38.865  28.363  1.00 10.83 ? 552  GLY A CA    1 
ATOM   4238  C C     . GLY A  1 521 ? 48.508  38.690  28.997  1.00 12.38 ? 552  GLY A C     1 
ATOM   4239  O O     . GLY A  1 521 ? 47.496  39.093  28.444  1.00 13.44 ? 552  GLY A O     1 
ATOM   4240  N N     . GLU A  1 522 ? 48.518  38.094  30.186  1.00 17.94 ? 553  GLU A N     1 
ATOM   4241  C CA    . GLU A  1 522 ? 47.318  37.803  30.975  1.00 18.54 ? 553  GLU A CA    1 
ATOM   4242  C C     . GLU A  1 522 ? 46.132  38.732  30.792  1.00 18.57 ? 553  GLU A C     1 
ATOM   4243  O O     . GLU A  1 522 ? 45.050  38.272  30.441  1.00 19.34 ? 553  GLU A O     1 
ATOM   4244  C CB    . GLU A  1 522 ? 47.660  37.734  32.470  1.00 18.89 ? 553  GLU A CB    1 
ATOM   4245  C CG    . GLU A  1 522 ? 48.509  36.543  32.856  1.00 27.66 ? 553  GLU A CG    1 
ATOM   4246  C CD    . GLU A  1 522 ? 47.976  35.223  32.314  1.00 36.04 ? 553  GLU A CD    1 
ATOM   4247  O OE1   . GLU A  1 522 ? 47.249  35.228  31.295  1.00 38.21 ? 553  GLU A OE1   1 
ATOM   4248  O OE2   . GLU A  1 522 ? 48.288  34.167  32.913  1.00 35.80 ? 553  GLU A OE2   1 
ATOM   4249  N N     . VAL A  1 523 ? 46.324  40.027  31.041  1.00 14.87 ? 554  VAL A N     1 
ATOM   4250  C CA    . VAL A  1 523 ? 45.240  40.986  30.904  1.00 14.84 ? 554  VAL A CA    1 
ATOM   4251  C C     . VAL A  1 523 ? 44.544  40.761  29.567  1.00 18.04 ? 554  VAL A C     1 
ATOM   4252  O O     . VAL A  1 523 ? 43.438  40.228  29.507  1.00 18.85 ? 554  VAL A O     1 
ATOM   4253  C CB    . VAL A  1 523 ? 45.764  42.430  30.961  1.00 14.84 ? 554  VAL A CB    1 
ATOM   4254  C CG1   . VAL A  1 523 ? 44.798  43.374  30.251  1.00 17.58 ? 554  VAL A CG1   1 
ATOM   4255  C CG2   . VAL A  1 523 ? 45.923  42.865  32.404  1.00 16.57 ? 554  VAL A CG2   1 
ATOM   4256  N N     . GLY A  1 524 ? 45.202  41.158  28.490  1.00 16.37 ? 555  GLY A N     1 
ATOM   4257  C CA    . GLY A  1 524 ? 44.622  40.973  27.175  1.00 19.10 ? 555  GLY A CA    1 
ATOM   4258  C C     . GLY A  1 524 ? 44.265  39.531  26.838  1.00 18.71 ? 555  GLY A C     1 
ATOM   4259  O O     . GLY A  1 524 ? 43.538  39.284  25.869  1.00 21.15 ? 555  GLY A O     1 
ATOM   4260  N N     . PHE A  1 525 ? 44.783  38.578  27.614  1.00 17.26 ? 556  PHE A N     1 
ATOM   4261  C CA    . PHE A  1 525 ? 44.481  37.171  27.383  1.00 17.33 ? 556  PHE A CA    1 
ATOM   4262  C C     . PHE A  1 525 ? 43.115  36.917  27.988  1.00 18.57 ? 556  PHE A C     1 
ATOM   4263  O O     . PHE A  1 525 ? 42.202  36.444  27.302  1.00 19.67 ? 556  PHE A O     1 
ATOM   4264  C CB    . PHE A  1 525 ? 45.512  36.267  28.062  1.00 15.21 ? 556  PHE A CB    1 
ATOM   4265  C CG    . PHE A  1 525 ? 45.395  34.809  27.677  1.00 13.41 ? 556  PHE A CG    1 
ATOM   4266  C CD1   . PHE A  1 525 ? 45.094  34.438  26.365  1.00 9.16  ? 556  PHE A CD1   1 
ATOM   4267  C CD2   . PHE A  1 525 ? 45.609  33.800  28.621  1.00 10.37 ? 556  PHE A CD2   1 
ATOM   4268  C CE1   . PHE A  1 525 ? 45.009  33.075  25.996  1.00 2.00  ? 556  PHE A CE1   1 
ATOM   4269  C CE2   . PHE A  1 525 ? 45.523  32.439  28.259  1.00 2.00  ? 556  PHE A CE2   1 
ATOM   4270  C CZ    . PHE A  1 525 ? 45.223  32.079  26.943  1.00 2.00  ? 556  PHE A CZ    1 
ATOM   4271  N N     . LYS A  1 526 ? 42.982  37.241  29.273  1.00 18.71 ? 557  LYS A N     1 
ATOM   4272  C CA    . LYS A  1 526 ? 41.725  37.060  29.992  1.00 19.63 ? 557  LYS A CA    1 
ATOM   4273  C C     . LYS A  1 526 ? 40.587  37.507  29.094  1.00 19.38 ? 557  LYS A C     1 
ATOM   4274  O O     . LYS A  1 526 ? 39.625  36.758  28.882  1.00 19.80 ? 557  LYS A O     1 
ATOM   4275  C CB    . LYS A  1 526 ? 41.711  37.899  31.270  1.00 24.68 ? 557  LYS A CB    1 
ATOM   4276  C CG    . LYS A  1 526 ? 40.557  37.579  32.206  1.00 25.56 ? 557  LYS A CG    1 
ATOM   4277  C CD    . LYS A  1 526 ? 40.387  38.649  33.291  1.00 27.79 ? 557  LYS A CD    1 
ATOM   4278  C CE    . LYS A  1 526 ? 40.073  38.010  34.646  1.00 29.24 ? 557  LYS A CE    1 
ATOM   4279  N NZ    . LYS A  1 526 ? 39.858  39.025  35.712  1.00 26.56 ? 557  LYS A NZ    1 
ATOM   4280  N N     . ILE A  1 527 ? 40.713  38.729  28.572  1.00 16.00 ? 558  ILE A N     1 
ATOM   4281  C CA    . ILE A  1 527 ? 39.723  39.300  27.682  1.00 13.68 ? 558  ILE A CA    1 
ATOM   4282  C C     . ILE A  1 527 ? 39.064  38.209  26.855  1.00 14.50 ? 558  ILE A C     1 
ATOM   4283  O O     . ILE A  1 527 ? 37.854  38.002  26.939  1.00 19.91 ? 558  ILE A O     1 
ATOM   4284  C CB    . ILE A  1 527 ? 40.366  40.322  26.755  1.00 8.13  ? 558  ILE A CB    1 
ATOM   4285  C CG1   . ILE A  1 527 ? 40.607  41.618  27.536  1.00 9.96  ? 558  ILE A CG1   1 
ATOM   4286  C CG2   . ILE A  1 527 ? 39.502  40.531  25.523  1.00 2.00  ? 558  ILE A CG2   1 
ATOM   4287  C CD1   . ILE A  1 527 ? 40.850  42.849  26.666  1.00 6.79  ? 558  ILE A CD1   1 
ATOM   4288  N N     . ILE A  1 528 ? 39.849  37.499  26.064  1.00 12.89 ? 559  ILE A N     1 
ATOM   4289  C CA    . ILE A  1 528 ? 39.275  36.431  25.270  1.00 18.37 ? 559  ILE A CA    1 
ATOM   4290  C C     . ILE A  1 528 ? 38.567  35.369  26.125  1.00 19.88 ? 559  ILE A C     1 
ATOM   4291  O O     . ILE A  1 528 ? 37.416  35.026  25.869  1.00 23.63 ? 559  ILE A O     1 
ATOM   4292  C CB    . ILE A  1 528 ? 40.338  35.723  24.435  1.00 16.27 ? 559  ILE A CB    1 
ATOM   4293  C CG1   . ILE A  1 528 ? 40.972  36.718  23.468  1.00 15.72 ? 559  ILE A CG1   1 
ATOM   4294  C CG2   . ILE A  1 528 ? 39.704  34.545  23.684  1.00 16.08 ? 559  ILE A CG2   1 
ATOM   4295  C CD1   . ILE A  1 528 ? 42.078  36.121  22.651  1.00 15.28 ? 559  ILE A CD1   1 
ATOM   4296  N N     . ASN A  1 529 ? 39.257  34.853  27.132  1.00 21.74 ? 560  ASN A N     1 
ATOM   4297  C CA    . ASN A  1 529 ? 38.697  33.826  28.001  1.00 27.67 ? 560  ASN A CA    1 
ATOM   4298  C C     . ASN A  1 529 ? 37.461  34.264  28.786  1.00 28.56 ? 560  ASN A C     1 
ATOM   4299  O O     . ASN A  1 529 ? 36.786  33.440  29.418  1.00 31.86 ? 560  ASN A O     1 
ATOM   4300  C CB    . ASN A  1 529 ? 39.775  33.343  28.957  1.00 33.17 ? 560  ASN A CB    1 
ATOM   4301  C CG    . ASN A  1 529 ? 41.144  33.341  28.316  1.00 38.92 ? 560  ASN A CG    1 
ATOM   4302  O OD1   . ASN A  1 529 ? 41.347  32.705  27.278  1.00 39.60 ? 560  ASN A OD1   1 
ATOM   4303  N ND2   . ASN A  1 529 ? 42.095  34.060  28.926  1.00 35.54 ? 560  ASN A ND2   1 
ATOM   4304  N N     . THR A  1 530 ? 37.171  35.561  28.763  1.00 27.15 ? 561  THR A N     1 
ATOM   4305  C CA    . THR A  1 530 ? 35.994  36.090  29.446  1.00 24.63 ? 561  THR A CA    1 
ATOM   4306  C C     . THR A  1 530 ? 35.269  36.987  28.450  1.00 25.31 ? 561  THR A C     1 
ATOM   4307  O O     . THR A  1 530 ? 35.166  38.201  28.620  1.00 28.55 ? 561  THR A O     1 
ATOM   4308  C CB    . THR A  1 530 ? 36.369  36.898  30.715  1.00 20.63 ? 561  THR A CB    1 
ATOM   4309  O OG1   . THR A  1 530 ? 37.009  38.124  30.353  1.00 17.49 ? 561  THR A OG1   1 
ATOM   4310  C CG2   . THR A  1 530 ? 37.295  36.101  31.574  1.00 20.48 ? 561  THR A CG2   1 
ATOM   4311  N N     . ALA A  1 531 ? 34.779  36.368  27.389  1.00 24.59 ? 562  ALA A N     1 
ATOM   4312  C CA    . ALA A  1 531 ? 34.078  37.097  26.352  1.00 22.65 ? 562  ALA A CA    1 
ATOM   4313  C C     . ALA A  1 531 ? 32.729  36.449  26.073  1.00 21.31 ? 562  ALA A C     1 
ATOM   4314  O O     . ALA A  1 531 ? 32.626  35.227  25.930  1.00 22.52 ? 562  ALA A O     1 
ATOM   4315  C CB    . ALA A  1 531 ? 34.937  37.138  25.067  1.00 26.16 ? 562  ALA A CB    1 
ATOM   4316  N N     . SER A  1 532 ? 31.696  37.277  26.008  1.00 20.30 ? 563  SER A N     1 
ATOM   4317  C CA    . SER A  1 532 ? 30.346  36.804  25.740  1.00 15.98 ? 563  SER A CA    1 
ATOM   4318  C C     . SER A  1 532 ? 29.695  37.852  24.880  1.00 14.73 ? 563  SER A C     1 
ATOM   4319  O O     . SER A  1 532 ? 29.950  39.053  25.045  1.00 14.12 ? 563  SER A O     1 
ATOM   4320  C CB    . SER A  1 532 ? 29.545  36.669  27.031  1.00 15.71 ? 563  SER A CB    1 
ATOM   4321  O OG    . SER A  1 532 ? 29.055  37.942  27.435  1.00 17.07 ? 563  SER A OG    1 
ATOM   4322  N N     . ILE A  1 533 ? 28.867  37.398  23.951  1.00 13.46 ? 564  ILE A N     1 
ATOM   4323  C CA    . ILE A  1 533 ? 28.168  38.318  23.076  1.00 11.88 ? 564  ILE A CA    1 
ATOM   4324  C C     . ILE A  1 533 ? 27.614  39.412  23.974  1.00 11.58 ? 564  ILE A C     1 
ATOM   4325  O O     . ILE A  1 533 ? 27.543  40.577  23.599  1.00 8.73  ? 564  ILE A O     1 
ATOM   4326  C CB    . ILE A  1 533 ? 27.008  37.614  22.350  1.00 12.31 ? 564  ILE A CB    1 
ATOM   4327  C CG1   . ILE A  1 533 ? 26.276  38.624  21.459  1.00 13.74 ? 564  ILE A CG1   1 
ATOM   4328  C CG2   . ILE A  1 533 ? 26.058  36.975  23.371  1.00 8.49  ? 564  ILE A CG2   1 
ATOM   4329  C CD1   . ILE A  1 533 ? 27.049  39.030  20.207  1.00 12.49 ? 564  ILE A CD1   1 
ATOM   4330  N N     . GLN A  1 534 ? 27.245  39.005  25.181  1.00 11.24 ? 565  GLN A N     1 
ATOM   4331  C CA    . GLN A  1 534 ? 26.700  39.909  26.171  1.00 11.73 ? 565  GLN A CA    1 
ATOM   4332  C C     . GLN A  1 534 ? 27.660  41.061  26.409  1.00 8.55  ? 565  GLN A C     1 
ATOM   4333  O O     . GLN A  1 534 ? 27.401  42.190  26.007  1.00 2.00  ? 565  GLN A O     1 
ATOM   4334  C CB    . GLN A  1 534 ? 26.449  39.151  27.477  1.00 18.69 ? 565  GLN A CB    1 
ATOM   4335  C CG    . GLN A  1 534 ? 26.095  40.033  28.670  1.00 23.73 ? 565  GLN A CG    1 
ATOM   4336  C CD    . GLN A  1 534 ? 25.093  41.122  28.323  1.00 25.78 ? 565  GLN A CD    1 
ATOM   4337  O OE1   . GLN A  1 534 ? 23.879  40.910  28.368  1.00 27.81 ? 565  GLN A OE1   1 
ATOM   4338  N NE2   . GLN A  1 534 ? 25.600  42.299  27.974  1.00 27.45 ? 565  GLN A NE2   1 
ATOM   4339  N N     . SER A  1 535 ? 28.768  40.767  27.072  1.00 10.56 ? 566  SER A N     1 
ATOM   4340  C CA    . SER A  1 535 ? 29.772  41.782  27.354  1.00 10.31 ? 566  SER A CA    1 
ATOM   4341  C C     . SER A  1 535 ? 30.147  42.504  26.071  1.00 8.02  ? 566  SER A C     1 
ATOM   4342  O O     . SER A  1 535 ? 30.257  43.729  26.061  1.00 2.00  ? 566  SER A O     1 
ATOM   4343  C CB    . SER A  1 535 ? 31.023  41.130  27.941  1.00 14.18 ? 566  SER A CB    1 
ATOM   4344  O OG    . SER A  1 535 ? 31.396  39.978  27.183  1.00 9.19  ? 566  SER A OG    1 
ATOM   4345  N N     . LEU A  1 536 ? 30.352  41.738  24.993  1.00 9.20  ? 567  LEU A N     1 
ATOM   4346  C CA    . LEU A  1 536 ? 30.717  42.328  23.717  1.00 9.74  ? 567  LEU A CA    1 
ATOM   4347  C C     . LEU A  1 536 ? 29.839  43.553  23.510  1.00 15.69 ? 567  LEU A C     1 
ATOM   4348  O O     . LEU A  1 536 ? 30.312  44.642  23.170  1.00 16.30 ? 567  LEU A O     1 
ATOM   4349  C CB    . LEU A  1 536 ? 30.502  41.345  22.563  1.00 9.08  ? 567  LEU A CB    1 
ATOM   4350  C CG    . LEU A  1 536 ? 30.414  42.020  21.171  1.00 11.82 ? 567  LEU A CG    1 
ATOM   4351  C CD1   . LEU A  1 536 ? 31.515  43.082  21.013  1.00 9.49  ? 567  LEU A CD1   1 
ATOM   4352  C CD2   . LEU A  1 536 ? 30.564  40.970  20.073  1.00 10.00 ? 567  LEU A CD2   1 
ATOM   4353  N N     . ILE A  1 537 ? 28.550  43.370  23.739  1.00 19.52 ? 568  ILE A N     1 
ATOM   4354  C CA    . ILE A  1 537 ? 27.610  44.462  23.583  1.00 26.76 ? 568  ILE A CA    1 
ATOM   4355  C C     . ILE A  1 537 ? 27.638  45.374  24.809  1.00 26.31 ? 568  ILE A C     1 
ATOM   4356  O O     . ILE A  1 537 ? 27.531  46.595  24.688  1.00 27.02 ? 568  ILE A O     1 
ATOM   4357  C CB    . ILE A  1 537 ? 26.190  43.913  23.359  1.00 29.52 ? 568  ILE A CB    1 
ATOM   4358  C CG1   . ILE A  1 537 ? 26.039  43.458  21.907  1.00 31.02 ? 568  ILE A CG1   1 
ATOM   4359  C CG2   . ILE A  1 537 ? 25.157  44.983  23.666  1.00 32.90 ? 568  ILE A CG2   1 
ATOM   4360  C CD1   . ILE A  1 537 ? 26.426  42.017  21.676  1.00 37.63 ? 568  ILE A CD1   1 
ATOM   4361  N N     . CYS A  1 538 ? 27.794  44.774  25.985  1.00 27.03 ? 569  CYS A N     1 
ATOM   4362  C CA    . CYS A  1 538 ? 27.842  45.527  27.234  1.00 28.70 ? 569  CYS A CA    1 
ATOM   4363  C C     . CYS A  1 538 ? 28.868  46.658  27.162  1.00 29.00 ? 569  CYS A C     1 
ATOM   4364  O O     . CYS A  1 538 ? 28.551  47.823  27.393  1.00 30.33 ? 569  CYS A O     1 
ATOM   4365  C CB    . CYS A  1 538 ? 28.193  44.589  28.389  1.00 26.77 ? 569  CYS A CB    1 
ATOM   4366  S SG    . CYS A  1 538 ? 27.320  44.970  29.939  1.00 27.79 ? 569  CYS A SG    1 
ATOM   4367  N N     . ASN A  1 539 ? 30.099  46.300  26.829  1.00 31.53 ? 570  ASN A N     1 
ATOM   4368  C CA    . ASN A  1 539 ? 31.176  47.264  26.735  1.00 33.81 ? 570  ASN A CA    1 
ATOM   4369  C C     . ASN A  1 539 ? 30.999  48.227  25.572  1.00 36.34 ? 570  ASN A C     1 
ATOM   4370  O O     . ASN A  1 539 ? 30.962  49.445  25.749  1.00 38.09 ? 570  ASN A O     1 
ATOM   4371  C CB    . ASN A  1 539 ? 32.511  46.536  26.570  1.00 30.98 ? 570  ASN A CB    1 
ATOM   4372  C CG    . ASN A  1 539 ? 32.817  45.620  27.726  1.00 31.06 ? 570  ASN A CG    1 
ATOM   4373  O OD1   . ASN A  1 539 ? 32.765  46.038  28.882  1.00 29.24 ? 570  ASN A OD1   1 
ATOM   4374  N ND2   . ASN A  1 539 ? 33.134  44.357  27.427  1.00 29.88 ? 570  ASN A ND2   1 
ATOM   4375  N N     . ASN A  1 540 ? 30.887  47.670  24.376  1.00 38.53 ? 571  ASN A N     1 
ATOM   4376  C CA    . ASN A  1 540 ? 30.773  48.478  23.180  1.00 40.54 ? 571  ASN A CA    1 
ATOM   4377  C C     . ASN A  1 540 ? 29.519  49.332  23.042  1.00 40.11 ? 571  ASN A C     1 
ATOM   4378  O O     . ASN A  1 540 ? 29.556  50.384  22.400  1.00 39.92 ? 571  ASN A O     1 
ATOM   4379  C CB    . ASN A  1 540 ? 30.924  47.582  21.956  1.00 45.98 ? 571  ASN A CB    1 
ATOM   4380  C CG    . ASN A  1 540 ? 32.367  47.204  21.686  1.00 52.05 ? 571  ASN A CG    1 
ATOM   4381  O OD1   . ASN A  1 540 ? 33.298  47.736  22.303  1.00 52.48 ? 571  ASN A OD1   1 
ATOM   4382  N ND2   . ASN A  1 540 ? 32.561  46.278  20.755  1.00 55.08 ? 571  ASN A ND2   1 
ATOM   4383  N N     . VAL A  1 541 ? 28.416  48.898  23.640  1.00 40.03 ? 572  VAL A N     1 
ATOM   4384  C CA    . VAL A  1 541 ? 27.166  49.651  23.529  1.00 37.64 ? 572  VAL A CA    1 
ATOM   4385  C C     . VAL A  1 541 ? 26.772  50.391  24.798  1.00 34.24 ? 572  VAL A C     1 
ATOM   4386  O O     . VAL A  1 541 ? 26.992  49.902  25.912  1.00 37.04 ? 572  VAL A O     1 
ATOM   4387  C CB    . VAL A  1 541 ? 25.997  48.737  23.116  1.00 37.94 ? 572  VAL A CB    1 
ATOM   4388  C CG1   . VAL A  1 541 ? 24.886  49.578  22.526  1.00 39.44 ? 572  VAL A CG1   1 
ATOM   4389  C CG2   . VAL A  1 541 ? 26.477  47.687  22.104  1.00 38.65 ? 572  VAL A CG2   1 
ATOM   4390  N N     . LYS A  1 542 ? 26.186  51.571  24.616  1.00 30.20 ? 573  LYS A N     1 
ATOM   4391  C CA    . LYS A  1 542 ? 25.756  52.403  25.732  1.00 28.37 ? 573  LYS A CA    1 
ATOM   4392  C C     . LYS A  1 542 ? 24.787  51.692  26.675  1.00 28.76 ? 573  LYS A C     1 
ATOM   4393  O O     . LYS A  1 542 ? 24.036  50.813  26.266  1.00 31.46 ? 573  LYS A O     1 
ATOM   4394  C CB    . LYS A  1 542 ? 25.098  53.663  25.200  1.00 25.86 ? 573  LYS A CB    1 
ATOM   4395  C CG    . LYS A  1 542 ? 25.245  54.851  26.104  1.00 29.04 ? 573  LYS A CG    1 
ATOM   4396  C CD    . LYS A  1 542 ? 25.247  56.133  25.295  1.00 35.16 ? 573  LYS A CD    1 
ATOM   4397  C CE    . LYS A  1 542 ? 25.043  57.357  26.185  1.00 37.85 ? 573  LYS A CE    1 
ATOM   4398  N NZ    . LYS A  1 542 ? 24.645  58.573  25.408  1.00 41.57 ? 573  LYS A NZ    1 
ATOM   4399  N N     . GLY A  1 543 ? 24.814  52.069  27.946  1.00 26.47 ? 574  GLY A N     1 
ATOM   4400  C CA    . GLY A  1 543 ? 23.909  51.471  28.914  1.00 21.67 ? 574  GLY A CA    1 
ATOM   4401  C C     . GLY A  1 543 ? 23.947  49.961  29.119  1.00 19.66 ? 574  GLY A C     1 
ATOM   4402  O O     . GLY A  1 543 ? 23.141  49.430  29.889  1.00 22.54 ? 574  GLY A O     1 
ATOM   4403  N N     . CYS A  1 544 ? 24.862  49.262  28.454  1.00 15.48 ? 575  CYS A N     1 
ATOM   4404  C CA    . CYS A  1 544 ? 24.958  47.805  28.607  1.00 18.36 ? 575  CYS A CA    1 
ATOM   4405  C C     . CYS A  1 544 ? 23.612  47.101  28.433  1.00 17.90 ? 575  CYS A C     1 
ATOM   4406  O O     . CYS A  1 544 ? 23.219  46.269  29.267  1.00 18.11 ? 575  CYS A O     1 
ATOM   4407  C CB    . CYS A  1 544 ? 25.531  47.438  29.989  1.00 15.93 ? 575  CYS A CB    1 
ATOM   4408  S SG    . CYS A  1 544 ? 27.307  46.990  30.003  1.00 27.26 ? 575  CYS A SG    1 
ATOM   4409  N N     . PRO A  1 545 ? 22.911  47.384  27.321  1.00 18.04 ? 576  PRO A N     1 
ATOM   4410  C CA    . PRO A  1 545 ? 21.602  46.779  27.043  1.00 18.55 ? 576  PRO A CA    1 
ATOM   4411  C C     . PRO A  1 545 ? 21.705  45.265  27.064  1.00 18.50 ? 576  PRO A C     1 
ATOM   4412  O O     . PRO A  1 545 ? 22.478  44.685  26.293  1.00 19.62 ? 576  PRO A O     1 
ATOM   4413  C CB    . PRO A  1 545 ? 21.258  47.288  25.647  1.00 20.22 ? 576  PRO A CB    1 
ATOM   4414  C CG    . PRO A  1 545 ? 22.585  47.637  25.045  1.00 19.87 ? 576  PRO A CG    1 
ATOM   4415  C CD    . PRO A  1 545 ? 23.355  48.221  26.200  1.00 18.81 ? 576  PRO A CD    1 
ATOM   4416  N N     . PHE A  1 546 ? 20.940  44.622  27.940  1.00 15.62 ? 577  PHE A N     1 
ATOM   4417  C CA    . PHE A  1 546 ? 20.994  43.169  28.013  1.00 14.24 ? 577  PHE A CA    1 
ATOM   4418  C C     . PHE A  1 546 ? 20.809  42.556  26.630  1.00 12.07 ? 577  PHE A C     1 
ATOM   4419  O O     . PHE A  1 546 ? 20.118  43.123  25.783  1.00 13.99 ? 577  PHE A O     1 
ATOM   4420  C CB    . PHE A  1 546 ? 19.891  42.614  28.926  1.00 10.98 ? 577  PHE A CB    1 
ATOM   4421  C CG    . PHE A  1 546 ? 19.577  41.180  28.654  1.00 4.06  ? 577  PHE A CG    1 
ATOM   4422  C CD1   . PHE A  1 546 ? 20.192  40.168  29.382  1.00 9.41  ? 577  PHE A CD1   1 
ATOM   4423  C CD2   . PHE A  1 546 ? 18.762  40.836  27.597  1.00 2.00  ? 577  PHE A CD2   1 
ATOM   4424  C CE1   . PHE A  1 546 ? 20.003  38.814  29.045  1.00 10.35 ? 577  PHE A CE1   1 
ATOM   4425  C CE2   . PHE A  1 546 ? 18.566  39.504  27.250  1.00 8.04  ? 577  PHE A CE2   1 
ATOM   4426  C CZ    . PHE A  1 546 ? 19.188  38.485  27.973  1.00 8.84  ? 577  PHE A CZ    1 
ATOM   4427  N N     . THR A  1 547 ? 21.422  41.400  26.403  1.00 8.90  ? 578  THR A N     1 
ATOM   4428  C CA    . THR A  1 547 ? 21.253  40.699  25.141  1.00 8.26  ? 578  THR A CA    1 
ATOM   4429  C C     . THR A  1 547 ? 21.527  39.221  25.274  1.00 9.95  ? 578  THR A C     1 
ATOM   4430  O O     . THR A  1 547 ? 22.055  38.746  26.284  1.00 9.22  ? 578  THR A O     1 
ATOM   4431  C CB    . THR A  1 547 ? 22.147  41.237  24.034  1.00 4.45  ? 578  THR A CB    1 
ATOM   4432  O OG1   . THR A  1 547 ? 21.844  42.617  23.811  1.00 7.70  ? 578  THR A OG1   1 
ATOM   4433  C CG2   . THR A  1 547 ? 21.887  40.484  22.730  1.00 2.00  ? 578  THR A CG2   1 
ATOM   4434  N N     . SER A  1 548 ? 21.122  38.497  24.243  1.00 13.28 ? 579  SER A N     1 
ATOM   4435  C CA    . SER A  1 548 ? 21.312  37.077  24.179  1.00 16.08 ? 579  SER A CA    1 
ATOM   4436  C C     . SER A  1 548 ? 20.956  36.757  22.754  1.00 22.65 ? 579  SER A C     1 
ATOM   4437  O O     . SER A  1 548 ? 20.474  37.619  22.027  1.00 24.98 ? 579  SER A O     1 
ATOM   4438  C CB    . SER A  1 548 ? 20.359  36.378  25.132  1.00 13.96 ? 579  SER A CB    1 
ATOM   4439  O OG    . SER A  1 548 ? 20.701  35.010  25.235  1.00 13.65 ? 579  SER A OG    1 
ATOM   4440  N N     . PHE A  1 549 ? 21.227  35.534  22.336  1.00 31.00 ? 580  PHE A N     1 
ATOM   4441  C CA    . PHE A  1 549 ? 20.883  35.139  20.986  1.00 38.89 ? 580  PHE A CA    1 
ATOM   4442  C C     . PHE A  1 549 ? 19.522  34.499  21.142  1.00 42.11 ? 580  PHE A C     1 
ATOM   4443  O O     . PHE A  1 549 ? 18.954  33.956  20.198  1.00 43.86 ? 580  PHE A O     1 
ATOM   4444  C CB    . PHE A  1 549 ? 21.910  34.142  20.437  1.00 43.81 ? 580  PHE A CB    1 
ATOM   4445  C CG    . PHE A  1 549 ? 23.222  34.780  20.045  1.00 48.07 ? 580  PHE A CG    1 
ATOM   4446  C CD1   . PHE A  1 549 ? 24.432  34.258  20.501  1.00 48.23 ? 580  PHE A CD1   1 
ATOM   4447  C CD2   . PHE A  1 549 ? 23.245  35.913  19.234  1.00 48.91 ? 580  PHE A CD2   1 
ATOM   4448  C CE1   . PHE A  1 549 ? 25.636  34.854  20.157  1.00 50.30 ? 580  PHE A CE1   1 
ATOM   4449  C CE2   . PHE A  1 549 ? 24.446  36.516  18.885  1.00 49.87 ? 580  PHE A CE2   1 
ATOM   4450  C CZ    . PHE A  1 549 ? 25.642  35.985  19.348  1.00 51.11 ? 580  PHE A CZ    1 
ATOM   4451  N N     . ASN A  1 550 ? 19.009  34.591  22.365  1.00 43.96 ? 581  ASN A N     1 
ATOM   4452  C CA    . ASN A  1 550 ? 17.718  34.039  22.720  1.00 46.94 ? 581  ASN A CA    1 
ATOM   4453  C C     . ASN A  1 550 ? 16.761  35.137  23.121  1.00 48.46 ? 581  ASN A C     1 
ATOM   4454  O O     . ASN A  1 550 ? 17.090  35.994  23.934  1.00 47.01 ? 581  ASN A O     1 
ATOM   4455  C CB    . ASN A  1 550 ? 17.866  33.063  23.880  1.00 48.24 ? 581  ASN A CB    1 
ATOM   4456  C CG    . ASN A  1 550 ? 16.981  31.860  23.724  1.00 57.92 ? 581  ASN A CG    1 
ATOM   4457  O OD1   . ASN A  1 550 ? 17.352  30.743  24.088  1.00 58.72 ? 581  ASN A OD1   1 
ATOM   4458  N ND2   . ASN A  1 550 ? 15.794  32.076  23.168  1.00 61.94 ? 581  ASN A ND2   1 
ATOM   4459  N N     . VAL A  1 551 ? 15.571  35.115  22.544  1.00 51.85 ? 582  VAL A N     1 
ATOM   4460  C CA    . VAL A  1 551 ? 14.574  36.117  22.877  1.00 54.90 ? 582  VAL A CA    1 
ATOM   4461  C C     . VAL A  1 551 ? 13.863  35.709  24.166  1.00 59.22 ? 582  VAL A C     1 
ATOM   4462  O O     . VAL A  1 551 ? 12.762  35.165  24.140  1.00 60.97 ? 582  VAL A O     1 
ATOM   4463  C CB    . VAL A  1 551 ? 13.538  36.291  21.736  1.00 53.68 ? 582  VAL A CB    1 
ATOM   4464  C CG1   . VAL A  1 551 ? 12.885  34.954  21.401  1.00 51.59 ? 582  VAL A CG1   1 
ATOM   4465  C CG2   . VAL A  1 551 ? 12.503  37.326  22.138  1.00 49.73 ? 582  VAL A CG2   1 
ATOM   4466  N N     . GLN A  1 552 ? 14.522  35.965  25.293  1.00 64.55 ? 583  GLN A N     1 
ATOM   4467  C CA    . GLN A  1 552 ? 13.986  35.647  26.614  1.00 66.49 ? 583  GLN A CA    1 
ATOM   4468  C C     . GLN A  1 552 ? 13.343  34.264  26.668  1.00 66.40 ? 583  GLN A C     1 
ATOM   4469  O O     . GLN A  1 552 ? 12.577  34.013  27.630  1.00 65.88 ? 583  GLN A O     1 
ATOM   4470  C CB    . GLN A  1 552 ? 12.966  36.710  27.040  1.00 68.32 ? 583  GLN A CB    1 
ATOM   4471  C CG    . GLN A  1 552 ? 13.570  38.093  27.224  1.00 74.87 ? 583  GLN A CG    1 
ATOM   4472  C CD    . GLN A  1 552 ? 14.322  38.571  25.989  1.00 79.38 ? 583  GLN A CD    1 
ATOM   4473  O OE1   . GLN A  1 552 ? 13.771  38.602  24.884  1.00 81.51 ? 583  GLN A OE1   1 
ATOM   4474  N NE2   . GLN A  1 552 ? 15.586  38.942  26.169  1.00 76.20 ? 583  GLN A NE2   1 
ATOM   4475  O OXT   . GLN A  1 552 ? 13.618  33.451  25.752  1.00 64.74 ? 583  GLN A OXT   1 
ATOM   4476  N N     . ALA B  1 1   ? 66.273  50.295  23.266  1.00 16.42 ? 1033 ALA B N     1 
ATOM   4477  C CA    . ALA B  1 1   ? 65.566  50.517  24.559  1.00 17.60 ? 1033 ALA B CA    1 
ATOM   4478  C C     . ALA B  1 1   ? 64.748  49.279  24.969  1.00 19.91 ? 1033 ALA B C     1 
ATOM   4479  O O     . ALA B  1 1   ? 64.363  49.132  26.141  1.00 21.19 ? 1033 ALA B O     1 
ATOM   4480  C CB    . ALA B  1 1   ? 64.662  51.752  24.450  1.00 12.82 ? 1033 ALA B CB    1 
ATOM   4481  N N     . ASN B  1 2   ? 64.513  48.378  24.017  1.00 19.24 ? 1034 ASN B N     1 
ATOM   4482  C CA    . ASN B  1 2   ? 63.742  47.166  24.284  1.00 19.94 ? 1034 ASN B CA    1 
ATOM   4483  C C     . ASN B  1 2   ? 64.322  46.253  25.359  1.00 19.93 ? 1034 ASN B C     1 
ATOM   4484  O O     . ASN B  1 2   ? 65.334  45.599  25.142  1.00 23.25 ? 1034 ASN B O     1 
ATOM   4485  C CB    . ASN B  1 2   ? 63.569  46.357  23.002  1.00 23.09 ? 1034 ASN B CB    1 
ATOM   4486  C CG    . ASN B  1 2   ? 62.603  45.209  23.176  1.00 28.92 ? 1034 ASN B CG    1 
ATOM   4487  O OD1   . ASN B  1 2   ? 62.349  44.770  24.298  1.00 31.16 ? 1034 ASN B OD1   1 
ATOM   4488  N ND2   . ASN B  1 2   ? 62.047  44.719  22.069  1.00 27.97 ? 1034 ASN B ND2   1 
ATOM   4489  N N     . PRO B  1 3   ? 63.663  46.174  26.526  1.00 21.62 ? 1035 PRO B N     1 
ATOM   4490  C CA    . PRO B  1 3   ? 64.082  45.342  27.664  1.00 18.93 ? 1035 PRO B CA    1 
ATOM   4491  C C     . PRO B  1 3   ? 64.232  43.858  27.341  1.00 20.80 ? 1035 PRO B C     1 
ATOM   4492  O O     . PRO B  1 3   ? 64.705  43.074  28.160  1.00 20.95 ? 1035 PRO B O     1 
ATOM   4493  C CB    . PRO B  1 3   ? 62.990  45.578  28.712  1.00 20.85 ? 1035 PRO B CB    1 
ATOM   4494  C CG    . PRO B  1 3   ? 61.828  46.112  27.947  1.00 19.05 ? 1035 PRO B CG    1 
ATOM   4495  C CD    . PRO B  1 3   ? 62.425  46.912  26.827  1.00 21.05 ? 1035 PRO B CD    1 
ATOM   4496  N N     . CYS B  1 4   ? 63.815  43.471  26.148  1.00 19.75 ? 1036 CYS B N     1 
ATOM   4497  C CA    . CYS B  1 4   ? 63.924  42.080  25.750  1.00 21.75 ? 1036 CYS B CA    1 
ATOM   4498  C C     . CYS B  1 4   ? 65.193  41.891  24.945  1.00 22.30 ? 1036 CYS B C     1 
ATOM   4499  O O     . CYS B  1 4   ? 65.698  40.767  24.819  1.00 24.55 ? 1036 CYS B O     1 
ATOM   4500  C CB    . CYS B  1 4   ? 62.724  41.665  24.902  1.00 19.06 ? 1036 CYS B CB    1 
ATOM   4501  S SG    . CYS B  1 4   ? 61.240  41.309  25.882  1.00 21.43 ? 1036 CYS B SG    1 
ATOM   4502  N N     . CYS B  1 5   ? 65.697  43.003  24.411  1.00 23.53 ? 1037 CYS B N     1 
ATOM   4503  C CA    . CYS B  1 5   ? 66.897  43.018  23.583  1.00 21.60 ? 1037 CYS B CA    1 
ATOM   4504  C C     . CYS B  1 5   ? 67.884  41.953  23.970  1.00 19.73 ? 1037 CYS B C     1 
ATOM   4505  O O     . CYS B  1 5   ? 68.403  41.254  23.113  1.00 23.07 ? 1037 CYS B O     1 
ATOM   4506  C CB    . CYS B  1 5   ? 67.559  44.383  23.657  1.00 23.49 ? 1037 CYS B CB    1 
ATOM   4507  S SG    . CYS B  1 5   ? 66.841  45.592  22.491  1.00 26.55 ? 1037 CYS B SG    1 
ATOM   4508  N N     . SER B  1 6   ? 68.108  41.814  25.272  1.00 16.76 ? 1038 SER B N     1 
ATOM   4509  C CA    . SER B  1 6   ? 69.046  40.835  25.810  1.00 12.73 ? 1038 SER B CA    1 
ATOM   4510  C C     . SER B  1 6   ? 68.651  39.357  25.692  1.00 10.98 ? 1038 SER B C     1 
ATOM   4511  O O     . SER B  1 6   ? 69.290  38.505  26.310  1.00 13.06 ? 1038 SER B O     1 
ATOM   4512  C CB    . SER B  1 6   ? 69.329  41.155  27.282  1.00 13.79 ? 1038 SER B CB    1 
ATOM   4513  O OG    . SER B  1 6   ? 68.208  41.747  27.916  1.00 16.29 ? 1038 SER B OG    1 
ATOM   4514  N N     . ASN B  1 7   ? 67.615  39.046  24.916  1.00 6.87  ? 1039 ASN B N     1 
ATOM   4515  C CA    . ASN B  1 7   ? 67.175  37.652  24.756  1.00 5.84  ? 1039 ASN B CA    1 
ATOM   4516  C C     . ASN B  1 7   ? 67.147  36.909  26.086  1.00 6.68  ? 1039 ASN B C     1 
ATOM   4517  O O     . ASN B  1 7   ? 67.510  35.729  26.153  1.00 6.07  ? 1039 ASN B O     1 
ATOM   4518  C CB    . ASN B  1 7   ? 68.119  36.908  23.807  1.00 5.45  ? 1039 ASN B CB    1 
ATOM   4519  C CG    . ASN B  1 7   ? 68.097  37.484  22.404  1.00 13.23 ? 1039 ASN B CG    1 
ATOM   4520  O OD1   . ASN B  1 7   ? 67.887  36.762  21.426  1.00 13.29 ? 1039 ASN B OD1   1 
ATOM   4521  N ND2   . ASN B  1 7   ? 68.303  38.799  22.297  1.00 2.00  ? 1039 ASN B ND2   1 
ATOM   4522  N N     . PRO B  1 8   ? 66.674  37.575  27.151  1.00 4.91  ? 1040 PRO B N     1 
ATOM   4523  C CA    . PRO B  1 8   ? 66.615  36.975  28.484  1.00 8.03  ? 1040 PRO B CA    1 
ATOM   4524  C C     . PRO B  1 8   ? 65.889  35.655  28.639  1.00 12.02 ? 1040 PRO B C     1 
ATOM   4525  O O     . PRO B  1 8   ? 66.430  34.726  29.245  1.00 13.03 ? 1040 PRO B O     1 
ATOM   4526  C CB    . PRO B  1 8   ? 65.983  38.068  29.352  1.00 6.85  ? 1040 PRO B CB    1 
ATOM   4527  C CG    . PRO B  1 8   ? 65.341  39.008  28.415  1.00 2.00  ? 1040 PRO B CG    1 
ATOM   4528  C CD    . PRO B  1 8   ? 66.118  38.943  27.145  1.00 2.00  ? 1040 PRO B CD    1 
ATOM   4529  N N     . CYS B  1 9   ? 64.677  35.567  28.092  1.00 15.13 ? 1041 CYS B N     1 
ATOM   4530  C CA    . CYS B  1 9   ? 63.853  34.361  28.228  1.00 17.62 ? 1041 CYS B CA    1 
ATOM   4531  C C     . CYS B  1 9   ? 64.469  33.120  27.612  1.00 18.25 ? 1041 CYS B C     1 
ATOM   4532  O O     . CYS B  1 9   ? 64.769  33.093  26.419  1.00 20.18 ? 1041 CYS B O     1 
ATOM   4533  C CB    . CYS B  1 9   ? 62.451  34.617  27.652  1.00 20.93 ? 1041 CYS B CB    1 
ATOM   4534  S SG    . CYS B  1 9   ? 61.640  36.096  28.371  1.00 25.35 ? 1041 CYS B SG    1 
ATOM   4535  N N     . GLN B  1 10  ? 64.642  32.091  28.439  1.00 17.78 ? 1042 GLN B N     1 
ATOM   4536  C CA    . GLN B  1 10  ? 65.237  30.839  28.002  1.00 19.67 ? 1042 GLN B CA    1 
ATOM   4537  C C     . GLN B  1 10  ? 64.252  29.698  27.732  1.00 22.91 ? 1042 GLN B C     1 
ATOM   4538  O O     . GLN B  1 10  ? 63.071  29.778  28.070  1.00 24.98 ? 1042 GLN B O     1 
ATOM   4539  C CB    . GLN B  1 10  ? 66.260  30.392  29.040  1.00 20.83 ? 1042 GLN B CB    1 
ATOM   4540  C CG    . GLN B  1 10  ? 67.265  31.480  29.410  1.00 23.72 ? 1042 GLN B CG    1 
ATOM   4541  C CD    . GLN B  1 10  ? 68.245  31.780  28.278  1.00 22.43 ? 1042 GLN B CD    1 
ATOM   4542  O OE1   . GLN B  1 10  ? 68.972  30.883  27.824  1.00 18.92 ? 1042 GLN B OE1   1 
ATOM   4543  N NE2   . GLN B  1 10  ? 68.264  33.040  27.811  1.00 16.60 ? 1042 GLN B NE2   1 
ATOM   4544  N N     . ASN B  1 11  ? 64.762  28.634  27.119  1.00 25.41 ? 1043 ASN B N     1 
ATOM   4545  C CA    . ASN B  1 11  ? 63.982  27.448  26.794  1.00 26.66 ? 1043 ASN B CA    1 
ATOM   4546  C C     . ASN B  1 11  ? 62.686  27.724  26.064  1.00 28.34 ? 1043 ASN B C     1 
ATOM   4547  O O     . ASN B  1 11  ? 61.602  27.357  26.534  1.00 29.14 ? 1043 ASN B O     1 
ATOM   4548  C CB    . ASN B  1 11  ? 63.667  26.679  28.056  1.00 28.72 ? 1043 ASN B CB    1 
ATOM   4549  C CG    . ASN B  1 11  ? 64.865  26.507  28.929  1.00 33.30 ? 1043 ASN B CG    1 
ATOM   4550  O OD1   . ASN B  1 11  ? 65.546  25.483  28.862  1.00 34.96 ? 1043 ASN B OD1   1 
ATOM   4551  N ND2   . ASN B  1 11  ? 65.139  27.504  29.761  1.00 34.82 ? 1043 ASN B ND2   1 
ATOM   4552  N N     . ARG B  1 12  ? 62.797  28.358  24.904  1.00 27.34 ? 1044 ARG B N     1 
ATOM   4553  C CA    . ARG B  1 12  ? 61.632  28.674  24.090  1.00 23.98 ? 1044 ARG B CA    1 
ATOM   4554  C C     . ARG B  1 12  ? 60.660  29.601  24.809  1.00 20.45 ? 1044 ARG B C     1 
ATOM   4555  O O     . ARG B  1 12  ? 59.548  29.818  24.336  1.00 20.88 ? 1044 ARG B O     1 
ATOM   4556  C CB    . ARG B  1 12  ? 60.922  27.385  23.669  1.00 22.87 ? 1044 ARG B CB    1 
ATOM   4557  C CG    . ARG B  1 12  ? 61.774  26.486  22.776  1.00 25.11 ? 1044 ARG B CG    1 
ATOM   4558  C CD    . ARG B  1 12  ? 61.843  27.015  21.356  1.00 24.00 ? 1044 ARG B CD    1 
ATOM   4559  N NE    . ARG B  1 12  ? 61.033  26.213  20.441  1.00 23.44 ? 1044 ARG B NE    1 
ATOM   4560  C CZ    . ARG B  1 12  ? 60.126  26.719  19.613  1.00 26.55 ? 1044 ARG B CZ    1 
ATOM   4561  N NH1   . ARG B  1 12  ? 59.912  28.028  19.577  1.00 25.15 ? 1044 ARG B NH1   1 
ATOM   4562  N NH2   . ARG B  1 12  ? 59.434  25.913  18.822  1.00 27.25 ? 1044 ARG B NH2   1 
ATOM   4563  N N     . GLY B  1 13  ? 61.081  30.148  25.945  1.00 17.42 ? 1045 GLY B N     1 
ATOM   4564  C CA    . GLY B  1 13  ? 60.227  31.069  26.667  1.00 17.23 ? 1045 GLY B CA    1 
ATOM   4565  C C     . GLY B  1 13  ? 59.966  32.275  25.780  1.00 18.81 ? 1045 GLY B C     1 
ATOM   4566  O O     . GLY B  1 13  ? 60.649  32.475  24.784  1.00 22.44 ? 1045 GLY B O     1 
ATOM   4567  N N     . GLU B  1 14  ? 58.980  33.086  26.114  1.00 20.05 ? 1046 GLU B N     1 
ATOM   4568  C CA    . GLU B  1 14  ? 58.700  34.241  25.289  1.00 22.50 ? 1046 GLU B CA    1 
ATOM   4569  C C     . GLU B  1 14  ? 58.872  35.523  26.082  1.00 22.71 ? 1046 GLU B C     1 
ATOM   4570  O O     . GLU B  1 14  ? 58.315  35.671  27.171  1.00 27.78 ? 1046 GLU B O     1 
ATOM   4571  C CB    . GLU B  1 14  ? 57.270  34.158  24.738  1.00 30.93 ? 1046 GLU B CB    1 
ATOM   4572  C CG    . GLU B  1 14  ? 57.135  34.521  23.256  1.00 35.69 ? 1046 GLU B CG    1 
ATOM   4573  C CD    . GLU B  1 14  ? 56.208  33.582  22.518  1.00 38.87 ? 1046 GLU B CD    1 
ATOM   4574  O OE1   . GLU B  1 14  ? 55.110  34.032  22.140  1.00 40.78 ? 1046 GLU B OE1   1 
ATOM   4575  O OE2   . GLU B  1 14  ? 56.572  32.400  22.317  1.00 40.19 ? 1046 GLU B OE2   1 
ATOM   4576  N N     . CYS B  1 15  ? 59.633  36.460  25.539  1.00 20.19 ? 1047 CYS B N     1 
ATOM   4577  C CA    . CYS B  1 15  ? 59.852  37.720  26.231  1.00 18.26 ? 1047 CYS B CA    1 
ATOM   4578  C C     . CYS B  1 15  ? 58.813  38.745  25.841  1.00 19.76 ? 1047 CYS B C     1 
ATOM   4579  O O     . CYS B  1 15  ? 58.490  38.870  24.663  1.00 22.49 ? 1047 CYS B O     1 
ATOM   4580  C CB    . CYS B  1 15  ? 61.234  38.264  25.905  1.00 19.32 ? 1047 CYS B CB    1 
ATOM   4581  S SG    . CYS B  1 15  ? 61.725  39.660  26.962  1.00 23.38 ? 1047 CYS B SG    1 
ATOM   4582  N N     . MET B  1 16  ? 58.295  39.478  26.830  1.00 18.91 ? 1048 MET B N     1 
ATOM   4583  C CA    . MET B  1 16  ? 57.291  40.528  26.592  1.00 15.57 ? 1048 MET B CA    1 
ATOM   4584  C C     . MET B  1 16  ? 57.603  41.807  27.390  1.00 9.72  ? 1048 MET B C     1 
ATOM   4585  O O     . MET B  1 16  ? 57.869  41.759  28.588  1.00 6.80  ? 1048 MET B O     1 
ATOM   4586  C CB    . MET B  1 16  ? 55.894  40.006  26.939  1.00 25.89 ? 1048 MET B CB    1 
ATOM   4587  C CG    . MET B  1 16  ? 55.051  40.960  27.771  1.00 32.70 ? 1048 MET B CG    1 
ATOM   4588  S SD    . MET B  1 16  ? 53.312  41.016  27.267  1.00 39.59 ? 1048 MET B SD    1 
ATOM   4589  C CE    . MET B  1 16  ? 52.506  41.172  28.879  1.00 46.39 ? 1048 MET B CE    1 
ATOM   4590  N N     . SER B  1 17  ? 57.559  42.944  26.703  1.00 8.67  ? 1049 SER B N     1 
ATOM   4591  C CA    . SER B  1 17  ? 57.864  44.248  27.303  1.00 10.71 ? 1049 SER B CA    1 
ATOM   4592  C C     . SER B  1 17  ? 56.808  44.723  28.264  1.00 10.42 ? 1049 SER B C     1 
ATOM   4593  O O     . SER B  1 17  ? 55.866  45.398  27.862  1.00 16.19 ? 1049 SER B O     1 
ATOM   4594  C CB    . SER B  1 17  ? 58.036  45.322  26.220  1.00 13.22 ? 1049 SER B CB    1 
ATOM   4595  O OG    . SER B  1 17  ? 57.437  44.938  24.987  1.00 16.63 ? 1049 SER B OG    1 
ATOM   4596  N N     . THR B  1 18  ? 56.970  44.385  29.535  1.00 9.65  ? 1050 THR B N     1 
ATOM   4597  C CA    . THR B  1 18  ? 56.011  44.784  30.550  1.00 9.11  ? 1050 THR B CA    1 
ATOM   4598  C C     . THR B  1 18  ? 56.305  46.192  31.042  1.00 11.86 ? 1050 THR B C     1 
ATOM   4599  O O     . THR B  1 18  ? 56.333  46.455  32.247  1.00 15.69 ? 1050 THR B O     1 
ATOM   4600  C CB    . THR B  1 18  ? 56.060  43.806  31.717  1.00 6.61  ? 1050 THR B CB    1 
ATOM   4601  O OG1   . THR B  1 18  ? 57.249  44.027  32.487  1.00 7.82  ? 1050 THR B OG1   1 
ATOM   4602  C CG2   . THR B  1 18  ? 56.065  42.386  31.189  1.00 2.00  ? 1050 THR B CG2   1 
ATOM   4603  N N     . GLY B  1 19  ? 56.513  47.104  30.101  1.00 16.13 ? 1051 GLY B N     1 
ATOM   4604  C CA    . GLY B  1 19  ? 56.837  48.472  30.463  1.00 20.71 ? 1051 GLY B CA    1 
ATOM   4605  C C     . GLY B  1 19  ? 58.105  48.905  29.737  1.00 24.98 ? 1051 GLY B C     1 
ATOM   4606  O O     . GLY B  1 19  ? 58.876  48.061  29.266  1.00 25.88 ? 1051 GLY B O     1 
ATOM   4607  N N     . PHE B  1 20  ? 58.323  50.214  29.645  1.00 27.70 ? 1052 PHE B N     1 
ATOM   4608  C CA    . PHE B  1 20  ? 59.480  50.760  28.956  1.00 29.35 ? 1052 PHE B CA    1 
ATOM   4609  C C     . PHE B  1 20  ? 60.830  50.076  29.217  1.00 35.92 ? 1052 PHE B C     1 
ATOM   4610  O O     . PHE B  1 20  ? 61.550  49.724  28.272  1.00 37.49 ? 1052 PHE B O     1 
ATOM   4611  C CB    . PHE B  1 20  ? 59.593  52.238  29.283  1.00 24.24 ? 1052 PHE B CB    1 
ATOM   4612  C CG    . PHE B  1 20  ? 58.749  53.105  28.416  1.00 22.48 ? 1052 PHE B CG    1 
ATOM   4613  C CD1   . PHE B  1 20  ? 57.692  53.826  28.952  1.00 19.87 ? 1052 PHE B CD1   1 
ATOM   4614  C CD2   . PHE B  1 20  ? 59.024  53.225  27.057  1.00 23.41 ? 1052 PHE B CD2   1 
ATOM   4615  C CE1   . PHE B  1 20  ? 56.918  54.664  28.144  1.00 16.11 ? 1052 PHE B CE1   1 
ATOM   4616  C CE2   . PHE B  1 20  ? 58.258  54.058  26.238  1.00 20.02 ? 1052 PHE B CE2   1 
ATOM   4617  C CZ    . PHE B  1 20  ? 57.201  54.781  26.786  1.00 15.90 ? 1052 PHE B CZ    1 
ATOM   4618  N N     . ASP B  1 21  ? 61.178  49.896  30.491  1.00 43.01 ? 1053 ASP B N     1 
ATOM   4619  C CA    . ASP B  1 21  ? 62.455  49.284  30.844  1.00 45.32 ? 1053 ASP B CA    1 
ATOM   4620  C C     . ASP B  1 21  ? 62.298  48.064  31.743  1.00 45.07 ? 1053 ASP B C     1 
ATOM   4621  O O     . ASP B  1 21  ? 63.011  47.912  32.723  1.00 44.62 ? 1053 ASP B O     1 
ATOM   4622  C CB    . ASP B  1 21  ? 63.367  50.328  31.519  1.00 47.89 ? 1053 ASP B CB    1 
ATOM   4623  C CG    . ASP B  1 21  ? 63.723  51.503  30.586  1.00 53.25 ? 1053 ASP B CG    1 
ATOM   4624  O OD1   . ASP B  1 21  ? 64.019  51.271  29.390  1.00 53.74 ? 1053 ASP B OD1   1 
ATOM   4625  O OD2   . ASP B  1 21  ? 63.708  52.663  31.052  1.00 53.18 ? 1053 ASP B OD2   1 
ATOM   4626  N N     . GLN B  1 22  ? 61.352  47.199  31.400  1.00 46.39 ? 1054 GLN B N     1 
ATOM   4627  C CA    . GLN B  1 22  ? 61.097  45.970  32.154  1.00 46.79 ? 1054 GLN B CA    1 
ATOM   4628  C C     . GLN B  1 22  ? 60.515  44.965  31.164  1.00 43.53 ? 1054 GLN B C     1 
ATOM   4629  O O     . GLN B  1 22  ? 59.985  45.353  30.125  1.00 46.52 ? 1054 GLN B O     1 
ATOM   4630  C CB    . GLN B  1 22  ? 60.108  46.231  33.286  1.00 50.38 ? 1054 GLN B CB    1 
ATOM   4631  C CG    . GLN B  1 22  ? 59.374  47.556  33.164  1.00 56.18 ? 1054 GLN B CG    1 
ATOM   4632  C CD    . GLN B  1 22  ? 59.596  48.462  34.363  1.00 61.05 ? 1054 GLN B CD    1 
ATOM   4633  O OE1   . GLN B  1 22  ? 59.289  48.092  35.500  1.00 59.58 ? 1054 GLN B OE1   1 
ATOM   4634  N NE2   . GLN B  1 22  ? 60.131  49.661  34.115  1.00 58.86 ? 1054 GLN B NE2   1 
ATOM   4635  N N     . TYR B  1 23  ? 60.603  43.680  31.475  1.00 37.13 ? 1055 TYR B N     1 
ATOM   4636  C CA    . TYR B  1 23  ? 60.098  42.669  30.553  1.00 34.63 ? 1055 TYR B CA    1 
ATOM   4637  C C     . TYR B  1 23  ? 59.457  41.500  31.295  1.00 29.84 ? 1055 TYR B C     1 
ATOM   4638  O O     . TYR B  1 23  ? 59.337  41.530  32.517  1.00 27.55 ? 1055 TYR B O     1 
ATOM   4639  C CB    . TYR B  1 23  ? 61.251  42.148  29.692  1.00 33.32 ? 1055 TYR B CB    1 
ATOM   4640  C CG    . TYR B  1 23  ? 62.165  41.212  30.463  1.00 35.49 ? 1055 TYR B CG    1 
ATOM   4641  C CD1   . TYR B  1 23  ? 62.232  39.849  30.149  1.00 34.55 ? 1055 TYR B CD1   1 
ATOM   4642  C CD2   . TYR B  1 23  ? 62.923  41.677  31.539  1.00 31.59 ? 1055 TYR B CD2   1 
ATOM   4643  C CE1   . TYR B  1 23  ? 63.029  38.982  30.889  1.00 32.97 ? 1055 TYR B CE1   1 
ATOM   4644  C CE2   . TYR B  1 23  ? 63.720  40.819  32.282  1.00 29.46 ? 1055 TYR B CE2   1 
ATOM   4645  C CZ    . TYR B  1 23  ? 63.771  39.476  31.953  1.00 32.42 ? 1055 TYR B CZ    1 
ATOM   4646  O OH    . TYR B  1 23  ? 64.574  38.616  32.667  1.00 32.71 ? 1055 TYR B OH    1 
ATOM   4647  N N     . LYS B  1 24  ? 59.052  40.472  30.551  1.00 27.87 ? 1056 LYS B N     1 
ATOM   4648  C CA    . LYS B  1 24  ? 58.444  39.298  31.151  1.00 26.66 ? 1056 LYS B CA    1 
ATOM   4649  C C     . LYS B  1 24  ? 58.587  38.078  30.272  1.00 25.65 ? 1056 LYS B C     1 
ATOM   4650  O O     . LYS B  1 24  ? 58.505  38.167  29.051  1.00 20.47 ? 1056 LYS B O     1 
ATOM   4651  C CB    . LYS B  1 24  ? 56.970  39.544  31.439  1.00 29.97 ? 1056 LYS B CB    1 
ATOM   4652  C CG    . LYS B  1 24  ? 56.152  38.277  31.586  1.00 31.54 ? 1056 LYS B CG    1 
ATOM   4653  C CD    . LYS B  1 24  ? 56.000  37.863  33.034  1.00 30.23 ? 1056 LYS B CD    1 
ATOM   4654  C CE    . LYS B  1 24  ? 55.667  36.386  33.141  1.00 33.05 ? 1056 LYS B CE    1 
ATOM   4655  N NZ    . LYS B  1 24  ? 55.135  36.024  34.486  1.00 32.33 ? 1056 LYS B NZ    1 
ATOM   4656  N N     . CYS B  1 25  ? 58.775  36.932  30.920  1.00 25.41 ? 1057 CYS B N     1 
ATOM   4657  C CA    . CYS B  1 25  ? 58.959  35.653  30.234  1.00 27.96 ? 1057 CYS B CA    1 
ATOM   4658  C C     . CYS B  1 25  ? 57.765  34.725  30.338  1.00 27.83 ? 1057 CYS B C     1 
ATOM   4659  O O     . CYS B  1 25  ? 57.280  34.431  31.427  1.00 31.11 ? 1057 CYS B O     1 
ATOM   4660  C CB    . CYS B  1 25  ? 60.201  34.924  30.770  1.00 24.93 ? 1057 CYS B CB    1 
ATOM   4661  S SG    . CYS B  1 25  ? 61.768  35.771  30.373  1.00 30.28 ? 1057 CYS B SG    1 
ATOM   4662  N N     . ASP B  1 26  ? 57.315  34.255  29.184  1.00 29.08 ? 1058 ASP B N     1 
ATOM   4663  C CA    . ASP B  1 26  ? 56.186  33.349  29.084  1.00 30.74 ? 1058 ASP B CA    1 
ATOM   4664  C C     . ASP B  1 26  ? 56.668  31.909  29.058  1.00 29.96 ? 1058 ASP B C     1 
ATOM   4665  O O     . ASP B  1 26  ? 56.709  31.276  28.003  1.00 30.08 ? 1058 ASP B O     1 
ATOM   4666  C CB    . ASP B  1 26  ? 55.398  33.649  27.809  1.00 32.68 ? 1058 ASP B CB    1 
ATOM   4667  C CG    . ASP B  1 26  ? 53.916  33.387  27.966  1.00 32.55 ? 1058 ASP B CG    1 
ATOM   4668  O OD1   . ASP B  1 26  ? 53.140  34.355  27.894  1.00 32.99 ? 1058 ASP B OD1   1 
ATOM   4669  O OD2   . ASP B  1 26  ? 53.522  32.219  28.160  1.00 31.19 ? 1058 ASP B OD2   1 
ATOM   4670  N N     . CYS B  1 27  ? 57.036  31.395  30.223  1.00 27.90 ? 1059 CYS B N     1 
ATOM   4671  C CA    . CYS B  1 27  ? 57.511  30.019  30.315  1.00 31.70 ? 1059 CYS B CA    1 
ATOM   4672  C C     . CYS B  1 27  ? 56.316  29.052  30.315  1.00 29.65 ? 1059 CYS B C     1 
ATOM   4673  O O     . CYS B  1 27  ? 56.055  28.344  31.293  1.00 31.26 ? 1059 CYS B O     1 
ATOM   4674  C CB    . CYS B  1 27  ? 58.363  29.852  31.583  1.00 29.97 ? 1059 CYS B CB    1 
ATOM   4675  S SG    . CYS B  1 27  ? 59.265  31.369  32.066  1.00 36.52 ? 1059 CYS B SG    1 
ATOM   4676  N N     . THR B  1 28  ? 55.598  29.028  29.200  1.00 27.29 ? 1060 THR B N     1 
ATOM   4677  C CA    . THR B  1 28  ? 54.429  28.182  29.078  1.00 25.67 ? 1060 THR B CA    1 
ATOM   4678  C C     . THR B  1 28  ? 54.728  26.890  28.337  1.00 28.08 ? 1060 THR B C     1 
ATOM   4679  O O     . THR B  1 28  ? 55.204  26.894  27.202  1.00 26.04 ? 1060 THR B O     1 
ATOM   4680  C CB    . THR B  1 28  ? 53.283  28.947  28.362  1.00 28.92 ? 1060 THR B CB    1 
ATOM   4681  O OG1   . THR B  1 28  ? 52.978  30.141  29.102  1.00 24.13 ? 1060 THR B OG1   1 
ATOM   4682  C CG2   . THR B  1 28  ? 52.016  28.067  28.236  1.00 19.45 ? 1060 THR B CG2   1 
ATOM   4683  N N     . ARG B  1 29  ? 54.441  25.776  28.998  1.00 30.85 ? 1061 ARG B N     1 
ATOM   4684  C CA    . ARG B  1 29  ? 54.677  24.460  28.420  1.00 35.59 ? 1061 ARG B CA    1 
ATOM   4685  C C     . ARG B  1 29  ? 56.158  24.298  28.105  1.00 36.83 ? 1061 ARG B C     1 
ATOM   4686  O O     . ARG B  1 29  ? 56.564  23.359  27.425  1.00 33.73 ? 1061 ARG B O     1 
ATOM   4687  C CB    . ARG B  1 29  ? 53.838  24.275  27.147  1.00 37.71 ? 1061 ARG B CB    1 
ATOM   4688  C CG    . ARG B  1 29  ? 52.508  23.556  27.390  1.00 38.81 ? 1061 ARG B CG    1 
ATOM   4689  C CD    . ARG B  1 29  ? 51.501  23.796  26.269  1.00 40.79 ? 1061 ARG B CD    1 
ATOM   4690  N NE    . ARG B  1 29  ? 50.770  25.050  26.431  1.00 42.67 ? 1061 ARG B NE    1 
ATOM   4691  C CZ    . ARG B  1 29  ? 50.481  25.867  25.426  1.00 45.57 ? 1061 ARG B CZ    1 
ATOM   4692  N NH1   . ARG B  1 29  ? 50.866  25.555  24.196  1.00 46.01 ? 1061 ARG B NH1   1 
ATOM   4693  N NH2   . ARG B  1 29  ? 49.816  26.991  25.647  1.00 47.48 ? 1061 ARG B NH2   1 
ATOM   4694  N N     . THR B  1 30  ? 56.952  25.229  28.624  1.00 40.31 ? 1062 THR B N     1 
ATOM   4695  C CA    . THR B  1 30  ? 58.396  25.240  28.434  1.00 42.76 ? 1062 THR B CA    1 
ATOM   4696  C C     . THR B  1 30  ? 59.056  24.161  29.280  1.00 42.64 ? 1062 THR B C     1 
ATOM   4697  O O     . THR B  1 30  ? 59.869  23.385  28.784  1.00 45.64 ? 1062 THR B O     1 
ATOM   4698  C CB    . THR B  1 30  ? 58.993  26.610  28.828  1.00 42.66 ? 1062 THR B CB    1 
ATOM   4699  O OG1   . THR B  1 30  ? 58.585  26.954  30.157  1.00 44.45 ? 1062 THR B OG1   1 
ATOM   4700  C CG2   . THR B  1 30  ? 58.509  27.684  27.890  1.00 46.60 ? 1062 THR B CG2   1 
ATOM   4701  N N     . GLY B  1 31  ? 58.696  24.118  30.560  1.00 44.65 ? 1063 GLY B N     1 
ATOM   4702  C CA    . GLY B  1 31  ? 59.266  23.136  31.468  1.00 43.68 ? 1063 GLY B CA    1 
ATOM   4703  C C     . GLY B  1 31  ? 60.119  23.828  32.515  1.00 42.77 ? 1063 GLY B C     1 
ATOM   4704  O O     . GLY B  1 31  ? 60.816  23.183  33.303  1.00 42.89 ? 1063 GLY B O     1 
ATOM   4705  N N     . PHE B  1 32  ? 60.063  25.157  32.514  1.00 41.98 ? 1064 PHE B N     1 
ATOM   4706  C CA    . PHE B  1 32  ? 60.831  25.953  33.459  1.00 41.99 ? 1064 PHE B CA    1 
ATOM   4707  C C     . PHE B  1 32  ? 60.062  27.181  33.926  1.00 41.79 ? 1064 PHE B C     1 
ATOM   4708  O O     . PHE B  1 32  ? 59.354  27.816  33.140  1.00 42.05 ? 1064 PHE B O     1 
ATOM   4709  C CB    . PHE B  1 32  ? 62.144  26.432  32.821  1.00 41.25 ? 1064 PHE B CB    1 
ATOM   4710  C CG    . PHE B  1 32  ? 62.870  25.378  32.056  1.00 38.92 ? 1064 PHE B CG    1 
ATOM   4711  C CD1   . PHE B  1 32  ? 62.442  24.998  30.794  1.00 40.78 ? 1064 PHE B CD1   1 
ATOM   4712  C CD2   . PHE B  1 32  ? 63.980  24.753  32.599  1.00 38.13 ? 1064 PHE B CD2   1 
ATOM   4713  C CE1   . PHE B  1 32  ? 63.113  24.004  30.076  1.00 40.83 ? 1064 PHE B CE1   1 
ATOM   4714  C CE2   . PHE B  1 32  ? 64.657  23.762  31.895  1.00 39.76 ? 1064 PHE B CE2   1 
ATOM   4715  C CZ    . PHE B  1 32  ? 64.221  23.386  30.627  1.00 39.07 ? 1064 PHE B CZ    1 
ATOM   4716  N N     . TYR B  1 33  ? 60.192  27.511  35.207  1.00 40.43 ? 1065 TYR B N     1 
ATOM   4717  C CA    . TYR B  1 33  ? 59.552  28.708  35.721  1.00 40.27 ? 1065 TYR B CA    1 
ATOM   4718  C C     . TYR B  1 33  ? 60.660  29.733  35.879  1.00 39.79 ? 1065 TYR B C     1 
ATOM   4719  O O     . TYR B  1 33  ? 61.580  29.801  35.056  1.00 40.93 ? 1065 TYR B O     1 
ATOM   4720  C CB    . TYR B  1 33  ? 58.845  28.481  37.070  1.00 39.41 ? 1065 TYR B CB    1 
ATOM   4721  C CG    . TYR B  1 33  ? 59.329  27.325  37.914  1.00 38.64 ? 1065 TYR B CG    1 
ATOM   4722  C CD1   . TYR B  1 33  ? 59.787  27.542  39.217  1.00 37.26 ? 1065 TYR B CD1   1 
ATOM   4723  C CD2   . TYR B  1 33  ? 59.273  26.009  37.441  1.00 37.43 ? 1065 TYR B CD2   1 
ATOM   4724  C CE1   . TYR B  1 33  ? 60.176  26.480  40.033  1.00 34.47 ? 1065 TYR B CE1   1 
ATOM   4725  C CE2   . TYR B  1 33  ? 59.661  24.938  38.246  1.00 36.43 ? 1065 TYR B CE2   1 
ATOM   4726  C CZ    . TYR B  1 33  ? 60.110  25.182  39.542  1.00 37.69 ? 1065 TYR B CZ    1 
ATOM   4727  O OH    . TYR B  1 33  ? 60.484  24.126  40.344  1.00 37.28 ? 1065 TYR B OH    1 
ATOM   4728  N N     . GLY B  1 34  ? 60.588  30.530  36.931  1.00 38.09 ? 1066 GLY B N     1 
ATOM   4729  C CA    . GLY B  1 34  ? 61.621  31.525  37.118  1.00 39.87 ? 1066 GLY B CA    1 
ATOM   4730  C C     . GLY B  1 34  ? 61.463  32.642  36.110  1.00 40.30 ? 1066 GLY B C     1 
ATOM   4731  O O     . GLY B  1 34  ? 61.032  32.435  34.975  1.00 39.38 ? 1066 GLY B O     1 
ATOM   4732  N N     . GLU B  1 35  ? 61.815  33.841  36.544  1.00 39.58 ? 1067 GLU B N     1 
ATOM   4733  C CA    . GLU B  1 35  ? 61.716  35.025  35.718  1.00 42.35 ? 1067 GLU B CA    1 
ATOM   4734  C C     . GLU B  1 35  ? 62.276  34.814  34.311  1.00 43.76 ? 1067 GLU B C     1 
ATOM   4735  O O     . GLU B  1 35  ? 61.808  35.431  33.356  1.00 45.98 ? 1067 GLU B O     1 
ATOM   4736  C CB    . GLU B  1 35  ? 62.445  36.178  36.429  1.00 42.45 ? 1067 GLU B CB    1 
ATOM   4737  C CG    . GLU B  1 35  ? 63.008  37.281  35.542  1.00 42.88 ? 1067 GLU B CG    1 
ATOM   4738  C CD    . GLU B  1 35  ? 63.646  38.398  36.355  1.00 45.24 ? 1067 GLU B CD    1 
ATOM   4739  O OE1   . GLU B  1 35  ? 63.782  38.241  37.589  1.00 42.98 ? 1067 GLU B OE1   1 
ATOM   4740  O OE2   . GLU B  1 35  ? 64.009  39.438  35.767  1.00 45.10 ? 1067 GLU B OE2   1 
ATOM   4741  N N     . ASN B  1 36  ? 63.253  33.924  34.173  1.00 44.30 ? 1068 ASN B N     1 
ATOM   4742  C CA    . ASN B  1 36  ? 63.876  33.708  32.872  1.00 42.99 ? 1068 ASN B CA    1 
ATOM   4743  C C     . ASN B  1 36  ? 63.574  32.364  32.230  1.00 41.52 ? 1068 ASN B C     1 
ATOM   4744  O O     . ASN B  1 36  ? 64.172  32.023  31.210  1.00 40.69 ? 1068 ASN B O     1 
ATOM   4745  C CB    . ASN B  1 36  ? 65.398  33.902  32.993  1.00 43.97 ? 1068 ASN B CB    1 
ATOM   4746  C CG    . ASN B  1 36  ? 65.796  35.363  33.267  1.00 48.85 ? 1068 ASN B CG    1 
ATOM   4747  O OD1   . ASN B  1 36  ? 65.350  36.281  32.572  1.00 38.51 ? 1068 ASN B OD1   1 
ATOM   4748  N ND2   . ASN B  1 36  ? 66.641  35.567  34.280  1.00 52.81 ? 1068 ASN B ND2   1 
ATOM   4749  N N     . CYS B  1 37  ? 62.650  31.608  32.823  1.00 40.02 ? 1069 CYS B N     1 
ATOM   4750  C CA    . CYS B  1 37  ? 62.258  30.296  32.299  1.00 39.54 ? 1069 CYS B CA    1 
ATOM   4751  C C     . CYS B  1 37  ? 63.404  29.331  32.451  1.00 40.43 ? 1069 CYS B C     1 
ATOM   4752  O O     . CYS B  1 37  ? 63.655  28.490  31.587  1.00 42.88 ? 1069 CYS B O     1 
ATOM   4753  C CB    . CYS B  1 37  ? 61.867  30.407  30.825  1.00 36.62 ? 1069 CYS B CB    1 
ATOM   4754  S SG    . CYS B  1 37  ? 60.590  31.677  30.542  1.00 42.57 ? 1069 CYS B SG    1 
ATOM   4755  N N     . THR B  1 38  ? 64.082  29.458  33.584  1.00 43.60 ? 1070 THR B N     1 
ATOM   4756  C CA    . THR B  1 38  ? 65.250  28.653  33.896  1.00 41.58 ? 1070 THR B CA    1 
ATOM   4757  C C     . THR B  1 38  ? 64.947  27.517  34.860  1.00 40.63 ? 1070 THR B C     1 
ATOM   4758  O O     . THR B  1 38  ? 65.171  26.355  34.534  1.00 39.40 ? 1070 THR B O     1 
ATOM   4759  C CB    . THR B  1 38  ? 66.335  29.550  34.488  1.00 44.08 ? 1070 THR B CB    1 
ATOM   4760  O OG1   . THR B  1 38  ? 65.712  30.655  35.159  1.00 42.83 ? 1070 THR B OG1   1 
ATOM   4761  C CG2   . THR B  1 38  ? 67.237  30.090  33.382  1.00 43.47 ? 1070 THR B CG2   1 
ATOM   4762  N N     . THR B  1 39  ? 64.451  27.846  36.049  1.00 38.68 ? 1071 THR B N     1 
ATOM   4763  C CA    . THR B  1 39  ? 64.123  26.812  37.025  1.00 39.59 ? 1071 THR B CA    1 
ATOM   4764  C C     . THR B  1 39  ? 63.260  25.772  36.327  1.00 39.41 ? 1071 THR B C     1 
ATOM   4765  O O     . THR B  1 39  ? 62.189  26.088  35.829  1.00 41.11 ? 1071 THR B O     1 
ATOM   4766  C CB    . THR B  1 39  ? 63.335  27.381  38.210  1.00 38.53 ? 1071 THR B CB    1 
ATOM   4767  O OG1   . THR B  1 39  ? 63.820  28.697  38.527  1.00 36.04 ? 1071 THR B OG1   1 
ATOM   4768  C CG2   . THR B  1 39  ? 63.464  26.449  39.420  1.00 41.32 ? 1071 THR B CG2   1 
ATOM   4769  N N     . PRO B  1 40  ? 63.714  24.517  36.284  1.00 39.03 ? 1072 PRO B N     1 
ATOM   4770  C CA    . PRO B  1 40  ? 62.934  23.473  35.623  1.00 42.78 ? 1072 PRO B CA    1 
ATOM   4771  C C     . PRO B  1 40  ? 61.962  22.779  36.564  1.00 46.08 ? 1072 PRO B C     1 
ATOM   4772  O O     . PRO B  1 40  ? 62.014  22.959  37.782  1.00 47.62 ? 1072 PRO B O     1 
ATOM   4773  C CB    . PRO B  1 40  ? 63.997  22.514  35.136  1.00 40.97 ? 1072 PRO B CB    1 
ATOM   4774  C CG    . PRO B  1 40  ? 65.030  22.590  36.211  1.00 39.90 ? 1072 PRO B CG    1 
ATOM   4775  C CD    . PRO B  1 40  ? 64.954  23.969  36.845  1.00 36.60 ? 1072 PRO B CD    1 
ATOM   4776  N N     . GLU B  1 41  ? 61.071  21.983  35.989  1.00 49.04 ? 1073 GLU B N     1 
ATOM   4777  C CA    . GLU B  1 41  ? 60.111  21.232  36.779  1.00 53.46 ? 1073 GLU B CA    1 
ATOM   4778  C C     . GLU B  1 41  ? 60.703  19.839  36.862  1.00 51.17 ? 1073 GLU B C     1 
ATOM   4779  O O     . GLU B  1 41  ? 61.680  19.543  36.172  1.00 50.30 ? 1073 GLU B O     1 
ATOM   4780  C CB    . GLU B  1 41  ? 58.745  21.204  36.085  1.00 57.51 ? 1073 GLU B CB    1 
ATOM   4781  C CG    . GLU B  1 41  ? 58.070  22.578  36.024  1.00 66.56 ? 1073 GLU B CG    1 
ATOM   4782  C CD    . GLU B  1 41  ? 56.841  22.612  35.122  1.00 71.06 ? 1073 GLU B CD    1 
ATOM   4783  O OE1   . GLU B  1 41  ? 55.948  23.454  35.376  1.00 71.94 ? 1073 GLU B OE1   1 
ATOM   4784  O OE2   . GLU B  1 41  ? 56.769  21.804  34.164  1.00 73.32 ? 1073 GLU B OE2   1 
ATOM   4785  N N     . PHE B  1 42  ? 60.126  18.986  37.695  1.00 49.54 ? 1074 PHE B N     1 
ATOM   4786  C CA    . PHE B  1 42  ? 60.656  17.641  37.835  1.00 49.49 ? 1074 PHE B CA    1 
ATOM   4787  C C     . PHE B  1 42  ? 60.764  16.849  36.526  1.00 48.12 ? 1074 PHE B C     1 
ATOM   4788  O O     . PHE B  1 42  ? 61.872  16.600  36.051  1.00 50.02 ? 1074 PHE B O     1 
ATOM   4789  C CB    . PHE B  1 42  ? 59.843  16.852  38.854  1.00 49.91 ? 1074 PHE B CB    1 
ATOM   4790  C CG    . PHE B  1 42  ? 60.648  15.824  39.592  1.00 50.23 ? 1074 PHE B CG    1 
ATOM   4791  C CD1   . PHE B  1 42  ? 61.683  16.213  40.431  1.00 51.47 ? 1074 PHE B CD1   1 
ATOM   4792  C CD2   . PHE B  1 42  ? 60.381  14.464  39.436  1.00 50.71 ? 1074 PHE B CD2   1 
ATOM   4793  C CE1   . PHE B  1 42  ? 62.444  15.262  41.106  1.00 52.27 ? 1074 PHE B CE1   1 
ATOM   4794  C CE2   . PHE B  1 42  ? 61.135  13.504  40.106  1.00 50.82 ? 1074 PHE B CE2   1 
ATOM   4795  C CZ    . PHE B  1 42  ? 62.168  13.901  40.941  1.00 51.56 ? 1074 PHE B CZ    1 
ATOM   4796  N N     . LEU B  1 43  ? 59.637  16.447  35.942  1.00 46.13 ? 1075 LEU B N     1 
ATOM   4797  C CA    . LEU B  1 43  ? 59.700  15.684  34.700  1.00 45.39 ? 1075 LEU B CA    1 
ATOM   4798  C C     . LEU B  1 43  ? 60.702  16.305  33.741  1.00 43.05 ? 1075 LEU B C     1 
ATOM   4799  O O     . LEU B  1 43  ? 61.342  15.607  32.961  1.00 42.80 ? 1075 LEU B O     1 
ATOM   4800  C CB    . LEU B  1 43  ? 58.331  15.599  34.017  1.00 51.10 ? 1075 LEU B CB    1 
ATOM   4801  C CG    . LEU B  1 43  ? 58.336  14.912  32.634  1.00 54.11 ? 1075 LEU B CG    1 
ATOM   4802  C CD1   . LEU B  1 43  ? 59.129  13.602  32.697  1.00 56.16 ? 1075 LEU B CD1   1 
ATOM   4803  C CD2   . LEU B  1 43  ? 56.906  14.646  32.166  1.00 53.36 ? 1075 LEU B CD2   1 
ATOM   4804  N N     . THR B  1 44  ? 60.834  17.623  33.798  1.00 40.26 ? 1076 THR B N     1 
ATOM   4805  C CA    . THR B  1 44  ? 61.783  18.310  32.942  1.00 40.55 ? 1076 THR B CA    1 
ATOM   4806  C C     . THR B  1 44  ? 63.147  17.683  33.198  1.00 42.40 ? 1076 THR B C     1 
ATOM   4807  O O     . THR B  1 44  ? 63.797  17.174  32.286  1.00 41.11 ? 1076 THR B O     1 
ATOM   4808  C CB    . THR B  1 44  ? 61.866  19.802  33.292  1.00 40.47 ? 1076 THR B CB    1 
ATOM   4809  O OG1   . THR B  1 44  ? 60.554  20.311  33.549  1.00 37.42 ? 1076 THR B OG1   1 
ATOM   4810  C CG2   . THR B  1 44  ? 62.497  20.577  32.153  1.00 38.91 ? 1076 THR B CG2   1 
ATOM   4811  N N     . ARG B  1 45  ? 63.560  17.720  34.461  1.00 43.91 ? 1077 ARG B N     1 
ATOM   4812  C CA    . ARG B  1 45  ? 64.839  17.169  34.886  1.00 46.39 ? 1077 ARG B CA    1 
ATOM   4813  C C     . ARG B  1 45  ? 65.011  15.764  34.358  1.00 45.19 ? 1077 ARG B C     1 
ATOM   4814  O O     . ARG B  1 45  ? 65.885  15.509  33.545  1.00 45.06 ? 1077 ARG B O     1 
ATOM   4815  C CB    . ARG B  1 45  ? 64.929  17.140  36.412  1.00 53.22 ? 1077 ARG B CB    1 
ATOM   4816  C CG    . ARG B  1 45  ? 64.066  18.176  37.105  1.00 64.92 ? 1077 ARG B CG    1 
ATOM   4817  C CD    . ARG B  1 45  ? 64.842  18.919  38.172  1.00 71.81 ? 1077 ARG B CD    1 
ATOM   4818  N NE    . ARG B  1 45  ? 64.370  20.291  38.328  1.00 83.15 ? 1077 ARG B NE    1 
ATOM   4819  C CZ    . ARG B  1 45  ? 64.389  20.957  39.478  1.00 88.12 ? 1077 ARG B CZ    1 
ATOM   4820  N NH1   . ARG B  1 45  ? 64.858  20.375  40.576  1.00 88.27 ? 1077 ARG B NH1   1 
ATOM   4821  N NH2   . ARG B  1 45  ? 63.947  22.208  39.532  1.00 90.18 ? 1077 ARG B NH2   1 
ATOM   4822  N N     . ILE B  1 46  ? 64.165  14.857  34.826  1.00 42.81 ? 1078 ILE B N     1 
ATOM   4823  C CA    . ILE B  1 46  ? 64.228  13.464  34.404  1.00 44.63 ? 1078 ILE B CA    1 
ATOM   4824  C C     . ILE B  1 46  ? 64.248  13.361  32.886  1.00 44.49 ? 1078 ILE B C     1 
ATOM   4825  O O     . ILE B  1 46  ? 64.817  12.421  32.326  1.00 42.83 ? 1078 ILE B O     1 
ATOM   4826  C CB    . ILE B  1 46  ? 63.025  12.658  34.927  1.00 45.09 ? 1078 ILE B CB    1 
ATOM   4827  C CG1   . ILE B  1 46  ? 62.324  13.433  36.049  1.00 46.84 ? 1078 ILE B CG1   1 
ATOM   4828  C CG2   . ILE B  1 46  ? 63.488  11.276  35.392  1.00 44.55 ? 1078 ILE B CG2   1 
ATOM   4829  C CD1   . ILE B  1 46  ? 63.182  13.657  37.290  1.00 42.52 ? 1078 ILE B CD1   1 
ATOM   4830  N N     . LYS B  1 47  ? 63.623  14.329  32.223  1.00 48.17 ? 1079 LYS B N     1 
ATOM   4831  C CA    . LYS B  1 47  ? 63.580  14.342  30.767  1.00 51.92 ? 1079 LYS B CA    1 
ATOM   4832  C C     . LYS B  1 47  ? 64.971  14.645  30.236  1.00 53.29 ? 1079 LYS B C     1 
ATOM   4833  O O     . LYS B  1 47  ? 65.415  14.050  29.254  1.00 55.98 ? 1079 LYS B O     1 
ATOM   4834  C CB    . LYS B  1 47  ? 62.587  15.399  30.260  1.00 56.90 ? 1079 LYS B CB    1 
ATOM   4835  C CG    . LYS B  1 47  ? 61.169  14.856  30.029  1.00 64.15 ? 1079 LYS B CG    1 
ATOM   4836  C CD    . LYS B  1 47  ? 60.278  15.825  29.253  1.00 65.22 ? 1079 LYS B CD    1 
ATOM   4837  C CE    . LYS B  1 47  ? 58.907  15.201  28.993  1.00 68.37 ? 1079 LYS B CE    1 
ATOM   4838  N NZ    . LYS B  1 47  ? 57.903  16.186  28.494  1.00 67.15 ? 1079 LYS B NZ    1 
ATOM   4839  N N     . LEU B  1 48  ? 65.659  15.566  30.902  1.00 51.27 ? 1080 LEU B N     1 
ATOM   4840  C CA    . LEU B  1 48  ? 67.001  15.961  30.500  1.00 51.17 ? 1080 LEU B CA    1 
ATOM   4841  C C     . LEU B  1 48  ? 68.048  14.938  30.906  1.00 52.01 ? 1080 LEU B C     1 
ATOM   4842  O O     . LEU B  1 48  ? 69.014  14.704  30.177  1.00 53.56 ? 1080 LEU B O     1 
ATOM   4843  C CB    . LEU B  1 48  ? 67.333  17.311  31.112  1.00 47.21 ? 1080 LEU B CB    1 
ATOM   4844  C CG    . LEU B  1 48  ? 66.189  18.304  30.914  1.00 48.67 ? 1080 LEU B CG    1 
ATOM   4845  C CD1   . LEU B  1 48  ? 66.537  19.640  31.555  1.00 46.31 ? 1080 LEU B CD1   1 
ATOM   4846  C CD2   . LEU B  1 48  ? 65.915  18.473  29.423  1.00 49.17 ? 1080 LEU B CD2   1 
ATOM   4847  N N     . LEU B  1 49  ? 67.847  14.326  32.070  1.00 53.15 ? 1081 LEU B N     1 
ATOM   4848  C CA    . LEU B  1 49  ? 68.763  13.315  32.585  1.00 51.65 ? 1081 LEU B CA    1 
ATOM   4849  C C     . LEU B  1 49  ? 68.438  11.997  31.914  1.00 51.26 ? 1081 LEU B C     1 
ATOM   4850  O O     . LEU B  1 49  ? 68.514  10.934  32.523  1.00 50.02 ? 1081 LEU B O     1 
ATOM   4851  C CB    . LEU B  1 49  ? 68.613  13.194  34.102  1.00 53.51 ? 1081 LEU B CB    1 
ATOM   4852  C CG    . LEU B  1 49  ? 68.484  14.530  34.846  1.00 55.81 ? 1081 LEU B CG    1 
ATOM   4853  C CD1   . LEU B  1 49  ? 68.689  14.303  36.333  1.00 56.82 ? 1081 LEU B CD1   1 
ATOM   4854  C CD2   . LEU B  1 49  ? 69.509  15.535  34.319  1.00 56.04 ? 1081 LEU B CD2   1 
ATOM   4855  N N     . LEU B  1 50  ? 68.060  12.100  30.647  1.00 50.13 ? 1082 LEU B N     1 
ATOM   4856  C CA    . LEU B  1 50  ? 67.708  10.961  29.810  1.00 52.63 ? 1082 LEU B CA    1 
ATOM   4857  C C     . LEU B  1 50  ? 67.776  11.457  28.368  1.00 52.74 ? 1082 LEU B C     1 
ATOM   4858  O O     . LEU B  1 50  ? 67.299  10.793  27.446  1.00 52.30 ? 1082 LEU B O     1 
ATOM   4859  C CB    . LEU B  1 50  ? 66.285  10.476  30.127  1.00 51.30 ? 1082 LEU B CB    1 
ATOM   4860  C CG    . LEU B  1 50  ? 66.114  9.691   31.435  1.00 52.32 ? 1082 LEU B CG    1 
ATOM   4861  C CD1   . LEU B  1 50  ? 64.638  9.599   31.803  1.00 49.04 ? 1082 LEU B CD1   1 
ATOM   4862  C CD2   . LEU B  1 50  ? 66.719  8.301   31.287  1.00 50.92 ? 1082 LEU B CD2   1 
ATOM   4863  N N     . LYS B  1 51  ? 68.366  12.642  28.197  1.00 51.58 ? 1083 LYS B N     1 
ATOM   4864  C CA    . LYS B  1 51  ? 68.515  13.270  26.886  1.00 50.27 ? 1083 LYS B CA    1 
ATOM   4865  C C     . LYS B  1 51  ? 69.964  13.207  26.437  1.00 45.79 ? 1083 LYS B C     1 
ATOM   4866  O O     . LYS B  1 51  ? 70.790  14.021  26.849  1.00 45.67 ? 1083 LYS B O     1 
ATOM   4867  C CB    . LYS B  1 51  ? 68.064  14.731  26.931  1.00 53.46 ? 1083 LYS B CB    1 
ATOM   4868  C CG    . LYS B  1 51  ? 68.005  15.391  25.556  1.00 56.05 ? 1083 LYS B CG    1 
ATOM   4869  C CD    . LYS B  1 51  ? 68.434  16.851  25.627  1.00 61.63 ? 1083 LYS B CD    1 
ATOM   4870  C CE    . LYS B  1 51  ? 68.998  17.336  24.297  1.00 64.47 ? 1083 LYS B CE    1 
ATOM   4871  N NZ    . LYS B  1 51  ? 69.414  18.774  24.339  1.00 65.63 ? 1083 LYS B NZ    1 
ATOM   4872  N N     . PRO B  1 52  ? 70.286  12.242  25.568  1.00 42.79 ? 1084 PRO B N     1 
ATOM   4873  C CA    . PRO B  1 52  ? 71.633  12.025  25.029  1.00 41.11 ? 1084 PRO B CA    1 
ATOM   4874  C C     . PRO B  1 52  ? 72.086  13.106  24.045  1.00 41.84 ? 1084 PRO B C     1 
ATOM   4875  O O     . PRO B  1 52  ? 71.322  13.496  23.157  1.00 42.01 ? 1084 PRO B O     1 
ATOM   4876  C CB    . PRO B  1 52  ? 71.518  10.668  24.355  1.00 42.75 ? 1084 PRO B CB    1 
ATOM   4877  C CG    . PRO B  1 52  ? 70.088  10.597  23.938  1.00 39.98 ? 1084 PRO B CG    1 
ATOM   4878  C CD    . PRO B  1 52  ? 69.319  11.275  25.021  1.00 39.25 ? 1084 PRO B CD    1 
ATOM   4879  N N     . THR B  1 53  ? 73.325  13.576  24.190  1.00 37.54 ? 1085 THR B N     1 
ATOM   4880  C CA    . THR B  1 53  ? 73.843  14.611  23.292  1.00 33.66 ? 1085 THR B CA    1 
ATOM   4881  C C     . THR B  1 53  ? 73.768  14.184  21.819  1.00 32.57 ? 1085 THR B C     1 
ATOM   4882  O O     . THR B  1 53  ? 74.040  13.038  21.476  1.00 33.00 ? 1085 THR B O     1 
ATOM   4883  C CB    . THR B  1 53  ? 75.289  14.969  23.621  1.00 31.86 ? 1085 THR B CB    1 
ATOM   4884  O OG1   . THR B  1 53  ? 76.153  14.390  22.639  1.00 34.99 ? 1085 THR B OG1   1 
ATOM   4885  C CG2   . THR B  1 53  ? 75.664  14.449  24.984  1.00 32.10 ? 1085 THR B CG2   1 
ATOM   4886  N N     . PRO B  1 54  ? 73.411  15.116  20.928  1.00 29.96 ? 1086 PRO B N     1 
ATOM   4887  C CA    . PRO B  1 54  ? 73.300  14.822  19.502  1.00 29.23 ? 1086 PRO B CA    1 
ATOM   4888  C C     . PRO B  1 54  ? 74.545  14.140  18.973  1.00 29.71 ? 1086 PRO B C     1 
ATOM   4889  O O     . PRO B  1 54  ? 74.470  13.236  18.133  1.00 29.60 ? 1086 PRO B O     1 
ATOM   4890  C CB    . PRO B  1 54  ? 73.071  16.196  18.862  1.00 30.40 ? 1086 PRO B CB    1 
ATOM   4891  C CG    . PRO B  1 54  ? 73.427  17.184  19.905  1.00 32.25 ? 1086 PRO B CG    1 
ATOM   4892  C CD    . PRO B  1 54  ? 73.126  16.527  21.212  1.00 30.88 ? 1086 PRO B CD    1 
ATOM   4893  N N     . ASN B  1 55  ? 75.689  14.592  19.471  1.00 29.50 ? 1087 ASN B N     1 
ATOM   4894  C CA    . ASN B  1 55  ? 76.963  14.036  19.069  1.00 30.13 ? 1087 ASN B CA    1 
ATOM   4895  C C     . ASN B  1 55  ? 76.977  12.574  19.456  1.00 30.52 ? 1087 ASN B C     1 
ATOM   4896  O O     . ASN B  1 55  ? 77.350  11.711  18.658  1.00 31.36 ? 1087 ASN B O     1 
ATOM   4897  C CB    . ASN B  1 55  ? 78.091  14.779  19.767  1.00 34.07 ? 1087 ASN B CB    1 
ATOM   4898  C CG    . ASN B  1 55  ? 78.195  16.214  19.314  1.00 41.68 ? 1087 ASN B CG    1 
ATOM   4899  O OD1   . ASN B  1 55  ? 77.585  16.606  18.319  1.00 44.43 ? 1087 ASN B OD1   1 
ATOM   4900  N ND2   . ASN B  1 55  ? 78.964  17.010  20.041  1.00 46.69 ? 1087 ASN B ND2   1 
ATOM   4901  N N     . THR B  1 56  ? 76.554  12.301  20.686  1.00 30.47 ? 1088 THR B N     1 
ATOM   4902  C CA    . THR B  1 56  ? 76.504  10.936  21.185  1.00 34.90 ? 1088 THR B CA    1 
ATOM   4903  C C     . THR B  1 56  ? 75.746  10.103  20.167  1.00 35.60 ? 1088 THR B C     1 
ATOM   4904  O O     . THR B  1 56  ? 76.281  9.163   19.576  1.00 35.55 ? 1088 THR B O     1 
ATOM   4905  C CB    . THR B  1 56  ? 75.739  10.847  22.511  1.00 33.63 ? 1088 THR B CB    1 
ATOM   4906  O OG1   . THR B  1 56  ? 76.374  11.667  23.499  1.00 38.21 ? 1088 THR B OG1   1 
ATOM   4907  C CG2   . THR B  1 56  ? 75.688  9.414   22.981  1.00 37.54 ? 1088 THR B CG2   1 
ATOM   4908  N N     . VAL B  1 57  ? 74.489  10.478  19.970  1.00 34.90 ? 1089 VAL B N     1 
ATOM   4909  C CA    . VAL B  1 57  ? 73.603  9.797   19.038  1.00 35.78 ? 1089 VAL B CA    1 
ATOM   4910  C C     . VAL B  1 57  ? 74.235  9.664   17.666  1.00 33.99 ? 1089 VAL B C     1 
ATOM   4911  O O     . VAL B  1 57  ? 74.418  8.551   17.146  1.00 30.71 ? 1089 VAL B O     1 
ATOM   4912  C CB    . VAL B  1 57  ? 72.291  10.561  18.887  1.00 34.88 ? 1089 VAL B CB    1 
ATOM   4913  C CG1   . VAL B  1 57  ? 71.142  9.568   18.686  1.00 33.94 ? 1089 VAL B CG1   1 
ATOM   4914  C CG2   . VAL B  1 57  ? 72.061  11.444  20.116  1.00 31.71 ? 1089 VAL B CG2   1 
ATOM   4915  N N     . HIS B  1 58  ? 74.548  10.817  17.084  1.00 35.73 ? 1090 HIS B N     1 
ATOM   4916  C CA    . HIS B  1 58  ? 75.178  10.859  15.776  1.00 37.23 ? 1090 HIS B CA    1 
ATOM   4917  C C     . HIS B  1 58  ? 76.207  9.748   15.744  1.00 35.83 ? 1090 HIS B C     1 
ATOM   4918  O O     . HIS B  1 58  ? 76.294  8.974   14.786  1.00 35.62 ? 1090 HIS B O     1 
ATOM   4919  C CB    . HIS B  1 58  ? 75.884  12.197  15.558  1.00 37.43 ? 1090 HIS B CB    1 
ATOM   4920  C CG    . HIS B  1 58  ? 76.561  12.298  14.227  1.00 40.57 ? 1090 HIS B CG    1 
ATOM   4921  N ND1   . HIS B  1 58  ? 76.701  11.217  13.379  1.00 37.70 ? 1090 HIS B ND1   1 
ATOM   4922  C CD2   . HIS B  1 58  ? 77.118  13.354  13.587  1.00 39.97 ? 1090 HIS B CD2   1 
ATOM   4923  C CE1   . HIS B  1 58  ? 77.313  11.604  12.275  1.00 41.42 ? 1090 HIS B CE1   1 
ATOM   4924  N NE2   . HIS B  1 58  ? 77.577  12.896  12.375  1.00 42.01 ? 1090 HIS B NE2   1 
ATOM   4925  N N     . TYR B  1 59  ? 76.982  9.677   16.817  1.00 33.89 ? 1091 TYR B N     1 
ATOM   4926  C CA    . TYR B  1 59  ? 77.997  8.662   16.930  1.00 34.89 ? 1091 TYR B CA    1 
ATOM   4927  C C     . TYR B  1 59  ? 77.325  7.308   16.744  1.00 29.70 ? 1091 TYR B C     1 
ATOM   4928  O O     . TYR B  1 59  ? 77.543  6.629   15.740  1.00 27.29 ? 1091 TYR B O     1 
ATOM   4929  C CB    . TYR B  1 59  ? 78.673  8.756   18.303  1.00 42.15 ? 1091 TYR B CB    1 
ATOM   4930  C CG    . TYR B  1 59  ? 79.604  7.608   18.595  1.00 52.59 ? 1091 TYR B CG    1 
ATOM   4931  C CD1   . TYR B  1 59  ? 80.980  7.747   18.438  1.00 56.31 ? 1091 TYR B CD1   1 
ATOM   4932  C CD2   . TYR B  1 59  ? 79.103  6.356   18.961  1.00 55.95 ? 1091 TYR B CD2   1 
ATOM   4933  C CE1   . TYR B  1 59  ? 81.837  6.665   18.626  1.00 59.18 ? 1091 TYR B CE1   1 
ATOM   4934  C CE2   . TYR B  1 59  ? 79.946  5.270   19.150  1.00 59.87 ? 1091 TYR B CE2   1 
ATOM   4935  C CZ    . TYR B  1 59  ? 81.312  5.429   18.977  1.00 62.58 ? 1091 TYR B CZ    1 
ATOM   4936  O OH    . TYR B  1 59  ? 82.145  4.342   19.125  1.00 63.58 ? 1091 TYR B OH    1 
ATOM   4937  N N     . ILE B  1 60  ? 76.490  6.933   17.706  1.00 24.92 ? 1092 ILE B N     1 
ATOM   4938  C CA    . ILE B  1 60  ? 75.814  5.644   17.656  1.00 23.57 ? 1092 ILE B CA    1 
ATOM   4939  C C     . ILE B  1 60  ? 75.171  5.355   16.314  1.00 27.77 ? 1092 ILE B C     1 
ATOM   4940  O O     . ILE B  1 60  ? 75.060  4.193   15.914  1.00 28.21 ? 1092 ILE B O     1 
ATOM   4941  C CB    . ILE B  1 60  ? 74.728  5.524   18.721  1.00 18.88 ? 1092 ILE B CB    1 
ATOM   4942  C CG1   . ILE B  1 60  ? 74.540  6.868   19.432  1.00 16.34 ? 1092 ILE B CG1   1 
ATOM   4943  C CG2   . ILE B  1 60  ? 75.073  4.383   19.654  1.00 14.89 ? 1092 ILE B CG2   1 
ATOM   4944  C CD1   . ILE B  1 60  ? 74.913  6.890   20.910  1.00 15.14 ? 1092 ILE B CD1   1 
ATOM   4945  N N     . LEU B  1 61  ? 74.757  6.415   15.623  1.00 28.91 ? 1093 LEU B N     1 
ATOM   4946  C CA    . LEU B  1 61  ? 74.109  6.297   14.316  1.00 29.16 ? 1093 LEU B CA    1 
ATOM   4947  C C     . LEU B  1 61  ? 75.090  5.899   13.238  1.00 30.17 ? 1093 LEU B C     1 
ATOM   4948  O O     . LEU B  1 61  ? 74.741  5.221   12.276  1.00 26.67 ? 1093 LEU B O     1 
ATOM   4949  C CB    . LEU B  1 61  ? 73.503  7.637   13.907  1.00 30.30 ? 1093 LEU B CB    1 
ATOM   4950  C CG    . LEU B  1 61  ? 72.008  7.865   14.085  1.00 34.13 ? 1093 LEU B CG    1 
ATOM   4951  C CD1   . LEU B  1 61  ? 71.257  6.524   14.118  1.00 33.00 ? 1093 LEU B CD1   1 
ATOM   4952  C CD2   . LEU B  1 61  ? 71.805  8.661   15.368  1.00 32.53 ? 1093 LEU B CD2   1 
ATOM   4953  N N     . THR B  1 62  ? 76.324  6.353   13.408  1.00 33.96 ? 1094 THR B N     1 
ATOM   4954  C CA    . THR B  1 62  ? 77.383  6.109   12.445  1.00 34.29 ? 1094 THR B CA    1 
ATOM   4955  C C     . THR B  1 62  ? 78.329  4.968   12.816  1.00 36.42 ? 1094 THR B C     1 
ATOM   4956  O O     . THR B  1 62  ? 79.329  4.738   12.134  1.00 34.37 ? 1094 THR B O     1 
ATOM   4957  C CB    . THR B  1 62  ? 78.193  7.393   12.256  1.00 36.31 ? 1094 THR B CB    1 
ATOM   4958  O OG1   . THR B  1 62  ? 78.312  8.054   13.518  1.00 36.33 ? 1094 THR B OG1   1 
ATOM   4959  C CG2   . THR B  1 62  ? 77.486  8.329   11.287  1.00 37.45 ? 1094 THR B CG2   1 
ATOM   4960  N N     . HIS B  1 63  ? 78.012  4.245   13.883  1.00 35.32 ? 1095 HIS B N     1 
ATOM   4961  C CA    . HIS B  1 63  ? 78.870  3.157   14.306  1.00 38.03 ? 1095 HIS B CA    1 
ATOM   4962  C C     . HIS B  1 63  ? 78.132  1.840   14.380  1.00 37.44 ? 1095 HIS B C     1 
ATOM   4963  O O     . HIS B  1 63  ? 77.111  1.675   13.736  1.00 38.93 ? 1095 HIS B O     1 
ATOM   4964  C CB    . HIS B  1 63  ? 79.504  3.490   15.651  1.00 42.56 ? 1095 HIS B CB    1 
ATOM   4965  C CG    . HIS B  1 63  ? 80.554  4.550   15.563  1.00 49.73 ? 1095 HIS B CG    1 
ATOM   4966  N ND1   . HIS B  1 63  ? 80.250  5.895   15.556  1.00 55.23 ? 1095 HIS B ND1   1 
ATOM   4967  C CD2   . HIS B  1 63  ? 81.898  4.467   15.427  1.00 50.57 ? 1095 HIS B CD2   1 
ATOM   4968  C CE1   . HIS B  1 63  ? 81.363  6.596   15.418  1.00 53.45 ? 1095 HIS B CE1   1 
ATOM   4969  N NE2   . HIS B  1 63  ? 82.375  5.753   15.338  1.00 52.26 ? 1095 HIS B NE2   1 
ATOM   4970  N N     . PHE B  1 64  ? 78.674  0.898   15.148  1.00 33.55 ? 1096 PHE B N     1 
ATOM   4971  C CA    . PHE B  1 64  ? 78.088  -0.421  15.313  1.00 29.84 ? 1096 PHE B CA    1 
ATOM   4972  C C     . PHE B  1 64  ? 77.499  -0.967  14.022  1.00 28.71 ? 1096 PHE B C     1 
ATOM   4973  O O     . PHE B  1 64  ? 76.616  -1.812  14.052  1.00 28.70 ? 1096 PHE B O     1 
ATOM   4974  C CB    . PHE B  1 64  ? 77.017  -0.370  16.389  1.00 33.34 ? 1096 PHE B CB    1 
ATOM   4975  C CG    . PHE B  1 64  ? 77.437  0.382   17.616  1.00 38.40 ? 1096 PHE B CG    1 
ATOM   4976  C CD1   . PHE B  1 64  ? 77.649  1.760   17.570  1.00 41.52 ? 1096 PHE B CD1   1 
ATOM   4977  C CD2   . PHE B  1 64  ? 77.633  -0.281  18.822  1.00 38.96 ? 1096 PHE B CD2   1 
ATOM   4978  C CE1   . PHE B  1 64  ? 78.052  2.467   18.709  1.00 39.67 ? 1096 PHE B CE1   1 
ATOM   4979  C CE2   . PHE B  1 64  ? 78.036  0.423   19.968  1.00 39.74 ? 1096 PHE B CE2   1 
ATOM   4980  C CZ    . PHE B  1 64  ? 78.244  1.798   19.906  1.00 37.18 ? 1096 PHE B CZ    1 
ATOM   4981  N N     . LYS B  1 65  ? 78.000  -0.487  12.890  1.00 25.19 ? 1097 LYS B N     1 
ATOM   4982  C CA    . LYS B  1 65  ? 77.522  -0.910  11.574  1.00 24.26 ? 1097 LYS B CA    1 
ATOM   4983  C C     . LYS B  1 65  ? 76.967  -2.333  11.548  1.00 22.63 ? 1097 LYS B C     1 
ATOM   4984  O O     . LYS B  1 65  ? 75.958  -2.603  10.901  1.00 22.89 ? 1097 LYS B O     1 
ATOM   4985  C CB    . LYS B  1 65  ? 78.651  -0.780  10.542  1.00 22.09 ? 1097 LYS B CB    1 
ATOM   4986  C CG    . LYS B  1 65  ? 78.356  -1.412  9.178   1.00 21.21 ? 1097 LYS B CG    1 
ATOM   4987  C CD    . LYS B  1 65  ? 79.368  -0.941  8.128   1.00 24.01 ? 1097 LYS B CD    1 
ATOM   4988  C CE    . LYS B  1 65  ? 79.163  -1.616  6.780   1.00 19.75 ? 1097 LYS B CE    1 
ATOM   4989  N NZ    . LYS B  1 65  ? 80.442  -2.089  6.162   1.00 18.50 ? 1097 LYS B NZ    1 
ATOM   4990  N N     . GLY B  1 66  ? 77.630  -3.244  12.249  1.00 24.18 ? 1098 GLY B N     1 
ATOM   4991  C CA    . GLY B  1 66  ? 77.156  -4.612  12.265  1.00 29.63 ? 1098 GLY B CA    1 
ATOM   4992  C C     . GLY B  1 66  ? 75.719  -4.667  12.741  1.00 32.14 ? 1098 GLY B C     1 
ATOM   4993  O O     . GLY B  1 66  ? 74.848  -5.223  12.072  1.00 30.15 ? 1098 GLY B O     1 
ATOM   4994  N N     . VAL B  1 67  ? 75.486  -4.087  13.915  1.00 32.50 ? 1099 VAL B N     1 
ATOM   4995  C CA    . VAL B  1 67  ? 74.163  -4.029  14.523  1.00 34.40 ? 1099 VAL B CA    1 
ATOM   4996  C C     . VAL B  1 67  ? 73.188  -3.327  13.583  1.00 35.86 ? 1099 VAL B C     1 
ATOM   4997  O O     . VAL B  1 67  ? 72.125  -3.851  13.287  1.00 34.52 ? 1099 VAL B O     1 
ATOM   4998  C CB    . VAL B  1 67  ? 74.234  -3.288  15.892  1.00 33.81 ? 1099 VAL B CB    1 
ATOM   4999  C CG1   . VAL B  1 67  ? 73.202  -2.170  15.961  1.00 29.96 ? 1099 VAL B CG1   1 
ATOM   5000  C CG2   . VAL B  1 67  ? 74.024  -4.281  17.022  1.00 32.31 ? 1099 VAL B CG2   1 
ATOM   5001  N N     . TRP B  1 68  ? 73.560  -2.146  13.106  1.00 37.14 ? 1100 TRP B N     1 
ATOM   5002  C CA    . TRP B  1 68  ? 72.706  -1.398  12.199  1.00 41.12 ? 1100 TRP B CA    1 
ATOM   5003  C C     . TRP B  1 68  ? 72.282  -2.273  11.032  1.00 39.63 ? 1100 TRP B C     1 
ATOM   5004  O O     . TRP B  1 68  ? 71.188  -2.135  10.512  1.00 40.71 ? 1100 TRP B O     1 
ATOM   5005  C CB    . TRP B  1 68  ? 73.442  -0.163  11.680  1.00 42.97 ? 1100 TRP B CB    1 
ATOM   5006  C CG    . TRP B  1 68  ? 73.433  0.968   12.650  1.00 46.56 ? 1100 TRP B CG    1 
ATOM   5007  C CD1   . TRP B  1 68  ? 74.501  1.703   13.050  1.00 46.75 ? 1100 TRP B CD1   1 
ATOM   5008  C CD2   . TRP B  1 68  ? 72.297  1.490   13.356  1.00 49.41 ? 1100 TRP B CD2   1 
ATOM   5009  N NE1   . TRP B  1 68  ? 74.112  2.654   13.963  1.00 48.19 ? 1100 TRP B NE1   1 
ATOM   5010  C CE2   . TRP B  1 68  ? 72.765  2.546   14.171  1.00 50.58 ? 1100 TRP B CE2   1 
ATOM   5011  C CE3   . TRP B  1 68  ? 70.934  1.167   13.380  1.00 49.71 ? 1100 TRP B CE3   1 
ATOM   5012  C CZ2   . TRP B  1 68  ? 71.916  3.284   15.001  1.00 51.39 ? 1100 TRP B CZ2   1 
ATOM   5013  C CZ3   . TRP B  1 68  ? 70.092  1.901   14.207  1.00 52.70 ? 1100 TRP B CZ3   1 
ATOM   5014  C CH2   . TRP B  1 68  ? 70.588  2.947   15.006  1.00 52.37 ? 1100 TRP B CH2   1 
ATOM   5015  N N     . ASN B  1 69  ? 73.156  -3.177  10.616  1.00 42.74 ? 1101 ASN B N     1 
ATOM   5016  C CA    . ASN B  1 69  ? 72.837  -4.073  9.513   1.00 43.91 ? 1101 ASN B CA    1 
ATOM   5017  C C     . ASN B  1 69  ? 71.712  -5.008  9.939   1.00 41.60 ? 1101 ASN B C     1 
ATOM   5018  O O     . ASN B  1 69  ? 70.842  -5.364  9.153   1.00 41.27 ? 1101 ASN B O     1 
ATOM   5019  C CB    . ASN B  1 69  ? 74.064  -4.893  9.115   1.00 45.11 ? 1101 ASN B CB    1 
ATOM   5020  C CG    . ASN B  1 69  ? 73.999  -5.368  7.683   1.00 50.44 ? 1101 ASN B CG    1 
ATOM   5021  O OD1   . ASN B  1 69  ? 74.061  -4.565  6.751   1.00 50.52 ? 1101 ASN B OD1   1 
ATOM   5022  N ND2   . ASN B  1 69  ? 73.869  -6.678  7.495   1.00 49.79 ? 1101 ASN B ND2   1 
ATOM   5023  N N     . ILE B  1 70  ? 71.742  -5.404  11.201  1.00 41.07 ? 1102 ILE B N     1 
ATOM   5024  C CA    . ILE B  1 70  ? 70.726  -6.285  11.740  1.00 39.87 ? 1102 ILE B CA    1 
ATOM   5025  C C     . ILE B  1 70  ? 69.361  -5.606  11.644  1.00 38.47 ? 1102 ILE B C     1 
ATOM   5026  O O     . ILE B  1 70  ? 68.432  -6.125  11.018  1.00 37.28 ? 1102 ILE B O     1 
ATOM   5027  C CB    . ILE B  1 70  ? 71.031  -6.618  13.215  1.00 39.78 ? 1102 ILE B CB    1 
ATOM   5028  C CG1   . ILE B  1 70  ? 72.270  -7.515  13.292  1.00 40.08 ? 1102 ILE B CG1   1 
ATOM   5029  C CG2   . ILE B  1 70  ? 69.831  -7.284  13.865  1.00 39.10 ? 1102 ILE B CG2   1 
ATOM   5030  C CD1   . ILE B  1 70  ? 73.242  -7.122  14.398  1.00 40.93 ? 1102 ILE B CD1   1 
ATOM   5031  N N     . VAL B  1 71  ? 69.249  -4.440  12.269  1.00 38.35 ? 1103 VAL B N     1 
ATOM   5032  C CA    . VAL B  1 71  ? 68.004  -3.689  12.259  1.00 37.90 ? 1103 VAL B CA    1 
ATOM   5033  C C     . VAL B  1 71  ? 67.584  -3.308  10.841  1.00 39.37 ? 1103 VAL B C     1 
ATOM   5034  O O     . VAL B  1 71  ? 66.407  -3.375  10.497  1.00 42.98 ? 1103 VAL B O     1 
ATOM   5035  C CB    . VAL B  1 71  ? 68.119  -2.401  13.116  1.00 32.95 ? 1103 VAL B CB    1 
ATOM   5036  C CG1   . VAL B  1 71  ? 67.694  -1.185  12.307  1.00 34.50 ? 1103 VAL B CG1   1 
ATOM   5037  C CG2   . VAL B  1 71  ? 67.247  -2.522  14.352  1.00 33.54 ? 1103 VAL B CG2   1 
ATOM   5038  N N     . ASN B  1 72  ? 68.549  -2.914  10.021  1.00 40.51 ? 1104 ASN B N     1 
ATOM   5039  C CA    . ASN B  1 72  ? 68.266  -2.513  8.648   1.00 42.52 ? 1104 ASN B CA    1 
ATOM   5040  C C     . ASN B  1 72  ? 67.556  -3.606  7.854   1.00 44.86 ? 1104 ASN B C     1 
ATOM   5041  O O     . ASN B  1 72  ? 67.163  -3.387  6.704   1.00 45.06 ? 1104 ASN B O     1 
ATOM   5042  C CB    . ASN B  1 72  ? 69.565  -2.133  7.935   1.00 39.50 ? 1104 ASN B CB    1 
ATOM   5043  C CG    . ASN B  1 72  ? 69.854  -0.646  7.999   1.00 39.71 ? 1104 ASN B CG    1 
ATOM   5044  O OD1   . ASN B  1 72  ? 69.525  0.022   8.980   1.00 36.97 ? 1104 ASN B OD1   1 
ATOM   5045  N ND2   . ASN B  1 72  ? 70.476  -0.118  6.950   1.00 38.64 ? 1104 ASN B ND2   1 
ATOM   5046  N N     . ASN B  1 73  ? 67.419  -4.784  8.458   1.00 46.38 ? 1105 ASN B N     1 
ATOM   5047  C CA    . ASN B  1 73  ? 66.751  -5.907  7.811   1.00 48.76 ? 1105 ASN B CA    1 
ATOM   5048  C C     . ASN B  1 73  ? 65.715  -6.532  8.740   1.00 48.81 ? 1105 ASN B C     1 
ATOM   5049  O O     . ASN B  1 73  ? 65.593  -7.754  8.815   1.00 51.11 ? 1105 ASN B O     1 
ATOM   5050  C CB    . ASN B  1 73  ? 67.771  -6.960  7.369   1.00 50.00 ? 1105 ASN B CB    1 
ATOM   5051  C CG    . ASN B  1 73  ? 68.803  -6.396  6.406   1.00 54.92 ? 1105 ASN B CG    1 
ATOM   5052  O OD1   . ASN B  1 73  ? 68.497  -6.091  5.251   1.00 58.63 ? 1105 ASN B OD1   1 
ATOM   5053  N ND2   . ASN B  1 73  ? 70.030  -6.246  6.882   1.00 54.53 ? 1105 ASN B ND2   1 
ATOM   5054  N N     . ILE B  1 74  B 64.982  -5.667  9.442   1.00 47.55 ? 1105 ILE B N     1 
ATOM   5055  C CA    . ILE B  1 74  B 63.917  -6.050  10.369  1.00 42.33 ? 1105 ILE B CA    1 
ATOM   5056  C C     . ILE B  1 74  B 62.862  -4.946  10.367  1.00 42.62 ? 1105 ILE B C     1 
ATOM   5057  O O     . ILE B  1 74  B 62.821  -4.096  11.257  1.00 40.99 ? 1105 ILE B O     1 
ATOM   5058  C CB    . ILE B  1 74  B 64.439  -6.217  11.792  1.00 40.33 ? 1105 ILE B CB    1 
ATOM   5059  C CG1   . ILE B  1 74  B 65.327  -7.452  11.859  1.00 44.10 ? 1105 ILE B CG1   1 
ATOM   5060  C CG2   . ILE B  1 74  B 63.270  -6.380  12.759  1.00 42.13 ? 1105 ILE B CG2   1 
ATOM   5061  C CD1   . ILE B  1 74  B 64.577  -8.775  11.609  1.00 43.51 ? 1105 ILE B CD1   1 
ATOM   5062  N N     . PRO B  1 75  ? 61.999  -4.945  9.347   1.00 46.81 ? 1106 PRO B N     1 
ATOM   5063  C CA    . PRO B  1 75  ? 60.922  -3.972  9.167   1.00 43.34 ? 1106 PRO B CA    1 
ATOM   5064  C C     . PRO B  1 75  ? 60.461  -3.217  10.415  1.00 43.79 ? 1106 PRO B C     1 
ATOM   5065  O O     . PRO B  1 75  ? 60.745  -2.026  10.555  1.00 42.92 ? 1106 PRO B O     1 
ATOM   5066  C CB    . PRO B  1 75  ? 59.816  -4.808  8.533   1.00 45.11 ? 1106 PRO B CB    1 
ATOM   5067  C CG    . PRO B  1 75  ? 60.594  -5.825  7.676   1.00 44.11 ? 1106 PRO B CG    1 
ATOM   5068  C CD    . PRO B  1 75  ? 62.003  -5.939  8.259   1.00 42.76 ? 1106 PRO B CD    1 
ATOM   5069  N N     . PHE B  1 76  ? 59.756  -3.889  11.320  1.00 45.29 ? 1107 PHE B N     1 
ATOM   5070  C CA    . PHE B  1 76  ? 59.283  -3.191  12.512  1.00 47.11 ? 1107 PHE B CA    1 
ATOM   5071  C C     . PHE B  1 76  ? 60.403  -2.421  13.182  1.00 44.76 ? 1107 PHE B C     1 
ATOM   5072  O O     . PHE B  1 76  ? 60.240  -1.248  13.530  1.00 44.33 ? 1107 PHE B O     1 
ATOM   5073  C CB    . PHE B  1 76  ? 58.629  -4.141  13.525  1.00 48.42 ? 1107 PHE B CB    1 
ATOM   5074  C CG    . PHE B  1 76  ? 59.315  -5.461  13.671  1.00 54.33 ? 1107 PHE B CG    1 
ATOM   5075  C CD1   . PHE B  1 76  ? 59.895  -5.816  14.890  1.00 56.99 ? 1107 PHE B CD1   1 
ATOM   5076  C CD2   . PHE B  1 76  ? 59.322  -6.381  12.626  1.00 55.59 ? 1107 PHE B CD2   1 
ATOM   5077  C CE1   . PHE B  1 76  ? 60.465  -7.070  15.074  1.00 54.22 ? 1107 PHE B CE1   1 
ATOM   5078  C CE2   . PHE B  1 76  ? 59.889  -7.639  12.792  1.00 57.74 ? 1107 PHE B CE2   1 
ATOM   5079  C CZ    . PHE B  1 76  ? 60.463  -7.988  14.023  1.00 56.66 ? 1107 PHE B CZ    1 
ATOM   5080  N N     . LEU B  1 77  ? 61.546  -3.077  13.353  1.00 42.22 ? 1108 LEU B N     1 
ATOM   5081  C CA    . LEU B  1 77  ? 62.696  -2.428  13.969  1.00 39.51 ? 1108 LEU B CA    1 
ATOM   5082  C C     . LEU B  1 77  ? 63.058  -1.150  13.210  1.00 37.06 ? 1108 LEU B C     1 
ATOM   5083  O O     . LEU B  1 77  ? 62.989  -0.047  13.766  1.00 32.95 ? 1108 LEU B O     1 
ATOM   5084  C CB    . LEU B  1 77  ? 63.888  -3.374  13.974  1.00 40.61 ? 1108 LEU B CB    1 
ATOM   5085  C CG    . LEU B  1 77  ? 63.973  -4.264  15.208  1.00 42.70 ? 1108 LEU B CG    1 
ATOM   5086  C CD1   . LEU B  1 77  ? 65.137  -5.229  15.064  1.00 42.41 ? 1108 LEU B CD1   1 
ATOM   5087  C CD2   . LEU B  1 77  ? 64.149  -3.393  16.439  1.00 43.82 ? 1108 LEU B CD2   1 
ATOM   5088  N N     . ARG B  1 78  ? 63.433  -1.306  11.938  1.00 32.18 ? 1109 ARG B N     1 
ATOM   5089  C CA    . ARG B  1 78  ? 63.797  -0.171  11.099  1.00 31.01 ? 1109 ARG B CA    1 
ATOM   5090  C C     . ARG B  1 78  ? 62.827  0.995   11.317  1.00 30.92 ? 1109 ARG B C     1 
ATOM   5091  O O     . ARG B  1 78  ? 63.214  2.088   11.774  1.00 29.32 ? 1109 ARG B O     1 
ATOM   5092  C CB    . ARG B  1 78  ? 63.789  -0.580  9.621   1.00 29.08 ? 1109 ARG B CB    1 
ATOM   5093  C CG    . ARG B  1 78  ? 63.971  0.598   8.660   1.00 28.94 ? 1109 ARG B CG    1 
ATOM   5094  C CD    . ARG B  1 78  ? 64.604  0.185   7.335   1.00 26.44 ? 1109 ARG B CD    1 
ATOM   5095  N NE    . ARG B  1 78  ? 64.832  1.343   6.469   1.00 26.65 ? 1109 ARG B NE    1 
ATOM   5096  C CZ    . ARG B  1 78  ? 64.721  1.331   5.142   1.00 26.76 ? 1109 ARG B CZ    1 
ATOM   5097  N NH1   . ARG B  1 78  ? 64.383  0.214   4.506   1.00 26.25 ? 1109 ARG B NH1   1 
ATOM   5098  N NH2   . ARG B  1 78  ? 64.944  2.441   4.450   1.00 25.34 ? 1109 ARG B NH2   1 
ATOM   5099  N N     . SER B  1 79  ? 61.561  0.746   10.983  1.00 30.74 ? 1110 SER B N     1 
ATOM   5100  C CA    . SER B  1 79  ? 60.512  1.744   11.141  1.00 26.89 ? 1110 SER B CA    1 
ATOM   5101  C C     . SER B  1 79  ? 60.538  2.278   12.570  1.00 24.49 ? 1110 SER B C     1 
ATOM   5102  O O     . SER B  1 79  ? 60.688  3.484   12.797  1.00 20.92 ? 1110 SER B O     1 
ATOM   5103  C CB    . SER B  1 79  ? 59.158  1.115   10.838  1.00 25.39 ? 1110 SER B CB    1 
ATOM   5104  O OG    . SER B  1 79  ? 59.253  0.262   9.711   1.00 26.20 ? 1110 SER B OG    1 
ATOM   5105  N N     . LEU B  1 80  ? 60.406  1.368   13.528  1.00 23.25 ? 1111 LEU B N     1 
ATOM   5106  C CA    . LEU B  1 80  ? 60.428  1.744   14.931  1.00 24.17 ? 1111 LEU B CA    1 
ATOM   5107  C C     . LEU B  1 80  ? 61.503  2.818   15.167  1.00 22.61 ? 1111 LEU B C     1 
ATOM   5108  O O     . LEU B  1 80  ? 61.302  3.786   15.916  1.00 19.27 ? 1111 LEU B O     1 
ATOM   5109  C CB    . LEU B  1 80  ? 60.689  0.498   15.776  1.00 22.37 ? 1111 LEU B CB    1 
ATOM   5110  C CG    . LEU B  1 80  ? 61.623  0.570   16.975  1.00 23.22 ? 1111 LEU B CG    1 
ATOM   5111  C CD1   . LEU B  1 80  ? 60.819  0.842   18.236  1.00 22.51 ? 1111 LEU B CD1   1 
ATOM   5112  C CD2   . LEU B  1 80  ? 62.371  -0.751  17.096  1.00 20.94 ? 1111 LEU B CD2   1 
ATOM   5113  N N     . ILE B  1 81  ? 62.633  2.652   14.492  1.00 21.70 ? 1112 ILE B N     1 
ATOM   5114  C CA    . ILE B  1 81  ? 63.732  3.591   14.615  1.00 21.88 ? 1112 ILE B CA    1 
ATOM   5115  C C     . ILE B  1 81  ? 63.439  4.864   13.831  1.00 21.59 ? 1112 ILE B C     1 
ATOM   5116  O O     . ILE B  1 81  ? 63.307  5.952   14.414  1.00 15.19 ? 1112 ILE B O     1 
ATOM   5117  C CB    . ILE B  1 81  ? 65.036  2.983   14.063  1.00 24.10 ? 1112 ILE B CB    1 
ATOM   5118  C CG1   . ILE B  1 81  ? 65.333  1.650   14.746  1.00 22.78 ? 1112 ILE B CG1   1 
ATOM   5119  C CG2   . ILE B  1 81  ? 66.190  3.952   14.267  1.00 20.89 ? 1112 ILE B CG2   1 
ATOM   5120  C CD1   . ILE B  1 81  ? 65.648  1.773   16.212  1.00 26.13 ? 1112 ILE B CD1   1 
ATOM   5121  N N     . MET B  1 82  ? 63.361  4.701   12.506  1.00 20.08 ? 1113 MET B N     1 
ATOM   5122  C CA    . MET B  1 82  ? 63.093  5.796   11.569  1.00 20.00 ? 1113 MET B CA    1 
ATOM   5123  C C     . MET B  1 82  ? 62.048  6.723   12.158  1.00 20.83 ? 1113 MET B C     1 
ATOM   5124  O O     . MET B  1 82  ? 62.166  7.950   12.098  1.00 12.62 ? 1113 MET B O     1 
ATOM   5125  C CB    . MET B  1 82  ? 62.592  5.236   10.244  1.00 16.59 ? 1113 MET B CB    1 
ATOM   5126  C CG    . MET B  1 82  ? 62.207  6.304   9.268   1.00 16.75 ? 1113 MET B CG    1 
ATOM   5127  S SD    . MET B  1 82  ? 63.641  7.219   8.729   1.00 24.80 ? 1113 MET B SD    1 
ATOM   5128  C CE    . MET B  1 82  ? 63.223  8.916   9.177   1.00 19.31 ? 1113 MET B CE    1 
ATOM   5129  N N     . LYS B  1 83  ? 61.024  6.094   12.728  1.00 27.63 ? 1114 LYS B N     1 
ATOM   5130  C CA    . LYS B  1 83  ? 59.922  6.785   13.382  1.00 31.20 ? 1114 LYS B CA    1 
ATOM   5131  C C     . LYS B  1 83  ? 60.511  7.597   14.519  1.00 28.92 ? 1114 LYS B C     1 
ATOM   5132  O O     . LYS B  1 83  ? 60.371  8.822   14.564  1.00 22.37 ? 1114 LYS B O     1 
ATOM   5133  C CB    . LYS B  1 83  ? 58.928  5.765   13.942  1.00 35.16 ? 1114 LYS B CB    1 
ATOM   5134  C CG    . LYS B  1 83  ? 58.259  6.186   15.248  1.00 42.44 ? 1114 LYS B CG    1 
ATOM   5135  C CD    . LYS B  1 83  ? 56.887  5.526   15.408  1.00 52.57 ? 1114 LYS B CD    1 
ATOM   5136  C CE    . LYS B  1 83  ? 56.516  5.320   16.883  1.00 58.56 ? 1114 LYS B CE    1 
ATOM   5137  N NZ    . LYS B  1 83  ? 55.468  4.264   17.073  1.00 63.36 ? 1114 LYS B NZ    1 
ATOM   5138  N N     . TYR B  1 84  ? 61.175  6.889   15.430  1.00 29.77 ? 1115 TYR B N     1 
ATOM   5139  C CA    . TYR B  1 84  ? 61.807  7.534   16.559  1.00 33.16 ? 1115 TYR B CA    1 
ATOM   5140  C C     . TYR B  1 84  ? 62.540  8.778   16.060  1.00 29.52 ? 1115 TYR B C     1 
ATOM   5141  O O     . TYR B  1 84  ? 62.417  9.856   16.647  1.00 27.92 ? 1115 TYR B O     1 
ATOM   5142  C CB    . TYR B  1 84  ? 62.837  6.623   17.236  1.00 39.43 ? 1115 TYR B CB    1 
ATOM   5143  C CG    . TYR B  1 84  ? 63.949  7.458   17.842  1.00 48.57 ? 1115 TYR B CG    1 
ATOM   5144  C CD1   . TYR B  1 84  ? 63.758  8.131   19.055  1.00 50.78 ? 1115 TYR B CD1   1 
ATOM   5145  C CD2   . TYR B  1 84  ? 65.139  7.690   17.141  1.00 52.66 ? 1115 TYR B CD2   1 
ATOM   5146  C CE1   . TYR B  1 84  ? 64.720  9.024   19.549  1.00 55.84 ? 1115 TYR B CE1   1 
ATOM   5147  C CE2   . TYR B  1 84  ? 66.108  8.581   17.625  1.00 55.41 ? 1115 TYR B CE2   1 
ATOM   5148  C CZ    . TYR B  1 84  ? 65.890  9.246   18.825  1.00 57.41 ? 1115 TYR B CZ    1 
ATOM   5149  O OH    . TYR B  1 84  ? 66.832  10.141  19.287  1.00 62.48 ? 1115 TYR B OH    1 
ATOM   5150  N N     . VAL B  1 85  ? 63.322  8.609   14.993  1.00 24.04 ? 1116 VAL B N     1 
ATOM   5151  C CA    . VAL B  1 85  ? 64.074  9.723   14.434  1.00 19.14 ? 1116 VAL B CA    1 
ATOM   5152  C C     . VAL B  1 85  ? 63.100  10.804  14.000  1.00 21.17 ? 1116 VAL B C     1 
ATOM   5153  O O     . VAL B  1 85  ? 63.280  11.988  14.301  1.00 22.02 ? 1116 VAL B O     1 
ATOM   5154  C CB    . VAL B  1 85  ? 64.956  9.269   13.229  1.00 19.19 ? 1116 VAL B CB    1 
ATOM   5155  C CG1   . VAL B  1 85  ? 64.934  7.752   13.129  1.00 16.55 ? 1116 VAL B CG1   1 
ATOM   5156  C CG2   . VAL B  1 85  ? 64.499  9.922   11.925  1.00 12.56 ? 1116 VAL B CG2   1 
ATOM   5157  N N     . LEU B  1 86  ? 62.054  10.383  13.305  1.00 17.35 ? 1117 LEU B N     1 
ATOM   5158  C CA    . LEU B  1 86  ? 61.058  11.310  12.840  1.00 15.76 ? 1117 LEU B CA    1 
ATOM   5159  C C     . LEU B  1 86  ? 60.567  12.124  14.025  1.00 16.97 ? 1117 LEU B C     1 
ATOM   5160  O O     . LEU B  1 86  ? 60.718  13.348  14.086  1.00 15.73 ? 1117 LEU B O     1 
ATOM   5161  C CB    . LEU B  1 86  ? 59.908  10.532  12.216  1.00 9.49  ? 1117 LEU B CB    1 
ATOM   5162  C CG    . LEU B  1 86  ? 59.778  10.639  10.696  1.00 7.24  ? 1117 LEU B CG    1 
ATOM   5163  C CD1   . LEU B  1 86  ? 60.637  11.781  10.156  1.00 7.75  ? 1117 LEU B CD1   1 
ATOM   5164  C CD2   . LEU B  1 86  ? 60.174  9.310   10.083  1.00 8.27  ? 1117 LEU B CD2   1 
ATOM   5165  N N     . THR B  1 87  ? 60.003  11.415  14.986  1.00 21.00 ? 1118 THR B N     1 
ATOM   5166  C CA    . THR B  1 87  ? 59.455  12.031  16.181  1.00 25.01 ? 1118 THR B CA    1 
ATOM   5167  C C     . THR B  1 87  ? 60.467  12.797  17.017  1.00 25.61 ? 1118 THR B C     1 
ATOM   5168  O O     . THR B  1 87  ? 60.131  13.823  17.611  1.00 26.23 ? 1118 THR B O     1 
ATOM   5169  C CB    . THR B  1 87  ? 58.798  10.972  17.070  1.00 25.31 ? 1118 THR B CB    1 
ATOM   5170  O OG1   . THR B  1 87  ? 59.732  9.900   17.291  1.00 27.99 ? 1118 THR B OG1   1 
ATOM   5171  C CG2   . THR B  1 87  ? 57.523  10.436  16.399  1.00 22.12 ? 1118 THR B CG2   1 
ATOM   5172  N N     . SER B  1 88  ? 61.696  12.298  17.073  1.00 30.74 ? 1119 SER B N     1 
ATOM   5173  C CA    . SER B  1 88  ? 62.722  12.956  17.860  1.00 34.72 ? 1119 SER B CA    1 
ATOM   5174  C C     . SER B  1 88  ? 62.731  14.420  17.494  1.00 39.08 ? 1119 SER B C     1 
ATOM   5175  O O     . SER B  1 88  ? 62.660  15.290  18.364  1.00 40.11 ? 1119 SER B O     1 
ATOM   5176  C CB    . SER B  1 88  ? 64.088  12.359  17.575  1.00 32.54 ? 1119 SER B CB    1 
ATOM   5177  O OG    . SER B  1 88  ? 64.022  11.491  16.468  1.00 30.44 ? 1119 SER B OG    1 
ATOM   5178  N N     . ARG B  1 89  ? 62.804  14.690  16.197  1.00 41.79 ? 1120 ARG B N     1 
ATOM   5179  C CA    . ARG B  1 89  ? 62.809  16.066  15.723  1.00 46.82 ? 1120 ARG B CA    1 
ATOM   5180  C C     . ARG B  1 89  ? 61.445  16.680  16.016  1.00 49.54 ? 1120 ARG B C     1 
ATOM   5181  O O     . ARG B  1 89  ? 61.229  17.279  17.076  1.00 48.98 ? 1120 ARG B O     1 
ATOM   5182  C CB    . ARG B  1 89  ? 63.103  16.093  14.225  1.00 47.22 ? 1120 ARG B CB    1 
ATOM   5183  C CG    . ARG B  1 89  ? 64.309  15.243  13.838  1.00 55.05 ? 1120 ARG B CG    1 
ATOM   5184  C CD    . ARG B  1 89  ? 65.539  16.105  13.509  1.00 56.40 ? 1120 ARG B CD    1 
ATOM   5185  N NE    . ARG B  1 89  ? 66.699  15.832  14.370  1.00 53.69 ? 1120 ARG B NE    1 
ATOM   5186  C CZ    . ARG B  1 89  ? 67.784  15.161  13.988  1.00 51.58 ? 1120 ARG B CZ    1 
ATOM   5187  N NH1   . ARG B  1 89  ? 67.877  14.677  12.756  1.00 48.74 ? 1120 ARG B NH1   1 
ATOM   5188  N NH2   . ARG B  1 89  ? 68.782  14.979  14.837  1.00 53.38 ? 1120 ARG B NH2   1 
ATOM   5189  N N     . SER B  1 90  ? 60.530  16.519  15.067  1.00 48.98 ? 1121 SER B N     1 
ATOM   5190  C CA    . SER B  1 90  ? 59.168  17.019  15.190  1.00 48.28 ? 1121 SER B CA    1 
ATOM   5191  C C     . SER B  1 90  ? 58.938  18.154  16.192  1.00 48.98 ? 1121 SER B C     1 
ATOM   5192  O O     . SER B  1 90  ? 58.809  19.319  15.800  1.00 50.41 ? 1121 SER B O     1 
ATOM   5193  C CB    . SER B  1 90  ? 58.251  15.852  15.532  1.00 46.21 ? 1121 SER B CB    1 
ATOM   5194  O OG    . SER B  1 90  ? 58.985  14.643  15.505  1.00 46.96 ? 1121 SER B OG    1 
ATOM   5195  N N     . TYR B  1 91  ? 58.885  17.811  17.477  1.00 48.86 ? 1122 TYR B N     1 
ATOM   5196  C CA    . TYR B  1 91  ? 58.630  18.783  18.534  1.00 50.52 ? 1122 TYR B CA    1 
ATOM   5197  C C     . TYR B  1 91  ? 59.531  20.016  18.533  1.00 48.01 ? 1122 TYR B C     1 
ATOM   5198  O O     . TYR B  1 91  ? 59.531  20.788  19.489  1.00 48.81 ? 1122 TYR B O     1 
ATOM   5199  C CB    . TYR B  1 91  ? 58.723  18.095  19.896  1.00 57.95 ? 1122 TYR B CB    1 
ATOM   5200  C CG    . TYR B  1 91  ? 60.083  18.223  20.548  1.00 65.76 ? 1122 TYR B CG    1 
ATOM   5201  C CD1   . TYR B  1 91  ? 60.286  19.095  21.621  1.00 65.30 ? 1122 TYR B CD1   1 
ATOM   5202  C CD2   . TYR B  1 91  ? 61.172  17.494  20.073  1.00 65.89 ? 1122 TYR B CD2   1 
ATOM   5203  C CE1   . TYR B  1 91  ? 61.536  19.242  22.199  1.00 66.52 ? 1122 TYR B CE1   1 
ATOM   5204  C CE2   . TYR B  1 91  ? 62.429  17.632  20.644  1.00 67.85 ? 1122 TYR B CE2   1 
ATOM   5205  C CZ    . TYR B  1 91  ? 62.607  18.508  21.705  1.00 71.16 ? 1122 TYR B CZ    1 
ATOM   5206  O OH    . TYR B  1 91  ? 63.865  18.656  22.255  1.00 72.12 ? 1122 TYR B OH    1 
ATOM   5207  N N     . LEU B  1 92  ? 60.290  20.216  17.467  1.00 45.74 ? 1123 LEU B N     1 
ATOM   5208  C CA    . LEU B  1 92  ? 61.189  21.356  17.402  1.00 45.24 ? 1123 LEU B CA    1 
ATOM   5209  C C     . LEU B  1 92  ? 60.685  22.605  16.688  1.00 43.69 ? 1123 LEU B C     1 
ATOM   5210  O O     . LEU B  1 92  ? 60.747  23.702  17.249  1.00 40.54 ? 1123 LEU B O     1 
ATOM   5211  C CB    . LEU B  1 92  ? 62.502  20.920  16.771  1.00 46.08 ? 1123 LEU B CB    1 
ATOM   5212  C CG    . LEU B  1 92  ? 63.735  21.213  17.623  1.00 46.71 ? 1123 LEU B CG    1 
ATOM   5213  C CD1   . LEU B  1 92  ? 63.554  20.650  19.031  1.00 46.66 ? 1123 LEU B CD1   1 
ATOM   5214  C CD2   . LEU B  1 92  ? 64.944  20.608  16.947  1.00 45.88 ? 1123 LEU B CD2   1 
ATOM   5215  N N     . ILE B  1 93  ? 60.202  22.435  15.456  1.00 45.90 ? 1124 ILE B N     1 
ATOM   5216  C CA    . ILE B  1 93  ? 59.698  23.557  14.655  1.00 48.53 ? 1124 ILE B CA    1 
ATOM   5217  C C     . ILE B  1 93  ? 58.429  24.217  15.188  1.00 47.35 ? 1124 ILE B C     1 
ATOM   5218  O O     . ILE B  1 93  ? 57.667  23.617  15.947  1.00 48.38 ? 1124 ILE B O     1 
ATOM   5219  C CB    . ILE B  1 93  ? 59.413  23.140  13.204  1.00 47.49 ? 1124 ILE B CB    1 
ATOM   5220  C CG1   . ILE B  1 93  ? 60.381  22.037  12.777  1.00 48.59 ? 1124 ILE B CG1   1 
ATOM   5221  C CG2   . ILE B  1 93  ? 59.525  24.359  12.295  1.00 48.86 ? 1124 ILE B CG2   1 
ATOM   5222  C CD1   . ILE B  1 93  ? 61.691  22.547  12.221  1.00 44.28 ? 1124 ILE B CD1   1 
ATOM   5223  N N     . ASP B  1 94  ? 58.211  25.459  14.767  1.00 47.21 ? 1125 ASP B N     1 
ATOM   5224  C CA    . ASP B  1 94  ? 57.045  26.225  15.183  1.00 46.34 ? 1125 ASP B CA    1 
ATOM   5225  C C     . ASP B  1 94  ? 55.909  26.160  14.155  1.00 44.84 ? 1125 ASP B C     1 
ATOM   5226  O O     . ASP B  1 94  ? 55.624  27.148  13.474  1.00 46.57 ? 1125 ASP B O     1 
ATOM   5227  C CB    . ASP B  1 94  ? 57.440  27.692  15.410  1.00 49.43 ? 1125 ASP B CB    1 
ATOM   5228  C CG    . ASP B  1 94  ? 57.667  28.018  16.872  1.00 54.61 ? 1125 ASP B CG    1 
ATOM   5229  O OD1   . ASP B  1 94  ? 57.395  27.150  17.726  1.00 57.67 ? 1125 ASP B OD1   1 
ATOM   5230  O OD2   . ASP B  1 94  ? 58.118  29.144  17.169  1.00 53.89 ? 1125 ASP B OD2   1 
ATOM   5231  N N     . SER B  1 95  ? 55.266  25.006  14.025  1.00 39.72 ? 1126 SER B N     1 
ATOM   5232  C CA    . SER B  1 95  ? 54.153  24.892  13.085  1.00 35.05 ? 1126 SER B CA    1 
ATOM   5233  C C     . SER B  1 95  ? 52.853  24.702  13.849  1.00 32.07 ? 1126 SER B C     1 
ATOM   5234  O O     . SER B  1 95  ? 52.732  23.807  14.683  1.00 33.48 ? 1126 SER B O     1 
ATOM   5235  C CB    . SER B  1 95  ? 54.341  23.724  12.120  1.00 38.03 ? 1126 SER B CB    1 
ATOM   5236  O OG    . SER B  1 95  ? 53.516  23.902  10.977  1.00 35.49 ? 1126 SER B OG    1 
ATOM   5237  N N     . PRO B  1 96  ? 51.849  25.530  13.555  1.00 28.06 ? 1127 PRO B N     1 
ATOM   5238  C CA    . PRO B  1 96  ? 51.877  26.601  12.556  1.00 20.86 ? 1127 PRO B CA    1 
ATOM   5239  C C     . PRO B  1 96  ? 52.885  27.734  12.810  1.00 18.06 ? 1127 PRO B C     1 
ATOM   5240  O O     . PRO B  1 96  ? 53.154  28.107  13.947  1.00 15.74 ? 1127 PRO B O     1 
ATOM   5241  C CB    . PRO B  1 96  ? 50.426  27.094  12.534  1.00 23.15 ? 1127 PRO B CB    1 
ATOM   5242  C CG    . PRO B  1 96  ? 49.932  26.798  13.900  1.00 24.83 ? 1127 PRO B CG    1 
ATOM   5243  C CD    . PRO B  1 96  ? 50.568  25.487  14.273  1.00 23.89 ? 1127 PRO B CD    1 
ATOM   5244  N N     . PRO B  1 97  ? 53.444  28.297  11.729  1.00 20.49 ? 1128 PRO B N     1 
ATOM   5245  C CA    . PRO B  1 97  ? 54.428  29.389  11.706  1.00 15.78 ? 1128 PRO B CA    1 
ATOM   5246  C C     . PRO B  1 97  ? 54.182  30.519  12.703  1.00 14.95 ? 1128 PRO B C     1 
ATOM   5247  O O     . PRO B  1 97  ? 53.048  30.777  13.116  1.00 19.09 ? 1128 PRO B O     1 
ATOM   5248  C CB    . PRO B  1 97  ? 54.373  29.908  10.265  1.00 11.96 ? 1128 PRO B CB    1 
ATOM   5249  C CG    . PRO B  1 97  ? 53.304  29.102  9.577   1.00 15.83 ? 1128 PRO B CG    1 
ATOM   5250  C CD    . PRO B  1 97  ? 53.113  27.857  10.368  1.00 18.91 ? 1128 PRO B CD    1 
ATOM   5251  N N     . THR B  1 98  ? 55.258  31.199  13.074  1.00 14.96 ? 1129 THR B N     1 
ATOM   5252  C CA    . THR B  1 98  ? 55.158  32.297  14.014  1.00 15.39 ? 1129 THR B CA    1 
ATOM   5253  C C     . THR B  1 98  ? 55.768  33.585  13.454  1.00 16.18 ? 1129 THR B C     1 
ATOM   5254  O O     . THR B  1 98  ? 55.176  34.225  12.587  1.00 18.43 ? 1129 THR B O     1 
ATOM   5255  C CB    . THR B  1 98  ? 55.832  31.948  15.361  1.00 12.40 ? 1129 THR B CB    1 
ATOM   5256  O OG1   . THR B  1 98  ? 57.177  31.505  15.129  1.00 19.00 ? 1129 THR B OG1   1 
ATOM   5257  C CG2   . THR B  1 98  ? 55.072  30.849  16.056  1.00 15.54 ? 1129 THR B CG2   1 
ATOM   5258  N N     . TYR B  1 99  ? 56.953  33.954  13.929  1.00 16.60 ? 1130 TYR B N     1 
ATOM   5259  C CA    . TYR B  1 99  ? 57.602  35.191  13.498  1.00 17.55 ? 1130 TYR B CA    1 
ATOM   5260  C C     . TYR B  1 99  ? 58.187  35.192  12.099  1.00 17.93 ? 1130 TYR B C     1 
ATOM   5261  O O     . TYR B  1 99  ? 58.241  34.159  11.416  1.00 18.94 ? 1130 TYR B O     1 
ATOM   5262  C CB    . TYR B  1 99  ? 58.711  35.583  14.474  1.00 11.61 ? 1130 TYR B CB    1 
ATOM   5263  C CG    . TYR B  1 99  ? 58.438  35.166  15.888  1.00 10.30 ? 1130 TYR B CG    1 
ATOM   5264  C CD1   . TYR B  1 99  ? 58.726  33.867  16.320  1.00 2.00  ? 1130 TYR B CD1   1 
ATOM   5265  C CD2   . TYR B  1 99  ? 57.895  36.073  16.807  1.00 7.53  ? 1130 TYR B CD2   1 
ATOM   5266  C CE1   . TYR B  1 99  ? 58.485  33.481  17.633  1.00 8.47  ? 1130 TYR B CE1   1 
ATOM   5267  C CE2   . TYR B  1 99  ? 57.646  35.704  18.129  1.00 2.00  ? 1130 TYR B CE2   1 
ATOM   5268  C CZ    . TYR B  1 99  ? 57.948  34.407  18.541  1.00 11.12 ? 1130 TYR B CZ    1 
ATOM   5269  O OH    . TYR B  1 99  ? 57.758  34.054  19.873  1.00 14.39 ? 1130 TYR B OH    1 
ATOM   5270  N N     . ASN B  1 100 ? 58.618  36.383  11.689  1.00 15.03 ? 1131 ASN B N     1 
ATOM   5271  C CA    . ASN B  1 100 ? 59.231  36.590  10.389  1.00 16.90 ? 1131 ASN B CA    1 
ATOM   5272  C C     . ASN B  1 100 ? 60.084  37.838  10.497  1.00 17.57 ? 1131 ASN B C     1 
ATOM   5273  O O     . ASN B  1 100 ? 60.204  38.427  11.577  1.00 18.49 ? 1131 ASN B O     1 
ATOM   5274  C CB    . ASN B  1 100 ? 58.169  36.782  9.294   1.00 17.38 ? 1131 ASN B CB    1 
ATOM   5275  C CG    . ASN B  1 100 ? 57.458  38.132  9.385   1.00 22.20 ? 1131 ASN B CG    1 
ATOM   5276  O OD1   . ASN B  1 100 ? 57.955  39.081  9.998   1.00 23.87 ? 1131 ASN B OD1   1 
ATOM   5277  N ND2   . ASN B  1 100 ? 56.284  38.219  8.769   1.00 21.71 ? 1131 ASN B ND2   1 
ATOM   5278  N N     . VAL B  1 101 ? 60.647  38.249  9.368   1.00 12.24 ? 1132 VAL B N     1 
ATOM   5279  C CA    . VAL B  1 101 ? 61.495  39.428  9.307   1.00 13.71 ? 1132 VAL B CA    1 
ATOM   5280  C C     . VAL B  1 101 ? 60.963  40.583  10.143  1.00 14.60 ? 1132 VAL B C     1 
ATOM   5281  O O     . VAL B  1 101 ? 61.539  40.926  11.169  1.00 16.15 ? 1132 VAL B O     1 
ATOM   5282  C CB    . VAL B  1 101 ? 61.664  39.925  7.849   1.00 13.00 ? 1132 VAL B CB    1 
ATOM   5283  C CG1   . VAL B  1 101 ? 61.898  41.419  7.827   1.00 14.17 ? 1132 VAL B CG1   1 
ATOM   5284  C CG2   . VAL B  1 101 ? 62.827  39.222  7.190   1.00 8.72  ? 1132 VAL B CG2   1 
ATOM   5285  N N     . HIS B  1 102 ? 59.860  41.171  9.703   1.00 15.15 ? 1133 HIS B N     1 
ATOM   5286  C CA    . HIS B  1 102 ? 59.286  42.308  10.388  1.00 18.34 ? 1133 HIS B CA    1 
ATOM   5287  C C     . HIS B  1 102 ? 58.577  42.056  11.708  1.00 19.07 ? 1133 HIS B C     1 
ATOM   5288  O O     . HIS B  1 102 ? 58.351  43.009  12.464  1.00 21.00 ? 1133 HIS B O     1 
ATOM   5289  C CB    . HIS B  1 102 ? 58.323  43.025  9.450   1.00 24.15 ? 1133 HIS B CB    1 
ATOM   5290  C CG    . HIS B  1 102 ? 58.979  43.578  8.228   1.00 30.80 ? 1133 HIS B CG    1 
ATOM   5291  N ND1   . HIS B  1 102 ? 58.689  43.127  6.957   1.00 31.14 ? 1133 HIS B ND1   1 
ATOM   5292  C CD2   . HIS B  1 102 ? 59.922  44.541  8.079   1.00 30.31 ? 1133 HIS B CD2   1 
ATOM   5293  C CE1   . HIS B  1 102 ? 59.423  43.787  6.078   1.00 31.79 ? 1133 HIS B CE1   1 
ATOM   5294  N NE2   . HIS B  1 102 ? 60.181  44.650  6.733   1.00 30.92 ? 1133 HIS B NE2   1 
ATOM   5295  N N     . TYR B  1 103 ? 58.237  40.804  12.014  1.00 17.74 ? 1134 TYR B N     1 
ATOM   5296  C CA    . TYR B  1 103 ? 57.511  40.547  13.254  1.00 16.28 ? 1134 TYR B CA    1 
ATOM   5297  C C     . TYR B  1 103 ? 58.213  39.681  14.280  1.00 15.77 ? 1134 TYR B C     1 
ATOM   5298  O O     . TYR B  1 103 ? 58.485  38.497  14.048  1.00 12.82 ? 1134 TYR B O     1 
ATOM   5299  C CB    . TYR B  1 103 ? 56.107  39.985  12.945  1.00 14.88 ? 1134 TYR B CB    1 
ATOM   5300  C CG    . TYR B  1 103 ? 55.207  40.978  12.214  1.00 12.72 ? 1134 TYR B CG    1 
ATOM   5301  C CD1   . TYR B  1 103 ? 55.114  40.967  10.820  1.00 11.08 ? 1134 TYR B CD1   1 
ATOM   5302  C CD2   . TYR B  1 103 ? 54.509  41.975  12.914  1.00 9.82  ? 1134 TYR B CD2   1 
ATOM   5303  C CE1   . TYR B  1 103 ? 54.355  41.931  10.138  1.00 16.73 ? 1134 TYR B CE1   1 
ATOM   5304  C CE2   . TYR B  1 103 ? 53.744  42.950  12.250  1.00 7.12  ? 1134 TYR B CE2   1 
ATOM   5305  C CZ    . TYR B  1 103 ? 53.669  42.932  10.855  1.00 15.83 ? 1134 TYR B CZ    1 
ATOM   5306  O OH    . TYR B  1 103 ? 52.944  43.905  10.158  1.00 10.76 ? 1134 TYR B OH    1 
ATOM   5307  N N     . GLY B  1 104 ? 58.492  40.314  15.419  1.00 13.83 ? 1135 GLY B N     1 
ATOM   5308  C CA    . GLY B  1 104 ? 59.149  39.660  16.537  1.00 12.38 ? 1135 GLY B CA    1 
ATOM   5309  C C     . GLY B  1 104 ? 58.138  39.085  17.509  1.00 12.29 ? 1135 GLY B C     1 
ATOM   5310  O O     . GLY B  1 104 ? 58.482  38.277  18.375  1.00 13.74 ? 1135 GLY B O     1 
ATOM   5311  N N     . TYR B  1 105 ? 56.891  39.523  17.389  1.00 9.21  ? 1136 TYR B N     1 
ATOM   5312  C CA    . TYR B  1 105 ? 55.828  38.997  18.231  1.00 8.46  ? 1136 TYR B CA    1 
ATOM   5313  C C     . TYR B  1 105 ? 54.896  38.238  17.285  1.00 11.96 ? 1136 TYR B C     1 
ATOM   5314  O O     . TYR B  1 105 ? 54.935  38.463  16.062  1.00 10.67 ? 1136 TYR B O     1 
ATOM   5315  C CB    . TYR B  1 105 ? 55.066  40.127  18.912  1.00 5.59  ? 1136 TYR B CB    1 
ATOM   5316  C CG    . TYR B  1 105 ? 54.714  41.275  18.004  1.00 5.11  ? 1136 TYR B CG    1 
ATOM   5317  C CD1   . TYR B  1 105 ? 54.163  41.057  16.745  1.00 4.72  ? 1136 TYR B CD1   1 
ATOM   5318  C CD2   . TYR B  1 105 ? 54.948  42.592  18.397  1.00 3.52  ? 1136 TYR B CD2   1 
ATOM   5319  C CE1   . TYR B  1 105 ? 53.857  42.124  15.889  1.00 5.10  ? 1136 TYR B CE1   1 
ATOM   5320  C CE2   . TYR B  1 105 ? 54.645  43.666  17.550  1.00 4.47  ? 1136 TYR B CE2   1 
ATOM   5321  C CZ    . TYR B  1 105 ? 54.102  43.426  16.294  1.00 2.00  ? 1136 TYR B CZ    1 
ATOM   5322  O OH    . TYR B  1 105 ? 53.841  44.480  15.446  1.00 2.00  ? 1136 TYR B OH    1 
ATOM   5323  N N     . LYS B  1 106 ? 54.086  37.321  17.818  1.00 12.12 ? 1137 LYS B N     1 
ATOM   5324  C CA    . LYS B  1 106 ? 53.149  36.589  16.961  1.00 10.51 ? 1137 LYS B CA    1 
ATOM   5325  C C     . LYS B  1 106 ? 52.146  37.612  16.467  1.00 10.68 ? 1137 LYS B C     1 
ATOM   5326  O O     . LYS B  1 106 ? 51.692  38.468  17.226  1.00 9.68  ? 1137 LYS B O     1 
ATOM   5327  C CB    . LYS B  1 106 ? 52.418  35.492  17.729  1.00 9.79  ? 1137 LYS B CB    1 
ATOM   5328  C CG    . LYS B  1 106 ? 53.231  34.228  17.904  1.00 9.68  ? 1137 LYS B CG    1 
ATOM   5329  C CD    . LYS B  1 106 ? 53.577  34.017  19.370  1.00 7.50  ? 1137 LYS B CD    1 
ATOM   5330  C CE    . LYS B  1 106 ? 53.628  32.533  19.708  1.00 7.30  ? 1137 LYS B CE    1 
ATOM   5331  N NZ    . LYS B  1 106 ? 53.001  32.254  21.021  1.00 11.03 ? 1137 LYS B NZ    1 
ATOM   5332  N N     . SER B  1 107 ? 51.820  37.540  15.186  1.00 8.68  ? 1138 SER B N     1 
ATOM   5333  C CA    . SER B  1 107 ? 50.882  38.478  14.610  1.00 8.08  ? 1138 SER B CA    1 
ATOM   5334  C C     . SER B  1 107 ? 50.146  37.814  13.446  1.00 9.17  ? 1138 SER B C     1 
ATOM   5335  O O     . SER B  1 107 ? 50.678  36.890  12.803  1.00 6.13  ? 1138 SER B O     1 
ATOM   5336  C CB    . SER B  1 107 ? 51.629  39.724  14.133  1.00 5.58  ? 1138 SER B CB    1 
ATOM   5337  O OG    . SER B  1 107 ? 51.675  39.785  12.711  1.00 10.34 ? 1138 SER B OG    1 
ATOM   5338  N N     . TRP B  1 108 ? 48.918  38.274  13.192  1.00 9.98  ? 1139 TRP B N     1 
ATOM   5339  C CA    . TRP B  1 108 ? 48.135  37.715  12.109  1.00 9.16  ? 1139 TRP B CA    1 
ATOM   5340  C C     . TRP B  1 108 ? 48.846  38.003  10.802  1.00 6.67  ? 1139 TRP B C     1 
ATOM   5341  O O     . TRP B  1 108 ? 49.107  37.095  10.013  1.00 2.00  ? 1139 TRP B O     1 
ATOM   5342  C CB    . TRP B  1 108 ? 46.716  38.299  12.056  1.00 11.93 ? 1139 TRP B CB    1 
ATOM   5343  C CG    . TRP B  1 108 ? 45.894  37.518  11.060  1.00 11.92 ? 1139 TRP B CG    1 
ATOM   5344  C CD1   . TRP B  1 108 ? 45.703  37.817  9.733   1.00 10.95 ? 1139 TRP B CD1   1 
ATOM   5345  C CD2   . TRP B  1 108 ? 45.374  36.191  11.246  1.00 8.12  ? 1139 TRP B CD2   1 
ATOM   5346  N NE1   . TRP B  1 108 ? 45.118  36.747  9.086   1.00 9.30  ? 1139 TRP B NE1   1 
ATOM   5347  C CE2   . TRP B  1 108 ? 44.908  35.738  9.990   1.00 5.08  ? 1139 TRP B CE2   1 
ATOM   5348  C CE3   . TRP B  1 108 ? 45.271  35.340  12.359  1.00 4.56  ? 1139 TRP B CE3   1 
ATOM   5349  C CZ2   . TRP B  1 108 ? 44.343  34.466  9.810   1.00 2.00  ? 1139 TRP B CZ2   1 
ATOM   5350  C CZ3   . TRP B  1 108 ? 44.710  34.069  12.179  1.00 5.30  ? 1139 TRP B CZ3   1 
ATOM   5351  C CH2   . TRP B  1 108 ? 44.254  33.648  10.913  1.00 2.00  ? 1139 TRP B CH2   1 
ATOM   5352  N N     . GLU B  1 109 ? 49.151  39.281  10.588  1.00 11.02 ? 1140 GLU B N     1 
ATOM   5353  C CA    . GLU B  1 109 ? 49.851  39.717  9.384   1.00 11.82 ? 1140 GLU B CA    1 
ATOM   5354  C C     . GLU B  1 109 ? 50.978  38.742  9.146   1.00 10.14 ? 1140 GLU B C     1 
ATOM   5355  O O     . GLU B  1 109 ? 51.291  38.392  8.007   1.00 2.00  ? 1140 GLU B O     1 
ATOM   5356  C CB    . GLU B  1 109 ? 50.445  41.108  9.576   1.00 13.21 ? 1140 GLU B CB    1 
ATOM   5357  C CG    . GLU B  1 109 ? 51.447  41.471  8.489   1.00 14.99 ? 1140 GLU B CG    1 
ATOM   5358  C CD    . GLU B  1 109 ? 50.847  41.344  7.107   1.00 16.77 ? 1140 GLU B CD    1 
ATOM   5359  O OE1   . GLU B  1 109 ? 51.569  40.932  6.181   1.00 17.29 ? 1140 GLU B OE1   1 
ATOM   5360  O OE2   . GLU B  1 109 ? 49.649  41.657  6.942   1.00 17.71 ? 1140 GLU B OE2   1 
ATOM   5361  N N     . ALA B  1 110 ? 51.591  38.331  10.252  1.00 10.36 ? 1141 ALA B N     1 
ATOM   5362  C CA    . ALA B  1 110 ? 52.673  37.362  10.216  1.00 12.71 ? 1141 ALA B CA    1 
ATOM   5363  C C     . ALA B  1 110 ? 52.072  36.084  9.640   1.00 15.03 ? 1141 ALA B C     1 
ATOM   5364  O O     . ALA B  1 110 ? 52.102  35.849  8.424   1.00 13.34 ? 1141 ALA B O     1 
ATOM   5365  C CB    . ALA B  1 110 ? 53.212  37.099  11.634  1.00 9.92  ? 1141 ALA B CB    1 
ATOM   5366  N N     . PHE B  1 111 ? 51.493  35.287  10.530  1.00 14.39 ? 1142 PHE B N     1 
ATOM   5367  C CA    . PHE B  1 111 ? 50.889  34.022  10.156  1.00 14.75 ? 1142 PHE B CA    1 
ATOM   5368  C C     . PHE B  1 111 ? 50.172  33.999  8.810   1.00 14.39 ? 1142 PHE B C     1 
ATOM   5369  O O     . PHE B  1 111 ? 50.054  32.939  8.187   1.00 15.47 ? 1142 PHE B O     1 
ATOM   5370  C CB    . PHE B  1 111 ? 49.895  33.574  11.224  1.00 11.89 ? 1142 PHE B CB    1 
ATOM   5371  C CG    . PHE B  1 111 ? 48.996  32.474  10.762  1.00 11.78 ? 1142 PHE B CG    1 
ATOM   5372  C CD1   . PHE B  1 111 ? 49.361  31.145  10.911  1.00 13.58 ? 1142 PHE B CD1   1 
ATOM   5373  C CD2   . PHE B  1 111 ? 47.816  32.771  10.111  1.00 16.04 ? 1142 PHE B CD2   1 
ATOM   5374  C CE1   . PHE B  1 111 ? 48.565  30.135  10.411  1.00 15.16 ? 1142 PHE B CE1   1 
ATOM   5375  C CE2   . PHE B  1 111 ? 47.022  31.765  9.610   1.00 17.93 ? 1142 PHE B CE2   1 
ATOM   5376  C CZ    . PHE B  1 111 ? 47.401  30.442  9.762   1.00 16.25 ? 1142 PHE B CZ    1 
ATOM   5377  N N     . SER B  1 112 ? 49.683  35.154  8.373   1.00 12.86 ? 1143 SER B N     1 
ATOM   5378  C CA    . SER B  1 112 ? 48.943  35.231  7.126   1.00 11.84 ? 1143 SER B CA    1 
ATOM   5379  C C     . SER B  1 112 ? 49.801  35.401  5.874   1.00 14.01 ? 1143 SER B C     1 
ATOM   5380  O O     . SER B  1 112 ? 49.767  34.559  4.979   1.00 14.82 ? 1143 SER B O     1 
ATOM   5381  C CB    . SER B  1 112 ? 47.910  36.365  7.205   1.00 14.12 ? 1143 SER B CB    1 
ATOM   5382  O OG    . SER B  1 112 ? 48.530  37.639  7.360   1.00 18.50 ? 1143 SER B OG    1 
ATOM   5383  N N     . ASN B  1 113 ? 50.566  36.488  5.804   1.00 12.87 ? 1144 ASN B N     1 
ATOM   5384  C CA    . ASN B  1 113 ? 51.384  36.753  4.632   1.00 10.29 ? 1144 ASN B CA    1 
ATOM   5385  C C     . ASN B  1 113 ? 52.218  35.543  4.228   1.00 11.20 ? 1144 ASN B C     1 
ATOM   5386  O O     . ASN B  1 113 ? 52.977  34.990  5.024   1.00 9.11  ? 1144 ASN B O     1 
ATOM   5387  C CB    . ASN B  1 113 ? 52.267  37.978  4.871   1.00 2.00  ? 1144 ASN B CB    1 
ATOM   5388  C CG    . ASN B  1 113 ? 52.533  38.751  3.594   1.00 4.31  ? 1144 ASN B CG    1 
ATOM   5389  O OD1   . ASN B  1 113 ? 52.807  38.145  2.554   1.00 2.00  ? 1144 ASN B OD1   1 
ATOM   5390  N ND2   . ASN B  1 113 ? 52.445  40.079  3.662   1.00 2.00  ? 1144 ASN B ND2   1 
ATOM   5391  N N     . LEU B  1 114 ? 52.061  35.121  2.980   1.00 14.07 ? 1145 LEU B N     1 
ATOM   5392  C CA    . LEU B  1 114 ? 52.783  33.950  2.500   1.00 15.97 ? 1145 LEU B CA    1 
ATOM   5393  C C     . LEU B  1 114 ? 54.046  34.268  1.712   1.00 17.47 ? 1145 LEU B C     1 
ATOM   5394  O O     . LEU B  1 114 ? 54.824  33.371  1.372   1.00 13.05 ? 1145 LEU B O     1 
ATOM   5395  C CB    . LEU B  1 114 ? 51.833  33.093  1.662   1.00 13.80 ? 1145 LEU B CB    1 
ATOM   5396  C CG    . LEU B  1 114 ? 50.750  32.388  2.482   1.00 10.47 ? 1145 LEU B CG    1 
ATOM   5397  C CD1   . LEU B  1 114 ? 50.282  31.135  1.752   1.00 11.53 ? 1145 LEU B CD1   1 
ATOM   5398  C CD2   . LEU B  1 114 ? 51.296  32.015  3.857   1.00 9.63  ? 1145 LEU B CD2   1 
ATOM   5399  N N     . SER B  1 115 ? 54.237  35.552  1.424   1.00 18.54 ? 1146 SER B N     1 
ATOM   5400  C CA    . SER B  1 115 ? 55.405  36.005  0.682   1.00 22.05 ? 1146 SER B CA    1 
ATOM   5401  C C     . SER B  1 115 ? 56.607  36.106  1.632   1.00 25.02 ? 1146 SER B C     1 
ATOM   5402  O O     . SER B  1 115 ? 57.755  36.169  1.186   1.00 25.40 ? 1146 SER B O     1 
ATOM   5403  C CB    . SER B  1 115 ? 55.135  37.373  0.035   1.00 22.98 ? 1146 SER B CB    1 
ATOM   5404  O OG    . SER B  1 115 ? 53.897  37.931  0.459   1.00 23.46 ? 1146 SER B OG    1 
ATOM   5405  N N     . TYR B  1 116 ? 56.337  36.124  2.938   1.00 26.02 ? 1147 TYR B N     1 
ATOM   5406  C CA    . TYR B  1 116 ? 57.395  36.195  3.938   1.00 25.96 ? 1147 TYR B CA    1 
ATOM   5407  C C     . TYR B  1 116 ? 58.037  34.822  4.081   1.00 22.04 ? 1147 TYR B C     1 
ATOM   5408  O O     . TYR B  1 116 ? 57.567  33.841  3.514   1.00 25.97 ? 1147 TYR B O     1 
ATOM   5409  C CB    . TYR B  1 116 ? 56.826  36.582  5.303   1.00 31.38 ? 1147 TYR B CB    1 
ATOM   5410  C CG    . TYR B  1 116 ? 56.711  38.064  5.579   1.00 36.94 ? 1147 TYR B CG    1 
ATOM   5411  C CD1   . TYR B  1 116 ? 55.670  38.809  5.041   1.00 39.42 ? 1147 TYR B CD1   1 
ATOM   5412  C CD2   . TYR B  1 116 ? 57.599  38.705  6.442   1.00 39.31 ? 1147 TYR B CD2   1 
ATOM   5413  C CE1   . TYR B  1 116 ? 55.504  40.153  5.358   1.00 38.26 ? 1147 TYR B CE1   1 
ATOM   5414  C CE2   . TYR B  1 116 ? 57.443  40.053  6.768   1.00 38.89 ? 1147 TYR B CE2   1 
ATOM   5415  C CZ    . TYR B  1 116 ? 56.389  40.767  6.221   1.00 41.03 ? 1147 TYR B CZ    1 
ATOM   5416  O OH    . TYR B  1 116 ? 56.204  42.093  6.538   1.00 39.89 ? 1147 TYR B OH    1 
ATOM   5417  N N     . TYR B  1 117 ? 59.119  34.770  4.846   1.00 19.18 ? 1148 TYR B N     1 
ATOM   5418  C CA    . TYR B  1 117 ? 59.831  33.524  5.141   1.00 11.71 ? 1148 TYR B CA    1 
ATOM   5419  C C     . TYR B  1 117 ? 59.626  33.501  6.663   1.00 10.99 ? 1148 TYR B C     1 
ATOM   5420  O O     . TYR B  1 117 ? 59.802  34.534  7.339   1.00 2.00  ? 1148 TYR B O     1 
ATOM   5421  C CB    . TYR B  1 117 ? 61.336  33.655  4.832   1.00 13.21 ? 1148 TYR B CB    1 
ATOM   5422  C CG    . TYR B  1 117 ? 61.844  33.157  3.483   1.00 8.50  ? 1148 TYR B CG    1 
ATOM   5423  C CD1   . TYR B  1 117 ? 61.915  31.793  3.196   1.00 3.27  ? 1148 TYR B CD1   1 
ATOM   5424  C CD2   . TYR B  1 117 ? 62.371  34.057  2.536   1.00 5.90  ? 1148 TYR B CD2   1 
ATOM   5425  C CE1   . TYR B  1 117 ? 62.510  31.327  2.001   1.00 4.95  ? 1148 TYR B CE1   1 
ATOM   5426  C CE2   . TYR B  1 117 ? 62.969  33.609  1.343   1.00 3.44  ? 1148 TYR B CE2   1 
ATOM   5427  C CZ    . TYR B  1 117 ? 63.041  32.235  1.080   1.00 6.11  ? 1148 TYR B CZ    1 
ATOM   5428  O OH    . TYR B  1 117 ? 63.676  31.774  -0.075  1.00 3.61  ? 1148 TYR B OH    1 
ATOM   5429  N N     . THR B  1 118 ? 59.225  32.366  7.219   1.00 8.21  ? 1149 THR B N     1 
ATOM   5430  C CA    . THR B  1 118 ? 59.025  32.335  8.663   1.00 13.03 ? 1149 THR B CA    1 
ATOM   5431  C C     . THR B  1 118 ? 60.394  32.299  9.327   1.00 14.10 ? 1149 THR B C     1 
ATOM   5432  O O     . THR B  1 118 ? 61.361  31.862  8.718   1.00 21.21 ? 1149 THR B O     1 
ATOM   5433  C CB    . THR B  1 118 ? 58.184  31.109  9.105   1.00 11.81 ? 1149 THR B CB    1 
ATOM   5434  O OG1   . THR B  1 118 ? 58.167  31.039  10.539  1.00 14.37 ? 1149 THR B OG1   1 
ATOM   5435  C CG2   . THR B  1 118 ? 58.746  29.811  8.516   1.00 5.07  ? 1149 THR B CG2   1 
ATOM   5436  N N     . ARG B  1 119 ? 60.492  32.764  10.565  1.00 17.67 ? 1150 ARG B N     1 
ATOM   5437  C CA    . ARG B  1 119 ? 61.782  32.757  11.243  1.00 17.79 ? 1150 ARG B CA    1 
ATOM   5438  C C     . ARG B  1 119 ? 61.772  31.947  12.535  1.00 18.99 ? 1150 ARG B C     1 
ATOM   5439  O O     . ARG B  1 119 ? 61.017  32.246  13.465  1.00 18.71 ? 1150 ARG B O     1 
ATOM   5440  C CB    . ARG B  1 119 ? 62.243  34.196  11.511  1.00 18.43 ? 1150 ARG B CB    1 
ATOM   5441  C CG    . ARG B  1 119 ? 63.004  34.814  10.341  1.00 19.49 ? 1150 ARG B CG    1 
ATOM   5442  C CD    . ARG B  1 119 ? 64.507  34.627  10.490  1.00 18.20 ? 1150 ARG B CD    1 
ATOM   5443  N NE    . ARG B  1 119 ? 65.014  35.275  11.696  1.00 16.95 ? 1150 ARG B NE    1 
ATOM   5444  C CZ    . ARG B  1 119 ? 65.388  36.549  11.767  1.00 12.52 ? 1150 ARG B CZ    1 
ATOM   5445  N NH1   . ARG B  1 119 ? 65.313  37.320  10.698  1.00 2.98  ? 1150 ARG B NH1   1 
ATOM   5446  N NH2   . ARG B  1 119 ? 65.841  37.050  12.912  1.00 12.71 ? 1150 ARG B NH2   1 
ATOM   5447  N N     . ALA B  1 120 ? 62.621  30.918  12.570  1.00 18.90 ? 1151 ALA B N     1 
ATOM   5448  C CA    . ALA B  1 120 ? 62.747  30.027  13.719  1.00 19.58 ? 1151 ALA B CA    1 
ATOM   5449  C C     . ALA B  1 120 ? 63.029  30.823  14.982  1.00 18.11 ? 1151 ALA B C     1 
ATOM   5450  O O     . ALA B  1 120 ? 62.763  30.359  16.091  1.00 21.65 ? 1151 ALA B O     1 
ATOM   5451  C CB    . ALA B  1 120 ? 63.864  29.020  13.479  1.00 21.27 ? 1151 ALA B CB    1 
ATOM   5452  N N     . LEU B  1 121 ? 63.588  32.016  14.808  1.00 14.42 ? 1152 LEU B N     1 
ATOM   5453  C CA    . LEU B  1 121 ? 63.887  32.891  15.933  1.00 10.36 ? 1152 LEU B CA    1 
ATOM   5454  C C     . LEU B  1 121 ? 63.580  34.287  15.489  1.00 9.57  ? 1152 LEU B C     1 
ATOM   5455  O O     . LEU B  1 121 ? 63.886  34.698  14.379  1.00 5.23  ? 1152 LEU B O     1 
ATOM   5456  C CB    . LEU B  1 121 ? 65.358  32.805  16.347  1.00 15.13 ? 1152 LEU B CB    1 
ATOM   5457  C CG    . LEU B  1 121 ? 65.777  31.736  17.370  1.00 14.05 ? 1152 LEU B CG    1 
ATOM   5458  C CD1   . LEU B  1 121 ? 67.246  31.975  17.764  1.00 8.25  ? 1152 LEU B CD1   1 
ATOM   5459  C CD2   . LEU B  1 121 ? 64.861  31.771  18.588  1.00 11.42 ? 1152 LEU B CD2   1 
ATOM   5460  N N     . PRO B  1 122 ? 62.981  35.053  16.374  1.00 12.05 ? 1153 PRO B N     1 
ATOM   5461  C CA    . PRO B  1 122 ? 62.612  36.440  16.068  1.00 10.65 ? 1153 PRO B CA    1 
ATOM   5462  C C     . PRO B  1 122 ? 63.799  37.320  15.727  1.00 12.92 ? 1153 PRO B C     1 
ATOM   5463  O O     . PRO B  1 122 ? 64.928  37.042  16.122  1.00 16.44 ? 1153 PRO B O     1 
ATOM   5464  C CB    . PRO B  1 122 ? 61.920  36.916  17.354  1.00 13.03 ? 1153 PRO B CB    1 
ATOM   5465  C CG    . PRO B  1 122 ? 62.513  36.013  18.443  1.00 13.48 ? 1153 PRO B CG    1 
ATOM   5466  C CD    . PRO B  1 122 ? 62.656  34.670  17.761  1.00 11.72 ? 1153 PRO B CD    1 
ATOM   5467  N N     . PRO B  1 123 ? 63.568  38.374  14.950  1.00 12.57 ? 1154 PRO B N     1 
ATOM   5468  C CA    . PRO B  1 123 ? 64.680  39.260  14.619  1.00 12.15 ? 1154 PRO B CA    1 
ATOM   5469  C C     . PRO B  1 123 ? 65.019  40.053  15.882  1.00 14.93 ? 1154 PRO B C     1 
ATOM   5470  O O     . PRO B  1 123 ? 64.567  39.713  16.976  1.00 11.65 ? 1154 PRO B O     1 
ATOM   5471  C CB    . PRO B  1 123 ? 64.118  40.160  13.518  1.00 12.71 ? 1154 PRO B CB    1 
ATOM   5472  C CG    . PRO B  1 123 ? 62.647  40.145  13.740  1.00 12.00 ? 1154 PRO B CG    1 
ATOM   5473  C CD    . PRO B  1 123 ? 62.319  38.778  14.294  1.00 11.60 ? 1154 PRO B CD    1 
ATOM   5474  N N     . VAL B  1 124 ? 65.803  41.115  15.725  1.00 18.55 ? 1155 VAL B N     1 
ATOM   5475  C CA    . VAL B  1 124 ? 66.191  41.938  16.857  1.00 17.80 ? 1155 VAL B CA    1 
ATOM   5476  C C     . VAL B  1 124 ? 65.666  43.349  16.693  1.00 17.60 ? 1155 VAL B C     1 
ATOM   5477  O O     . VAL B  1 124 ? 65.848  43.983  15.644  1.00 16.17 ? 1155 VAL B O     1 
ATOM   5478  C CB    . VAL B  1 124 ? 67.722  41.990  17.004  1.00 18.43 ? 1155 VAL B CB    1 
ATOM   5479  C CG1   . VAL B  1 124 ? 68.087  42.403  18.426  1.00 18.41 ? 1155 VAL B CG1   1 
ATOM   5480  C CG2   . VAL B  1 124 ? 68.323  40.619  16.658  1.00 13.56 ? 1155 VAL B CG2   1 
ATOM   5481  N N     . ALA B  1 125 ? 65.013  43.838  17.739  1.00 20.77 ? 1156 ALA B N     1 
ATOM   5482  C CA    . ALA B  1 125 ? 64.454  45.181  17.697  1.00 24.82 ? 1156 ALA B CA    1 
ATOM   5483  C C     . ALA B  1 125 ? 65.445  46.153  17.087  1.00 27.15 ? 1156 ALA B C     1 
ATOM   5484  O O     . ALA B  1 125 ? 66.587  46.254  17.541  1.00 29.13 ? 1156 ALA B O     1 
ATOM   5485  C CB    . ALA B  1 125 ? 64.068  45.644  19.099  1.00 22.37 ? 1156 ALA B CB    1 
ATOM   5486  N N     . ASP B  1 126 ? 65.014  46.846  16.040  1.00 29.35 ? 1157 ASP B N     1 
ATOM   5487  C CA    . ASP B  1 126 ? 65.861  47.834  15.402  1.00 35.69 ? 1157 ASP B CA    1 
ATOM   5488  C C     . ASP B  1 126 ? 66.219  48.887  16.443  1.00 36.90 ? 1157 ASP B C     1 
ATOM   5489  O O     . ASP B  1 126 ? 67.129  49.689  16.241  1.00 39.01 ? 1157 ASP B O     1 
ATOM   5490  C CB    . ASP B  1 126 ? 65.108  48.460  14.242  1.00 37.26 ? 1157 ASP B CB    1 
ATOM   5491  C CG    . ASP B  1 126 ? 64.552  47.421  13.315  1.00 43.78 ? 1157 ASP B CG    1 
ATOM   5492  O OD1   . ASP B  1 126 ? 65.113  46.304  13.335  1.00 45.48 ? 1157 ASP B OD1   1 
ATOM   5493  O OD2   . ASP B  1 126 ? 63.576  47.703  12.582  1.00 44.48 ? 1157 ASP B OD2   1 
ATOM   5494  N N     . ASP B  1 127 ? 65.492  48.865  17.561  1.00 36.37 ? 1158 ASP B N     1 
ATOM   5495  C CA    . ASP B  1 127 ? 65.711  49.797  18.664  1.00 36.47 ? 1158 ASP B CA    1 
ATOM   5496  C C     . ASP B  1 127 ? 66.787  49.243  19.609  1.00 35.89 ? 1158 ASP B C     1 
ATOM   5497  O O     . ASP B  1 127 ? 67.322  49.967  20.451  1.00 37.19 ? 1158 ASP B O     1 
ATOM   5498  C CB    . ASP B  1 127 ? 64.377  50.047  19.399  1.00 35.14 ? 1158 ASP B CB    1 
ATOM   5499  C CG    . ASP B  1 127 ? 64.393  49.599  20.863  1.00 36.52 ? 1158 ASP B CG    1 
ATOM   5500  O OD1   . ASP B  1 127 ? 64.645  48.406  21.145  1.00 33.16 ? 1158 ASP B OD1   1 
ATOM   5501  O OD2   . ASP B  1 127 ? 64.133  50.455  21.738  1.00 39.19 ? 1158 ASP B OD2   1 
ATOM   5502  N N     . CYS B  1 128 ? 67.105  47.960  19.455  1.00 35.43 ? 1159 CYS B N     1 
ATOM   5503  C CA    . CYS B  1 128 ? 68.127  47.315  20.270  1.00 34.31 ? 1159 CYS B CA    1 
ATOM   5504  C C     . CYS B  1 128 ? 69.449  48.074  20.061  1.00 35.62 ? 1159 CYS B C     1 
ATOM   5505  O O     . CYS B  1 128 ? 69.674  48.643  18.988  1.00 36.87 ? 1159 CYS B O     1 
ATOM   5506  C CB    . CYS B  1 128 ? 68.277  45.849  19.848  1.00 30.82 ? 1159 CYS B CB    1 
ATOM   5507  S SG    . CYS B  1 128 ? 67.136  44.705  20.690  1.00 28.45 ? 1159 CYS B SG    1 
ATOM   5508  N N     . PRO B  1 129 ? 70.340  48.084  21.076  1.00 34.56 ? 1160 PRO B N     1 
ATOM   5509  C CA    . PRO B  1 129 ? 71.635  48.781  20.998  1.00 33.84 ? 1160 PRO B CA    1 
ATOM   5510  C C     . PRO B  1 129 ? 72.686  48.139  20.085  1.00 32.49 ? 1160 PRO B C     1 
ATOM   5511  O O     . PRO B  1 129 ? 73.256  48.797  19.216  1.00 31.98 ? 1160 PRO B O     1 
ATOM   5512  C CB    . PRO B  1 129 ? 72.101  48.823  22.446  1.00 33.39 ? 1160 PRO B CB    1 
ATOM   5513  C CG    . PRO B  1 129 ? 71.493  47.603  23.055  1.00 36.37 ? 1160 PRO B CG    1 
ATOM   5514  C CD    . PRO B  1 129 ? 70.164  47.410  22.376  1.00 36.22 ? 1160 PRO B CD    1 
ATOM   5515  N N     . THR B  1 130 ? 72.941  46.853  20.284  1.00 32.60 ? 1161 THR B N     1 
ATOM   5516  C CA    . THR B  1 130 ? 73.932  46.159  19.486  1.00 29.60 ? 1161 THR B CA    1 
ATOM   5517  C C     . THR B  1 130 ? 73.281  45.146  18.563  1.00 29.52 ? 1161 THR B C     1 
ATOM   5518  O O     . THR B  1 130 ? 72.233  44.589  18.870  1.00 28.68 ? 1161 THR B O     1 
ATOM   5519  C CB    . THR B  1 130 ? 74.996  45.458  20.396  1.00 28.36 ? 1161 THR B CB    1 
ATOM   5520  O OG1   . THR B  1 130 ? 74.723  44.056  20.508  1.00 26.55 ? 1161 THR B OG1   1 
ATOM   5521  C CG2   . THR B  1 130 ? 74.987  46.074  21.770  1.00 25.94 ? 1161 THR B CG2   1 
ATOM   5522  N N     . PRO B  1 131 ? 73.892  44.924  17.394  1.00 29.67 ? 1162 PRO B N     1 
ATOM   5523  C CA    . PRO B  1 131 ? 73.432  43.985  16.370  1.00 29.21 ? 1162 PRO B CA    1 
ATOM   5524  C C     . PRO B  1 131 ? 72.962  42.624  16.900  1.00 28.83 ? 1162 PRO B C     1 
ATOM   5525  O O     . PRO B  1 131 ? 72.162  41.945  16.255  1.00 31.61 ? 1162 PRO B O     1 
ATOM   5526  C CB    . PRO B  1 131 ? 74.637  43.850  15.451  1.00 28.31 ? 1162 PRO B CB    1 
ATOM   5527  C CG    . PRO B  1 131 ? 75.340  45.158  15.575  1.00 30.09 ? 1162 PRO B CG    1 
ATOM   5528  C CD    . PRO B  1 131 ? 75.107  45.649  16.970  1.00 30.85 ? 1162 PRO B CD    1 
ATOM   5529  N N     . MET B  1 132 ? 73.465  42.208  18.052  1.00 22.27 ? 1163 MET B N     1 
ATOM   5530  C CA    . MET B  1 132 ? 73.031  40.938  18.606  1.00 25.48 ? 1163 MET B CA    1 
ATOM   5531  C C     . MET B  1 132 ? 72.232  41.215  19.861  1.00 25.09 ? 1163 MET B C     1 
ATOM   5532  O O     . MET B  1 132 ? 72.188  40.407  20.785  1.00 27.35 ? 1163 MET B O     1 
ATOM   5533  C CB    . MET B  1 132 ? 74.228  40.051  18.938  1.00 23.56 ? 1163 MET B CB    1 
ATOM   5534  C CG    . MET B  1 132 ? 75.003  39.582  17.729  1.00 19.97 ? 1163 MET B CG    1 
ATOM   5535  S SD    . MET B  1 132 ? 74.065  38.511  16.654  1.00 18.45 ? 1163 MET B SD    1 
ATOM   5536  C CE    . MET B  1 132 ? 73.658  39.656  15.364  1.00 17.96 ? 1163 MET B CE    1 
ATOM   5537  N N     . GLY B  1 133 ? 71.587  42.370  19.877  1.00 26.21 ? 1164 GLY B N     1 
ATOM   5538  C CA    . GLY B  1 133 ? 70.797  42.752  21.027  1.00 28.04 ? 1164 GLY B CA    1 
ATOM   5539  C C     . GLY B  1 133 ? 71.582  43.679  21.923  1.00 30.07 ? 1164 GLY B C     1 
ATOM   5540  O O     . GLY B  1 133 ? 71.411  44.900  21.863  1.00 27.49 ? 1164 GLY B O     1 
ATOM   5541  N N     . VAL B  1 134 ? 72.448  43.096  22.752  1.00 33.95 ? 1165 VAL B N     1 
ATOM   5542  C CA    . VAL B  1 134 ? 73.273  43.876  23.674  1.00 38.03 ? 1165 VAL B CA    1 
ATOM   5543  C C     . VAL B  1 134 ? 74.750  43.477  23.657  1.00 38.32 ? 1165 VAL B C     1 
ATOM   5544  O O     . VAL B  1 134 ? 75.635  44.336  23.680  1.00 36.81 ? 1165 VAL B O     1 
ATOM   5545  C CB    . VAL B  1 134 ? 72.757  43.753  25.117  1.00 39.20 ? 1165 VAL B CB    1 
ATOM   5546  C CG1   . VAL B  1 134 ? 71.693  44.810  25.371  1.00 41.07 ? 1165 VAL B CG1   1 
ATOM   5547  C CG2   . VAL B  1 134 ? 72.216  42.352  25.354  1.00 38.17 ? 1165 VAL B CG2   1 
ATOM   5548  N N     . LYS B  1 135 ? 75.020  42.175  23.629  1.00 37.20 ? 1166 LYS B N     1 
ATOM   5549  C CA    . LYS B  1 135 ? 76.399  41.705  23.613  1.00 37.72 ? 1166 LYS B CA    1 
ATOM   5550  C C     . LYS B  1 135 ? 77.034  42.069  22.283  1.00 37.89 ? 1166 LYS B C     1 
ATOM   5551  O O     . LYS B  1 135 ? 76.414  41.908  21.225  1.00 37.52 ? 1166 LYS B O     1 
ATOM   5552  C CB    . LYS B  1 135 ? 76.451  40.188  23.820  1.00 35.67 ? 1166 LYS B CB    1 
ATOM   5553  C CG    . LYS B  1 135 ? 76.202  39.759  25.254  1.00 31.64 ? 1166 LYS B CG    1 
ATOM   5554  C CD    . LYS B  1 135 ? 76.596  38.311  25.467  1.00 25.74 ? 1166 LYS B CD    1 
ATOM   5555  C CE    . LYS B  1 135 ? 75.374  37.464  25.757  1.00 23.36 ? 1166 LYS B CE    1 
ATOM   5556  N NZ    . LYS B  1 135 ? 75.677  36.320  26.665  1.00 17.70 ? 1166 LYS B NZ    1 
ATOM   5557  N N     . GLY B  1 136 ? 78.263  42.577  22.344  1.00 38.96 ? 1167 GLY B N     1 
ATOM   5558  C CA    . GLY B  1 136 ? 78.964  42.954  21.128  1.00 41.47 ? 1167 GLY B CA    1 
ATOM   5559  C C     . GLY B  1 136 ? 79.203  44.442  20.982  1.00 42.14 ? 1167 GLY B C     1 
ATOM   5560  O O     . GLY B  1 136 ? 78.972  45.204  21.915  1.00 42.70 ? 1167 GLY B O     1 
ATOM   5561  N N     . ASN B  1 137 ? 79.655  44.861  19.806  1.00 41.44 ? 1168 ASN B N     1 
ATOM   5562  C CA    . ASN B  1 137 ? 79.934  46.267  19.567  1.00 43.70 ? 1168 ASN B CA    1 
ATOM   5563  C C     . ASN B  1 137 ? 78.851  46.944  18.749  1.00 44.56 ? 1168 ASN B C     1 
ATOM   5564  O O     . ASN B  1 137 ? 77.935  46.290  18.257  1.00 44.73 ? 1168 ASN B O     1 
ATOM   5565  C CB    . ASN B  1 137 ? 81.272  46.417  18.842  1.00 48.67 ? 1168 ASN B CB    1 
ATOM   5566  C CG    . ASN B  1 137 ? 82.457  46.134  19.743  1.00 50.68 ? 1168 ASN B CG    1 
ATOM   5567  O OD1   . ASN B  1 137 ? 82.936  47.018  20.453  1.00 50.06 ? 1168 ASN B OD1   1 
ATOM   5568  N ND2   . ASN B  1 137 ? 82.938  44.894  19.719  1.00 53.99 ? 1168 ASN B ND2   1 
ATOM   5569  N N     . LYS B  1 138 ? 78.978  48.260  18.597  1.00 43.92 ? 1169 LYS B N     1 
ATOM   5570  C CA    . LYS B  1 138 ? 78.029  49.045  17.824  1.00 46.90 ? 1169 LYS B CA    1 
ATOM   5571  C C     . LYS B  1 138 ? 77.849  48.406  16.455  1.00 44.92 ? 1169 LYS B C     1 
ATOM   5572  O O     . LYS B  1 138 ? 76.919  48.721  15.723  1.00 47.34 ? 1169 LYS B O     1 
ATOM   5573  C CB    . LYS B  1 138 ? 78.537  50.472  17.664  1.00 49.62 ? 1169 LYS B CB    1 
ATOM   5574  C CG    . LYS B  1 138 ? 78.154  51.388  18.812  1.00 57.11 ? 1169 LYS B CG    1 
ATOM   5575  C CD    . LYS B  1 138 ? 79.336  52.240  19.263  1.00 63.06 ? 1169 LYS B CD    1 
ATOM   5576  C CE    . LYS B  1 138 ? 79.213  52.630  20.738  1.00 64.09 ? 1169 LYS B CE    1 
ATOM   5577  N NZ    . LYS B  1 138 ? 79.702  54.016  20.994  1.00 68.70 ? 1169 LYS B NZ    1 
ATOM   5578  N N     . GLU B  1 139 ? 78.756  47.505  16.109  1.00 44.98 ? 1170 GLU B N     1 
ATOM   5579  C CA    . GLU B  1 139 ? 78.662  46.821  14.838  1.00 43.87 ? 1170 GLU B CA    1 
ATOM   5580  C C     . GLU B  1 139 ? 79.245  45.432  14.882  1.00 39.85 ? 1170 GLU B C     1 
ATOM   5581  O O     . GLU B  1 139 ? 79.621  44.921  15.937  1.00 36.84 ? 1170 GLU B O     1 
ATOM   5582  C CB    . GLU B  1 139 ? 79.371  47.607  13.749  1.00 49.34 ? 1170 GLU B CB    1 
ATOM   5583  C CG    . GLU B  1 139 ? 78.581  48.759  13.237  1.00 55.91 ? 1170 GLU B CG    1 
ATOM   5584  C CD    . GLU B  1 139 ? 79.414  49.999  13.191  1.00 62.11 ? 1170 GLU B CD    1 
ATOM   5585  O OE1   . GLU B  1 139 ? 79.870  50.351  12.081  1.00 63.74 ? 1170 GLU B OE1   1 
ATOM   5586  O OE2   . GLU B  1 139 ? 79.618  50.609  14.265  1.00 61.26 ? 1170 GLU B OE2   1 
ATOM   5587  N N     . LEU B  1 140 ? 79.317  44.841  13.699  1.00 32.64 ? 1171 LEU B N     1 
ATOM   5588  C CA    . LEU B  1 140 ? 79.832  43.503  13.518  1.00 28.78 ? 1171 LEU B CA    1 
ATOM   5589  C C     . LEU B  1 140 ? 81.026  43.530  12.578  1.00 24.53 ? 1171 LEU B C     1 
ATOM   5590  O O     . LEU B  1 140 ? 81.146  44.406  11.712  1.00 21.59 ? 1171 LEU B O     1 
ATOM   5591  C CB    . LEU B  1 140 ? 78.743  42.602  12.907  1.00 29.56 ? 1171 LEU B CB    1 
ATOM   5592  C CG    . LEU B  1 140 ? 77.769  41.815  13.791  1.00 30.36 ? 1171 LEU B CG    1 
ATOM   5593  C CD1   . LEU B  1 140 ? 78.326  40.425  14.073  1.00 29.70 ? 1171 LEU B CD1   1 
ATOM   5594  C CD2   . LEU B  1 140 ? 77.535  42.568  15.089  1.00 34.29 ? 1171 LEU B CD2   1 
ATOM   5595  N N     . PRO B  1 141 ? 81.928  42.557  12.735  1.00 21.78 ? 1172 PRO B N     1 
ATOM   5596  C CA    . PRO B  1 141 ? 83.110  42.469  11.881  1.00 20.90 ? 1172 PRO B CA    1 
ATOM   5597  C C     . PRO B  1 141 ? 82.719  42.702  10.424  1.00 20.85 ? 1172 PRO B C     1 
ATOM   5598  O O     . PRO B  1 141 ? 81.673  42.230  9.980   1.00 23.56 ? 1172 PRO B O     1 
ATOM   5599  C CB    . PRO B  1 141 ? 83.605  41.028  12.098  1.00 15.57 ? 1172 PRO B CB    1 
ATOM   5600  C CG    . PRO B  1 141 ? 82.591  40.361  12.999  1.00 14.82 ? 1172 PRO B CG    1 
ATOM   5601  C CD    . PRO B  1 141 ? 81.901  41.471  13.726  1.00 19.60 ? 1172 PRO B CD    1 
ATOM   5602  N N     . ASP B  1 142 ? 83.533  43.437  9.679   1.00 22.66 ? 1173 ASP B N     1 
ATOM   5603  C CA    . ASP B  1 142 ? 83.216  43.642  8.275   1.00 24.25 ? 1173 ASP B CA    1 
ATOM   5604  C C     . ASP B  1 142 ? 83.172  42.229  7.704   1.00 25.73 ? 1173 ASP B C     1 
ATOM   5605  O O     . ASP B  1 142 ? 83.939  41.356  8.134   1.00 25.01 ? 1173 ASP B O     1 
ATOM   5606  C CB    . ASP B  1 142 ? 84.302  44.478  7.594   1.00 25.08 ? 1173 ASP B CB    1 
ATOM   5607  C CG    . ASP B  1 142 ? 84.522  44.089  6.149   1.00 28.86 ? 1173 ASP B CG    1 
ATOM   5608  O OD1   . ASP B  1 142 ? 84.383  44.953  5.255   1.00 28.41 ? 1173 ASP B OD1   1 
ATOM   5609  O OD2   . ASP B  1 142 ? 84.841  42.917  5.901   1.00 30.12 ? 1173 ASP B OD2   1 
ATOM   5610  N N     . SER B  1 143 ? 82.283  41.999  6.743   1.00 27.60 ? 1174 SER B N     1 
ATOM   5611  C CA    . SER B  1 143 ? 82.128  40.666  6.155   1.00 30.00 ? 1174 SER B CA    1 
ATOM   5612  C C     . SER B  1 143 ? 83.304  40.281  5.262   1.00 30.18 ? 1174 SER B C     1 
ATOM   5613  O O     . SER B  1 143 ? 83.802  39.156  5.334   1.00 26.15 ? 1174 SER B O     1 
ATOM   5614  C CB    . SER B  1 143 ? 80.818  40.581  5.360   1.00 26.51 ? 1174 SER B CB    1 
ATOM   5615  O OG    . SER B  1 143 ? 80.669  41.679  4.479   1.00 24.77 ? 1174 SER B OG    1 
ATOM   5616  N N     . LYS B  1 144 ? 83.733  41.221  4.418   1.00 34.19 ? 1175 LYS B N     1 
ATOM   5617  C CA    . LYS B  1 144 ? 84.863  41.013  3.509   1.00 34.07 ? 1175 LYS B CA    1 
ATOM   5618  C C     . LYS B  1 144 ? 85.941  40.250  4.276   1.00 32.35 ? 1175 LYS B C     1 
ATOM   5619  O O     . LYS B  1 144 ? 86.420  39.207  3.821   1.00 31.94 ? 1175 LYS B O     1 
ATOM   5620  C CB    . LYS B  1 144 ? 85.409  42.368  3.034   1.00 36.38 ? 1175 LYS B CB    1 
ATOM   5621  C CG    . LYS B  1 144 ? 86.364  42.283  1.851   1.00 42.26 ? 1175 LYS B CG    1 
ATOM   5622  C CD    . LYS B  1 144 ? 87.428  43.378  1.922   1.00 47.50 ? 1175 LYS B CD    1 
ATOM   5623  C CE    . LYS B  1 144 ? 88.339  43.354  0.699   1.00 48.67 ? 1175 LYS B CE    1 
ATOM   5624  N NZ    . LYS B  1 144 ? 87.953  44.380  -0.320  1.00 49.07 ? 1175 LYS B NZ    1 
ATOM   5625  N N     . GLU B  1 145 ? 86.304  40.783  5.444   1.00 29.18 ? 1176 GLU B N     1 
ATOM   5626  C CA    . GLU B  1 145 ? 87.294  40.175  6.317   1.00 26.64 ? 1176 GLU B CA    1 
ATOM   5627  C C     . GLU B  1 145 ? 86.882  38.731  6.533   1.00 21.26 ? 1176 GLU B C     1 
ATOM   5628  O O     . GLU B  1 145 ? 87.325  37.851  5.802   1.00 25.23 ? 1176 GLU B O     1 
ATOM   5629  C CB    . GLU B  1 145 ? 87.334  40.903  7.657   1.00 32.85 ? 1176 GLU B CB    1 
ATOM   5630  C CG    . GLU B  1 145 ? 87.717  42.371  7.553   1.00 42.19 ? 1176 GLU B CG    1 
ATOM   5631  C CD    . GLU B  1 145 ? 89.114  42.639  8.083   1.00 49.70 ? 1176 GLU B CD    1 
ATOM   5632  O OE1   . GLU B  1 145 ? 90.025  41.824  7.799   1.00 51.88 ? 1176 GLU B OE1   1 
ATOM   5633  O OE2   . GLU B  1 145 ? 89.296  43.662  8.784   1.00 48.90 ? 1176 GLU B OE2   1 
ATOM   5634  N N     . VAL B  1 146 ? 86.027  38.501  7.527   1.00 16.77 ? 1177 VAL B N     1 
ATOM   5635  C CA    . VAL B  1 146 ? 85.519  37.163  7.843   1.00 12.20 ? 1177 VAL B CA    1 
ATOM   5636  C C     . VAL B  1 146 ? 85.535  36.281  6.596   1.00 11.04 ? 1177 VAL B C     1 
ATOM   5637  O O     . VAL B  1 146 ? 86.116  35.182  6.599   1.00 8.15  ? 1177 VAL B O     1 
ATOM   5638  C CB    . VAL B  1 146 ? 84.058  37.244  8.368   1.00 10.07 ? 1177 VAL B CB    1 
ATOM   5639  C CG1   . VAL B  1 146 ? 83.796  36.118  9.353   1.00 2.00  ? 1177 VAL B CG1   1 
ATOM   5640  C CG2   . VAL B  1 146 ? 83.798  38.621  9.016   1.00 2.83  ? 1177 VAL B CG2   1 
ATOM   5641  N N     . LEU B  1 147 ? 84.882  36.794  5.547   1.00 7.51  ? 1178 LEU B N     1 
ATOM   5642  C CA    . LEU B  1 147 ? 84.782  36.156  4.240   1.00 9.98  ? 1178 LEU B CA    1 
ATOM   5643  C C     . LEU B  1 147 ? 86.130  35.546  3.880   1.00 7.57  ? 1178 LEU B C     1 
ATOM   5644  O O     . LEU B  1 147 ? 86.269  34.330  3.705   1.00 2.00  ? 1178 LEU B O     1 
ATOM   5645  C CB    . LEU B  1 147 ? 84.408  37.215  3.198   1.00 11.44 ? 1178 LEU B CB    1 
ATOM   5646  C CG    . LEU B  1 147 ? 83.642  36.803  1.930   1.00 13.02 ? 1178 LEU B CG    1 
ATOM   5647  C CD1   . LEU B  1 147 ? 84.011  37.756  0.799   1.00 13.73 ? 1178 LEU B CD1   1 
ATOM   5648  C CD2   . LEU B  1 147 ? 83.965  35.355  1.535   1.00 13.01 ? 1178 LEU B CD2   1 
ATOM   5649  N N     . GLU B  1 148 ? 87.114  36.429  3.757   1.00 11.50 ? 1179 GLU B N     1 
ATOM   5650  C CA    . GLU B  1 148 ? 88.481  36.035  3.456   1.00 15.65 ? 1179 GLU B CA    1 
ATOM   5651  C C     . GLU B  1 148 ? 89.091  35.350  4.676   1.00 13.05 ? 1179 GLU B C     1 
ATOM   5652  O O     . GLU B  1 148 ? 89.402  34.165  4.653   1.00 14.64 ? 1179 GLU B O     1 
ATOM   5653  C CB    . GLU B  1 148 ? 89.328  37.259  3.123   1.00 13.44 ? 1179 GLU B CB    1 
ATOM   5654  C CG    . GLU B  1 148 ? 88.696  38.238  2.166   1.00 16.58 ? 1179 GLU B CG    1 
ATOM   5655  C CD    . GLU B  1 148 ? 89.336  39.618  2.284   1.00 21.54 ? 1179 GLU B CD    1 
ATOM   5656  O OE1   . GLU B  1 148 ? 89.777  39.970  3.406   1.00 21.14 ? 1179 GLU B OE1   1 
ATOM   5657  O OE2   . GLU B  1 148 ? 89.407  40.350  1.268   1.00 20.42 ? 1179 GLU B OE2   1 
ATOM   5658  N N     . LYS B  1 149 ? 89.257  36.127  5.735   1.00 14.21 ? 1180 LYS B N     1 
ATOM   5659  C CA    . LYS B  1 149 ? 89.829  35.650  6.993   1.00 18.38 ? 1180 LYS B CA    1 
ATOM   5660  C C     . LYS B  1 149 ? 89.504  34.208  7.402   1.00 18.28 ? 1180 LYS B C     1 
ATOM   5661  O O     . LYS B  1 149 ? 90.226  33.634  8.208   1.00 18.47 ? 1180 LYS B O     1 
ATOM   5662  C CB    . LYS B  1 149 ? 89.429  36.589  8.143   1.00 20.87 ? 1180 LYS B CB    1 
ATOM   5663  C CG    . LYS B  1 149 ? 89.880  38.026  7.974   1.00 29.29 ? 1180 LYS B CG    1 
ATOM   5664  C CD    . LYS B  1 149 ? 91.330  38.188  8.381   1.00 33.34 ? 1180 LYS B CD    1 
ATOM   5665  C CE    . LYS B  1 149 ? 91.608  39.615  8.840   1.00 35.42 ? 1180 LYS B CE    1 
ATOM   5666  N NZ    . LYS B  1 149 ? 93.023  40.024  8.607   1.00 34.50 ? 1180 LYS B NZ    1 
ATOM   5667  N N     . VAL B  1 150 ? 88.437  33.614  6.874   1.00 15.63 ? 1181 VAL B N     1 
ATOM   5668  C CA    . VAL B  1 150 ? 88.119  32.245  7.272   1.00 15.41 ? 1181 VAL B CA    1 
ATOM   5669  C C     . VAL B  1 150 ? 87.153  31.507  6.369   1.00 15.53 ? 1181 VAL B C     1 
ATOM   5670  O O     . VAL B  1 150 ? 86.846  30.342  6.627   1.00 17.94 ? 1181 VAL B O     1 
ATOM   5671  C CB    . VAL B  1 150 ? 87.506  32.200  8.669   1.00 17.40 ? 1181 VAL B CB    1 
ATOM   5672  C CG1   . VAL B  1 150 ? 88.590  31.953  9.723   1.00 19.76 ? 1181 VAL B CG1   1 
ATOM   5673  C CG2   . VAL B  1 150 ? 86.747  33.504  8.931   1.00 21.71 ? 1181 VAL B CG2   1 
ATOM   5674  N N     . LEU B  1 151 ? 86.674  32.152  5.313   1.00 15.14 ? 1182 LEU B N     1 
ATOM   5675  C CA    . LEU B  1 151 ? 85.735  31.468  4.444   1.00 18.53 ? 1182 LEU B CA    1 
ATOM   5676  C C     . LEU B  1 151 ? 86.259  31.021  3.091   1.00 18.57 ? 1182 LEU B C     1 
ATOM   5677  O O     . LEU B  1 151 ? 86.245  29.824  2.776   1.00 17.73 ? 1182 LEU B O     1 
ATOM   5678  C CB    . LEU B  1 151 ? 84.495  32.332  4.242   1.00 20.78 ? 1182 LEU B CB    1 
ATOM   5679  C CG    . LEU B  1 151 ? 83.689  32.657  5.507   1.00 21.40 ? 1182 LEU B CG    1 
ATOM   5680  C CD1   . LEU B  1 151 ? 82.560  33.599  5.124   1.00 15.29 ? 1182 LEU B CD1   1 
ATOM   5681  C CD2   . LEU B  1 151 ? 83.136  31.382  6.155   1.00 19.64 ? 1182 LEU B CD2   1 
ATOM   5682  N N     . LEU B  1 152 ? 86.701  31.977  2.283   1.00 21.81 ? 1183 LEU B N     1 
ATOM   5683  C CA    . LEU B  1 152 ? 87.200  31.656  0.952   1.00 22.74 ? 1183 LEU B CA    1 
ATOM   5684  C C     . LEU B  1 152 ? 88.144  30.460  0.924   1.00 22.82 ? 1183 LEU B C     1 
ATOM   5685  O O     . LEU B  1 152 ? 89.046  30.350  1.738   1.00 23.36 ? 1183 LEU B O     1 
ATOM   5686  C CB    . LEU B  1 152 ? 87.878  32.875  0.349   1.00 23.13 ? 1183 LEU B CB    1 
ATOM   5687  C CG    . LEU B  1 152 ? 86.824  33.900  -0.061  1.00 26.50 ? 1183 LEU B CG    1 
ATOM   5688  C CD1   . LEU B  1 152 ? 87.221  35.280  0.454   1.00 24.46 ? 1183 LEU B CD1   1 
ATOM   5689  C CD2   . LEU B  1 152 ? 86.666  33.872  -1.590  1.00 26.18 ? 1183 LEU B CD2   1 
ATOM   5690  N N     . ARG B  1 153 ? 87.909  29.556  -0.014  1.00 24.27 ? 1184 ARG B N     1 
ATOM   5691  C CA    . ARG B  1 153 ? 88.723  28.365  -0.156  1.00 26.14 ? 1184 ARG B CA    1 
ATOM   5692  C C     . ARG B  1 153 ? 90.096  28.681  -0.725  1.00 28.29 ? 1184 ARG B C     1 
ATOM   5693  O O     . ARG B  1 153 ? 90.200  29.332  -1.768  1.00 24.68 ? 1184 ARG B O     1 
ATOM   5694  C CB    . ARG B  1 153 ? 88.032  27.373  -1.088  1.00 26.61 ? 1184 ARG B CB    1 
ATOM   5695  C CG    . ARG B  1 153 ? 88.941  26.272  -1.621  1.00 32.06 ? 1184 ARG B CG    1 
ATOM   5696  C CD    . ARG B  1 153 ? 88.278  25.517  -2.766  1.00 35.29 ? 1184 ARG B CD    1 
ATOM   5697  N NE    . ARG B  1 153 ? 86.891  25.180  -2.462  1.00 39.79 ? 1184 ARG B NE    1 
ATOM   5698  C CZ    . ARG B  1 153 ? 85.910  25.154  -3.354  1.00 41.05 ? 1184 ARG B CZ    1 
ATOM   5699  N NH1   . ARG B  1 153 ? 86.153  25.447  -4.622  1.00 40.69 ? 1184 ARG B NH1   1 
ATOM   5700  N NH2   . ARG B  1 153 ? 84.682  24.839  -2.971  1.00 39.70 ? 1184 ARG B NH2   1 
ATOM   5701  N N     . ARG B  1 154 ? 91.142  28.211  -0.041  1.00 30.34 ? 1185 ARG B N     1 
ATOM   5702  C CA    . ARG B  1 154 ? 92.519  28.403  -0.497  1.00 31.09 ? 1185 ARG B CA    1 
ATOM   5703  C C     . ARG B  1 154 ? 92.812  27.136  -1.279  1.00 32.39 ? 1185 ARG B C     1 
ATOM   5704  O O     . ARG B  1 154 ? 92.833  27.146  -2.508  1.00 32.92 ? 1185 ARG B O     1 
ATOM   5705  C CB    . ARG B  1 154 ? 93.482  28.518  0.682   1.00 29.51 ? 1185 ARG B CB    1 
ATOM   5706  C CG    . ARG B  1 154 ? 92.813  28.812  1.988   1.00 34.14 ? 1185 ARG B CG    1 
ATOM   5707  C CD    . ARG B  1 154 ? 92.894  30.282  2.337   1.00 37.15 ? 1185 ARG B CD    1 
ATOM   5708  N NE    . ARG B  1 154 ? 92.528  30.495  3.737   1.00 48.75 ? 1185 ARG B NE    1 
ATOM   5709  C CZ    . ARG B  1 154 ? 91.936  31.591  4.204   1.00 50.60 ? 1185 ARG B CZ    1 
ATOM   5710  N NH1   . ARG B  1 154 ? 91.638  32.590  3.382   1.00 51.61 ? 1185 ARG B NH1   1 
ATOM   5711  N NH2   . ARG B  1 154 ? 91.628  31.684  5.495   1.00 53.62 ? 1185 ARG B NH2   1 
ATOM   5712  N N     . GLU B  1 155 ? 93.039  26.046  -0.560  1.00 33.40 ? 1186 GLU B N     1 
ATOM   5713  C CA    . GLU B  1 155 ? 93.279  24.763  -1.195  1.00 36.35 ? 1186 GLU B CA    1 
ATOM   5714  C C     . GLU B  1 155 ? 91.921  24.077  -1.178  1.00 35.74 ? 1186 GLU B C     1 
ATOM   5715  O O     . GLU B  1 155 ? 91.293  23.972  -0.121  1.00 37.59 ? 1186 GLU B O     1 
ATOM   5716  C CB    . GLU B  1 155 ? 94.282  23.940  -0.385  1.00 41.58 ? 1186 GLU B CB    1 
ATOM   5717  C CG    . GLU B  1 155 ? 95.624  23.745  -1.063  1.00 51.24 ? 1186 GLU B CG    1 
ATOM   5718  C CD    . GLU B  1 155 ? 96.645  23.080  -0.156  1.00 59.46 ? 1186 GLU B CD    1 
ATOM   5719  O OE1   . GLU B  1 155 ? 96.626  21.831  -0.061  1.00 60.94 ? 1186 GLU B OE1   1 
ATOM   5720  O OE2   . GLU B  1 155 ? 97.465  23.806  0.458   1.00 60.76 ? 1186 GLU B OE2   1 
ATOM   5721  N N     . PHE B  1 156 ? 91.445  23.638  -2.338  1.00 34.69 ? 1187 PHE B N     1 
ATOM   5722  C CA    . PHE B  1 156 ? 90.151  22.968  -2.383  1.00 35.94 ? 1187 PHE B CA    1 
ATOM   5723  C C     . PHE B  1 156 ? 90.125  21.825  -1.367  1.00 35.57 ? 1187 PHE B C     1 
ATOM   5724  O O     . PHE B  1 156 ? 91.026  20.983  -1.336  1.00 36.24 ? 1187 PHE B O     1 
ATOM   5725  C CB    . PHE B  1 156 ? 89.879  22.417  -3.787  1.00 36.71 ? 1187 PHE B CB    1 
ATOM   5726  C CG    . PHE B  1 156 ? 88.758  21.398  -3.848  1.00 39.58 ? 1187 PHE B CG    1 
ATOM   5727  C CD1   . PHE B  1 156 ? 88.942  20.097  -3.379  1.00 40.45 ? 1187 PHE B CD1   1 
ATOM   5728  C CD2   . PHE B  1 156 ? 87.529  21.733  -4.407  1.00 42.45 ? 1187 PHE B CD2   1 
ATOM   5729  C CE1   . PHE B  1 156 ? 87.924  19.148  -3.469  1.00 42.19 ? 1187 PHE B CE1   1 
ATOM   5730  C CE2   . PHE B  1 156 ? 86.502  20.789  -4.501  1.00 40.27 ? 1187 PHE B CE2   1 
ATOM   5731  C CZ    . PHE B  1 156 ? 86.703  19.493  -4.030  1.00 41.66 ? 1187 PHE B CZ    1 
ATOM   5732  N N     . ILE B  1 157 ? 89.098  21.803  -0.529  1.00 31.06 ? 1188 ILE B N     1 
ATOM   5733  C CA    . ILE B  1 157 ? 88.957  20.745  0.461   1.00 28.39 ? 1188 ILE B CA    1 
ATOM   5734  C C     . ILE B  1 157 ? 87.855  19.810  -0.014  1.00 31.15 ? 1188 ILE B C     1 
ATOM   5735  O O     . ILE B  1 157 ? 86.705  20.222  -0.179  1.00 34.01 ? 1188 ILE B O     1 
ATOM   5736  C CB    . ILE B  1 157 ? 88.549  21.301  1.821   1.00 26.67 ? 1188 ILE B CB    1 
ATOM   5737  C CG1   . ILE B  1 157 ? 89.487  22.439  2.211   1.00 30.75 ? 1188 ILE B CG1   1 
ATOM   5738  C CG2   . ILE B  1 157 ? 88.551  20.185  2.845   1.00 31.39 ? 1188 ILE B CG2   1 
ATOM   5739  C CD1   . ILE B  1 157 ? 88.855  23.479  3.113   1.00 30.83 ? 1188 ILE B CD1   1 
ATOM   5740  N N     . PRO B  1 158 ? 88.177  18.533  -0.222  1.00 30.20 ? 1189 PRO B N     1 
ATOM   5741  C CA    . PRO B  1 158 ? 87.127  17.627  -0.683  1.00 28.06 ? 1189 PRO B CA    1 
ATOM   5742  C C     . PRO B  1 158 ? 86.267  17.209  0.487   1.00 29.11 ? 1189 PRO B C     1 
ATOM   5743  O O     . PRO B  1 158 ? 86.734  17.169  1.631   1.00 27.64 ? 1189 PRO B O     1 
ATOM   5744  C CB    . PRO B  1 158 ? 87.904  16.452  -1.248  1.00 28.31 ? 1189 PRO B CB    1 
ATOM   5745  C CG    . PRO B  1 158 ? 89.096  16.383  -0.357  1.00 32.23 ? 1189 PRO B CG    1 
ATOM   5746  C CD    . PRO B  1 158 ? 89.450  17.826  -0.018  1.00 30.31 ? 1189 PRO B CD    1 
ATOM   5747  N N     . ASP B  1 159 ? 85.003  16.914  0.222   1.00 26.12 ? 1190 ASP B N     1 
ATOM   5748  C CA    . ASP B  1 159 ? 84.175  16.466  1.315   1.00 21.87 ? 1190 ASP B CA    1 
ATOM   5749  C C     . ASP B  1 159 ? 84.617  15.037  1.646   1.00 20.73 ? 1190 ASP B C     1 
ATOM   5750  O O     . ASP B  1 159 ? 84.647  14.164  0.776   1.00 16.62 ? 1190 ASP B O     1 
ATOM   5751  C CB    . ASP B  1 159 ? 82.699  16.426  0.950   1.00 22.12 ? 1190 ASP B CB    1 
ATOM   5752  C CG    . ASP B  1 159 ? 81.979  15.274  1.654   1.00 23.15 ? 1190 ASP B CG    1 
ATOM   5753  O OD1   . ASP B  1 159 ? 81.811  15.366  2.894   1.00 18.44 ? 1190 ASP B OD1   1 
ATOM   5754  O OD2   . ASP B  1 159 ? 81.611  14.273  0.982   1.00 15.78 ? 1190 ASP B OD2   1 
ATOM   5755  N N     . PRO B  1 160 ? 85.001  14.794  2.902   1.00 19.27 ? 1191 PRO B N     1 
ATOM   5756  C CA    . PRO B  1 160 ? 85.415  13.438  3.252   1.00 15.55 ? 1191 PRO B CA    1 
ATOM   5757  C C     . PRO B  1 160 ? 84.301  12.448  2.952   1.00 18.45 ? 1191 PRO B C     1 
ATOM   5758  O O     . PRO B  1 160 ? 84.563  11.278  2.672   1.00 21.17 ? 1191 PRO B O     1 
ATOM   5759  C CB    . PRO B  1 160 ? 85.710  13.522  4.743   1.00 16.45 ? 1191 PRO B CB    1 
ATOM   5760  C CG    . PRO B  1 160 ? 85.083  14.832  5.200   1.00 19.74 ? 1191 PRO B CG    1 
ATOM   5761  C CD    . PRO B  1 160 ? 85.130  15.734  4.028   1.00 16.25 ? 1191 PRO B CD    1 
ATOM   5762  N N     . GLN B  1 161 ? 83.057  12.921  2.989   1.00 19.50 ? 1192 GLN B N     1 
ATOM   5763  C CA    . GLN B  1 161 ? 81.900  12.047  2.748   1.00 23.23 ? 1192 GLN B CA    1 
ATOM   5764  C C     . GLN B  1 161 ? 81.700  11.514  1.318   1.00 21.73 ? 1192 GLN B C     1 
ATOM   5765  O O     . GLN B  1 161 ? 80.850  10.643  1.091   1.00 21.06 ? 1192 GLN B O     1 
ATOM   5766  C CB    . GLN B  1 161 ? 80.622  12.742  3.222   1.00 23.67 ? 1192 GLN B CB    1 
ATOM   5767  C CG    . GLN B  1 161 ? 80.738  13.326  4.623   1.00 26.87 ? 1192 GLN B CG    1 
ATOM   5768  C CD    . GLN B  1 161 ? 79.488  13.114  5.443   1.00 26.60 ? 1192 GLN B CD    1 
ATOM   5769  O OE1   . GLN B  1 161 ? 79.198  13.890  6.354   1.00 27.66 ? 1192 GLN B OE1   1 
ATOM   5770  N NE2   . GLN B  1 161 ? 78.735  12.057  5.124   1.00 26.41 ? 1192 GLN B NE2   1 
ATOM   5771  N N     . GLY B  1 162 ? 82.468  12.033  0.364   1.00 22.30 ? 1193 GLY B N     1 
ATOM   5772  C CA    . GLY B  1 162 ? 82.359  11.549  -1.002  1.00 25.72 ? 1193 GLY B CA    1 
ATOM   5773  C C     . GLY B  1 162 ? 81.309  12.223  -1.862  1.00 27.02 ? 1193 GLY B C     1 
ATOM   5774  O O     . GLY B  1 162 ? 81.036  11.798  -2.985  1.00 24.12 ? 1193 GLY B O     1 
ATOM   5775  N N     . SER B  1 163 ? 80.723  13.285  -1.330  1.00 27.21 ? 1194 SER B N     1 
ATOM   5776  C CA    . SER B  1 163 ? 79.693  14.035  -2.036  1.00 26.35 ? 1194 SER B CA    1 
ATOM   5777  C C     . SER B  1 163 ? 80.132  14.456  -3.436  1.00 24.67 ? 1194 SER B C     1 
ATOM   5778  O O     . SER B  1 163 ? 80.889  15.409  -3.593  1.00 25.94 ? 1194 SER B O     1 
ATOM   5779  C CB    . SER B  1 163 ? 79.318  15.273  -1.215  1.00 26.75 ? 1194 SER B CB    1 
ATOM   5780  O OG    . SER B  1 163 ? 79.069  14.930  0.143   1.00 25.68 ? 1194 SER B OG    1 
ATOM   5781  N N     . ASN B  1 164 ? 79.638  13.751  -4.447  1.00 26.17 ? 1195 ASN B N     1 
ATOM   5782  C CA    . ASN B  1 164 ? 79.976  14.049  -5.840  1.00 25.44 ? 1195 ASN B CA    1 
ATOM   5783  C C     . ASN B  1 164 ? 79.252  15.284  -6.329  1.00 23.15 ? 1195 ASN B C     1 
ATOM   5784  O O     . ASN B  1 164 ? 78.606  15.977  -5.555  1.00 26.63 ? 1195 ASN B O     1 
ATOM   5785  C CB    . ASN B  1 164 ? 79.603  12.876  -6.744  1.00 25.86 ? 1195 ASN B CB    1 
ATOM   5786  C CG    . ASN B  1 164 ? 78.229  12.336  -6.449  1.00 24.60 ? 1195 ASN B CG    1 
ATOM   5787  O OD1   . ASN B  1 164 ? 77.273  13.091  -6.324  1.00 23.64 ? 1195 ASN B OD1   1 
ATOM   5788  N ND2   . ASN B  1 164 ? 78.120  11.022  -6.329  1.00 27.25 ? 1195 ASN B ND2   1 
ATOM   5789  N N     . MET B  1 165 ? 79.363  15.552  -7.623  1.00 23.10 ? 1196 MET B N     1 
ATOM   5790  C CA    . MET B  1 165 ? 78.707  16.707  -8.216  1.00 22.82 ? 1196 MET B CA    1 
ATOM   5791  C C     . MET B  1 165 ? 77.191  16.465  -8.306  1.00 24.65 ? 1196 MET B C     1 
ATOM   5792  O O     . MET B  1 165 ? 76.389  17.402  -8.168  1.00 20.94 ? 1196 MET B O     1 
ATOM   5793  C CB    . MET B  1 165 ? 79.300  16.990  -9.599  1.00 20.24 ? 1196 MET B CB    1 
ATOM   5794  C CG    . MET B  1 165 ? 80.541  17.867  -9.559  1.00 20.69 ? 1196 MET B CG    1 
ATOM   5795  S SD    . MET B  1 165 ? 80.345  19.436  -8.653  1.00 32.60 ? 1196 MET B SD    1 
ATOM   5796  C CE    . MET B  1 165 ? 80.663  18.976  -6.983  1.00 19.71 ? 1196 MET B CE    1 
ATOM   5797  N N     . MET B  1 166 ? 76.808  15.206  -8.535  1.00 23.07 ? 1197 MET B N     1 
ATOM   5798  C CA    . MET B  1 166 ? 75.399  14.840  -8.603  1.00 21.80 ? 1197 MET B CA    1 
ATOM   5799  C C     . MET B  1 166 ? 74.767  15.473  -7.374  1.00 19.89 ? 1197 MET B C     1 
ATOM   5800  O O     . MET B  1 166 ? 74.031  16.456  -7.470  1.00 25.38 ? 1197 MET B O     1 
ATOM   5801  C CB    . MET B  1 166 ? 75.226  13.326  -8.509  1.00 23.26 ? 1197 MET B CB    1 
ATOM   5802  C CG    . MET B  1 166 ? 75.163  12.596  -9.839  1.00 31.65 ? 1197 MET B CG    1 
ATOM   5803  S SD    . MET B  1 166 ? 74.629  13.612  -11.219 1.00 38.53 ? 1197 MET B SD    1 
ATOM   5804  C CE    . MET B  1 166 ? 73.976  12.334  -12.273 1.00 37.77 ? 1197 MET B CE    1 
ATOM   5805  N N     . PHE B  1 167 ? 75.082  14.918  -6.211  1.00 14.46 ? 1198 PHE B N     1 
ATOM   5806  C CA    . PHE B  1 167 ? 74.535  15.452  -4.993  1.00 10.52 ? 1198 PHE B CA    1 
ATOM   5807  C C     . PHE B  1 167 ? 74.461  16.976  -5.042  1.00 12.46 ? 1198 PHE B C     1 
ATOM   5808  O O     . PHE B  1 167 ? 73.386  17.555  -4.945  1.00 14.43 ? 1198 PHE B O     1 
ATOM   5809  C CB    . PHE B  1 167 ? 75.369  15.018  -3.802  1.00 2.00  ? 1198 PHE B CB    1 
ATOM   5810  C CG    . PHE B  1 167 ? 74.964  15.684  -2.520  1.00 3.18  ? 1198 PHE B CG    1 
ATOM   5811  C CD1   . PHE B  1 167 ? 74.223  14.987  -1.564  1.00 5.91  ? 1198 PHE B CD1   1 
ATOM   5812  C CD2   . PHE B  1 167 ? 75.292  17.022  -2.278  1.00 2.00  ? 1198 PHE B CD2   1 
ATOM   5813  C CE1   . PHE B  1 167 ? 73.805  15.620  -0.372  1.00 10.74 ? 1198 PHE B CE1   1 
ATOM   5814  C CE2   . PHE B  1 167 ? 74.885  17.661  -1.105  1.00 7.86  ? 1198 PHE B CE2   1 
ATOM   5815  C CZ    . PHE B  1 167 ? 74.138  16.963  -0.145  1.00 9.96  ? 1198 PHE B CZ    1 
ATOM   5816  N N     . ALA B  1 168 ? 75.603  17.630  -5.201  1.00 14.39 ? 1199 ALA B N     1 
ATOM   5817  C CA    . ALA B  1 168 ? 75.613  19.090  -5.236  1.00 17.05 ? 1199 ALA B CA    1 
ATOM   5818  C C     . ALA B  1 168 ? 74.471  19.651  -6.083  1.00 16.31 ? 1199 ALA B C     1 
ATOM   5819  O O     . ALA B  1 168 ? 73.541  20.265  -5.563  1.00 19.55 ? 1199 ALA B O     1 
ATOM   5820  C CB    . ALA B  1 168 ? 76.942  19.598  -5.764  1.00 13.95 ? 1199 ALA B CB    1 
ATOM   5821  N N     . PHE B  1 169 ? 74.531  19.434  -7.387  1.00 15.59 ? 1200 PHE B N     1 
ATOM   5822  C CA    . PHE B  1 169 ? 73.495  19.948  -8.262  1.00 16.96 ? 1200 PHE B CA    1 
ATOM   5823  C C     . PHE B  1 169 ? 72.085  19.548  -7.841  1.00 18.02 ? 1200 PHE B C     1 
ATOM   5824  O O     . PHE B  1 169 ? 71.130  20.299  -8.046  1.00 18.54 ? 1200 PHE B O     1 
ATOM   5825  C CB    . PHE B  1 169 ? 73.777  19.518  -9.705  1.00 18.87 ? 1200 PHE B CB    1 
ATOM   5826  C CG    . PHE B  1 169 ? 74.792  20.386  -10.386 1.00 25.27 ? 1200 PHE B CG    1 
ATOM   5827  C CD1   . PHE B  1 169 ? 74.666  21.778  -10.343 1.00 28.92 ? 1200 PHE B CD1   1 
ATOM   5828  C CD2   . PHE B  1 169 ? 75.900  19.830  -11.019 1.00 27.02 ? 1200 PHE B CD2   1 
ATOM   5829  C CE1   . PHE B  1 169 ? 75.628  22.599  -10.919 1.00 29.62 ? 1200 PHE B CE1   1 
ATOM   5830  C CE2   . PHE B  1 169 ? 76.869  20.646  -11.599 1.00 27.11 ? 1200 PHE B CE2   1 
ATOM   5831  C CZ    . PHE B  1 169 ? 76.735  22.029  -11.549 1.00 27.39 ? 1200 PHE B CZ    1 
ATOM   5832  N N     . PHE B  1 170 ? 71.942  18.363  -7.259  1.00 18.17 ? 1201 PHE B N     1 
ATOM   5833  C CA    . PHE B  1 170 ? 70.625  17.941  -6.815  1.00 11.06 ? 1201 PHE B CA    1 
ATOM   5834  C C     . PHE B  1 170 ? 70.283  18.975  -5.777  1.00 10.60 ? 1201 PHE B C     1 
ATOM   5835  O O     . PHE B  1 170 ? 69.581  19.934  -6.070  1.00 4.55  ? 1201 PHE B O     1 
ATOM   5836  C CB    . PHE B  1 170 ? 70.689  16.559  -6.195  1.00 13.99 ? 1201 PHE B CB    1 
ATOM   5837  C CG    . PHE B  1 170 ? 69.352  16.002  -5.856  1.00 19.90 ? 1201 PHE B CG    1 
ATOM   5838  C CD1   . PHE B  1 170 ? 68.786  14.981  -6.625  1.00 21.83 ? 1201 PHE B CD1   1 
ATOM   5839  C CD2   . PHE B  1 170 ? 68.654  16.484  -4.763  1.00 18.37 ? 1201 PHE B CD2   1 
ATOM   5840  C CE1   . PHE B  1 170 ? 67.538  14.447  -6.302  1.00 20.35 ? 1201 PHE B CE1   1 
ATOM   5841  C CE2   . PHE B  1 170 ? 67.409  15.962  -4.432  1.00 21.18 ? 1201 PHE B CE2   1 
ATOM   5842  C CZ    . PHE B  1 170 ? 66.848  14.938  -5.204  1.00 21.67 ? 1201 PHE B CZ    1 
ATOM   5843  N N     . ALA B  1 171 ? 70.817  18.788  -4.575  1.00 9.81  ? 1202 ALA B N     1 
ATOM   5844  C CA    . ALA B  1 171 ? 70.615  19.731  -3.490  1.00 12.27 ? 1202 ALA B CA    1 
ATOM   5845  C C     . ALA B  1 171 ? 70.362  21.121  -4.072  1.00 15.16 ? 1202 ALA B C     1 
ATOM   5846  O O     . ALA B  1 171 ? 69.372  21.775  -3.732  1.00 16.33 ? 1202 ALA B O     1 
ATOM   5847  C CB    . ALA B  1 171 ? 71.848  19.761  -2.604  1.00 10.72 ? 1202 ALA B CB    1 
ATOM   5848  N N     . GLN B  1 172 ? 71.249  21.564  -4.960  1.00 17.06 ? 1203 GLN B N     1 
ATOM   5849  C CA    . GLN B  1 172 ? 71.103  22.878  -5.577  1.00 23.81 ? 1203 GLN B CA    1 
ATOM   5850  C C     . GLN B  1 172 ? 69.742  22.996  -6.265  1.00 23.66 ? 1203 GLN B C     1 
ATOM   5851  O O     . GLN B  1 172 ? 68.920  23.846  -5.924  1.00 23.49 ? 1203 GLN B O     1 
ATOM   5852  C CB    . GLN B  1 172 ? 72.209  23.106  -6.607  1.00 27.43 ? 1203 GLN B CB    1 
ATOM   5853  C CG    . GLN B  1 172 ? 71.843  24.125  -7.665  1.00 33.60 ? 1203 GLN B CG    1 
ATOM   5854  C CD    . GLN B  1 172 ? 72.704  25.362  -7.603  1.00 40.65 ? 1203 GLN B CD    1 
ATOM   5855  O OE1   . GLN B  1 172 ? 72.690  26.107  -6.613  1.00 41.43 ? 1203 GLN B OE1   1 
ATOM   5856  N NE2   . GLN B  1 172 ? 73.462  25.596  -8.670  1.00 44.12 ? 1203 GLN B NE2   1 
ATOM   5857  N N     . HIS B  1 173 ? 69.534  22.133  -7.248  1.00 24.76 ? 1204 HIS B N     1 
ATOM   5858  C CA    . HIS B  1 173 ? 68.300  22.071  -8.022  1.00 26.39 ? 1204 HIS B CA    1 
ATOM   5859  C C     . HIS B  1 173 ? 67.082  21.912  -7.114  1.00 24.10 ? 1204 HIS B C     1 
ATOM   5860  O O     . HIS B  1 173 ? 66.165  22.733  -7.143  1.00 23.25 ? 1204 HIS B O     1 
ATOM   5861  C CB    . HIS B  1 173 ? 68.396  20.886  -8.991  1.00 29.57 ? 1204 HIS B CB    1 
ATOM   5862  C CG    . HIS B  1 173 ? 67.144  20.617  -9.767  1.00 33.16 ? 1204 HIS B CG    1 
ATOM   5863  N ND1   . HIS B  1 173 ? 66.105  19.859  -9.268  1.00 33.22 ? 1204 HIS B ND1   1 
ATOM   5864  C CD2   . HIS B  1 173 ? 66.800  20.932  -11.041 1.00 33.77 ? 1204 HIS B CD2   1 
ATOM   5865  C CE1   . HIS B  1 173 ? 65.178  19.716  -10.200 1.00 34.11 ? 1204 HIS B CE1   1 
ATOM   5866  N NE2   . HIS B  1 173 ? 65.577  20.358  -11.284 1.00 33.56 ? 1204 HIS B NE2   1 
ATOM   5867  N N     . PHE B  1 174 ? 67.085  20.851  -6.313  1.00 21.49 ? 1205 PHE B N     1 
ATOM   5868  C CA    . PHE B  1 174 ? 65.993  20.570  -5.396  1.00 21.43 ? 1205 PHE B CA    1 
ATOM   5869  C C     . PHE B  1 174 ? 65.659  21.754  -4.501  1.00 21.17 ? 1205 PHE B C     1 
ATOM   5870  O O     . PHE B  1 174 ? 64.592  22.326  -4.613  1.00 22.63 ? 1205 PHE B O     1 
ATOM   5871  C CB    . PHE B  1 174 ? 66.338  19.351  -4.546  1.00 24.38 ? 1205 PHE B CB    1 
ATOM   5872  C CG    . PHE B  1 174 ? 65.401  19.113  -3.388  1.00 27.51 ? 1205 PHE B CG    1 
ATOM   5873  C CD1   . PHE B  1 174 ? 64.069  18.784  -3.600  1.00 30.55 ? 1205 PHE B CD1   1 
ATOM   5874  C CD2   . PHE B  1 174 ? 65.872  19.142  -2.080  1.00 29.92 ? 1205 PHE B CD2   1 
ATOM   5875  C CE1   . PHE B  1 174 ? 63.230  18.481  -2.519  1.00 31.03 ? 1205 PHE B CE1   1 
ATOM   5876  C CE2   . PHE B  1 174 ? 65.039  18.839  -1.012  1.00 29.33 ? 1205 PHE B CE2   1 
ATOM   5877  C CZ    . PHE B  1 174 ? 63.721  18.508  -1.229  1.00 26.49 ? 1205 PHE B CZ    1 
ATOM   5878  N N     . THR B  1 175 ? 66.563  22.134  -3.613  1.00 19.30 ? 1206 THR B N     1 
ATOM   5879  C CA    . THR B  1 175 ? 66.286  23.252  -2.723  1.00 18.32 ? 1206 THR B CA    1 
ATOM   5880  C C     . THR B  1 175 ? 65.795  24.506  -3.442  1.00 19.72 ? 1206 THR B C     1 
ATOM   5881  O O     . THR B  1 175 ? 65.257  25.418  -2.815  1.00 21.21 ? 1206 THR B O     1 
ATOM   5882  C CB    . THR B  1 175 ? 67.530  23.652  -1.921  1.00 18.29 ? 1206 THR B CB    1 
ATOM   5883  O OG1   . THR B  1 175 ? 68.555  24.082  -2.828  1.00 15.45 ? 1206 THR B OG1   1 
ATOM   5884  C CG2   . THR B  1 175 ? 68.033  22.487  -1.083  1.00 14.00 ? 1206 THR B CG2   1 
ATOM   5885  N N     . HIS B  1 176 ? 65.952  24.561  -4.757  1.00 22.86 ? 1207 HIS B N     1 
ATOM   5886  C CA    . HIS B  1 176 ? 65.543  25.766  -5.480  1.00 27.63 ? 1207 HIS B CA    1 
ATOM   5887  C C     . HIS B  1 176 ? 64.049  26.003  -5.703  1.00 26.63 ? 1207 HIS B C     1 
ATOM   5888  O O     . HIS B  1 176 ? 63.644  26.967  -6.366  1.00 17.88 ? 1207 HIS B O     1 
ATOM   5889  C CB    . HIS B  1 176 ? 66.299  25.858  -6.803  1.00 34.45 ? 1207 HIS B CB    1 
ATOM   5890  C CG    . HIS B  1 176 ? 67.431  26.837  -6.768  1.00 44.10 ? 1207 HIS B CG    1 
ATOM   5891  N ND1   . HIS B  1 176 ? 68.325  26.901  -5.720  1.00 47.21 ? 1207 HIS B ND1   1 
ATOM   5892  C CD2   . HIS B  1 176 ? 67.782  27.826  -7.623  1.00 47.66 ? 1207 HIS B CD2   1 
ATOM   5893  C CE1   . HIS B  1 176 ? 69.177  27.888  -5.930  1.00 50.14 ? 1207 HIS B CE1   1 
ATOM   5894  N NE2   . HIS B  1 176 ? 68.870  28.464  -7.078  1.00 50.60 ? 1207 HIS B NE2   1 
ATOM   5895  N N     . GLN B  1 177 ? 63.231  25.109  -5.156  1.00 26.63 ? 1208 GLN B N     1 
ATOM   5896  C CA    . GLN B  1 177 ? 61.797  25.264  -5.249  1.00 21.43 ? 1208 GLN B CA    1 
ATOM   5897  C C     . GLN B  1 177 ? 61.404  26.038  -3.991  1.00 23.04 ? 1208 GLN B C     1 
ATOM   5898  O O     . GLN B  1 177 ? 60.863  27.134  -4.089  1.00 21.25 ? 1208 GLN B O     1 
ATOM   5899  C CB    . GLN B  1 177 ? 61.087  23.913  -5.296  1.00 16.63 ? 1208 GLN B CB    1 
ATOM   5900  C CG    . GLN B  1 177 ? 61.783  22.783  -4.593  1.00 12.84 ? 1208 GLN B CG    1 
ATOM   5901  C CD    . GLN B  1 177 ? 61.091  21.430  -4.798  1.00 18.60 ? 1208 GLN B CD    1 
ATOM   5902  O OE1   . GLN B  1 177 ? 59.870  21.306  -4.640  1.00 19.76 ? 1208 GLN B OE1   1 
ATOM   5903  N NE2   . GLN B  1 177 ? 61.875  20.408  -5.146  1.00 15.90 ? 1208 GLN B NE2   1 
ATOM   5904  N N     . PHE B  1 178 ? 61.713  25.503  -2.811  1.00 22.97 ? 1209 PHE B N     1 
ATOM   5905  C CA    . PHE B  1 178 ? 61.357  26.219  -1.591  1.00 24.70 ? 1209 PHE B CA    1 
ATOM   5906  C C     . PHE B  1 178 ? 62.062  27.564  -1.521  1.00 23.61 ? 1209 PHE B C     1 
ATOM   5907  O O     . PHE B  1 178 ? 61.405  28.611  -1.494  1.00 24.79 ? 1209 PHE B O     1 
ATOM   5908  C CB    . PHE B  1 178 ? 61.671  25.432  -0.306  1.00 29.27 ? 1209 PHE B CB    1 
ATOM   5909  C CG    . PHE B  1 178 ? 62.499  24.211  -0.503  1.00 33.48 ? 1209 PHE B CG    1 
ATOM   5910  C CD1   . PHE B  1 178 ? 62.064  23.170  -1.316  1.00 38.60 ? 1209 PHE B CD1   1 
ATOM   5911  C CD2   . PHE B  1 178 ? 63.703  24.076  0.171   1.00 37.39 ? 1209 PHE B CD2   1 
ATOM   5912  C CE1   . PHE B  1 178 ? 62.820  22.005  -1.457  1.00 39.09 ? 1209 PHE B CE1   1 
ATOM   5913  C CE2   . PHE B  1 178 ? 64.466  22.916  0.038   1.00 41.56 ? 1209 PHE B CE2   1 
ATOM   5914  C CZ    . PHE B  1 178 ? 64.022  21.878  -0.780  1.00 38.55 ? 1209 PHE B CZ    1 
ATOM   5915  N N     . PHE B  1 179 ? 63.390  27.549  -1.470  1.00 22.49 ? 1210 PHE B N     1 
ATOM   5916  C CA    . PHE B  1 179 ? 64.111  28.809  -1.422  1.00 22.53 ? 1210 PHE B CA    1 
ATOM   5917  C C     . PHE B  1 179 ? 63.949  29.428  -2.792  1.00 22.81 ? 1210 PHE B C     1 
ATOM   5918  O O     . PHE B  1 179 ? 64.213  28.774  -3.797  1.00 22.71 ? 1210 PHE B O     1 
ATOM   5919  C CB    . PHE B  1 179 ? 65.593  28.593  -1.136  1.00 21.75 ? 1210 PHE B CB    1 
ATOM   5920  C CG    . PHE B  1 179 ? 65.858  27.650  -0.015  1.00 22.62 ? 1210 PHE B CG    1 
ATOM   5921  C CD1   . PHE B  1 179 ? 65.405  27.928  1.266   1.00 25.16 ? 1210 PHE B CD1   1 
ATOM   5922  C CD2   . PHE B  1 179 ? 66.565  26.481  -0.237  1.00 24.39 ? 1210 PHE B CD2   1 
ATOM   5923  C CE1   . PHE B  1 179 ? 65.657  27.050  2.315   1.00 24.10 ? 1210 PHE B CE1   1 
ATOM   5924  C CE2   . PHE B  1 179 ? 66.820  25.602  0.793   1.00 23.01 ? 1210 PHE B CE2   1 
ATOM   5925  C CZ    . PHE B  1 179 ? 66.364  25.889  2.076   1.00 25.23 ? 1210 PHE B CZ    1 
ATOM   5926  N N     . LYS B  1 180 ? 63.505  30.680  -2.831  1.00 22.58 ? 1211 LYS B N     1 
ATOM   5927  C CA    . LYS B  1 180 ? 63.308  31.381  -4.093  1.00 25.19 ? 1211 LYS B CA    1 
ATOM   5928  C C     . LYS B  1 180 ? 63.158  32.864  -3.808  1.00 26.77 ? 1211 LYS B C     1 
ATOM   5929  O O     . LYS B  1 180 ? 62.469  33.588  -4.519  1.00 27.20 ? 1211 LYS B O     1 
ATOM   5930  C CB    . LYS B  1 180 ? 62.066  30.853  -4.810  1.00 21.54 ? 1211 LYS B CB    1 
ATOM   5931  C CG    . LYS B  1 180 ? 62.345  29.696  -5.756  1.00 21.61 ? 1211 LYS B CG    1 
ATOM   5932  C CD    . LYS B  1 180 ? 61.065  29.016  -6.208  1.00 19.91 ? 1211 LYS B CD    1 
ATOM   5933  C CE    . LYS B  1 180 ? 60.224  29.951  -7.064  1.00 20.89 ? 1211 LYS B CE    1 
ATOM   5934  N NZ    . LYS B  1 180 ? 58.788  29.575  -7.011  1.00 20.38 ? 1211 LYS B NZ    1 
ATOM   5935  N N     . THR B  1 181 ? 63.822  33.298  -2.749  1.00 27.90 ? 1212 THR B N     1 
ATOM   5936  C CA    . THR B  1 181 ? 63.801  34.687  -2.332  1.00 31.85 ? 1212 THR B CA    1 
ATOM   5937  C C     . THR B  1 181 ? 63.507  35.696  -3.438  1.00 34.42 ? 1212 THR B C     1 
ATOM   5938  O O     . THR B  1 181 ? 64.156  35.710  -4.481  1.00 35.47 ? 1212 THR B O     1 
ATOM   5939  C CB    . THR B  1 181 ? 65.140  35.068  -1.676  1.00 29.00 ? 1212 THR B CB    1 
ATOM   5940  O OG1   . THR B  1 181 ? 65.575  33.988  -0.845  1.00 26.63 ? 1212 THR B OG1   1 
ATOM   5941  C CG2   . THR B  1 181 ? 64.988  36.325  -0.828  1.00 24.85 ? 1212 THR B CG2   1 
ATOM   5942  N N     . ASP B  1 182 ? 62.509  36.533  -3.194  1.00 40.04 ? 1213 ASP B N     1 
ATOM   5943  C CA    . ASP B  1 182 ? 62.132  37.561  -4.134  1.00 46.33 ? 1213 ASP B CA    1 
ATOM   5944  C C     . ASP B  1 182 ? 62.865  38.805  -3.668  1.00 48.82 ? 1213 ASP B C     1 
ATOM   5945  O O     . ASP B  1 182 ? 62.460  39.452  -2.705  1.00 52.65 ? 1213 ASP B O     1 
ATOM   5946  C CB    . ASP B  1 182 ? 60.627  37.791  -4.094  1.00 49.20 ? 1213 ASP B CB    1 
ATOM   5947  C CG    . ASP B  1 182 ? 60.231  39.091  -4.752  1.00 55.59 ? 1213 ASP B CG    1 
ATOM   5948  O OD1   . ASP B  1 182 ? 60.976  39.550  -5.653  1.00 55.93 ? 1213 ASP B OD1   1 
ATOM   5949  O OD2   . ASP B  1 182 ? 59.181  39.654  -4.367  1.00 55.44 ? 1213 ASP B OD2   1 
ATOM   5950  N N     . HIS B  1 183 ? 63.947  39.136  -4.359  1.00 51.03 ? 1214 HIS B N     1 
ATOM   5951  C CA    . HIS B  1 183 ? 64.759  40.284  -3.991  1.00 51.96 ? 1214 HIS B CA    1 
ATOM   5952  C C     . HIS B  1 183 ? 64.092  41.630  -4.220  1.00 50.85 ? 1214 HIS B C     1 
ATOM   5953  O O     . HIS B  1 183 ? 64.321  42.572  -3.465  1.00 48.80 ? 1214 HIS B O     1 
ATOM   5954  C CB    . HIS B  1 183 ? 66.096  40.209  -4.725  1.00 57.63 ? 1214 HIS B CB    1 
ATOM   5955  C CG    . HIS B  1 183 ? 66.897  38.994  -4.370  1.00 62.49 ? 1214 HIS B CG    1 
ATOM   5956  N ND1   . HIS B  1 183 ? 66.843  37.826  -5.103  1.00 62.56 ? 1214 HIS B ND1   1 
ATOM   5957  C CD2   . HIS B  1 183 ? 67.732  38.750  -3.332  1.00 61.93 ? 1214 HIS B CD2   1 
ATOM   5958  C CE1   . HIS B  1 183 ? 67.609  36.915  -4.529  1.00 64.01 ? 1214 HIS B CE1   1 
ATOM   5959  N NE2   . HIS B  1 183 ? 68.159  37.450  -3.453  1.00 63.79 ? 1214 HIS B NE2   1 
ATOM   5960  N N     . LYS B  1 184 ? 63.268  41.729  -5.256  1.00 47.54 ? 1215 LYS B N     1 
ATOM   5961  C CA    . LYS B  1 184 ? 62.579  42.984  -5.524  1.00 44.29 ? 1215 LYS B CA    1 
ATOM   5962  C C     . LYS B  1 184 ? 61.921  43.394  -4.216  1.00 40.20 ? 1215 LYS B C     1 
ATOM   5963  O O     . LYS B  1 184 ? 61.868  44.573  -3.866  1.00 39.82 ? 1215 LYS B O     1 
ATOM   5964  C CB    . LYS B  1 184 ? 61.511  42.785  -6.600  1.00 48.08 ? 1215 LYS B CB    1 
ATOM   5965  C CG    . LYS B  1 184 ? 61.801  41.633  -7.562  1.00 52.37 ? 1215 LYS B CG    1 
ATOM   5966  C CD    . LYS B  1 184 ? 62.279  42.151  -8.917  1.00 55.18 ? 1215 LYS B CD    1 
ATOM   5967  C CE    . LYS B  1 184 ? 61.956  41.170  -10.041 1.00 56.08 ? 1215 LYS B CE    1 
ATOM   5968  N NZ    . LYS B  1 184 ? 61.269  41.844  -11.184 1.00 60.62 ? 1215 LYS B NZ    1 
ATOM   5969  N N     . ARG B  1 185 ? 61.446  42.390  -3.484  1.00 37.38 ? 1216 ARG B N     1 
ATOM   5970  C CA    . ARG B  1 185 ? 60.776  42.606  -2.209  1.00 33.77 ? 1216 ARG B CA    1 
ATOM   5971  C C     . ARG B  1 185 ? 61.786  42.732  -1.082  1.00 28.35 ? 1216 ARG B C     1 
ATOM   5972  O O     . ARG B  1 185 ? 61.793  43.721  -0.348  1.00 25.46 ? 1216 ARG B O     1 
ATOM   5973  C CB    . ARG B  1 185 ? 59.806  41.449  -1.921  1.00 36.07 ? 1216 ARG B CB    1 
ATOM   5974  C CG    . ARG B  1 185 ? 58.375  41.713  -2.400  1.00 42.58 ? 1216 ARG B CG    1 
ATOM   5975  C CD    . ARG B  1 185 ? 57.368  40.667  -1.909  1.00 47.36 ? 1216 ARG B CD    1 
ATOM   5976  N NE    . ARG B  1 185 ? 56.056  40.852  -2.525  1.00 51.14 ? 1216 ARG B NE    1 
ATOM   5977  C CZ    . ARG B  1 185 ? 55.227  41.849  -2.233  1.00 55.22 ? 1216 ARG B CZ    1 
ATOM   5978  N NH1   . ARG B  1 185 ? 55.569  42.761  -1.326  1.00 56.39 ? 1216 ARG B NH1   1 
ATOM   5979  N NH2   . ARG B  1 185 ? 54.063  41.946  -2.861  1.00 59.53 ? 1216 ARG B NH2   1 
ATOM   5980  N N     . GLY B  1 186 ? 62.645  41.730  -0.957  1.00 22.46 ? 1217 GLY B N     1 
ATOM   5981  C CA    . GLY B  1 186 ? 63.641  41.747  0.092   1.00 19.97 ? 1217 GLY B CA    1 
ATOM   5982  C C     . GLY B  1 186 ? 64.226  40.369  0.334   1.00 19.26 ? 1217 GLY B C     1 
ATOM   5983  O O     . GLY B  1 186 ? 63.827  39.379  -0.289  1.00 19.16 ? 1217 GLY B O     1 
ATOM   5984  N N     . PRO B  1 187 ? 65.183  40.271  1.258   1.00 17.25 ? 1218 PRO B N     1 
ATOM   5985  C CA    . PRO B  1 187 ? 65.826  38.993  1.575   1.00 15.25 ? 1218 PRO B CA    1 
ATOM   5986  C C     . PRO B  1 187 ? 64.870  38.047  2.281   1.00 16.26 ? 1218 PRO B C     1 
ATOM   5987  O O     . PRO B  1 187 ? 64.927  36.830  2.073   1.00 19.98 ? 1218 PRO B O     1 
ATOM   5988  C CB    . PRO B  1 187 ? 67.001  39.380  2.478   1.00 14.09 ? 1218 PRO B CB    1 
ATOM   5989  C CG    . PRO B  1 187 ? 67.053  40.904  2.475   1.00 13.20 ? 1218 PRO B CG    1 
ATOM   5990  C CD    . PRO B  1 187 ? 65.697  41.380  2.082   1.00 17.55 ? 1218 PRO B CD    1 
ATOM   5991  N N     . GLY B  1 188 ? 64.017  38.618  3.135   1.00 12.54 ? 1219 GLY B N     1 
ATOM   5992  C CA    . GLY B  1 188 ? 63.051  37.841  3.899   1.00 12.84 ? 1219 GLY B CA    1 
ATOM   5993  C C     . GLY B  1 188 ? 61.851  37.243  3.174   1.00 12.06 ? 1219 GLY B C     1 
ATOM   5994  O O     . GLY B  1 188 ? 61.191  36.347  3.700   1.00 10.15 ? 1219 GLY B O     1 
ATOM   5995  N N     . PHE B  1 189 ? 61.570  37.712  1.961   1.00 12.58 ? 1220 PHE B N     1 
ATOM   5996  C CA    . PHE B  1 189 ? 60.422  37.217  1.207   1.00 11.09 ? 1220 PHE B CA    1 
ATOM   5997  C C     . PHE B  1 189 ? 60.709  36.127  0.183   1.00 11.76 ? 1220 PHE B C     1 
ATOM   5998  O O     . PHE B  1 189 ? 61.657  36.228  -0.580  1.00 12.40 ? 1220 PHE B O     1 
ATOM   5999  C CB    . PHE B  1 189 ? 59.749  38.379  0.501   1.00 11.54 ? 1220 PHE B CB    1 
ATOM   6000  C CG    . PHE B  1 189 ? 59.550  39.571  1.369   1.00 14.35 ? 1220 PHE B CG    1 
ATOM   6001  C CD1   . PHE B  1 189 ? 60.227  40.756  1.108   1.00 10.99 ? 1220 PHE B CD1   1 
ATOM   6002  C CD2   . PHE B  1 189 ? 58.674  39.515  2.452   1.00 19.82 ? 1220 PHE B CD2   1 
ATOM   6003  C CE1   . PHE B  1 189 ? 60.038  41.877  1.913   1.00 16.15 ? 1220 PHE B CE1   1 
ATOM   6004  C CE2   . PHE B  1 189 ? 58.472  40.636  3.274   1.00 19.06 ? 1220 PHE B CE2   1 
ATOM   6005  C CZ    . PHE B  1 189 ? 59.157  41.820  3.002   1.00 18.07 ? 1220 PHE B CZ    1 
ATOM   6006  N N     . THR B  1 190 ? 59.879  35.090  0.167   1.00 8.44  ? 1221 THR B N     1 
ATOM   6007  C CA    . THR B  1 190 ? 60.040  34.015  -0.792  1.00 9.14  ? 1221 THR B CA    1 
ATOM   6008  C C     . THR B  1 190 ? 59.011  34.242  -1.892  1.00 11.70 ? 1221 THR B C     1 
ATOM   6009  O O     . THR B  1 190 ? 58.068  35.009  -1.706  1.00 9.60  ? 1221 THR B O     1 
ATOM   6010  C CB    . THR B  1 190 ? 59.802  32.629  -0.145  1.00 8.45  ? 1221 THR B CB    1 
ATOM   6011  O OG1   . THR B  1 190 ? 59.137  31.759  -1.077  1.00 2.00  ? 1221 THR B OG1   1 
ATOM   6012  C CG2   . THR B  1 190 ? 58.974  32.772  1.109   1.00 2.00  ? 1221 THR B CG2   1 
ATOM   6013  N N     . ARG B  1 191 ? 59.212  33.587  -3.033  1.00 15.21 ? 1222 ARG B N     1 
ATOM   6014  C CA    . ARG B  1 191 ? 58.315  33.706  -4.166  1.00 19.74 ? 1222 ARG B CA    1 
ATOM   6015  C C     . ARG B  1 191 ? 57.650  32.353  -4.336  1.00 18.12 ? 1222 ARG B C     1 
ATOM   6016  O O     . ARG B  1 191 ? 56.653  32.201  -5.054  1.00 20.08 ? 1222 ARG B O     1 
ATOM   6017  C CB    . ARG B  1 191 ? 59.102  34.072  -5.424  1.00 28.83 ? 1222 ARG B CB    1 
ATOM   6018  C CG    . ARG B  1 191 ? 58.662  35.374  -6.088  1.00 38.45 ? 1222 ARG B CG    1 
ATOM   6019  C CD    . ARG B  1 191 ? 59.269  35.513  -7.474  1.00 44.18 ? 1222 ARG B CD    1 
ATOM   6020  N NE    . ARG B  1 191 ? 60.727  35.520  -7.411  1.00 54.44 ? 1222 ARG B NE    1 
ATOM   6021  C CZ    . ARG B  1 191 ? 61.490  34.459  -7.660  1.00 59.29 ? 1222 ARG B CZ    1 
ATOM   6022  N NH1   . ARG B  1 191 ? 60.936  33.300  -7.994  1.00 61.22 ? 1222 ARG B NH1   1 
ATOM   6023  N NH2   . ARG B  1 191 ? 62.811  34.555  -7.567  1.00 61.58 ? 1222 ARG B NH2   1 
ATOM   6024  N N     . GLY B  1 192 ? 58.230  31.363  -3.674  1.00 14.98 ? 1223 GLY B N     1 
ATOM   6025  C CA    . GLY B  1 192 ? 57.674  30.028  -3.722  1.00 11.85 ? 1223 GLY B CA    1 
ATOM   6026  C C     . GLY B  1 192 ? 56.649  29.912  -2.604  1.00 14.23 ? 1223 GLY B C     1 
ATOM   6027  O O     . GLY B  1 192 ? 56.954  29.434  -1.500  1.00 12.06 ? 1223 GLY B O     1 
ATOM   6028  N N     . LEU B  1 193 ? 55.427  30.358  -2.879  1.00 11.37 ? 1224 LEU B N     1 
ATOM   6029  C CA    . LEU B  1 193 ? 54.378  30.311  -1.878  1.00 9.35  ? 1224 LEU B CA    1 
ATOM   6030  C C     . LEU B  1 193 ? 54.049  28.871  -1.533  1.00 7.53  ? 1224 LEU B C     1 
ATOM   6031  O O     . LEU B  1 193 ? 53.448  28.582  -0.488  1.00 4.08  ? 1224 LEU B O     1 
ATOM   6032  C CB    . LEU B  1 193 ? 53.164  31.074  -2.389  1.00 10.57 ? 1224 LEU B CB    1 
ATOM   6033  C CG    . LEU B  1 193 ? 53.627  32.496  -2.742  1.00 6.57  ? 1224 LEU B CG    1 
ATOM   6034  C CD1   . LEU B  1 193 ? 52.801  33.024  -3.873  1.00 2.00  ? 1224 LEU B CD1   1 
ATOM   6035  C CD2   . LEU B  1 193 ? 53.550  33.406  -1.517  1.00 5.89  ? 1224 LEU B CD2   1 
ATOM   6036  N N     . GLY B  1 194 ? 54.481  27.967  -2.407  1.00 6.38  ? 1225 GLY B N     1 
ATOM   6037  C CA    . GLY B  1 194 ? 54.251  26.559  -2.160  1.00 7.29  ? 1225 GLY B CA    1 
ATOM   6038  C C     . GLY B  1 194 ? 54.857  26.194  -0.819  1.00 7.01  ? 1225 GLY B C     1 
ATOM   6039  O O     . GLY B  1 194 ? 54.447  25.230  -0.176  1.00 2.00  ? 1225 GLY B O     1 
ATOM   6040  N N     . HIS B  1 195 ? 55.826  26.995  -0.389  1.00 6.55  ? 1226 HIS B N     1 
ATOM   6041  C CA    . HIS B  1 195 ? 56.520  26.760  0.868   1.00 6.74  ? 1226 HIS B CA    1 
ATOM   6042  C C     . HIS B  1 195 ? 56.775  25.289  1.112   1.00 2.00  ? 1226 HIS B C     1 
ATOM   6043  O O     . HIS B  1 195 ? 56.507  24.780  2.196   1.00 2.00  ? 1226 HIS B O     1 
ATOM   6044  C CB    . HIS B  1 195 ? 55.737  27.338  2.028   1.00 2.00  ? 1226 HIS B CB    1 
ATOM   6045  C CG    . HIS B  1 195 ? 55.866  28.815  2.136   1.00 9.52  ? 1226 HIS B CG    1 
ATOM   6046  N ND1   . HIS B  1 195 ? 56.239  29.446  3.303   1.00 12.71 ? 1226 HIS B ND1   1 
ATOM   6047  C CD2   . HIS B  1 195 ? 55.703  29.792  1.211   1.00 12.26 ? 1226 HIS B CD2   1 
ATOM   6048  C CE1   . HIS B  1 195 ? 56.300  30.752  3.094   1.00 12.91 ? 1226 HIS B CE1   1 
ATOM   6049  N NE2   . HIS B  1 195 ? 55.979  30.988  1.833   1.00 14.28 ? 1226 HIS B NE2   1 
ATOM   6050  N N     . GLY B  1 196 ? 57.300  24.614  0.099   1.00 2.00  ? 1227 GLY B N     1 
ATOM   6051  C CA    . GLY B  1 196 ? 57.592  23.211  0.256   1.00 2.00  ? 1227 GLY B CA    1 
ATOM   6052  C C     . GLY B  1 196 ? 57.818  22.461  -1.043  1.00 5.59  ? 1227 GLY B C     1 
ATOM   6053  O O     . GLY B  1 196 ? 57.828  23.047  -2.137  1.00 3.42  ? 1227 GLY B O     1 
ATOM   6054  N N     . VAL B  1 197 ? 58.008  21.150  -0.904  1.00 4.98  ? 1228 VAL B N     1 
ATOM   6055  C CA    . VAL B  1 197 ? 58.220  20.269  -2.035  1.00 2.67  ? 1228 VAL B CA    1 
ATOM   6056  C C     . VAL B  1 197 ? 56.961  20.190  -2.899  1.00 9.50  ? 1228 VAL B C     1 
ATOM   6057  O O     . VAL B  1 197 ? 56.085  19.351  -2.684  1.00 15.40 ? 1228 VAL B O     1 
ATOM   6058  C CB    . VAL B  1 197 ? 58.560  18.841  -1.578  1.00 5.23  ? 1228 VAL B CB    1 
ATOM   6059  C CG1   . VAL B  1 197 ? 59.387  18.160  -2.654  1.00 2.46  ? 1228 VAL B CG1   1 
ATOM   6060  C CG2   . VAL B  1 197 ? 59.290  18.864  -0.234  1.00 2.00  ? 1228 VAL B CG2   1 
ATOM   6061  N N     . ASP B  1 198 ? 56.879  21.057  -3.894  1.00 9.11  ? 1229 ASP B N     1 
ATOM   6062  C CA    . ASP B  1 198 ? 55.726  21.066  -4.759  1.00 7.80  ? 1229 ASP B CA    1 
ATOM   6063  C C     . ASP B  1 198 ? 56.128  21.017  -6.224  1.00 8.53  ? 1229 ASP B C     1 
ATOM   6064  O O     . ASP B  1 198 ? 55.287  21.188  -7.099  1.00 8.56  ? 1229 ASP B O     1 
ATOM   6065  C CB    . ASP B  1 198 ? 54.904  22.318  -4.472  1.00 7.40  ? 1229 ASP B CB    1 
ATOM   6066  C CG    . ASP B  1 198 ? 55.593  23.591  -4.936  1.00 14.81 ? 1229 ASP B CG    1 
ATOM   6067  O OD1   . ASP B  1 198 ? 55.209  24.690  -4.457  1.00 13.91 ? 1229 ASP B OD1   1 
ATOM   6068  O OD2   . ASP B  1 198 ? 56.519  23.498  -5.780  1.00 12.47 ? 1229 ASP B OD2   1 
ATOM   6069  N N     . LEU B  1 199 ? 57.418  20.774  -6.470  1.00 5.82  ? 1230 LEU B N     1 
ATOM   6070  C CA    . LEU B  1 199 ? 58.008  20.712  -7.815  1.00 4.29  ? 1230 LEU B CA    1 
ATOM   6071  C C     . LEU B  1 199 ? 57.575  21.879  -8.685  1.00 3.63  ? 1230 LEU B C     1 
ATOM   6072  O O     . LEU B  1 199 ? 57.360  21.747  -9.893  1.00 2.00  ? 1230 LEU B O     1 
ATOM   6073  C CB    . LEU B  1 199 ? 57.658  19.398  -8.507  1.00 3.60  ? 1230 LEU B CB    1 
ATOM   6074  C CG    . LEU B  1 199 ? 57.811  18.168  -7.616  1.00 10.69 ? 1230 LEU B CG    1 
ATOM   6075  C CD1   . LEU B  1 199 ? 57.464  16.907  -8.403  1.00 12.11 ? 1230 LEU B CD1   1 
ATOM   6076  C CD2   . LEU B  1 199 ? 59.238  18.090  -7.092  1.00 9.80  ? 1230 LEU B CD2   1 
ATOM   6077  N N     . ASN B  1 200 ? 57.442  23.038  -8.066  1.00 2.00  ? 1231 ASN B N     1 
ATOM   6078  C CA    . ASN B  1 200 ? 57.039  24.196  -8.827  1.00 5.77  ? 1231 ASN B CA    1 
ATOM   6079  C C     . ASN B  1 200 ? 58.152  24.542  -9.815  1.00 7.11  ? 1231 ASN B C     1 
ATOM   6080  O O     . ASN B  1 200 ? 57.929  25.238  -10.801 1.00 2.00  ? 1231 ASN B O     1 
ATOM   6081  C CB    . ASN B  1 200 ? 56.746  25.366  -7.882  1.00 7.20  ? 1231 ASN B CB    1 
ATOM   6082  C CG    . ASN B  1 200 ? 57.957  26.240  -7.624  1.00 11.24 ? 1231 ASN B CG    1 
ATOM   6083  O OD1   . ASN B  1 200 ? 58.538  26.839  -8.551  1.00 9.66  ? 1231 ASN B OD1   1 
ATOM   6084  N ND2   . ASN B  1 200 ? 58.341  26.334  -6.358  1.00 2.93  ? 1231 ASN B ND2   1 
ATOM   6085  N N     . HIS B  1 201 ? 59.357  24.040  -9.544  1.00 12.11 ? 1232 HIS B N     1 
ATOM   6086  C CA    . HIS B  1 201 ? 60.516  24.305  -10.405 1.00 11.36 ? 1232 HIS B CA    1 
ATOM   6087  C C     . HIS B  1 201 ? 60.401  23.509  -11.697 1.00 11.79 ? 1232 HIS B C     1 
ATOM   6088  O O     . HIS B  1 201 ? 61.077  23.799  -12.689 1.00 8.51  ? 1232 HIS B O     1 
ATOM   6089  C CB    . HIS B  1 201 ? 61.834  23.963  -9.685  1.00 10.35 ? 1232 HIS B CB    1 
ATOM   6090  C CG    . HIS B  1 201 ? 61.830  22.634  -9.004  1.00 12.37 ? 1232 HIS B CG    1 
ATOM   6091  N ND1   . HIS B  1 201 ? 62.340  21.495  -9.586  1.00 16.06 ? 1232 HIS B ND1   1 
ATOM   6092  C CD2   . HIS B  1 201 ? 61.384  22.259  -7.782  1.00 15.22 ? 1232 HIS B CD2   1 
ATOM   6093  C CE1   . HIS B  1 201 ? 62.211  20.475  -8.754  1.00 16.19 ? 1232 HIS B CE1   1 
ATOM   6094  N NE2   . HIS B  1 201 ? 61.632  20.911  -7.651  1.00 14.70 ? 1232 HIS B NE2   1 
ATOM   6095  N N     . ILE B  1 202 ? 59.536  22.504  -11.682 1.00 9.83  ? 1233 ILE B N     1 
ATOM   6096  C CA    . ILE B  1 202 ? 59.314  21.699  -12.866 1.00 10.23 ? 1233 ILE B CA    1 
ATOM   6097  C C     . ILE B  1 202 ? 58.081  22.170  -13.615 1.00 11.02 ? 1233 ILE B C     1 
ATOM   6098  O O     . ILE B  1 202 ? 58.042  22.110  -14.841 1.00 12.74 ? 1233 ILE B O     1 
ATOM   6099  C CB    . ILE B  1 202 ? 59.062  20.260  -12.524 1.00 8.24  ? 1233 ILE B CB    1 
ATOM   6100  C CG1   . ILE B  1 202 ? 60.261  19.694  -11.774 1.00 11.24 ? 1233 ILE B CG1   1 
ATOM   6101  C CG2   . ILE B  1 202 ? 58.753  19.491  -13.782 1.00 3.06  ? 1233 ILE B CG2   1 
ATOM   6102  C CD1   . ILE B  1 202 ? 59.864  18.588  -10.819 1.00 10.65 ? 1233 ILE B CD1   1 
ATOM   6103  N N     . TYR B  1 203 ? 57.074  22.628  -12.877 1.00 11.47 ? 1234 TYR B N     1 
ATOM   6104  C CA    . TYR B  1 203 ? 55.843  23.080  -13.505 1.00 9.08  ? 1234 TYR B CA    1 
ATOM   6105  C C     . TYR B  1 203 ? 55.504  24.556  -13.344 1.00 10.57 ? 1234 TYR B C     1 
ATOM   6106  O O     . TYR B  1 203 ? 54.393  24.956  -13.659 1.00 11.79 ? 1234 TYR B O     1 
ATOM   6107  C CB    . TYR B  1 203 ? 54.675  22.277  -12.974 1.00 4.65  ? 1234 TYR B CB    1 
ATOM   6108  C CG    . TYR B  1 203 ? 54.922  20.811  -12.825 1.00 2.00  ? 1234 TYR B CG    1 
ATOM   6109  C CD1   . TYR B  1 203 ? 54.819  19.956  -13.922 1.00 2.00  ? 1234 TYR B CD1   1 
ATOM   6110  C CD2   . TYR B  1 203 ? 55.156  20.258  -11.568 1.00 2.00  ? 1234 TYR B CD2   1 
ATOM   6111  C CE1   . TYR B  1 203 ? 54.931  18.575  -13.768 1.00 4.54  ? 1234 TYR B CE1   1 
ATOM   6112  C CE2   . TYR B  1 203 ? 55.271  18.885  -11.395 1.00 2.00  ? 1234 TYR B CE2   1 
ATOM   6113  C CZ    . TYR B  1 203 ? 55.153  18.045  -12.495 1.00 6.06  ? 1234 TYR B CZ    1 
ATOM   6114  O OH    . TYR B  1 203 ? 55.223  16.680  -12.319 1.00 6.27  ? 1234 TYR B OH    1 
ATOM   6115  N N     . GLY B  1 204 ? 56.431  25.367  -12.850 1.00 14.46 ? 1235 GLY B N     1 
ATOM   6116  C CA    . GLY B  1 204 ? 56.141  26.786  -12.676 1.00 13.31 ? 1235 GLY B CA    1 
ATOM   6117  C C     . GLY B  1 204 ? 55.308  27.014  -11.429 1.00 14.67 ? 1235 GLY B C     1 
ATOM   6118  O O     . GLY B  1 204 ? 54.709  26.071  -10.917 1.00 10.58 ? 1235 GLY B O     1 
ATOM   6119  N N     . GLU B  1 205 ? 55.266  28.246  -10.927 1.00 17.67 ? 1236 GLU B N     1 
ATOM   6120  C CA    . GLU B  1 205 ? 54.478  28.509  -9.729  1.00 21.51 ? 1236 GLU B CA    1 
ATOM   6121  C C     . GLU B  1 205 ? 53.053  28.814  -10.144 1.00 22.74 ? 1236 GLU B C     1 
ATOM   6122  O O     . GLU B  1 205 ? 52.113  28.241  -9.593  1.00 24.03 ? 1236 GLU B O     1 
ATOM   6123  C CB    . GLU B  1 205 ? 55.046  29.682  -8.926  1.00 25.12 ? 1236 GLU B CB    1 
ATOM   6124  C CG    . GLU B  1 205 ? 55.863  29.252  -7.710  1.00 31.59 ? 1236 GLU B CG    1 
ATOM   6125  C CD    . GLU B  1 205 ? 55.161  29.491  -6.381  1.00 38.04 ? 1236 GLU B CD    1 
ATOM   6126  O OE1   . GLU B  1 205 ? 55.507  28.785  -5.404  1.00 35.63 ? 1236 GLU B OE1   1 
ATOM   6127  O OE2   . GLU B  1 205 ? 54.274  30.377  -6.311  1.00 39.49 ? 1236 GLU B OE2   1 
ATOM   6128  N N     . THR B  1 206 ? 52.896  29.698  -11.128 1.00 22.79 ? 1237 THR B N     1 
ATOM   6129  C CA    . THR B  1 206 ? 51.567  30.067  -11.593 1.00 23.56 ? 1237 THR B CA    1 
ATOM   6130  C C     . THR B  1 206 ? 51.053  29.087  -12.623 1.00 25.47 ? 1237 THR B C     1 
ATOM   6131  O O     . THR B  1 206 ? 51.835  28.466  -13.348 1.00 21.20 ? 1237 THR B O     1 
ATOM   6132  C CB    . THR B  1 206 ? 51.536  31.484  -12.225 1.00 24.66 ? 1237 THR B CB    1 
ATOM   6133  O OG1   . THR B  1 206 ? 52.276  31.489  -13.457 1.00 24.99 ? 1237 THR B OG1   1 
ATOM   6134  C CG2   . THR B  1 206 ? 52.123  32.515  -11.261 1.00 24.48 ? 1237 THR B CG2   1 
ATOM   6135  N N     . LEU B  1 207 ? 49.726  28.964  -12.671 1.00 28.75 ? 1238 LEU B N     1 
ATOM   6136  C CA    . LEU B  1 207 ? 49.047  28.089  -13.615 1.00 31.25 ? 1238 LEU B CA    1 
ATOM   6137  C C     . LEU B  1 207 ? 49.437  28.511  -15.017 1.00 33.40 ? 1238 LEU B C     1 
ATOM   6138  O O     . LEU B  1 207 ? 49.826  27.682  -15.846 1.00 34.35 ? 1238 LEU B O     1 
ATOM   6139  C CB    . LEU B  1 207 ? 47.537  28.219  -13.463 1.00 31.16 ? 1238 LEU B CB    1 
ATOM   6140  C CG    . LEU B  1 207 ? 46.812  27.008  -12.886 1.00 34.94 ? 1238 LEU B CG    1 
ATOM   6141  C CD1   . LEU B  1 207 ? 45.378  27.411  -12.607 1.00 35.87 ? 1238 LEU B CD1   1 
ATOM   6142  C CD2   . LEU B  1 207 ? 46.858  25.830  -13.850 1.00 36.07 ? 1238 LEU B CD2   1 
ATOM   6143  N N     . ASP B  1 208 ? 49.326  29.814  -15.264 1.00 33.83 ? 1239 ASP B N     1 
ATOM   6144  C CA    . ASP B  1 208 ? 49.662  30.389  -16.553 1.00 37.94 ? 1239 ASP B CA    1 
ATOM   6145  C C     . ASP B  1 208 ? 50.929  29.743  -17.075 1.00 38.16 ? 1239 ASP B C     1 
ATOM   6146  O O     . ASP B  1 208 ? 50.954  29.171  -18.168 1.00 39.34 ? 1239 ASP B O     1 
ATOM   6147  C CB    . ASP B  1 208 ? 49.864  31.890  -16.410 1.00 41.85 ? 1239 ASP B CB    1 
ATOM   6148  C CG    . ASP B  1 208 ? 49.311  32.654  -17.586 1.00 51.48 ? 1239 ASP B CG    1 
ATOM   6149  O OD1   . ASP B  1 208 ? 48.458  33.545  -17.374 1.00 54.52 ? 1239 ASP B OD1   1 
ATOM   6150  O OD2   . ASP B  1 208 ? 49.731  32.355  -18.726 1.00 54.65 ? 1239 ASP B OD2   1 
ATOM   6151  N N     . ARG B  1 209 ? 51.979  29.830  -16.268 1.00 37.30 ? 1240 ARG B N     1 
ATOM   6152  C CA    . ARG B  1 209 ? 53.267  29.248  -16.608 1.00 35.35 ? 1240 ARG B CA    1 
ATOM   6153  C C     . ARG B  1 209 ? 53.068  27.755  -16.864 1.00 33.05 ? 1240 ARG B C     1 
ATOM   6154  O O     . ARG B  1 209 ? 53.304  27.250  -17.962 1.00 31.02 ? 1240 ARG B O     1 
ATOM   6155  C CB    . ARG B  1 209 ? 54.231  29.465  -15.440 1.00 41.88 ? 1240 ARG B CB    1 
ATOM   6156  C CG    . ARG B  1 209 ? 55.556  28.735  -15.542 1.00 45.32 ? 1240 ARG B CG    1 
ATOM   6157  C CD    . ARG B  1 209 ? 56.610  29.431  -14.682 1.00 51.76 ? 1240 ARG B CD    1 
ATOM   6158  N NE    . ARG B  1 209 ? 57.971  29.116  -15.110 1.00 57.83 ? 1240 ARG B NE    1 
ATOM   6159  C CZ    . ARG B  1 209 ? 58.772  29.966  -15.742 1.00 58.34 ? 1240 ARG B CZ    1 
ATOM   6160  N NH1   . ARG B  1 209 ? 58.357  31.193  -16.022 1.00 60.57 ? 1240 ARG B NH1   1 
ATOM   6161  N NH2   . ARG B  1 209 ? 59.986  29.581  -16.101 1.00 57.96 ? 1240 ARG B NH2   1 
ATOM   6162  N N     . GLN B  1 210 ? 52.605  27.064  -15.832 1.00 30.00 ? 1241 GLN B N     1 
ATOM   6163  C CA    . GLN B  1 210 ? 52.368  25.638  -15.895 1.00 27.47 ? 1241 GLN B CA    1 
ATOM   6164  C C     . GLN B  1 210 ? 51.745  25.199  -17.205 1.00 26.98 ? 1241 GLN B C     1 
ATOM   6165  O O     . GLN B  1 210 ? 52.170  24.219  -17.818 1.00 25.33 ? 1241 GLN B O     1 
ATOM   6166  C CB    . GLN B  1 210 ? 51.457  25.227  -14.739 1.00 27.33 ? 1241 GLN B CB    1 
ATOM   6167  C CG    . GLN B  1 210 ? 50.125  24.610  -15.163 1.00 28.16 ? 1241 GLN B CG    1 
ATOM   6168  C CD    . GLN B  1 210 ? 49.882  23.227  -14.557 1.00 29.64 ? 1241 GLN B CD    1 
ATOM   6169  O OE1   . GLN B  1 210 ? 49.211  22.389  -15.161 1.00 25.92 ? 1241 GLN B OE1   1 
ATOM   6170  N NE2   . GLN B  1 210 ? 50.425  22.988  -13.359 1.00 25.92 ? 1241 GLN B NE2   1 
ATOM   6171  N N     . HIS B  1 211 ? 50.732  25.938  -17.636 1.00 28.01 ? 1242 HIS B N     1 
ATOM   6172  C CA    . HIS B  1 211 ? 50.028  25.593  -18.856 1.00 27.95 ? 1242 HIS B CA    1 
ATOM   6173  C C     . HIS B  1 211 ? 50.905  25.696  -20.091 1.00 23.41 ? 1242 HIS B C     1 
ATOM   6174  O O     . HIS B  1 211 ? 50.776  24.896  -21.021 1.00 21.49 ? 1242 HIS B O     1 
ATOM   6175  C CB    . HIS B  1 211 ? 48.765  26.457  -18.990 1.00 30.94 ? 1242 HIS B CB    1 
ATOM   6176  C CG    . HIS B  1 211 ? 47.637  25.996  -18.115 1.00 35.97 ? 1242 HIS B CG    1 
ATOM   6177  N ND1   . HIS B  1 211 ? 47.445  24.669  -17.788 1.00 37.59 ? 1242 HIS B ND1   1 
ATOM   6178  C CD2   . HIS B  1 211 ? 46.682  26.687  -17.449 1.00 35.22 ? 1242 HIS B CD2   1 
ATOM   6179  C CE1   . HIS B  1 211 ? 46.424  24.563  -16.958 1.00 36.52 ? 1242 HIS B CE1   1 
ATOM   6180  N NE2   . HIS B  1 211 ? 45.944  25.773  -16.735 1.00 37.25 ? 1242 HIS B NE2   1 
ATOM   6181  N N     . LYS B  1 212 ? 51.801  26.671  -20.095 1.00 18.38 ? 1243 LYS B N     1 
ATOM   6182  C CA    . LYS B  1 212 ? 52.688  26.840  -21.227 1.00 15.64 ? 1243 LYS B CA    1 
ATOM   6183  C C     . LYS B  1 212 ? 53.708  25.710  -21.241 1.00 16.20 ? 1243 LYS B C     1 
ATOM   6184  O O     . LYS B  1 212 ? 54.192  25.301  -22.305 1.00 18.17 ? 1243 LYS B O     1 
ATOM   6185  C CB    . LYS B  1 212 ? 53.382  28.189  -21.146 1.00 13.15 ? 1243 LYS B CB    1 
ATOM   6186  C CG    . LYS B  1 212 ? 52.406  29.345  -20.992 1.00 13.79 ? 1243 LYS B CG    1 
ATOM   6187  C CD    . LYS B  1 212 ? 53.047  30.557  -20.331 1.00 13.18 ? 1243 LYS B CD    1 
ATOM   6188  C CE    . LYS B  1 212 ? 53.254  31.674  -21.341 1.00 11.50 ? 1243 LYS B CE    1 
ATOM   6189  N NZ    . LYS B  1 212 ? 53.048  33.024  -20.747 1.00 13.88 ? 1243 LYS B NZ    1 
ATOM   6190  N N     . LEU B  1 213 ? 54.026  25.193  -20.057 1.00 16.11 ? 1244 LEU B N     1 
ATOM   6191  C CA    . LEU B  1 213 ? 54.993  24.098  -19.952 1.00 17.73 ? 1244 LEU B CA    1 
ATOM   6192  C C     . LEU B  1 213 ? 54.276  22.788  -20.194 1.00 17.15 ? 1244 LEU B C     1 
ATOM   6193  O O     . LEU B  1 213 ? 54.895  21.717  -20.190 1.00 17.61 ? 1244 LEU B O     1 
ATOM   6194  C CB    . LEU B  1 213 ? 55.644  24.054  -18.563 1.00 13.42 ? 1244 LEU B CB    1 
ATOM   6195  C CG    . LEU B  1 213 ? 56.298  25.310  -17.980 1.00 9.25  ? 1244 LEU B CG    1 
ATOM   6196  C CD1   . LEU B  1 213 ? 56.823  24.975  -16.576 1.00 2.00  ? 1244 LEU B CD1   1 
ATOM   6197  C CD2   . LEU B  1 213 ? 57.413  25.798  -18.889 1.00 2.00  ? 1244 LEU B CD2   1 
ATOM   6198  N N     . ARG B  1 214 ? 52.963  22.882  -20.389 1.00 20.09 ? 1245 ARG B N     1 
ATOM   6199  C CA    . ARG B  1 214 ? 52.141  21.702  -20.622 1.00 21.19 ? 1245 ARG B CA    1 
ATOM   6200  C C     . ARG B  1 214 ? 51.884  21.508  -22.100 1.00 19.50 ? 1245 ARG B C     1 
ATOM   6201  O O     . ARG B  1 214 ? 51.765  22.474  -22.862 1.00 18.80 ? 1245 ARG B O     1 
ATOM   6202  C CB    . ARG B  1 214 ? 50.816  21.825  -19.879 1.00 22.38 ? 1245 ARG B CB    1 
ATOM   6203  C CG    . ARG B  1 214 ? 50.844  21.187  -18.516 1.00 27.08 ? 1245 ARG B CG    1 
ATOM   6204  C CD    . ARG B  1 214 ? 49.514  21.329  -17.820 1.00 32.72 ? 1245 ARG B CD    1 
ATOM   6205  N NE    . ARG B  1 214 ? 48.537  20.379  -18.337 1.00 38.40 ? 1245 ARG B NE    1 
ATOM   6206  C CZ    . ARG B  1 214 ? 47.337  20.171  -17.800 1.00 35.83 ? 1245 ARG B CZ    1 
ATOM   6207  N NH1   . ARG B  1 214 ? 46.963  20.851  -16.722 1.00 36.45 ? 1245 ARG B NH1   1 
ATOM   6208  N NH2   . ARG B  1 214 ? 46.506  19.288  -18.346 1.00 36.32 ? 1245 ARG B NH2   1 
ATOM   6209  N N     . LEU B  1 215 ? 51.797  20.248  -22.499 1.00 14.56 ? 1246 LEU B N     1 
ATOM   6210  C CA    . LEU B  1 215 ? 51.562  19.924  -23.891 1.00 13.39 ? 1246 LEU B CA    1 
ATOM   6211  C C     . LEU B  1 215 ? 50.074  19.671  -24.118 1.00 17.78 ? 1246 LEU B C     1 
ATOM   6212  O O     . LEU B  1 215 ? 49.572  19.795  -25.252 1.00 20.38 ? 1246 LEU B O     1 
ATOM   6213  C CB    . LEU B  1 215 ? 52.383  18.702  -24.260 1.00 9.07  ? 1246 LEU B CB    1 
ATOM   6214  C CG    . LEU B  1 215 ? 51.839  17.759  -25.316 1.00 9.56  ? 1246 LEU B CG    1 
ATOM   6215  C CD1   . LEU B  1 215 ? 52.188  18.291  -26.690 1.00 2.00  ? 1246 LEU B CD1   1 
ATOM   6216  C CD2   . LEU B  1 215 ? 52.422  16.369  -25.079 1.00 8.76  ? 1246 LEU B CD2   1 
ATOM   6217  N N     . PHE B  1 216 ? 49.372  19.352  -23.027 1.00 16.27 ? 1247 PHE B N     1 
ATOM   6218  C CA    . PHE B  1 216 ? 47.938  19.076  -23.059 1.00 9.53  ? 1247 PHE B CA    1 
ATOM   6219  C C     . PHE B  1 216 ? 47.620  17.907  -23.971 1.00 13.57 ? 1247 PHE B C     1 
ATOM   6220  O O     . PHE B  1 216 ? 46.880  18.018  -24.937 1.00 11.56 ? 1247 PHE B O     1 
ATOM   6221  C CB    . PHE B  1 216 ? 47.195  20.306  -23.500 1.00 3.35  ? 1247 PHE B CB    1 
ATOM   6222  C CG    . PHE B  1 216 ? 47.244  21.401  -22.506 1.00 2.00  ? 1247 PHE B CG    1 
ATOM   6223  C CD1   . PHE B  1 216 ? 47.686  22.668  -22.873 1.00 4.78  ? 1247 PHE B CD1   1 
ATOM   6224  C CD2   . PHE B  1 216 ? 46.812  21.180  -21.201 1.00 2.00  ? 1247 PHE B CD2   1 
ATOM   6225  C CE1   . PHE B  1 216 ? 47.693  23.721  -21.945 1.00 9.58  ? 1247 PHE B CE1   1 
ATOM   6226  C CE2   . PHE B  1 216 ? 46.809  22.208  -20.265 1.00 2.00  ? 1247 PHE B CE2   1 
ATOM   6227  C CZ    . PHE B  1 216 ? 47.250  23.491  -20.633 1.00 6.90  ? 1247 PHE B CZ    1 
ATOM   6228  N N     . LYS B  1 217 ? 48.217  16.776  -23.631 1.00 17.81 ? 1248 LYS B N     1 
ATOM   6229  C CA    . LYS B  1 217 ? 48.053  15.541  -24.350 1.00 22.46 ? 1248 LYS B CA    1 
ATOM   6230  C C     . LYS B  1 217 ? 48.695  14.543  -23.428 1.00 23.29 ? 1248 LYS B C     1 
ATOM   6231  O O     . LYS B  1 217 ? 49.870  14.681  -23.095 1.00 22.72 ? 1248 LYS B O     1 
ATOM   6232  C CB    . LYS B  1 217 ? 48.820  15.585  -25.666 1.00 27.31 ? 1248 LYS B CB    1 
ATOM   6233  C CG    . LYS B  1 217 ? 47.939  15.670  -26.892 1.00 35.49 ? 1248 LYS B CG    1 
ATOM   6234  C CD    . LYS B  1 217 ? 48.579  16.558  -27.946 1.00 39.28 ? 1248 LYS B CD    1 
ATOM   6235  C CE    . LYS B  1 217 ? 48.525  18.022  -27.543 1.00 41.67 ? 1248 LYS B CE    1 
ATOM   6236  N NZ    . LYS B  1 217 ? 48.803  18.913  -28.710 1.00 45.05 ? 1248 LYS B NZ    1 
ATOM   6237  N N     . ASP B  1 218 ? 47.925  13.552  -23.001 1.00 24.62 ? 1249 ASP B N     1 
ATOM   6238  C CA    . ASP B  1 218 ? 48.454  12.532  -22.108 1.00 24.17 ? 1249 ASP B CA    1 
ATOM   6239  C C     . ASP B  1 218 ? 49.086  13.181  -20.878 1.00 24.94 ? 1249 ASP B C     1 
ATOM   6240  O O     . ASP B  1 218 ? 49.961  12.602  -20.243 1.00 26.95 ? 1249 ASP B O     1 
ATOM   6241  C CB    . ASP B  1 218 ? 49.491  11.688  -22.854 1.00 21.97 ? 1249 ASP B CB    1 
ATOM   6242  C CG    . ASP B  1 218 ? 49.093  11.418  -24.302 1.00 25.03 ? 1249 ASP B CG    1 
ATOM   6243  O OD1   . ASP B  1 218 ? 48.709  10.266  -24.610 1.00 22.25 ? 1249 ASP B OD1   1 
ATOM   6244  O OD2   . ASP B  1 218 ? 49.162  12.356  -25.130 1.00 25.37 ? 1249 ASP B OD2   1 
ATOM   6245  N N     . GLY B  1 219 ? 48.635  14.393  -20.556 1.00 27.81 ? 1250 GLY B N     1 
ATOM   6246  C CA    . GLY B  1 219 ? 49.157  15.114  -19.405 1.00 30.11 ? 1250 GLY B CA    1 
ATOM   6247  C C     . GLY B  1 219 ? 50.667  15.291  -19.424 1.00 27.84 ? 1250 GLY B C     1 
ATOM   6248  O O     . GLY B  1 219 ? 51.310  15.388  -18.383 1.00 28.51 ? 1250 GLY B O     1 
ATOM   6249  N N     . LYS B  1 220 ? 51.240  15.340  -20.613 1.00 27.01 ? 1251 LYS B N     1 
ATOM   6250  C CA    . LYS B  1 220 ? 52.674  15.491  -20.740 1.00 25.49 ? 1251 LYS B CA    1 
ATOM   6251  C C     . LYS B  1 220 ? 53.136  16.948  -20.790 1.00 27.97 ? 1251 LYS B C     1 
ATOM   6252  O O     . LYS B  1 220 ? 52.398  17.848  -21.242 1.00 27.94 ? 1251 LYS B O     1 
ATOM   6253  C CB    . LYS B  1 220 ? 53.164  14.769  -21.997 1.00 22.53 ? 1251 LYS B CB    1 
ATOM   6254  C CG    . LYS B  1 220 ? 53.438  13.294  -21.786 1.00 25.42 ? 1251 LYS B CG    1 
ATOM   6255  C CD    . LYS B  1 220 ? 53.400  12.558  -23.113 1.00 27.53 ? 1251 LYS B CD    1 
ATOM   6256  C CE    . LYS B  1 220 ? 53.879  11.121  -22.993 1.00 25.63 ? 1251 LYS B CE    1 
ATOM   6257  N NZ    . LYS B  1 220 ? 53.673  10.380  -24.281 1.00 26.10 ? 1251 LYS B NZ    1 
ATOM   6258  N N     . LEU B  1 221 ? 54.368  17.163  -20.317 1.00 24.58 ? 1252 LEU B N     1 
ATOM   6259  C CA    . LEU B  1 221 ? 54.986  18.482  -20.323 1.00 21.41 ? 1252 LEU B CA    1 
ATOM   6260  C C     . LEU B  1 221 ? 55.588  18.660  -21.694 1.00 18.48 ? 1252 LEU B C     1 
ATOM   6261  O O     . LEU B  1 221 ? 56.199  17.741  -22.241 1.00 14.62 ? 1252 LEU B O     1 
ATOM   6262  C CB    . LEU B  1 221 ? 56.090  18.573  -19.274 1.00 20.89 ? 1252 LEU B CB    1 
ATOM   6263  C CG    . LEU B  1 221 ? 55.607  19.037  -17.895 1.00 23.36 ? 1252 LEU B CG    1 
ATOM   6264  C CD1   . LEU B  1 221 ? 56.361  18.274  -16.813 1.00 20.93 ? 1252 LEU B CD1   1 
ATOM   6265  C CD2   . LEU B  1 221 ? 55.802  20.547  -17.751 1.00 16.81 ? 1252 LEU B CD2   1 
ATOM   6266  N N     . LYS B  1 222 ? 55.386  19.838  -22.261 1.00 18.04 ? 1253 LYS B N     1 
ATOM   6267  C CA    . LYS B  1 222 ? 55.921  20.120  -23.567 1.00 18.35 ? 1253 LYS B CA    1 
ATOM   6268  C C     . LYS B  1 222 ? 57.415  19.821  -23.515 1.00 23.23 ? 1253 LYS B C     1 
ATOM   6269  O O     . LYS B  1 222 ? 58.097  20.186  -22.552 1.00 24.74 ? 1253 LYS B O     1 
ATOM   6270  C CB    . LYS B  1 222 ? 55.706  21.586  -23.912 1.00 20.96 ? 1253 LYS B CB    1 
ATOM   6271  C CG    . LYS B  1 222 ? 54.313  21.939  -24.311 1.00 21.63 ? 1253 LYS B CG    1 
ATOM   6272  C CD    . LYS B  1 222 ? 54.344  22.946  -25.439 1.00 23.95 ? 1253 LYS B CD    1 
ATOM   6273  C CE    . LYS B  1 222 ? 53.780  24.288  -25.006 1.00 27.27 ? 1253 LYS B CE    1 
ATOM   6274  N NZ    . LYS B  1 222 ? 53.419  25.162  -26.181 1.00 30.58 ? 1253 LYS B NZ    1 
ATOM   6275  N N     . TYR B  1 223 ? 57.920  19.147  -24.543 1.00 26.52 ? 1254 TYR B N     1 
ATOM   6276  C CA    . TYR B  1 223 ? 59.336  18.827  -24.609 1.00 25.89 ? 1254 TYR B CA    1 
ATOM   6277  C C     . TYR B  1 223 ? 59.885  19.127  -26.004 1.00 26.69 ? 1254 TYR B C     1 
ATOM   6278  O O     . TYR B  1 223 ? 59.239  19.819  -26.785 1.00 27.07 ? 1254 TYR B O     1 
ATOM   6279  C CB    . TYR B  1 223 ? 59.566  17.359  -24.226 1.00 24.23 ? 1254 TYR B CB    1 
ATOM   6280  C CG    . TYR B  1 223 ? 58.973  16.331  -25.158 1.00 26.28 ? 1254 TYR B CG    1 
ATOM   6281  C CD1   . TYR B  1 223 ? 59.030  16.491  -26.547 1.00 28.95 ? 1254 TYR B CD1   1 
ATOM   6282  C CD2   . TYR B  1 223 ? 58.407  15.164  -24.650 1.00 29.36 ? 1254 TYR B CD2   1 
ATOM   6283  C CE1   . TYR B  1 223 ? 58.545  15.514  -27.409 1.00 31.65 ? 1254 TYR B CE1   1 
ATOM   6284  C CE2   . TYR B  1 223 ? 57.918  14.175  -25.496 1.00 31.63 ? 1254 TYR B CE2   1 
ATOM   6285  C CZ    . TYR B  1 223 ? 57.992  14.352  -26.879 1.00 31.96 ? 1254 TYR B CZ    1 
ATOM   6286  O OH    . TYR B  1 223 ? 57.542  13.362  -27.731 1.00 31.39 ? 1254 TYR B OH    1 
ATOM   6287  N N     . GLN B  1 224 ? 61.071  18.604  -26.313 1.00 27.98 ? 1255 GLN B N     1 
ATOM   6288  C CA    . GLN B  1 224 ? 61.699  18.826  -27.613 1.00 26.79 ? 1255 GLN B CA    1 
ATOM   6289  C C     . GLN B  1 224 ? 62.822  17.827  -27.832 1.00 25.12 ? 1255 GLN B C     1 
ATOM   6290  O O     . GLN B  1 224 ? 63.545  17.479  -26.901 1.00 24.75 ? 1255 GLN B O     1 
ATOM   6291  C CB    . GLN B  1 224 ? 62.249  20.247  -27.699 1.00 26.47 ? 1255 GLN B CB    1 
ATOM   6292  C CG    . GLN B  1 224 ? 63.617  20.421  -27.097 1.00 23.47 ? 1255 GLN B CG    1 
ATOM   6293  C CD    . GLN B  1 224 ? 64.265  21.710  -27.554 1.00 27.89 ? 1255 GLN B CD    1 
ATOM   6294  O OE1   . GLN B  1 224 ? 64.254  22.033  -28.744 1.00 26.35 ? 1255 GLN B OE1   1 
ATOM   6295  N NE2   . GLN B  1 224 ? 64.830  22.462  -26.610 1.00 26.14 ? 1255 GLN B NE2   1 
ATOM   6296  N N     . VAL B  1 225 ? 62.963  17.362  -29.064 1.00 24.44 ? 1256 VAL B N     1 
ATOM   6297  C CA    . VAL B  1 225 ? 63.995  16.390  -29.364 1.00 27.02 ? 1256 VAL B CA    1 
ATOM   6298  C C     . VAL B  1 225 ? 65.151  16.973  -30.161 1.00 28.99 ? 1256 VAL B C     1 
ATOM   6299  O O     . VAL B  1 225 ? 64.980  17.427  -31.301 1.00 27.54 ? 1256 VAL B O     1 
ATOM   6300  C CB    . VAL B  1 225 ? 63.425  15.185  -30.135 1.00 25.30 ? 1256 VAL B CB    1 
ATOM   6301  C CG1   . VAL B  1 225 ? 64.560  14.361  -30.734 1.00 28.51 ? 1256 VAL B CG1   1 
ATOM   6302  C CG2   . VAL B  1 225 ? 62.590  14.330  -29.210 1.00 28.38 ? 1256 VAL B CG2   1 
ATOM   6303  N N     . ILE B  1 226 ? 66.331  16.957  -29.545 1.00 29.74 ? 1257 ILE B N     1 
ATOM   6304  C CA    . ILE B  1 226 ? 67.535  17.453  -30.188 1.00 29.01 ? 1257 ILE B CA    1 
ATOM   6305  C C     . ILE B  1 226 ? 68.480  16.283  -30.310 1.00 28.92 ? 1257 ILE B C     1 
ATOM   6306  O O     . ILE B  1 226 ? 68.732  15.574  -29.334 1.00 29.15 ? 1257 ILE B O     1 
ATOM   6307  C CB    . ILE B  1 226 ? 68.219  18.556  -29.374 1.00 28.74 ? 1257 ILE B CB    1 
ATOM   6308  C CG1   . ILE B  1 226 ? 67.166  19.452  -28.717 1.00 28.71 ? 1257 ILE B CG1   1 
ATOM   6309  C CG2   . ILE B  1 226 ? 69.118  19.363  -30.284 1.00 30.12 ? 1257 ILE B CG2   1 
ATOM   6310  C CD1   . ILE B  1 226 ? 67.619  20.892  -28.470 1.00 25.66 ? 1257 ILE B CD1   1 
ATOM   6311  N N     . GLY B  1 227 ? 68.986  16.074  -31.517 1.00 27.27 ? 1258 GLY B N     1 
ATOM   6312  C CA    . GLY B  1 227 ? 69.901  14.978  -31.736 1.00 26.15 ? 1258 GLY B CA    1 
ATOM   6313  C C     . GLY B  1 227 ? 69.395  13.682  -31.146 1.00 25.59 ? 1258 GLY B C     1 
ATOM   6314  O O     . GLY B  1 227 ? 70.138  12.964  -30.488 1.00 26.22 ? 1258 GLY B O     1 
ATOM   6315  N N     . GLY B  1 228 ? 68.122  13.388  -31.366 1.00 27.15 ? 1259 GLY B N     1 
ATOM   6316  C CA    . GLY B  1 228 ? 67.558  12.152  -30.858 1.00 28.93 ? 1259 GLY B CA    1 
ATOM   6317  C C     . GLY B  1 228 ? 67.431  12.085  -29.352 1.00 26.72 ? 1259 GLY B C     1 
ATOM   6318  O O     . GLY B  1 228 ? 67.243  10.998  -28.804 1.00 25.20 ? 1259 GLY B O     1 
ATOM   6319  N N     . GLU B  1 229 ? 67.520  13.230  -28.686 1.00 24.78 ? 1260 GLU B N     1 
ATOM   6320  C CA    . GLU B  1 229 ? 67.405  13.252  -27.238 1.00 28.90 ? 1260 GLU B CA    1 
ATOM   6321  C C     . GLU B  1 229 ? 66.291  14.164  -26.744 1.00 31.23 ? 1260 GLU B C     1 
ATOM   6322  O O     . GLU B  1 229 ? 66.014  15.198  -27.352 1.00 32.79 ? 1260 GLU B O     1 
ATOM   6323  C CB    . GLU B  1 229 ? 68.726  13.681  -26.613 1.00 29.32 ? 1260 GLU B CB    1 
ATOM   6324  C CG    . GLU B  1 229 ? 69.799  12.613  -26.669 1.00 28.57 ? 1260 GLU B CG    1 
ATOM   6325  C CD    . GLU B  1 229 ? 69.500  11.418  -25.788 1.00 27.16 ? 1260 GLU B CD    1 
ATOM   6326  O OE1   . GLU B  1 229 ? 68.916  10.445  -26.291 1.00 24.65 ? 1260 GLU B OE1   1 
ATOM   6327  O OE2   . GLU B  1 229 ? 69.857  11.443  -24.594 1.00 28.82 ? 1260 GLU B OE2   1 
ATOM   6328  N N     . VAL B  1 230 ? 65.670  13.773  -25.631 1.00 33.35 ? 1261 VAL B N     1 
ATOM   6329  C CA    . VAL B  1 230 ? 64.574  14.534  -25.020 1.00 34.29 ? 1261 VAL B CA    1 
ATOM   6330  C C     . VAL B  1 230 ? 65.083  15.692  -24.168 1.00 33.95 ? 1261 VAL B C     1 
ATOM   6331  O O     . VAL B  1 230 ? 65.813  15.495  -23.204 1.00 33.67 ? 1261 VAL B O     1 
ATOM   6332  C CB    . VAL B  1 230 ? 63.708  13.640  -24.109 1.00 36.75 ? 1261 VAL B CB    1 
ATOM   6333  C CG1   . VAL B  1 230 ? 62.619  14.476  -23.447 1.00 35.90 ? 1261 VAL B CG1   1 
ATOM   6334  C CG2   . VAL B  1 230 ? 63.110  12.495  -24.909 1.00 35.38 ? 1261 VAL B CG2   1 
ATOM   6335  N N     . TYR B  1 231 ? 64.663  16.899  -24.505 1.00 33.88 ? 1262 TYR B N     1 
ATOM   6336  C CA    . TYR B  1 231 ? 65.109  18.061  -23.765 1.00 34.36 ? 1262 TYR B CA    1 
ATOM   6337  C C     . TYR B  1 231 ? 63.981  19.048  -23.510 1.00 30.42 ? 1262 TYR B C     1 
ATOM   6338  O O     . TYR B  1 231 ? 62.970  19.063  -24.211 1.00 27.99 ? 1262 TYR B O     1 
ATOM   6339  C CB    . TYR B  1 231 ? 66.216  18.788  -24.545 1.00 46.97 ? 1262 TYR B CB    1 
ATOM   6340  C CG    . TYR B  1 231 ? 67.582  18.143  -24.482 1.00 53.16 ? 1262 TYR B CG    1 
ATOM   6341  C CD1   . TYR B  1 231 ? 68.096  17.435  -25.571 1.00 54.10 ? 1262 TYR B CD1   1 
ATOM   6342  C CD2   . TYR B  1 231 ? 68.360  18.238  -23.330 1.00 54.21 ? 1262 TYR B CD2   1 
ATOM   6343  C CE1   . TYR B  1 231 ? 69.355  16.837  -25.508 1.00 58.88 ? 1262 TYR B CE1   1 
ATOM   6344  C CE2   . TYR B  1 231 ? 69.617  17.646  -23.255 1.00 56.89 ? 1262 TYR B CE2   1 
ATOM   6345  C CZ    . TYR B  1 231 ? 70.112  16.945  -24.343 1.00 59.34 ? 1262 TYR B CZ    1 
ATOM   6346  O OH    . TYR B  1 231 ? 71.358  16.355  -24.256 1.00 58.16 ? 1262 TYR B OH    1 
ATOM   6347  N N     . PRO B  1 232 ? 64.137  19.883  -22.481 1.00 31.28 ? 1263 PRO B N     1 
ATOM   6348  C CA    . PRO B  1 232 ? 63.083  20.862  -22.214 1.00 24.81 ? 1263 PRO B CA    1 
ATOM   6349  C C     . PRO B  1 232 ? 62.840  21.607  -23.531 1.00 23.97 ? 1263 PRO B C     1 
ATOM   6350  O O     . PRO B  1 232 ? 63.664  21.554  -24.439 1.00 24.66 ? 1263 PRO B O     1 
ATOM   6351  C CB    . PRO B  1 232 ? 63.695  21.763  -21.143 1.00 22.78 ? 1263 PRO B CB    1 
ATOM   6352  C CG    . PRO B  1 232 ? 64.693  20.882  -20.454 1.00 26.88 ? 1263 PRO B CG    1 
ATOM   6353  C CD    . PRO B  1 232 ? 65.238  19.961  -21.507 1.00 27.67 ? 1263 PRO B CD    1 
ATOM   6354  N N     . PRO B  1 233 ? 61.711  22.311  -23.653 1.00 28.50 ? 1264 PRO B N     1 
ATOM   6355  C CA    . PRO B  1 233 ? 61.418  23.040  -24.886 1.00 22.80 ? 1264 PRO B CA    1 
ATOM   6356  C C     . PRO B  1 233 ? 61.862  24.492  -24.824 1.00 21.42 ? 1264 PRO B C     1 
ATOM   6357  O O     . PRO B  1 233 ? 62.208  24.996  -23.755 1.00 23.52 ? 1264 PRO B O     1 
ATOM   6358  C CB    . PRO B  1 233 ? 59.907  22.892  -25.012 1.00 23.76 ? 1264 PRO B CB    1 
ATOM   6359  C CG    . PRO B  1 233 ? 59.407  22.679  -23.565 1.00 22.66 ? 1264 PRO B CG    1 
ATOM   6360  C CD    . PRO B  1 233 ? 60.621  22.474  -22.676 1.00 27.86 ? 1264 PRO B CD    1 
ATOM   6361  N N     . THR B  1 234 ? 61.826  25.165  -25.970 1.00 22.74 ? 1265 THR B N     1 
ATOM   6362  C CA    . THR B  1 234 ? 62.259  26.564  -26.067 1.00 23.35 ? 1265 THR B CA    1 
ATOM   6363  C C     . THR B  1 234 ? 61.329  27.649  -25.538 1.00 24.10 ? 1265 THR B C     1 
ATOM   6364  O O     . THR B  1 234 ? 60.118  27.483  -25.458 1.00 25.72 ? 1265 THR B O     1 
ATOM   6365  C CB    . THR B  1 234 ? 62.562  26.960  -27.512 1.00 24.87 ? 1265 THR B CB    1 
ATOM   6366  O OG1   . THR B  1 234 ? 61.632  27.979  -27.920 1.00 23.06 ? 1265 THR B OG1   1 
ATOM   6367  C CG2   . THR B  1 234 ? 62.479  25.730  -28.442 1.00 26.73 ? 1265 THR B CG2   1 
ATOM   6368  N N     . VAL B  1 235 ? 61.925  28.784  -25.206 1.00 23.47 ? 1266 VAL B N     1 
ATOM   6369  C CA    . VAL B  1 235 ? 61.187  29.926  -24.712 1.00 26.09 ? 1266 VAL B CA    1 
ATOM   6370  C C     . VAL B  1 235 ? 60.409  30.528  -25.856 1.00 27.19 ? 1266 VAL B C     1 
ATOM   6371  O O     . VAL B  1 235 ? 59.355  31.114  -25.646 1.00 30.80 ? 1266 VAL B O     1 
ATOM   6372  C CB    . VAL B  1 235 ? 62.134  31.013  -24.188 1.00 25.73 ? 1266 VAL B CB    1 
ATOM   6373  C CG1   . VAL B  1 235 ? 61.353  32.292  -23.909 1.00 30.04 ? 1266 VAL B CG1   1 
ATOM   6374  C CG2   . VAL B  1 235 ? 62.850  30.522  -22.933 1.00 27.88 ? 1266 VAL B CG2   1 
ATOM   6375  N N     . LYS B  1 236 ? 60.941  30.390  -27.067 1.00 31.17 ? 1267 LYS B N     1 
ATOM   6376  C CA    . LYS B  1 236 ? 60.304  30.950  -28.252 1.00 35.42 ? 1267 LYS B CA    1 
ATOM   6377  C C     . LYS B  1 236 ? 59.075  30.161  -28.692 1.00 36.60 ? 1267 LYS B C     1 
ATOM   6378  O O     . LYS B  1 236 ? 58.326  30.601  -29.562 1.00 40.48 ? 1267 LYS B O     1 
ATOM   6379  C CB    . LYS B  1 236 ? 61.318  31.026  -29.394 1.00 35.57 ? 1267 LYS B CB    1 
ATOM   6380  C CG    . LYS B  1 236 ? 60.754  31.475  -30.733 1.00 35.96 ? 1267 LYS B CG    1 
ATOM   6381  C CD    . LYS B  1 236 ? 61.418  30.710  -31.860 1.00 35.17 ? 1267 LYS B CD    1 
ATOM   6382  C CE    . LYS B  1 236 ? 60.640  30.805  -33.144 1.00 38.10 ? 1267 LYS B CE    1 
ATOM   6383  N NZ    . LYS B  1 236 ? 61.575  30.891  -34.308 1.00 36.05 ? 1267 LYS B NZ    1 
ATOM   6384  N N     . ASP B  1 237 ? 58.855  29.006  -28.077 1.00 38.46 ? 1268 ASP B N     1 
ATOM   6385  C CA    . ASP B  1 237 ? 57.706  28.177  -28.429 1.00 38.68 ? 1268 ASP B CA    1 
ATOM   6386  C C     . ASP B  1 237 ? 56.678  28.069  -27.318 1.00 37.06 ? 1268 ASP B C     1 
ATOM   6387  O O     . ASP B  1 237 ? 55.567  27.597  -27.540 1.00 36.92 ? 1268 ASP B O     1 
ATOM   6388  C CB    . ASP B  1 237 ? 58.175  26.781  -28.808 1.00 45.86 ? 1268 ASP B CB    1 
ATOM   6389  C CG    . ASP B  1 237 ? 59.436  26.811  -29.632 1.00 56.25 ? 1268 ASP B CG    1 
ATOM   6390  O OD1   . ASP B  1 237 ? 59.772  27.899  -30.158 1.00 60.52 ? 1268 ASP B OD1   1 
ATOM   6391  O OD2   . ASP B  1 237 ? 60.091  25.751  -29.752 1.00 60.00 ? 1268 ASP B OD2   1 
ATOM   6392  N N     . THR B  1 238 ? 57.054  28.495  -26.120 1.00 31.27 ? 1269 THR B N     1 
ATOM   6393  C CA    . THR B  1 238 ? 56.156  28.434  -24.978 1.00 27.12 ? 1269 THR B CA    1 
ATOM   6394  C C     . THR B  1 238 ? 56.009  29.802  -24.347 1.00 27.70 ? 1269 THR B C     1 
ATOM   6395  O O     . THR B  1 238 ? 55.211  29.987  -23.439 1.00 29.96 ? 1269 THR B O     1 
ATOM   6396  C CB    . THR B  1 238 ? 56.689  27.513  -23.911 1.00 25.53 ? 1269 THR B CB    1 
ATOM   6397  O OG1   . THR B  1 238 ? 57.781  28.164  -23.250 1.00 24.31 ? 1269 THR B OG1   1 
ATOM   6398  C CG2   . THR B  1 238 ? 57.161  26.203  -24.528 1.00 26.28 ? 1269 THR B CG2   1 
ATOM   6399  N N     . GLN B  1 239 ? 56.798  30.757  -24.817 1.00 29.77 ? 1270 GLN B N     1 
ATOM   6400  C CA    . GLN B  1 239 ? 56.747  32.109  -24.295 1.00 30.36 ? 1270 GLN B CA    1 
ATOM   6401  C C     . GLN B  1 239 ? 56.950  32.131  -22.790 1.00 28.87 ? 1270 GLN B C     1 
ATOM   6402  O O     . GLN B  1 239 ? 56.777  33.163  -22.156 1.00 31.43 ? 1270 GLN B O     1 
ATOM   6403  C CB    . GLN B  1 239 ? 55.412  32.755  -24.641 1.00 34.99 ? 1270 GLN B CB    1 
ATOM   6404  C CG    . GLN B  1 239 ? 55.347  33.338  -26.042 1.00 40.96 ? 1270 GLN B CG    1 
ATOM   6405  C CD    . GLN B  1 239 ? 55.901  32.393  -27.100 1.00 46.48 ? 1270 GLN B CD    1 
ATOM   6406  O OE1   . GLN B  1 239 ? 55.776  31.164  -26.989 1.00 41.61 ? 1270 GLN B OE1   1 
ATOM   6407  N NE2   . GLN B  1 239 ? 56.513  32.964  -28.138 1.00 43.22 ? 1270 GLN B NE2   1 
ATOM   6408  N N     . VAL B  1 240 ? 57.320  30.989  -22.223 1.00 28.04 ? 1271 VAL B N     1 
ATOM   6409  C CA    . VAL B  1 240 ? 57.566  30.895  -20.793 1.00 30.05 ? 1271 VAL B CA    1 
ATOM   6410  C C     . VAL B  1 240 ? 58.653  31.882  -20.377 1.00 33.05 ? 1271 VAL B C     1 
ATOM   6411  O O     . VAL B  1 240 ? 59.547  32.198  -21.155 1.00 34.28 ? 1271 VAL B O     1 
ATOM   6412  C CB    . VAL B  1 240 ? 58.025  29.481  -20.411 1.00 30.19 ? 1271 VAL B CB    1 
ATOM   6413  C CG1   . VAL B  1 240 ? 58.529  29.454  -18.964 1.00 26.91 ? 1271 VAL B CG1   1 
ATOM   6414  C CG2   . VAL B  1 240 ? 56.870  28.503  -20.600 1.00 29.93 ? 1271 VAL B CG2   1 
ATOM   6415  N N     . GLU B  1 241 ? 58.573  32.356  -19.139 1.00 39.01 ? 1272 GLU B N     1 
ATOM   6416  C CA    . GLU B  1 241 ? 59.537  33.314  -18.610 1.00 44.89 ? 1272 GLU B CA    1 
ATOM   6417  C C     . GLU B  1 241 ? 60.814  32.627  -18.138 1.00 45.35 ? 1272 GLU B C     1 
ATOM   6418  O O     . GLU B  1 241 ? 60.781  31.840  -17.190 1.00 47.78 ? 1272 GLU B O     1 
ATOM   6419  C CB    . GLU B  1 241 ? 58.920  34.080  -17.436 1.00 52.28 ? 1272 GLU B CB    1 
ATOM   6420  C CG    . GLU B  1 241 ? 57.913  35.141  -17.842 1.00 61.18 ? 1272 GLU B CG    1 
ATOM   6421  C CD    . GLU B  1 241 ? 58.537  36.245  -18.662 1.00 68.36 ? 1272 GLU B CD    1 
ATOM   6422  O OE1   . GLU B  1 241 ? 58.851  35.999  -19.847 1.00 69.96 ? 1272 GLU B OE1   1 
ATOM   6423  O OE2   . GLU B  1 241 ? 58.712  37.356  -18.121 1.00 70.71 ? 1272 GLU B OE2   1 
ATOM   6424  N N     . MET B  1 242 ? 61.934  32.928  -18.794 1.00 43.53 ? 1273 MET B N     1 
ATOM   6425  C CA    . MET B  1 242 ? 63.225  32.343  -18.430 1.00 39.82 ? 1273 MET B CA    1 
ATOM   6426  C C     . MET B  1 242 ? 64.305  33.420  -18.322 1.00 38.48 ? 1273 MET B C     1 
ATOM   6427  O O     . MET B  1 242 ? 64.428  34.273  -19.204 1.00 38.19 ? 1273 MET B O     1 
ATOM   6428  C CB    . MET B  1 242 ? 63.644  31.307  -19.473 1.00 36.58 ? 1273 MET B CB    1 
ATOM   6429  C CG    . MET B  1 242 ? 62.996  29.949  -19.278 1.00 35.11 ? 1273 MET B CG    1 
ATOM   6430  S SD    . MET B  1 242 ? 63.146  29.386  -17.580 1.00 36.82 ? 1273 MET B SD    1 
ATOM   6431  C CE    . MET B  1 242 ? 63.824  27.779  -17.830 1.00 31.65 ? 1273 MET B CE    1 
ATOM   6432  N N     . ILE B  1 243 ? 65.081  33.374  -17.239 1.00 38.37 ? 1274 ILE B N     1 
ATOM   6433  C CA    . ILE B  1 243 ? 66.164  34.336  -17.000 1.00 38.71 ? 1274 ILE B CA    1 
ATOM   6434  C C     . ILE B  1 243 ? 67.421  33.937  -17.776 1.00 37.50 ? 1274 ILE B C     1 
ATOM   6435  O O     . ILE B  1 243 ? 68.122  33.002  -17.399 1.00 35.51 ? 1274 ILE B O     1 
ATOM   6436  C CB    . ILE B  1 243 ? 66.530  34.421  -15.502 1.00 35.58 ? 1274 ILE B CB    1 
ATOM   6437  C CG1   . ILE B  1 243 ? 65.371  33.910  -14.648 1.00 36.36 ? 1274 ILE B CG1   1 
ATOM   6438  C CG2   . ILE B  1 243 ? 66.829  35.854  -15.124 1.00 37.06 ? 1274 ILE B CG2   1 
ATOM   6439  C CD1   . ILE B  1 243 ? 65.668  33.869  -13.175 1.00 32.85 ? 1274 ILE B CD1   1 
ATOM   6440  N N     . TYR B  1 244 ? 67.701  34.665  -18.854 1.00 37.13 ? 1275 TYR B N     1 
ATOM   6441  C CA    . TYR B  1 244 ? 68.850  34.385  -19.706 1.00 37.52 ? 1275 TYR B CA    1 
ATOM   6442  C C     . TYR B  1 244 ? 69.616  35.648  -20.112 1.00 38.93 ? 1275 TYR B C     1 
ATOM   6443  O O     . TYR B  1 244 ? 69.061  36.749  -20.152 1.00 36.56 ? 1275 TYR B O     1 
ATOM   6444  C CB    . TYR B  1 244 ? 68.396  33.666  -20.985 1.00 35.68 ? 1275 TYR B CB    1 
ATOM   6445  C CG    . TYR B  1 244 ? 68.142  32.187  -20.833 1.00 35.99 ? 1275 TYR B CG    1 
ATOM   6446  C CD1   . TYR B  1 244 ? 68.744  31.456  -19.809 1.00 39.38 ? 1275 TYR B CD1   1 
ATOM   6447  C CD2   . TYR B  1 244 ? 67.309  31.511  -21.724 1.00 37.02 ? 1275 TYR B CD2   1 
ATOM   6448  C CE1   . TYR B  1 244 ? 68.528  30.094  -19.679 1.00 36.34 ? 1275 TYR B CE1   1 
ATOM   6449  C CE2   . TYR B  1 244 ? 67.085  30.146  -21.601 1.00 34.60 ? 1275 TYR B CE2   1 
ATOM   6450  C CZ    . TYR B  1 244 ? 67.698  29.443  -20.579 1.00 35.36 ? 1275 TYR B CZ    1 
ATOM   6451  O OH    . TYR B  1 244 ? 67.498  28.083  -20.472 1.00 36.68 ? 1275 TYR B OH    1 
ATOM   6452  N N     . PRO B  1 245 ? 70.918  35.492  -20.412 1.00 38.70 ? 1276 PRO B N     1 
ATOM   6453  C CA    . PRO B  1 245 ? 71.776  36.601  -20.829 1.00 43.05 ? 1276 PRO B CA    1 
ATOM   6454  C C     . PRO B  1 245 ? 71.653  36.813  -22.343 1.00 41.87 ? 1276 PRO B C     1 
ATOM   6455  O O     . PRO B  1 245 ? 71.651  35.860  -23.120 1.00 40.63 ? 1276 PRO B O     1 
ATOM   6456  C CB    . PRO B  1 245 ? 73.172  36.153  -20.403 1.00 41.90 ? 1276 PRO B CB    1 
ATOM   6457  C CG    . PRO B  1 245 ? 73.108  34.648  -20.344 1.00 40.09 ? 1276 PRO B CG    1 
ATOM   6458  C CD    . PRO B  1 245 ? 71.664  34.219  -20.333 1.00 43.05 ? 1276 PRO B CD    1 
ATOM   6459  N N     . PRO B  1 246 ? 71.560  38.075  -22.770 1.00 40.25 ? 1277 PRO B N     1 
ATOM   6460  C CA    . PRO B  1 246 ? 71.427  38.541  -24.150 1.00 43.13 ? 1277 PRO B CA    1 
ATOM   6461  C C     . PRO B  1 246 ? 71.949  37.680  -25.300 1.00 46.10 ? 1277 PRO B C     1 
ATOM   6462  O O     . PRO B  1 246 ? 71.253  37.505  -26.296 1.00 47.50 ? 1277 PRO B O     1 
ATOM   6463  C CB    . PRO B  1 246 ? 72.095  39.908  -24.118 1.00 42.36 ? 1277 PRO B CB    1 
ATOM   6464  C CG    . PRO B  1 246 ? 71.844  40.404  -22.729 1.00 42.25 ? 1277 PRO B CG    1 
ATOM   6465  C CD    . PRO B  1 246 ? 71.616  39.209  -21.831 1.00 41.44 ? 1277 PRO B CD    1 
ATOM   6466  N N     . HIS B  1 247 ? 73.157  37.144  -25.182 1.00 47.49 ? 1278 HIS B N     1 
ATOM   6467  C CA    . HIS B  1 247 ? 73.727  36.349  -26.275 1.00 52.37 ? 1278 HIS B CA    1 
ATOM   6468  C C     . HIS B  1 247 ? 73.051  35.009  -26.595 1.00 51.47 ? 1278 HIS B C     1 
ATOM   6469  O O     . HIS B  1 247 ? 72.937  34.633  -27.765 1.00 52.71 ? 1278 HIS B O     1 
ATOM   6470  C CB    . HIS B  1 247 ? 75.224  36.105  -26.027 1.00 56.41 ? 1278 HIS B CB    1 
ATOM   6471  C CG    . HIS B  1 247 ? 75.573  35.913  -24.585 1.00 60.86 ? 1278 HIS B CG    1 
ATOM   6472  N ND1   . HIS B  1 247 ? 75.518  36.938  -23.663 1.00 62.41 ? 1278 HIS B ND1   1 
ATOM   6473  C CD2   . HIS B  1 247 ? 75.979  34.816  -23.904 1.00 61.66 ? 1278 HIS B CD2   1 
ATOM   6474  C CE1   . HIS B  1 247 ? 75.876  36.480  -22.476 1.00 63.09 ? 1278 HIS B CE1   1 
ATOM   6475  N NE2   . HIS B  1 247 ? 76.160  35.195  -22.595 1.00 64.74 ? 1278 HIS B NE2   1 
ATOM   6476  N N     . ILE B  1 248 ? 72.610  34.294  -25.565 1.00 49.75 ? 1279 ILE B N     1 
ATOM   6477  C CA    . ILE B  1 248 ? 71.983  32.992  -25.757 1.00 48.64 ? 1279 ILE B CA    1 
ATOM   6478  C C     . ILE B  1 248 ? 71.069  32.904  -26.966 1.00 51.20 ? 1279 ILE B C     1 
ATOM   6479  O O     . ILE B  1 248 ? 70.178  33.732  -27.160 1.00 51.77 ? 1279 ILE B O     1 
ATOM   6480  C CB    . ILE B  1 248 ? 71.162  32.574  -24.540 1.00 45.07 ? 1279 ILE B CB    1 
ATOM   6481  C CG1   . ILE B  1 248 ? 71.929  32.895  -23.258 1.00 45.94 ? 1279 ILE B CG1   1 
ATOM   6482  C CG2   . ILE B  1 248 ? 70.829  31.094  -24.637 1.00 45.09 ? 1279 ILE B CG2   1 
ATOM   6483  C CD1   . ILE B  1 248 ? 73.209  32.090  -23.083 1.00 43.81 ? 1279 ILE B CD1   1 
ATOM   6484  N N     . PRO B  1 249 ? 71.274  31.879  -27.799 1.00 51.75 ? 1280 PRO B N     1 
ATOM   6485  C CA    . PRO B  1 249 ? 70.436  31.718  -28.986 1.00 53.35 ? 1280 PRO B CA    1 
ATOM   6486  C C     . PRO B  1 249 ? 69.112  31.075  -28.596 1.00 54.51 ? 1280 PRO B C     1 
ATOM   6487  O O     . PRO B  1 249 ? 69.056  30.232  -27.695 1.00 53.03 ? 1280 PRO B O     1 
ATOM   6488  C CB    . PRO B  1 249 ? 71.270  30.824  -29.886 1.00 50.91 ? 1280 PRO B CB    1 
ATOM   6489  C CG    . PRO B  1 249 ? 72.049  29.982  -28.926 1.00 50.66 ? 1280 PRO B CG    1 
ATOM   6490  C CD    . PRO B  1 249 ? 72.279  30.810  -27.682 1.00 51.68 ? 1280 PRO B CD    1 
ATOM   6491  N N     . GLU B  1 250 ? 68.050  31.488  -29.275 1.00 57.87 ? 1281 GLU B N     1 
ATOM   6492  C CA    . GLU B  1 250 ? 66.727  30.961  -29.000 1.00 58.19 ? 1281 GLU B CA    1 
ATOM   6493  C C     . GLU B  1 250 ? 66.733  29.439  -28.983 1.00 56.93 ? 1281 GLU B C     1 
ATOM   6494  O O     . GLU B  1 250 ? 66.117  28.819  -28.119 1.00 58.59 ? 1281 GLU B O     1 
ATOM   6495  C CB    . GLU B  1 250 ? 65.737  31.465  -30.052 1.00 61.60 ? 1281 GLU B CB    1 
ATOM   6496  C CG    . GLU B  1 250 ? 65.246  32.889  -29.814 1.00 62.19 ? 1281 GLU B CG    1 
ATOM   6497  C CD    . GLU B  1 250 ? 64.657  33.519  -31.063 1.00 64.28 ? 1281 GLU B CD    1 
ATOM   6498  O OE1   . GLU B  1 250 ? 64.495  32.803  -32.079 1.00 60.92 ? 1281 GLU B OE1   1 
ATOM   6499  O OE2   . GLU B  1 250 ? 64.356  34.730  -31.023 1.00 62.99 ? 1281 GLU B OE2   1 
ATOM   6500  N N     . ASN B  1 251 ? 67.436  28.837  -29.933 1.00 52.79 ? 1282 ASN B N     1 
ATOM   6501  C CA    . ASN B  1 251 ? 67.493  27.384  -30.007 1.00 50.52 ? 1282 ASN B CA    1 
ATOM   6502  C C     . ASN B  1 251 ? 68.066  26.799  -28.729 1.00 47.64 ? 1282 ASN B C     1 
ATOM   6503  O O     . ASN B  1 251 ? 68.008  25.597  -28.505 1.00 49.55 ? 1282 ASN B O     1 
ATOM   6504  C CB    . ASN B  1 251 ? 68.349  26.946  -31.193 1.00 48.77 ? 1282 ASN B CB    1 
ATOM   6505  C CG    . ASN B  1 251 ? 69.785  27.378  -31.057 1.00 49.55 ? 1282 ASN B CG    1 
ATOM   6506  O OD1   . ASN B  1 251 ? 70.119  28.531  -31.320 1.00 49.87 ? 1282 ASN B OD1   1 
ATOM   6507  N ND2   . ASN B  1 251 ? 70.645  26.457  -30.644 1.00 47.24 ? 1282 ASN B ND2   1 
ATOM   6508  N N     . LEU B  1 252 ? 68.617  27.661  -27.888 1.00 45.61 ? 1283 LEU B N     1 
ATOM   6509  C CA    . LEU B  1 252 ? 69.213  27.211  -26.646 1.00 42.69 ? 1283 LEU B CA    1 
ATOM   6510  C C     . LEU B  1 252 ? 68.449  27.678  -25.422 1.00 40.72 ? 1283 LEU B C     1 
ATOM   6511  O O     . LEU B  1 252 ? 68.548  27.074  -24.359 1.00 41.16 ? 1283 LEU B O     1 
ATOM   6512  C CB    . LEU B  1 252 ? 70.662  27.690  -26.571 1.00 46.30 ? 1283 LEU B CB    1 
ATOM   6513  C CG    . LEU B  1 252 ? 71.642  26.945  -27.483 1.00 51.49 ? 1283 LEU B CG    1 
ATOM   6514  C CD1   . LEU B  1 252 ? 73.054  27.390  -27.159 1.00 51.65 ? 1283 LEU B CD1   1 
ATOM   6515  C CD2   . LEU B  1 252 ? 71.503  25.433  -27.305 1.00 50.92 ? 1283 LEU B CD2   1 
ATOM   6516  N N     . GLN B  1 253 ? 67.694  28.758  -25.568 1.00 36.87 ? 1284 GLN B N     1 
ATOM   6517  C CA    . GLN B  1 253 ? 66.903  29.284  -24.468 1.00 34.41 ? 1284 GLN B CA    1 
ATOM   6518  C C     . GLN B  1 253 ? 65.888  28.262  -23.982 1.00 35.72 ? 1284 GLN B C     1 
ATOM   6519  O O     . GLN B  1 253 ? 64.793  28.143  -24.532 1.00 37.60 ? 1284 GLN B O     1 
ATOM   6520  C CB    . GLN B  1 253 ? 66.162  30.521  -24.909 1.00 33.49 ? 1284 GLN B CB    1 
ATOM   6521  C CG    . GLN B  1 253 ? 67.019  31.521  -25.590 1.00 34.96 ? 1284 GLN B CG    1 
ATOM   6522  C CD    . GLN B  1 253 ? 66.404  32.885  -25.509 1.00 34.87 ? 1284 GLN B CD    1 
ATOM   6523  O OE1   . GLN B  1 253 ? 66.051  33.343  -24.428 1.00 35.54 ? 1284 GLN B OE1   1 
ATOM   6524  N NE2   . GLN B  1 253 ? 66.257  33.543  -26.649 1.00 36.08 ? 1284 GLN B NE2   1 
ATOM   6525  N N     . PHE B  1 254 ? 66.239  27.530  -22.936 1.00 34.65 ? 1285 PHE B N     1 
ATOM   6526  C CA    . PHE B  1 254 ? 65.341  26.519  -22.414 1.00 32.15 ? 1285 PHE B CA    1 
ATOM   6527  C C     . PHE B  1 254 ? 64.261  27.058  -21.488 1.00 30.73 ? 1285 PHE B C     1 
ATOM   6528  O O     . PHE B  1 254 ? 64.479  28.014  -20.742 1.00 29.94 ? 1285 PHE B O     1 
ATOM   6529  C CB    . PHE B  1 254 ? 66.159  25.443  -21.717 1.00 34.50 ? 1285 PHE B CB    1 
ATOM   6530  C CG    . PHE B  1 254 ? 66.819  24.498  -22.666 1.00 37.67 ? 1285 PHE B CG    1 
ATOM   6531  C CD1   . PHE B  1 254 ? 67.316  23.278  -22.227 1.00 37.34 ? 1285 PHE B CD1   1 
ATOM   6532  C CD2   . PHE B  1 254 ? 66.912  24.814  -24.018 1.00 37.06 ? 1285 PHE B CD2   1 
ATOM   6533  C CE1   . PHE B  1 254 ? 67.891  22.379  -23.126 1.00 36.81 ? 1285 PHE B CE1   1 
ATOM   6534  C CE2   . PHE B  1 254 ? 67.483  23.927  -24.924 1.00 35.80 ? 1285 PHE B CE2   1 
ATOM   6535  C CZ    . PHE B  1 254 ? 67.973  22.705  -24.479 1.00 35.48 ? 1285 PHE B CZ    1 
ATOM   6536  N N     . ALA B  1 255 ? 63.085  26.437  -21.558 1.00 29.00 ? 1286 ALA B N     1 
ATOM   6537  C CA    . ALA B  1 255 ? 61.937  26.821  -20.736 1.00 23.71 ? 1286 ALA B CA    1 
ATOM   6538  C C     . ALA B  1 255 ? 61.615  25.687  -19.781 1.00 20.22 ? 1286 ALA B C     1 
ATOM   6539  O O     . ALA B  1 255 ? 61.355  24.563  -20.212 1.00 20.07 ? 1286 ALA B O     1 
ATOM   6540  C CB    . ALA B  1 255 ? 60.737  27.109  -21.621 1.00 20.95 ? 1286 ALA B CB    1 
ATOM   6541  N N     . VAL B  1 256 ? 61.638  25.983  -18.486 1.00 14.93 ? 1287 VAL B N     1 
ATOM   6542  C CA    . VAL B  1 256 ? 61.359  24.970  -17.479 1.00 12.55 ? 1287 VAL B CA    1 
ATOM   6543  C C     . VAL B  1 256 ? 60.695  25.580  -16.258 1.00 13.23 ? 1287 VAL B C     1 
ATOM   6544  O O     . VAL B  1 256 ? 60.689  26.796  -16.077 1.00 9.66  ? 1287 VAL B O     1 
ATOM   6545  C CB    . VAL B  1 256 ? 62.644  24.275  -17.012 1.00 13.15 ? 1287 VAL B CB    1 
ATOM   6546  C CG1   . VAL B  1 256 ? 63.577  24.034  -18.195 1.00 12.49 ? 1287 VAL B CG1   1 
ATOM   6547  C CG2   . VAL B  1 256 ? 63.329  25.120  -15.967 1.00 8.76  ? 1287 VAL B CG2   1 
ATOM   6548  N N     . GLY B  1 257 ? 60.148  24.717  -15.413 1.00 15.02 ? 1288 GLY B N     1 
ATOM   6549  C CA    . GLY B  1 257 ? 59.485  25.187  -14.219 1.00 14.47 ? 1288 GLY B CA    1 
ATOM   6550  C C     . GLY B  1 257 ? 60.172  26.388  -13.604 1.00 16.73 ? 1288 GLY B C     1 
ATOM   6551  O O     . GLY B  1 257 ? 59.526  27.400  -13.315 1.00 16.66 ? 1288 GLY B O     1 
ATOM   6552  N N     . GLN B  1 258 ? 61.484  26.301  -13.418 1.00 17.60 ? 1289 GLN B N     1 
ATOM   6553  C CA    . GLN B  1 258 ? 62.213  27.411  -12.815 1.00 18.36 ? 1289 GLN B CA    1 
ATOM   6554  C C     . GLN B  1 258 ? 62.875  28.343  -13.829 1.00 21.86 ? 1289 GLN B C     1 
ATOM   6555  O O     . GLN B  1 258 ? 63.620  27.908  -14.703 1.00 22.01 ? 1289 GLN B O     1 
ATOM   6556  C CB    . GLN B  1 258 ? 63.234  26.859  -11.836 1.00 16.84 ? 1289 GLN B CB    1 
ATOM   6557  C CG    . GLN B  1 258 ? 62.972  27.288  -10.414 1.00 10.12 ? 1289 GLN B CG    1 
ATOM   6558  C CD    . GLN B  1 258 ? 63.287  28.761  -10.198 1.00 10.91 ? 1289 GLN B CD    1 
ATOM   6559  O OE1   . GLN B  1 258 ? 63.364  29.566  -11.160 1.00 2.00  ? 1289 GLN B OE1   1 
ATOM   6560  N NE2   . GLN B  1 258 ? 63.480  29.127  -8.935  1.00 2.00  ? 1289 GLN B NE2   1 
ATOM   6561  N N     . GLU B  1 259 ? 62.599  29.635  -13.700 1.00 26.59 ? 1290 GLU B N     1 
ATOM   6562  C CA    . GLU B  1 259 ? 63.123  30.617  -14.636 1.00 32.54 ? 1290 GLU B CA    1 
ATOM   6563  C C     . GLU B  1 259 ? 64.620  30.829  -14.604 1.00 31.11 ? 1290 GLU B C     1 
ATOM   6564  O O     . GLU B  1 259 ? 65.216  31.203  -15.613 1.00 29.39 ? 1290 GLU B O     1 
ATOM   6565  C CB    . GLU B  1 259 ? 62.439  31.955  -14.415 1.00 41.57 ? 1290 GLU B CB    1 
ATOM   6566  C CG    . GLU B  1 259 ? 62.277  32.321  -12.970 1.00 48.68 ? 1290 GLU B CG    1 
ATOM   6567  C CD    . GLU B  1 259 ? 61.404  33.537  -12.804 1.00 59.39 ? 1290 GLU B CD    1 
ATOM   6568  O OE1   . GLU B  1 259 ? 61.844  34.498  -12.136 1.00 60.89 ? 1290 GLU B OE1   1 
ATOM   6569  O OE2   . GLU B  1 259 ? 60.276  33.534  -13.348 1.00 62.05 ? 1290 GLU B OE2   1 
ATOM   6570  N N     . VAL B  1 260 ? 65.229  30.593  -13.451 1.00 27.94 ? 1291 VAL B N     1 
ATOM   6571  C CA    . VAL B  1 260 ? 66.667  30.786  -13.312 1.00 25.50 ? 1291 VAL B CA    1 
ATOM   6572  C C     . VAL B  1 260 ? 67.524  29.606  -13.826 1.00 25.22 ? 1291 VAL B C     1 
ATOM   6573  O O     . VAL B  1 260 ? 68.597  29.803  -14.376 1.00 25.71 ? 1291 VAL B O     1 
ATOM   6574  C CB    . VAL B  1 260 ? 66.996  31.091  -11.827 1.00 25.97 ? 1291 VAL B CB    1 
ATOM   6575  C CG1   . VAL B  1 260 ? 67.110  29.800  -11.033 1.00 29.64 ? 1291 VAL B CG1   1 
ATOM   6576  C CG2   . VAL B  1 260 ? 68.263  31.909  -11.727 1.00 27.24 ? 1291 VAL B CG2   1 
ATOM   6577  N N     . PHE B  1 261 ? 67.014  28.391  -13.665 1.00 25.78 ? 1292 PHE B N     1 
ATOM   6578  C CA    . PHE B  1 261 ? 67.683  27.150  -14.054 1.00 24.39 ? 1292 PHE B CA    1 
ATOM   6579  C C     . PHE B  1 261 ? 68.453  27.044  -15.368 1.00 25.64 ? 1292 PHE B C     1 
ATOM   6580  O O     . PHE B  1 261 ? 69.157  26.053  -15.604 1.00 27.18 ? 1292 PHE B O     1 
ATOM   6581  C CB    . PHE B  1 261 ? 66.665  26.010  -13.993 1.00 22.52 ? 1292 PHE B CB    1 
ATOM   6582  C CG    . PHE B  1 261 ? 66.382  25.539  -12.603 1.00 16.55 ? 1292 PHE B CG    1 
ATOM   6583  C CD1   . PHE B  1 261 ? 66.688  26.353  -11.510 1.00 16.25 ? 1292 PHE B CD1   1 
ATOM   6584  C CD2   . PHE B  1 261 ? 65.840  24.278  -12.377 1.00 13.22 ? 1292 PHE B CD2   1 
ATOM   6585  C CE1   . PHE B  1 261 ? 66.460  25.913  -10.210 1.00 17.63 ? 1292 PHE B CE1   1 
ATOM   6586  C CE2   . PHE B  1 261 ? 65.608  23.823  -11.082 1.00 14.75 ? 1292 PHE B CE2   1 
ATOM   6587  C CZ    . PHE B  1 261 ? 65.918  24.637  -9.991  1.00 17.04 ? 1292 PHE B CZ    1 
ATOM   6588  N N     . GLY B  1 262 ? 68.322  28.041  -16.228 1.00 25.31 ? 1293 GLY B N     1 
ATOM   6589  C CA    . GLY B  1 262 ? 69.030  27.985  -17.494 1.00 27.67 ? 1293 GLY B CA    1 
ATOM   6590  C C     . GLY B  1 262 ? 70.500  28.353  -17.394 1.00 28.99 ? 1293 GLY B C     1 
ATOM   6591  O O     . GLY B  1 262 ? 71.318  27.944  -18.225 1.00 27.98 ? 1293 GLY B O     1 
ATOM   6592  N N     . LEU B  1 263 ? 70.835  29.124  -16.363 1.00 28.30 ? 1294 LEU B N     1 
ATOM   6593  C CA    . LEU B  1 263 ? 72.208  29.578  -16.128 1.00 28.61 ? 1294 LEU B CA    1 
ATOM   6594  C C     . LEU B  1 263 ? 73.141  28.524  -15.540 1.00 25.97 ? 1294 LEU B C     1 
ATOM   6595  O O     . LEU B  1 263 ? 74.274  28.839  -15.186 1.00 28.24 ? 1294 LEU B O     1 
ATOM   6596  C CB    . LEU B  1 263 ? 72.197  30.795  -15.198 1.00 30.26 ? 1294 LEU B CB    1 
ATOM   6597  C CG    . LEU B  1 263 ? 71.170  31.880  -15.522 1.00 33.88 ? 1294 LEU B CG    1 
ATOM   6598  C CD1   . LEU B  1 263 ? 71.057  32.821  -14.332 1.00 33.40 ? 1294 LEU B CD1   1 
ATOM   6599  C CD2   . LEU B  1 263 ? 71.580  32.634  -16.798 1.00 33.04 ? 1294 LEU B CD2   1 
ATOM   6600  N N     . VAL B  1 264 ? 72.679  27.285  -15.433 1.00 20.37 ? 1295 VAL B N     1 
ATOM   6601  C CA    . VAL B  1 264 ? 73.516  26.252  -14.859 1.00 20.31 ? 1295 VAL B CA    1 
ATOM   6602  C C     . VAL B  1 264 ? 73.305  24.909  -15.509 1.00 18.94 ? 1295 VAL B C     1 
ATOM   6603  O O     . VAL B  1 264 ? 72.414  24.160  -15.123 1.00 22.51 ? 1295 VAL B O     1 
ATOM   6604  C CB    . VAL B  1 264 ? 73.244  26.082  -13.358 1.00 20.53 ? 1295 VAL B CB    1 
ATOM   6605  C CG1   . VAL B  1 264 ? 74.117  24.952  -12.806 1.00 20.52 ? 1295 VAL B CG1   1 
ATOM   6606  C CG2   . VAL B  1 264 ? 73.493  27.399  -12.623 1.00 16.31 ? 1295 VAL B CG2   1 
ATOM   6607  N N     . PRO B  1 265 ? 74.125  24.577  -16.510 1.00 17.68 ? 1296 PRO B N     1 
ATOM   6608  C CA    . PRO B  1 265 ? 73.990  23.287  -17.193 1.00 17.32 ? 1296 PRO B CA    1 
ATOM   6609  C C     . PRO B  1 265 ? 73.793  22.154  -16.192 1.00 16.48 ? 1296 PRO B C     1 
ATOM   6610  O O     . PRO B  1 265 ? 73.246  21.098  -16.522 1.00 14.01 ? 1296 PRO B O     1 
ATOM   6611  C CB    . PRO B  1 265 ? 75.297  23.159  -17.979 1.00 16.40 ? 1296 PRO B CB    1 
ATOM   6612  C CG    . PRO B  1 265 ? 75.701  24.569  -18.255 1.00 16.42 ? 1296 PRO B CG    1 
ATOM   6613  C CD    . PRO B  1 265 ? 75.215  25.395  -17.072 1.00 19.00 ? 1296 PRO B CD    1 
ATOM   6614  N N     . GLY B  1 266 ? 74.232  22.382  -14.961 1.00 14.32 ? 1297 GLY B N     1 
ATOM   6615  C CA    . GLY B  1 266 ? 74.077  21.358  -13.942 1.00 15.49 ? 1297 GLY B CA    1 
ATOM   6616  C C     . GLY B  1 266 ? 72.606  21.203  -13.631 1.00 14.34 ? 1297 GLY B C     1 
ATOM   6617  O O     . GLY B  1 266 ? 72.073  20.089  -13.613 1.00 8.96  ? 1297 GLY B O     1 
ATOM   6618  N N     . LEU B  1 267 ? 71.968  22.350  -13.381 1.00 14.89 ? 1298 LEU B N     1 
ATOM   6619  C CA    . LEU B  1 267 ? 70.535  22.437  -13.088 1.00 14.11 ? 1298 LEU B CA    1 
ATOM   6620  C C     . LEU B  1 267 ? 69.761  21.895  -14.282 1.00 11.74 ? 1298 LEU B C     1 
ATOM   6621  O O     . LEU B  1 267 ? 69.088  20.855  -14.200 1.00 11.14 ? 1298 LEU B O     1 
ATOM   6622  C CB    . LEU B  1 267 ? 70.141  23.898  -12.847 1.00 8.52  ? 1298 LEU B CB    1 
ATOM   6623  C CG    . LEU B  1 267 ? 70.135  24.321  -11.372 1.00 11.17 ? 1298 LEU B CG    1 
ATOM   6624  C CD1   . LEU B  1 267 ? 70.890  23.286  -10.516 1.00 7.59  ? 1298 LEU B CD1   1 
ATOM   6625  C CD2   . LEU B  1 267 ? 70.756  25.705  -11.229 1.00 8.52  ? 1298 LEU B CD2   1 
ATOM   6626  N N     . MET B  1 268 ? 69.874  22.614  -15.391 1.00 9.65  ? 1299 MET B N     1 
ATOM   6627  C CA    . MET B  1 268 ? 69.218  22.215  -16.610 1.00 9.12  ? 1299 MET B CA    1 
ATOM   6628  C C     . MET B  1 268 ? 69.222  20.691  -16.806 1.00 9.58  ? 1299 MET B C     1 
ATOM   6629  O O     . MET B  1 268 ? 68.220  20.097  -17.191 1.00 11.95 ? 1299 MET B O     1 
ATOM   6630  C CB    . MET B  1 268 ? 69.909  22.882  -17.781 1.00 8.60  ? 1299 MET B CB    1 
ATOM   6631  C CG    . MET B  1 268 ? 69.152  22.685  -19.063 1.00 9.73  ? 1299 MET B CG    1 
ATOM   6632  S SD    . MET B  1 268 ? 67.586  23.495  -18.927 1.00 20.73 ? 1299 MET B SD    1 
ATOM   6633  C CE    . MET B  1 268 ? 68.085  25.069  -18.170 1.00 2.00  ? 1299 MET B CE    1 
ATOM   6634  N N     . MET B  1 269 ? 70.364  20.073  -16.541 1.00 12.26 ? 1300 MET B N     1 
ATOM   6635  C CA    . MET B  1 269 ? 70.515  18.631  -16.686 1.00 14.53 ? 1300 MET B CA    1 
ATOM   6636  C C     . MET B  1 269 ? 69.434  17.935  -15.869 1.00 12.32 ? 1300 MET B C     1 
ATOM   6637  O O     . MET B  1 269 ? 68.632  17.152  -16.407 1.00 13.47 ? 1300 MET B O     1 
ATOM   6638  C CB    . MET B  1 269 ? 71.922  18.197  -16.206 1.00 17.69 ? 1300 MET B CB    1 
ATOM   6639  C CG    . MET B  1 269 ? 72.123  16.690  -15.958 1.00 16.12 ? 1300 MET B CG    1 
ATOM   6640  S SD    . MET B  1 269 ? 72.992  16.372  -14.392 1.00 29.62 ? 1300 MET B SD    1 
ATOM   6641  C CE    . MET B  1 269 ? 73.601  14.673  -14.592 1.00 23.45 ? 1300 MET B CE    1 
ATOM   6642  N N     . TYR B  1 270 ? 69.411  18.235  -14.576 1.00 7.99  ? 1301 TYR B N     1 
ATOM   6643  C CA    . TYR B  1 270 ? 68.435  17.645  -13.685 1.00 10.97 ? 1301 TYR B CA    1 
ATOM   6644  C C     . TYR B  1 270 ? 67.037  17.871  -14.225 1.00 12.33 ? 1301 TYR B C     1 
ATOM   6645  O O     . TYR B  1 270 ? 66.240  16.925  -14.345 1.00 14.43 ? 1301 TYR B O     1 
ATOM   6646  C CB    . TYR B  1 270 ? 68.559  18.245  -12.293 1.00 9.53  ? 1301 TYR B CB    1 
ATOM   6647  C CG    . TYR B  1 270 ? 69.345  17.361  -11.361 1.00 17.10 ? 1301 TYR B CG    1 
ATOM   6648  C CD1   . TYR B  1 270 ? 69.070  15.980  -11.269 1.00 16.25 ? 1301 TYR B CD1   1 
ATOM   6649  C CD2   . TYR B  1 270 ? 70.385  17.886  -10.592 1.00 20.07 ? 1301 TYR B CD2   1 
ATOM   6650  C CE1   . TYR B  1 270 ? 69.814  15.148  -10.429 1.00 17.85 ? 1301 TYR B CE1   1 
ATOM   6651  C CE2   . TYR B  1 270 ? 71.137  17.066  -9.753  1.00 20.58 ? 1301 TYR B CE2   1 
ATOM   6652  C CZ    . TYR B  1 270 ? 70.848  15.698  -9.665  1.00 21.97 ? 1301 TYR B CZ    1 
ATOM   6653  O OH    . TYR B  1 270 ? 71.562  14.912  -8.768  1.00 18.24 ? 1301 TYR B OH    1 
ATOM   6654  N N     . ALA B  1 271 ? 66.737  19.128  -14.550 1.00 11.49 ? 1302 ALA B N     1 
ATOM   6655  C CA    . ALA B  1 271 ? 65.437  19.463  -15.110 1.00 8.79  ? 1302 ALA B CA    1 
ATOM   6656  C C     . ALA B  1 271 ? 65.144  18.353  -16.114 1.00 7.64  ? 1302 ALA B C     1 
ATOM   6657  O O     . ALA B  1 271 ? 64.425  17.372  -15.825 1.00 2.00  ? 1302 ALA B O     1 
ATOM   6658  C CB    . ALA B  1 271 ? 65.516  20.811  -15.827 1.00 2.00  ? 1302 ALA B CB    1 
ATOM   6659  N N     . THR B  1 272 ? 65.752  18.513  -17.284 1.00 8.07  ? 1303 THR B N     1 
ATOM   6660  C CA    . THR B  1 272 ? 65.617  17.560  -18.364 1.00 10.10 ? 1303 THR B CA    1 
ATOM   6661  C C     . THR B  1 272 ? 65.330  16.178  -17.845 1.00 6.56  ? 1303 THR B C     1 
ATOM   6662  O O     . THR B  1 272 ? 64.439  15.507  -18.354 1.00 8.24  ? 1303 THR B O     1 
ATOM   6663  C CB    . THR B  1 272 ? 66.885  17.492  -19.179 1.00 12.46 ? 1303 THR B CB    1 
ATOM   6664  O OG1   . THR B  1 272 ? 67.375  18.827  -19.391 1.00 15.06 ? 1303 THR B OG1   1 
ATOM   6665  C CG2   . THR B  1 272 ? 66.612  16.789  -20.513 1.00 10.14 ? 1303 THR B CG2   1 
ATOM   6666  N N     . ILE B  1 273 ? 66.089  15.744  -16.844 1.00 5.58  ? 1304 ILE B N     1 
ATOM   6667  C CA    . ILE B  1 273 ? 65.855  14.424  -16.287 1.00 9.21  ? 1304 ILE B CA    1 
ATOM   6668  C C     . ILE B  1 273 ? 64.414  14.345  -15.800 1.00 12.80 ? 1304 ILE B C     1 
ATOM   6669  O O     . ILE B  1 273 ? 63.585  13.644  -16.395 1.00 14.92 ? 1304 ILE B O     1 
ATOM   6670  C CB    . ILE B  1 273 ? 66.751  14.137  -15.097 1.00 11.07 ? 1304 ILE B CB    1 
ATOM   6671  C CG1   . ILE B  1 273 ? 68.214  14.315  -15.498 1.00 13.15 ? 1304 ILE B CG1   1 
ATOM   6672  C CG2   . ILE B  1 273 ? 66.472  12.716  -14.571 1.00 15.93 ? 1304 ILE B CG2   1 
ATOM   6673  C CD1   . ILE B  1 273 ? 69.123  14.555  -14.315 1.00 10.77 ? 1304 ILE B CD1   1 
ATOM   6674  N N     . TRP B  1 274 ? 64.126  15.061  -14.713 1.00 12.79 ? 1305 TRP B N     1 
ATOM   6675  C CA    . TRP B  1 274 ? 62.785  15.094  -14.124 1.00 10.35 ? 1305 TRP B CA    1 
ATOM   6676  C C     . TRP B  1 274 ? 61.706  15.253  -15.181 1.00 11.66 ? 1305 TRP B C     1 
ATOM   6677  O O     . TRP B  1 274 ? 60.741  14.483  -15.208 1.00 12.17 ? 1305 TRP B O     1 
ATOM   6678  C CB    . TRP B  1 274 ? 62.674  16.249  -13.138 1.00 10.07 ? 1305 TRP B CB    1 
ATOM   6679  C CG    . TRP B  1 274 ? 63.226  15.904  -11.808 1.00 11.76 ? 1305 TRP B CG    1 
ATOM   6680  C CD1   . TRP B  1 274 ? 64.267  16.513  -11.165 1.00 9.23  ? 1305 TRP B CD1   1 
ATOM   6681  C CD2   . TRP B  1 274 ? 62.747  14.886  -10.932 1.00 7.87  ? 1305 TRP B CD2   1 
ATOM   6682  N NE1   . TRP B  1 274 ? 64.457  15.938  -9.942  1.00 8.71  ? 1305 TRP B NE1   1 
ATOM   6683  C CE2   . TRP B  1 274 ? 63.539  14.937  -9.767  1.00 6.42  ? 1305 TRP B CE2   1 
ATOM   6684  C CE3   . TRP B  1 274 ? 61.719  13.933  -11.018 1.00 4.55  ? 1305 TRP B CE3   1 
ATOM   6685  C CZ2   . TRP B  1 274 ? 63.339  14.070  -8.680  1.00 4.99  ? 1305 TRP B CZ2   1 
ATOM   6686  C CZ3   . TRP B  1 274 ? 61.514  13.069  -9.938  1.00 2.00  ? 1305 TRP B CZ3   1 
ATOM   6687  C CH2   . TRP B  1 274 ? 62.326  13.148  -8.780  1.00 4.26  ? 1305 TRP B CH2   1 
ATOM   6688  N N     . LEU B  1 275 ? 61.861  16.262  -16.039 1.00 11.18 ? 1306 LEU B N     1 
ATOM   6689  C CA    . LEU B  1 275 ? 60.892  16.495  -17.100 1.00 10.89 ? 1306 LEU B CA    1 
ATOM   6690  C C     . LEU B  1 275 ? 60.666  15.145  -17.763 1.00 12.74 ? 1306 LEU B C     1 
ATOM   6691  O O     . LEU B  1 275 ? 59.538  14.698  -17.913 1.00 16.61 ? 1306 LEU B O     1 
ATOM   6692  C CB    . LEU B  1 275 ? 61.437  17.499  -18.131 1.00 8.45  ? 1306 LEU B CB    1 
ATOM   6693  C CG    . LEU B  1 275 ? 60.691  17.537  -19.475 1.00 2.00  ? 1306 LEU B CG    1 
ATOM   6694  C CD1   . LEU B  1 275 ? 60.939  18.883  -20.125 1.00 2.00  ? 1306 LEU B CD1   1 
ATOM   6695  C CD2   . LEU B  1 275 ? 61.131  16.372  -20.389 1.00 2.00  ? 1306 LEU B CD2   1 
ATOM   6696  N N     . ARG B  1 276 ? 61.754  14.495  -18.155 1.00 13.31 ? 1307 ARG B N     1 
ATOM   6697  C CA    . ARG B  1 276 ? 61.659  13.192  -18.785 1.00 15.26 ? 1307 ARG B CA    1 
ATOM   6698  C C     . ARG B  1 276 ? 60.894  12.236  -17.856 1.00 12.68 ? 1307 ARG B C     1 
ATOM   6699  O O     . ARG B  1 276 ? 60.043  11.463  -18.302 1.00 9.38  ? 1307 ARG B O     1 
ATOM   6700  C CB    . ARG B  1 276 ? 63.071  12.660  -19.075 1.00 20.99 ? 1307 ARG B CB    1 
ATOM   6701  C CG    . ARG B  1 276 ? 63.792  13.429  -20.183 1.00 27.53 ? 1307 ARG B CG    1 
ATOM   6702  C CD    . ARG B  1 276 ? 65.267  13.051  -20.276 1.00 36.22 ? 1307 ARG B CD    1 
ATOM   6703  N NE    . ARG B  1 276 ? 65.601  12.384  -21.541 1.00 44.86 ? 1307 ARG B NE    1 
ATOM   6704  C CZ    . ARG B  1 276 ? 66.571  12.774  -22.366 1.00 46.82 ? 1307 ARG B CZ    1 
ATOM   6705  N NH1   . ARG B  1 276 ? 67.312  13.833  -22.069 1.00 50.67 ? 1307 ARG B NH1   1 
ATOM   6706  N NH2   . ARG B  1 276 ? 66.802  12.105  -23.489 1.00 48.92 ? 1307 ARG B NH2   1 
ATOM   6707  N N     . GLU B  1 277 ? 61.192  12.310  -16.562 1.00 11.75 ? 1308 GLU B N     1 
ATOM   6708  C CA    . GLU B  1 277 ? 60.536  11.459  -15.567 1.00 13.99 ? 1308 GLU B CA    1 
ATOM   6709  C C     . GLU B  1 277 ? 59.023  11.591  -15.637 1.00 15.60 ? 1308 GLU B C     1 
ATOM   6710  O O     . GLU B  1 277 ? 58.301  10.594  -15.773 1.00 14.80 ? 1308 GLU B O     1 
ATOM   6711  C CB    . GLU B  1 277 ? 61.001  11.825  -14.155 1.00 14.67 ? 1308 GLU B CB    1 
ATOM   6712  C CG    . GLU B  1 277 ? 60.168  11.201  -13.045 1.00 10.54 ? 1308 GLU B CG    1 
ATOM   6713  C CD    . GLU B  1 277 ? 60.056  9.683   -13.150 1.00 13.91 ? 1308 GLU B CD    1 
ATOM   6714  O OE1   . GLU B  1 277 ? 59.637  9.069   -12.147 1.00 16.13 ? 1308 GLU B OE1   1 
ATOM   6715  O OE2   . GLU B  1 277 ? 60.374  9.094   -14.216 1.00 2.00  ? 1308 GLU B OE2   1 
ATOM   6716  N N     . HIS B  1 278 ? 58.556  12.830  -15.516 1.00 17.15 ? 1309 HIS B N     1 
ATOM   6717  C CA    . HIS B  1 278 ? 57.130  13.151  -15.583 1.00 19.75 ? 1309 HIS B CA    1 
ATOM   6718  C C     . HIS B  1 278 ? 56.465  12.386  -16.731 1.00 17.55 ? 1309 HIS B C     1 
ATOM   6719  O O     . HIS B  1 278 ? 55.761  11.396  -16.506 1.00 14.34 ? 1309 HIS B O     1 
ATOM   6720  C CB    . HIS B  1 278 ? 56.952  14.650  -15.819 1.00 24.86 ? 1309 HIS B CB    1 
ATOM   6721  C CG    . HIS B  1 278 ? 55.529  15.072  -15.967 1.00 27.46 ? 1309 HIS B CG    1 
ATOM   6722  N ND1   . HIS B  1 278 ? 54.764  15.492  -14.897 1.00 28.24 ? 1309 HIS B ND1   1 
ATOM   6723  C CD2   . HIS B  1 278 ? 54.725  15.134  -17.054 1.00 25.47 ? 1309 HIS B CD2   1 
ATOM   6724  C CE1   . HIS B  1 278 ? 53.549  15.792  -15.319 1.00 30.09 ? 1309 HIS B CE1   1 
ATOM   6725  N NE2   . HIS B  1 278 ? 53.501  15.583  -16.623 1.00 31.56 ? 1309 HIS B NE2   1 
ATOM   6726  N N     . ASN B  1 279 ? 56.708  12.861  -17.953 1.00 14.17 ? 1310 ASN B N     1 
ATOM   6727  C CA    . ASN B  1 279 ? 56.172  12.243  -19.154 1.00 14.92 ? 1310 ASN B CA    1 
ATOM   6728  C C     . ASN B  1 279 ? 56.353  10.729  -19.114 1.00 18.12 ? 1310 ASN B C     1 
ATOM   6729  O O     . ASN B  1 279 ? 55.508  9.975   -19.588 1.00 20.70 ? 1310 ASN B O     1 
ATOM   6730  C CB    . ASN B  1 279 ? 56.847  12.857  -20.377 1.00 13.03 ? 1310 ASN B CB    1 
ATOM   6731  C CG    . ASN B  1 279 ? 56.571  14.355  -20.498 1.00 19.80 ? 1310 ASN B CG    1 
ATOM   6732  O OD1   . ASN B  1 279 ? 56.073  14.981  -19.552 1.00 22.44 ? 1310 ASN B OD1   1 
ATOM   6733  N ND2   . ASN B  1 279 ? 56.885  14.934  -21.649 1.00 15.68 ? 1310 ASN B ND2   1 
ATOM   6734  N N     . ARG B  1 280 ? 57.448  10.272  -18.535 1.00 17.95 ? 1311 ARG B N     1 
ATOM   6735  C CA    . ARG B  1 280 ? 57.670  8.841   -18.440 1.00 18.49 ? 1311 ARG B CA    1 
ATOM   6736  C C     . ARG B  1 280 ? 56.485  8.273   -17.659 1.00 21.81 ? 1311 ARG B C     1 
ATOM   6737  O O     . ARG B  1 280 ? 55.848  7.291   -18.070 1.00 18.39 ? 1311 ARG B O     1 
ATOM   6738  C CB    . ARG B  1 280 ? 58.975  8.531   -17.688 1.00 13.71 ? 1311 ARG B CB    1 
ATOM   6739  C CG    . ARG B  1 280 ? 59.236  7.038   -17.525 1.00 14.30 ? 1311 ARG B CG    1 
ATOM   6740  C CD    . ARG B  1 280 ? 60.024  6.748   -16.282 1.00 12.43 ? 1311 ARG B CD    1 
ATOM   6741  N NE    . ARG B  1 280 ? 59.606  5.517   -15.643 1.00 5.64  ? 1311 ARG B NE    1 
ATOM   6742  C CZ    . ARG B  1 280 ? 59.387  5.433   -14.336 1.00 13.18 ? 1311 ARG B CZ    1 
ATOM   6743  N NH1   . ARG B  1 280 ? 59.565  6.517   -13.584 1.00 2.00  ? 1311 ARG B NH1   1 
ATOM   6744  N NH2   . ARG B  1 280 ? 58.987  4.280   -13.782 1.00 14.31 ? 1311 ARG B NH2   1 
ATOM   6745  N N     . VAL B  1 281 ? 56.208  8.902   -16.521 1.00 23.79 ? 1312 VAL B N     1 
ATOM   6746  C CA    . VAL B  1 281 ? 55.117  8.477   -15.665 1.00 31.12 ? 1312 VAL B CA    1 
ATOM   6747  C C     . VAL B  1 281 ? 53.796  8.541   -16.429 1.00 30.71 ? 1312 VAL B C     1 
ATOM   6748  O O     . VAL B  1 281 ? 52.999  7.596   -16.389 1.00 34.52 ? 1312 VAL B O     1 
ATOM   6749  C CB    . VAL B  1 281 ? 55.045  9.352   -14.393 1.00 31.91 ? 1312 VAL B CB    1 
ATOM   6750  C CG1   . VAL B  1 281 ? 53.583  9.584   -13.982 1.00 32.01 ? 1312 VAL B CG1   1 
ATOM   6751  C CG2   . VAL B  1 281 ? 55.823  8.673   -13.265 1.00 32.90 ? 1312 VAL B CG2   1 
ATOM   6752  N N     . CYS B  1 282 ? 53.575  9.650   -17.132 1.00 29.40 ? 1313 CYS B N     1 
ATOM   6753  C CA    . CYS B  1 282 ? 52.363  9.826   -17.915 1.00 28.07 ? 1313 CYS B CA    1 
ATOM   6754  C C     . CYS B  1 282 ? 52.075  8.560   -18.714 1.00 29.57 ? 1313 CYS B C     1 
ATOM   6755  O O     . CYS B  1 282 ? 50.978  8.009   -18.648 1.00 35.37 ? 1313 CYS B O     1 
ATOM   6756  C CB    . CYS B  1 282 ? 52.509  11.022  -18.849 1.00 24.63 ? 1313 CYS B CB    1 
ATOM   6757  S SG    . CYS B  1 282 ? 52.422  12.622  -17.991 1.00 26.79 ? 1313 CYS B SG    1 
ATOM   6758  N N     . ASP B  1 283 ? 53.057  8.073   -19.455 1.00 28.24 ? 1314 ASP B N     1 
ATOM   6759  C CA    . ASP B  1 283 ? 52.840  6.861   -20.225 1.00 28.28 ? 1314 ASP B CA    1 
ATOM   6760  C C     . ASP B  1 283 ? 52.369  5.691   -19.369 1.00 26.32 ? 1314 ASP B C     1 
ATOM   6761  O O     . ASP B  1 283 ? 51.419  5.005   -19.721 1.00 24.06 ? 1314 ASP B O     1 
ATOM   6762  C CB    . ASP B  1 283 ? 54.114  6.484   -20.954 1.00 28.26 ? 1314 ASP B CB    1 
ATOM   6763  C CG    . ASP B  1 283 ? 54.501  7.514   -21.971 1.00 33.25 ? 1314 ASP B CG    1 
ATOM   6764  O OD1   . ASP B  1 283 ? 55.643  7.477   -22.473 1.00 36.75 ? 1314 ASP B OD1   1 
ATOM   6765  O OD2   . ASP B  1 283 ? 53.649  8.376   -22.267 1.00 34.71 ? 1314 ASP B OD2   1 
ATOM   6766  N N     . ILE B  1 284 ? 53.038  5.465   -18.245 1.00 26.04 ? 1315 ILE B N     1 
ATOM   6767  C CA    . ILE B  1 284 ? 52.677  4.371   -17.354 1.00 24.87 ? 1315 ILE B CA    1 
ATOM   6768  C C     . ILE B  1 284 ? 51.230  4.516   -16.912 1.00 21.04 ? 1315 ILE B C     1 
ATOM   6769  O O     . ILE B  1 284 ? 50.495  3.522   -16.820 1.00 19.92 ? 1315 ILE B O     1 
ATOM   6770  C CB    . ILE B  1 284 ? 53.586  4.333   -16.106 1.00 29.48 ? 1315 ILE B CB    1 
ATOM   6771  C CG1   . ILE B  1 284 ? 55.002  4.783   -16.481 1.00 33.34 ? 1315 ILE B CG1   1 
ATOM   6772  C CG2   . ILE B  1 284 ? 53.615  2.915   -15.521 1.00 28.87 ? 1315 ILE B CG2   1 
ATOM   6773  C CD1   . ILE B  1 284 ? 55.735  5.453   -15.349 1.00 36.34 ? 1315 ILE B CD1   1 
ATOM   6774  N N     . LEU B  1 285 ? 50.819  5.751   -16.639 1.00 15.92 ? 1316 LEU B N     1 
ATOM   6775  C CA    . LEU B  1 285 ? 49.441  5.993   -16.231 1.00 16.09 ? 1316 LEU B CA    1 
ATOM   6776  C C     . LEU B  1 285 ? 48.515  5.693   -17.414 1.00 18.37 ? 1316 LEU B C     1 
ATOM   6777  O O     . LEU B  1 285 ? 47.671  4.808   -17.331 1.00 14.44 ? 1316 LEU B O     1 
ATOM   6778  C CB    . LEU B  1 285 ? 49.266  7.437   -15.763 1.00 8.49  ? 1316 LEU B CB    1 
ATOM   6779  C CG    . LEU B  1 285 ? 49.835  7.727   -14.366 1.00 11.81 ? 1316 LEU B CG    1 
ATOM   6780  C CD1   . LEU B  1 285 ? 49.399  9.137   -13.920 1.00 8.18  ? 1316 LEU B CD1   1 
ATOM   6781  C CD2   . LEU B  1 285 ? 49.386  6.654   -13.345 1.00 3.58  ? 1316 LEU B CD2   1 
ATOM   6782  N N     . LYS B  1 286 ? 48.691  6.417   -18.519 1.00 21.65 ? 1317 LYS B N     1 
ATOM   6783  C CA    . LYS B  1 286 ? 47.888  6.199   -19.726 1.00 24.35 ? 1317 LYS B CA    1 
ATOM   6784  C C     . LYS B  1 286 ? 47.737  4.706   -20.066 1.00 26.25 ? 1317 LYS B C     1 
ATOM   6785  O O     . LYS B  1 286 ? 46.849  4.313   -20.824 1.00 24.00 ? 1317 LYS B O     1 
ATOM   6786  C CB    . LYS B  1 286 ? 48.522  6.928   -20.919 1.00 23.88 ? 1317 LYS B CB    1 
ATOM   6787  C CG    . LYS B  1 286 ? 47.844  6.635   -22.258 1.00 20.08 ? 1317 LYS B CG    1 
ATOM   6788  C CD    . LYS B  1 286 ? 47.916  7.843   -23.198 1.00 19.96 ? 1317 LYS B CD    1 
ATOM   6789  C CE    . LYS B  1 286 ? 47.678  7.428   -24.658 1.00 25.08 ? 1317 LYS B CE    1 
ATOM   6790  N NZ    . LYS B  1 286 ? 48.794  7.749   -25.619 1.00 20.95 ? 1317 LYS B NZ    1 
ATOM   6791  N N     . GLN B  1 287 ? 48.630  3.888   -19.521 1.00 30.31 ? 1318 GLN B N     1 
ATOM   6792  C CA    . GLN B  1 287 ? 48.589  2.458   -19.747 1.00 32.58 ? 1318 GLN B CA    1 
ATOM   6793  C C     . GLN B  1 287 ? 47.536  1.923   -18.801 1.00 32.91 ? 1318 GLN B C     1 
ATOM   6794  O O     . GLN B  1 287 ? 46.640  1.169   -19.187 1.00 33.11 ? 1318 GLN B O     1 
ATOM   6795  C CB    . GLN B  1 287 ? 49.942  1.833   -19.414 1.00 38.07 ? 1318 GLN B CB    1 
ATOM   6796  C CG    . GLN B  1 287 ? 50.115  0.429   -19.958 1.00 46.72 ? 1318 GLN B CG    1 
ATOM   6797  C CD    . GLN B  1 287 ? 49.985  0.381   -21.468 1.00 55.35 ? 1318 GLN B CD    1 
ATOM   6798  O OE1   . GLN B  1 287 ? 49.842  1.420   -22.127 1.00 58.72 ? 1318 GLN B OE1   1 
ATOM   6799  N NE2   . GLN B  1 287 ? 50.032  -0.824  -22.029 1.00 57.90 ? 1318 GLN B NE2   1 
ATOM   6800  N N     . GLU B  1 288 ? 47.660  2.340   -17.547 1.00 32.59 ? 1319 GLU B N     1 
ATOM   6801  C CA    . GLU B  1 288 ? 46.743  1.932   -16.490 1.00 33.09 ? 1319 GLU B CA    1 
ATOM   6802  C C     . GLU B  1 288 ? 45.332  2.441   -16.751 1.00 29.07 ? 1319 GLU B C     1 
ATOM   6803  O O     . GLU B  1 288 ? 44.363  1.704   -16.608 1.00 31.37 ? 1319 GLU B O     1 
ATOM   6804  C CB    . GLU B  1 288 ? 47.238  2.463   -15.135 1.00 36.67 ? 1319 GLU B CB    1 
ATOM   6805  C CG    . GLU B  1 288 ? 47.591  1.394   -14.098 1.00 40.26 ? 1319 GLU B CG    1 
ATOM   6806  C CD    . GLU B  1 288 ? 48.189  0.136   -14.715 1.00 45.08 ? 1319 GLU B CD    1 
ATOM   6807  O OE1   . GLU B  1 288 ? 48.052  -0.948  -14.109 1.00 43.67 ? 1319 GLU B OE1   1 
ATOM   6808  O OE2   . GLU B  1 288 ? 48.796  0.224   -15.802 1.00 46.08 ? 1319 GLU B OE2   1 
ATOM   6809  N N     . HIS B  1 289 ? 45.223  3.704   -17.147 1.00 26.53 ? 1320 HIS B N     1 
ATOM   6810  C CA    . HIS B  1 289 ? 43.930  4.310   -17.401 1.00 22.05 ? 1320 HIS B CA    1 
ATOM   6811  C C     . HIS B  1 289 ? 43.805  4.828   -18.810 1.00 20.00 ? 1320 HIS B C     1 
ATOM   6812  O O     . HIS B  1 289 ? 43.994  6.014   -19.061 1.00 20.57 ? 1320 HIS B O     1 
ATOM   6813  C CB    . HIS B  1 289 ? 43.702  5.447   -16.418 1.00 18.52 ? 1320 HIS B CB    1 
ATOM   6814  C CG    . HIS B  1 289 ? 43.986  5.075   -14.996 1.00 19.05 ? 1320 HIS B CG    1 
ATOM   6815  N ND1   . HIS B  1 289 ? 43.493  3.926   -14.415 1.00 16.94 ? 1320 HIS B ND1   1 
ATOM   6816  C CD2   . HIS B  1 289 ? 44.676  5.719   -14.026 1.00 19.43 ? 1320 HIS B CD2   1 
ATOM   6817  C CE1   . HIS B  1 289 ? 43.861  3.882   -13.148 1.00 17.15 ? 1320 HIS B CE1   1 
ATOM   6818  N NE2   . HIS B  1 289 ? 44.578  4.959   -12.886 1.00 17.09 ? 1320 HIS B NE2   1 
ATOM   6819  N N     . PRO B  1 290 ? 43.486  3.941   -19.760 1.00 18.06 ? 1321 PRO B N     1 
ATOM   6820  C CA    . PRO B  1 290 ? 43.342  4.391   -21.154 1.00 21.81 ? 1321 PRO B CA    1 
ATOM   6821  C C     . PRO B  1 290 ? 42.155  5.341   -21.243 1.00 19.28 ? 1321 PRO B C     1 
ATOM   6822  O O     . PRO B  1 290 ? 41.928  6.007   -22.256 1.00 17.86 ? 1321 PRO B O     1 
ATOM   6823  C CB    . PRO B  1 290 ? 43.101  3.097   -21.938 1.00 20.23 ? 1321 PRO B CB    1 
ATOM   6824  C CG    . PRO B  1 290 ? 42.629  2.101   -20.908 1.00 20.94 ? 1321 PRO B CG    1 
ATOM   6825  C CD    . PRO B  1 290 ? 43.251  2.493   -19.600 1.00 19.71 ? 1321 PRO B CD    1 
ATOM   6826  N N     . GLU B  1 291 ? 41.424  5.398   -20.137 1.00 17.90 ? 1322 GLU B N     1 
ATOM   6827  C CA    . GLU B  1 291 ? 40.237  6.225   -19.999 1.00 18.52 ? 1322 GLU B CA    1 
ATOM   6828  C C     . GLU B  1 291 ? 40.436  7.508   -19.195 1.00 20.11 ? 1322 GLU B C     1 
ATOM   6829  O O     . GLU B  1 291 ? 39.467  8.050   -18.664 1.00 22.85 ? 1322 GLU B O     1 
ATOM   6830  C CB    . GLU B  1 291 ? 39.148  5.410   -19.326 1.00 14.62 ? 1322 GLU B CB    1 
ATOM   6831  C CG    . GLU B  1 291 ? 39.696  4.196   -18.600 1.00 16.80 ? 1322 GLU B CG    1 
ATOM   6832  C CD    . GLU B  1 291 ? 40.162  4.478   -17.169 1.00 13.45 ? 1322 GLU B CD    1 
ATOM   6833  O OE1   . GLU B  1 291 ? 39.695  5.452   -16.541 1.00 9.32  ? 1322 GLU B OE1   1 
ATOM   6834  O OE2   . GLU B  1 291 ? 41.003  3.698   -16.676 1.00 12.31 ? 1322 GLU B OE2   1 
ATOM   6835  N N     . TRP B  1 292 ? 41.667  8.001   -19.091 1.00 20.68 ? 1323 TRP B N     1 
ATOM   6836  C CA    . TRP B  1 292 ? 41.894  9.221   -18.328 1.00 21.32 ? 1323 TRP B CA    1 
ATOM   6837  C C     . TRP B  1 292 ? 42.117  10.414  -19.236 1.00 23.08 ? 1323 TRP B C     1 
ATOM   6838  O O     . TRP B  1 292 ? 42.386  10.262  -20.432 1.00 23.07 ? 1323 TRP B O     1 
ATOM   6839  C CB    . TRP B  1 292 ? 43.078  9.045   -17.380 1.00 22.44 ? 1323 TRP B CB    1 
ATOM   6840  C CG    . TRP B  1 292 ? 42.660  8.517   -16.057 1.00 25.71 ? 1323 TRP B CG    1 
ATOM   6841  C CD1   . TRP B  1 292 ? 41.488  7.882   -15.768 1.00 26.67 ? 1323 TRP B CD1   1 
ATOM   6842  C CD2   . TRP B  1 292 ? 43.400  8.582   -14.830 1.00 28.65 ? 1323 TRP B CD2   1 
ATOM   6843  N NE1   . TRP B  1 292 ? 41.451  7.546   -14.436 1.00 29.32 ? 1323 TRP B NE1   1 
ATOM   6844  C CE2   . TRP B  1 292 ? 42.608  7.964   -13.836 1.00 31.21 ? 1323 TRP B CE2   1 
ATOM   6845  C CE3   . TRP B  1 292 ? 44.653  9.102   -14.472 1.00 29.68 ? 1323 TRP B CE3   1 
ATOM   6846  C CZ2   . TRP B  1 292 ? 43.032  7.851   -12.503 1.00 33.26 ? 1323 TRP B CZ2   1 
ATOM   6847  C CZ3   . TRP B  1 292 ? 45.071  8.989   -13.150 1.00 29.32 ? 1323 TRP B CZ3   1 
ATOM   6848  C CH2   . TRP B  1 292 ? 44.262  8.367   -12.182 1.00 32.26 ? 1323 TRP B CH2   1 
ATOM   6849  N N     . GLY B  1 293 ? 41.989  11.606  -18.667 1.00 22.32 ? 1324 GLY B N     1 
ATOM   6850  C CA    . GLY B  1 293 ? 42.178  12.801  -19.462 1.00 21.05 ? 1324 GLY B CA    1 
ATOM   6851  C C     . GLY B  1 293 ? 43.548  13.446  -19.333 1.00 19.15 ? 1324 GLY B C     1 
ATOM   6852  O O     . GLY B  1 293 ? 44.315  13.161  -18.404 1.00 17.81 ? 1324 GLY B O     1 
ATOM   6853  N N     . ASP B  1 294 ? 43.864  14.316  -20.285 1.00 18.26 ? 1325 ASP B N     1 
ATOM   6854  C CA    . ASP B  1 294 ? 45.126  15.004  -20.244 1.00 14.71 ? 1325 ASP B CA    1 
ATOM   6855  C C     . ASP B  1 294 ? 45.265  15.619  -18.859 1.00 15.35 ? 1325 ASP B C     1 
ATOM   6856  O O     . ASP B  1 294 ? 46.175  15.263  -18.106 1.00 22.44 ? 1325 ASP B O     1 
ATOM   6857  C CB    . ASP B  1 294 ? 45.186  16.103  -21.304 1.00 13.78 ? 1325 ASP B CB    1 
ATOM   6858  C CG    . ASP B  1 294 ? 46.327  17.074  -21.062 1.00 12.03 ? 1325 ASP B CG    1 
ATOM   6859  O OD1   . ASP B  1 294 ? 47.485  16.633  -21.109 1.00 10.88 ? 1325 ASP B OD1   1 
ATOM   6860  O OD2   . ASP B  1 294 ? 46.077  18.269  -20.817 1.00 10.99 ? 1325 ASP B OD2   1 
ATOM   6861  N N     . GLU B  1 295 ? 44.349  16.511  -18.499 1.00 11.38 ? 1326 GLU B N     1 
ATOM   6862  C CA    . GLU B  1 295 ? 44.447  17.166  -17.205 1.00 12.19 ? 1326 GLU B CA    1 
ATOM   6863  C C     . GLU B  1 295 ? 44.460  16.248  -15.978 1.00 14.68 ? 1326 GLU B C     1 
ATOM   6864  O O     . GLU B  1 295 ? 44.856  16.678  -14.891 1.00 18.16 ? 1326 GLU B O     1 
ATOM   6865  C CB    . GLU B  1 295 ? 43.353  18.231  -17.043 1.00 5.61  ? 1326 GLU B CB    1 
ATOM   6866  C CG    . GLU B  1 295 ? 43.909  19.655  -16.838 1.00 2.00  ? 1326 GLU B CG    1 
ATOM   6867  C CD    . GLU B  1 295 ? 44.095  20.019  -15.361 1.00 9.00  ? 1326 GLU B CD    1 
ATOM   6868  O OE1   . GLU B  1 295 ? 44.438  21.196  -15.061 1.00 8.38  ? 1326 GLU B OE1   1 
ATOM   6869  O OE2   . GLU B  1 295 ? 43.890  19.128  -14.498 1.00 2.00  ? 1326 GLU B OE2   1 
ATOM   6870  N N     . GLN B  1 296 ? 44.047  14.996  -16.118 1.00 11.87 ? 1327 GLN B N     1 
ATOM   6871  C CA    . GLN B  1 296 ? 44.069  14.140  -14.943 1.00 14.95 ? 1327 GLN B CA    1 
ATOM   6872  C C     . GLN B  1 296 ? 45.419  13.467  -14.864 1.00 16.26 ? 1327 GLN B C     1 
ATOM   6873  O O     . GLN B  1 296 ? 46.008  13.360  -13.780 1.00 15.07 ? 1327 GLN B O     1 
ATOM   6874  C CB    . GLN B  1 296 ? 42.970  13.076  -14.978 1.00 17.21 ? 1327 GLN B CB    1 
ATOM   6875  C CG    . GLN B  1 296 ? 43.129  12.043  -13.847 1.00 21.41 ? 1327 GLN B CG    1 
ATOM   6876  C CD    . GLN B  1 296 ? 41.878  11.218  -13.623 1.00 22.72 ? 1327 GLN B CD    1 
ATOM   6877  O OE1   . GLN B  1 296 ? 41.119  10.969  -14.558 1.00 24.03 ? 1327 GLN B OE1   1 
ATOM   6878  N NE2   . GLN B  1 296 ? 41.659  10.788  -12.380 1.00 23.13 ? 1327 GLN B NE2   1 
ATOM   6879  N N     . LEU B  1 297 ? 45.896  13.001  -16.019 1.00 15.66 ? 1328 LEU B N     1 
ATOM   6880  C CA    . LEU B  1 297 ? 47.208  12.357  -16.116 1.00 14.78 ? 1328 LEU B CA    1 
ATOM   6881  C C     . LEU B  1 297 ? 48.219  13.372  -15.592 1.00 13.32 ? 1328 LEU B C     1 
ATOM   6882  O O     . LEU B  1 297 ? 48.913  13.135  -14.588 1.00 13.18 ? 1328 LEU B O     1 
ATOM   6883  C CB    . LEU B  1 297 ? 47.540  12.047  -17.569 1.00 14.68 ? 1328 LEU B CB    1 
ATOM   6884  C CG    . LEU B  1 297 ? 46.791  10.861  -18.170 1.00 16.39 ? 1328 LEU B CG    1 
ATOM   6885  C CD1   . LEU B  1 297 ? 46.854  10.971  -19.690 1.00 15.10 ? 1328 LEU B CD1   1 
ATOM   6886  C CD2   . LEU B  1 297 ? 47.423  9.537   -17.698 1.00 14.54 ? 1328 LEU B CD2   1 
ATOM   6887  N N     . PHE B  1 298 ? 48.277  14.517  -16.269 1.00 10.27 ? 1329 PHE B N     1 
ATOM   6888  C CA    . PHE B  1 298 ? 49.180  15.565  -15.860 1.00 10.26 ? 1329 PHE B CA    1 
ATOM   6889  C C     . PHE B  1 298 ? 49.177  15.773  -14.357 1.00 11.05 ? 1329 PHE B C     1 
ATOM   6890  O O     . PHE B  1 298 ? 50.233  15.990  -13.760 1.00 17.06 ? 1329 PHE B O     1 
ATOM   6891  C CB    . PHE B  1 298 ? 48.811  16.889  -16.499 1.00 5.13  ? 1329 PHE B CB    1 
ATOM   6892  C CG    . PHE B  1 298 ? 49.440  18.067  -15.816 1.00 8.30  ? 1329 PHE B CG    1 
ATOM   6893  C CD1   . PHE B  1 298 ? 50.583  18.644  -16.324 1.00 7.32  ? 1329 PHE B CD1   1 
ATOM   6894  C CD2   . PHE B  1 298 ? 48.911  18.571  -14.631 1.00 12.63 ? 1329 PHE B CD2   1 
ATOM   6895  C CE1   . PHE B  1 298 ? 51.194  19.700  -15.666 1.00 9.26  ? 1329 PHE B CE1   1 
ATOM   6896  C CE2   . PHE B  1 298 ? 49.519  19.632  -13.963 1.00 9.55  ? 1329 PHE B CE2   1 
ATOM   6897  C CZ    . PHE B  1 298 ? 50.662  20.194  -14.482 1.00 7.85  ? 1329 PHE B CZ    1 
ATOM   6898  N N     . GLN B  1 299 ? 47.998  15.739  -13.741 1.00 13.96 ? 1330 GLN B N     1 
ATOM   6899  C CA    . GLN B  1 299 ? 47.925  15.980  -12.305 1.00 17.00 ? 1330 GLN B CA    1 
ATOM   6900  C C     . GLN B  1 299 ? 48.324  14.777  -11.472 1.00 19.58 ? 1330 GLN B C     1 
ATOM   6901  O O     . GLN B  1 299 ? 48.956  14.929  -10.421 1.00 17.72 ? 1330 GLN B O     1 
ATOM   6902  C CB    . GLN B  1 299 ? 46.536  16.478  -11.912 1.00 14.85 ? 1330 GLN B CB    1 
ATOM   6903  C CG    . GLN B  1 299 ? 46.198  17.823  -12.537 1.00 14.51 ? 1330 GLN B CG    1 
ATOM   6904  C CD    . GLN B  1 299 ? 46.530  18.991  -11.636 1.00 17.19 ? 1330 GLN B CD    1 
ATOM   6905  O OE1   . GLN B  1 299 ? 46.903  18.807  -10.480 1.00 19.30 ? 1330 GLN B OE1   1 
ATOM   6906  N NE2   . GLN B  1 299 ? 46.389  20.208  -12.160 1.00 13.92 ? 1330 GLN B NE2   1 
ATOM   6907  N N     . THR B  1 300 ? 47.975  13.581  -11.930 1.00 19.17 ? 1331 THR B N     1 
ATOM   6908  C CA    . THR B  1 300 ? 48.360  12.387  -11.182 1.00 21.34 ? 1331 THR B CA    1 
ATOM   6909  C C     . THR B  1 300 ? 49.884  12.289  -11.218 1.00 23.06 ? 1331 THR B C     1 
ATOM   6910  O O     . THR B  1 300 ? 50.529  12.036  -10.200 1.00 19.14 ? 1331 THR B O     1 
ATOM   6911  C CB    . THR B  1 300 ? 47.755  11.115  -11.788 1.00 24.65 ? 1331 THR B CB    1 
ATOM   6912  O OG1   . THR B  1 300 ? 46.416  11.396  -12.224 1.00 25.13 ? 1331 THR B OG1   1 
ATOM   6913  C CG2   . THR B  1 300 ? 47.742  9.978   -10.746 1.00 23.13 ? 1331 THR B CG2   1 
ATOM   6914  N N     . SER B  1 301 ? 50.455  12.511  -12.402 1.00 23.34 ? 1332 SER B N     1 
ATOM   6915  C CA    . SER B  1 301 ? 51.899  12.473  -12.565 1.00 21.13 ? 1332 SER B CA    1 
ATOM   6916  C C     . SER B  1 301 ? 52.524  13.346  -11.481 1.00 20.06 ? 1332 SER B C     1 
ATOM   6917  O O     . SER B  1 301 ? 53.200  12.847  -10.577 1.00 21.62 ? 1332 SER B O     1 
ATOM   6918  C CB    . SER B  1 301 ? 52.284  13.000  -13.949 1.00 21.83 ? 1332 SER B CB    1 
ATOM   6919  O OG    . SER B  1 301 ? 51.933  12.086  -14.969 1.00 16.91 ? 1332 SER B OG    1 
ATOM   6920  N N     . ARG B  1 302 ? 52.268  14.650  -11.564 1.00 18.32 ? 1333 ARG B N     1 
ATOM   6921  C CA    . ARG B  1 302 ? 52.814  15.591  -10.599 1.00 18.61 ? 1333 ARG B CA    1 
ATOM   6922  C C     . ARG B  1 302 ? 52.704  15.093  -9.167  1.00 21.84 ? 1333 ARG B C     1 
ATOM   6923  O O     . ARG B  1 302 ? 53.525  15.428  -8.319  1.00 25.32 ? 1333 ARG B O     1 
ATOM   6924  C CB    . ARG B  1 302 ? 52.095  16.930  -10.710 1.00 16.94 ? 1333 ARG B CB    1 
ATOM   6925  C CG    . ARG B  1 302 ? 52.503  17.929  -9.641  1.00 10.20 ? 1333 ARG B CG    1 
ATOM   6926  C CD    . ARG B  1 302 ? 52.205  19.332  -10.094 1.00 8.09  ? 1333 ARG B CD    1 
ATOM   6927  N NE    . ARG B  1 302 ? 52.651  20.308  -9.107  1.00 8.64  ? 1333 ARG B NE    1 
ATOM   6928  C CZ    . ARG B  1 302 ? 52.813  21.607  -9.358  1.00 10.09 ? 1333 ARG B CZ    1 
ATOM   6929  N NH1   . ARG B  1 302 ? 52.568  22.097  -10.569 1.00 6.58  ? 1333 ARG B NH1   1 
ATOM   6930  N NH2   . ARG B  1 302 ? 53.219  22.422  -8.394  1.00 7.71  ? 1333 ARG B NH2   1 
ATOM   6931  N N     . LEU B  1 303 ? 51.682  14.299  -8.884  1.00 20.34 ? 1334 LEU B N     1 
ATOM   6932  C CA    . LEU B  1 303 ? 51.516  13.804  -7.529  1.00 22.16 ? 1334 LEU B CA    1 
ATOM   6933  C C     . LEU B  1 303 ? 52.520  12.708  -7.277  1.00 22.36 ? 1334 LEU B C     1 
ATOM   6934  O O     . LEU B  1 303 ? 53.208  12.718  -6.257  1.00 23.82 ? 1334 LEU B O     1 
ATOM   6935  C CB    . LEU B  1 303 ? 50.095  13.282  -7.308  1.00 24.51 ? 1334 LEU B CB    1 
ATOM   6936  C CG    . LEU B  1 303 ? 49.012  14.319  -6.957  1.00 24.33 ? 1334 LEU B CG    1 
ATOM   6937  C CD1   . LEU B  1 303 ? 48.047  13.682  -5.960  1.00 23.71 ? 1334 LEU B CD1   1 
ATOM   6938  C CD2   . LEU B  1 303 ? 49.629  15.600  -6.382  1.00 23.22 ? 1334 LEU B CD2   1 
ATOM   6939  N N     . ILE B  1 304 ? 52.604  11.772  -8.219  1.00 24.38 ? 1335 ILE B N     1 
ATOM   6940  C CA    . ILE B  1 304 ? 53.541  10.648  -8.140  1.00 24.24 ? 1335 ILE B CA    1 
ATOM   6941  C C     . ILE B  1 304 ? 54.979  11.182  -8.072  1.00 23.63 ? 1335 ILE B C     1 
ATOM   6942  O O     . ILE B  1 304 ? 55.754  10.794  -7.189  1.00 23.78 ? 1335 ILE B O     1 
ATOM   6943  C CB    . ILE B  1 304 ? 53.419  9.728   -9.382  1.00 25.84 ? 1335 ILE B CB    1 
ATOM   6944  C CG1   . ILE B  1 304 ? 52.136  8.897   -9.291  1.00 27.58 ? 1335 ILE B CG1   1 
ATOM   6945  C CG2   . ILE B  1 304 ? 54.646  8.842   -9.498  1.00 25.53 ? 1335 ILE B CG2   1 
ATOM   6946  C CD1   . ILE B  1 304 ? 51.224  9.054   -10.501 1.00 28.87 ? 1335 ILE B CD1   1 
ATOM   6947  N N     . LEU B  1 305 ? 55.327  12.078  -8.998  1.00 20.37 ? 1336 LEU B N     1 
ATOM   6948  C CA    . LEU B  1 305 ? 56.669  12.644  -9.032  1.00 16.15 ? 1336 LEU B CA    1 
ATOM   6949  C C     . LEU B  1 305 ? 56.995  13.285  -7.685  1.00 15.80 ? 1336 LEU B C     1 
ATOM   6950  O O     . LEU B  1 305 ? 58.022  12.960  -7.077  1.00 20.28 ? 1336 LEU B O     1 
ATOM   6951  C CB    . LEU B  1 305 ? 56.789  13.659  -10.173 1.00 10.33 ? 1336 LEU B CB    1 
ATOM   6952  C CG    . LEU B  1 305 ? 57.702  13.268  -11.350 1.00 6.05  ? 1336 LEU B CG    1 
ATOM   6953  C CD1   . LEU B  1 305 ? 57.220  11.985  -12.000 1.00 2.15  ? 1336 LEU B CD1   1 
ATOM   6954  C CD2   . LEU B  1 305 ? 57.723  14.395  -12.374 1.00 3.67  ? 1336 LEU B CD2   1 
ATOM   6955  N N     . ILE B  1 306 ? 56.123  14.171  -7.204  1.00 12.42 ? 1337 ILE B N     1 
ATOM   6956  C CA    . ILE B  1 306 ? 56.357  14.802  -5.909  1.00 12.64 ? 1337 ILE B CA    1 
ATOM   6957  C C     . ILE B  1 306 ? 56.678  13.698  -4.906  1.00 11.60 ? 1337 ILE B C     1 
ATOM   6958  O O     . ILE B  1 306 ? 57.557  13.835  -4.059  1.00 9.34  ? 1337 ILE B O     1 
ATOM   6959  C CB    . ILE B  1 306 ? 55.113  15.599  -5.406  1.00 12.53 ? 1337 ILE B CB    1 
ATOM   6960  C CG1   . ILE B  1 306 ? 55.393  17.102  -5.500  1.00 17.19 ? 1337 ILE B CG1   1 
ATOM   6961  C CG2   . ILE B  1 306 ? 54.830  15.297  -3.934  1.00 15.27 ? 1337 ILE B CG2   1 
ATOM   6962  C CD1   . ILE B  1 306 ? 54.166  17.947  -5.633  1.00 11.67 ? 1337 ILE B CD1   1 
ATOM   6963  N N     . GLY B  1 307 ? 55.952  12.596  -5.009  1.00 9.90  ? 1338 GLY B N     1 
ATOM   6964  C CA    . GLY B  1 307 ? 56.198  11.505  -4.099  1.00 9.26  ? 1338 GLY B CA    1 
ATOM   6965  C C     . GLY B  1 307 ? 57.634  11.056  -4.230  1.00 10.94 ? 1338 GLY B C     1 
ATOM   6966  O O     . GLY B  1 307 ? 58.389  11.090  -3.254  1.00 8.64  ? 1338 GLY B O     1 
ATOM   6967  N N     . GLU B  1 308 ? 58.003  10.625  -5.437  1.00 12.83 ? 1339 GLU B N     1 
ATOM   6968  C CA    . GLU B  1 308 ? 59.358  10.159  -5.724  1.00 16.15 ? 1339 GLU B CA    1 
ATOM   6969  C C     . GLU B  1 308 ? 60.342  11.115  -5.081  1.00 15.76 ? 1339 GLU B C     1 
ATOM   6970  O O     . GLU B  1 308 ? 61.138  10.718  -4.231  1.00 17.28 ? 1339 GLU B O     1 
ATOM   6971  C CB    . GLU B  1 308 ? 59.610  10.125  -7.230  1.00 14.34 ? 1339 GLU B CB    1 
ATOM   6972  C CG    . GLU B  1 308 ? 59.175  8.843   -7.903  1.00 17.69 ? 1339 GLU B CG    1 
ATOM   6973  C CD    . GLU B  1 308 ? 58.926  9.049   -9.375  1.00 20.97 ? 1339 GLU B CD    1 
ATOM   6974  O OE1   . GLU B  1 308 ? 59.076  10.199  -9.847  1.00 24.04 ? 1339 GLU B OE1   1 
ATOM   6975  O OE2   . GLU B  1 308 ? 58.580  8.069   -10.064 1.00 21.61 ? 1339 GLU B OE2   1 
ATOM   6976  N N     . THR B  1 309 ? 60.283  12.378  -5.492  1.00 12.19 ? 1340 THR B N     1 
ATOM   6977  C CA    . THR B  1 309 ? 61.161  13.387  -4.937  1.00 8.36  ? 1340 THR B CA    1 
ATOM   6978  C C     . THR B  1 309 ? 61.267  13.234  -3.422  1.00 8.97  ? 1340 THR B C     1 
ATOM   6979  O O     . THR B  1 309 ? 62.315  12.880  -2.911  1.00 12.66 ? 1340 THR B O     1 
ATOM   6980  C CB    . THR B  1 309 ? 60.652  14.770  -5.271  1.00 8.76  ? 1340 THR B CB    1 
ATOM   6981  O OG1   . THR B  1 309 ? 60.796  14.999  -6.682  1.00 9.80  ? 1340 THR B OG1   1 
ATOM   6982  C CG2   . THR B  1 309 ? 61.429  15.810  -4.486  1.00 9.74  ? 1340 THR B CG2   1 
ATOM   6983  N N     . ILE B  1 310 ? 60.182  13.483  -2.701  1.00 12.52 ? 1341 ILE B N     1 
ATOM   6984  C CA    . ILE B  1 310 ? 60.189  13.334  -1.244  1.00 13.44 ? 1341 ILE B CA    1 
ATOM   6985  C C     . ILE B  1 310 ? 60.913  12.048  -0.846  1.00 13.37 ? 1341 ILE B C     1 
ATOM   6986  O O     . ILE B  1 310 ? 61.588  12.008  0.185   1.00 14.35 ? 1341 ILE B O     1 
ATOM   6987  C CB    . ILE B  1 310 ? 58.737  13.286  -0.650  1.00 13.34 ? 1341 ILE B CB    1 
ATOM   6988  C CG1   . ILE B  1 310 ? 57.995  14.596  -0.947  1.00 13.99 ? 1341 ILE B CG1   1 
ATOM   6989  C CG2   . ILE B  1 310 ? 58.793  13.032  0.862   1.00 13.01 ? 1341 ILE B CG2   1 
ATOM   6990  C CD1   . ILE B  1 310 ? 58.156  15.686  0.121   1.00 15.14 ? 1341 ILE B CD1   1 
ATOM   6991  N N     . LYS B  1 311 ? 60.769  11.002  -1.659  1.00 11.27 ? 1342 LYS B N     1 
ATOM   6992  C CA    . LYS B  1 311 ? 61.424  9.722   -1.378  1.00 12.45 ? 1342 LYS B CA    1 
ATOM   6993  C C     . LYS B  1 311 ? 62.947  9.819   -1.625  1.00 13.47 ? 1342 LYS B C     1 
ATOM   6994  O O     . LYS B  1 311 ? 63.760  9.688   -0.693  1.00 13.13 ? 1342 LYS B O     1 
ATOM   6995  C CB    . LYS B  1 311 ? 60.829  8.618   -2.258  1.00 11.26 ? 1342 LYS B CB    1 
ATOM   6996  C CG    . LYS B  1 311 ? 61.654  7.344   -2.289  1.00 7.04  ? 1342 LYS B CG    1 
ATOM   6997  C CD    . LYS B  1 311 ? 61.164  6.357   -1.236  1.00 4.88  ? 1342 LYS B CD    1 
ATOM   6998  C CE    . LYS B  1 311 ? 61.077  4.940   -1.811  1.00 2.00  ? 1342 LYS B CE    1 
ATOM   6999  N NZ    . LYS B  1 311 ? 61.287  3.892   -0.773  1.00 2.00  ? 1342 LYS B NZ    1 
ATOM   7000  N N     . ILE B  1 312 ? 63.315  10.047  -2.887  1.00 12.93 ? 1343 ILE B N     1 
ATOM   7001  C CA    . ILE B  1 312 ? 64.705  10.167  -3.295  1.00 13.93 ? 1343 ILE B CA    1 
ATOM   7002  C C     . ILE B  1 312 ? 65.490  11.124  -2.396  1.00 15.06 ? 1343 ILE B C     1 
ATOM   7003  O O     . ILE B  1 312 ? 66.684  10.938  -2.177  1.00 15.31 ? 1343 ILE B O     1 
ATOM   7004  C CB    . ILE B  1 312 ? 64.798  10.633  -4.771  1.00 12.64 ? 1343 ILE B CB    1 
ATOM   7005  C CG1   . ILE B  1 312 ? 64.280  9.522   -5.682  1.00 16.76 ? 1343 ILE B CG1   1 
ATOM   7006  C CG2   . ILE B  1 312 ? 66.245  10.973  -5.143  1.00 12.68 ? 1343 ILE B CG2   1 
ATOM   7007  C CD1   . ILE B  1 312 ? 64.363  9.844   -7.164  1.00 18.31 ? 1343 ILE B CD1   1 
ATOM   7008  N N     . VAL B  1 313 ? 64.838  12.150  -1.871  1.00 12.80 ? 1344 VAL B N     1 
ATOM   7009  C CA    . VAL B  1 313 ? 65.547  13.065  -0.995  1.00 11.70 ? 1344 VAL B CA    1 
ATOM   7010  C C     . VAL B  1 313 ? 65.791  12.351  0.336   1.00 15.36 ? 1344 VAL B C     1 
ATOM   7011  O O     . VAL B  1 313 ? 66.923  11.988  0.660   1.00 15.73 ? 1344 VAL B O     1 
ATOM   7012  C CB    . VAL B  1 313 ? 64.742  14.351  -0.751  1.00 12.94 ? 1344 VAL B CB    1 
ATOM   7013  C CG1   . VAL B  1 313 ? 65.160  14.991  0.578   1.00 9.41  ? 1344 VAL B CG1   1 
ATOM   7014  C CG2   . VAL B  1 313 ? 64.945  15.324  -1.918  1.00 9.03  ? 1344 VAL B CG2   1 
ATOM   7015  N N     . ILE B  1 314 ? 64.722  12.124  1.094   1.00 23.07 ? 1345 ILE B N     1 
ATOM   7016  C CA    . ILE B  1 314 ? 64.839  11.446  2.386   1.00 25.28 ? 1345 ILE B CA    1 
ATOM   7017  C C     . ILE B  1 314 ? 65.715  10.188  2.364   1.00 27.37 ? 1345 ILE B C     1 
ATOM   7018  O O     . ILE B  1 314 ? 66.692  10.098  3.101   1.00 25.84 ? 1345 ILE B O     1 
ATOM   7019  C CB    . ILE B  1 314 ? 63.451  11.042  2.943   1.00 27.09 ? 1345 ILE B CB    1 
ATOM   7020  C CG1   . ILE B  1 314 ? 62.649  12.300  3.312   1.00 28.18 ? 1345 ILE B CG1   1 
ATOM   7021  C CG2   . ILE B  1 314 ? 63.619  10.115  4.149   1.00 24.56 ? 1345 ILE B CG2   1 
ATOM   7022  C CD1   . ILE B  1 314 ? 61.112  12.103  3.278   1.00 26.36 ? 1345 ILE B CD1   1 
ATOM   7023  N N     . GLU B  1 315 ? 65.371  9.232   1.508   1.00 25.05 ? 1346 GLU B N     1 
ATOM   7024  C CA    . GLU B  1 315 ? 66.100  7.974   1.433   1.00 28.40 ? 1346 GLU B CA    1 
ATOM   7025  C C     . GLU B  1 315 ? 67.493  7.973   0.799   1.00 28.49 ? 1346 GLU B C     1 
ATOM   7026  O O     . GLU B  1 315 ? 68.326  7.128   1.152   1.00 29.61 ? 1346 GLU B O     1 
ATOM   7027  C CB    . GLU B  1 315 ? 65.215  6.935   0.759   1.00 31.20 ? 1346 GLU B CB    1 
ATOM   7028  C CG    . GLU B  1 315 ? 63.853  6.820   1.432   1.00 39.25 ? 1346 GLU B CG    1 
ATOM   7029  C CD    . GLU B  1 315 ? 63.303  5.406   1.440   1.00 41.93 ? 1346 GLU B CD    1 
ATOM   7030  O OE1   . GLU B  1 315 ? 64.103  4.452   1.436   1.00 44.88 ? 1346 GLU B OE1   1 
ATOM   7031  O OE2   . GLU B  1 315 ? 62.064  5.252   1.451   1.00 43.05 ? 1346 GLU B OE2   1 
ATOM   7032  N N     . ASP B  1 316 ? 67.751  8.887   -0.135  1.00 24.95 ? 1347 ASP B N     1 
ATOM   7033  C CA    . ASP B  1 316 ? 69.073  8.971   -0.751  1.00 20.19 ? 1347 ASP B CA    1 
ATOM   7034  C C     . ASP B  1 316 ? 69.723  10.213  -0.183  1.00 18.94 ? 1347 ASP B C     1 
ATOM   7035  O O     . ASP B  1 316 ? 70.238  10.182  0.939   1.00 22.76 ? 1347 ASP B O     1 
ATOM   7036  C CB    . ASP B  1 316 ? 68.966  9.098   -2.256  1.00 20.09 ? 1347 ASP B CB    1 
ATOM   7037  C CG    . ASP B  1 316 ? 68.641  7.791   -2.912  1.00 25.10 ? 1347 ASP B CG    1 
ATOM   7038  O OD1   . ASP B  1 316 ? 68.876  6.738   -2.276  1.00 25.82 ? 1347 ASP B OD1   1 
ATOM   7039  O OD2   . ASP B  1 316 ? 68.146  7.814   -4.060  1.00 26.99 ? 1347 ASP B OD2   1 
ATOM   7040  N N     . TYR B  1 317 ? 69.701  11.294  -0.960  1.00 12.23 ? 1348 TYR B N     1 
ATOM   7041  C CA    . TYR B  1 317 ? 70.234  12.584  -0.535  1.00 8.20  ? 1348 TYR B CA    1 
ATOM   7042  C C     . TYR B  1 317 ? 70.407  12.607  0.981   1.00 3.69  ? 1348 TYR B C     1 
ATOM   7043  O O     . TYR B  1 317 ? 71.466  12.248  1.469   1.00 6.73  ? 1348 TYR B O     1 
ATOM   7044  C CB    . TYR B  1 317 ? 69.263  13.655  -0.982  1.00 2.72  ? 1348 TYR B CB    1 
ATOM   7045  C CG    . TYR B  1 317 ? 69.679  15.078  -0.767  1.00 2.00  ? 1348 TYR B CG    1 
ATOM   7046  C CD1   . TYR B  1 317 ? 69.998  15.893  -1.854  1.00 2.00  ? 1348 TYR B CD1   1 
ATOM   7047  C CD2   . TYR B  1 317 ? 69.608  15.659  0.500   1.00 2.00  ? 1348 TYR B CD2   1 
ATOM   7048  C CE1   . TYR B  1 317 ? 70.218  17.252  -1.691  1.00 2.00  ? 1348 TYR B CE1   1 
ATOM   7049  C CE2   . TYR B  1 317 ? 69.826  17.025  0.679   1.00 2.00  ? 1348 TYR B CE2   1 
ATOM   7050  C CZ    . TYR B  1 317 ? 70.123  17.819  -0.422  1.00 2.00  ? 1348 TYR B CZ    1 
ATOM   7051  O OH    . TYR B  1 317 ? 70.283  19.181  -0.249  1.00 7.10  ? 1348 TYR B OH    1 
ATOM   7052  N N     . VAL B  1 318 ? 69.377  12.985  1.731   1.00 5.05  ? 1349 VAL B N     1 
ATOM   7053  C CA    . VAL B  1 318 ? 69.473  12.998  3.203   1.00 10.15 ? 1349 VAL B CA    1 
ATOM   7054  C C     . VAL B  1 318 ? 70.192  11.799  3.822   1.00 13.06 ? 1349 VAL B C     1 
ATOM   7055  O O     . VAL B  1 318 ? 70.959  11.958  4.763   1.00 11.90 ? 1349 VAL B O     1 
ATOM   7056  C CB    . VAL B  1 318 ? 68.094  13.035  3.884   1.00 10.94 ? 1349 VAL B CB    1 
ATOM   7057  C CG1   . VAL B  1 318 ? 68.284  13.133  5.408   1.00 4.70  ? 1349 VAL B CG1   1 
ATOM   7058  C CG2   . VAL B  1 318 ? 67.260  14.190  3.331   1.00 5.65  ? 1349 VAL B CG2   1 
ATOM   7059  N N     . GLN B  1 319 ? 69.911  10.600  3.330   1.00 16.58 ? 1350 GLN B N     1 
ATOM   7060  C CA    . GLN B  1 319 ? 70.570  9.416   3.867   1.00 24.05 ? 1350 GLN B CA    1 
ATOM   7061  C C     . GLN B  1 319 ? 72.082  9.648   3.856   1.00 27.94 ? 1350 GLN B C     1 
ATOM   7062  O O     . GLN B  1 319 ? 72.735  9.712   4.910   1.00 29.97 ? 1350 GLN B O     1 
ATOM   7063  C CB    . GLN B  1 319 ? 70.236  8.182   3.023   1.00 25.29 ? 1350 GLN B CB    1 
ATOM   7064  C CG    . GLN B  1 319 ? 71.114  6.982   3.295   1.00 29.25 ? 1350 GLN B CG    1 
ATOM   7065  C CD    . GLN B  1 319 ? 70.915  6.416   4.691   1.00 37.28 ? 1350 GLN B CD    1 
ATOM   7066  O OE1   . GLN B  1 319 ? 71.383  6.991   5.689   1.00 36.42 ? 1350 GLN B OE1   1 
ATOM   7067  N NE2   . GLN B  1 319 ? 70.223  5.278   4.774   1.00 39.36 ? 1350 GLN B NE2   1 
ATOM   7068  N N     . HIS B  1 320 ? 72.622  9.774   2.648   1.00 28.76 ? 1351 HIS B N     1 
ATOM   7069  C CA    . HIS B  1 320 ? 74.043  10.007  2.447   1.00 30.07 ? 1351 HIS B CA    1 
ATOM   7070  C C     . HIS B  1 320 ? 74.512  11.157  3.333   1.00 27.46 ? 1351 HIS B C     1 
ATOM   7071  O O     . HIS B  1 320 ? 75.421  10.997  4.147   1.00 27.63 ? 1351 HIS B O     1 
ATOM   7072  C CB    . HIS B  1 320 ? 74.283  10.313  0.967   1.00 34.17 ? 1351 HIS B CB    1 
ATOM   7073  C CG    . HIS B  1 320 ? 75.462  11.194  0.707   1.00 41.19 ? 1351 HIS B CG    1 
ATOM   7074  N ND1   . HIS B  1 320 ? 76.702  10.694  0.379   1.00 44.26 ? 1351 HIS B ND1   1 
ATOM   7075  C CD2   . HIS B  1 320 ? 75.582  12.544  0.690   1.00 45.87 ? 1351 HIS B CD2   1 
ATOM   7076  C CE1   . HIS B  1 320 ? 77.538  11.694  0.171   1.00 47.53 ? 1351 HIS B CE1   1 
ATOM   7077  N NE2   . HIS B  1 320 ? 76.884  12.828  0.353   1.00 46.63 ? 1351 HIS B NE2   1 
ATOM   7078  N N     . LEU B  1 321 ? 73.874  12.311  3.177   1.00 21.13 ? 1352 LEU B N     1 
ATOM   7079  C CA    . LEU B  1 321 ? 74.220  13.493  3.951   1.00 20.51 ? 1352 LEU B CA    1 
ATOM   7080  C C     . LEU B  1 321 ? 74.451  13.204  5.427   1.00 17.93 ? 1352 LEU B C     1 
ATOM   7081  O O     . LEU B  1 321 ? 75.182  13.933  6.095   1.00 19.98 ? 1352 LEU B O     1 
ATOM   7082  C CB    . LEU B  1 321 ? 73.125  14.549  3.819   1.00 20.09 ? 1352 LEU B CB    1 
ATOM   7083  C CG    . LEU B  1 321 ? 73.591  15.993  3.629   1.00 23.11 ? 1352 LEU B CG    1 
ATOM   7084  C CD1   . LEU B  1 321 ? 74.859  16.007  2.772   1.00 19.14 ? 1352 LEU B CD1   1 
ATOM   7085  C CD2   . LEU B  1 321 ? 72.493  16.819  2.967   1.00 17.97 ? 1352 LEU B CD2   1 
ATOM   7086  N N     . SER B  1 322 ? 73.842  12.135  5.927   1.00 19.45 ? 1353 SER B N     1 
ATOM   7087  C CA    . SER B  1 322 ? 73.962  11.779  7.340   1.00 20.73 ? 1353 SER B CA    1 
ATOM   7088  C C     . SER B  1 322 ? 75.043  10.745  7.621   1.00 24.41 ? 1353 SER B C     1 
ATOM   7089  O O     . SER B  1 322 ? 75.561  10.648  8.742   1.00 22.03 ? 1353 SER B O     1 
ATOM   7090  C CB    . SER B  1 322 ? 72.618  11.257  7.869   1.00 19.05 ? 1353 SER B CB    1 
ATOM   7091  O OG    . SER B  1 322 ? 72.589  9.835   7.911   1.00 14.99 ? 1353 SER B OG    1 
ATOM   7092  N N     . GLY B  1 323 ? 75.374  9.962   6.599   1.00 28.62 ? 1354 GLY B N     1 
ATOM   7093  C CA    . GLY B  1 323 ? 76.382  8.932   6.758   1.00 31.47 ? 1354 GLY B CA    1 
ATOM   7094  C C     . GLY B  1 323 ? 76.024  7.962   7.861   1.00 34.03 ? 1354 GLY B C     1 
ATOM   7095  O O     . GLY B  1 323 ? 76.890  7.265   8.381   1.00 36.49 ? 1354 GLY B O     1 
ATOM   7096  N N     . TYR B  1 324 ? 74.751  7.920   8.238   1.00 36.92 ? 1355 TYR B N     1 
ATOM   7097  C CA    . TYR B  1 324 ? 74.335  6.998   9.284   1.00 41.27 ? 1355 TYR B CA    1 
ATOM   7098  C C     . TYR B  1 324 ? 74.391  5.617   8.668   1.00 42.36 ? 1355 TYR B C     1 
ATOM   7099  O O     . TYR B  1 324 ? 74.408  5.474   7.444   1.00 41.61 ? 1355 TYR B O     1 
ATOM   7100  C CB    . TYR B  1 324 ? 72.900  7.278   9.736   1.00 42.56 ? 1355 TYR B CB    1 
ATOM   7101  C CG    . TYR B  1 324 ? 72.709  8.587   10.462  1.00 45.09 ? 1355 TYR B CG    1 
ATOM   7102  C CD1   . TYR B  1 324 ? 73.803  9.348   10.866  1.00 44.98 ? 1355 TYR B CD1   1 
ATOM   7103  C CD2   . TYR B  1 324 ? 71.425  9.067   10.746  1.00 43.70 ? 1355 TYR B CD2   1 
ATOM   7104  C CE1   . TYR B  1 324 ? 73.626  10.552  11.533  1.00 44.73 ? 1355 TYR B CE1   1 
ATOM   7105  C CE2   . TYR B  1 324 ? 71.237  10.267  11.411  1.00 43.02 ? 1355 TYR B CE2   1 
ATOM   7106  C CZ    . TYR B  1 324 ? 72.341  11.002  11.804  1.00 45.75 ? 1355 TYR B CZ    1 
ATOM   7107  O OH    . TYR B  1 324 ? 72.168  12.174  12.490  1.00 46.94 ? 1355 TYR B OH    1 
ATOM   7108  N N     . HIS B  1 325 ? 74.424  4.600   9.514   1.00 43.61 ? 1356 HIS B N     1 
ATOM   7109  C CA    . HIS B  1 325 ? 74.453  3.243   9.014   1.00 46.84 ? 1356 HIS B CA    1 
ATOM   7110  C C     . HIS B  1 325 ? 73.020  2.753   8.886   1.00 48.86 ? 1356 HIS B C     1 
ATOM   7111  O O     . HIS B  1 325 ? 72.724  1.859   8.083   1.00 50.67 ? 1356 HIS B O     1 
ATOM   7112  C CB    . HIS B  1 325 ? 75.254  2.348   9.953   1.00 48.42 ? 1356 HIS B CB    1 
ATOM   7113  C CG    . HIS B  1 325 ? 76.715  2.319   9.634   1.00 52.72 ? 1356 HIS B CG    1 
ATOM   7114  N ND1   . HIS B  1 325 ? 77.690  2.571   10.574  1.00 53.09 ? 1356 HIS B ND1   1 
ATOM   7115  C CD2   . HIS B  1 325 ? 77.364  2.107   8.463   1.00 49.63 ? 1356 HIS B CD2   1 
ATOM   7116  C CE1   . HIS B  1 325 ? 78.877  2.516   9.998   1.00 52.21 ? 1356 HIS B CE1   1 
ATOM   7117  N NE2   . HIS B  1 325 ? 78.707  2.237   8.717   1.00 51.29 ? 1356 HIS B NE2   1 
ATOM   7118  N N     . PHE B  1 326 ? 72.133  3.348   9.679   1.00 51.72 ? 1357 PHE B N     1 
ATOM   7119  C CA    . PHE B  1 326 ? 70.720  3.000   9.648   1.00 49.54 ? 1357 PHE B CA    1 
ATOM   7120  C C     . PHE B  1 326 ? 70.174  3.507   8.316   1.00 47.76 ? 1357 PHE B C     1 
ATOM   7121  O O     . PHE B  1 326 ? 70.442  4.645   7.934   1.00 47.45 ? 1357 PHE B O     1 
ATOM   7122  C CB    . PHE B  1 326 ? 69.999  3.686   10.815  1.00 56.08 ? 1357 PHE B CB    1 
ATOM   7123  C CG    . PHE B  1 326 ? 68.499  3.771   10.654  1.00 58.16 ? 1357 PHE B CG    1 
ATOM   7124  C CD1   . PHE B  1 326 ? 67.677  2.736   11.096  1.00 59.79 ? 1357 PHE B CD1   1 
ATOM   7125  C CD2   . PHE B  1 326 ? 67.911  4.894   10.076  1.00 60.12 ? 1357 PHE B CD2   1 
ATOM   7126  C CE1   . PHE B  1 326 ? 66.298  2.818   10.968  1.00 61.88 ? 1357 PHE B CE1   1 
ATOM   7127  C CE2   . PHE B  1 326 ? 66.531  4.987   9.943   1.00 60.82 ? 1357 PHE B CE2   1 
ATOM   7128  C CZ    . PHE B  1 326 ? 65.721  3.944   10.391  1.00 63.03 ? 1357 PHE B CZ    1 
ATOM   7129  N N     . LYS B  1 327 ? 69.431  2.668   7.601   1.00 44.71 ? 1358 LYS B N     1 
ATOM   7130  C CA    . LYS B  1 327 ? 68.874  3.088   6.323   1.00 43.83 ? 1358 LYS B CA    1 
ATOM   7131  C C     . LYS B  1 327 ? 67.606  3.902   6.536   1.00 42.70 ? 1358 LYS B C     1 
ATOM   7132  O O     . LYS B  1 327 ? 66.564  3.376   6.927   1.00 42.70 ? 1358 LYS B O     1 
ATOM   7133  C CB    . LYS B  1 327 ? 68.581  1.884   5.425   1.00 42.53 ? 1358 LYS B CB    1 
ATOM   7134  C CG    . LYS B  1 327 ? 69.413  1.891   4.152   1.00 43.06 ? 1358 LYS B CG    1 
ATOM   7135  C CD    . LYS B  1 327 ? 68.742  1.135   3.020   1.00 43.54 ? 1358 LYS B CD    1 
ATOM   7136  C CE    . LYS B  1 327 ? 69.534  1.287   1.719   1.00 43.66 ? 1358 LYS B CE    1 
ATOM   7137  N NZ    . LYS B  1 327 ? 69.959  -0.024  1.143   1.00 46.27 ? 1358 LYS B NZ    1 
ATOM   7138  N N     . LEU B  1 328 ? 67.710  5.200   6.285   1.00 40.68 ? 1359 LEU B N     1 
ATOM   7139  C CA    . LEU B  1 328 ? 66.582  6.091   6.446   1.00 36.51 ? 1359 LEU B CA    1 
ATOM   7140  C C     . LEU B  1 328 ? 65.450  5.638   5.543   1.00 37.73 ? 1359 LEU B C     1 
ATOM   7141  O O     . LEU B  1 328 ? 65.666  5.331   4.361   1.00 35.02 ? 1359 LEU B O     1 
ATOM   7142  C CB    . LEU B  1 328 ? 66.994  7.518   6.095   1.00 32.97 ? 1359 LEU B CB    1 
ATOM   7143  C CG    . LEU B  1 328 ? 67.757  8.251   7.198   1.00 32.58 ? 1359 LEU B CG    1 
ATOM   7144  C CD1   . LEU B  1 328 ? 67.716  9.754   6.933   1.00 31.67 ? 1359 LEU B CD1   1 
ATOM   7145  C CD2   . LEU B  1 328 ? 67.157  7.911   8.569   1.00 29.72 ? 1359 LEU B CD2   1 
ATOM   7146  N N     . LYS B  1 329 ? 64.247  5.598   6.113   1.00 39.36 ? 1360 LYS B N     1 
ATOM   7147  C CA    . LYS B  1 329 ? 63.053  5.184   5.384   1.00 41.03 ? 1360 LYS B CA    1 
ATOM   7148  C C     . LYS B  1 329 ? 62.009  6.292   5.306   1.00 40.81 ? 1360 LYS B C     1 
ATOM   7149  O O     . LYS B  1 329 ? 61.800  7.037   6.267   1.00 39.20 ? 1360 LYS B O     1 
ATOM   7150  C CB    . LYS B  1 329 ? 62.425  3.957   6.053   1.00 40.26 ? 1360 LYS B CB    1 
ATOM   7151  C CG    . LYS B  1 329 ? 61.402  3.226   5.198   1.00 38.33 ? 1360 LYS B CG    1 
ATOM   7152  C CD    . LYS B  1 329 ? 60.998  1.920   5.869   1.00 40.69 ? 1360 LYS B CD    1 
ATOM   7153  C CE    . LYS B  1 329 ? 59.570  1.504   5.529   1.00 40.35 ? 1360 LYS B CE    1 
ATOM   7154  N NZ    . LYS B  1 329 ? 58.822  1.043   6.733   1.00 38.03 ? 1360 LYS B NZ    1 
ATOM   7155  N N     . PHE B  1 330 ? 61.359  6.395   4.151   1.00 41.98 ? 1361 PHE B N     1 
ATOM   7156  C CA    . PHE B  1 330 ? 60.309  7.386   3.955   1.00 41.92 ? 1361 PHE B CA    1 
ATOM   7157  C C     . PHE B  1 330 ? 58.968  6.655   3.897   1.00 41.74 ? 1361 PHE B C     1 
ATOM   7158  O O     . PHE B  1 330 ? 58.619  6.035   2.890   1.00 39.71 ? 1361 PHE B O     1 
ATOM   7159  C CB    . PHE B  1 330 ? 60.532  8.173   2.659   1.00 41.09 ? 1361 PHE B CB    1 
ATOM   7160  C CG    . PHE B  1 330 ? 59.319  8.916   2.191   1.00 36.36 ? 1361 PHE B CG    1 
ATOM   7161  C CD1   . PHE B  1 330 ? 58.554  9.659   3.090   1.00 35.58 ? 1361 PHE B CD1   1 
ATOM   7162  C CD2   . PHE B  1 330 ? 58.909  8.836   0.867   1.00 34.81 ? 1361 PHE B CD2   1 
ATOM   7163  C CE1   . PHE B  1 330 ? 57.390  10.307  2.674   1.00 34.40 ? 1361 PHE B CE1   1 
ATOM   7164  C CE2   . PHE B  1 330 ? 57.749  9.480   0.440   1.00 30.91 ? 1361 PHE B CE2   1 
ATOM   7165  C CZ    . PHE B  1 330 ? 56.988  10.213  1.345   1.00 31.55 ? 1361 PHE B CZ    1 
ATOM   7166  N N     . ASP B  1 331 ? 58.228  6.734   4.996   1.00 41.95 ? 1362 ASP B N     1 
ATOM   7167  C CA    . ASP B  1 331 ? 56.928  6.087   5.103   1.00 39.95 ? 1362 ASP B CA    1 
ATOM   7168  C C     . ASP B  1 331 ? 56.060  6.921   6.044   1.00 38.00 ? 1362 ASP B C     1 
ATOM   7169  O O     . ASP B  1 331 ? 56.235  6.869   7.263   1.00 35.92 ? 1362 ASP B O     1 
ATOM   7170  C CB    . ASP B  1 331 ? 57.105  4.677   5.657   1.00 38.91 ? 1362 ASP B CB    1 
ATOM   7171  C CG    . ASP B  1 331 ? 55.817  4.086   6.136   1.00 42.91 ? 1362 ASP B CG    1 
ATOM   7172  O OD1   . ASP B  1 331 ? 54.781  4.315   5.475   1.00 44.42 ? 1362 ASP B OD1   1 
ATOM   7173  O OD2   . ASP B  1 331 ? 55.839  3.395   7.174   1.00 45.20 ? 1362 ASP B OD2   1 
ATOM   7174  N N     . PRO B  1 332 ? 55.120  7.711   5.484   1.00 36.72 ? 1363 PRO B N     1 
ATOM   7175  C CA    . PRO B  1 332 ? 54.217  8.576   6.262   1.00 33.37 ? 1363 PRO B CA    1 
ATOM   7176  C C     . PRO B  1 332 ? 53.365  7.818   7.271   1.00 33.21 ? 1363 PRO B C     1 
ATOM   7177  O O     . PRO B  1 332 ? 52.908  8.382   8.273   1.00 31.69 ? 1363 PRO B O     1 
ATOM   7178  C CB    . PRO B  1 332 ? 53.369  9.269   5.196   1.00 34.00 ? 1363 PRO B CB    1 
ATOM   7179  C CG    . PRO B  1 332 ? 54.175  9.144   3.930   1.00 31.83 ? 1363 PRO B CG    1 
ATOM   7180  C CD    . PRO B  1 332 ? 54.864  7.821   4.038   1.00 32.23 ? 1363 PRO B CD    1 
ATOM   7181  N N     . GLU B  1 333 ? 53.177  6.533   6.992   1.00 33.89 ? 1364 GLU B N     1 
ATOM   7182  C CA    . GLU B  1 333 ? 52.400  5.645   7.837   1.00 35.30 ? 1364 GLU B CA    1 
ATOM   7183  C C     . GLU B  1 333 ? 52.986  5.588   9.225   1.00 34.24 ? 1364 GLU B C     1 
ATOM   7184  O O     . GLU B  1 333 ? 52.485  4.889   10.092  1.00 34.98 ? 1364 GLU B O     1 
ATOM   7185  C CB    . GLU B  1 333 ? 52.407  4.245   7.252   1.00 39.30 ? 1364 GLU B CB    1 
ATOM   7186  C CG    . GLU B  1 333 ? 51.396  4.030   6.158   1.00 44.17 ? 1364 GLU B CG    1 
ATOM   7187  C CD    . GLU B  1 333 ? 50.711  2.694   6.296   1.00 49.60 ? 1364 GLU B CD    1 
ATOM   7188  O OE1   . GLU B  1 333 ? 50.254  2.142   5.269   1.00 50.84 ? 1364 GLU B OE1   1 
ATOM   7189  O OE2   . GLU B  1 333 ? 50.637  2.194   7.442   1.00 51.30 ? 1364 GLU B OE2   1 
ATOM   7190  N N     . LEU B  1 334 ? 54.065  6.322   9.429   1.00 33.61 ? 1365 LEU B N     1 
ATOM   7191  C CA    . LEU B  1 334 ? 54.734  6.343   10.717  1.00 33.89 ? 1365 LEU B CA    1 
ATOM   7192  C C     . LEU B  1 334 ? 54.175  7.449   11.600  1.00 32.57 ? 1365 LEU B C     1 
ATOM   7193  O O     . LEU B  1 334 ? 54.277  7.391   12.827  1.00 34.36 ? 1365 LEU B O     1 
ATOM   7194  C CB    . LEU B  1 334 ? 56.239  6.570   10.524  1.00 36.26 ? 1365 LEU B CB    1 
ATOM   7195  C CG    . LEU B  1 334 ? 57.050  5.580   9.686   1.00 35.47 ? 1365 LEU B CG    1 
ATOM   7196  C CD1   . LEU B  1 334 ? 58.502  6.016   9.669   1.00 36.07 ? 1365 LEU B CD1   1 
ATOM   7197  C CD2   . LEU B  1 334 ? 56.927  4.185   10.269  1.00 36.68 ? 1365 LEU B CD2   1 
ATOM   7198  N N     . LEU B  1 335 ? 53.588  8.458   10.972  1.00 29.81 ? 1366 LEU B N     1 
ATOM   7199  C CA    . LEU B  1 335 ? 53.045  9.583   11.707  1.00 30.74 ? 1366 LEU B CA    1 
ATOM   7200  C C     . LEU B  1 335 ? 51.543  9.491   11.887  1.00 31.58 ? 1366 LEU B C     1 
ATOM   7201  O O     . LEU B  1 335 ? 50.927  10.376  12.487  1.00 31.25 ? 1366 LEU B O     1 
ATOM   7202  C CB    . LEU B  1 335 ? 53.401  10.870  10.970  1.00 34.18 ? 1366 LEU B CB    1 
ATOM   7203  C CG    . LEU B  1 335 ? 54.901  11.005  10.679  1.00 37.37 ? 1366 LEU B CG    1 
ATOM   7204  C CD1   . LEU B  1 335 ? 55.176  12.232  9.812   1.00 33.91 ? 1366 LEU B CD1   1 
ATOM   7205  C CD2   . LEU B  1 335 ? 55.651  11.103  12.006  1.00 38.03 ? 1366 LEU B CD2   1 
ATOM   7206  N N     . PHE B  1 336 ? 50.971  8.401   11.380  1.00 30.83 ? 1367 PHE B N     1 
ATOM   7207  C CA    . PHE B  1 336 ? 49.534  8.171   11.427  1.00 27.19 ? 1367 PHE B CA    1 
ATOM   7208  C C     . PHE B  1 336 ? 48.961  7.924   12.814  1.00 30.40 ? 1367 PHE B C     1 
ATOM   7209  O O     . PHE B  1 336 ? 47.866  7.388   12.962  1.00 31.99 ? 1367 PHE B O     1 
ATOM   7210  C CB    . PHE B  1 336 ? 49.184  7.019   10.496  1.00 23.63 ? 1367 PHE B CB    1 
ATOM   7211  C CG    . PHE B  1 336 ? 49.235  7.389   9.038   1.00 18.98 ? 1367 PHE B CG    1 
ATOM   7212  C CD1   . PHE B  1 336 ? 49.112  6.414   8.050   1.00 18.26 ? 1367 PHE B CD1   1 
ATOM   7213  C CD2   . PHE B  1 336 ? 49.407  8.707   8.650   1.00 18.47 ? 1367 PHE B CD2   1 
ATOM   7214  C CE1   . PHE B  1 336 ? 49.159  6.746   6.694   1.00 13.35 ? 1367 PHE B CE1   1 
ATOM   7215  C CE2   . PHE B  1 336 ? 49.454  9.044   7.297   1.00 20.24 ? 1367 PHE B CE2   1 
ATOM   7216  C CZ    . PHE B  1 336 ? 49.329  8.056   6.317   1.00 13.96 ? 1367 PHE B CZ    1 
ATOM   7217  N N     . ASN B  1 337 ? 49.713  8.321   13.829  1.00 33.23 ? 1368 ASN B N     1 
ATOM   7218  C CA    . ASN B  1 337 ? 49.283  8.192   15.211  1.00 37.85 ? 1368 ASN B CA    1 
ATOM   7219  C C     . ASN B  1 337 ? 50.217  9.102   15.985  1.00 38.49 ? 1368 ASN B C     1 
ATOM   7220  O O     . ASN B  1 337 ? 50.394  8.977   17.199  1.00 40.79 ? 1368 ASN B O     1 
ATOM   7221  C CB    . ASN B  1 337 ? 49.396  6.743   15.693  1.00 36.87 ? 1368 ASN B CB    1 
ATOM   7222  C CG    . ASN B  1 337 ? 50.728  6.117   15.357  1.00 44.19 ? 1368 ASN B CG    1 
ATOM   7223  O OD1   . ASN B  1 337 ? 51.382  6.496   14.382  1.00 45.41 ? 1368 ASN B OD1   1 
ATOM   7224  N ND2   . ASN B  1 337 ? 51.142  5.148   16.165  1.00 46.03 ? 1368 ASN B ND2   1 
ATOM   7225  N N     . GLN B  1 338 ? 50.808  10.028  15.242  1.00 39.40 ? 1369 GLN B N     1 
ATOM   7226  C CA    . GLN B  1 338 ? 51.736  10.996  15.783  1.00 40.39 ? 1369 GLN B CA    1 
ATOM   7227  C C     . GLN B  1 338 ? 51.159  12.375  15.592  1.00 38.54 ? 1369 GLN B C     1 
ATOM   7228  O O     . GLN B  1 338 ? 50.748  12.723  14.489  1.00 38.83 ? 1369 GLN B O     1 
ATOM   7229  C CB    . GLN B  1 338 ? 53.065  10.892  15.048  1.00 48.54 ? 1369 GLN B CB    1 
ATOM   7230  C CG    . GLN B  1 338 ? 53.665  9.504   15.121  1.00 53.74 ? 1369 GLN B CG    1 
ATOM   7231  C CD    . GLN B  1 338 ? 53.706  8.980   16.541  1.00 59.20 ? 1369 GLN B CD    1 
ATOM   7232  O OE1   . GLN B  1 338 ? 53.698  9.757   17.503  1.00 61.01 ? 1369 GLN B OE1   1 
ATOM   7233  N NE2   . GLN B  1 338 ? 53.750  7.659   16.684  1.00 61.20 ? 1369 GLN B NE2   1 
ATOM   7234  N N     . GLN B  1 339 ? 51.126  13.150  16.669  1.00 36.16 ? 1370 GLN B N     1 
ATOM   7235  C CA    . GLN B  1 339 ? 50.598  14.506  16.619  1.00 39.25 ? 1370 GLN B CA    1 
ATOM   7236  C C     . GLN B  1 339 ? 51.465  15.368  15.701  1.00 37.06 ? 1370 GLN B C     1 
ATOM   7237  O O     . GLN B  1 339 ? 52.245  16.206  16.153  1.00 38.02 ? 1370 GLN B O     1 
ATOM   7238  C CB    . GLN B  1 339 ? 50.567  15.092  18.025  1.00 40.97 ? 1370 GLN B CB    1 
ATOM   7239  C CG    . GLN B  1 339 ? 49.168  15.188  18.600  1.00 50.54 ? 1370 GLN B CG    1 
ATOM   7240  C CD    . GLN B  1 339 ? 49.146  15.833  19.972  1.00 53.81 ? 1370 GLN B CD    1 
ATOM   7241  O OE1   . GLN B  1 339 ? 49.883  15.419  20.871  1.00 53.99 ? 1370 GLN B OE1   1 
ATOM   7242  N NE2   . GLN B  1 339 ? 48.297  16.851  20.142  1.00 53.17 ? 1370 GLN B NE2   1 
ATOM   7243  N N     . PHE B  1 340 ? 51.308  15.162  14.401  1.00 35.83 ? 1371 PHE B N     1 
ATOM   7244  C CA    . PHE B  1 340 ? 52.097  15.874  13.417  1.00 32.51 ? 1371 PHE B CA    1 
ATOM   7245  C C     . PHE B  1 340 ? 51.255  16.816  12.557  1.00 31.63 ? 1371 PHE B C     1 
ATOM   7246  O O     . PHE B  1 340 ? 50.212  16.447  12.024  1.00 29.23 ? 1371 PHE B O     1 
ATOM   7247  C CB    . PHE B  1 340 ? 52.838  14.852  12.540  1.00 33.99 ? 1371 PHE B CB    1 
ATOM   7248  C CG    . PHE B  1 340 ? 53.547  15.456  11.370  1.00 37.01 ? 1371 PHE B CG    1 
ATOM   7249  C CD1   . PHE B  1 340 ? 54.694  16.217  11.557  1.00 38.50 ? 1371 PHE B CD1   1 
ATOM   7250  C CD2   . PHE B  1 340 ? 53.069  15.268  10.075  1.00 37.06 ? 1371 PHE B CD2   1 
ATOM   7251  C CE1   . PHE B  1 340 ? 55.358  16.786  10.471  1.00 37.67 ? 1371 PHE B CE1   1 
ATOM   7252  C CE2   . PHE B  1 340 ? 53.729  15.835  8.984   1.00 38.22 ? 1371 PHE B CE2   1 
ATOM   7253  C CZ    . PHE B  1 340 ? 54.875  16.593  9.187   1.00 37.12 ? 1371 PHE B CZ    1 
ATOM   7254  N N     . GLN B  1 341 ? 51.736  18.042  12.423  1.00 29.85 ? 1372 GLN B N     1 
ATOM   7255  C CA    . GLN B  1 341 ? 51.056  19.053  11.639  1.00 28.48 ? 1372 GLN B CA    1 
ATOM   7256  C C     . GLN B  1 341 ? 51.415  18.972  10.157  1.00 26.75 ? 1372 GLN B C     1 
ATOM   7257  O O     . GLN B  1 341 ? 52.402  19.552  9.715   1.00 27.16 ? 1372 GLN B O     1 
ATOM   7258  C CB    . GLN B  1 341 ? 51.414  20.436  12.179  1.00 31.11 ? 1372 GLN B CB    1 
ATOM   7259  C CG    . GLN B  1 341 ? 50.699  20.790  13.472  1.00 37.89 ? 1372 GLN B CG    1 
ATOM   7260  C CD    . GLN B  1 341 ? 49.202  20.860  13.292  1.00 41.44 ? 1372 GLN B CD    1 
ATOM   7261  O OE1   . GLN B  1 341 ? 48.709  20.999  12.169  1.00 42.06 ? 1372 GLN B OE1   1 
ATOM   7262  N NE2   . GLN B  1 341 ? 48.464  20.763  14.394  1.00 43.22 ? 1372 GLN B NE2   1 
ATOM   7263  N N     . TYR B  1 342 ? 50.603  18.252  9.394   1.00 24.19 ? 1373 TYR B N     1 
ATOM   7264  C CA    . TYR B  1 342 ? 50.830  18.108  7.966   1.00 20.62 ? 1373 TYR B CA    1 
ATOM   7265  C C     . TYR B  1 342 ? 50.707  19.437  7.232   1.00 23.35 ? 1373 TYR B C     1 
ATOM   7266  O O     . TYR B  1 342 ? 49.789  19.632  6.431   1.00 25.29 ? 1373 TYR B O     1 
ATOM   7267  C CB    . TYR B  1 342 ? 49.845  17.099  7.384   1.00 17.76 ? 1373 TYR B CB    1 
ATOM   7268  C CG    . TYR B  1 342 ? 50.255  15.680  7.666   1.00 18.81 ? 1373 TYR B CG    1 
ATOM   7269  C CD1   . TYR B  1 342 ? 49.763  14.992  8.778   1.00 20.82 ? 1373 TYR B CD1   1 
ATOM   7270  C CD2   . TYR B  1 342 ? 51.184  15.036  6.857   1.00 20.65 ? 1373 TYR B CD2   1 
ATOM   7271  C CE1   . TYR B  1 342 ? 50.197  13.687  9.077   1.00 19.97 ? 1373 TYR B CE1   1 
ATOM   7272  C CE2   . TYR B  1 342 ? 51.622  13.746  7.143   1.00 19.21 ? 1373 TYR B CE2   1 
ATOM   7273  C CZ    . TYR B  1 342 ? 51.130  13.070  8.251   1.00 19.96 ? 1373 TYR B CZ    1 
ATOM   7274  O OH    . TYR B  1 342 ? 51.566  11.772  8.505   1.00 19.45 ? 1373 TYR B OH    1 
ATOM   7275  N N     . GLN B  1 343 ? 51.644  20.342  7.504   1.00 25.79 ? 1374 GLN B N     1 
ATOM   7276  C CA    . GLN B  1 343 ? 51.684  21.666  6.877   1.00 27.36 ? 1374 GLN B CA    1 
ATOM   7277  C C     . GLN B  1 343 ? 53.099  22.229  7.027   1.00 27.42 ? 1374 GLN B C     1 
ATOM   7278  O O     . GLN B  1 343 ? 53.880  21.745  7.854   1.00 28.24 ? 1374 GLN B O     1 
ATOM   7279  C CB    . GLN B  1 343 ? 50.689  22.603  7.550   1.00 31.34 ? 1374 GLN B CB    1 
ATOM   7280  C CG    . GLN B  1 343 ? 51.231  23.304  8.791   1.00 35.18 ? 1374 GLN B CG    1 
ATOM   7281  C CD    . GLN B  1 343 ? 50.125  23.847  9.685   1.00 37.93 ? 1374 GLN B CD    1 
ATOM   7282  O OE1   . GLN B  1 343 ? 49.925  25.062  9.782   1.00 38.78 ? 1374 GLN B OE1   1 
ATOM   7283  N NE2   . GLN B  1 343 ? 49.400  22.946  10.344  1.00 37.87 ? 1374 GLN B NE2   1 
ATOM   7284  N N     . ASN B  1 344 ? 53.437  23.254  6.252   1.00 24.44 ? 1375 ASN B N     1 
ATOM   7285  C CA    . ASN B  1 344 ? 54.779  23.806  6.347   1.00 23.40 ? 1375 ASN B CA    1 
ATOM   7286  C C     . ASN B  1 344 ? 55.009  25.218  5.787   1.00 26.26 ? 1375 ASN B C     1 
ATOM   7287  O O     . ASN B  1 344 ? 54.498  25.600  4.724   1.00 24.16 ? 1375 ASN B O     1 
ATOM   7288  C CB    . ASN B  1 344 ? 55.765  22.831  5.689   1.00 25.33 ? 1375 ASN B CB    1 
ATOM   7289  C CG    . ASN B  1 344 ? 57.217  23.224  5.909   1.00 23.04 ? 1375 ASN B CG    1 
ATOM   7290  O OD1   . ASN B  1 344 ? 57.896  22.687  6.795   1.00 17.02 ? 1375 ASN B OD1   1 
ATOM   7291  N ND2   . ASN B  1 344 ? 57.701  24.160  5.097   1.00 20.27 ? 1375 ASN B ND2   1 
ATOM   7292  N N     . ARG B  1 345 ? 55.802  25.986  6.528   1.00 25.10 ? 1376 ARG B N     1 
ATOM   7293  C CA    . ARG B  1 345 ? 56.163  27.338  6.131   1.00 24.61 ? 1376 ARG B CA    1 
ATOM   7294  C C     . ARG B  1 345 ? 57.679  27.358  6.180   1.00 22.90 ? 1376 ARG B C     1 
ATOM   7295  O O     . ARG B  1 345 ? 58.263  26.946  7.183   1.00 24.22 ? 1376 ARG B O     1 
ATOM   7296  C CB    . ARG B  1 345 ? 55.606  28.354  7.115   1.00 25.29 ? 1376 ARG B CB    1 
ATOM   7297  C CG    . ARG B  1 345 ? 55.595  29.752  6.561   1.00 27.13 ? 1376 ARG B CG    1 
ATOM   7298  C CD    . ARG B  1 345 ? 54.411  29.947  5.646   1.00 28.79 ? 1376 ARG B CD    1 
ATOM   7299  N NE    . ARG B  1 345 ? 53.689  31.168  5.980   1.00 30.64 ? 1376 ARG B NE    1 
ATOM   7300  C CZ    . ARG B  1 345 ? 52.620  31.207  6.771   1.00 27.92 ? 1376 ARG B CZ    1 
ATOM   7301  N NH1   . ARG B  1 345 ? 52.149  30.097  7.306   1.00 28.31 ? 1376 ARG B NH1   1 
ATOM   7302  N NH2   . ARG B  1 345 ? 52.030  32.357  7.038   1.00 24.46 ? 1376 ARG B NH2   1 
ATOM   7303  N N     . ILE B  1 346 ? 58.310  27.825  5.102   1.00 21.29 ? 1377 ILE B N     1 
ATOM   7304  C CA    . ILE B  1 346 ? 59.779  27.866  5.003   1.00 16.03 ? 1377 ILE B CA    1 
ATOM   7305  C C     . ILE B  1 346 ? 60.475  29.018  5.754   1.00 16.77 ? 1377 ILE B C     1 
ATOM   7306  O O     . ILE B  1 346 ? 60.202  30.212  5.507   1.00 17.35 ? 1377 ILE B O     1 
ATOM   7307  C CB    . ILE B  1 346 ? 60.216  27.880  3.529   1.00 11.12 ? 1377 ILE B CB    1 
ATOM   7308  C CG1   . ILE B  1 346 ? 60.487  26.458  3.073   1.00 6.38  ? 1377 ILE B CG1   1 
ATOM   7309  C CG2   . ILE B  1 346 ? 61.474  28.693  3.358   1.00 11.89 ? 1377 ILE B CG2   1 
ATOM   7310  C CD1   . ILE B  1 346 ? 59.614  26.005  2.006   1.00 2.00  ? 1377 ILE B CD1   1 
ATOM   7311  N N     . ALA B  1 347 ? 61.395  28.635  6.650   1.00 17.55 ? 1378 ALA B N     1 
ATOM   7312  C CA    . ALA B  1 347 ? 62.152  29.571  7.494   1.00 15.12 ? 1378 ALA B CA    1 
ATOM   7313  C C     . ALA B  1 347 ? 63.385  30.190  6.854   1.00 15.73 ? 1378 ALA B C     1 
ATOM   7314  O O     . ALA B  1 347 ? 64.081  29.543  6.080   1.00 16.84 ? 1378 ALA B O     1 
ATOM   7315  C CB    . ALA B  1 347 ? 62.556  28.892  8.785   1.00 13.37 ? 1378 ALA B CB    1 
ATOM   7316  N N     . SER B  1 348 ? 63.654  31.446  7.204   1.00 14.42 ? 1379 SER B N     1 
ATOM   7317  C CA    . SER B  1 348 ? 64.805  32.167  6.669   1.00 17.09 ? 1379 SER B CA    1 
ATOM   7318  C C     . SER B  1 348 ? 66.075  31.360  6.930   1.00 17.28 ? 1379 SER B C     1 
ATOM   7319  O O     . SER B  1 348 ? 66.844  31.076  6.010   1.00 17.27 ? 1379 SER B O     1 
ATOM   7320  C CB    . SER B  1 348 ? 64.917  33.542  7.336   1.00 12.59 ? 1379 SER B CB    1 
ATOM   7321  O OG    . SER B  1 348 ? 65.668  34.438  6.528   1.00 16.42 ? 1379 SER B OG    1 
ATOM   7322  N N     . GLU B  1 349 ? 66.266  31.012  8.203   1.00 15.29 ? 1380 GLU B N     1 
ATOM   7323  C CA    . GLU B  1 349 ? 67.397  30.245  8.691   1.00 10.79 ? 1380 GLU B CA    1 
ATOM   7324  C C     . GLU B  1 349 ? 67.659  29.099  7.745   1.00 12.39 ? 1380 GLU B C     1 
ATOM   7325  O O     . GLU B  1 349 ? 68.686  29.057  7.069   1.00 17.25 ? 1380 GLU B O     1 
ATOM   7326  C CB    . GLU B  1 349 ? 67.078  29.710  10.082  1.00 9.49  ? 1380 GLU B CB    1 
ATOM   7327  C CG    . GLU B  1 349 ? 67.119  30.773  11.176  1.00 14.86 ? 1380 GLU B CG    1 
ATOM   7328  C CD    . GLU B  1 349 ? 65.838  31.623  11.285  1.00 18.92 ? 1380 GLU B CD    1 
ATOM   7329  O OE1   . GLU B  1 349 ? 64.953  31.521  10.412  1.00 17.43 ? 1380 GLU B OE1   1 
ATOM   7330  O OE2   . GLU B  1 349 ? 65.713  32.411  12.253  1.00 16.57 ? 1380 GLU B OE2   1 
ATOM   7331  N N     . PHE B  1 350 ? 66.726  28.167  7.686   1.00 14.37 ? 1381 PHE B N     1 
ATOM   7332  C CA    . PHE B  1 350 ? 66.867  27.023  6.802   1.00 15.73 ? 1381 PHE B CA    1 
ATOM   7333  C C     . PHE B  1 350 ? 67.412  27.447  5.425   1.00 16.93 ? 1381 PHE B C     1 
ATOM   7334  O O     . PHE B  1 350 ? 68.177  26.714  4.797   1.00 20.48 ? 1381 PHE B O     1 
ATOM   7335  C CB    . PHE B  1 350 ? 65.507  26.348  6.644   1.00 20.06 ? 1381 PHE B CB    1 
ATOM   7336  C CG    . PHE B  1 350 ? 65.557  25.006  5.956   1.00 26.70 ? 1381 PHE B CG    1 
ATOM   7337  C CD1   . PHE B  1 350 ? 66.183  23.915  6.561   1.00 26.37 ? 1381 PHE B CD1   1 
ATOM   7338  C CD2   . PHE B  1 350 ? 64.926  24.816  4.726   1.00 25.16 ? 1381 PHE B CD2   1 
ATOM   7339  C CE1   . PHE B  1 350 ? 66.177  22.656  5.962   1.00 24.04 ? 1381 PHE B CE1   1 
ATOM   7340  C CE2   . PHE B  1 350 ? 64.918  23.559  4.118   1.00 26.24 ? 1381 PHE B CE2   1 
ATOM   7341  C CZ    . PHE B  1 350 ? 65.546  22.478  4.743   1.00 26.58 ? 1381 PHE B CZ    1 
ATOM   7342  N N     . ASN B  1 351 ? 67.021  28.628  4.957   1.00 16.08 ? 1382 ASN B N     1 
ATOM   7343  C CA    . ASN B  1 351 ? 67.489  29.105  3.666   1.00 15.71 ? 1382 ASN B CA    1 
ATOM   7344  C C     . ASN B  1 351 ? 68.964  29.399  3.719   1.00 17.41 ? 1382 ASN B C     1 
ATOM   7345  O O     . ASN B  1 351 ? 69.719  28.978  2.851   1.00 19.29 ? 1382 ASN B O     1 
ATOM   7346  C CB    . ASN B  1 351 ? 66.752  30.377  3.235   1.00 17.12 ? 1382 ASN B CB    1 
ATOM   7347  C CG    . ASN B  1 351 ? 67.299  30.958  1.926   1.00 21.48 ? 1382 ASN B CG    1 
ATOM   7348  O OD1   . ASN B  1 351 ? 67.612  32.151  1.836   1.00 19.43 ? 1382 ASN B OD1   1 
ATOM   7349  N ND2   . ASN B  1 351 ? 67.422  30.112  0.909   1.00 24.15 ? 1382 ASN B ND2   1 
ATOM   7350  N N     . THR B  1 352 ? 69.374  30.144  4.734   1.00 19.38 ? 1383 THR B N     1 
ATOM   7351  C CA    . THR B  1 352 ? 70.774  30.498  4.880   1.00 22.40 ? 1383 THR B CA    1 
ATOM   7352  C C     . THR B  1 352 ? 71.621  29.240  5.022   1.00 24.83 ? 1383 THR B C     1 
ATOM   7353  O O     . THR B  1 352 ? 72.533  29.022  4.214   1.00 24.91 ? 1383 THR B O     1 
ATOM   7354  C CB    . THR B  1 352 ? 71.005  31.434  6.093   1.00 23.76 ? 1383 THR B CB    1 
ATOM   7355  O OG1   . THR B  1 352 ? 69.994  32.454  6.118   1.00 22.45 ? 1383 THR B OG1   1 
ATOM   7356  C CG2   . THR B  1 352 ? 72.365  32.112  5.978   1.00 21.47 ? 1383 THR B CG2   1 
ATOM   7357  N N     . LEU B  1 353 ? 71.326  28.406  6.022   1.00 24.17 ? 1384 LEU B N     1 
ATOM   7358  C CA    . LEU B  1 353 ? 72.088  27.168  6.198   1.00 29.54 ? 1384 LEU B CA    1 
ATOM   7359  C C     . LEU B  1 353 ? 72.317  26.499  4.856   1.00 29.35 ? 1384 LEU B C     1 
ATOM   7360  O O     . LEU B  1 353 ? 73.281  25.753  4.679   1.00 31.26 ? 1384 LEU B O     1 
ATOM   7361  C CB    . LEU B  1 353 ? 71.355  26.170  7.084   1.00 30.01 ? 1384 LEU B CB    1 
ATOM   7362  C CG    . LEU B  1 353 ? 70.453  26.657  8.207   1.00 37.51 ? 1384 LEU B CG    1 
ATOM   7363  C CD1   . LEU B  1 353 ? 69.778  25.444  8.834   1.00 39.45 ? 1384 LEU B CD1   1 
ATOM   7364  C CD2   . LEU B  1 353 ? 71.261  27.412  9.257   1.00 36.71 ? 1384 LEU B CD2   1 
ATOM   7365  N N     . TYR B  1 354 ? 71.419  26.761  3.913   1.00 34.44 ? 1385 TYR B N     1 
ATOM   7366  C CA    . TYR B  1 354 ? 71.531  26.172  2.594   1.00 36.19 ? 1385 TYR B CA    1 
ATOM   7367  C C     . TYR B  1 354 ? 72.785  26.601  1.861   1.00 35.40 ? 1385 TYR B C     1 
ATOM   7368  O O     . TYR B  1 354 ? 73.409  25.781  1.201   1.00 37.52 ? 1385 TYR B O     1 
ATOM   7369  C CB    . TYR B  1 354 ? 70.300  26.494  1.753   1.00 50.28 ? 1385 TYR B CB    1 
ATOM   7370  C CG    . TYR B  1 354 ? 70.619  26.952  0.346   1.00 62.36 ? 1385 TYR B CG    1 
ATOM   7371  C CD1   . TYR B  1 354 ? 71.143  26.064  -0.601  1.00 68.04 ? 1385 TYR B CD1   1 
ATOM   7372  C CD2   . TYR B  1 354 ? 70.428  28.284  -0.030  1.00 65.43 ? 1385 TYR B CD2   1 
ATOM   7373  C CE1   . TYR B  1 354 ? 71.472  26.495  -1.884  1.00 70.72 ? 1385 TYR B CE1   1 
ATOM   7374  C CE2   . TYR B  1 354 ? 70.751  28.726  -1.304  1.00 69.17 ? 1385 TYR B CE2   1 
ATOM   7375  C CZ    . TYR B  1 354 ? 71.275  27.829  -2.227  1.00 73.49 ? 1385 TYR B CZ    1 
ATOM   7376  O OH    . TYR B  1 354 ? 71.617  28.270  -3.487  1.00 76.85 ? 1385 TYR B OH    1 
ATOM   7377  N N     . HIS B  1 355 ? 73.130  27.878  1.963   1.00 29.64 ? 1386 HIS B N     1 
ATOM   7378  C CA    . HIS B  1 355 ? 74.313  28.439  1.304   1.00 28.83 ? 1386 HIS B CA    1 
ATOM   7379  C C     . HIS B  1 355 ? 75.546  27.555  1.507   1.00 23.88 ? 1386 HIS B C     1 
ATOM   7380  O O     . HIS B  1 355 ? 76.469  27.870  2.260   1.00 23.04 ? 1386 HIS B O     1 
ATOM   7381  C CB    . HIS B  1 355 ? 74.537  29.863  1.830   1.00 32.95 ? 1386 HIS B CB    1 
ATOM   7382  C CG    . HIS B  1 355 ? 73.308  30.726  1.752   1.00 38.32 ? 1386 HIS B CG    1 
ATOM   7383  N ND1   . HIS B  1 355 ? 72.235  30.416  0.942   1.00 41.63 ? 1386 HIS B ND1   1 
ATOM   7384  C CD2   . HIS B  1 355 ? 72.981  31.881  2.378   1.00 40.29 ? 1386 HIS B CD2   1 
ATOM   7385  C CE1   . HIS B  1 355 ? 71.303  31.341  1.071   1.00 39.14 ? 1386 HIS B CE1   1 
ATOM   7386  N NE2   . HIS B  1 355 ? 71.731  32.241  1.937   1.00 41.34 ? 1386 HIS B NE2   1 
ATOM   7387  N N     . TRP B  1 356 ? 75.527  26.450  0.772   1.00 21.50 ? 1387 TRP B N     1 
ATOM   7388  C CA    . TRP B  1 356 ? 76.527  25.392  0.793   1.00 18.55 ? 1387 TRP B CA    1 
ATOM   7389  C C     . TRP B  1 356 ? 77.562  25.505  -0.311  1.00 21.76 ? 1387 TRP B C     1 
ATOM   7390  O O     . TRP B  1 356 ? 77.943  24.488  -0.922  1.00 21.04 ? 1387 TRP B O     1 
ATOM   7391  C CB    . TRP B  1 356 ? 75.823  24.064  0.610   1.00 14.72 ? 1387 TRP B CB    1 
ATOM   7392  C CG    . TRP B  1 356 ? 75.034  23.606  1.764   1.00 8.79  ? 1387 TRP B CG    1 
ATOM   7393  C CD1   . TRP B  1 356 ? 74.963  24.181  3.001   1.00 3.62  ? 1387 TRP B CD1   1 
ATOM   7394  C CD2   . TRP B  1 356 ? 74.308  22.378  1.844   1.00 5.63  ? 1387 TRP B CD2   1 
ATOM   7395  N NE1   . TRP B  1 356 ? 74.246  23.375  3.843   1.00 2.00  ? 1387 TRP B NE1   1 
ATOM   7396  C CE2   . TRP B  1 356 ? 73.838  22.260  3.156   1.00 2.00  ? 1387 TRP B CE2   1 
ATOM   7397  C CE3   . TRP B  1 356 ? 74.020  21.354  0.920   1.00 6.86  ? 1387 TRP B CE3   1 
ATOM   7398  C CZ2   . TRP B  1 356 ? 73.096  21.164  3.578   1.00 4.85  ? 1387 TRP B CZ2   1 
ATOM   7399  C CZ3   . TRP B  1 356 ? 73.282  20.261  1.338   1.00 2.00  ? 1387 TRP B CZ3   1 
ATOM   7400  C CH2   . TRP B  1 356 ? 72.828  20.175  2.658   1.00 9.00  ? 1387 TRP B CH2   1 
ATOM   7401  N N     . HIS B  1 357 ? 78.009  26.729  -0.564  1.00 24.43 ? 1388 HIS B N     1 
ATOM   7402  C CA    . HIS B  1 357 ? 78.997  27.000  -1.601  1.00 28.99 ? 1388 HIS B CA    1 
ATOM   7403  C C     . HIS B  1 357 ? 80.196  26.041  -1.623  1.00 24.48 ? 1388 HIS B C     1 
ATOM   7404  O O     . HIS B  1 357 ? 80.564  25.521  -2.681  1.00 17.76 ? 1388 HIS B O     1 
ATOM   7405  C CB    . HIS B  1 357 ? 79.432  28.448  -1.456  1.00 37.68 ? 1388 HIS B CB    1 
ATOM   7406  C CG    . HIS B  1 357 ? 78.288  29.378  -1.180  1.00 48.31 ? 1388 HIS B CG    1 
ATOM   7407  N ND1   . HIS B  1 357 ? 78.223  30.169  -0.052  1.00 51.85 ? 1388 HIS B ND1   1 
ATOM   7408  C CD2   . HIS B  1 357 ? 77.157  29.633  -1.883  1.00 49.07 ? 1388 HIS B CD2   1 
ATOM   7409  C CE1   . HIS B  1 357 ? 77.103  30.870  -0.071  1.00 53.37 ? 1388 HIS B CE1   1 
ATOM   7410  N NE2   . HIS B  1 357 ? 76.439  30.563  -1.171  1.00 53.24 ? 1388 HIS B NE2   1 
ATOM   7411  N N     . PRO B  1 358 ? 80.833  25.813  -0.459  1.00 21.51 ? 1389 PRO B N     1 
ATOM   7412  C CA    . PRO B  1 358 ? 81.981  24.903  -0.375  1.00 22.99 ? 1389 PRO B CA    1 
ATOM   7413  C C     . PRO B  1 358 ? 81.847  23.652  -1.261  1.00 24.99 ? 1389 PRO B C     1 
ATOM   7414  O O     . PRO B  1 358 ? 82.849  23.115  -1.757  1.00 24.61 ? 1389 PRO B O     1 
ATOM   7415  C CB    . PRO B  1 358 ? 82.056  24.542  1.116   1.00 19.06 ? 1389 PRO B CB    1 
ATOM   7416  C CG    . PRO B  1 358 ? 81.042  25.424  1.817   1.00 20.58 ? 1389 PRO B CG    1 
ATOM   7417  C CD    . PRO B  1 358 ? 80.559  26.449  0.841   1.00 21.97 ? 1389 PRO B CD    1 
ATOM   7418  N N     . LEU B  1 359 ? 80.615  23.192  -1.460  1.00 25.53 ? 1390 LEU B N     1 
ATOM   7419  C CA    . LEU B  1 359 ? 80.373  22.008  -2.285  1.00 26.65 ? 1390 LEU B CA    1 
ATOM   7420  C C     . LEU B  1 359 ? 80.942  22.210  -3.672  1.00 27.78 ? 1390 LEU B C     1 
ATOM   7421  O O     . LEU B  1 359 ? 81.529  21.316  -4.277  1.00 23.88 ? 1390 LEU B O     1 
ATOM   7422  C CB    . LEU B  1 359 ? 78.875  21.764  -2.412  1.00 31.82 ? 1390 LEU B CB    1 
ATOM   7423  C CG    . LEU B  1 359 ? 78.122  21.297  -1.169  1.00 36.12 ? 1390 LEU B CG    1 
ATOM   7424  C CD1   . LEU B  1 359 ? 76.751  20.803  -1.572  1.00 35.61 ? 1390 LEU B CD1   1 
ATOM   7425  C CD2   . LEU B  1 359 ? 78.902  20.178  -0.490  1.00 38.76 ? 1390 LEU B CD2   1 
ATOM   7426  N N     . LEU B  1 360 ? 80.723  23.418  -4.162  1.00 27.95 ? 1391 LEU B N     1 
ATOM   7427  C CA    . LEU B  1 360 ? 81.160  23.842  -5.472  1.00 29.44 ? 1391 LEU B CA    1 
ATOM   7428  C C     . LEU B  1 360 ? 82.629  23.580  -5.759  1.00 31.83 ? 1391 LEU B C     1 
ATOM   7429  O O     . LEU B  1 360 ? 83.490  24.000  -4.992  1.00 30.91 ? 1391 LEU B O     1 
ATOM   7430  C CB    . LEU B  1 360 ? 80.885  25.330  -5.619  1.00 30.02 ? 1391 LEU B CB    1 
ATOM   7431  C CG    . LEU B  1 360 ? 79.872  25.711  -6.691  1.00 28.57 ? 1391 LEU B CG    1 
ATOM   7432  C CD1   . LEU B  1 360 ? 79.663  27.204  -6.626  1.00 25.25 ? 1391 LEU B CD1   1 
ATOM   7433  C CD2   . LEU B  1 360 ? 80.368  25.290  -8.077  1.00 27.47 ? 1391 LEU B CD2   1 
ATOM   7434  N N     . PRO B  1 361 ? 82.931  22.882  -6.873  1.00 37.25 ? 1392 PRO B N     1 
ATOM   7435  C CA    . PRO B  1 361 ? 84.321  22.582  -7.246  1.00 35.65 ? 1392 PRO B CA    1 
ATOM   7436  C C     . PRO B  1 361 ? 85.005  23.832  -7.803  1.00 38.44 ? 1392 PRO B C     1 
ATOM   7437  O O     . PRO B  1 361 ? 84.417  24.912  -7.801  1.00 36.12 ? 1392 PRO B O     1 
ATOM   7438  C CB    . PRO B  1 361 ? 84.186  21.480  -8.294  1.00 36.17 ? 1392 PRO B CB    1 
ATOM   7439  C CG    . PRO B  1 361 ? 82.874  21.748  -8.921  1.00 37.37 ? 1392 PRO B CG    1 
ATOM   7440  C CD    . PRO B  1 361 ? 81.975  22.311  -7.840  1.00 33.65 ? 1392 PRO B CD    1 
ATOM   7441  N N     . ASP B  1 362 ? 86.242  23.689  -8.275  1.00 42.47 ? 1393 ASP B N     1 
ATOM   7442  C CA    . ASP B  1 362 ? 86.987  24.832  -8.811  1.00 42.89 ? 1393 ASP B CA    1 
ATOM   7443  C C     . ASP B  1 362 ? 86.863  24.844  -10.315 1.00 40.41 ? 1393 ASP B C     1 
ATOM   7444  O O     . ASP B  1 362 ? 87.033  25.875  -10.970 1.00 39.66 ? 1393 ASP B O     1 
ATOM   7445  C CB    . ASP B  1 362 ? 88.459  24.743  -8.413  1.00 49.07 ? 1393 ASP B CB    1 
ATOM   7446  C CG    . ASP B  1 362 ? 88.658  24.808  -6.914  1.00 55.64 ? 1393 ASP B CG    1 
ATOM   7447  O OD1   . ASP B  1 362 ? 89.012  23.770  -6.318  1.00 59.18 ? 1393 ASP B OD1   1 
ATOM   7448  O OD2   . ASP B  1 362 ? 88.460  25.897  -6.333  1.00 60.33 ? 1393 ASP B OD2   1 
ATOM   7449  N N     . THR B  1 363 ? 86.587  23.662  -10.848 1.00 38.31 ? 1394 THR B N     1 
ATOM   7450  C CA    . THR B  1 363 ? 86.379  23.483  -12.269 1.00 34.98 ? 1394 THR B CA    1 
ATOM   7451  C C     . THR B  1 363 ? 85.291  22.437  -12.371 1.00 33.81 ? 1394 THR B C     1 
ATOM   7452  O O     . THR B  1 363 ? 84.950  21.787  -11.382 1.00 28.58 ? 1394 THR B O     1 
ATOM   7453  C CB    . THR B  1 363 ? 87.615  22.955  -12.983 1.00 31.20 ? 1394 THR B CB    1 
ATOM   7454  O OG1   . THR B  1 363 ? 87.872  21.615  -12.550 1.00 32.43 ? 1394 THR B OG1   1 
ATOM   7455  C CG2   . THR B  1 363 ? 88.798  23.830  -12.685 1.00 33.37 ? 1394 THR B CG2   1 
ATOM   7456  N N     . PHE B  1 364 ? 84.743  22.282  -13.567 1.00 31.67 ? 1395 PHE B N     1 
ATOM   7457  C CA    . PHE B  1 364 ? 83.694  21.310  -13.784 1.00 27.85 ? 1395 PHE B CA    1 
ATOM   7458  C C     . PHE B  1 364 ? 84.186  20.371  -14.848 1.00 28.13 ? 1395 PHE B C     1 
ATOM   7459  O O     . PHE B  1 364 ? 84.252  20.713  -16.028 1.00 27.69 ? 1395 PHE B O     1 
ATOM   7460  C CB    . PHE B  1 364 ? 82.418  22.026  -14.206 1.00 24.26 ? 1395 PHE B CB    1 
ATOM   7461  C CG    . PHE B  1 364 ? 81.873  22.930  -13.141 1.00 14.81 ? 1395 PHE B CG    1 
ATOM   7462  C CD1   . PHE B  1 364 ? 82.047  24.306  -13.220 1.00 11.96 ? 1395 PHE B CD1   1 
ATOM   7463  C CD2   . PHE B  1 364 ? 81.212  22.401  -12.037 1.00 10.32 ? 1395 PHE B CD2   1 
ATOM   7464  C CE1   . PHE B  1 364 ? 81.571  25.143  -12.212 1.00 10.99 ? 1395 PHE B CE1   1 
ATOM   7465  C CE2   . PHE B  1 364 ? 80.736  23.229  -11.027 1.00 7.56  ? 1395 PHE B CE2   1 
ATOM   7466  C CZ    . PHE B  1 364 ? 80.916  24.600  -11.114 1.00 6.90  ? 1395 PHE B CZ    1 
ATOM   7467  N N     . ASN B  1 365 ? 84.556  19.182  -14.405 1.00 31.93 ? 1396 ASN B N     1 
ATOM   7468  C CA    . ASN B  1 365 ? 85.097  18.186  -15.300 1.00 34.97 ? 1396 ASN B CA    1 
ATOM   7469  C C     . ASN B  1 365 ? 84.043  17.270  -15.860 1.00 35.68 ? 1396 ASN B C     1 
ATOM   7470  O O     . ASN B  1 365 ? 83.532  16.376  -15.182 1.00 36.40 ? 1396 ASN B O     1 
ATOM   7471  C CB    . ASN B  1 365 ? 86.188  17.384  -14.588 1.00 34.60 ? 1396 ASN B CB    1 
ATOM   7472  C CG    . ASN B  1 365 ? 86.839  18.169  -13.461 1.00 36.66 ? 1396 ASN B CG    1 
ATOM   7473  O OD1   . ASN B  1 365 ? 87.262  17.586  -12.467 1.00 34.59 ? 1396 ASN B OD1   1 
ATOM   7474  N ND2   . ASN B  1 365 ? 86.920  19.496  -13.607 1.00 36.00 ? 1396 ASN B ND2   1 
ATOM   7475  N N     . ILE B  1 366 ? 83.717  17.527  -17.117 1.00 38.10 ? 1397 ILE B N     1 
ATOM   7476  C CA    . ILE B  1 366 ? 82.741  16.736  -17.834 1.00 41.83 ? 1397 ILE B CA    1 
ATOM   7477  C C     . ILE B  1 366 ? 83.543  15.882  -18.798 1.00 45.94 ? 1397 ILE B C     1 
ATOM   7478  O O     . ILE B  1 366 ? 84.097  16.398  -19.769 1.00 46.65 ? 1397 ILE B O     1 
ATOM   7479  C CB    . ILE B  1 366 ? 81.775  17.631  -18.639 1.00 40.69 ? 1397 ILE B CB    1 
ATOM   7480  C CG1   . ILE B  1 366 ? 81.312  18.809  -17.779 1.00 42.62 ? 1397 ILE B CG1   1 
ATOM   7481  C CG2   . ILE B  1 366 ? 80.561  16.820  -19.072 1.00 39.36 ? 1397 ILE B CG2   1 
ATOM   7482  C CD1   . ILE B  1 366 ? 80.460  18.402  -16.583 1.00 40.30 ? 1397 ILE B CD1   1 
ATOM   7483  N N     . GLU B  1 367 ? 83.623  14.582  -18.526 1.00 49.60 ? 1398 GLU B N     1 
ATOM   7484  C CA    . GLU B  1 367 ? 84.384  13.696  -19.392 1.00 53.16 ? 1398 GLU B CA    1 
ATOM   7485  C C     . GLU B  1 367 ? 85.828  14.195  -19.376 1.00 55.28 ? 1398 GLU B C     1 
ATOM   7486  O O     . GLU B  1 367 ? 86.414  14.423  -18.312 1.00 53.36 ? 1398 GLU B O     1 
ATOM   7487  C CB    . GLU B  1 367 ? 83.831  13.773  -20.812 1.00 54.72 ? 1398 GLU B CB    1 
ATOM   7488  C CG    . GLU B  1 367 ? 83.691  12.453  -21.520 1.00 58.21 ? 1398 GLU B CG    1 
ATOM   7489  C CD    . GLU B  1 367 ? 82.850  12.580  -22.774 1.00 62.56 ? 1398 GLU B CD    1 
ATOM   7490  O OE1   . GLU B  1 367 ? 82.540  13.729  -23.162 1.00 62.13 ? 1398 GLU B OE1   1 
ATOM   7491  O OE2   . GLU B  1 367 ? 82.494  11.540  -23.371 1.00 62.52 ? 1398 GLU B OE2   1 
ATOM   7492  N N     . ASP B  1 368 ? 86.393  14.379  -20.563 1.00 54.59 ? 1399 ASP B N     1 
ATOM   7493  C CA    . ASP B  1 368 ? 87.752  14.866  -20.681 1.00 54.46 ? 1399 ASP B CA    1 
ATOM   7494  C C     . ASP B  1 368 ? 87.817  16.262  -20.095 1.00 53.78 ? 1399 ASP B C     1 
ATOM   7495  O O     . ASP B  1 368 ? 88.383  16.481  -19.031 1.00 57.69 ? 1399 ASP B O     1 
ATOM   7496  C CB    . ASP B  1 368 ? 88.154  14.922  -22.149 1.00 56.42 ? 1399 ASP B CB    1 
ATOM   7497  C CG    . ASP B  1 368 ? 88.041  13.580  -22.828 1.00 62.73 ? 1399 ASP B CG    1 
ATOM   7498  O OD1   . ASP B  1 368 ? 87.779  12.580  -22.123 1.00 62.35 ? 1399 ASP B OD1   1 
ATOM   7499  O OD2   . ASP B  1 368 ? 88.215  13.525  -24.064 1.00 65.27 ? 1399 ASP B OD2   1 
ATOM   7500  N N     . GLN B  1 369 ? 87.214  17.196  -20.813 1.00 52.19 ? 1400 GLN B N     1 
ATOM   7501  C CA    . GLN B  1 369 ? 87.180  18.592  -20.431 1.00 49.42 ? 1400 GLN B CA    1 
ATOM   7502  C C     . GLN B  1 369 ? 87.135  18.930  -18.946 1.00 45.17 ? 1400 GLN B C     1 
ATOM   7503  O O     . GLN B  1 369 ? 86.880  18.088  -18.084 1.00 44.03 ? 1400 GLN B O     1 
ATOM   7504  C CB    . GLN B  1 369 ? 85.995  19.256  -21.117 1.00 54.13 ? 1400 GLN B CB    1 
ATOM   7505  C CG    . GLN B  1 369 ? 86.224  19.507  -22.576 1.00 57.95 ? 1400 GLN B CG    1 
ATOM   7506  C CD    . GLN B  1 369 ? 87.480  20.303  -22.802 1.00 62.69 ? 1400 GLN B CD    1 
ATOM   7507  O OE1   . GLN B  1 369 ? 87.891  21.091  -21.944 1.00 59.57 ? 1400 GLN B OE1   1 
ATOM   7508  N NE2   . GLN B  1 369 ? 88.107  20.105  -23.957 1.00 62.62 ? 1400 GLN B NE2   1 
ATOM   7509  N N     . GLU B  1 370 ? 87.391  20.201  -18.678 1.00 39.40 ? 1401 GLU B N     1 
ATOM   7510  C CA    . GLU B  1 370 ? 87.368  20.763  -17.339 1.00 37.08 ? 1401 GLU B CA    1 
ATOM   7511  C C     . GLU B  1 370 ? 86.905  22.187  -17.596 1.00 33.50 ? 1401 GLU B C     1 
ATOM   7512  O O     . GLU B  1 370 ? 87.436  22.857  -18.490 1.00 31.87 ? 1401 GLU B O     1 
ATOM   7513  C CB    . GLU B  1 370 ? 88.765  20.773  -16.722 1.00 38.27 ? 1401 GLU B CB    1 
ATOM   7514  C CG    . GLU B  1 370 ? 88.959  19.754  -15.614 1.00 47.54 ? 1401 GLU B CG    1 
ATOM   7515  C CD    . GLU B  1 370 ? 90.268  19.955  -14.852 1.00 52.39 ? 1401 GLU B CD    1 
ATOM   7516  O OE1   . GLU B  1 370 ? 90.541  21.108  -14.441 1.00 53.50 ? 1401 GLU B OE1   1 
ATOM   7517  O OE2   . GLU B  1 370 ? 91.022  18.964  -14.665 1.00 52.50 ? 1401 GLU B OE2   1 
ATOM   7518  N N     . TYR B  1 371 ? 85.917  22.654  -16.837 1.00 28.12 ? 1402 TYR B N     1 
ATOM   7519  C CA    . TYR B  1 371 ? 85.414  23.994  -17.067 1.00 23.81 ? 1402 TYR B CA    1 
ATOM   7520  C C     . TYR B  1 371 ? 85.544  24.900  -15.881 1.00 21.64 ? 1402 TYR B C     1 
ATOM   7521  O O     . TYR B  1 371 ? 85.720  24.458  -14.754 1.00 23.62 ? 1402 TYR B O     1 
ATOM   7522  C CB    . TYR B  1 371 ? 83.959  23.947  -17.496 1.00 24.71 ? 1402 TYR B CB    1 
ATOM   7523  C CG    . TYR B  1 371 ? 83.715  23.093  -18.717 1.00 27.23 ? 1402 TYR B CG    1 
ATOM   7524  C CD1   . TYR B  1 371 ? 83.721  23.649  -19.995 1.00 24.28 ? 1402 TYR B CD1   1 
ATOM   7525  C CD2   . TYR B  1 371 ? 83.478  21.718  -18.595 1.00 27.63 ? 1402 TYR B CD2   1 
ATOM   7526  C CE1   . TYR B  1 371 ? 83.496  22.860  -21.119 1.00 24.31 ? 1402 TYR B CE1   1 
ATOM   7527  C CE2   . TYR B  1 371 ? 83.254  20.921  -19.716 1.00 25.48 ? 1402 TYR B CE2   1 
ATOM   7528  C CZ    . TYR B  1 371 ? 83.263  21.499  -20.972 1.00 23.89 ? 1402 TYR B CZ    1 
ATOM   7529  O OH    . TYR B  1 371 ? 83.022  20.721  -22.076 1.00 21.57 ? 1402 TYR B OH    1 
ATOM   7530  N N     . SER B  1 372 ? 85.449  26.186  -16.150 1.00 15.83 ? 1403 SER B N     1 
ATOM   7531  C CA    . SER B  1 372 ? 85.554  27.168  -15.108 1.00 17.20 ? 1403 SER B CA    1 
ATOM   7532  C C     . SER B  1 372 ? 84.165  27.711  -14.901 1.00 21.53 ? 1403 SER B C     1 
ATOM   7533  O O     . SER B  1 372 ? 83.304  27.546  -15.753 1.00 21.71 ? 1403 SER B O     1 
ATOM   7534  C CB    . SER B  1 372 ? 86.465  28.300  -15.556 1.00 20.18 ? 1403 SER B CB    1 
ATOM   7535  O OG    . SER B  1 372 ? 85.783  29.160  -16.461 1.00 14.10 ? 1403 SER B OG    1 
ATOM   7536  N N     . PHE B  1 373 ? 83.943  28.362  -13.770 1.00 25.37 ? 1404 PHE B N     1 
ATOM   7537  C CA    . PHE B  1 373 ? 82.644  28.943  -13.508 1.00 29.24 ? 1404 PHE B CA    1 
ATOM   7538  C C     . PHE B  1 373 ? 82.385  29.844  -14.693 1.00 32.67 ? 1404 PHE B C     1 
ATOM   7539  O O     . PHE B  1 373 ? 81.359  29.735  -15.362 1.00 33.59 ? 1404 PHE B O     1 
ATOM   7540  C CB    . PHE B  1 373 ? 82.684  29.743  -12.210 1.00 30.20 ? 1404 PHE B CB    1 
ATOM   7541  C CG    . PHE B  1 373 ? 82.782  28.880  -10.987 1.00 32.24 ? 1404 PHE B CG    1 
ATOM   7542  C CD1   . PHE B  1 373 ? 83.641  27.782  -10.965 1.00 33.14 ? 1404 PHE B CD1   1 
ATOM   7543  C CD2   . PHE B  1 373 ? 81.997  29.142  -9.868  1.00 34.41 ? 1404 PHE B CD2   1 
ATOM   7544  C CE1   . PHE B  1 373 ? 83.720  26.957  -9.850  1.00 34.59 ? 1404 PHE B CE1   1 
ATOM   7545  C CE2   . PHE B  1 373 ? 82.065  28.322  -8.742  1.00 34.83 ? 1404 PHE B CE2   1 
ATOM   7546  C CZ    . PHE B  1 373 ? 82.929  27.227  -8.734  1.00 36.14 ? 1404 PHE B CZ    1 
ATOM   7547  N N     . LYS B  1 374 ? 83.353  30.704  -14.971 1.00 35.73 ? 1405 LYS B N     1 
ATOM   7548  C CA    . LYS B  1 374 ? 83.268  31.633  -16.087 1.00 41.95 ? 1405 LYS B CA    1 
ATOM   7549  C C     . LYS B  1 374 ? 82.833  30.898  -17.349 1.00 44.28 ? 1405 LYS B C     1 
ATOM   7550  O O     . LYS B  1 374 ? 82.148  31.461  -18.205 1.00 46.46 ? 1405 LYS B O     1 
ATOM   7551  C CB    . LYS B  1 374 ? 84.625  32.302  -16.306 1.00 44.25 ? 1405 LYS B CB    1 
ATOM   7552  C CG    . LYS B  1 374 ? 85.331  32.672  -15.000 1.00 49.67 ? 1405 LYS B CG    1 
ATOM   7553  C CD    . LYS B  1 374 ? 86.130  31.501  -14.434 1.00 51.31 ? 1405 LYS B CD    1 
ATOM   7554  C CE    . LYS B  1 374 ? 85.745  31.174  -12.991 1.00 52.56 ? 1405 LYS B CE    1 
ATOM   7555  N NZ    . LYS B  1 374 ? 86.245  29.815  -12.575 1.00 56.90 ? 1405 LYS B NZ    1 
ATOM   7556  N N     . GLN B  1 375 ? 83.229  29.634  -17.451 1.00 43.53 ? 1406 GLN B N     1 
ATOM   7557  C CA    . GLN B  1 375 ? 82.884  28.810  -18.605 1.00 44.27 ? 1406 GLN B CA    1 
ATOM   7558  C C     . GLN B  1 375 ? 81.469  28.255  -18.465 1.00 42.51 ? 1406 GLN B C     1 
ATOM   7559  O O     . GLN B  1 375 ? 80.565  28.646  -19.203 1.00 45.50 ? 1406 GLN B O     1 
ATOM   7560  C CB    . GLN B  1 375 ? 83.868  27.648  -18.737 1.00 48.76 ? 1406 GLN B CB    1 
ATOM   7561  C CG    . GLN B  1 375 ? 85.307  28.047  -19.014 1.00 52.09 ? 1406 GLN B CG    1 
ATOM   7562  C CD    . GLN B  1 375 ? 86.196  26.839  -19.242 1.00 56.64 ? 1406 GLN B CD    1 
ATOM   7563  O OE1   . GLN B  1 375 ? 86.485  26.083  -18.318 1.00 53.73 ? 1406 GLN B OE1   1 
ATOM   7564  N NE2   . GLN B  1 375 ? 86.629  26.648  -20.480 1.00 57.90 ? 1406 GLN B NE2   1 
ATOM   7565  N N     . PHE B  1 376 ? 81.298  27.340  -17.512 1.00 38.91 ? 1407 PHE B N     1 
ATOM   7566  C CA    . PHE B  1 376 ? 80.022  26.688  -17.217 1.00 33.71 ? 1407 PHE B CA    1 
ATOM   7567  C C     . PHE B  1 376 ? 78.784  27.585  -17.314 1.00 33.48 ? 1407 PHE B C     1 
ATOM   7568  O O     . PHE B  1 376 ? 77.855  27.308  -18.079 1.00 33.68 ? 1407 PHE B O     1 
ATOM   7569  C CB    . PHE B  1 376 ? 80.082  26.101  -15.814 1.00 30.30 ? 1407 PHE B CB    1 
ATOM   7570  C CG    . PHE B  1 376 ? 79.573  24.703  -15.722 1.00 27.71 ? 1407 PHE B CG    1 
ATOM   7571  C CD1   . PHE B  1 376 ? 79.502  23.902  -16.851 1.00 26.04 ? 1407 PHE B CD1   1 
ATOM   7572  C CD2   . PHE B  1 376 ? 79.210  24.165  -14.489 1.00 27.10 ? 1407 PHE B CD2   1 
ATOM   7573  C CE1   . PHE B  1 376 ? 79.087  22.582  -16.752 1.00 28.77 ? 1407 PHE B CE1   1 
ATOM   7574  C CE2   . PHE B  1 376 ? 78.793  22.845  -14.376 1.00 23.13 ? 1407 PHE B CE2   1 
ATOM   7575  C CZ    . PHE B  1 376 ? 78.732  22.050  -15.508 1.00 25.68 ? 1407 PHE B CZ    1 
ATOM   7576  N N     . LEU B  1 377 ? 78.785  28.652  -16.521 1.00 33.19 ? 1408 LEU B N     1 
ATOM   7577  C CA    . LEU B  1 377 ? 77.679  29.589  -16.463 1.00 32.88 ? 1408 LEU B CA    1 
ATOM   7578  C C     . LEU B  1 377 ? 76.980  29.878  -17.770 1.00 37.37 ? 1408 LEU B C     1 
ATOM   7579  O O     . LEU B  1 377 ? 77.603  30.277  -18.759 1.00 37.60 ? 1408 LEU B O     1 
ATOM   7580  C CB    . LEU B  1 377 ? 78.136  30.902  -15.848 1.00 26.82 ? 1408 LEU B CB    1 
ATOM   7581  C CG    . LEU B  1 377 ? 78.224  30.898  -14.318 1.00 26.08 ? 1408 LEU B CG    1 
ATOM   7582  C CD1   . LEU B  1 377 ? 77.908  32.293  -13.813 1.00 21.74 ? 1408 LEU B CD1   1 
ATOM   7583  C CD2   . LEU B  1 377 ? 77.275  29.865  -13.707 1.00 22.32 ? 1408 LEU B CD2   1 
ATOM   7584  N N     . TYR B  1 378 ? 75.665  29.671  -17.739 1.00 42.49 ? 1409 TYR B N     1 
ATOM   7585  C CA    . TYR B  1 378 ? 74.771  29.900  -18.865 1.00 45.13 ? 1409 TYR B CA    1 
ATOM   7586  C C     . TYR B  1 378 ? 75.210  29.216  -20.142 1.00 45.85 ? 1409 TYR B C     1 
ATOM   7587  O O     . TYR B  1 378 ? 74.791  29.602  -21.230 1.00 45.98 ? 1409 TYR B O     1 
ATOM   7588  C CB    . TYR B  1 378 ? 74.608  31.401  -19.139 1.00 50.74 ? 1409 TYR B CB    1 
ATOM   7589  C CG    . TYR B  1 378 ? 75.045  32.339  -18.028 1.00 56.45 ? 1409 TYR B CG    1 
ATOM   7590  C CD1   . TYR B  1 378 ? 75.627  33.567  -18.329 1.00 57.70 ? 1409 TYR B CD1   1 
ATOM   7591  C CD2   . TYR B  1 378 ? 74.857  32.016  -16.683 1.00 58.99 ? 1409 TYR B CD2   1 
ATOM   7592  C CE1   . TYR B  1 378 ? 76.009  34.454  -17.325 1.00 57.58 ? 1409 TYR B CE1   1 
ATOM   7593  C CE2   . TYR B  1 378 ? 75.236  32.897  -15.672 1.00 58.20 ? 1409 TYR B CE2   1 
ATOM   7594  C CZ    . TYR B  1 378 ? 75.812  34.114  -16.003 1.00 57.96 ? 1409 TYR B CZ    1 
ATOM   7595  O OH    . TYR B  1 378 ? 76.188  34.997  -15.018 1.00 57.53 ? 1409 TYR B OH    1 
ATOM   7596  N N     . ASN B  1 379 ? 76.048  28.198  -20.026 1.00 47.28 ? 1410 ASN B N     1 
ATOM   7597  C CA    . ASN B  1 379 ? 76.495  27.517  -21.224 1.00 50.66 ? 1410 ASN B CA    1 
ATOM   7598  C C     . ASN B  1 379 ? 75.867  26.149  -21.357 1.00 50.24 ? 1410 ASN B C     1 
ATOM   7599  O O     . ASN B  1 379 ? 76.546  25.126  -21.269 1.00 49.38 ? 1410 ASN B O     1 
ATOM   7600  C CB    . ASN B  1 379 ? 78.010  27.382  -21.243 1.00 54.08 ? 1410 ASN B CB    1 
ATOM   7601  C CG    . ASN B  1 379 ? 78.526  27.023  -22.616 1.00 59.08 ? 1410 ASN B CG    1 
ATOM   7602  O OD1   . ASN B  1 379 ? 77.899  26.226  -23.325 1.00 57.02 ? 1410 ASN B OD1   1 
ATOM   7603  N ND2   . ASN B  1 379 ? 79.658  27.612  -22.998 1.00 64.98 ? 1410 ASN B ND2   1 
ATOM   7604  N N     . ASN B  1 380 ? 74.564  26.130  -21.584 1.00 51.09 ? 1411 ASN B N     1 
ATOM   7605  C CA    . ASN B  1 380 ? 73.875  24.865  -21.725 1.00 51.67 ? 1411 ASN B CA    1 
ATOM   7606  C C     . ASN B  1 380 ? 74.360  24.186  -22.994 1.00 50.34 ? 1411 ASN B C     1 
ATOM   7607  O O     . ASN B  1 380 ? 74.099  22.998  -23.225 1.00 48.45 ? 1411 ASN B O     1 
ATOM   7608  C CB    . ASN B  1 380 ? 72.369  25.098  -21.757 1.00 54.03 ? 1411 ASN B CB    1 
ATOM   7609  C CG    . ASN B  1 380 ? 71.838  25.589  -20.424 1.00 57.16 ? 1411 ASN B CG    1 
ATOM   7610  O OD1   . ASN B  1 380 ? 70.663  25.909  -20.297 1.00 61.87 ? 1411 ASN B OD1   1 
ATOM   7611  N ND2   . ASN B  1 380 ? 72.709  25.650  -19.419 1.00 57.79 ? 1411 ASN B ND2   1 
ATOM   7612  N N     . SER B  1 381 ? 75.076  24.951  -23.815 1.00 47.08 ? 1412 SER B N     1 
ATOM   7613  C CA    . SER B  1 381 ? 75.626  24.406  -25.044 1.00 41.98 ? 1412 SER B CA    1 
ATOM   7614  C C     . SER B  1 381 ? 76.480  23.226  -24.598 1.00 38.94 ? 1412 SER B C     1 
ATOM   7615  O O     . SER B  1 381 ? 76.573  22.194  -25.277 1.00 35.68 ? 1412 SER B O     1 
ATOM   7616  C CB    . SER B  1 381 ? 76.479  25.453  -25.755 1.00 39.58 ? 1412 SER B CB    1 
ATOM   7617  O OG    . SER B  1 381 ? 76.285  25.371  -27.158 1.00 37.45 ? 1412 SER B OG    1 
ATOM   7618  N N     . ILE B  1 382 ? 77.091  23.400  -23.432 1.00 32.75 ? 1413 ILE B N     1 
ATOM   7619  C CA    . ILE B  1 382 ? 77.906  22.361  -22.833 1.00 31.93 ? 1413 ILE B CA    1 
ATOM   7620  C C     . ILE B  1 382 ? 77.046  21.099  -22.742 1.00 30.69 ? 1413 ILE B C     1 
ATOM   7621  O O     . ILE B  1 382 ? 77.358  20.078  -23.355 1.00 29.07 ? 1413 ILE B O     1 
ATOM   7622  C CB    . ILE B  1 382 ? 78.344  22.758  -21.401 1.00 31.01 ? 1413 ILE B CB    1 
ATOM   7623  C CG1   . ILE B  1 382 ? 79.312  23.941  -21.455 1.00 28.45 ? 1413 ILE B CG1   1 
ATOM   7624  C CG2   . ILE B  1 382 ? 78.969  21.557  -20.685 1.00 27.12 ? 1413 ILE B CG2   1 
ATOM   7625  C CD1   . ILE B  1 382 ? 79.573  24.572  -20.099 1.00 27.97 ? 1413 ILE B CD1   1 
ATOM   7626  N N     . LEU B  1 383 ? 75.964  21.194  -21.969 1.00 30.50 ? 1414 LEU B N     1 
ATOM   7627  C CA    . LEU B  1 383 ? 75.031  20.089  -21.769 1.00 29.83 ? 1414 LEU B CA    1 
ATOM   7628  C C     . LEU B  1 383 ? 74.726  19.382  -23.074 1.00 30.51 ? 1414 LEU B C     1 
ATOM   7629  O O     . LEU B  1 383 ? 74.902  18.164  -23.207 1.00 28.41 ? 1414 LEU B O     1 
ATOM   7630  C CB    . LEU B  1 383 ? 73.728  20.605  -21.162 1.00 33.18 ? 1414 LEU B CB    1 
ATOM   7631  C CG    . LEU B  1 383 ? 72.634  19.566  -20.896 1.00 33.69 ? 1414 LEU B CG    1 
ATOM   7632  C CD1   . LEU B  1 383 ? 73.252  18.258  -20.390 1.00 34.17 ? 1414 LEU B CD1   1 
ATOM   7633  C CD2   . LEU B  1 383 ? 71.658  20.120  -19.869 1.00 34.78 ? 1414 LEU B CD2   1 
ATOM   7634  N N     . LEU B  1 384 ? 74.268  20.168  -24.037 1.00 31.26 ? 1415 LEU B N     1 
ATOM   7635  C CA    . LEU B  1 384 ? 73.932  19.652  -25.349 1.00 36.48 ? 1415 LEU B CA    1 
ATOM   7636  C C     . LEU B  1 384 ? 75.102  18.924  -25.982 1.00 39.89 ? 1415 LEU B C     1 
ATOM   7637  O O     . LEU B  1 384 ? 74.944  17.846  -26.557 1.00 39.61 ? 1415 LEU B O     1 
ATOM   7638  C CB    . LEU B  1 384 ? 73.520  20.798  -26.259 1.00 34.40 ? 1415 LEU B CB    1 
ATOM   7639  C CG    . LEU B  1 384 ? 72.022  21.073  -26.368 1.00 31.26 ? 1415 LEU B CG    1 
ATOM   7640  C CD1   . LEU B  1 384 ? 71.743  21.812  -27.672 1.00 29.32 ? 1415 LEU B CD1   1 
ATOM   7641  C CD2   . LEU B  1 384 ? 71.249  19.754  -26.289 1.00 29.55 ? 1415 LEU B CD2   1 
ATOM   7642  N N     . GLU B  1 385 ? 76.275  19.535  -25.872 1.00 45.77 ? 1416 GLU B N     1 
ATOM   7643  C CA    . GLU B  1 385 ? 77.508  18.998  -26.435 1.00 52.04 ? 1416 GLU B CA    1 
ATOM   7644  C C     . GLU B  1 385 ? 77.870  17.579  -25.999 1.00 51.63 ? 1416 GLU B C     1 
ATOM   7645  O O     . GLU B  1 385 ? 78.026  16.687  -26.835 1.00 51.79 ? 1416 GLU B O     1 
ATOM   7646  C CB    . GLU B  1 385 ? 78.655  19.941  -26.096 1.00 58.87 ? 1416 GLU B CB    1 
ATOM   7647  C CG    . GLU B  1 385 ? 79.384  20.489  -27.297 1.00 66.87 ? 1416 GLU B CG    1 
ATOM   7648  C CD    . GLU B  1 385 ? 80.878  20.230  -27.218 1.00 75.88 ? 1416 GLU B CD    1 
ATOM   7649  O OE1   . GLU B  1 385 ? 81.530  20.782  -26.301 1.00 79.28 ? 1416 GLU B OE1   1 
ATOM   7650  O OE2   . GLU B  1 385 ? 81.397  19.470  -28.069 1.00 77.78 ? 1416 GLU B OE2   1 
ATOM   7651  N N     . HIS B  1 386 ? 78.000  17.376  -24.691 1.00 50.56 ? 1417 HIS B N     1 
ATOM   7652  C CA    . HIS B  1 386 ? 78.372  16.072  -24.149 1.00 51.06 ? 1417 HIS B CA    1 
ATOM   7653  C C     . HIS B  1 386 ? 77.235  15.065  -24.026 1.00 48.26 ? 1417 HIS B C     1 
ATOM   7654  O O     . HIS B  1 386 ? 77.428  13.871  -24.279 1.00 49.68 ? 1417 HIS B O     1 
ATOM   7655  C CB    . HIS B  1 386 ? 79.033  16.240  -22.776 1.00 54.76 ? 1417 HIS B CB    1 
ATOM   7656  C CG    . HIS B  1 386 ? 80.319  17.008  -22.813 1.00 60.99 ? 1417 HIS B CG    1 
ATOM   7657  N ND1   . HIS B  1 386 ? 80.482  18.154  -23.562 1.00 62.39 ? 1417 HIS B ND1   1 
ATOM   7658  C CD2   . HIS B  1 386 ? 81.496  16.810  -22.172 1.00 60.44 ? 1417 HIS B CD2   1 
ATOM   7659  C CE1   . HIS B  1 386 ? 81.700  18.630  -23.380 1.00 60.77 ? 1417 HIS B CE1   1 
ATOM   7660  N NE2   . HIS B  1 386 ? 82.335  17.833  -22.540 1.00 60.99 ? 1417 HIS B NE2   1 
ATOM   7661  N N     . GLY B  1 387 ? 76.057  15.540  -23.629 1.00 44.78 ? 1418 GLY B N     1 
ATOM   7662  C CA    . GLY B  1 387 ? 74.932  14.639  -23.469 1.00 38.31 ? 1418 GLY B CA    1 
ATOM   7663  C C     . GLY B  1 387 ? 74.664  14.380  -22.002 1.00 33.84 ? 1418 GLY B C     1 
ATOM   7664  O O     . GLY B  1 387 ? 75.556  14.491  -21.158 1.00 31.33 ? 1418 GLY B O     1 
ATOM   7665  N N     . LEU B  1 388 ? 73.423  14.033  -21.695 1.00 33.59 ? 1419 LEU B N     1 
ATOM   7666  C CA    . LEU B  1 388 ? 73.033  13.783  -20.315 1.00 32.51 ? 1419 LEU B CA    1 
ATOM   7667  C C     . LEU B  1 388 ? 73.833  12.647  -19.705 1.00 28.71 ? 1419 LEU B C     1 
ATOM   7668  O O     . LEU B  1 388 ? 74.406  12.779  -18.625 1.00 25.30 ? 1419 LEU B O     1 
ATOM   7669  C CB    . LEU B  1 388 ? 71.530  13.470  -20.238 1.00 29.58 ? 1419 LEU B CB    1 
ATOM   7670  C CG    . LEU B  1 388 ? 70.625  14.558  -19.631 1.00 26.71 ? 1419 LEU B CG    1 
ATOM   7671  C CD1   . LEU B  1 388 ? 70.673  14.457  -18.111 1.00 26.04 ? 1419 LEU B CD1   1 
ATOM   7672  C CD2   . LEU B  1 388 ? 71.073  15.952  -20.078 1.00 22.09 ? 1419 LEU B CD2   1 
ATOM   7673  N N     . THR B  1 389 ? 73.885  11.543  -20.430 1.00 29.30 ? 1420 THR B N     1 
ATOM   7674  C CA    . THR B  1 389 ? 74.590  10.362  -19.972 1.00 32.61 ? 1420 THR B CA    1 
ATOM   7675  C C     . THR B  1 389 ? 75.986  10.644  -19.450 1.00 32.76 ? 1420 THR B C     1 
ATOM   7676  O O     . THR B  1 389 ? 76.327  10.242  -18.332 1.00 33.40 ? 1420 THR B O     1 
ATOM   7677  C CB    . THR B  1 389 ? 74.686  9.343   -21.094 1.00 30.45 ? 1420 THR B CB    1 
ATOM   7678  O OG1   . THR B  1 389 ? 74.048  9.886   -22.259 1.00 30.83 ? 1420 THR B OG1   1 
ATOM   7679  C CG2   . THR B  1 389 ? 74.015  8.028   -20.683 1.00 27.06 ? 1420 THR B CG2   1 
ATOM   7680  N N     . GLN B  1 390 ? 76.805  11.313  -20.258 1.00 33.75 ? 1421 GLN B N     1 
ATOM   7681  C CA    . GLN B  1 390 ? 78.159  11.631  -19.821 1.00 34.17 ? 1421 GLN B CA    1 
ATOM   7682  C C     . GLN B  1 390 ? 78.028  12.456  -18.548 1.00 31.26 ? 1421 GLN B C     1 
ATOM   7683  O O     . GLN B  1 390 ? 78.477  12.042  -17.481 1.00 29.12 ? 1421 GLN B O     1 
ATOM   7684  C CB    . GLN B  1 390 ? 78.894  12.433  -20.891 1.00 43.03 ? 1421 GLN B CB    1 
ATOM   7685  C CG    . GLN B  1 390 ? 79.856  11.605  -21.748 1.00 58.56 ? 1421 GLN B CG    1 
ATOM   7686  C CD    . GLN B  1 390 ? 80.856  10.780  -20.932 1.00 68.86 ? 1421 GLN B CD    1 
ATOM   7687  O OE1   . GLN B  1 390 ? 81.315  11.202  -19.866 1.00 71.38 ? 1421 GLN B OE1   1 
ATOM   7688  N NE2   . GLN B  1 390 ? 81.200  9.597   -21.441 1.00 73.96 ? 1421 GLN B NE2   1 
ATOM   7689  N N     . PHE B  1 391 ? 77.389  13.615  -18.679 1.00 25.44 ? 1422 PHE B N     1 
ATOM   7690  C CA    . PHE B  1 391 ? 77.149  14.512  -17.564 1.00 19.72 ? 1422 PHE B CA    1 
ATOM   7691  C C     . PHE B  1 391 ? 76.942  13.734  -16.288 1.00 21.57 ? 1422 PHE B C     1 
ATOM   7692  O O     . PHE B  1 391 ? 77.562  14.003  -15.258 1.00 19.05 ? 1422 PHE B O     1 
ATOM   7693  C CB    . PHE B  1 391 ? 75.901  15.325  -17.833 1.00 13.33 ? 1422 PHE B CB    1 
ATOM   7694  C CG    . PHE B  1 391 ? 76.183  16.733  -18.176 1.00 6.10  ? 1422 PHE B CG    1 
ATOM   7695  C CD1   . PHE B  1 391 ? 76.459  17.091  -19.484 1.00 4.16  ? 1422 PHE B CD1   1 
ATOM   7696  C CD2   . PHE B  1 391 ? 76.166  17.710  -17.196 1.00 2.00  ? 1422 PHE B CD2   1 
ATOM   7697  C CE1   . PHE B  1 391 ? 76.714  18.412  -19.810 1.00 7.29  ? 1422 PHE B CE1   1 
ATOM   7698  C CE2   . PHE B  1 391 ? 76.418  19.041  -17.511 1.00 2.00  ? 1422 PHE B CE2   1 
ATOM   7699  C CZ    . PHE B  1 391 ? 76.690  19.395  -18.819 1.00 6.41  ? 1422 PHE B CZ    1 
ATOM   7700  N N     . VAL B  1 392 ? 76.036  12.769  -16.369 1.00 22.79 ? 1423 VAL B N     1 
ATOM   7701  C CA    . VAL B  1 392 ? 75.716  11.937  -15.227 1.00 22.65 ? 1423 VAL B CA    1 
ATOM   7702  C C     . VAL B  1 392 ? 77.023  11.364  -14.745 1.00 23.74 ? 1423 VAL B C     1 
ATOM   7703  O O     . VAL B  1 392 ? 77.598  11.857  -13.771 1.00 23.28 ? 1423 VAL B O     1 
ATOM   7704  C CB    . VAL B  1 392 ? 74.779  10.779  -15.613 1.00 25.45 ? 1423 VAL B CB    1 
ATOM   7705  C CG1   . VAL B  1 392 ? 74.421  9.974   -14.386 1.00 25.03 ? 1423 VAL B CG1   1 
ATOM   7706  C CG2   . VAL B  1 392 ? 73.524  11.323  -16.267 1.00 24.19 ? 1423 VAL B CG2   1 
ATOM   7707  N N     . GLU B  1 393 ? 77.488  10.335  -15.452 1.00 22.92 ? 1424 GLU B N     1 
ATOM   7708  C CA    . GLU B  1 393 ? 78.742  9.656   -15.137 1.00 21.54 ? 1424 GLU B CA    1 
ATOM   7709  C C     . GLU B  1 393 ? 79.771  10.635  -14.582 1.00 19.21 ? 1424 GLU B C     1 
ATOM   7710  O O     . GLU B  1 393 ? 80.214  10.502  -13.442 1.00 19.10 ? 1424 GLU B O     1 
ATOM   7711  C CB    . GLU B  1 393 ? 79.292  8.990   -16.398 1.00 25.19 ? 1424 GLU B CB    1 
ATOM   7712  C CG    . GLU B  1 393 ? 78.385  7.916   -16.965 1.00 24.15 ? 1424 GLU B CG    1 
ATOM   7713  C CD    . GLU B  1 393 ? 78.844  7.446   -18.323 1.00 23.62 ? 1424 GLU B CD    1 
ATOM   7714  O OE1   . GLU B  1 393 ? 79.142  8.314   -19.167 1.00 17.63 ? 1424 GLU B OE1   1 
ATOM   7715  O OE2   . GLU B  1 393 ? 78.907  6.216   -18.537 1.00 24.35 ? 1424 GLU B OE2   1 
ATOM   7716  N N     . SER B  1 394 ? 80.130  11.623  -15.393 1.00 18.12 ? 1425 SER B N     1 
ATOM   7717  C CA    . SER B  1 394 ? 81.105  12.628  -14.993 1.00 21.17 ? 1425 SER B CA    1 
ATOM   7718  C C     . SER B  1 394 ? 80.799  13.155  -13.617 1.00 22.98 ? 1425 SER B C     1 
ATOM   7719  O O     . SER B  1 394 ? 81.569  12.948  -12.677 1.00 24.38 ? 1425 SER B O     1 
ATOM   7720  C CB    . SER B  1 394 ? 81.122  13.793  -15.991 1.00 21.57 ? 1425 SER B CB    1 
ATOM   7721  O OG    . SER B  1 394 ? 81.311  13.319  -17.318 1.00 23.98 ? 1425 SER B OG    1 
ATOM   7722  N N     . PHE B  1 395 ? 79.667  13.835  -13.504 1.00 24.01 ? 1426 PHE B N     1 
ATOM   7723  C CA    . PHE B  1 395 ? 79.255  14.412  -12.237 1.00 27.54 ? 1426 PHE B CA    1 
ATOM   7724  C C     . PHE B  1 395 ? 79.148  13.373  -11.118 1.00 26.76 ? 1426 PHE B C     1 
ATOM   7725  O O     . PHE B  1 395 ? 79.295  13.696  -9.932  1.00 26.15 ? 1426 PHE B O     1 
ATOM   7726  C CB    . PHE B  1 395 ? 77.927  15.127  -12.415 1.00 33.27 ? 1426 PHE B CB    1 
ATOM   7727  C CG    . PHE B  1 395 ? 78.053  16.492  -13.022 1.00 36.19 ? 1426 PHE B CG    1 
ATOM   7728  C CD1   . PHE B  1 395 ? 79.254  17.187  -12.969 1.00 33.45 ? 1426 PHE B CD1   1 
ATOM   7729  C CD2   . PHE B  1 395 ? 76.955  17.094  -13.631 1.00 40.32 ? 1426 PHE B CD2   1 
ATOM   7730  C CE1   . PHE B  1 395 ? 79.361  18.465  -13.511 1.00 37.35 ? 1426 PHE B CE1   1 
ATOM   7731  C CE2   . PHE B  1 395 ? 77.048  18.375  -14.179 1.00 40.15 ? 1426 PHE B CE2   1 
ATOM   7732  C CZ    . PHE B  1 395 ? 78.255  19.062  -14.118 1.00 39.43 ? 1426 PHE B CZ    1 
ATOM   7733  N N     . THR B  1 396 ? 78.911  12.123  -11.498 1.00 24.21 ? 1427 THR B N     1 
ATOM   7734  C CA    . THR B  1 396 ? 78.782  11.049  -10.525 1.00 20.76 ? 1427 THR B CA    1 
ATOM   7735  C C     . THR B  1 396 ? 80.095  10.788  -9.803  1.00 20.30 ? 1427 THR B C     1 
ATOM   7736  O O     . THR B  1 396 ? 80.125  10.039  -8.826  1.00 16.33 ? 1427 THR B O     1 
ATOM   7737  C CB    . THR B  1 396 ? 78.310  9.730   -11.190 1.00 23.82 ? 1427 THR B CB    1 
ATOM   7738  O OG1   . THR B  1 396 ? 77.191  9.996   -12.051 1.00 24.81 ? 1427 THR B OG1   1 
ATOM   7739  C CG2   . THR B  1 396 ? 77.885  8.711   -10.127 1.00 20.72 ? 1427 THR B CG2   1 
ATOM   7740  N N     . ARG B  1 397 ? 81.181  11.400  -10.279 1.00 22.92 ? 1428 ARG B N     1 
ATOM   7741  C CA    . ARG B  1 397 ? 82.492  11.214  -9.643  1.00 23.91 ? 1428 ARG B CA    1 
ATOM   7742  C C     . ARG B  1 397 ? 83.170  12.495  -9.159  1.00 21.99 ? 1428 ARG B C     1 
ATOM   7743  O O     . ARG B  1 397 ? 83.732  12.526  -8.057  1.00 21.81 ? 1428 ARG B O     1 
ATOM   7744  C CB    . ARG B  1 397 ? 83.451  10.473  -10.570 1.00 25.62 ? 1428 ARG B CB    1 
ATOM   7745  C CG    . ARG B  1 397 ? 83.641  11.128  -11.914 1.00 41.36 ? 1428 ARG B CG    1 
ATOM   7746  C CD    . ARG B  1 397 ? 84.152  10.120  -12.937 1.00 49.60 ? 1428 ARG B CD    1 
ATOM   7747  N NE    . ARG B  1 397 ? 84.044  10.621  -14.304 1.00 54.99 ? 1428 ARG B NE    1 
ATOM   7748  C CZ    . ARG B  1 397 ? 83.938  9.843   -15.377 1.00 61.29 ? 1428 ARG B CZ    1 
ATOM   7749  N NH1   . ARG B  1 397 ? 83.923  8.521   -15.238 1.00 61.43 ? 1428 ARG B NH1   1 
ATOM   7750  N NH2   . ARG B  1 397 ? 83.847  10.386  -16.588 1.00 60.66 ? 1428 ARG B NH2   1 
ATOM   7751  N N     . GLN B  1 398 ? 83.118  13.554  -9.958  1.00 16.32 ? 1429 GLN B N     1 
ATOM   7752  C CA    . GLN B  1 398 ? 83.768  14.789  -9.542  1.00 14.28 ? 1429 GLN B CA    1 
ATOM   7753  C C     . GLN B  1 398 ? 83.430  15.242  -8.118  1.00 14.93 ? 1429 GLN B C     1 
ATOM   7754  O O     . GLN B  1 398 ? 82.565  16.097  -7.924  1.00 18.17 ? 1429 GLN B O     1 
ATOM   7755  C CB    . GLN B  1 398 ? 83.445  15.936  -10.493 1.00 8.39  ? 1429 GLN B CB    1 
ATOM   7756  C CG    . GLN B  1 398 ? 83.972  17.263  -9.953  1.00 2.98  ? 1429 GLN B CG    1 
ATOM   7757  C CD    . GLN B  1 398 ? 84.154  18.296  -11.031 1.00 9.72  ? 1429 GLN B CD    1 
ATOM   7758  O OE1   . GLN B  1 398 ? 83.918  18.026  -12.220 1.00 13.01 ? 1429 GLN B OE1   1 
ATOM   7759  N NE2   . GLN B  1 398 ? 84.573  19.494  -10.632 1.00 5.97  ? 1429 GLN B NE2   1 
ATOM   7760  N N     . ILE B  1 399 ? 84.120  14.683  -7.128  1.00 15.13 ? 1430 ILE B N     1 
ATOM   7761  C CA    . ILE B  1 399 ? 83.904  15.057  -5.726  1.00 13.69 ? 1430 ILE B CA    1 
ATOM   7762  C C     . ILE B  1 399 ? 83.638  16.562  -5.511  1.00 12.00 ? 1430 ILE B C     1 
ATOM   7763  O O     . ILE B  1 399 ? 84.189  17.429  -6.212  1.00 9.98  ? 1430 ILE B O     1 
ATOM   7764  C CB    . ILE B  1 399 ? 85.127  14.686  -4.864  1.00 13.24 ? 1430 ILE B CB    1 
ATOM   7765  C CG1   . ILE B  1 399 ? 84.959  15.239  -3.449  1.00 6.11  ? 1430 ILE B CG1   1 
ATOM   7766  C CG2   . ILE B  1 399 ? 86.388  15.261  -5.497  1.00 8.25  ? 1430 ILE B CG2   1 
ATOM   7767  C CD1   . ILE B  1 399 ? 84.693  14.174  -2.426  1.00 8.37  ? 1430 ILE B CD1   1 
ATOM   7768  N N     . ALA B  1 400 ? 82.809  16.846  -4.510  1.00 12.07 ? 1431 ALA B N     1 
ATOM   7769  C CA    . ALA B  1 400 ? 82.433  18.202  -4.154  1.00 13.90 ? 1431 ALA B CA    1 
ATOM   7770  C C     . ALA B  1 400 ? 83.159  18.614  -2.884  1.00 15.39 ? 1431 ALA B C     1 
ATOM   7771  O O     . ALA B  1 400 ? 83.485  17.769  -2.036  1.00 14.01 ? 1431 ALA B O     1 
ATOM   7772  C CB    . ALA B  1 400 ? 80.937  18.286  -3.947  1.00 11.73 ? 1431 ALA B CB    1 
ATOM   7773  N N     . GLY B  1 401 ? 83.390  19.920  -2.750  1.00 15.90 ? 1432 GLY B N     1 
ATOM   7774  C CA    . GLY B  1 401 ? 84.092  20.433  -1.594  1.00 18.73 ? 1432 GLY B CA    1 
ATOM   7775  C C     . GLY B  1 401 ? 83.379  20.276  -0.266  1.00 19.98 ? 1432 GLY B C     1 
ATOM   7776  O O     . GLY B  1 401 ? 82.164  20.451  -0.183  1.00 19.70 ? 1432 GLY B O     1 
ATOM   7777  N N     . ARG B  1 402 ? 84.142  19.933  0.771   1.00 20.66 ? 1433 ARG B N     1 
ATOM   7778  C CA    . ARG B  1 402 ? 83.600  19.809  2.119   1.00 23.31 ? 1433 ARG B CA    1 
ATOM   7779  C C     . ARG B  1 402 ? 83.023  21.187  2.456   1.00 22.23 ? 1433 ARG B C     1 
ATOM   7780  O O     . ARG B  1 402 ? 83.367  22.183  1.822   1.00 17.19 ? 1433 ARG B O     1 
ATOM   7781  C CB    . ARG B  1 402 ? 84.712  19.445  3.100   1.00 26.82 ? 1433 ARG B CB    1 
ATOM   7782  C CG    . ARG B  1 402 ? 84.229  18.819  4.390   1.00 29.92 ? 1433 ARG B CG    1 
ATOM   7783  C CD    . ARG B  1 402 ? 84.987  19.376  5.589   1.00 33.50 ? 1433 ARG B CD    1 
ATOM   7784  N NE    . ARG B  1 402 ? 84.783  18.540  6.767   1.00 36.85 ? 1433 ARG B NE    1 
ATOM   7785  C CZ    . ARG B  1 402 ? 85.547  17.501  7.087   1.00 36.39 ? 1433 ARG B CZ    1 
ATOM   7786  N NH1   . ARG B  1 402 ? 86.567  17.172  6.318   1.00 35.29 ? 1433 ARG B NH1   1 
ATOM   7787  N NH2   . ARG B  1 402 ? 85.277  16.775  8.163   1.00 39.52 ? 1433 ARG B NH2   1 
ATOM   7788  N N     . VAL B  1 403 ? 82.166  21.266  3.463   1.00 24.53 ? 1434 VAL B N     1 
ATOM   7789  C CA    . VAL B  1 403 ? 81.547  22.547  3.762   1.00 24.98 ? 1434 VAL B CA    1 
ATOM   7790  C C     . VAL B  1 403 ? 81.727  23.091  5.168   1.00 25.21 ? 1434 VAL B C     1 
ATOM   7791  O O     . VAL B  1 403 ? 81.796  24.306  5.352   1.00 27.39 ? 1434 VAL B O     1 
ATOM   7792  C CB    . VAL B  1 403 ? 80.045  22.477  3.435   1.00 23.86 ? 1434 VAL B CB    1 
ATOM   7793  C CG1   . VAL B  1 403 ? 79.355  23.722  3.897   1.00 24.21 ? 1434 VAL B CG1   1 
ATOM   7794  C CG2   . VAL B  1 403 ? 79.851  22.293  1.934   1.00 22.32 ? 1434 VAL B CG2   1 
ATOM   7795  N N     . ALA B  1 404 ? 81.813  22.209  6.160   1.00 30.66 ? 1435 ALA B N     1 
ATOM   7796  C CA    . ALA B  1 404 ? 81.970  22.655  7.545   1.00 31.80 ? 1435 ALA B CA    1 
ATOM   7797  C C     . ALA B  1 404 ? 83.414  22.931  7.962   1.00 33.19 ? 1435 ALA B C     1 
ATOM   7798  O O     . ALA B  1 404 ? 83.653  23.757  8.844   1.00 34.27 ? 1435 ALA B O     1 
ATOM   7799  C CB    . ALA B  1 404 ? 81.343  21.638  8.487   1.00 34.61 ? 1435 ALA B CB    1 
ATOM   7800  N N     . GLY B  1 405 ? 84.366  22.247  7.327   1.00 32.06 ? 1436 GLY B N     1 
ATOM   7801  C CA    . GLY B  1 405 ? 85.773  22.422  7.661   1.00 31.48 ? 1436 GLY B CA    1 
ATOM   7802  C C     . GLY B  1 405 ? 86.274  23.843  7.889   1.00 31.64 ? 1436 GLY B C     1 
ATOM   7803  O O     . GLY B  1 405 ? 86.892  24.138  8.916   1.00 31.08 ? 1436 GLY B O     1 
ATOM   7804  N N     . GLY B  1 406 ? 86.016  24.721  6.926   1.00 30.16 ? 1437 GLY B N     1 
ATOM   7805  C CA    . GLY B  1 406 ? 86.454  26.095  7.049   1.00 27.75 ? 1437 GLY B CA    1 
ATOM   7806  C C     . GLY B  1 406 ? 87.120  26.560  5.770   1.00 25.95 ? 1437 GLY B C     1 
ATOM   7807  O O     . GLY B  1 406 ? 87.561  25.742  4.954   1.00 24.78 ? 1437 GLY B O     1 
ATOM   7808  N N     . ARG B  1 407 ? 87.173  27.879  5.602   1.00 23.88 ? 1438 ARG B N     1 
ATOM   7809  C CA    . ARG B  1 407 ? 87.778  28.512  4.442   1.00 25.23 ? 1438 ARG B CA    1 
ATOM   7810  C C     . ARG B  1 407 ? 87.774  27.634  3.193   1.00 22.79 ? 1438 ARG B C     1 
ATOM   7811  O O     . ARG B  1 407 ? 88.829  27.291  2.664   1.00 23.93 ? 1438 ARG B O     1 
ATOM   7812  C CB    . ARG B  1 407 ? 89.211  28.930  4.775   1.00 28.23 ? 1438 ARG B CB    1 
ATOM   7813  C CG    . ARG B  1 407 ? 89.646  28.615  6.213   1.00 36.76 ? 1438 ARG B CG    1 
ATOM   7814  C CD    . ARG B  1 407 ? 91.130  28.927  6.461   1.00 40.95 ? 1438 ARG B CD    1 
ATOM   7815  N NE    . ARG B  1 407 ? 91.308  29.967  7.475   1.00 47.03 ? 1438 ARG B NE    1 
ATOM   7816  C CZ    . ARG B  1 407 ? 92.477  30.301  8.011   1.00 48.30 ? 1438 ARG B CZ    1 
ATOM   7817  N NH1   . ARG B  1 407 ? 93.583  29.680  7.633   1.00 49.36 ? 1438 ARG B NH1   1 
ATOM   7818  N NH2   . ARG B  1 407 ? 92.537  31.254  8.931   1.00 48.41 ? 1438 ARG B NH2   1 
ATOM   7819  N N     . ASN B  1 408 ? 86.592  27.271  2.715   1.00 19.79 ? 1439 ASN B N     1 
ATOM   7820  C CA    . ASN B  1 408 ? 86.503  26.433  1.523   1.00 15.76 ? 1439 ASN B CA    1 
ATOM   7821  C C     . ASN B  1 408 ? 85.492  26.969  0.504   1.00 14.94 ? 1439 ASN B C     1 
ATOM   7822  O O     . ASN B  1 408 ? 84.879  26.213  -0.254  1.00 14.01 ? 1439 ASN B O     1 
ATOM   7823  C CB    . ASN B  1 408 ? 86.135  25.007  1.908   1.00 10.50 ? 1439 ASN B CB    1 
ATOM   7824  C CG    . ASN B  1 408 ? 86.450  24.030  0.820   1.00 12.90 ? 1439 ASN B CG    1 
ATOM   7825  O OD1   . ASN B  1 408 ? 87.226  24.328  -0.090  1.00 14.52 ? 1439 ASN B OD1   1 
ATOM   7826  N ND2   . ASN B  1 408 ? 85.856  22.851  0.896   1.00 13.36 ? 1439 ASN B ND2   1 
ATOM   7827  N N     . VAL B  1 409 ? 85.345  28.287  0.473   1.00 12.69 ? 1440 VAL B N     1 
ATOM   7828  C CA    . VAL B  1 409 ? 84.394  28.907  -0.432  1.00 11.24 ? 1440 VAL B CA    1 
ATOM   7829  C C     . VAL B  1 409 ? 85.014  29.442  -1.712  1.00 7.83  ? 1440 VAL B C     1 
ATOM   7830  O O     . VAL B  1 409 ? 85.773  30.407  -1.692  1.00 8.61  ? 1440 VAL B O     1 
ATOM   7831  C CB    . VAL B  1 409 ? 83.654  30.081  0.260   1.00 10.39 ? 1440 VAL B CB    1 
ATOM   7832  C CG1   . VAL B  1 409 ? 82.669  30.708  -0.691  1.00 3.67  ? 1440 VAL B CG1   1 
ATOM   7833  C CG2   . VAL B  1 409 ? 82.938  29.590  1.506   1.00 8.92  ? 1440 VAL B CG2   1 
ATOM   7834  N N     . PRO B  1 410 ? 84.679  28.830  -2.850  1.00 5.64  ? 1441 PRO B N     1 
ATOM   7835  C CA    . PRO B  1 410 ? 85.197  29.251  -4.149  1.00 9.83  ? 1441 PRO B CA    1 
ATOM   7836  C C     . PRO B  1 410 ? 85.245  30.772  -4.242  1.00 8.76  ? 1441 PRO B C     1 
ATOM   7837  O O     . PRO B  1 410 ? 84.390  31.471  -3.718  1.00 8.20  ? 1441 PRO B O     1 
ATOM   7838  C CB    . PRO B  1 410 ? 84.208  28.648  -5.134  1.00 8.58  ? 1441 PRO B CB    1 
ATOM   7839  C CG    . PRO B  1 410 ? 83.724  27.422  -4.462  1.00 10.96 ? 1441 PRO B CG    1 
ATOM   7840  C CD    . PRO B  1 410 ? 83.771  27.681  -2.971  1.00 10.82 ? 1441 PRO B CD    1 
ATOM   7841  N N     . ILE B  1 411 ? 86.249  31.287  -4.918  1.00 10.53 ? 1442 ILE B N     1 
ATOM   7842  C CA    . ILE B  1 411 ? 86.380  32.723  -5.011  1.00 15.44 ? 1442 ILE B CA    1 
ATOM   7843  C C     . ILE B  1 411 ? 85.368  33.300  -5.990  1.00 14.04 ? 1442 ILE B C     1 
ATOM   7844  O O     . ILE B  1 411 ? 84.968  34.464  -5.868  1.00 9.23  ? 1442 ILE B O     1 
ATOM   7845  C CB    . ILE B  1 411 ? 87.833  33.102  -5.418  1.00 19.03 ? 1442 ILE B CB    1 
ATOM   7846  C CG1   . ILE B  1 411 ? 88.775  32.745  -4.272  1.00 17.43 ? 1442 ILE B CG1   1 
ATOM   7847  C CG2   . ILE B  1 411 ? 87.955  34.606  -5.743  1.00 16.02 ? 1442 ILE B CG2   1 
ATOM   7848  C CD1   . ILE B  1 411 ? 88.909  31.244  -4.025  1.00 21.57 ? 1442 ILE B CD1   1 
ATOM   7849  N N     . ALA B  1 412 ? 84.954  32.496  -6.966  1.00 13.91 ? 1443 ALA B N     1 
ATOM   7850  C CA    . ALA B  1 412 ? 83.972  32.979  -7.936  1.00 16.02 ? 1443 ALA B CA    1 
ATOM   7851  C C     . ALA B  1 412 ? 82.699  33.288  -7.141  1.00 19.56 ? 1443 ALA B C     1 
ATOM   7852  O O     . ALA B  1 412 ? 82.041  34.317  -7.341  1.00 19.66 ? 1443 ALA B O     1 
ATOM   7853  C CB    . ALA B  1 412 ? 83.704  31.907  -8.980  1.00 12.19 ? 1443 ALA B CB    1 
ATOM   7854  N N     . VAL B  1 413 ? 82.394  32.386  -6.207  1.00 19.72 ? 1444 VAL B N     1 
ATOM   7855  C CA    . VAL B  1 413 ? 81.227  32.480  -5.329  1.00 17.36 ? 1444 VAL B CA    1 
ATOM   7856  C C     . VAL B  1 413 ? 81.391  33.596  -4.290  1.00 18.14 ? 1444 VAL B C     1 
ATOM   7857  O O     . VAL B  1 413 ? 80.489  33.877  -3.499  1.00 19.09 ? 1444 VAL B O     1 
ATOM   7858  C CB    . VAL B  1 413 ? 81.020  31.123  -4.615  1.00 14.75 ? 1444 VAL B CB    1 
ATOM   7859  C CG1   . VAL B  1 413 ? 80.259  31.303  -3.311  1.00 8.96  ? 1444 VAL B CG1   1 
ATOM   7860  C CG2   . VAL B  1 413 ? 80.307  30.164  -5.550  1.00 9.83  ? 1444 VAL B CG2   1 
ATOM   7861  N N     . GLN B  1 414 ? 82.561  34.218  -4.299  1.00 21.00 ? 1445 GLN B N     1 
ATOM   7862  C CA    . GLN B  1 414 ? 82.877  35.301  -3.382  1.00 21.99 ? 1445 GLN B CA    1 
ATOM   7863  C C     . GLN B  1 414 ? 81.654  36.121  -3.007  1.00 23.03 ? 1445 GLN B C     1 
ATOM   7864  O O     . GLN B  1 414 ? 81.129  36.010  -1.890  1.00 20.61 ? 1445 GLN B O     1 
ATOM   7865  C CB    . GLN B  1 414 ? 83.912  36.226  -4.020  1.00 24.58 ? 1445 GLN B CB    1 
ATOM   7866  C CG    . GLN B  1 414 ? 85.151  36.434  -3.191  1.00 25.62 ? 1445 GLN B CG    1 
ATOM   7867  C CD    . GLN B  1 414 ? 85.797  37.747  -3.500  1.00 25.63 ? 1445 GLN B CD    1 
ATOM   7868  O OE1   . GLN B  1 414 ? 86.170  38.493  -2.595  1.00 30.31 ? 1445 GLN B OE1   1 
ATOM   7869  N NE2   . GLN B  1 414 ? 85.930  38.051  -4.785  1.00 25.73 ? 1445 GLN B NE2   1 
ATOM   7870  N N     . ALA B  1 415 ? 81.221  36.943  -3.965  1.00 22.30 ? 1446 ALA B N     1 
ATOM   7871  C CA    . ALA B  1 415 ? 80.069  37.838  -3.813  1.00 22.03 ? 1446 ALA B CA    1 
ATOM   7872  C C     . ALA B  1 415 ? 78.927  37.226  -3.010  1.00 21.31 ? 1446 ALA B C     1 
ATOM   7873  O O     . ALA B  1 415 ? 78.462  37.796  -2.011  1.00 19.28 ? 1446 ALA B O     1 
ATOM   7874  C CB    . ALA B  1 415 ? 79.560  38.244  -5.184  1.00 21.41 ? 1446 ALA B CB    1 
ATOM   7875  N N     . VAL B  1 416 ? 78.476  36.063  -3.469  1.00 16.01 ? 1447 VAL B N     1 
ATOM   7876  C CA    . VAL B  1 416 ? 77.386  35.365  -2.832  1.00 12.55 ? 1447 VAL B CA    1 
ATOM   7877  C C     . VAL B  1 416 ? 77.602  35.208  -1.341  1.00 13.19 ? 1447 VAL B C     1 
ATOM   7878  O O     . VAL B  1 416 ? 76.977  35.904  -0.543  1.00 15.10 ? 1447 VAL B O     1 
ATOM   7879  C CB    . VAL B  1 416 ? 77.200  33.995  -3.466  1.00 10.28 ? 1447 VAL B CB    1 
ATOM   7880  C CG1   . VAL B  1 416 ? 76.470  33.071  -2.516  1.00 10.97 ? 1447 VAL B CG1   1 
ATOM   7881  C CG2   . VAL B  1 416 ? 76.442  34.143  -4.763  1.00 2.00  ? 1447 VAL B CG2   1 
ATOM   7882  N N     . ALA B  1 417 ? 78.489  34.292  -0.970  1.00 15.26 ? 1448 ALA B N     1 
ATOM   7883  C CA    . ALA B  1 417 ? 78.786  34.026  0.435   1.00 14.39 ? 1448 ALA B CA    1 
ATOM   7884  C C     . ALA B  1 417 ? 78.816  35.301  1.267   1.00 12.44 ? 1448 ALA B C     1 
ATOM   7885  O O     . ALA B  1 417 ? 78.351  35.305  2.408   1.00 11.96 ? 1448 ALA B O     1 
ATOM   7886  C CB    . ALA B  1 417 ? 80.111  33.311  0.555   1.00 14.54 ? 1448 ALA B CB    1 
ATOM   7887  N N     . LYS B  1 418 ? 79.365  36.379  0.711   1.00 11.32 ? 1449 LYS B N     1 
ATOM   7888  C CA    . LYS B  1 418 ? 79.418  37.629  1.461   1.00 13.07 ? 1449 LYS B CA    1 
ATOM   7889  C C     . LYS B  1 418 ? 77.989  38.051  1.750   1.00 12.50 ? 1449 LYS B C     1 
ATOM   7890  O O     . LYS B  1 418 ? 77.615  38.309  2.898   1.00 11.13 ? 1449 LYS B O     1 
ATOM   7891  C CB    . LYS B  1 418 ? 80.137  38.738  0.679   1.00 13.05 ? 1449 LYS B CB    1 
ATOM   7892  C CG    . LYS B  1 418 ? 80.587  39.903  1.575   1.00 10.95 ? 1449 LYS B CG    1 
ATOM   7893  C CD    . LYS B  1 418 ? 80.590  41.234  0.834   1.00 13.85 ? 1449 LYS B CD    1 
ATOM   7894  C CE    . LYS B  1 418 ? 81.079  42.385  1.708   1.00 15.53 ? 1449 LYS B CE    1 
ATOM   7895  N NZ    . LYS B  1 418 ? 80.197  43.582  1.588   1.00 16.16 ? 1449 LYS B NZ    1 
ATOM   7896  N N     . ALA B  1 419 ? 77.195  38.126  0.691   1.00 12.88 ? 1450 ALA B N     1 
ATOM   7897  C CA    . ALA B  1 419 ? 75.806  38.495  0.841   1.00 13.18 ? 1450 ALA B CA    1 
ATOM   7898  C C     . ALA B  1 419 ? 75.229  37.630  1.958   1.00 12.13 ? 1450 ALA B C     1 
ATOM   7899  O O     . ALA B  1 419 ? 74.724  38.155  2.959   1.00 9.46  ? 1450 ALA B O     1 
ATOM   7900  C CB    . ALA B  1 419 ? 75.074  38.243  -0.445  1.00 12.43 ? 1450 ALA B CB    1 
ATOM   7901  N N     . SER B  1 420 ? 75.326  36.310  1.790   1.00 9.90  ? 1451 SER B N     1 
ATOM   7902  C CA    . SER B  1 420 ? 74.821  35.379  2.781   1.00 13.22 ? 1451 SER B CA    1 
ATOM   7903  C C     . SER B  1 420 ? 75.050  35.920  4.181   1.00 20.19 ? 1451 SER B C     1 
ATOM   7904  O O     . SER B  1 420 ? 74.227  35.711  5.070   1.00 23.36 ? 1451 SER B O     1 
ATOM   7905  C CB    . SER B  1 420 ? 75.492  34.027  2.623   1.00 11.90 ? 1451 SER B CB    1 
ATOM   7906  O OG    . SER B  1 420 ? 75.590  33.677  1.252   1.00 14.36 ? 1451 SER B OG    1 
ATOM   7907  N N     . ILE B  1 421 ? 76.163  36.624  4.385   1.00 25.28 ? 1452 ILE B N     1 
ATOM   7908  C CA    . ILE B  1 421 ? 76.439  37.222  5.689   1.00 26.76 ? 1452 ILE B CA    1 
ATOM   7909  C C     . ILE B  1 421 ? 75.736  38.564  5.800   1.00 27.24 ? 1452 ILE B C     1 
ATOM   7910  O O     . ILE B  1 421 ? 74.963  38.790  6.727   1.00 30.48 ? 1452 ILE B O     1 
ATOM   7911  C CB    . ILE B  1 421 ? 77.917  37.480  5.911   1.00 28.92 ? 1452 ILE B CB    1 
ATOM   7912  C CG1   . ILE B  1 421 ? 78.715  36.229  5.552   1.00 30.60 ? 1452 ILE B CG1   1 
ATOM   7913  C CG2   . ILE B  1 421 ? 78.143  37.906  7.356   1.00 28.00 ? 1452 ILE B CG2   1 
ATOM   7914  C CD1   . ILE B  1 421 ? 79.810  36.489  4.550   1.00 30.51 ? 1452 ILE B CD1   1 
ATOM   7915  N N     . ASP B  1 422 ? 76.018  39.457  4.860   1.00 27.11 ? 1453 ASP B N     1 
ATOM   7916  C CA    . ASP B  1 422 ? 75.392  40.774  4.864   1.00 30.49 ? 1453 ASP B CA    1 
ATOM   7917  C C     . ASP B  1 422 ? 73.900  40.647  5.170   1.00 29.05 ? 1453 ASP B C     1 
ATOM   7918  O O     . ASP B  1 422 ? 73.379  41.312  6.075   1.00 29.00 ? 1453 ASP B O     1 
ATOM   7919  C CB    . ASP B  1 422 ? 75.562  41.454  3.503   1.00 36.61 ? 1453 ASP B CB    1 
ATOM   7920  C CG    . ASP B  1 422 ? 76.990  41.394  2.987   1.00 41.74 ? 1453 ASP B CG    1 
ATOM   7921  O OD1   . ASP B  1 422 ? 77.194  40.988  1.818   1.00 43.35 ? 1453 ASP B OD1   1 
ATOM   7922  O OD2   . ASP B  1 422 ? 77.905  41.762  3.752   1.00 41.38 ? 1453 ASP B OD2   1 
ATOM   7923  N N     . GLN B  1 423 ? 73.225  39.785  4.407   1.00 26.01 ? 1454 GLN B N     1 
ATOM   7924  C CA    . GLN B  1 423 ? 71.786  39.541  4.553   1.00 21.44 ? 1454 GLN B CA    1 
ATOM   7925  C C     . GLN B  1 423 ? 71.337  39.275  5.967   1.00 18.62 ? 1454 GLN B C     1 
ATOM   7926  O O     . GLN B  1 423 ? 70.684  40.110  6.581   1.00 18.66 ? 1454 GLN B O     1 
ATOM   7927  C CB    . GLN B  1 423 ? 71.367  38.356  3.702   1.00 21.43 ? 1454 GLN B CB    1 
ATOM   7928  C CG    . GLN B  1 423 ? 72.046  38.317  2.371   1.00 23.98 ? 1454 GLN B CG    1 
ATOM   7929  C CD    . GLN B  1 423 ? 71.081  38.061  1.248   1.00 23.81 ? 1454 GLN B CD    1 
ATOM   7930  O OE1   . GLN B  1 423 ? 70.386  38.982  0.791   1.00 20.03 ? 1454 GLN B OE1   1 
ATOM   7931  N NE2   . GLN B  1 423 ? 71.030  36.806  0.783   1.00 22.44 ? 1454 GLN B NE2   1 
ATOM   7932  N N     . SER B  1 424 ? 71.672  38.090  6.466   1.00 15.10 ? 1455 SER B N     1 
ATOM   7933  C CA    . SER B  1 424 ? 71.309  37.697  7.824   1.00 14.66 ? 1455 SER B CA    1 
ATOM   7934  C C     . SER B  1 424 ? 71.435  38.882  8.758   1.00 9.83  ? 1455 SER B C     1 
ATOM   7935  O O     . SER B  1 424 ? 70.659  39.027  9.692   1.00 10.59 ? 1455 SER B O     1 
ATOM   7936  C CB    . SER B  1 424 ? 72.222  36.579  8.293   1.00 14.83 ? 1455 SER B CB    1 
ATOM   7937  O OG    . SER B  1 424 ? 73.173  36.304  7.279   1.00 15.75 ? 1455 SER B OG    1 
ATOM   7938  N N     . ARG B  1 425 ? 72.419  39.725  8.495   1.00 8.58  ? 1456 ARG B N     1 
ATOM   7939  C CA    . ARG B  1 425 ? 72.613  40.899  9.308   1.00 12.75 ? 1456 ARG B CA    1 
ATOM   7940  C C     . ARG B  1 425 ? 71.410  41.845  9.128   1.00 14.15 ? 1456 ARG B C     1 
ATOM   7941  O O     . ARG B  1 425 ? 70.790  42.267  10.110  1.00 11.53 ? 1456 ARG B O     1 
ATOM   7942  C CB    . ARG B  1 425 ? 73.923  41.583  8.912   1.00 16.32 ? 1456 ARG B CB    1 
ATOM   7943  C CG    . ARG B  1 425 ? 75.160  41.065  9.666   1.00 19.16 ? 1456 ARG B CG    1 
ATOM   7944  C CD    . ARG B  1 425 ? 76.439  41.070  8.788   1.00 23.28 ? 1456 ARG B CD    1 
ATOM   7945  N NE    . ARG B  1 425 ? 77.530  40.344  9.436   1.00 23.48 ? 1456 ARG B NE    1 
ATOM   7946  C CZ    . ARG B  1 425 ? 78.645  40.910  9.891   1.00 25.06 ? 1456 ARG B CZ    1 
ATOM   7947  N NH1   . ARG B  1 425 ? 78.835  42.218  9.770   1.00 26.79 ? 1456 ARG B NH1   1 
ATOM   7948  N NH2   . ARG B  1 425 ? 79.555  40.167  10.503  1.00 24.53 ? 1456 ARG B NH2   1 
ATOM   7949  N N     . GLU B  1 426 ? 71.074  42.168  7.878   1.00 17.80 ? 1457 GLU B N     1 
ATOM   7950  C CA    . GLU B  1 426 ? 69.926  43.039  7.605   1.00 20.88 ? 1457 GLU B CA    1 
ATOM   7951  C C     . GLU B  1 426 ? 68.731  42.467  8.328   1.00 18.57 ? 1457 GLU B C     1 
ATOM   7952  O O     . GLU B  1 426 ? 68.081  43.159  9.112   1.00 20.42 ? 1457 GLU B O     1 
ATOM   7953  C CB    . GLU B  1 426 ? 69.596  43.092  6.115   1.00 27.44 ? 1457 GLU B CB    1 
ATOM   7954  C CG    . GLU B  1 426 ? 70.712  42.642  5.199   1.00 39.10 ? 1457 GLU B CG    1 
ATOM   7955  C CD    . GLU B  1 426 ? 70.289  42.648  3.738   1.00 47.49 ? 1457 GLU B CD    1 
ATOM   7956  O OE1   . GLU B  1 426 ? 69.648  43.640  3.303   1.00 48.49 ? 1457 GLU B OE1   1 
ATOM   7957  O OE2   . GLU B  1 426 ? 70.597  41.659  3.030   1.00 48.21 ? 1457 GLU B OE2   1 
ATOM   7958  N N     . MET B  1 427 ? 68.451  41.193  8.054   1.00 15.78 ? 1458 MET B N     1 
ATOM   7959  C CA    . MET B  1 427 ? 67.347  40.469  8.688   1.00 11.81 ? 1458 MET B CA    1 
ATOM   7960  C C     . MET B  1 427 ? 67.584  40.318  10.197  1.00 12.11 ? 1458 MET B C     1 
ATOM   7961  O O     . MET B  1 427 ? 67.047  39.403  10.821  1.00 8.43  ? 1458 MET B O     1 
ATOM   7962  C CB    . MET B  1 427 ? 67.214  39.068  8.095   1.00 12.04 ? 1458 MET B CB    1 
ATOM   7963  C CG    . MET B  1 427 ? 67.040  38.977  6.589   1.00 9.52  ? 1458 MET B CG    1 
ATOM   7964  S SD    . MET B  1 427 ? 67.084  37.217  6.172   1.00 21.08 ? 1458 MET B SD    1 
ATOM   7965  C CE    . MET B  1 427 ? 65.961  37.118  4.847   1.00 9.00  ? 1458 MET B CE    1 
ATOM   7966  N N     . LYS B  1 428 ? 68.400  41.200  10.768  1.00 13.61 ? 1459 LYS B N     1 
ATOM   7967  C CA    . LYS B  1 428 ? 68.706  41.155  12.183  1.00 18.80 ? 1459 LYS B CA    1 
ATOM   7968  C C     . LYS B  1 428 ? 68.688  39.734  12.756  1.00 17.17 ? 1459 LYS B C     1 
ATOM   7969  O O     . LYS B  1 428 ? 68.107  39.500  13.826  1.00 16.36 ? 1459 LYS B O     1 
ATOM   7970  C CB    . LYS B  1 428 ? 67.721  42.028  12.962  1.00 25.73 ? 1459 LYS B CB    1 
ATOM   7971  C CG    . LYS B  1 428 ? 67.449  43.369  12.329  1.00 32.03 ? 1459 LYS B CG    1 
ATOM   7972  C CD    . LYS B  1 428 ? 68.545  44.364  12.662  1.00 40.74 ? 1459 LYS B CD    1 
ATOM   7973  C CE    . LYS B  1 428 ? 68.830  45.272  11.470  1.00 46.69 ? 1459 LYS B CE    1 
ATOM   7974  N NZ    . LYS B  1 428 ? 69.284  46.627  11.896  1.00 52.91 ? 1459 LYS B NZ    1 
ATOM   7975  N N     . TYR B  1 429 ? 69.307  38.787  12.048  1.00 15.14 ? 1460 TYR B N     1 
ATOM   7976  C CA    . TYR B  1 429 ? 69.371  37.405  12.526  1.00 14.41 ? 1460 TYR B CA    1 
ATOM   7977  C C     . TYR B  1 429 ? 69.919  37.433  13.939  1.00 16.26 ? 1460 TYR B C     1 
ATOM   7978  O O     . TYR B  1 429 ? 70.520  38.418  14.351  1.00 23.00 ? 1460 TYR B O     1 
ATOM   7979  C CB    . TYR B  1 429 ? 70.309  36.580  11.661  1.00 14.47 ? 1460 TYR B CB    1 
ATOM   7980  C CG    . TYR B  1 429 ? 69.613  35.655  10.705  1.00 13.34 ? 1460 TYR B CG    1 
ATOM   7981  C CD1   . TYR B  1 429 ? 69.030  36.145  9.531   1.00 17.34 ? 1460 TYR B CD1   1 
ATOM   7982  C CD2   . TYR B  1 429 ? 69.558  34.282  10.955  1.00 14.25 ? 1460 TYR B CD2   1 
ATOM   7983  C CE1   . TYR B  1 429 ? 68.408  35.285  8.616   1.00 16.78 ? 1460 TYR B CE1   1 
ATOM   7984  C CE2   . TYR B  1 429 ? 68.943  33.407  10.056  1.00 16.10 ? 1460 TYR B CE2   1 
ATOM   7985  C CZ    . TYR B  1 429 ? 68.372  33.913  8.883   1.00 20.35 ? 1460 TYR B CZ    1 
ATOM   7986  O OH    . TYR B  1 429 ? 67.809  33.048  7.967   1.00 14.65 ? 1460 TYR B OH    1 
ATOM   7987  N N     . GLN B  1 430 ? 69.731  36.362  14.686  1.00 20.45 ? 1461 GLN B N     1 
ATOM   7988  C CA    . GLN B  1 430 ? 70.221  36.339  16.060  1.00 22.59 ? 1461 GLN B CA    1 
ATOM   7989  C C     . GLN B  1 430 ? 71.612  35.713  16.168  1.00 25.52 ? 1461 GLN B C     1 
ATOM   7990  O O     . GLN B  1 430 ? 72.202  35.319  15.157  1.00 27.50 ? 1461 GLN B O     1 
ATOM   7991  C CB    . GLN B  1 430 ? 69.235  35.581  16.958  1.00 27.61 ? 1461 GLN B CB    1 
ATOM   7992  C CG    . GLN B  1 430 ? 68.181  36.473  17.607  1.00 33.04 ? 1461 GLN B CG    1 
ATOM   7993  C CD    . GLN B  1 430 ? 67.374  35.754  18.673  1.00 35.87 ? 1461 GLN B CD    1 
ATOM   7994  O OE1   . GLN B  1 430 ? 67.918  35.002  19.477  1.00 37.48 ? 1461 GLN B OE1   1 
ATOM   7995  N NE2   . GLN B  1 430 ? 66.065  35.984  18.681  1.00 38.58 ? 1461 GLN B NE2   1 
ATOM   7996  N N     . SER B  1 431 ? 72.132  35.626  17.394  1.00 27.19 ? 1462 SER B N     1 
ATOM   7997  C CA    . SER B  1 431 ? 73.452  35.047  17.633  1.00 26.79 ? 1462 SER B CA    1 
ATOM   7998  C C     . SER B  1 431 ? 73.439  33.552  17.330  1.00 27.77 ? 1462 SER B C     1 
ATOM   7999  O O     . SER B  1 431 ? 72.409  32.891  17.447  1.00 27.60 ? 1462 SER B O     1 
ATOM   8000  C CB    . SER B  1 431 ? 73.872  35.281  19.085  1.00 25.98 ? 1462 SER B CB    1 
ATOM   8001  O OG    . SER B  1 431 ? 74.214  34.060  19.722  1.00 23.55 ? 1462 SER B OG    1 
ATOM   8002  N N     . LEU B  1 432 ? 74.586  33.023  16.932  1.00 28.63 ? 1463 LEU B N     1 
ATOM   8003  C CA    . LEU B  1 432 ? 74.690  31.608  16.612  1.00 29.57 ? 1463 LEU B CA    1 
ATOM   8004  C C     . LEU B  1 432 ? 74.457  30.767  17.862  1.00 28.28 ? 1463 LEU B C     1 
ATOM   8005  O O     . LEU B  1 432 ? 73.999  29.626  17.795  1.00 26.49 ? 1463 LEU B O     1 
ATOM   8006  C CB    . LEU B  1 432 ? 76.065  31.290  16.023  1.00 32.48 ? 1463 LEU B CB    1 
ATOM   8007  C CG    . LEU B  1 432 ? 76.360  29.790  16.084  1.00 40.01 ? 1463 LEU B CG    1 
ATOM   8008  C CD1   . LEU B  1 432 ? 76.434  29.218  14.685  1.00 36.95 ? 1463 LEU B CD1   1 
ATOM   8009  C CD2   . LEU B  1 432 ? 77.644  29.548  16.846  1.00 41.16 ? 1463 LEU B CD2   1 
ATOM   8010  N N     . ASN B  1 433 ? 74.792  31.339  19.008  1.00 29.81 ? 1464 ASN B N     1 
ATOM   8011  C CA    . ASN B  1 433 ? 74.598  30.643  20.275  1.00 32.15 ? 1464 ASN B CA    1 
ATOM   8012  C C     . ASN B  1 433 ? 73.093  30.602  20.571  1.00 28.18 ? 1464 ASN B C     1 
ATOM   8013  O O     . ASN B  1 433 ? 72.586  29.672  21.209  1.00 25.15 ? 1464 ASN B O     1 
ATOM   8014  C CB    . ASN B  1 433 ? 75.347  31.372  21.400  1.00 33.93 ? 1464 ASN B CB    1 
ATOM   8015  C CG    . ASN B  1 433 ? 76.803  30.948  21.500  1.00 37.17 ? 1464 ASN B CG    1 
ATOM   8016  O OD1   . ASN B  1 433 ? 77.692  31.785  21.712  1.00 37.61 ? 1464 ASN B OD1   1 
ATOM   8017  N ND2   . ASN B  1 433 ? 77.056  29.640  21.352  1.00 36.35 ? 1464 ASN B ND2   1 
ATOM   8018  N N     . GLU B  1 434 ? 72.390  31.629  20.101  1.00 24.41 ? 1465 GLU B N     1 
ATOM   8019  C CA    . GLU B  1 434 ? 70.956  31.707  20.285  1.00 20.54 ? 1465 GLU B CA    1 
ATOM   8020  C C     . GLU B  1 434 ? 70.363  30.562  19.471  1.00 21.84 ? 1465 GLU B C     1 
ATOM   8021  O O     . GLU B  1 434 ? 69.716  29.669  20.016  1.00 21.33 ? 1465 GLU B O     1 
ATOM   8022  C CB    . GLU B  1 434 ? 70.430  33.054  19.770  1.00 17.63 ? 1465 GLU B CB    1 
ATOM   8023  C CG    . GLU B  1 434 ? 70.953  34.286  20.525  1.00 14.89 ? 1465 GLU B CG    1 
ATOM   8024  C CD    . GLU B  1 434 ? 70.697  34.206  22.034  1.00 15.99 ? 1465 GLU B CD    1 
ATOM   8025  O OE1   . GLU B  1 434 ? 70.425  35.255  22.677  1.00 12.28 ? 1465 GLU B OE1   1 
ATOM   8026  O OE2   . GLU B  1 434 ? 70.764  33.085  22.578  1.00 12.96 ? 1465 GLU B OE2   1 
ATOM   8027  N N     . TYR B  1 435 ? 70.620  30.576  18.168  1.00 19.67 ? 1466 TYR B N     1 
ATOM   8028  C CA    . TYR B  1 435 ? 70.096  29.549  17.290  1.00 19.71 ? 1466 TYR B CA    1 
ATOM   8029  C C     . TYR B  1 435 ? 70.568  28.188  17.725  1.00 19.83 ? 1466 TYR B C     1 
ATOM   8030  O O     . TYR B  1 435 ? 69.992  27.177  17.334  1.00 26.92 ? 1466 TYR B O     1 
ATOM   8031  C CB    . TYR B  1 435 ? 70.521  29.805  15.843  1.00 21.45 ? 1466 TYR B CB    1 
ATOM   8032  C CG    . TYR B  1 435 ? 69.740  30.920  15.193  1.00 27.08 ? 1466 TYR B CG    1 
ATOM   8033  C CD1   . TYR B  1 435 ? 68.443  30.702  14.733  1.00 25.06 ? 1466 TYR B CD1   1 
ATOM   8034  C CD2   . TYR B  1 435 ? 70.282  32.210  15.070  1.00 26.56 ? 1466 TYR B CD2   1 
ATOM   8035  C CE1   . TYR B  1 435 ? 67.694  31.736  14.169  1.00 24.65 ? 1466 TYR B CE1   1 
ATOM   8036  C CE2   . TYR B  1 435 ? 69.543  33.254  14.505  1.00 26.28 ? 1466 TYR B CE2   1 
ATOM   8037  C CZ    . TYR B  1 435 ? 68.239  33.010  14.056  1.00 28.02 ? 1466 TYR B CZ    1 
ATOM   8038  O OH    . TYR B  1 435 ? 67.463  34.029  13.524  1.00 25.59 ? 1466 TYR B OH    1 
ATOM   8039  N N     . ARG B  1 436 ? 71.626  28.152  18.522  1.00 17.46 ? 1467 ARG B N     1 
ATOM   8040  C CA    . ARG B  1 436 ? 72.157  26.879  18.998  1.00 18.23 ? 1467 ARG B CA    1 
ATOM   8041  C C     . ARG B  1 436 ? 71.266  26.448  20.139  1.00 16.69 ? 1467 ARG B C     1 
ATOM   8042  O O     . ARG B  1 436 ? 70.725  25.338  20.151  1.00 18.83 ? 1467 ARG B O     1 
ATOM   8043  C CB    . ARG B  1 436 ? 73.585  27.052  19.521  1.00 17.64 ? 1467 ARG B CB    1 
ATOM   8044  C CG    . ARG B  1 436 ? 74.692  26.639  18.544  1.00 19.74 ? 1467 ARG B CG    1 
ATOM   8045  C CD    . ARG B  1 436 ? 76.038  26.556  19.249  1.00 15.56 ? 1467 ARG B CD    1 
ATOM   8046  N NE    . ARG B  1 436 ? 76.206  25.277  19.931  1.00 11.43 ? 1467 ARG B NE    1 
ATOM   8047  C CZ    . ARG B  1 436 ? 76.296  24.110  19.304  1.00 10.41 ? 1467 ARG B CZ    1 
ATOM   8048  N NH1   . ARG B  1 436 ? 76.231  24.075  17.984  1.00 2.00  ? 1467 ARG B NH1   1 
ATOM   8049  N NH2   . ARG B  1 436 ? 76.451  22.982  19.994  1.00 10.93 ? 1467 ARG B NH2   1 
ATOM   8050  N N     . LYS B  1 437 ? 71.132  27.357  21.102  1.00 17.76 ? 1468 LYS B N     1 
ATOM   8051  C CA    . LYS B  1 437 ? 70.313  27.158  22.290  1.00 15.86 ? 1468 LYS B CA    1 
ATOM   8052  C C     . LYS B  1 437 ? 68.924  26.743  21.819  1.00 18.61 ? 1468 LYS B C     1 
ATOM   8053  O O     . LYS B  1 437 ? 68.345  25.753  22.301  1.00 17.15 ? 1468 LYS B O     1 
ATOM   8054  C CB    . LYS B  1 437 ? 70.213  28.474  23.077  1.00 12.59 ? 1468 LYS B CB    1 
ATOM   8055  C CG    . LYS B  1 437 ? 71.331  28.718  24.077  1.00 9.19  ? 1468 LYS B CG    1 
ATOM   8056  C CD    . LYS B  1 437 ? 70.989  29.847  25.050  1.00 8.93  ? 1468 LYS B CD    1 
ATOM   8057  C CE    . LYS B  1 437 ? 70.661  31.151  24.322  1.00 12.20 ? 1468 LYS B CE    1 
ATOM   8058  N NZ    . LYS B  1 437 ? 70.322  32.346  25.196  1.00 6.46  ? 1468 LYS B NZ    1 
ATOM   8059  N N     . ARG B  1 438 ? 68.407  27.524  20.868  1.00 20.40 ? 1469 ARG B N     1 
ATOM   8060  C CA    . ARG B  1 438 ? 67.092  27.304  20.276  1.00 19.03 ? 1469 ARG B CA    1 
ATOM   8061  C C     . ARG B  1 438 ? 66.867  25.827  20.054  1.00 18.76 ? 1469 ARG B C     1 
ATOM   8062  O O     . ARG B  1 438 ? 65.931  25.252  20.608  1.00 22.99 ? 1469 ARG B O     1 
ATOM   8063  C CB    . ARG B  1 438 ? 66.981  28.028  18.936  1.00 19.82 ? 1469 ARG B CB    1 
ATOM   8064  C CG    . ARG B  1 438 ? 65.560  28.243  18.403  1.00 23.61 ? 1469 ARG B CG    1 
ATOM   8065  C CD    . ARG B  1 438 ? 64.482  27.648  19.294  1.00 27.16 ? 1469 ARG B CD    1 
ATOM   8066  N NE    . ARG B  1 438 ? 63.688  26.627  18.608  1.00 27.87 ? 1469 ARG B NE    1 
ATOM   8067  C CZ    . ARG B  1 438 ? 62.715  26.885  17.738  1.00 27.16 ? 1469 ARG B CZ    1 
ATOM   8068  N NH1   . ARG B  1 438 ? 62.398  28.140  17.432  1.00 27.33 ? 1469 ARG B NH1   1 
ATOM   8069  N NH2   . ARG B  1 438 ? 62.054  25.879  17.179  1.00 27.32 ? 1469 ARG B NH2   1 
ATOM   8070  N N     . PHE B  1 439 ? 67.732  25.205  19.259  1.00 14.46 ? 1470 PHE B N     1 
ATOM   8071  C CA    . PHE B  1 439 ? 67.574  23.791  18.981  1.00 13.08 ? 1470 PHE B CA    1 
ATOM   8072  C C     . PHE B  1 439 ? 68.196  22.897  20.028  1.00 15.13 ? 1470 PHE B C     1 
ATOM   8073  O O     . PHE B  1 439 ? 68.728  21.828  19.718  1.00 11.72 ? 1470 PHE B O     1 
ATOM   8074  C CB    . PHE B  1 439 ? 68.114  23.475  17.598  1.00 9.44  ? 1470 PHE B CB    1 
ATOM   8075  C CG    . PHE B  1 439 ? 67.315  24.109  16.497  1.00 9.00  ? 1470 PHE B CG    1 
ATOM   8076  C CD1   . PHE B  1 439 ? 66.702  23.328  15.512  1.00 8.11  ? 1470 PHE B CD1   1 
ATOM   8077  C CD2   . PHE B  1 439 ? 67.146  25.507  16.456  1.00 7.26  ? 1470 PHE B CD2   1 
ATOM   8078  C CE1   . PHE B  1 439 ? 65.929  23.925  14.495  1.00 5.53  ? 1470 PHE B CE1   1 
ATOM   8079  C CE2   . PHE B  1 439 ? 66.372  26.121  15.446  1.00 3.77  ? 1470 PHE B CE2   1 
ATOM   8080  C CZ    . PHE B  1 439 ? 65.765  25.332  14.468  1.00 4.45  ? 1470 PHE B CZ    1 
ATOM   8081  N N     . SER B  1 440 ? 68.083  23.345  21.278  1.00 16.74 ? 1471 SER B N     1 
ATOM   8082  C CA    . SER B  1 440 ? 68.587  22.629  22.448  1.00 20.02 ? 1471 SER B CA    1 
ATOM   8083  C C     . SER B  1 440 ? 70.011  22.141  22.269  1.00 23.61 ? 1471 SER B C     1 
ATOM   8084  O O     . SER B  1 440 ? 70.316  20.956  22.480  1.00 22.27 ? 1471 SER B O     1 
ATOM   8085  C CB    . SER B  1 440 ? 67.681  21.440  22.789  1.00 19.02 ? 1471 SER B CB    1 
ATOM   8086  O OG    . SER B  1 440 ? 66.805  21.127  21.719  1.00 17.55 ? 1471 SER B OG    1 
ATOM   8087  N N     . LEU B  1 441 ? 70.877  23.071  21.877  1.00 24.65 ? 1472 LEU B N     1 
ATOM   8088  C CA    . LEU B  1 441 ? 72.286  22.784  21.669  1.00 26.57 ? 1472 LEU B CA    1 
ATOM   8089  C C     . LEU B  1 441 ? 73.084  23.605  22.673  1.00 29.65 ? 1472 LEU B C     1 
ATOM   8090  O O     . LEU B  1 441 ? 72.833  24.807  22.823  1.00 32.50 ? 1472 LEU B O     1 
ATOM   8091  C CB    . LEU B  1 441 ? 72.692  23.199  20.260  1.00 23.48 ? 1472 LEU B CB    1 
ATOM   8092  C CG    . LEU B  1 441 ? 72.051  22.424  19.126  1.00 24.23 ? 1472 LEU B CG    1 
ATOM   8093  C CD1   . LEU B  1 441 ? 72.552  22.978  17.804  1.00 26.35 ? 1472 LEU B CD1   1 
ATOM   8094  C CD2   . LEU B  1 441 ? 72.382  20.943  19.280  1.00 22.25 ? 1472 LEU B CD2   1 
ATOM   8095  N N     . LYS B  1 442 ? 74.028  22.974  23.369  1.00 31.73 ? 1473 LYS B N     1 
ATOM   8096  C CA    . LYS B  1 442 ? 74.852  23.712  24.319  1.00 31.98 ? 1473 LYS B CA    1 
ATOM   8097  C C     . LYS B  1 442 ? 75.586  24.739  23.475  1.00 27.90 ? 1473 LYS B C     1 
ATOM   8098  O O     . LYS B  1 442 ? 76.151  24.402  22.437  1.00 27.53 ? 1473 LYS B O     1 
ATOM   8099  C CB    . LYS B  1 442 ? 75.862  22.789  24.997  1.00 37.11 ? 1473 LYS B CB    1 
ATOM   8100  C CG    . LYS B  1 442 ? 75.230  21.679  25.809  1.00 45.26 ? 1473 LYS B CG    1 
ATOM   8101  C CD    . LYS B  1 442 ? 74.810  22.177  27.185  1.00 52.22 ? 1473 LYS B CD    1 
ATOM   8102  C CE    . LYS B  1 442 ? 73.987  21.126  27.914  1.00 56.02 ? 1473 LYS B CE    1 
ATOM   8103  N NZ    . LYS B  1 442 ? 74.829  19.970  28.345  1.00 60.20 ? 1473 LYS B NZ    1 
ATOM   8104  N N     . PRO B  1 443 ? 75.571  26.007  23.894  1.00 27.52 ? 1474 PRO B N     1 
ATOM   8105  C CA    . PRO B  1 443 ? 76.271  27.017  23.092  1.00 30.61 ? 1474 PRO B CA    1 
ATOM   8106  C C     . PRO B  1 443 ? 77.800  26.850  23.122  1.00 28.94 ? 1474 PRO B C     1 
ATOM   8107  O O     . PRO B  1 443 ? 78.356  26.254  24.051  1.00 26.95 ? 1474 PRO B O     1 
ATOM   8108  C CB    . PRO B  1 443 ? 75.814  28.341  23.701  1.00 25.22 ? 1474 PRO B CB    1 
ATOM   8109  C CG    . PRO B  1 443 ? 75.414  27.993  25.105  1.00 26.96 ? 1474 PRO B CG    1 
ATOM   8110  C CD    . PRO B  1 443 ? 74.933  26.574  25.094  1.00 23.94 ? 1474 PRO B CD    1 
ATOM   8111  N N     . TYR B  1 444 ? 78.475  27.367  22.096  1.00 29.66 ? 1475 TYR B N     1 
ATOM   8112  C CA    . TYR B  1 444 ? 79.931  27.267  22.024  1.00 30.31 ? 1475 TYR B CA    1 
ATOM   8113  C C     . TYR B  1 444 ? 80.564  28.297  22.938  1.00 30.54 ? 1475 TYR B C     1 
ATOM   8114  O O     . TYR B  1 444 ? 80.330  29.502  22.813  1.00 29.11 ? 1475 TYR B O     1 
ATOM   8115  C CB    . TYR B  1 444 ? 80.416  27.448  20.585  1.00 27.72 ? 1475 TYR B CB    1 
ATOM   8116  C CG    . TYR B  1 444 ? 80.225  26.202  19.763  1.00 24.81 ? 1475 TYR B CG    1 
ATOM   8117  C CD1   . TYR B  1 444 ? 79.947  26.269  18.396  1.00 25.65 ? 1475 TYR B CD1   1 
ATOM   8118  C CD2   . TYR B  1 444 ? 80.297  24.947  20.362  1.00 24.54 ? 1475 TYR B CD2   1 
ATOM   8119  C CE1   . TYR B  1 444 ? 79.744  25.108  17.649  1.00 23.68 ? 1475 TYR B CE1   1 
ATOM   8120  C CE2   . TYR B  1 444 ? 80.099  23.789  19.633  1.00 22.33 ? 1475 TYR B CE2   1 
ATOM   8121  C CZ    . TYR B  1 444 ? 79.820  23.870  18.284  1.00 24.06 ? 1475 TYR B CZ    1 
ATOM   8122  O OH    . TYR B  1 444 ? 79.590  22.704  17.597  1.00 22.01 ? 1475 TYR B OH    1 
ATOM   8123  N N     . THR B  1 445 ? 81.365  27.792  23.868  1.00 32.48 ? 1476 THR B N     1 
ATOM   8124  C CA    . THR B  1 445 ? 82.037  28.607  24.873  1.00 32.88 ? 1476 THR B CA    1 
ATOM   8125  C C     . THR B  1 445 ? 83.284  29.325  24.388  1.00 32.20 ? 1476 THR B C     1 
ATOM   8126  O O     . THR B  1 445 ? 83.757  30.245  25.046  1.00 31.80 ? 1476 THR B O     1 
ATOM   8127  C CB    . THR B  1 445 ? 82.427  27.743  26.090  1.00 31.62 ? 1476 THR B CB    1 
ATOM   8128  O OG1   . THR B  1 445 ? 83.685  27.106  25.836  1.00 31.56 ? 1476 THR B OG1   1 
ATOM   8129  C CG2   . THR B  1 445 ? 81.371  26.668  26.346  1.00 34.08 ? 1476 THR B CG2   1 
ATOM   8130  N N     . SER B  1 446 ? 83.807  28.905  23.238  1.00 33.81 ? 1477 SER B N     1 
ATOM   8131  C CA    . SER B  1 446 ? 85.026  29.491  22.667  1.00 34.02 ? 1477 SER B CA    1 
ATOM   8132  C C     . SER B  1 446 ? 85.091  29.231  21.175  1.00 33.43 ? 1477 SER B C     1 
ATOM   8133  O O     . SER B  1 446 ? 84.650  28.180  20.705  1.00 35.14 ? 1477 SER B O     1 
ATOM   8134  C CB    . SER B  1 446 ? 86.262  28.859  23.307  1.00 36.21 ? 1477 SER B CB    1 
ATOM   8135  O OG    . SER B  1 446 ? 86.609  27.656  22.636  1.00 37.42 ? 1477 SER B OG    1 
ATOM   8136  N N     . PHE B  1 447 ? 85.654  30.171  20.428  1.00 32.96 ? 1478 PHE B N     1 
ATOM   8137  C CA    . PHE B  1 447 ? 85.757  29.981  18.988  1.00 34.62 ? 1478 PHE B CA    1 
ATOM   8138  C C     . PHE B  1 447 ? 86.520  28.691  18.714  1.00 34.64 ? 1478 PHE B C     1 
ATOM   8139  O O     . PHE B  1 447 ? 86.262  27.999  17.725  1.00 36.14 ? 1478 PHE B O     1 
ATOM   8140  C CB    . PHE B  1 447 ? 86.478  31.155  18.336  1.00 32.50 ? 1478 PHE B CB    1 
ATOM   8141  C CG    . PHE B  1 447 ? 85.789  32.466  18.532  1.00 32.11 ? 1478 PHE B CG    1 
ATOM   8142  C CD1   . PHE B  1 447 ? 85.746  33.058  19.785  1.00 31.84 ? 1478 PHE B CD1   1 
ATOM   8143  C CD2   . PHE B  1 447 ? 85.189  33.120  17.463  1.00 33.39 ? 1478 PHE B CD2   1 
ATOM   8144  C CE1   . PHE B  1 447 ? 85.117  34.286  19.976  1.00 31.31 ? 1478 PHE B CE1   1 
ATOM   8145  C CE2   . PHE B  1 447 ? 84.556  34.349  17.642  1.00 32.10 ? 1478 PHE B CE2   1 
ATOM   8146  C CZ    . PHE B  1 447 ? 84.522  34.934  18.905  1.00 31.03 ? 1478 PHE B CZ    1 
ATOM   8147  N N     . GLU B  1 448 ? 87.449  28.363  19.605  1.00 34.57 ? 1479 GLU B N     1 
ATOM   8148  C CA    . GLU B  1 448 ? 88.248  27.161  19.445  1.00 37.07 ? 1479 GLU B CA    1 
ATOM   8149  C C     . GLU B  1 448 ? 87.378  25.922  19.525  1.00 33.38 ? 1479 GLU B C     1 
ATOM   8150  O O     . GLU B  1 448 ? 87.680  24.897  18.928  1.00 35.19 ? 1479 GLU B O     1 
ATOM   8151  C CB    . GLU B  1 448 ? 89.327  27.102  20.523  1.00 42.92 ? 1479 GLU B CB    1 
ATOM   8152  C CG    . GLU B  1 448 ? 90.619  26.412  20.088  1.00 50.63 ? 1479 GLU B CG    1 
ATOM   8153  C CD    . GLU B  1 448 ? 91.840  27.027  20.734  1.00 52.10 ? 1479 GLU B CD    1 
ATOM   8154  O OE1   . GLU B  1 448 ? 92.072  26.761  21.937  1.00 54.18 ? 1479 GLU B OE1   1 
ATOM   8155  O OE2   . GLU B  1 448 ? 92.558  27.778  20.037  1.00 55.48 ? 1479 GLU B OE2   1 
ATOM   8156  N N     . GLU B  1 449 ? 86.296  26.021  20.280  1.00 33.00 ? 1480 GLU B N     1 
ATOM   8157  C CA    . GLU B  1 449 ? 85.383  24.906  20.437  1.00 30.67 ? 1480 GLU B CA    1 
ATOM   8158  C C     . GLU B  1 449 ? 84.601  24.738  19.149  1.00 29.68 ? 1480 GLU B C     1 
ATOM   8159  O O     . GLU B  1 449 ? 84.421  23.627  18.648  1.00 28.93 ? 1480 GLU B O     1 
ATOM   8160  C CB    . GLU B  1 449 ? 84.426  25.187  21.586  1.00 32.66 ? 1480 GLU B CB    1 
ATOM   8161  C CG    . GLU B  1 449 ? 83.334  24.156  21.750  1.00 33.10 ? 1480 GLU B CG    1 
ATOM   8162  C CD    . GLU B  1 449 ? 82.706  24.207  23.119  1.00 34.99 ? 1480 GLU B CD    1 
ATOM   8163  O OE1   . GLU B  1 449 ? 82.546  25.321  23.656  1.00 32.52 ? 1480 GLU B OE1   1 
ATOM   8164  O OE2   . GLU B  1 449 ? 82.379  23.131  23.656  1.00 36.51 ? 1480 GLU B OE2   1 
ATOM   8165  N N     . LEU B  1 450 ? 84.140  25.862  18.618  1.00 27.18 ? 1481 LEU B N     1 
ATOM   8166  C CA    . LEU B  1 450 ? 83.369  25.874  17.386  1.00 26.87 ? 1481 LEU B CA    1 
ATOM   8167  C C     . LEU B  1 450 ? 84.166  25.307  16.202  1.00 27.80 ? 1481 LEU B C     1 
ATOM   8168  O O     . LEU B  1 450 ? 83.592  24.724  15.280  1.00 26.19 ? 1481 LEU B O     1 
ATOM   8169  C CB    . LEU B  1 450 ? 82.920  27.315  17.084  1.00 21.03 ? 1481 LEU B CB    1 
ATOM   8170  C CG    . LEU B  1 450 ? 82.650  27.707  15.624  1.00 22.30 ? 1481 LEU B CG    1 
ATOM   8171  C CD1   . LEU B  1 450 ? 81.516  26.854  15.050  1.00 20.70 ? 1481 LEU B CD1   1 
ATOM   8172  C CD2   . LEU B  1 450 ? 82.285  29.179  15.550  1.00 21.78 ? 1481 LEU B CD2   1 
ATOM   8173  N N     . THR B  1 451 ? 85.487  25.464  16.236  1.00 28.97 ? 1482 THR B N     1 
ATOM   8174  C CA    . THR B  1 451 ? 86.336  25.001  15.141  1.00 30.27 ? 1482 THR B CA    1 
ATOM   8175  C C     . THR B  1 451 ? 87.227  23.813  15.471  1.00 29.90 ? 1482 THR B C     1 
ATOM   8176  O O     . THR B  1 451 ? 87.540  22.990  14.607  1.00 32.08 ? 1482 THR B O     1 
ATOM   8177  C CB    . THR B  1 451 ? 87.255  26.123  14.678  1.00 27.90 ? 1482 THR B CB    1 
ATOM   8178  O OG1   . THR B  1 451 ? 87.300  27.126  15.692  1.00 26.94 ? 1482 THR B OG1   1 
ATOM   8179  C CG2   . THR B  1 451 ? 86.756  26.732  13.390  1.00 26.19 ? 1482 THR B CG2   1 
ATOM   8180  N N     . GLY B  1 452 ? 87.636  23.726  16.725  1.00 31.83 ? 1483 GLY B N     1 
ATOM   8181  C CA    . GLY B  1 452 ? 88.532  22.659  17.122  1.00 30.36 ? 1483 GLY B CA    1 
ATOM   8182  C C     . GLY B  1 452 ? 89.941  23.195  16.913  1.00 29.28 ? 1483 GLY B C     1 
ATOM   8183  O O     . GLY B  1 452 ? 90.726  23.338  17.867  1.00 30.65 ? 1483 GLY B O     1 
ATOM   8184  N N     . GLU B  1 453 ? 90.260  23.509  15.659  1.00 25.74 ? 1484 GLU B N     1 
ATOM   8185  C CA    . GLU B  1 453 ? 91.569  24.059  15.320  1.00 25.40 ? 1484 GLU B CA    1 
ATOM   8186  C C     . GLU B  1 453 ? 91.713  25.395  16.043  1.00 27.73 ? 1484 GLU B C     1 
ATOM   8187  O O     . GLU B  1 453 ? 90.707  26.010  16.428  1.00 25.72 ? 1484 GLU B O     1 
ATOM   8188  C CB    . GLU B  1 453 ? 91.665  24.287  13.818  1.00 20.77 ? 1484 GLU B CB    1 
ATOM   8189  C CG    . GLU B  1 453 ? 90.584  25.203  13.292  1.00 18.77 ? 1484 GLU B CG    1 
ATOM   8190  C CD    . GLU B  1 453 ? 91.005  26.654  13.277  1.00 15.64 ? 1484 GLU B CD    1 
ATOM   8191  O OE1   . GLU B  1 453 ? 90.688  27.388  14.241  1.00 8.43  ? 1484 GLU B OE1   1 
ATOM   8192  O OE2   . GLU B  1 453 ? 91.647  27.061  12.292  1.00 13.95 ? 1484 GLU B OE2   1 
ATOM   8193  N N     . LYS B  1 454 ? 92.952  25.851  16.216  1.00 24.87 ? 1485 LYS B N     1 
ATOM   8194  C CA    . LYS B  1 454 ? 93.189  27.113  16.912  1.00 23.79 ? 1485 LYS B CA    1 
ATOM   8195  C C     . LYS B  1 454 ? 93.407  28.264  15.950  1.00 18.02 ? 1485 LYS B C     1 
ATOM   8196  O O     . LYS B  1 454 ? 93.239  29.420  16.317  1.00 15.58 ? 1485 LYS B O     1 
ATOM   8197  C CB    . LYS B  1 454 ? 94.404  27.000  17.840  1.00 29.40 ? 1485 LYS B CB    1 
ATOM   8198  C CG    . LYS B  1 454 ? 94.449  25.733  18.693  1.00 34.68 ? 1485 LYS B CG    1 
ATOM   8199  C CD    . LYS B  1 454 ? 95.598  25.783  19.710  1.00 35.72 ? 1485 LYS B CD    1 
ATOM   8200  C CE    . LYS B  1 454 ? 95.525  24.624  20.710  1.00 40.80 ? 1485 LYS B CE    1 
ATOM   8201  N NZ    . LYS B  1 454 ? 95.335  25.089  22.123  1.00 44.72 ? 1485 LYS B NZ    1 
ATOM   8202  N N     . GLU B  1 455 ? 93.777  27.946  14.717  1.00 15.83 ? 1486 GLU B N     1 
ATOM   8203  C CA    . GLU B  1 455 ? 94.028  28.980  13.723  1.00 17.39 ? 1486 GLU B CA    1 
ATOM   8204  C C     . GLU B  1 455 ? 92.851  29.931  13.579  1.00 12.68 ? 1486 GLU B C     1 
ATOM   8205  O O     . GLU B  1 455 ? 92.783  30.955  14.263  1.00 9.70  ? 1486 GLU B O     1 
ATOM   8206  C CB    . GLU B  1 455 ? 94.353  28.350  12.360  1.00 27.43 ? 1486 GLU B CB    1 
ATOM   8207  C CG    . GLU B  1 455 ? 95.680  28.814  11.743  1.00 38.91 ? 1486 GLU B CG    1 
ATOM   8208  C CD    . GLU B  1 455 ? 95.554  30.092  10.908  1.00 49.47 ? 1486 GLU B CD    1 
ATOM   8209  O OE1   . GLU B  1 455 ? 94.915  31.068  11.367  1.00 53.67 ? 1486 GLU B OE1   1 
ATOM   8210  O OE2   . GLU B  1 455 ? 96.103  30.123  9.782   1.00 55.30 ? 1486 GLU B OE2   1 
ATOM   8211  N N     . MET B  1 456 ? 91.941  29.588  12.671  1.00 11.57 ? 1487 MET B N     1 
ATOM   8212  C CA    . MET B  1 456 ? 90.747  30.391  12.403  1.00 11.42 ? 1487 MET B CA    1 
ATOM   8213  C C     . MET B  1 456 ? 90.152  30.940  13.705  1.00 13.03 ? 1487 MET B C     1 
ATOM   8214  O O     . MET B  1 456 ? 89.932  32.155  13.858  1.00 5.90  ? 1487 MET B O     1 
ATOM   8215  C CB    . MET B  1 456 ? 89.706  29.540  11.667  1.00 11.85 ? 1487 MET B CB    1 
ATOM   8216  C CG    . MET B  1 456 ? 90.207  29.008  10.332  1.00 10.14 ? 1487 MET B CG    1 
ATOM   8217  S SD    . MET B  1 456 ? 89.058  27.888  9.481   1.00 14.90 ? 1487 MET B SD    1 
ATOM   8218  C CE    . MET B  1 456 ? 89.151  26.414  10.510  1.00 8.16  ? 1487 MET B CE    1 
ATOM   8219  N N     . ALA B  1 457 ? 89.903  30.024  14.638  1.00 10.89 ? 1488 ALA B N     1 
ATOM   8220  C CA    . ALA B  1 457 ? 89.363  30.378  15.935  1.00 13.67 ? 1488 ALA B CA    1 
ATOM   8221  C C     . ALA B  1 457 ? 89.985  31.694  16.402  1.00 13.29 ? 1488 ALA B C     1 
ATOM   8222  O O     . ALA B  1 457 ? 89.317  32.725  16.506  1.00 9.46  ? 1488 ALA B O     1 
ATOM   8223  C CB    . ALA B  1 457 ? 89.674  29.277  16.919  1.00 10.79 ? 1488 ALA B CB    1 
ATOM   8224  N N     . ALA B  1 458 ? 91.281  31.646  16.669  1.00 18.39 ? 1489 ALA B N     1 
ATOM   8225  C CA    . ALA B  1 458 ? 92.007  32.818  17.121  1.00 21.79 ? 1489 ALA B CA    1 
ATOM   8226  C C     . ALA B  1 458 ? 91.770  33.979  16.151  1.00 26.03 ? 1489 ALA B C     1 
ATOM   8227  O O     . ALA B  1 458 ? 91.534  35.124  16.564  1.00 23.37 ? 1489 ALA B O     1 
ATOM   8228  C CB    . ALA B  1 458 ? 93.480  32.486  17.203  1.00 18.56 ? 1489 ALA B CB    1 
ATOM   8229  N N     . GLU B  1 459 ? 91.828  33.667  14.861  1.00 26.55 ? 1490 GLU B N     1 
ATOM   8230  C CA    . GLU B  1 459 ? 91.618  34.667  13.836  1.00 31.25 ? 1490 GLU B CA    1 
ATOM   8231  C C     . GLU B  1 459 ? 90.248  35.316  14.005  1.00 28.43 ? 1490 GLU B C     1 
ATOM   8232  O O     . GLU B  1 459 ? 90.105  36.533  13.834  1.00 28.46 ? 1490 GLU B O     1 
ATOM   8233  C CB    . GLU B  1 459 ? 91.735  34.021  12.456  1.00 37.54 ? 1490 GLU B CB    1 
ATOM   8234  C CG    . GLU B  1 459 ? 91.198  34.867  11.315  1.00 46.84 ? 1490 GLU B CG    1 
ATOM   8235  C CD    . GLU B  1 459 ? 92.062  36.081  11.019  1.00 52.65 ? 1490 GLU B CD    1 
ATOM   8236  O OE1   . GLU B  1 459 ? 92.696  36.114  9.941   1.00 55.01 ? 1490 GLU B OE1   1 
ATOM   8237  O OE2   . GLU B  1 459 ? 92.105  37.005  11.860  1.00 54.45 ? 1490 GLU B OE2   1 
ATOM   8238  N N     . LEU B  1 460 ? 89.253  34.505  14.365  1.00 24.49 ? 1491 LEU B N     1 
ATOM   8239  C CA    . LEU B  1 460 ? 87.883  34.986  14.548  1.00 20.17 ? 1491 LEU B CA    1 
ATOM   8240  C C     . LEU B  1 460 ? 87.732  35.773  15.833  1.00 20.35 ? 1491 LEU B C     1 
ATOM   8241  O O     . LEU B  1 460 ? 87.157  36.868  15.833  1.00 15.48 ? 1491 LEU B O     1 
ATOM   8242  C CB    . LEU B  1 460 ? 86.912  33.815  14.570  1.00 17.83 ? 1491 LEU B CB    1 
ATOM   8243  C CG    . LEU B  1 460 ? 86.498  33.323  13.187  1.00 19.65 ? 1491 LEU B CG    1 
ATOM   8244  C CD1   . LEU B  1 460 ? 86.078  31.877  13.279  1.00 17.40 ? 1491 LEU B CD1   1 
ATOM   8245  C CD2   . LEU B  1 460 ? 85.370  34.192  12.633  1.00 18.26 ? 1491 LEU B CD2   1 
ATOM   8246  N N     . LYS B  1 461 ? 88.240  35.190  16.922  1.00 18.06 ? 1492 LYS B N     1 
ATOM   8247  C CA    . LYS B  1 461 ? 88.204  35.802  18.246  1.00 18.55 ? 1492 LYS B CA    1 
ATOM   8248  C C     . LYS B  1 461 ? 88.725  37.228  18.135  1.00 16.19 ? 1492 LYS B C     1 
ATOM   8249  O O     . LYS B  1 461 ? 88.367  38.098  18.919  1.00 14.77 ? 1492 LYS B O     1 
ATOM   8250  C CB    . LYS B  1 461 ? 89.070  34.996  19.212  1.00 16.50 ? 1492 LYS B CB    1 
ATOM   8251  C CG    . LYS B  1 461 ? 89.356  35.713  20.513  1.00 17.49 ? 1492 LYS B CG    1 
ATOM   8252  C CD    . LYS B  1 461 ? 88.109  35.801  21.372  1.00 17.93 ? 1492 LYS B CD    1 
ATOM   8253  C CE    . LYS B  1 461 ? 88.455  35.853  22.859  1.00 20.85 ? 1492 LYS B CE    1 
ATOM   8254  N NZ    . LYS B  1 461 ? 88.899  34.528  23.389  1.00 21.95 ? 1492 LYS B NZ    1 
ATOM   8255  N N     . ALA B  1 462 ? 89.582  37.444  17.146  1.00 17.55 ? 1493 ALA B N     1 
ATOM   8256  C CA    . ALA B  1 462 ? 90.143  38.752  16.873  1.00 21.30 ? 1493 ALA B CA    1 
ATOM   8257  C C     . ALA B  1 462 ? 88.989  39.661  16.479  1.00 25.64 ? 1493 ALA B C     1 
ATOM   8258  O O     . ALA B  1 462 ? 88.788  40.734  17.050  1.00 24.92 ? 1493 ALA B O     1 
ATOM   8259  C CB    . ALA B  1 462 ? 91.116  38.651  15.719  1.00 19.28 ? 1493 ALA B CB    1 
ATOM   8260  N N     . LEU B  1 463 ? 88.233  39.181  15.495  1.00 28.57 ? 1494 LEU B N     1 
ATOM   8261  C CA    . LEU B  1 463 ? 87.078  39.862  14.912  1.00 29.98 ? 1494 LEU B CA    1 
ATOM   8262  C C     . LEU B  1 463 ? 85.783  39.983  15.740  1.00 33.29 ? 1494 LEU B C     1 
ATOM   8263  O O     . LEU B  1 463 ? 85.167  41.047  15.766  1.00 34.53 ? 1494 LEU B O     1 
ATOM   8264  C CB    . LEU B  1 463 ? 86.727  39.173  13.598  1.00 25.47 ? 1494 LEU B CB    1 
ATOM   8265  C CG    . LEU B  1 463 ? 87.604  39.423  12.382  1.00 22.56 ? 1494 LEU B CG    1 
ATOM   8266  C CD1   . LEU B  1 463 ? 87.353  38.321  11.354  1.00 20.08 ? 1494 LEU B CD1   1 
ATOM   8267  C CD2   . LEU B  1 463 ? 87.304  40.804  11.811  1.00 16.82 ? 1494 LEU B CD2   1 
ATOM   8268  N N     . TYR B  1 464 ? 85.357  38.901  16.392  1.00 37.60 ? 1495 TYR B N     1 
ATOM   8269  C CA    . TYR B  1 464 ? 84.107  38.925  17.157  1.00 41.40 ? 1495 TYR B CA    1 
ATOM   8270  C C     . TYR B  1 464 ? 84.258  39.189  18.654  1.00 42.65 ? 1495 TYR B C     1 
ATOM   8271  O O     . TYR B  1 464 ? 83.345  39.719  19.286  1.00 43.92 ? 1495 TYR B O     1 
ATOM   8272  C CB    . TYR B  1 464 ? 83.339  37.603  16.958  1.00 39.06 ? 1495 TYR B CB    1 
ATOM   8273  C CG    . TYR B  1 464 ? 82.672  37.444  15.598  1.00 38.16 ? 1495 TYR B CG    1 
ATOM   8274  C CD1   . TYR B  1 464 ? 83.426  37.223  14.449  1.00 36.42 ? 1495 TYR B CD1   1 
ATOM   8275  C CD2   . TYR B  1 464 ? 81.285  37.505  15.465  1.00 37.35 ? 1495 TYR B CD2   1 
ATOM   8276  C CE1   . TYR B  1 464 ? 82.821  37.069  13.208  1.00 33.90 ? 1495 TYR B CE1   1 
ATOM   8277  C CE2   . TYR B  1 464 ? 80.672  37.354  14.225  1.00 34.81 ? 1495 TYR B CE2   1 
ATOM   8278  C CZ    . TYR B  1 464 ? 81.447  37.137  13.106  1.00 34.14 ? 1495 TYR B CZ    1 
ATOM   8279  O OH    . TYR B  1 464 ? 80.846  36.992  11.881  1.00 32.57 ? 1495 TYR B OH    1 
ATOM   8280  N N     . SER B  1 465 ? 85.403  38.822  19.217  1.00 45.73 ? 1496 SER B N     1 
ATOM   8281  C CA    . SER B  1 465 ? 85.639  39.004  20.646  1.00 47.60 ? 1496 SER B CA    1 
ATOM   8282  C C     . SER B  1 465 ? 84.789  38.014  21.449  1.00 46.79 ? 1496 SER B C     1 
ATOM   8283  O O     . SER B  1 465 ? 85.285  36.967  21.864  1.00 48.78 ? 1496 SER B O     1 
ATOM   8284  C CB    . SER B  1 465 ? 85.315  40.441  21.069  1.00 49.71 ? 1496 SER B CB    1 
ATOM   8285  O OG    . SER B  1 465 ? 85.579  41.349  20.013  1.00 52.72 ? 1496 SER B OG    1 
ATOM   8286  N N     . ASP B  1 466 ? 83.512  38.330  21.661  1.00 42.49 ? 1497 ASP B N     1 
ATOM   8287  C CA    . ASP B  1 466 ? 82.633  37.433  22.415  1.00 37.84 ? 1497 ASP B CA    1 
ATOM   8288  C C     . ASP B  1 466 ? 82.085  36.316  21.551  1.00 31.46 ? 1497 ASP B C     1 
ATOM   8289  O O     . ASP B  1 466 ? 81.378  36.574  20.581  1.00 33.06 ? 1497 ASP B O     1 
ATOM   8290  C CB    . ASP B  1 466 ? 81.457  38.198  23.035  1.00 37.04 ? 1497 ASP B CB    1 
ATOM   8291  C CG    . ASP B  1 466 ? 80.747  37.395  24.120  1.00 37.99 ? 1497 ASP B CG    1 
ATOM   8292  O OD1   . ASP B  1 466 ? 79.873  37.966  24.803  1.00 36.26 ? 1497 ASP B OD1   1 
ATOM   8293  O OD2   . ASP B  1 466 ? 81.062  36.196  24.292  1.00 34.91 ? 1497 ASP B OD2   1 
ATOM   8294  N N     . ILE B  1 467 ? 82.414  35.076  21.913  1.00 26.15 ? 1498 ILE B N     1 
ATOM   8295  C CA    . ILE B  1 467 ? 81.949  33.902  21.176  1.00 20.03 ? 1498 ILE B CA    1 
ATOM   8296  C C     . ILE B  1 467 ? 80.453  34.053  20.846  1.00 19.30 ? 1498 ILE B C     1 
ATOM   8297  O O     . ILE B  1 467 ? 80.009  33.797  19.713  1.00 15.76 ? 1498 ILE B O     1 
ATOM   8298  C CB    . ILE B  1 467 ? 82.178  32.610  22.004  1.00 15.54 ? 1498 ILE B CB    1 
ATOM   8299  C CG1   . ILE B  1 467 ? 81.818  31.375  21.172  1.00 9.48  ? 1498 ILE B CG1   1 
ATOM   8300  C CG2   . ILE B  1 467 ? 81.350  32.651  23.283  1.00 16.83 ? 1498 ILE B CG2   1 
ATOM   8301  C CD1   . ILE B  1 467 ? 82.409  31.362  19.789  1.00 3.63  ? 1498 ILE B CD1   1 
ATOM   8302  N N     . ASP B  1 468 ? 79.688  34.490  21.844  1.00 17.69 ? 1499 ASP B N     1 
ATOM   8303  C CA    . ASP B  1 468 ? 78.259  34.692  21.687  1.00 13.38 ? 1499 ASP B CA    1 
ATOM   8304  C C     . ASP B  1 468 ? 78.011  35.490  20.423  1.00 12.71 ? 1499 ASP B C     1 
ATOM   8305  O O     . ASP B  1 468 ? 77.338  35.035  19.513  1.00 16.25 ? 1499 ASP B O     1 
ATOM   8306  C CB    . ASP B  1 468 ? 77.693  35.445  22.893  1.00 14.21 ? 1499 ASP B CB    1 
ATOM   8307  C CG    . ASP B  1 468 ? 77.991  34.743  24.208  1.00 18.56 ? 1499 ASP B CG    1 
ATOM   8308  O OD1   . ASP B  1 468 ? 78.134  33.497  24.196  1.00 19.33 ? 1499 ASP B OD1   1 
ATOM   8309  O OD2   . ASP B  1 468 ? 78.085  35.439  25.248  1.00 16.80 ? 1499 ASP B OD2   1 
ATOM   8310  N N     . VAL B  1 469 ? 78.589  36.675  20.350  1.00 8.41  ? 1500 VAL B N     1 
ATOM   8311  C CA    . VAL B  1 469 ? 78.384  37.524  19.186  1.00 6.88  ? 1500 VAL B CA    1 
ATOM   8312  C C     . VAL B  1 469 ? 78.763  36.898  17.850  1.00 5.52  ? 1500 VAL B C     1 
ATOM   8313  O O     . VAL B  1 469 ? 78.764  37.578  16.820  1.00 2.00  ? 1500 VAL B O     1 
ATOM   8314  C CB    . VAL B  1 469 ? 79.139  38.853  19.339  1.00 8.31  ? 1500 VAL B CB    1 
ATOM   8315  C CG1   . VAL B  1 469 ? 78.555  39.882  18.380  1.00 9.70  ? 1500 VAL B CG1   1 
ATOM   8316  C CG2   . VAL B  1 469 ? 79.036  39.345  20.780  1.00 3.29  ? 1500 VAL B CG2   1 
ATOM   8317  N N     . MET B  1 470 ? 79.084  35.609  17.863  1.00 2.00  ? 1501 MET B N     1 
ATOM   8318  C CA    . MET B  1 470 ? 79.436  34.923  16.626  1.00 9.27  ? 1501 MET B CA    1 
ATOM   8319  C C     . MET B  1 470 ? 78.193  34.728  15.759  1.00 11.95 ? 1501 MET B C     1 
ATOM   8320  O O     . MET B  1 470 ? 77.167  34.242  16.234  1.00 19.15 ? 1501 MET B O     1 
ATOM   8321  C CB    . MET B  1 470 ? 80.060  33.554  16.927  1.00 9.18  ? 1501 MET B CB    1 
ATOM   8322  C CG    . MET B  1 470 ? 80.765  32.899  15.729  1.00 10.64 ? 1501 MET B CG    1 
ATOM   8323  S SD    . MET B  1 470 ? 81.390  34.119  14.497  1.00 16.34 ? 1501 MET B SD    1 
ATOM   8324  C CE    . MET B  1 470 ? 81.251  33.116  12.989  1.00 9.19  ? 1501 MET B CE    1 
ATOM   8325  N N     . GLU B  1 471 ? 78.281  35.122  14.493  1.00 10.92 ? 1502 GLU B N     1 
ATOM   8326  C CA    . GLU B  1 471 ? 77.173  34.944  13.561  1.00 9.99  ? 1502 GLU B CA    1 
ATOM   8327  C C     . GLU B  1 471 ? 77.008  33.464  13.150  1.00 13.83 ? 1502 GLU B C     1 
ATOM   8328  O O     . GLU B  1 471 ? 77.986  32.715  12.996  1.00 13.65 ? 1502 GLU B O     1 
ATOM   8329  C CB    . GLU B  1 471 ? 77.393  35.803  12.328  1.00 2.00  ? 1502 GLU B CB    1 
ATOM   8330  C CG    . GLU B  1 471 ? 77.601  37.254  12.672  1.00 5.91  ? 1502 GLU B CG    1 
ATOM   8331  C CD    . GLU B  1 471 ? 77.451  38.174  11.468  1.00 11.71 ? 1502 GLU B CD    1 
ATOM   8332  O OE1   . GLU B  1 471 ? 77.479  37.691  10.309  1.00 7.25  ? 1502 GLU B OE1   1 
ATOM   8333  O OE2   . GLU B  1 471 ? 77.303  39.397  11.682  1.00 11.42 ? 1502 GLU B OE2   1 
ATOM   8334  N N     . LEU B  1 472 ? 75.752  33.054  12.996  1.00 17.08 ? 1503 LEU B N     1 
ATOM   8335  C CA    . LEU B  1 472 ? 75.403  31.693  12.614  1.00 16.68 ? 1503 LEU B CA    1 
ATOM   8336  C C     . LEU B  1 472 ? 75.997  31.248  11.288  1.00 15.37 ? 1503 LEU B C     1 
ATOM   8337  O O     . LEU B  1 472 ? 76.925  30.437  11.258  1.00 13.50 ? 1503 LEU B O     1 
ATOM   8338  C CB    . LEU B  1 472 ? 73.883  31.548  12.551  1.00 17.23 ? 1503 LEU B CB    1 
ATOM   8339  C CG    . LEU B  1 472 ? 73.342  30.253  11.930  1.00 20.42 ? 1503 LEU B CG    1 
ATOM   8340  C CD1   . LEU B  1 472 ? 73.692  29.044  12.811  1.00 17.90 ? 1503 LEU B CD1   1 
ATOM   8341  C CD2   . LEU B  1 472 ? 71.840  30.375  11.754  1.00 18.58 ? 1503 LEU B CD2   1 
ATOM   8342  N N     . TYR B  1 473 ? 75.452  31.778  10.193  1.00 16.37 ? 1504 TYR B N     1 
ATOM   8343  C CA    . TYR B  1 473 ? 75.926  31.413  8.859   1.00 17.81 ? 1504 TYR B CA    1 
ATOM   8344  C C     . TYR B  1 473 ? 77.422  31.159  8.820   1.00 17.11 ? 1504 TYR B C     1 
ATOM   8345  O O     . TYR B  1 473 ? 77.877  30.082  8.418   1.00 11.60 ? 1504 TYR B O     1 
ATOM   8346  C CB    . TYR B  1 473 ? 75.619  32.502  7.825   1.00 19.42 ? 1504 TYR B CB    1 
ATOM   8347  C CG    . TYR B  1 473 ? 76.157  32.122  6.455   1.00 22.96 ? 1504 TYR B CG    1 
ATOM   8348  C CD1   . TYR B  1 473 ? 75.802  30.903  5.870   1.00 21.35 ? 1504 TYR B CD1   1 
ATOM   8349  C CD2   . TYR B  1 473 ? 77.068  32.933  5.779   1.00 22.02 ? 1504 TYR B CD2   1 
ATOM   8350  C CE1   . TYR B  1 473 ? 76.339  30.497  4.660   1.00 21.41 ? 1504 TYR B CE1   1 
ATOM   8351  C CE2   . TYR B  1 473 ? 77.617  32.530  4.555   1.00 21.59 ? 1504 TYR B CE2   1 
ATOM   8352  C CZ    . TYR B  1 473 ? 77.244  31.308  4.006   1.00 22.68 ? 1504 TYR B CZ    1 
ATOM   8353  O OH    . TYR B  1 473 ? 77.770  30.884  2.807   1.00 21.71 ? 1504 TYR B OH    1 
ATOM   8354  N N     . PRO B  1 474 ? 78.206  32.160  9.244   1.00 17.12 ? 1505 PRO B N     1 
ATOM   8355  C CA    . PRO B  1 474 ? 79.663  32.015  9.239   1.00 17.17 ? 1505 PRO B CA    1 
ATOM   8356  C C     . PRO B  1 474 ? 80.029  30.787  10.045  1.00 16.93 ? 1505 PRO B C     1 
ATOM   8357  O O     . PRO B  1 474 ? 80.542  29.793  9.517   1.00 19.03 ? 1505 PRO B O     1 
ATOM   8358  C CB    . PRO B  1 474 ? 80.170  33.288  9.913   1.00 17.34 ? 1505 PRO B CB    1 
ATOM   8359  C CG    . PRO B  1 474 ? 79.025  34.231  9.940   1.00 19.91 ? 1505 PRO B CG    1 
ATOM   8360  C CD    . PRO B  1 474 ? 77.761  33.453  9.799   1.00 17.80 ? 1505 PRO B CD    1 
ATOM   8361  N N     . ALA B  1 475 ? 79.744  30.874  11.338  1.00 15.94 ? 1506 ALA B N     1 
ATOM   8362  C CA    . ALA B  1 475 ? 80.031  29.795  12.260  1.00 15.37 ? 1506 ALA B CA    1 
ATOM   8363  C C     . ALA B  1 475 ? 79.714  28.426  11.663  1.00 16.54 ? 1506 ALA B C     1 
ATOM   8364  O O     . ALA B  1 475 ? 80.346  27.435  11.993  1.00 13.54 ? 1506 ALA B O     1 
ATOM   8365  C CB    . ALA B  1 475 ? 79.245  30.006  13.534  1.00 17.31 ? 1506 ALA B CB    1 
ATOM   8366  N N     . LEU B  1 476 ? 78.747  28.381  10.760  1.00 15.13 ? 1507 LEU B N     1 
ATOM   8367  C CA    . LEU B  1 476 ? 78.354  27.123  10.159  1.00 15.19 ? 1507 LEU B CA    1 
ATOM   8368  C C     . LEU B  1 476 ? 79.383  26.548  9.205   1.00 16.64 ? 1507 LEU B C     1 
ATOM   8369  O O     . LEU B  1 476 ? 79.711  25.357  9.272   1.00 15.56 ? 1507 LEU B O     1 
ATOM   8370  C CB    . LEU B  1 476 ? 77.031  27.299  9.425   1.00 16.05 ? 1507 LEU B CB    1 
ATOM   8371  C CG    . LEU B  1 476 ? 75.784  27.239  10.298  1.00 14.15 ? 1507 LEU B CG    1 
ATOM   8372  C CD1   . LEU B  1 476 ? 74.731  28.202  9.727   1.00 11.11 ? 1507 LEU B CD1   1 
ATOM   8373  C CD2   . LEU B  1 476 ? 75.289  25.801  10.356  1.00 6.88  ? 1507 LEU B CD2   1 
ATOM   8374  N N     . LEU B  1 477 ? 79.873  27.396  8.306   1.00 21.04 ? 1508 LEU B N     1 
ATOM   8375  C CA    . LEU B  1 477 ? 80.852  26.995  7.300   1.00 21.70 ? 1508 LEU B CA    1 
ATOM   8376  C C     . LEU B  1 477 ? 82.212  26.756  7.923   1.00 26.75 ? 1508 LEU B C     1 
ATOM   8377  O O     . LEU B  1 477 ? 82.998  25.942  7.434   1.00 24.43 ? 1508 LEU B O     1 
ATOM   8378  C CB    . LEU B  1 477 ? 80.964  28.083  6.237   1.00 23.15 ? 1508 LEU B CB    1 
ATOM   8379  C CG    . LEU B  1 477 ? 79.852  28.107  5.183   1.00 24.28 ? 1508 LEU B CG    1 
ATOM   8380  C CD1   . LEU B  1 477 ? 80.173  29.139  4.104   1.00 24.60 ? 1508 LEU B CD1   1 
ATOM   8381  C CD2   . LEU B  1 477 ? 79.712  26.727  4.563   1.00 24.79 ? 1508 LEU B CD2   1 
ATOM   8382  N N     . VAL B  1 478 ? 82.473  27.478  9.011   1.00 29.60 ? 1509 VAL B N     1 
ATOM   8383  C CA    . VAL B  1 478 ? 83.733  27.380  9.744   1.00 32.88 ? 1509 VAL B CA    1 
ATOM   8384  C C     . VAL B  1 478 ? 83.623  26.336  10.841  1.00 32.26 ? 1509 VAL B C     1 
ATOM   8385  O O     . VAL B  1 478 ? 84.624  25.813  11.309  1.00 35.64 ? 1509 VAL B O     1 
ATOM   8386  C CB    . VAL B  1 478 ? 84.097  28.736  10.380  1.00 35.12 ? 1509 VAL B CB    1 
ATOM   8387  C CG1   . VAL B  1 478 ? 85.320  28.590  11.251  1.00 38.50 ? 1509 VAL B CG1   1 
ATOM   8388  C CG2   . VAL B  1 478 ? 84.349  29.771  9.290   1.00 37.31 ? 1509 VAL B CG2   1 
ATOM   8389  N N     . GLU B  1 479 ? 82.393  26.039  11.243  1.00 33.04 ? 1510 GLU B N     1 
ATOM   8390  C CA    . GLU B  1 479 ? 82.133  25.046  12.279  1.00 31.70 ? 1510 GLU B CA    1 
ATOM   8391  C C     . GLU B  1 479 ? 83.139  23.894  12.214  1.00 28.39 ? 1510 GLU B C     1 
ATOM   8392  O O     . GLU B  1 479 ? 83.788  23.664  11.197  1.00 28.62 ? 1510 GLU B O     1 
ATOM   8393  C CB    . GLU B  1 479 ? 80.705  24.502  12.133  1.00 35.29 ? 1510 GLU B CB    1 
ATOM   8394  C CG    . GLU B  1 479 ? 79.963  24.315  13.452  1.00 39.91 ? 1510 GLU B CG    1 
ATOM   8395  C CD    . GLU B  1 479 ? 78.888  23.247  13.364  1.00 43.56 ? 1510 GLU B CD    1 
ATOM   8396  O OE1   . GLU B  1 479 ? 78.481  22.910  12.228  1.00 44.39 ? 1510 GLU B OE1   1 
ATOM   8397  O OE2   . GLU B  1 479 ? 78.456  22.748  14.427  1.00 39.92 ? 1510 GLU B OE2   1 
ATOM   8398  N N     . LYS B  1 480 ? 83.263  23.165  13.310  1.00 26.24 ? 1511 LYS B N     1 
ATOM   8399  C CA    . LYS B  1 480 ? 84.198  22.054  13.374  1.00 20.20 ? 1511 LYS B CA    1 
ATOM   8400  C C     . LYS B  1 480 ? 83.544  20.729  12.981  1.00 14.38 ? 1511 LYS B C     1 
ATOM   8401  O O     . LYS B  1 480 ? 82.916  20.061  13.795  1.00 15.71 ? 1511 LYS B O     1 
ATOM   8402  C CB    . LYS B  1 480 ? 84.771  21.957  14.786  1.00 20.78 ? 1511 LYS B CB    1 
ATOM   8403  C CG    . LYS B  1 480 ? 85.637  20.756  15.013  1.00 23.30 ? 1511 LYS B CG    1 
ATOM   8404  C CD    . LYS B  1 480 ? 85.178  20.008  16.236  1.00 27.58 ? 1511 LYS B CD    1 
ATOM   8405  C CE    . LYS B  1 480 ? 85.363  18.518  16.061  1.00 28.90 ? 1511 LYS B CE    1 
ATOM   8406  N NZ    . LYS B  1 480 ? 85.527  17.845  17.383  1.00 36.58 ? 1511 LYS B NZ    1 
ATOM   8407  N N     . PRO B  1 481 ? 83.684  20.339  11.717  1.00 9.65  ? 1512 PRO B N     1 
ATOM   8408  C CA    . PRO B  1 481 ? 83.111  19.094  11.201  1.00 14.19 ? 1512 PRO B CA    1 
ATOM   8409  C C     . PRO B  1 481 ? 83.094  17.903  12.129  1.00 16.76 ? 1512 PRO B C     1 
ATOM   8410  O O     . PRO B  1 481 ? 83.841  17.824  13.090  1.00 18.69 ? 1512 PRO B O     1 
ATOM   8411  C CB    . PRO B  1 481 ? 83.940  18.805  9.967   1.00 6.36  ? 1512 PRO B CB    1 
ATOM   8412  C CG    . PRO B  1 481 ? 84.286  20.179  9.458   1.00 11.78 ? 1512 PRO B CG    1 
ATOM   8413  C CD    . PRO B  1 481 ? 84.393  21.091  10.669  1.00 8.01  ? 1512 PRO B CD    1 
ATOM   8414  N N     . ARG B  1 482 ? 82.213  16.967  11.815  1.00 21.62 ? 1513 ARG B N     1 
ATOM   8415  C CA    . ARG B  1 482 ? 82.087  15.746  12.585  1.00 25.51 ? 1513 ARG B CA    1 
ATOM   8416  C C     . ARG B  1 482 ? 83.124  14.812  11.982  1.00 26.26 ? 1513 ARG B C     1 
ATOM   8417  O O     . ARG B  1 482 ? 83.536  14.989  10.837  1.00 25.66 ? 1513 ARG B O     1 
ATOM   8418  C CB    . ARG B  1 482 ? 80.685  15.159  12.400  1.00 30.34 ? 1513 ARG B CB    1 
ATOM   8419  C CG    . ARG B  1 482 ? 79.767  15.337  13.586  1.00 36.61 ? 1513 ARG B CG    1 
ATOM   8420  C CD    . ARG B  1 482 ? 78.716  16.431  13.357  1.00 43.11 ? 1513 ARG B CD    1 
ATOM   8421  N NE    . ARG B  1 482 ? 77.897  16.610  14.558  1.00 53.40 ? 1513 ARG B NE    1 
ATOM   8422  C CZ    . ARG B  1 482 ? 76.572  16.509  14.595  1.00 57.27 ? 1513 ARG B CZ    1 
ATOM   8423  N NH1   . ARG B  1 482 ? 75.895  16.231  13.494  1.00 59.08 ? 1513 ARG B NH1   1 
ATOM   8424  N NH2   . ARG B  1 482 ? 75.921  16.678  15.738  1.00 62.19 ? 1513 ARG B NH2   1 
ATOM   8425  N N     . PRO B  1 483 ? 83.570  13.816  12.750  1.00 25.13 ? 1514 PRO B N     1 
ATOM   8426  C CA    . PRO B  1 483 ? 84.564  12.831  12.309  1.00 25.36 ? 1514 PRO B CA    1 
ATOM   8427  C C     . PRO B  1 483 ? 84.422  12.410  10.850  1.00 29.39 ? 1514 PRO B C     1 
ATOM   8428  O O     . PRO B  1 483 ? 83.794  11.399  10.563  1.00 29.99 ? 1514 PRO B O     1 
ATOM   8429  C CB    . PRO B  1 483 ? 84.336  11.650  13.246  1.00 21.98 ? 1514 PRO B CB    1 
ATOM   8430  C CG    . PRO B  1 483 ? 83.785  12.259  14.498  1.00 23.20 ? 1514 PRO B CG    1 
ATOM   8431  C CD    . PRO B  1 483 ? 83.149  13.593  14.142  1.00 24.24 ? 1514 PRO B CD    1 
ATOM   8432  N N     . ASP B  1 484 ? 85.013  13.180  9.939   1.00 32.82 ? 1515 ASP B N     1 
ATOM   8433  C CA    . ASP B  1 484 ? 84.962  12.877  8.502   1.00 35.52 ? 1515 ASP B CA    1 
ATOM   8434  C C     . ASP B  1 484 ? 83.658  13.295  7.841   1.00 33.31 ? 1515 ASP B C     1 
ATOM   8435  O O     . ASP B  1 484 ? 83.426  13.028  6.663   1.00 32.25 ? 1515 ASP B O     1 
ATOM   8436  C CB    . ASP B  1 484 ? 85.187  11.379  8.256   1.00 40.93 ? 1515 ASP B CB    1 
ATOM   8437  C CG    . ASP B  1 484 ? 86.446  10.864  8.927   1.00 46.44 ? 1515 ASP B CG    1 
ATOM   8438  O OD1   . ASP B  1 484 ? 87.558  11.260  8.503   1.00 46.97 ? 1515 ASP B OD1   1 
ATOM   8439  O OD2   . ASP B  1 484 ? 86.317  10.064  9.879   1.00 49.72 ? 1515 ASP B OD2   1 
ATOM   8440  N N     . ALA B  1 485 ? 82.801  13.943  8.611   1.00 30.14 ? 1516 ALA B N     1 
ATOM   8441  C CA    . ALA B  1 485 ? 81.531  14.399  8.089   1.00 31.57 ? 1516 ALA B CA    1 
ATOM   8442  C C     . ALA B  1 485 ? 81.758  15.633  7.250   1.00 30.03 ? 1516 ALA B C     1 
ATOM   8443  O O     . ALA B  1 485 ? 82.867  16.160  7.199   1.00 31.49 ? 1516 ALA B O     1 
ATOM   8444  C CB    . ALA B  1 485 ? 80.593  14.715  9.215   1.00 32.09 ? 1516 ALA B CB    1 
ATOM   8445  N N     . ILE B  1 486 ? 80.697  16.102  6.605   1.00 26.90 ? 1517 ILE B N     1 
ATOM   8446  C CA    . ILE B  1 486 ? 80.793  17.278  5.762   1.00 25.84 ? 1517 ILE B CA    1 
ATOM   8447  C C     . ILE B  1 486 ? 80.218  18.473  6.480   1.00 24.55 ? 1517 ILE B C     1 
ATOM   8448  O O     . ILE B  1 486 ? 80.491  19.621  6.112   1.00 24.80 ? 1517 ILE B O     1 
ATOM   8449  C CB    . ILE B  1 486 ? 80.037  17.073  4.445   1.00 24.59 ? 1517 ILE B CB    1 
ATOM   8450  C CG1   . ILE B  1 486 ? 79.807  18.418  3.745   1.00 22.44 ? 1517 ILE B CG1   1 
ATOM   8451  C CG2   . ILE B  1 486 ? 78.741  16.353  4.718   1.00 27.26 ? 1517 ILE B CG2   1 
ATOM   8452  C CD1   . ILE B  1 486 ? 79.753  18.298  2.237   1.00 20.23 ? 1517 ILE B CD1   1 
ATOM   8453  N N     . PHE B  1 487 ? 79.421  18.198  7.508   1.00 23.03 ? 1518 PHE B N     1 
ATOM   8454  C CA    . PHE B  1 487 ? 78.798  19.264  8.293   1.00 23.63 ? 1518 PHE B CA    1 
ATOM   8455  C C     . PHE B  1 487 ? 79.175  19.173  9.751   1.00 19.27 ? 1518 PHE B C     1 
ATOM   8456  O O     . PHE B  1 487 ? 79.607  18.114  10.235  1.00 16.47 ? 1518 PHE B O     1 
ATOM   8457  C CB    . PHE B  1 487 ? 77.266  19.192  8.231   1.00 23.51 ? 1518 PHE B CB    1 
ATOM   8458  C CG    . PHE B  1 487 ? 76.699  19.392  6.866   1.00 20.24 ? 1518 PHE B CG    1 
ATOM   8459  C CD1   . PHE B  1 487 ? 76.958  20.562  6.156   1.00 13.65 ? 1518 PHE B CD1   1 
ATOM   8460  C CD2   . PHE B  1 487 ? 75.906  18.398  6.285   1.00 16.94 ? 1518 PHE B CD2   1 
ATOM   8461  C CE1   . PHE B  1 487 ? 76.439  20.744  4.886   1.00 13.93 ? 1518 PHE B CE1   1 
ATOM   8462  C CE2   . PHE B  1 487 ? 75.382  18.567  5.014   1.00 16.78 ? 1518 PHE B CE2   1 
ATOM   8463  C CZ    . PHE B  1 487 ? 75.652  19.746  4.312   1.00 17.18 ? 1518 PHE B CZ    1 
ATOM   8464  N N     . GLY B  1 488 ? 78.988  20.290  10.448  1.00 17.35 ? 1519 GLY B N     1 
ATOM   8465  C CA    . GLY B  1 488 ? 79.249  20.303  11.870  1.00 20.39 ? 1519 GLY B CA    1 
ATOM   8466  C C     . GLY B  1 488 ? 77.972  19.792  12.532  1.00 22.29 ? 1519 GLY B C     1 
ATOM   8467  O O     . GLY B  1 488 ? 77.100  19.217  11.852  1.00 22.35 ? 1519 GLY B O     1 
ATOM   8468  N N     . GLU B  1 489 ? 77.843  19.988  13.843  1.00 19.79 ? 1520 GLU B N     1 
ATOM   8469  C CA    . GLU B  1 489 ? 76.640  19.544  14.542  1.00 17.93 ? 1520 GLU B CA    1 
ATOM   8470  C C     . GLU B  1 489 ? 75.564  20.592  14.287  1.00 16.16 ? 1520 GLU B C     1 
ATOM   8471  O O     . GLU B  1 489 ? 74.456  20.271  13.864  1.00 17.40 ? 1520 GLU B O     1 
ATOM   8472  C CB    . GLU B  1 489 ? 76.934  19.375  16.041  1.00 14.99 ? 1520 GLU B CB    1 
ATOM   8473  C CG    . GLU B  1 489 ? 75.789  19.631  16.980  1.00 9.44  ? 1520 GLU B CG    1 
ATOM   8474  C CD    . GLU B  1 489 ? 76.202  20.534  18.131  1.00 12.20 ? 1520 GLU B CD    1 
ATOM   8475  O OE1   . GLU B  1 489 ? 76.582  21.693  17.867  1.00 10.64 ? 1520 GLU B OE1   1 
ATOM   8476  O OE2   . GLU B  1 489 ? 76.158  20.095  19.299  1.00 7.61  ? 1520 GLU B OE2   1 
ATOM   8477  N N     . THR B  1 490 ? 75.916  21.849  14.505  1.00 15.32 ? 1521 THR B N     1 
ATOM   8478  C CA    . THR B  1 490 ? 74.984  22.943  14.296  1.00 16.01 ? 1521 THR B CA    1 
ATOM   8479  C C     . THR B  1 490 ? 74.161  22.827  12.999  1.00 14.02 ? 1521 THR B C     1 
ATOM   8480  O O     . THR B  1 490 ? 72.921  22.753  13.042  1.00 13.72 ? 1521 THR B O     1 
ATOM   8481  C CB    . THR B  1 490 ? 75.737  24.293  14.323  1.00 15.04 ? 1521 THR B CB    1 
ATOM   8482  O OG1   . THR B  1 490 ? 75.866  24.732  15.685  1.00 18.69 ? 1521 THR B OG1   1 
ATOM   8483  C CG2   . THR B  1 490 ? 74.997  25.352  13.505  1.00 13.36 ? 1521 THR B CG2   1 
ATOM   8484  N N     . MET B  1 491 ? 74.830  22.804  11.850  1.00 12.35 ? 1522 MET B N     1 
ATOM   8485  C CA    . MET B  1 491 ? 74.105  22.720  10.584  1.00 14.05 ? 1522 MET B CA    1 
ATOM   8486  C C     . MET B  1 491 ? 73.211  21.492  10.521  1.00 15.22 ? 1522 MET B C     1 
ATOM   8487  O O     . MET B  1 491 ? 72.123  21.533  9.955   1.00 17.73 ? 1522 MET B O     1 
ATOM   8488  C CB    . MET B  1 491 ? 75.062  22.695  9.399   1.00 11.60 ? 1522 MET B CB    1 
ATOM   8489  C CG    . MET B  1 491 ? 74.406  22.221  8.109   1.00 7.91  ? 1522 MET B CG    1 
ATOM   8490  S SD    . MET B  1 491 ? 74.538  23.387  6.706   1.00 17.81 ? 1522 MET B SD    1 
ATOM   8491  C CE    . MET B  1 491 ? 74.455  25.002  7.567   1.00 13.43 ? 1522 MET B CE    1 
ATOM   8492  N N     . VAL B  1 492 ? 73.659  20.386  11.090  1.00 13.95 ? 1523 VAL B N     1 
ATOM   8493  C CA    . VAL B  1 492 ? 72.826  19.204  11.051  1.00 14.78 ? 1523 VAL B CA    1 
ATOM   8494  C C     . VAL B  1 492 ? 71.593  19.385  11.923  1.00 17.82 ? 1523 VAL B C     1 
ATOM   8495  O O     . VAL B  1 492 ? 70.467  19.262  11.452  1.00 21.15 ? 1523 VAL B O     1 
ATOM   8496  C CB    . VAL B  1 492 ? 73.598  17.966  11.514  1.00 15.97 ? 1523 VAL B CB    1 
ATOM   8497  C CG1   . VAL B  1 492 ? 72.661  16.977  12.185  1.00 16.53 ? 1523 VAL B CG1   1 
ATOM   8498  C CG2   . VAL B  1 492 ? 74.278  17.321  10.321  1.00 18.91 ? 1523 VAL B CG2   1 
ATOM   8499  N N     . GLU B  1 493 ? 71.804  19.697  13.193  1.00 19.28 ? 1524 GLU B N     1 
ATOM   8500  C CA    . GLU B  1 493 ? 70.687  19.867  14.118  1.00 24.91 ? 1524 GLU B CA    1 
ATOM   8501  C C     . GLU B  1 493 ? 69.682  20.988  13.808  1.00 24.75 ? 1524 GLU B C     1 
ATOM   8502  O O     . GLU B  1 493 ? 68.687  21.157  14.519  1.00 25.51 ? 1524 GLU B O     1 
ATOM   8503  C CB    . GLU B  1 493 ? 71.223  20.032  15.543  1.00 30.09 ? 1524 GLU B CB    1 
ATOM   8504  C CG    . GLU B  1 493 ? 71.409  18.710  16.293  1.00 36.17 ? 1524 GLU B CG    1 
ATOM   8505  C CD    . GLU B  1 493 ? 70.608  17.557  15.692  1.00 40.63 ? 1524 GLU B CD    1 
ATOM   8506  O OE1   . GLU B  1 493 ? 69.803  16.950  16.422  1.00 40.71 ? 1524 GLU B OE1   1 
ATOM   8507  O OE2   . GLU B  1 493 ? 70.781  17.250  14.495  1.00 38.87 ? 1524 GLU B OE2   1 
ATOM   8508  N N     . LEU B  1 494 ? 69.934  21.759  12.762  1.00 20.05 ? 1525 LEU B N     1 
ATOM   8509  C CA    . LEU B  1 494 ? 69.007  22.815  12.412  1.00 18.75 ? 1525 LEU B CA    1 
ATOM   8510  C C     . LEU B  1 494 ? 68.200  22.355  11.205  1.00 22.63 ? 1525 LEU B C     1 
ATOM   8511  O O     . LEU B  1 494 ? 66.963  22.415  11.204  1.00 27.51 ? 1525 LEU B O     1 
ATOM   8512  C CB    . LEU B  1 494 ? 69.754  24.102  12.060  1.00 13.31 ? 1525 LEU B CB    1 
ATOM   8513  C CG    . LEU B  1 494 ? 70.317  24.992  13.173  1.00 9.52  ? 1525 LEU B CG    1 
ATOM   8514  C CD1   . LEU B  1 494 ? 70.017  26.438  12.849  1.00 2.00  ? 1525 LEU B CD1   1 
ATOM   8515  C CD2   . LEU B  1 494 ? 69.714  24.646  14.510  1.00 2.00  ? 1525 LEU B CD2   1 
ATOM   8516  N N     . GLY B  1 495 ? 68.901  21.889  10.177  1.00 21.82 ? 1526 GLY B N     1 
ATOM   8517  C CA    . GLY B  1 495 ? 68.223  21.446  8.977   1.00 18.88 ? 1526 GLY B CA    1 
ATOM   8518  C C     . GLY B  1 495 ? 67.466  20.154  9.168   1.00 19.26 ? 1526 GLY B C     1 
ATOM   8519  O O     . GLY B  1 495 ? 66.528  19.871  8.440   1.00 17.18 ? 1526 GLY B O     1 
ATOM   8520  N N     . ALA B  1 496 ? 67.872  19.363  10.150  1.00 21.87 ? 1527 ALA B N     1 
ATOM   8521  C CA    . ALA B  1 496 ? 67.208  18.088  10.389  1.00 24.26 ? 1527 ALA B CA    1 
ATOM   8522  C C     . ALA B  1 496 ? 65.712  18.324  10.646  1.00 23.55 ? 1527 ALA B C     1 
ATOM   8523  O O     . ALA B  1 496 ? 64.850  17.733  9.986   1.00 23.30 ? 1527 ALA B O     1 
ATOM   8524  C CB    . ALA B  1 496 ? 67.864  17.366  11.571  1.00 23.95 ? 1527 ALA B CB    1 
ATOM   8525  N N     . PRO B  1 497 ? 65.386  19.191  11.610  1.00 21.77 ? 1528 PRO B N     1 
ATOM   8526  C CA    . PRO B  1 497 ? 63.972  19.443  11.873  1.00 23.18 ? 1528 PRO B CA    1 
ATOM   8527  C C     . PRO B  1 497 ? 63.383  20.138  10.652  1.00 23.62 ? 1528 PRO B C     1 
ATOM   8528  O O     . PRO B  1 497 ? 62.559  19.579  9.924   1.00 20.92 ? 1528 PRO B O     1 
ATOM   8529  C CB    . PRO B  1 497 ? 63.990  20.362  13.097  1.00 22.51 ? 1528 PRO B CB    1 
ATOM   8530  C CG    . PRO B  1 497 ? 65.369  20.258  13.656  1.00 19.59 ? 1528 PRO B CG    1 
ATOM   8531  C CD    . PRO B  1 497 ? 66.255  19.970  12.502  1.00 20.64 ? 1528 PRO B CD    1 
ATOM   8532  N N     . PHE B  1 498 ? 63.844  21.366  10.446  1.00 28.21 ? 1529 PHE B N     1 
ATOM   8533  C CA    . PHE B  1 498 ? 63.424  22.205  9.342   1.00 30.78 ? 1529 PHE B CA    1 
ATOM   8534  C C     . PHE B  1 498 ? 63.067  21.362  8.128   1.00 34.10 ? 1529 PHE B C     1 
ATOM   8535  O O     . PHE B  1 498 ? 62.032  21.549  7.503   1.00 33.12 ? 1529 PHE B O     1 
ATOM   8536  C CB    . PHE B  1 498 ? 64.566  23.134  8.960   1.00 31.33 ? 1529 PHE B CB    1 
ATOM   8537  C CG    . PHE B  1 498 ? 64.628  24.405  9.750   1.00 33.45 ? 1529 PHE B CG    1 
ATOM   8538  C CD1   . PHE B  1 498 ? 65.775  25.189  9.718   1.00 34.31 ? 1529 PHE B CD1   1 
ATOM   8539  C CD2   . PHE B  1 498 ? 63.543  24.844  10.497  1.00 36.11 ? 1529 PHE B CD2   1 
ATOM   8540  C CE1   . PHE B  1 498 ? 65.845  26.397  10.415  1.00 35.30 ? 1529 PHE B CE1   1 
ATOM   8541  C CE2   . PHE B  1 498 ? 63.597  26.056  11.204  1.00 35.91 ? 1529 PHE B CE2   1 
ATOM   8542  C CZ    . PHE B  1 498 ? 64.751  26.833  11.161  1.00 34.97 ? 1529 PHE B CZ    1 
ATOM   8543  N N     . SER B  1 499 ? 63.943  20.425  7.801   1.00 33.69 ? 1530 SER B N     1 
ATOM   8544  C CA    . SER B  1 499 ? 63.746  19.583  6.638   1.00 34.58 ? 1530 SER B CA    1 
ATOM   8545  C C     . SER B  1 499 ? 62.619  18.583  6.756   1.00 36.30 ? 1530 SER B C     1 
ATOM   8546  O O     . SER B  1 499 ? 61.629  18.676  6.027   1.00 37.13 ? 1530 SER B O     1 
ATOM   8547  C CB    . SER B  1 499 ? 65.029  18.828  6.310   1.00 34.77 ? 1530 SER B CB    1 
ATOM   8548  O OG    . SER B  1 499 ? 64.746  17.700  5.504   1.00 30.23 ? 1530 SER B OG    1 
ATOM   8549  N N     . LEU B  1 500 ? 62.771  17.623  7.666   1.00 37.46 ? 1531 LEU B N     1 
ATOM   8550  C CA    . LEU B  1 500 ? 61.764  16.580  7.831   1.00 38.85 ? 1531 LEU B CA    1 
ATOM   8551  C C     . LEU B  1 500 ? 60.352  17.112  8.038   1.00 35.55 ? 1531 LEU B C     1 
ATOM   8552  O O     . LEU B  1 500 ? 59.394  16.346  8.119   1.00 33.74 ? 1531 LEU B O     1 
ATOM   8553  C CB    . LEU B  1 500 ? 62.169  15.608  8.949   1.00 44.20 ? 1531 LEU B CB    1 
ATOM   8554  C CG    . LEU B  1 500 ? 62.691  14.245  8.441   1.00 51.96 ? 1531 LEU B CG    1 
ATOM   8555  C CD1   . LEU B  1 500 ? 63.409  14.402  7.101   1.00 52.44 ? 1531 LEU B CD1   1 
ATOM   8556  C CD2   . LEU B  1 500 ? 63.632  13.639  9.466   1.00 52.45 ? 1531 LEU B CD2   1 
ATOM   8557  N N     . LYS B  1 501 ? 60.237  18.432  8.128   1.00 33.20 ? 1532 LYS B N     1 
ATOM   8558  C CA    . LYS B  1 501 ? 58.937  19.082  8.244   1.00 29.70 ? 1532 LYS B CA    1 
ATOM   8559  C C     . LYS B  1 501 ? 58.488  19.129  6.793   1.00 25.43 ? 1532 LYS B C     1 
ATOM   8560  O O     . LYS B  1 501 ? 57.910  18.172  6.289   1.00 23.49 ? 1532 LYS B O     1 
ATOM   8561  C CB    . LYS B  1 501 ? 59.074  20.512  8.770   1.00 30.76 ? 1532 LYS B CB    1 
ATOM   8562  C CG    . LYS B  1 501 ? 58.165  20.850  9.931   1.00 37.99 ? 1532 LYS B CG    1 
ATOM   8563  C CD    . LYS B  1 501 ? 56.721  20.423  9.691   1.00 45.21 ? 1532 LYS B CD    1 
ATOM   8564  C CE    . LYS B  1 501 ? 56.001  20.135  11.011  1.00 46.18 ? 1532 LYS B CE    1 
ATOM   8565  N NZ    . LYS B  1 501 ? 54.635  20.717  11.059  1.00 46.43 ? 1532 LYS B NZ    1 
ATOM   8566  N N     . GLY B  1 502 ? 58.803  20.230  6.118   1.00 21.01 ? 1533 GLY B N     1 
ATOM   8567  C CA    . GLY B  1 502 ? 58.437  20.380  4.723   1.00 18.19 ? 1533 GLY B CA    1 
ATOM   8568  C C     . GLY B  1 502 ? 58.560  19.099  3.920   1.00 13.34 ? 1533 GLY B C     1 
ATOM   8569  O O     . GLY B  1 502 ? 58.024  19.003  2.818   1.00 16.59 ? 1533 GLY B O     1 
ATOM   8570  N N     . LEU B  1 503 ? 59.285  18.122  4.446   1.00 12.31 ? 1534 LEU B N     1 
ATOM   8571  C CA    . LEU B  1 503 ? 59.428  16.850  3.755   1.00 13.93 ? 1534 LEU B CA    1 
ATOM   8572  C C     . LEU B  1 503 ? 58.196  15.995  4.061   1.00 14.09 ? 1534 LEU B C     1 
ATOM   8573  O O     . LEU B  1 503 ? 57.509  15.506  3.159   1.00 12.80 ? 1534 LEU B O     1 
ATOM   8574  C CB    . LEU B  1 503 ? 60.685  16.135  4.246   1.00 17.03 ? 1534 LEU B CB    1 
ATOM   8575  C CG    . LEU B  1 503 ? 61.678  15.633  3.191   1.00 17.26 ? 1534 LEU B CG    1 
ATOM   8576  C CD1   . LEU B  1 503 ? 61.114  15.804  1.775   1.00 16.62 ? 1534 LEU B CD1   1 
ATOM   8577  C CD2   . LEU B  1 503 ? 62.967  16.403  3.341   1.00 14.84 ? 1534 LEU B CD2   1 
ATOM   8578  N N     . MET B  1 504 ? 57.933  15.822  5.352   1.00 13.91 ? 1535 MET B N     1 
ATOM   8579  C CA    . MET B  1 504 ? 56.792  15.053  5.813   1.00 16.85 ? 1535 MET B CA    1 
ATOM   8580  C C     . MET B  1 504 ? 55.504  15.901  5.745   1.00 18.04 ? 1535 MET B C     1 
ATOM   8581  O O     . MET B  1 504 ? 54.486  15.477  5.177   1.00 18.82 ? 1535 MET B O     1 
ATOM   8582  C CB    . MET B  1 504 ? 57.046  14.584  7.254   1.00 14.19 ? 1535 MET B CB    1 
ATOM   8583  C CG    . MET B  1 504 ? 57.888  13.329  7.345   1.00 9.86  ? 1535 MET B CG    1 
ATOM   8584  S SD    . MET B  1 504 ? 57.876  12.483  5.771   1.00 11.86 ? 1535 MET B SD    1 
ATOM   8585  C CE    . MET B  1 504 ? 57.634  10.760  6.303   1.00 2.00  ? 1535 MET B CE    1 
ATOM   8586  N N     . GLY B  1 505 ? 55.574  17.100  6.327   1.00 17.21 ? 1536 GLY B N     1 
ATOM   8587  C CA    . GLY B  1 505 ? 54.448  18.023  6.369   1.00 15.77 ? 1536 GLY B CA    1 
ATOM   8588  C C     . GLY B  1 505 ? 53.788  18.268  5.040   1.00 16.29 ? 1536 GLY B C     1 
ATOM   8589  O O     . GLY B  1 505 ? 52.844  19.047  4.945   1.00 16.04 ? 1536 GLY B O     1 
ATOM   8590  N N     . ASN B  1 506 ? 54.288  17.620  3.998   1.00 15.28 ? 1537 ASN B N     1 
ATOM   8591  C CA    . ASN B  1 506 ? 53.684  17.798  2.694   1.00 17.95 ? 1537 ASN B CA    1 
ATOM   8592  C C     . ASN B  1 506 ? 52.348  17.074  2.669   1.00 17.39 ? 1537 ASN B C     1 
ATOM   8593  O O     . ASN B  1 506 ? 52.204  15.986  3.235   1.00 16.57 ? 1537 ASN B O     1 
ATOM   8594  C CB    . ASN B  1 506 ? 54.565  17.235  1.586   1.00 18.81 ? 1537 ASN B CB    1 
ATOM   8595  C CG    . ASN B  1 506 ? 53.791  17.008  0.303   1.00 21.68 ? 1537 ASN B CG    1 
ATOM   8596  O OD1   . ASN B  1 506 ? 53.010  16.059  0.202   1.00 21.55 ? 1537 ASN B OD1   1 
ATOM   8597  N ND2   . ASN B  1 506 ? 53.993  17.881  -0.679  1.00 18.86 ? 1537 ASN B ND2   1 
ATOM   8598  N N     . PRO B  1 507 ? 51.352  17.672  2.000   1.00 18.81 ? 1538 PRO B N     1 
ATOM   8599  C CA    . PRO B  1 507 ? 50.011  17.095  1.885   1.00 13.77 ? 1538 PRO B CA    1 
ATOM   8600  C C     . PRO B  1 507 ? 50.061  15.602  1.655   1.00 11.10 ? 1538 PRO B C     1 
ATOM   8601  O O     . PRO B  1 507 ? 49.721  14.811  2.522   1.00 14.18 ? 1538 PRO B O     1 
ATOM   8602  C CB    . PRO B  1 507 ? 49.400  17.819  0.688   1.00 14.04 ? 1538 PRO B CB    1 
ATOM   8603  C CG    . PRO B  1 507 ? 50.486  18.770  0.169   1.00 13.15 ? 1538 PRO B CG    1 
ATOM   8604  C CD    . PRO B  1 507 ? 51.446  18.964  1.298   1.00 16.10 ? 1538 PRO B CD    1 
ATOM   8605  N N     . ILE B  1 508 ? 50.510  15.223  0.476   1.00 8.42  ? 1539 ILE B N     1 
ATOM   8606  C CA    . ILE B  1 508 ? 50.591  13.819  0.098   1.00 10.98 ? 1539 ILE B CA    1 
ATOM   8607  C C     . ILE B  1 508 ? 51.087  12.844  1.163   1.00 11.28 ? 1539 ILE B C     1 
ATOM   8608  O O     . ILE B  1 508 ? 50.986  11.622  0.994   1.00 13.41 ? 1539 ILE B O     1 
ATOM   8609  C CB    . ILE B  1 508 ? 51.459  13.639  -1.187  1.00 8.73  ? 1539 ILE B CB    1 
ATOM   8610  C CG1   . ILE B  1 508 ? 52.846  13.094  -0.833  1.00 9.49  ? 1539 ILE B CG1   1 
ATOM   8611  C CG2   . ILE B  1 508 ? 51.594  14.962  -1.925  1.00 7.29  ? 1539 ILE B CG2   1 
ATOM   8612  C CD1   . ILE B  1 508 ? 53.085  11.689  -1.372  1.00 6.96  ? 1539 ILE B CD1   1 
ATOM   8613  N N     . CYS B  1 509 ? 51.640  13.359  2.250   1.00 12.68 ? 1540 CYS B N     1 
ATOM   8614  C CA    . CYS B  1 509 ? 52.122  12.466  3.304   1.00 18.93 ? 1540 CYS B CA    1 
ATOM   8615  C C     . CYS B  1 509 ? 51.071  12.276  4.394   1.00 19.95 ? 1540 CYS B C     1 
ATOM   8616  O O     . CYS B  1 509 ? 51.260  11.478  5.328   1.00 20.48 ? 1540 CYS B O     1 
ATOM   8617  C CB    . CYS B  1 509 ? 53.408  13.021  3.911   1.00 15.66 ? 1540 CYS B CB    1 
ATOM   8618  S SG    . CYS B  1 509 ? 54.759  13.058  2.709   1.00 35.30 ? 1540 CYS B SG    1 
ATOM   8619  N N     . SER B  1 510 ? 49.964  13.008  4.245   1.00 22.49 ? 1541 SER B N     1 
ATOM   8620  C CA    . SER B  1 510 ? 48.852  12.985  5.188   1.00 20.24 ? 1541 SER B CA    1 
ATOM   8621  C C     . SER B  1 510 ? 47.979  11.772  4.930   1.00 22.70 ? 1541 SER B C     1 
ATOM   8622  O O     . SER B  1 510 ? 47.925  11.259  3.808   1.00 20.78 ? 1541 SER B O     1 
ATOM   8623  C CB    . SER B  1 510 ? 48.023  14.251  5.049   1.00 19.20 ? 1541 SER B CB    1 
ATOM   8624  O OG    . SER B  1 510 ? 47.519  14.349  3.736   1.00 20.90 ? 1541 SER B OG    1 
ATOM   8625  N N     . PRO B  1 511 ? 47.264  11.317  5.971   1.00 22.38 ? 1542 PRO B N     1 
ATOM   8626  C CA    . PRO B  1 511 ? 46.378  10.148  5.905   1.00 23.99 ? 1542 PRO B CA    1 
ATOM   8627  C C     . PRO B  1 511 ? 45.430  10.115  4.716   1.00 26.14 ? 1542 PRO B C     1 
ATOM   8628  O O     . PRO B  1 511 ? 45.428  9.157   3.936   1.00 26.35 ? 1542 PRO B O     1 
ATOM   8629  C CB    . PRO B  1 511 ? 45.627  10.186  7.233   1.00 23.23 ? 1542 PRO B CB    1 
ATOM   8630  C CG    . PRO B  1 511 ? 46.516  10.972  8.155   1.00 20.87 ? 1542 PRO B CG    1 
ATOM   8631  C CD    . PRO B  1 511 ? 47.252  11.956  7.304   1.00 19.63 ? 1542 PRO B CD    1 
ATOM   8632  N N     . GLN B  1 512 ? 44.625  11.159  4.572   1.00 27.98 ? 1543 GLN B N     1 
ATOM   8633  C CA    . GLN B  1 512 ? 43.662  11.201  3.470   1.00 33.67 ? 1543 GLN B CA    1 
ATOM   8634  C C     . GLN B  1 512 ? 44.325  11.523  2.131   1.00 29.20 ? 1543 GLN B C     1 
ATOM   8635  O O     . GLN B  1 512 ? 43.787  12.296  1.339   1.00 33.14 ? 1543 GLN B O     1 
ATOM   8636  C CB    . GLN B  1 512 ? 42.545  12.229  3.762   1.00 40.51 ? 1543 GLN B CB    1 
ATOM   8637  C CG    . GLN B  1 512 ? 42.765  13.097  5.004   1.00 52.94 ? 1543 GLN B CG    1 
ATOM   8638  C CD    . GLN B  1 512 ? 44.020  13.950  4.920   1.00 61.24 ? 1543 GLN B CD    1 
ATOM   8639  O OE1   . GLN B  1 512 ? 45.015  13.677  5.599   1.00 60.41 ? 1543 GLN B OE1   1 
ATOM   8640  N NE2   . GLN B  1 512 ? 43.980  14.987  4.086   1.00 66.17 ? 1543 GLN B NE2   1 
ATOM   8641  N N     . TYR B  1 513 ? 45.484  10.923  1.873   1.00 23.73 ? 1544 TYR B N     1 
ATOM   8642  C CA    . TYR B  1 513 ? 46.217  11.184  0.637   1.00 17.77 ? 1544 TYR B CA    1 
ATOM   8643  C C     . TYR B  1 513 ? 47.109  10.007  0.346   1.00 15.04 ? 1544 TYR B C     1 
ATOM   8644  O O     . TYR B  1 513 ? 47.314  9.631   -0.799  1.00 13.06 ? 1544 TYR B O     1 
ATOM   8645  C CB    . TYR B  1 513 ? 47.089  12.422  0.805   1.00 11.20 ? 1544 TYR B CB    1 
ATOM   8646  C CG    . TYR B  1 513 ? 46.498  13.666  0.228   1.00 6.21  ? 1544 TYR B CG    1 
ATOM   8647  C CD1   . TYR B  1 513 ? 46.641  13.964  -1.127  1.00 2.00  ? 1544 TYR B CD1   1 
ATOM   8648  C CD2   . TYR B  1 513 ? 45.796  14.560  1.037   1.00 7.37  ? 1544 TYR B CD2   1 
ATOM   8649  C CE1   . TYR B  1 513 ? 46.095  15.139  -1.671  1.00 2.00  ? 1544 TYR B CE1   1 
ATOM   8650  C CE2   . TYR B  1 513 ? 45.245  15.738  0.509   1.00 11.06 ? 1544 TYR B CE2   1 
ATOM   8651  C CZ    . TYR B  1 513 ? 45.398  16.023  -0.837  1.00 2.49  ? 1544 TYR B CZ    1 
ATOM   8652  O OH    . TYR B  1 513 ? 44.879  17.203  -1.308  1.00 2.00  ? 1544 TYR B OH    1 
ATOM   8653  N N     . TRP B  1 514 ? 47.647  9.433   1.409   1.00 16.45 ? 1545 TRP B N     1 
ATOM   8654  C CA    . TRP B  1 514 ? 48.535  8.305   1.286   1.00 17.45 ? 1545 TRP B CA    1 
ATOM   8655  C C     . TRP B  1 514 ? 47.806  7.031   0.893   1.00 14.59 ? 1545 TRP B C     1 
ATOM   8656  O O     . TRP B  1 514 ? 47.516  6.195   1.746   1.00 13.14 ? 1545 TRP B O     1 
ATOM   8657  C CB    . TRP B  1 514 ? 49.291  8.099   2.604   1.00 23.68 ? 1545 TRP B CB    1 
ATOM   8658  C CG    . TRP B  1 514 ? 50.622  7.395   2.425   1.00 27.51 ? 1545 TRP B CG    1 
ATOM   8659  C CD1   . TRP B  1 514 ? 51.121  6.373   3.186   1.00 26.70 ? 1545 TRP B CD1   1 
ATOM   8660  C CD2   . TRP B  1 514 ? 51.561  7.593   1.361   1.00 27.64 ? 1545 TRP B CD2   1 
ATOM   8661  N NE1   . TRP B  1 514 ? 52.302  5.918   2.652   1.00 29.55 ? 1545 TRP B NE1   1 
ATOM   8662  C CE2   . TRP B  1 514 ? 52.593  6.650   1.533   1.00 26.97 ? 1545 TRP B CE2   1 
ATOM   8663  C CE3   . TRP B  1 514 ? 51.626  8.474   0.276   1.00 31.82 ? 1545 TRP B CE3   1 
ATOM   8664  C CZ2   . TRP B  1 514 ? 53.674  6.564   0.660   1.00 31.12 ? 1545 TRP B CZ2   1 
ATOM   8665  C CZ3   . TRP B  1 514 ? 52.701  8.383   -0.591  1.00 32.76 ? 1545 TRP B CZ3   1 
ATOM   8666  C CH2   . TRP B  1 514 ? 53.709  7.435   -0.393  1.00 32.37 ? 1545 TRP B CH2   1 
ATOM   8667  N N     . LYS B  1 515 ? 47.501  6.892   -0.399  1.00 13.13 ? 1546 LYS B N     1 
ATOM   8668  C CA    . LYS B  1 515 ? 46.825  5.694   -0.909  1.00 12.79 ? 1546 LYS B CA    1 
ATOM   8669  C C     . LYS B  1 515 ? 46.868  5.605   -2.435  1.00 7.09  ? 1546 LYS B C     1 
ATOM   8670  O O     . LYS B  1 515 ? 46.773  6.610   -3.145  1.00 2.00  ? 1546 LYS B O     1 
ATOM   8671  C CB    . LYS B  1 515 ? 45.380  5.619   -0.415  1.00 21.57 ? 1546 LYS B CB    1 
ATOM   8672  C CG    . LYS B  1 515 ? 44.651  6.956   -0.319  1.00 25.56 ? 1546 LYS B CG    1 
ATOM   8673  C CD    . LYS B  1 515 ? 43.324  6.802   0.408   1.00 25.13 ? 1546 LYS B CD    1 
ATOM   8674  C CE    . LYS B  1 515 ? 42.885  8.128   1.007   1.00 32.74 ? 1546 LYS B CE    1 
ATOM   8675  N NZ    . LYS B  1 515 ? 41.423  8.359   0.825   1.00 41.86 ? 1546 LYS B NZ    1 
ATOM   8676  N N     . PRO B  1 516 ? 46.978  4.378   -2.953  1.00 4.25  ? 1547 PRO B N     1 
ATOM   8677  C CA    . PRO B  1 516 ? 47.054  4.090   -4.393  1.00 9.80  ? 1547 PRO B CA    1 
ATOM   8678  C C     . PRO B  1 516 ? 46.216  5.051   -5.232  1.00 12.69 ? 1547 PRO B C     1 
ATOM   8679  O O     . PRO B  1 516 ? 46.702  5.684   -6.183  1.00 14.48 ? 1547 PRO B O     1 
ATOM   8680  C CB    . PRO B  1 516 ? 46.574  2.631   -4.506  1.00 5.35  ? 1547 PRO B CB    1 
ATOM   8681  C CG    . PRO B  1 516 ? 46.469  2.106   -3.081  1.00 2.00  ? 1547 PRO B CG    1 
ATOM   8682  C CD    . PRO B  1 516 ? 46.973  3.154   -2.134  1.00 4.10  ? 1547 PRO B CD    1 
ATOM   8683  N N     . SER B  1 517 ? 44.950  5.141   -4.851  1.00 13.46 ? 1548 SER B N     1 
ATOM   8684  C CA    . SER B  1 517 ? 43.983  5.997   -5.509  1.00 9.51  ? 1548 SER B CA    1 
ATOM   8685  C C     . SER B  1 517 ? 44.639  7.307   -5.854  1.00 8.03  ? 1548 SER B C     1 
ATOM   8686  O O     . SER B  1 517 ? 44.789  7.649   -7.015  1.00 11.71 ? 1548 SER B O     1 
ATOM   8687  C CB    . SER B  1 517 ? 42.799  6.257   -4.570  1.00 11.82 ? 1548 SER B CB    1 
ATOM   8688  O OG    . SER B  1 517 ? 43.238  6.585   -3.254  1.00 6.56  ? 1548 SER B OG    1 
ATOM   8689  N N     . THR B  1 518 ? 45.036  8.027   -4.815  1.00 5.45  ? 1549 THR B N     1 
ATOM   8690  C CA    . THR B  1 518 ? 45.668  9.327   -4.947  1.00 7.07  ? 1549 THR B CA    1 
ATOM   8691  C C     . THR B  1 518 ? 46.656  9.391   -6.085  1.00 5.70  ? 1549 THR B C     1 
ATOM   8692  O O     . THR B  1 518 ? 46.959  10.478  -6.578  1.00 6.08  ? 1549 THR B O     1 
ATOM   8693  C CB    . THR B  1 518 ? 46.421  9.681   -3.684  1.00 2.00  ? 1549 THR B CB    1 
ATOM   8694  O OG1   . THR B  1 518 ? 45.899  8.902   -2.600  1.00 2.00  ? 1549 THR B OG1   1 
ATOM   8695  C CG2   . THR B  1 518 ? 46.297  11.162  -3.385  1.00 2.00  ? 1549 THR B CG2   1 
ATOM   8696  N N     . PHE B  1 519 ? 47.161  8.229   -6.491  1.00 6.47  ? 1550 PHE B N     1 
ATOM   8697  C CA    . PHE B  1 519 ? 48.146  8.156   -7.563  1.00 10.07 ? 1550 PHE B CA    1 
ATOM   8698  C C     . PHE B  1 519 ? 47.784  7.258   -8.747  1.00 8.63  ? 1550 PHE B C     1 
ATOM   8699  O O     . PHE B  1 519 ? 48.663  6.753   -9.434  1.00 15.37 ? 1550 PHE B O     1 
ATOM   8700  C CB    . PHE B  1 519 ? 49.487  7.682   -6.981  1.00 9.96  ? 1550 PHE B CB    1 
ATOM   8701  C CG    . PHE B  1 519 ? 49.835  8.320   -5.672  1.00 9.13  ? 1550 PHE B CG    1 
ATOM   8702  C CD1   . PHE B  1 519 ? 49.535  7.671   -4.476  1.00 9.53  ? 1550 PHE B CD1   1 
ATOM   8703  C CD2   . PHE B  1 519 ? 50.413  9.609   -5.629  1.00 9.28  ? 1550 PHE B CD2   1 
ATOM   8704  C CE1   . PHE B  1 519 ? 49.798  8.296   -3.235  1.00 8.78  ? 1550 PHE B CE1   1 
ATOM   8705  C CE2   . PHE B  1 519 ? 50.683  10.250  -4.398  1.00 5.01  ? 1550 PHE B CE2   1 
ATOM   8706  C CZ    . PHE B  1 519 ? 50.372  9.591   -3.197  1.00 5.63  ? 1550 PHE B CZ    1 
ATOM   8707  N N     . GLY B  1 520 ? 46.508  7.046   -9.009  1.00 7.62  ? 1551 GLY B N     1 
ATOM   8708  C CA    . GLY B  1 520 ? 46.174  6.184   -10.125 1.00 5.49  ? 1551 GLY B CA    1 
ATOM   8709  C C     . GLY B  1 520 ? 46.347  4.747   -9.687  1.00 4.53  ? 1551 GLY B C     1 
ATOM   8710  O O     . GLY B  1 520 ? 46.543  3.844   -10.507 1.00 2.00  ? 1551 GLY B O     1 
ATOM   8711  N N     . GLY B  1 521 ? 46.295  4.543   -8.375  1.00 5.61  ? 1552 GLY B N     1 
ATOM   8712  C CA    . GLY B  1 521 ? 46.411  3.203   -7.826  1.00 10.19 ? 1552 GLY B CA    1 
ATOM   8713  C C     . GLY B  1 521 ? 47.794  2.590   -7.695  1.00 16.83 ? 1552 GLY B C     1 
ATOM   8714  O O     . GLY B  1 521 ? 48.801  3.161   -8.124  1.00 20.17 ? 1552 GLY B O     1 
ATOM   8715  N N     . GLU B  1 522 ? 47.818  1.398   -7.102  1.00 19.29 ? 1553 GLU B N     1 
ATOM   8716  C CA    . GLU B  1 522 ? 49.034  0.622   -6.845  1.00 20.80 ? 1553 GLU B CA    1 
ATOM   8717  C C     . GLU B  1 522 ? 50.201  0.843   -7.780  1.00 20.26 ? 1553 GLU B C     1 
ATOM   8718  O O     . GLU B  1 522 ? 51.280  1.200   -7.325  1.00 22.12 ? 1553 GLU B O     1 
ATOM   8719  C CB    . GLU B  1 522 ? 48.714  -0.875  -6.813  1.00 21.78 ? 1553 GLU B CB    1 
ATOM   8720  C CG    . GLU B  1 522 ? 47.909  -1.318  -5.612  1.00 27.11 ? 1553 GLU B CG    1 
ATOM   8721  C CD    . GLU B  1 522 ? 48.448  -0.784  -4.299  1.00 34.86 ? 1553 GLU B CD    1 
ATOM   8722  O OE1   . GLU B  1 522 ? 49.124  0.273   -4.296  1.00 39.38 ? 1553 GLU B OE1   1 
ATOM   8723  O OE2   . GLU B  1 522 ? 48.188  -1.427  -3.258  1.00 32.38 ? 1553 GLU B OE2   1 
ATOM   8724  N N     . VAL B  1 523 ? 49.997  0.615   -9.075  1.00 17.18 ? 1554 VAL B N     1 
ATOM   8725  C CA    . VAL B  1 523 ? 51.073  0.799   -10.041 1.00 14.18 ? 1554 VAL B CA    1 
ATOM   8726  C C     . VAL B  1 523 ? 51.761  2.148   -9.806  1.00 19.04 ? 1554 VAL B C     1 
ATOM   8727  O O     . VAL B  1 523 ? 52.883  2.217   -9.285  1.00 19.86 ? 1554 VAL B O     1 
ATOM   8728  C CB    . VAL B  1 523 ? 50.537  0.741   -11.480 1.00 11.14 ? 1554 VAL B CB    1 
ATOM   8729  C CG1   . VAL B  1 523 ? 51.469  1.488   -12.425 1.00 10.07 ? 1554 VAL B CG1   1 
ATOM   8730  C CG2   . VAL B  1 523 ? 50.385  -0.706  -11.906 1.00 8.97  ? 1554 VAL B CG2   1 
ATOM   8731  N N     . GLY B  1 524 ? 51.074  3.222   -10.176 1.00 20.60 ? 1555 GLY B N     1 
ATOM   8732  C CA    . GLY B  1 524 ? 51.637  4.545   -9.994  1.00 22.76 ? 1555 GLY B CA    1 
ATOM   8733  C C     . GLY B  1 524 ? 52.034  4.828   -8.559  1.00 21.59 ? 1555 GLY B C     1 
ATOM   8734  O O     . GLY B  1 524 ? 52.790  5.766   -8.307  1.00 23.86 ? 1555 GLY B O     1 
ATOM   8735  N N     . PHE B  1 525 ? 51.522  4.037   -7.618  1.00 18.48 ? 1556 PHE B N     1 
ATOM   8736  C CA    . PHE B  1 525 ? 51.859  4.230   -6.210  1.00 17.45 ? 1556 PHE B CA    1 
ATOM   8737  C C     . PHE B  1 525 ? 53.240  3.658   -5.994  1.00 19.74 ? 1556 PHE B C     1 
ATOM   8738  O O     . PHE B  1 525 ? 54.149  4.352   -5.527  1.00 20.07 ? 1556 PHE B O     1 
ATOM   8739  C CB    . PHE B  1 525 ? 50.863  3.505   -5.294  1.00 18.92 ? 1556 PHE B CB    1 
ATOM   8740  C CG    . PHE B  1 525 ? 50.983  3.887   -3.832  1.00 15.87 ? 1556 PHE B CG    1 
ATOM   8741  C CD1   . PHE B  1 525 ? 51.279  5.201   -3.454  1.00 13.30 ? 1556 PHE B CD1   1 
ATOM   8742  C CD2   . PHE B  1 525 ? 50.786  2.929   -2.832  1.00 12.44 ? 1556 PHE B CD2   1 
ATOM   8743  C CE1   . PHE B  1 525 ? 51.376  5.559   -2.093  1.00 12.72 ? 1556 PHE B CE1   1 
ATOM   8744  C CE2   . PHE B  1 525 ? 50.880  3.273   -1.476  1.00 7.76  ? 1556 PHE B CE2   1 
ATOM   8745  C CZ    . PHE B  1 525 ? 51.176  4.592   -1.103  1.00 8.57  ? 1556 PHE B CZ    1 
ATOM   8746  N N     . LYS B  1 526 ? 53.387  2.383   -6.343  1.00 18.17 ? 1557 LYS B N     1 
ATOM   8747  C CA    . LYS B  1 526 ? 54.654  1.682   -6.214  1.00 18.58 ? 1557 LYS B CA    1 
ATOM   8748  C C     . LYS B  1 526 ? 55.751  2.619   -6.664  1.00 18.75 ? 1557 LYS B C     1 
ATOM   8749  O O     . LYS B  1 526 ? 56.705  2.884   -5.935  1.00 19.29 ? 1557 LYS B O     1 
ATOM   8750  C CB    . LYS B  1 526 ? 54.671  0.440   -7.098  1.00 21.46 ? 1557 LYS B CB    1 
ATOM   8751  C CG    . LYS B  1 526 ? 55.823  -0.488  -6.795  1.00 23.97 ? 1557 LYS B CG    1 
ATOM   8752  C CD    . LYS B  1 526 ? 55.936  -1.567  -7.848  1.00 27.31 ? 1557 LYS B CD    1 
ATOM   8753  C CE    . LYS B  1 526 ? 56.270  -2.912  -7.210  1.00 31.53 ? 1557 LYS B CE    1 
ATOM   8754  N NZ    . LYS B  1 526 ? 56.557  -3.972  -8.223  1.00 33.30 ? 1557 LYS B NZ    1 
ATOM   8755  N N     . ILE B  1 527 ? 55.601  3.126   -7.877  1.00 14.88 ? 1558 ILE B N     1 
ATOM   8756  C CA    . ILE B  1 527 ? 56.569  4.050   -8.414  1.00 13.52 ? 1558 ILE B CA    1 
ATOM   8757  C C     . ILE B  1 527 ? 57.238  4.868   -7.313  1.00 16.02 ? 1558 ILE B C     1 
ATOM   8758  O O     . ILE B  1 527 ? 58.453  4.785   -7.127  1.00 21.36 ? 1558 ILE B O     1 
ATOM   8759  C CB    . ILE B  1 527 ? 55.909  4.995   -9.413  1.00 12.54 ? 1558 ILE B CB    1 
ATOM   8760  C CG1   . ILE B  1 527 ? 55.632  4.225   -10.719 1.00 13.91 ? 1558 ILE B CG1   1 
ATOM   8761  C CG2   . ILE B  1 527 ? 56.783  6.230   -9.597  1.00 2.00  ? 1558 ILE B CG2   1 
ATOM   8762  C CD1   . ILE B  1 527 ? 55.411  5.095   -11.949 1.00 12.65 ? 1558 ILE B CD1   1 
ATOM   8763  N N     . ILE B  1 528 ? 56.460  5.645   -6.572  1.00 16.57 ? 1559 ILE B N     1 
ATOM   8764  C CA    . ILE B  1 528 ? 57.049  6.446   -5.507  1.00 16.99 ? 1559 ILE B CA    1 
ATOM   8765  C C     . ILE B  1 528 ? 57.785  5.583   -4.473  1.00 19.84 ? 1559 ILE B C     1 
ATOM   8766  O O     . ILE B  1 528 ? 58.946  5.841   -4.138  1.00 17.91 ? 1559 ILE B O     1 
ATOM   8767  C CB    . ILE B  1 528 ? 55.989  7.262   -4.766  1.00 16.49 ? 1559 ILE B CB    1 
ATOM   8768  C CG1   . ILE B  1 528 ? 55.363  8.269   -5.710  1.00 18.45 ? 1559 ILE B CG1   1 
ATOM   8769  C CG2   . ILE B  1 528 ? 56.617  7.997   -3.592  1.00 17.07 ? 1559 ILE B CG2   1 
ATOM   8770  C CD1   . ILE B  1 528 ? 54.223  9.033   -5.071  1.00 19.72 ? 1559 ILE B CD1   1 
ATOM   8771  N N     . ASN B  1 529 ? 57.105  4.563   -3.965  1.00 21.77 ? 1560 ASN B N     1 
ATOM   8772  C CA    . ASN B  1 529 ? 57.696  3.683   -2.959  1.00 27.43 ? 1560 ASN B CA    1 
ATOM   8773  C C     . ASN B  1 529 ? 58.934  2.924   -3.431  1.00 26.50 ? 1560 ASN B C     1 
ATOM   8774  O O     . ASN B  1 529 ? 59.622  2.288   -2.632  1.00 26.83 ? 1560 ASN B O     1 
ATOM   8775  C CB    . ASN B  1 529 ? 56.644  2.700   -2.466  1.00 32.51 ? 1560 ASN B CB    1 
ATOM   8776  C CG    . ASN B  1 529 ? 55.271  3.316   -2.422  1.00 39.42 ? 1560 ASN B CG    1 
ATOM   8777  O OD1   . ASN B  1 529 ? 55.064  4.350   -1.777  1.00 39.46 ? 1560 ASN B OD1   1 
ATOM   8778  N ND2   . ASN B  1 529 ? 54.318  2.694   -3.118  1.00 41.40 ? 1560 ASN B ND2   1 
ATOM   8779  N N     . THR B  1 530 ? 59.205  2.978   -4.730  1.00 25.24 ? 1561 THR B N     1 
ATOM   8780  C CA    . THR B  1 530 ? 60.377  2.319   -5.289  1.00 24.02 ? 1561 THR B CA    1 
ATOM   8781  C C     . THR B  1 530 ? 61.070  3.327   -6.188  1.00 24.57 ? 1561 THR B C     1 
ATOM   8782  O O     . THR B  1 530 ? 61.165  3.150   -7.399  1.00 28.02 ? 1561 THR B O     1 
ATOM   8783  C CB    . THR B  1 530 ? 59.997  1.083   -6.097  1.00 20.54 ? 1561 THR B CB    1 
ATOM   8784  O OG1   . THR B  1 530 ? 59.325  1.483   -7.290  1.00 20.69 ? 1561 THR B OG1   1 
ATOM   8785  C CG2   . THR B  1 530 ? 59.092  0.188   -5.279  1.00 21.14 ? 1561 THR B CG2   1 
ATOM   8786  N N     . ALA B  1 531 ? 61.548  4.399   -5.573  1.00 23.54 ? 1562 ALA B N     1 
ATOM   8787  C CA    . ALA B  1 531 ? 62.214  5.458   -6.305  1.00 23.31 ? 1562 ALA B CA    1 
ATOM   8788  C C     . ALA B  1 531 ? 63.557  5.753   -5.674  1.00 24.18 ? 1562 ALA B C     1 
ATOM   8789  O O     . ALA B  1 531 ? 63.658  5.908   -4.450  1.00 26.99 ? 1562 ALA B O     1 
ATOM   8790  C CB    . ALA B  1 531 ? 61.347  6.716   -6.304  1.00 25.68 ? 1562 ALA B CB    1 
ATOM   8791  N N     . SER B  1 532 ? 64.586  5.833   -6.513  1.00 20.55 ? 1563 SER B N     1 
ATOM   8792  C CA    . SER B  1 532 ? 65.938  6.109   -6.054  1.00 17.51 ? 1563 SER B CA    1 
ATOM   8793  C C     . SER B  1 532 ? 66.570  7.016   -7.083  1.00 18.11 ? 1563 SER B C     1 
ATOM   8794  O O     . SER B  1 532 ? 66.311  6.876   -8.287  1.00 19.14 ? 1563 SER B O     1 
ATOM   8795  C CB    . SER B  1 532 ? 66.742  4.815   -5.954  1.00 14.86 ? 1563 SER B CB    1 
ATOM   8796  O OG    . SER B  1 532 ? 67.232  4.435   -7.225  1.00 15.95 ? 1563 SER B OG    1 
ATOM   8797  N N     . ILE B  1 533 ? 67.376  7.962   -6.617  1.00 15.64 ? 1564 ILE B N     1 
ATOM   8798  C CA    . ILE B  1 533 ? 68.052  8.867   -7.525  1.00 11.47 ? 1564 ILE B CA    1 
ATOM   8799  C C     . ILE B  1 533 ? 68.606  7.975   -8.624  1.00 9.60  ? 1564 ILE B C     1 
ATOM   8800  O O     . ILE B  1 533 ? 68.658  8.364   -9.791  1.00 8.16  ? 1564 ILE B O     1 
ATOM   8801  C CB    . ILE B  1 533 ? 69.208  9.595   -6.819  1.00 14.13 ? 1564 ILE B CB    1 
ATOM   8802  C CG1   . ILE B  1 533 ? 69.896  10.526  -7.817  1.00 14.46 ? 1564 ILE B CG1   1 
ATOM   8803  C CG2   . ILE B  1 533 ? 70.200  8.575   -6.213  1.00 6.57  ? 1564 ILE B CG2   1 
ATOM   8804  C CD1   . ILE B  1 533 ? 69.066  11.725  -8.199  1.00 13.40 ? 1564 ILE B CD1   1 
ATOM   8805  N N     . GLN B  1 534 ? 68.999  6.767   -8.228  1.00 2.00  ? 1565 GLN B N     1 
ATOM   8806  C CA    . GLN B  1 534 ? 69.532  5.802   -9.163  1.00 12.15 ? 1565 GLN B CA    1 
ATOM   8807  C C     . GLN B  1 534 ? 68.565  5.578   -10.328 1.00 13.26 ? 1565 GLN B C     1 
ATOM   8808  O O     . GLN B  1 534 ? 68.815  6.014   -11.462 1.00 11.07 ? 1565 GLN B O     1 
ATOM   8809  C CB    . GLN B  1 534 ? 69.806  4.477   -8.449  1.00 17.86 ? 1565 GLN B CB    1 
ATOM   8810  C CG    . GLN B  1 534 ? 70.172  3.315   -9.389  1.00 24.66 ? 1565 GLN B CG    1 
ATOM   8811  C CD    . GLN B  1 534 ? 71.170  3.711   -10.476 1.00 24.73 ? 1565 GLN B CD    1 
ATOM   8812  O OE1   . GLN B  1 534 ? 72.379  3.678   -10.261 1.00 27.22 ? 1565 GLN B OE1   1 
ATOM   8813  N NE2   . GLN B  1 534 ? 70.661  4.086   -11.647 1.00 24.90 ? 1565 GLN B NE2   1 
ATOM   8814  N N     . SER B  1 535 ? 67.462  4.894   -10.044 1.00 13.63 ? 1566 SER B N     1 
ATOM   8815  C CA    . SER B  1 535 ? 66.460  4.610   -11.064 1.00 12.20 ? 1566 SER B CA    1 
ATOM   8816  C C     . SER B  1 535 ? 66.038  5.899   -11.749 1.00 10.13 ? 1566 SER B C     1 
ATOM   8817  O O     . SER B  1 535 ? 65.898  5.933   -12.975 1.00 6.88  ? 1566 SER B O     1 
ATOM   8818  C CB    . SER B  1 535 ? 65.240  3.951   -10.434 1.00 13.98 ? 1566 SER B CB    1 
ATOM   8819  O OG    . SER B  1 535 ? 64.881  4.641   -9.253  1.00 11.92 ? 1566 SER B OG    1 
ATOM   8820  N N     . LEU B  1 536 ? 65.839  6.959   -10.963 1.00 7.88  ? 1567 LEU B N     1 
ATOM   8821  C CA    . LEU B  1 536 ? 65.431  8.234   -11.540 1.00 10.58 ? 1567 LEU B CA    1 
ATOM   8822  C C     . LEU B  1 536 ? 66.289  8.473   -12.770 1.00 16.35 ? 1567 LEU B C     1 
ATOM   8823  O O     . LEU B  1 536 ? 65.795  8.847   -13.842 1.00 18.08 ? 1567 LEU B O     1 
ATOM   8824  C CB    . LEU B  1 536 ? 65.634  9.392   -10.554 1.00 8.75  ? 1567 LEU B CB    1 
ATOM   8825  C CG    . LEU B  1 536 ? 65.711  10.795  -11.194 1.00 6.86  ? 1567 LEU B CG    1 
ATOM   8826  C CD1   . LEU B  1 536 ? 64.638  10.946  -12.240 1.00 6.73  ? 1567 LEU B CD1   1 
ATOM   8827  C CD2   . LEU B  1 536 ? 65.527  11.881  -10.141 1.00 2.00  ? 1567 LEU B CD2   1 
ATOM   8828  N N     . ILE B  1 537 ? 67.584  8.233   -12.611 1.00 22.84 ? 1568 ILE B N     1 
ATOM   8829  C CA    . ILE B  1 537 ? 68.516  8.429   -13.707 1.00 26.90 ? 1568 ILE B CA    1 
ATOM   8830  C C     . ILE B  1 537 ? 68.503  7.223   -14.643 1.00 26.39 ? 1568 ILE B C     1 
ATOM   8831  O O     . ILE B  1 537 ? 68.596  7.362   -15.866 1.00 26.29 ? 1568 ILE B O     1 
ATOM   8832  C CB    . ILE B  1 537 ? 69.941  8.677   -13.165 1.00 28.93 ? 1568 ILE B CB    1 
ATOM   8833  C CG1   . ILE B  1 537 ? 70.065  10.130  -12.692 1.00 30.21 ? 1568 ILE B CG1   1 
ATOM   8834  C CG2   . ILE B  1 537 ? 70.966  8.403   -14.254 1.00 30.46 ? 1568 ILE B CG2   1 
ATOM   8835  C CD1   . ILE B  1 537 ? 69.701  10.336  -11.237 1.00 37.27 ? 1568 ILE B CD1   1 
ATOM   8836  N N     . CYS B  1 538 ? 68.372  6.042   -14.056 1.00 27.22 ? 1569 CYS B N     1 
ATOM   8837  C CA    . CYS B  1 538 ? 68.338  4.808   -14.818 1.00 28.98 ? 1569 CYS B CA    1 
ATOM   8838  C C     . CYS B  1 538 ? 67.303  4.882   -15.936 1.00 30.73 ? 1569 CYS B C     1 
ATOM   8839  O O     . CYS B  1 538 ? 67.614  4.671   -17.111 1.00 31.73 ? 1569 CYS B O     1 
ATOM   8840  C CB    . CYS B  1 538 ? 67.996  3.656   -13.885 1.00 27.32 ? 1569 CYS B CB    1 
ATOM   8841  S SG    . CYS B  1 538 ? 68.785  2.098   -14.361 1.00 34.59 ? 1569 CYS B SG    1 
ATOM   8842  N N     . ASN B  1 539 ? 66.068  5.186   -15.555 1.00 32.89 ? 1570 ASN B N     1 
ATOM   8843  C CA    . ASN B  1 539 ? 64.964  5.289   -16.499 1.00 33.19 ? 1570 ASN B CA    1 
ATOM   8844  C C     . ASN B  1 539 ? 65.100  6.472   -17.439 1.00 34.86 ? 1570 ASN B C     1 
ATOM   8845  O O     . ASN B  1 539 ? 65.103  6.311   -18.654 1.00 34.92 ? 1570 ASN B O     1 
ATOM   8846  C CB    . ASN B  1 539 ? 63.643  5.417   -15.741 1.00 30.82 ? 1570 ASN B CB    1 
ATOM   8847  C CG    . ASN B  1 539 ? 63.366  4.230   -14.855 1.00 29.00 ? 1570 ASN B CG    1 
ATOM   8848  O OD1   . ASN B  1 539 ? 63.413  3.089   -15.315 1.00 24.64 ? 1570 ASN B OD1   1 
ATOM   8849  N ND2   . ASN B  1 539 ? 63.074  4.487   -13.576 1.00 26.61 ? 1570 ASN B ND2   1 
ATOM   8850  N N     . ASN B  1 540 ? 65.219  7.661   -16.861 1.00 38.21 ? 1571 ASN B N     1 
ATOM   8851  C CA    . ASN B  1 540 ? 65.305  8.886   -17.640 1.00 40.93 ? 1571 ASN B CA    1 
ATOM   8852  C C     . ASN B  1 540 ? 66.532  9.070   -18.514 1.00 40.11 ? 1571 ASN B C     1 
ATOM   8853  O O     . ASN B  1 540 ? 66.460  9.750   -19.540 1.00 39.31 ? 1571 ASN B O     1 
ATOM   8854  C CB    . ASN B  1 540 ? 65.163  10.087  -16.712 1.00 45.42 ? 1571 ASN B CB    1 
ATOM   8855  C CG    . ASN B  1 540 ? 63.728  10.333  -16.312 1.00 52.97 ? 1571 ASN B CG    1 
ATOM   8856  O OD1   . ASN B  1 540 ? 62.807  9.693   -16.824 1.00 55.19 ? 1571 ASN B OD1   1 
ATOM   8857  N ND2   . ASN B  1 540 ? 63.527  11.261  -15.391 1.00 56.85 ? 1571 ASN B ND2   1 
ATOM   8858  N N     . VAL B  1 541 ? 67.651  8.469   -18.121 1.00 39.50 ? 1572 VAL B N     1 
ATOM   8859  C CA    . VAL B  1 541 ? 68.882  8.615   -18.889 1.00 37.20 ? 1572 VAL B CA    1 
ATOM   8860  C C     . VAL B  1 541 ? 69.280  7.363   -19.652 1.00 34.01 ? 1572 VAL B C     1 
ATOM   8861  O O     . VAL B  1 541 ? 69.041  6.244   -19.192 1.00 34.63 ? 1572 VAL B O     1 
ATOM   8862  C CB    . VAL B  1 541 ? 70.049  9.026   -17.991 1.00 37.61 ? 1572 VAL B CB    1 
ATOM   8863  C CG1   . VAL B  1 541 ? 71.140  9.655   -18.835 1.00 39.39 ? 1572 VAL B CG1   1 
ATOM   8864  C CG2   . VAL B  1 541 ? 69.564  10.000  -16.926 1.00 39.06 ? 1572 VAL B CG2   1 
ATOM   8865  N N     . LYS B  1 542 ? 69.895  7.574   -20.816 1.00 30.53 ? 1573 LYS B N     1 
ATOM   8866  C CA    . LYS B  1 542 ? 70.338  6.490   -21.696 1.00 26.90 ? 1573 LYS B CA    1 
ATOM   8867  C C     . LYS B  1 542 ? 71.317  5.554   -21.023 1.00 26.76 ? 1573 LYS B C     1 
ATOM   8868  O O     . LYS B  1 542 ? 72.089  5.964   -20.166 1.00 30.44 ? 1573 LYS B O     1 
ATOM   8869  C CB    . LYS B  1 542 ? 70.997  7.061   -22.947 1.00 26.00 ? 1573 LYS B CB    1 
ATOM   8870  C CG    . LYS B  1 542 ? 70.835  6.197   -24.173 1.00 31.33 ? 1573 LYS B CG    1 
ATOM   8871  C CD    . LYS B  1 542 ? 70.771  7.049   -25.437 1.00 34.14 ? 1573 LYS B CD    1 
ATOM   8872  C CE    . LYS B  1 542 ? 70.941  6.185   -26.682 1.00 37.49 ? 1573 LYS B CE    1 
ATOM   8873  N NZ    . LYS B  1 542 ? 71.290  6.985   -27.891 1.00 38.30 ? 1573 LYS B NZ    1 
ATOM   8874  N N     . GLY B  1 543 ? 71.278  4.289   -21.416 1.00 23.94 ? 1574 GLY B N     1 
ATOM   8875  C CA    . GLY B  1 543 ? 72.188  3.306   -20.850 1.00 22.21 ? 1574 GLY B CA    1 
ATOM   8876  C C     . GLY B  1 543 ? 72.176  3.075   -19.351 1.00 19.06 ? 1574 GLY B C     1 
ATOM   8877  O O     . GLY B  1 543 ? 72.988  2.309   -18.846 1.00 23.71 ? 1574 GLY B O     1 
ATOM   8878  N N     . CYS B  1 544 ? 71.264  3.708   -18.630 1.00 17.27 ? 1575 CYS B N     1 
ATOM   8879  C CA    . CYS B  1 544 ? 71.200  3.540   -17.175 1.00 19.99 ? 1575 CYS B CA    1 
ATOM   8880  C C     . CYS B  1 544 ? 72.563  3.712   -16.501 1.00 17.51 ? 1575 CYS B C     1 
ATOM   8881  O O     . CYS B  1 544 ? 73.002  2.857   -15.722 1.00 16.99 ? 1575 CYS B O     1 
ATOM   8882  C CB    . CYS B  1 544 ? 70.628  2.165   -16.812 1.00 20.04 ? 1575 CYS B CB    1 
ATOM   8883  S SG    . CYS B  1 544 ? 68.848  2.205   -16.381 1.00 33.06 ? 1575 CYS B SG    1 
ATOM   8884  N N     . PRO B  1 545 ? 73.234  4.845   -16.769 1.00 15.54 ? 1576 PRO B N     1 
ATOM   8885  C CA    . PRO B  1 545 ? 74.545  5.117   -16.184 1.00 14.92 ? 1576 PRO B CA    1 
ATOM   8886  C C     . PRO B  1 545 ? 74.447  5.066   -14.671 1.00 15.34 ? 1576 PRO B C     1 
ATOM   8887  O O     . PRO B  1 545 ? 73.652  5.798   -14.072 1.00 12.94 ? 1576 PRO B O     1 
ATOM   8888  C CB    . PRO B  1 545 ? 74.871  6.527   -16.674 1.00 17.85 ? 1576 PRO B CB    1 
ATOM   8889  C CG    . PRO B  1 545 ? 73.537  7.130   -17.014 1.00 16.69 ? 1576 PRO B CG    1 
ATOM   8890  C CD    . PRO B  1 545 ? 72.764  5.978   -17.582 1.00 16.91 ? 1576 PRO B CD    1 
ATOM   8891  N N     . PHE B  1 546 ? 75.244  4.206   -14.050 1.00 14.45 ? 1577 PHE B N     1 
ATOM   8892  C CA    . PHE B  1 546 ? 75.219  4.120   -12.598 1.00 11.46 ? 1577 PHE B CA    1 
ATOM   8893  C C     . PHE B  1 546 ? 75.421  5.496   -11.969 1.00 9.46  ? 1577 PHE B C     1 
ATOM   8894  O O     . PHE B  1 546 ? 76.088  6.362   -12.531 1.00 7.51  ? 1577 PHE B O     1 
ATOM   8895  C CB    . PHE B  1 546 ? 76.322  3.198   -12.063 1.00 12.71 ? 1577 PHE B CB    1 
ATOM   8896  C CG    . PHE B  1 546 ? 76.667  3.464   -10.620 1.00 8.28  ? 1577 PHE B CG    1 
ATOM   8897  C CD1   . PHE B  1 546 ? 76.092  2.695   -9.603  1.00 10.95 ? 1577 PHE B CD1   1 
ATOM   8898  C CD2   . PHE B  1 546 ? 77.481  4.550   -10.273 1.00 5.12  ? 1577 PHE B CD2   1 
ATOM   8899  C CE1   . PHE B  1 546 ? 76.312  3.011   -8.261  1.00 12.74 ? 1577 PHE B CE1   1 
ATOM   8900  C CE2   . PHE B  1 546 ? 77.708  4.878   -8.941  1.00 7.87  ? 1577 PHE B CE2   1 
ATOM   8901  C CZ    . PHE B  1 546 ? 77.123  4.113   -7.928  1.00 12.08 ? 1577 PHE B CZ    1 
ATOM   8902  N N     . THR B  1 547 ? 74.849  5.679   -10.786 1.00 7.77  ? 1578 THR B N     1 
ATOM   8903  C CA    . THR B  1 547 ? 75.003  6.921   -10.058 1.00 7.08  ? 1578 THR B CA    1 
ATOM   8904  C C     . THR B  1 547 ? 74.749  6.741   -8.586  1.00 11.20 ? 1578 THR B C     1 
ATOM   8905  O O     . THR B  1 547 ? 74.249  5.710   -8.129  1.00 8.13  ? 1578 THR B O     1 
ATOM   8906  C CB    . THR B  1 547 ? 74.069  8.023   -10.568 1.00 7.91  ? 1578 THR B CB    1 
ATOM   8907  O OG1   . THR B  1 547 ? 74.346  8.267   -11.952 1.00 12.24 ? 1578 THR B OG1   1 
ATOM   8908  C CG2   . THR B  1 547 ? 74.321  9.327   -9.811  1.00 5.40  ? 1578 THR B CG2   1 
ATOM   8909  N N     . SER B  1 548 ? 75.144  7.764   -7.851  1.00 13.73 ? 1579 SER B N     1 
ATOM   8910  C CA    . SER B  1 548 ? 74.984  7.818   -6.421  1.00 17.70 ? 1579 SER B CA    1 
ATOM   8911  C C     . SER B  1 548 ? 75.318  9.250   -6.074  1.00 23.49 ? 1579 SER B C     1 
ATOM   8912  O O     . SER B  1 548 ? 75.782  10.002  -6.932  1.00 26.63 ? 1579 SER B O     1 
ATOM   8913  C CB    . SER B  1 548 ? 75.960  6.865   -5.749  1.00 14.89 ? 1579 SER B CB    1 
ATOM   8914  O OG    . SER B  1 548 ? 75.666  6.773   -4.369  1.00 8.90  ? 1579 SER B OG    1 
ATOM   8915  N N     . PHE B  1 549 ? 75.045  9.647   -4.840  1.00 31.49 ? 1580 PHE B N     1 
ATOM   8916  C CA    . PHE B  1 549 ? 75.368  10.998  -4.421  1.00 38.64 ? 1580 PHE B CA    1 
ATOM   8917  C C     . PHE B  1 549 ? 76.733  10.852  -3.786  1.00 40.85 ? 1580 PHE B C     1 
ATOM   8918  O O     . PHE B  1 549 ? 77.275  11.785  -3.194  1.00 41.36 ? 1580 PHE B O     1 
ATOM   8919  C CB    . PHE B  1 549 ? 74.346  11.515  -3.408  1.00 42.80 ? 1580 PHE B CB    1 
ATOM   8920  C CG    . PHE B  1 549 ? 73.023  11.896  -4.020  1.00 47.60 ? 1580 PHE B CG    1 
ATOM   8921  C CD1   . PHE B  1 549 ? 71.828  11.401  -3.495  1.00 49.00 ? 1580 PHE B CD1   1 
ATOM   8922  C CD2   . PHE B  1 549 ? 72.969  12.742  -5.128  1.00 48.73 ? 1580 PHE B CD2   1 
ATOM   8923  C CE1   . PHE B  1 549 ? 70.601  11.740  -4.061  1.00 50.22 ? 1580 PHE B CE1   1 
ATOM   8924  C CE2   . PHE B  1 549 ? 71.749  13.090  -5.705  1.00 48.60 ? 1580 PHE B CE2   1 
ATOM   8925  C CZ    . PHE B  1 549 ? 70.562  12.586  -5.170  1.00 50.83 ? 1580 PHE B CZ    1 
ATOM   8926  N N     . ASN B  1 550 ? 77.275  9.645   -3.932  1.00 44.53 ? 1581 ASN B N     1 
ATOM   8927  C CA    . ASN B  1 550 ? 78.585  9.295   -3.404  1.00 49.11 ? 1581 ASN B CA    1 
ATOM   8928  C C     . ASN B  1 550 ? 79.539  8.917   -4.523  1.00 48.58 ? 1581 ASN B C     1 
ATOM   8929  O O     . ASN B  1 550 ? 79.212  8.094   -5.381  1.00 48.99 ? 1581 ASN B O     1 
ATOM   8930  C CB    . ASN B  1 550 ? 78.472  8.122   -2.440  1.00 50.80 ? 1581 ASN B CB    1 
ATOM   8931  C CG    . ASN B  1 550 ? 79.388  8.270   -1.262  1.00 58.74 ? 1581 ASN B CG    1 
ATOM   8932  O OD1   . ASN B  1 550 ? 79.045  7.878   -0.146  1.00 59.89 ? 1581 ASN B OD1   1 
ATOM   8933  N ND2   . ASN B  1 550 ? 80.566  8.848   -1.496  1.00 60.94 ? 1581 ASN B ND2   1 
ATOM   8934  N N     . VAL B  1 551 ? 80.721  9.518   -4.512  1.00 51.69 ? 1582 VAL B N     1 
ATOM   8935  C CA    . VAL B  1 551 ? 81.702  9.219   -5.535  1.00 54.70 ? 1582 VAL B CA    1 
ATOM   8936  C C     . VAL B  1 551 ? 82.422  7.933   -5.159  1.00 58.31 ? 1582 VAL B C     1 
ATOM   8937  O O     . VAL B  1 551 ? 83.526  7.960   -4.624  1.00 59.15 ? 1582 VAL B O     1 
ATOM   8938  C CB    . VAL B  1 551 ? 82.717  10.375  -5.707  1.00 50.66 ? 1582 VAL B CB    1 
ATOM   8939  C CG1   . VAL B  1 551 ? 83.388  10.700  -4.391  1.00 47.19 ? 1582 VAL B CG1   1 
ATOM   8940  C CG2   . VAL B  1 551 ? 83.734  10.004  -6.760  1.00 49.77 ? 1582 VAL B CG2   1 
ATOM   8941  N N     . GLN B  1 552 ? 81.762  6.808   -5.431  1.00 62.44 ? 1583 GLN B N     1 
ATOM   8942  C CA    . GLN B  1 552 ? 82.294  5.478   -5.149  1.00 64.94 ? 1583 GLN B CA    1 
ATOM   8943  C C     . GLN B  1 552 ? 82.961  5.413   -3.786  1.00 64.15 ? 1583 GLN B C     1 
ATOM   8944  O O     . GLN B  1 552 ? 83.720  4.450   -3.559  1.00 64.33 ? 1583 GLN B O     1 
ATOM   8945  C CB    . GLN B  1 552 ? 83.293  5.067   -6.234  1.00 69.37 ? 1583 GLN B CB    1 
ATOM   8946  C CG    . GLN B  1 552 ? 82.679  4.914   -7.622  1.00 76.69 ? 1583 GLN B CG    1 
ATOM   8947  C CD    . GLN B  1 552 ? 81.916  6.157   -8.083  1.00 80.17 ? 1583 GLN B CD    1 
ATOM   8948  O OE1   . GLN B  1 552 ? 82.457  7.268   -8.112  1.00 81.16 ? 1583 GLN B OE1   1 
ATOM   8949  N NE2   . GLN B  1 552 ? 80.652  5.969   -8.444  1.00 76.41 ? 1583 GLN B NE2   1 
ATOM   8950  O OXT   . GLN B  1 552 ? 82.715  6.323   -2.964  1.00 61.47 ? 1583 GLN B OXT   1 
ATOM   8951  N N     . ALA C  1 1   ? 54.830  58.338  41.651  1.00 14.80 ? 2033 ALA C N     1 
ATOM   8952  C CA    . ALA C  1 1   ? 54.154  59.658  41.415  1.00 18.20 ? 2033 ALA C CA    1 
ATOM   8953  C C     . ALA C  1 1   ? 53.329  60.125  42.625  1.00 17.75 ? 2033 ALA C C     1 
ATOM   8954  O O     . ALA C  1 1   ? 52.949  61.302  42.715  1.00 21.33 ? 2033 ALA C O     1 
ATOM   8955  C CB    . ALA C  1 1   ? 53.258  59.573  40.174  1.00 16.73 ? 2033 ALA C CB    1 
ATOM   8956  N N     . ASN C  1 2   ? 53.069  59.211  43.556  1.00 18.92 ? 2034 ASN C N     1 
ATOM   8957  C CA    . ASN C  1 2   ? 52.290  59.539  44.741  1.00 20.94 ? 2034 ASN C CA    1 
ATOM   8958  C C     . ASN C  1 2   ? 52.904  60.630  45.609  1.00 21.82 ? 2034 ASN C C     1 
ATOM   8959  O O     . ASN C  1 2   ? 53.933  60.420  46.245  1.00 22.68 ? 2034 ASN C O     1 
ATOM   8960  C CB    . ASN C  1 2   ? 52.071  58.297  45.605  1.00 25.12 ? 2034 ASN C CB    1 
ATOM   8961  C CG    . ASN C  1 2   ? 51.064  58.542  46.732  1.00 30.41 ? 2034 ASN C CG    1 
ATOM   8962  O OD1   . ASN C  1 2   ? 50.802  59.692  47.113  1.00 30.17 ? 2034 ASN C OD1   1 
ATOM   8963  N ND2   . ASN C  1 2   ? 50.490  57.462  47.262  1.00 27.78 ? 2034 ASN C ND2   1 
ATOM   8964  N N     . PRO C  1 3   ? 52.257  61.803  45.654  1.00 20.60 ? 2035 PRO C N     1 
ATOM   8965  C CA    . PRO C  1 3   ? 52.691  62.966  46.434  1.00 20.96 ? 2035 PRO C CA    1 
ATOM   8966  C C     . PRO C  1 3   ? 52.823  62.686  47.930  1.00 20.33 ? 2035 PRO C C     1 
ATOM   8967  O O     . PRO C  1 3   ? 53.311  63.518  48.691  1.00 21.10 ? 2035 PRO C O     1 
ATOM   8968  C CB    . PRO C  1 3   ? 51.611  64.014  46.152  1.00 23.78 ? 2035 PRO C CB    1 
ATOM   8969  C CG    . PRO C  1 3   ? 50.427  63.230  45.653  1.00 21.87 ? 2035 PRO C CG    1 
ATOM   8970  C CD    . PRO C  1 3   ? 51.017  62.079  44.907  1.00 22.09 ? 2035 PRO C CD    1 
ATOM   8971  N N     . CYS C  1 4   ? 52.373  61.516  48.358  1.00 19.63 ? 2036 CYS C N     1 
ATOM   8972  C CA    . CYS C  1 4   ? 52.472  61.168  49.768  1.00 21.73 ? 2036 CYS C CA    1 
ATOM   8973  C C     . CYS C  1 4   ? 53.742  60.379  49.993  1.00 24.19 ? 2036 CYS C C     1 
ATOM   8974  O O     . CYS C  1 4   ? 54.262  60.331  51.110  1.00 25.68 ? 2036 CYS C O     1 
ATOM   8975  C CB    . CYS C  1 4   ? 51.262  60.343  50.212  1.00 20.69 ? 2036 CYS C CB    1 
ATOM   8976  S SG    . CYS C  1 4   ? 49.777  61.338  50.561  1.00 20.52 ? 2036 CYS C SG    1 
ATOM   8977  N N     . CYS C  1 5   ? 54.233  59.762  48.917  1.00 26.13 ? 2037 CYS C N     1 
ATOM   8978  C CA    . CYS C  1 5   ? 55.453  58.949  48.942  1.00 24.52 ? 2037 CYS C CA    1 
ATOM   8979  C C     . CYS C  1 5   ? 56.450  59.384  50.010  1.00 23.20 ? 2037 CYS C C     1 
ATOM   8980  O O     . CYS C  1 5   ? 56.965  58.552  50.754  1.00 26.21 ? 2037 CYS C O     1 
ATOM   8981  C CB    . CYS C  1 5   ? 56.135  58.998  47.579  1.00 23.30 ? 2037 CYS C CB    1 
ATOM   8982  S SG    . CYS C  1 5   ? 55.454  57.809  46.402  1.00 23.23 ? 2037 CYS C SG    1 
ATOM   8983  N N     . SER C  1 6   ? 56.700  60.689  50.086  1.00 17.92 ? 2038 SER C N     1 
ATOM   8984  C CA    . SER C  1 6   ? 57.645  61.247  51.049  1.00 16.13 ? 2038 SER C CA    1 
ATOM   8985  C C     . SER C  1 6   ? 57.244  61.186  52.523  1.00 12.13 ? 2038 SER C C     1 
ATOM   8986  O O     . SER C  1 6   ? 57.890  61.825  53.353  1.00 14.47 ? 2038 SER C O     1 
ATOM   8987  C CB    . SER C  1 6   ? 57.951  62.710  50.693  1.00 15.57 ? 2038 SER C CB    1 
ATOM   8988  O OG    . SER C  1 6   ? 56.834  63.355  50.095  1.00 21.26 ? 2038 SER C OG    1 
ATOM   8989  N N     . ASN C  1 7   ? 56.193  60.438  52.852  1.00 9.14  ? 2039 ASN C N     1 
ATOM   8990  C CA    . ASN C  1 7   ? 55.727  60.338  54.238  1.00 7.48  ? 2039 ASN C CA    1 
ATOM   8991  C C     . ASN C  1 7   ? 55.695  61.695  54.944  1.00 6.85  ? 2039 ASN C C     1 
ATOM   8992  O O     . ASN C  1 7   ? 56.035  61.791  56.129  1.00 10.63 ? 2039 ASN C O     1 
ATOM   8993  C CB    . ASN C  1 7   ? 56.643  59.400  55.014  1.00 4.06  ? 2039 ASN C CB    1 
ATOM   8994  C CG    . ASN C  1 7   ? 56.548  57.995  54.521  1.00 8.96  ? 2039 ASN C CG    1 
ATOM   8995  O OD1   . ASN C  1 7   ? 56.329  57.065  55.295  1.00 6.06  ? 2039 ASN C OD1   1 
ATOM   8996  N ND2   . ASN C  1 7   ? 56.688  57.824  53.215  1.00 4.77  ? 2039 ASN C ND2   1 
ATOM   8997  N N     . PRO C  1 8   ? 55.237  62.746  54.249  1.00 9.94  ? 2040 PRO C N     1 
ATOM   8998  C CA    . PRO C  1 8   ? 55.180  64.098  54.810  1.00 9.19  ? 2040 PRO C CA    1 
ATOM   8999  C C     . PRO C  1 8   ? 54.450  64.319  56.125  1.00 11.78 ? 2040 PRO C C     1 
ATOM   9000  O O     . PRO C  1 8   ? 54.974  64.971  57.026  1.00 10.09 ? 2040 PRO C O     1 
ATOM   9001  C CB    . PRO C  1 8   ? 54.565  64.930  53.684  1.00 10.69 ? 2040 PRO C CB    1 
ATOM   9002  C CG    . PRO C  1 8   ? 53.875  63.944  52.798  1.00 8.70  ? 2040 PRO C CG    1 
ATOM   9003  C CD    . PRO C  1 8   ? 54.681  62.697  52.887  1.00 7.77  ? 2040 PRO C CD    1 
ATOM   9004  N N     . CYS C  1 9   ? 53.241  63.782  56.229  1.00 15.76 ? 2041 CYS C N     1 
ATOM   9005  C CA    . CYS C  1 9   ? 52.409  63.971  57.421  1.00 18.01 ? 2041 CYS C CA    1 
ATOM   9006  C C     . CYS C  1 9   ? 53.025  63.396  58.687  1.00 18.12 ? 2041 CYS C C     1 
ATOM   9007  O O     . CYS C  1 9   ? 53.308  62.205  58.765  1.00 18.31 ? 2041 CYS C O     1 
ATOM   9008  C CB    . CYS C  1 9   ? 50.996  63.388  57.181  1.00 18.48 ? 2041 CYS C CB    1 
ATOM   9009  S SG    . CYS C  1 9   ? 50.180  64.044  55.680  1.00 12.63 ? 2041 CYS C SG    1 
ATOM   9010  N N     . GLN C  1 10  ? 53.204  64.258  59.685  1.00 20.02 ? 2042 GLN C N     1 
ATOM   9011  C CA    . GLN C  1 10  ? 53.811  63.868  60.950  1.00 21.60 ? 2042 GLN C CA    1 
ATOM   9012  C C     . GLN C  1 10  ? 52.834  63.639  62.092  1.00 23.23 ? 2042 GLN C C     1 
ATOM   9013  O O     . GLN C  1 10  ? 51.659  63.972  61.996  1.00 27.66 ? 2042 GLN C O     1 
ATOM   9014  C CB    . GLN C  1 10  ? 54.824  64.935  61.364  1.00 21.39 ? 2042 GLN C CB    1 
ATOM   9015  C CG    . GLN C  1 10  ? 55.851  65.268  60.276  1.00 21.25 ? 2042 GLN C CG    1 
ATOM   9016  C CD    . GLN C  1 10  ? 56.793  64.111  59.989  1.00 19.06 ? 2042 GLN C CD    1 
ATOM   9017  O OE1   . GLN C  1 10  ? 57.551  63.684  60.865  1.00 18.65 ? 2042 GLN C OE1   1 
ATOM   9018  N NE2   . GLN C  1 10  ? 56.749  63.596  58.760  1.00 16.25 ? 2042 GLN C NE2   1 
ATOM   9019  N N     . ASN C  1 11  ? 53.341  63.069  63.179  1.00 25.46 ? 2043 ASN C N     1 
ATOM   9020  C CA    . ASN C  1 11  ? 52.549  62.796  64.373  1.00 26.22 ? 2043 ASN C CA    1 
ATOM   9021  C C     . ASN C  1 11  ? 51.246  62.066  64.121  1.00 28.15 ? 2043 ASN C C     1 
ATOM   9022  O O     . ASN C  1 11  ? 50.175  62.569  64.457  1.00 29.38 ? 2043 ASN C O     1 
ATOM   9023  C CB    . ASN C  1 11  ? 52.234  64.092  65.097  1.00 28.71 ? 2043 ASN C CB    1 
ATOM   9024  C CG    . ASN C  1 11  ? 53.428  64.979  65.219  1.00 32.52 ? 2043 ASN C CG    1 
ATOM   9025  O OD1   . ASN C  1 11  ? 54.107  64.969  66.242  1.00 34.43 ? 2043 ASN C OD1   1 
ATOM   9026  N ND2   . ASN C  1 11  ? 53.703  65.760  64.174  1.00 34.77 ? 2043 ASN C ND2   1 
ATOM   9027  N N     . ARG C  1 12  ? 51.339  60.875  63.544  1.00 27.93 ? 2044 ARG C N     1 
ATOM   9028  C CA    . ARG C  1 12  ? 50.161  60.068  63.253  1.00 24.20 ? 2044 ARG C CA    1 
ATOM   9029  C C     . ARG C  1 12  ? 49.196  60.759  62.300  1.00 22.28 ? 2044 ARG C C     1 
ATOM   9030  O O     . ARG C  1 12  ? 48.071  60.301  62.122  1.00 23.06 ? 2044 ARG C O     1 
ATOM   9031  C CB    . ARG C  1 12  ? 49.429  59.706  64.543  1.00 23.77 ? 2044 ARG C CB    1 
ATOM   9032  C CG    . ARG C  1 12  ? 50.248  58.870  65.494  1.00 25.66 ? 2044 ARG C CG    1 
ATOM   9033  C CD    . ARG C  1 12  ? 50.304  57.443  65.026  1.00 22.93 ? 2044 ARG C CD    1 
ATOM   9034  N NE    . ARG C  1 12  ? 49.488  56.588  65.867  1.00 20.88 ? 2044 ARG C NE    1 
ATOM   9035  C CZ    . ARG C  1 12  ? 48.590  55.738  65.389  1.00 28.55 ? 2044 ARG C CZ    1 
ATOM   9036  N NH1   . ARG C  1 12  ? 48.405  55.643  64.073  1.00 29.36 ? 2044 ARG C NH1   1 
ATOM   9037  N NH2   . ARG C  1 12  ? 47.882  54.977  66.222  1.00 26.73 ? 2044 ARG C NH2   1 
ATOM   9038  N N     . GLY C  1 13  ? 49.630  61.865  61.695  1.00 19.58 ? 2045 GLY C N     1 
ATOM   9039  C CA    . GLY C  1 13  ? 48.782  62.563  60.742  1.00 20.39 ? 2045 GLY C CA    1 
ATOM   9040  C C     . GLY C  1 13  ? 48.513  61.653  59.555  1.00 20.40 ? 2045 GLY C C     1 
ATOM   9041  O O     . GLY C  1 13  ? 49.228  60.675  59.356  1.00 19.00 ? 2045 GLY C O     1 
ATOM   9042  N N     . GLU C  1 14  ? 47.491  61.958  58.763  1.00 21.48 ? 2046 GLU C N     1 
ATOM   9043  C CA    . GLU C  1 14  ? 47.180  61.116  57.616  1.00 23.69 ? 2046 GLU C CA    1 
ATOM   9044  C C     . GLU C  1 14  ? 47.355  61.843  56.303  1.00 22.12 ? 2046 GLU C C     1 
ATOM   9045  O O     . GLU C  1 14  ? 46.807  62.919  56.104  1.00 21.26 ? 2046 GLU C O     1 
ATOM   9046  C CB    . GLU C  1 14  ? 45.760  60.593  57.712  1.00 28.11 ? 2046 GLU C CB    1 
ATOM   9047  C CG    . GLU C  1 14  ? 45.637  59.113  57.421  1.00 36.32 ? 2046 GLU C CG    1 
ATOM   9048  C CD    . GLU C  1 14  ? 44.697  58.425  58.393  1.00 41.91 ? 2046 GLU C CD    1 
ATOM   9049  O OE1   . GLU C  1 14  ? 43.593  58.012  57.957  1.00 42.50 ? 2046 GLU C OE1   1 
ATOM   9050  O OE2   . GLU C  1 14  ? 45.063  58.305  59.589  1.00 42.36 ? 2046 GLU C OE2   1 
ATOM   9051  N N     . CYS C  1 15  ? 48.123  61.243  55.403  1.00 21.85 ? 2047 CYS C N     1 
ATOM   9052  C CA    . CYS C  1 15  ? 48.381  61.849  54.108  1.00 21.16 ? 2047 CYS C CA    1 
ATOM   9053  C C     . CYS C  1 15  ? 47.350  61.422  53.075  1.00 19.76 ? 2047 CYS C C     1 
ATOM   9054  O O     . CYS C  1 15  ? 47.035  60.239  52.955  1.00 17.97 ? 2047 CYS C O     1 
ATOM   9055  C CB    . CYS C  1 15  ? 49.785  61.478  53.615  1.00 20.70 ? 2047 CYS C CB    1 
ATOM   9056  S SG    . CYS C  1 15  ? 50.306  62.451  52.171  1.00 24.27 ? 2047 CYS C SG    1 
ATOM   9057  N N     . MET C  1 16  ? 46.848  62.394  52.318  1.00 18.38 ? 2048 MET C N     1 
ATOM   9058  C CA    . MET C  1 16  ? 45.855  62.134  51.281  1.00 14.77 ? 2048 MET C CA    1 
ATOM   9059  C C     . MET C  1 16  ? 46.165  62.896  49.984  1.00 9.31  ? 2048 MET C C     1 
ATOM   9060  O O     . MET C  1 16  ? 46.401  64.122  49.999  1.00 4.50  ? 2048 MET C O     1 
ATOM   9061  C CB    . MET C  1 16  ? 44.463  62.514  51.790  1.00 25.38 ? 2048 MET C CB    1 
ATOM   9062  C CG    . MET C  1 16  ? 43.635  63.366  50.817  1.00 32.70 ? 2048 MET C CG    1 
ATOM   9063  S SD    . MET C  1 16  ? 41.897  62.894  50.787  1.00 41.59 ? 2048 MET C SD    1 
ATOM   9064  C CE    . MET C  1 16  ? 41.125  64.501  50.555  1.00 49.63 ? 2048 MET C CE    1 
ATOM   9065  N N     . SER C  1 17  ? 46.140  62.156  48.874  1.00 2.00  ? 2049 SER C N     1 
ATOM   9066  C CA    . SER C  1 17  ? 46.439  62.705  47.557  1.00 7.77  ? 2049 SER C CA    1 
ATOM   9067  C C     . SER C  1 17  ? 45.390  63.662  47.050  1.00 10.23 ? 2049 SER C C     1 
ATOM   9068  O O     . SER C  1 17  ? 44.406  63.239  46.437  1.00 13.29 ? 2049 SER C O     1 
ATOM   9069  C CB    . SER C  1 17  ? 46.618  61.587  46.520  1.00 9.05  ? 2049 SER C CB    1 
ATOM   9070  O OG    . SER C  1 17  ? 45.945  60.407  46.901  1.00 10.74 ? 2049 SER C OG    1 
ATOM   9071  N N     . THR C  1 18  ? 45.610  64.950  47.295  1.00 9.68  ? 2050 THR C N     1 
ATOM   9072  C CA    . THR C  1 18  ? 44.674  65.964  46.853  1.00 10.21 ? 2050 THR C CA    1 
ATOM   9073  C C     . THR C  1 18  ? 44.974  66.394  45.419  1.00 13.16 ? 2050 THR C C     1 
ATOM   9074  O O     . THR C  1 18  ? 45.021  67.582  45.101  1.00 14.47 ? 2050 THR C O     1 
ATOM   9075  C CB    . THR C  1 18  ? 44.712  67.183  47.784  1.00 10.87 ? 2050 THR C CB    1 
ATOM   9076  O OG1   . THR C  1 18  ? 45.908  67.941  47.549  1.00 9.39  ? 2050 THR C OG1   1 
ATOM   9077  C CG2   . THR C  1 18  ? 44.666  66.720  49.231  1.00 13.00 ? 2050 THR C CG2   1 
ATOM   9078  N N     . GLY C  1 19  ? 45.146  65.415  44.541  1.00 15.17 ? 2051 GLY C N     1 
ATOM   9079  C CA    . GLY C  1 19  ? 45.447  65.737  43.165  1.00 19.21 ? 2051 GLY C CA    1 
ATOM   9080  C C     . GLY C  1 19  ? 46.685  64.956  42.791  1.00 23.99 ? 2051 GLY C C     1 
ATOM   9081  O O     . GLY C  1 19  ? 47.369  64.433  43.674  1.00 25.34 ? 2051 GLY C O     1 
ATOM   9082  N N     . PHE C  1 20  ? 46.968  64.875  41.494  1.00 27.07 ? 2052 PHE C N     1 
ATOM   9083  C CA    . PHE C  1 20  ? 48.111  64.125  40.977  1.00 30.50 ? 2052 PHE C CA    1 
ATOM   9084  C C     . PHE C  1 20  ? 49.462  64.394  41.641  1.00 37.17 ? 2052 PHE C C     1 
ATOM   9085  O O     . PHE C  1 20  ? 50.177  63.462  42.014  1.00 38.05 ? 2052 PHE C O     1 
ATOM   9086  C CB    . PHE C  1 20  ? 48.238  64.371  39.480  1.00 27.53 ? 2052 PHE C CB    1 
ATOM   9087  C CG    . PHE C  1 20  ? 47.374  63.474  38.645  1.00 26.47 ? 2052 PHE C CG    1 
ATOM   9088  C CD1   . PHE C  1 20  ? 46.327  63.996  37.890  1.00 22.55 ? 2052 PHE C CD1   1 
ATOM   9089  C CD2   . PHE C  1 20  ? 47.620  62.105  38.596  1.00 25.58 ? 2052 PHE C CD2   1 
ATOM   9090  C CE1   . PHE C  1 20  ? 45.538  63.164  37.096  1.00 19.11 ? 2052 PHE C CE1   1 
ATOM   9091  C CE2   . PHE C  1 20  ? 46.837  61.265  37.806  1.00 22.76 ? 2052 PHE C CE2   1 
ATOM   9092  C CZ    . PHE C  1 20  ? 45.794  61.799  37.053  1.00 19.01 ? 2052 PHE C CZ    1 
ATOM   9093  N N     . ASP C  1 21  ? 49.816  65.666  41.786  1.00 41.58 ? 2053 ASP C N     1 
ATOM   9094  C CA    . ASP C  1 21  ? 51.092  66.018  42.386  1.00 44.18 ? 2053 ASP C CA    1 
ATOM   9095  C C     . ASP C  1 21  ? 50.953  66.962  43.567  1.00 44.69 ? 2053 ASP C C     1 
ATOM   9096  O O     . ASP C  1 21  ? 51.709  67.926  43.685  1.00 43.77 ? 2053 ASP C O     1 
ATOM   9097  C CB    . ASP C  1 21  ? 52.008  66.644  41.327  1.00 48.20 ? 2053 ASP C CB    1 
ATOM   9098  C CG    . ASP C  1 21  ? 52.359  65.672  40.200  1.00 53.02 ? 2053 ASP C CG    1 
ATOM   9099  O OD1   . ASP C  1 21  ? 52.650  64.484  40.489  1.00 53.79 ? 2053 ASP C OD1   1 
ATOM   9100  O OD2   . ASP C  1 21  ? 52.342  66.103  39.026  1.00 53.45 ? 2053 ASP C OD2   1 
ATOM   9101  N N     . GLN C  1 22  ? 49.979  66.682  44.432  1.00 44.93 ? 2054 GLN C N     1 
ATOM   9102  C CA    . GLN C  1 22  ? 49.728  67.476  45.640  1.00 45.50 ? 2054 GLN C CA    1 
ATOM   9103  C C     . GLN C  1 22  ? 49.137  66.532  46.682  1.00 42.48 ? 2054 GLN C C     1 
ATOM   9104  O O     . GLN C  1 22  ? 48.596  65.485  46.331  1.00 44.16 ? 2054 GLN C O     1 
ATOM   9105  C CB    . GLN C  1 22  ? 48.760  68.617  45.339  1.00 47.81 ? 2054 GLN C CB    1 
ATOM   9106  C CG    . GLN C  1 22  ? 48.036  68.462  44.006  1.00 55.09 ? 2054 GLN C CG    1 
ATOM   9107  C CD    . GLN C  1 22  ? 48.266  69.631  43.058  1.00 58.56 ? 2054 GLN C CD    1 
ATOM   9108  O OE1   . GLN C  1 22  ? 47.978  70.784  43.389  1.00 56.28 ? 2054 GLN C OE1   1 
ATOM   9109  N NE2   . GLN C  1 22  ? 48.782  69.336  41.869  1.00 56.20 ? 2054 GLN C NE2   1 
ATOM   9110  N N     . TYR C  1 23  ? 49.242  66.884  47.959  1.00 36.39 ? 2055 TYR C N     1 
ATOM   9111  C CA    . TYR C  1 23  ? 48.722  66.011  49.011  1.00 32.53 ? 2055 TYR C CA    1 
ATOM   9112  C C     . TYR C  1 23  ? 48.094  66.806  50.148  1.00 30.54 ? 2055 TYR C C     1 
ATOM   9113  O O     . TYR C  1 23  ? 48.011  68.036  50.088  1.00 25.70 ? 2055 TYR C O     1 
ATOM   9114  C CB    . TYR C  1 23  ? 49.853  65.148  49.577  1.00 33.66 ? 2055 TYR C CB    1 
ATOM   9115  C CG    . TYR C  1 23  ? 50.781  65.940  50.481  1.00 37.29 ? 2055 TYR C CG    1 
ATOM   9116  C CD1   . TYR C  1 23  ? 50.850  65.676  51.854  1.00 35.14 ? 2055 TYR C CD1   1 
ATOM   9117  C CD2   . TYR C  1 23  ? 51.540  67.003  49.977  1.00 35.26 ? 2055 TYR C CD2   1 
ATOM   9118  C CE1   . TYR C  1 23  ? 51.649  66.454  52.702  1.00 31.07 ? 2055 TYR C CE1   1 
ATOM   9119  C CE2   . TYR C  1 23  ? 52.339  67.786  50.816  1.00 31.46 ? 2055 TYR C CE2   1 
ATOM   9120  C CZ    . TYR C  1 23  ? 52.387  67.505  52.176  1.00 31.95 ? 2055 TYR C CZ    1 
ATOM   9121  O OH    . TYR C  1 23  ? 53.169  68.269  53.011  1.00 26.93 ? 2055 TYR C OH    1 
ATOM   9122  N N     . LYS C  1 24  ? 47.662  66.099  51.190  1.00 29.16 ? 2056 LYS C N     1 
ATOM   9123  C CA    . LYS C  1 24  ? 47.063  66.763  52.341  1.00 30.26 ? 2056 LYS C CA    1 
ATOM   9124  C C     . LYS C  1 24  ? 47.207  65.938  53.607  1.00 28.62 ? 2056 LYS C C     1 
ATOM   9125  O O     . LYS C  1 24  ? 47.152  64.711  53.572  1.00 26.24 ? 2056 LYS C O     1 
ATOM   9126  C CB    . LYS C  1 24  ? 45.588  67.059  52.083  1.00 33.63 ? 2056 LYS C CB    1 
ATOM   9127  C CG    . LYS C  1 24  ? 44.759  67.266  53.339  1.00 34.72 ? 2056 LYS C CG    1 
ATOM   9128  C CD    . LYS C  1 24  ? 44.636  68.740  53.696  1.00 31.20 ? 2056 LYS C CD    1 
ATOM   9129  C CE    . LYS C  1 24  ? 44.337  68.918  55.172  1.00 32.07 ? 2056 LYS C CE    1 
ATOM   9130  N NZ    . LYS C  1 24  ? 43.765  70.254  55.477  1.00 31.21 ? 2056 LYS C NZ    1 
ATOM   9131  N N     . CYS C  1 25  ? 47.365  66.635  54.727  1.00 27.77 ? 2057 CYS C N     1 
ATOM   9132  C CA    . CYS C  1 25  ? 47.557  65.992  56.017  1.00 27.50 ? 2057 CYS C CA    1 
ATOM   9133  C C     . CYS C  1 25  ? 46.376  66.146  56.956  1.00 31.99 ? 2057 CYS C C     1 
ATOM   9134  O O     . CYS C  1 25  ? 45.922  67.267  57.242  1.00 31.01 ? 2057 CYS C O     1 
ATOM   9135  C CB    . CYS C  1 25  ? 48.819  66.549  56.693  1.00 26.19 ? 2057 CYS C CB    1 
ATOM   9136  S SG    . CYS C  1 25  ? 50.379  66.056  55.884  1.00 23.80 ? 2057 CYS C SG    1 
ATOM   9137  N N     . ASP C  1 26  ? 45.917  65.002  57.460  1.00 32.39 ? 2058 ASP C N     1 
ATOM   9138  C CA    . ASP C  1 26  ? 44.783  64.931  58.376  1.00 34.38 ? 2058 ASP C CA    1 
ATOM   9139  C C     . ASP C  1 26  ? 45.262  64.955  59.820  1.00 33.67 ? 2058 ASP C C     1 
ATOM   9140  O O     . ASP C  1 26  ? 45.293  63.920  60.491  1.00 34.74 ? 2058 ASP C O     1 
ATOM   9141  C CB    . ASP C  1 26  ? 43.989  63.640  58.123  1.00 36.22 ? 2058 ASP C CB    1 
ATOM   9142  C CG    . ASP C  1 26  ? 42.498  63.806  58.369  1.00 36.12 ? 2058 ASP C CG    1 
ATOM   9143  O OD1   . ASP C  1 26  ? 41.723  63.713  57.392  1.00 34.66 ? 2058 ASP C OD1   1 
ATOM   9144  O OD2   . ASP C  1 26  ? 42.101  64.026  59.534  1.00 35.04 ? 2058 ASP C OD2   1 
ATOM   9145  N N     . CYS C  1 27  ? 45.633  66.139  60.294  1.00 32.45 ? 2059 CYS C N     1 
ATOM   9146  C CA    . CYS C  1 27  ? 46.112  66.288  61.668  1.00 31.44 ? 2059 CYS C CA    1 
ATOM   9147  C C     . CYS C  1 27  ? 44.916  66.337  62.611  1.00 30.15 ? 2059 CYS C C     1 
ATOM   9148  O O     . CYS C  1 27  ? 44.666  67.342  63.270  1.00 31.15 ? 2059 CYS C O     1 
ATOM   9149  C CB    . CYS C  1 27  ? 46.949  67.567  61.803  1.00 28.02 ? 2059 CYS C CB    1 
ATOM   9150  S SG    . CYS C  1 27  ? 47.895  68.003  60.303  1.00 36.38 ? 2059 CYS C SG    1 
ATOM   9151  N N     . THR C  1 28  ? 44.179  65.236  62.670  1.00 29.06 ? 2060 THR C N     1 
ATOM   9152  C CA    . THR C  1 28  ? 42.996  65.166  63.509  1.00 29.09 ? 2060 THR C CA    1 
ATOM   9153  C C     . THR C  1 28  ? 43.276  64.466  64.832  1.00 30.70 ? 2060 THR C C     1 
ATOM   9154  O O     . THR C  1 28  ? 43.719  63.312  64.874  1.00 28.87 ? 2060 THR C O     1 
ATOM   9155  C CB    . THR C  1 28  ? 41.841  64.448  62.756  1.00 29.33 ? 2060 THR C CB    1 
ATOM   9156  O OG1   . THR C  1 28  ? 41.512  65.192  61.574  1.00 24.98 ? 2060 THR C OG1   1 
ATOM   9157  C CG2   . THR C  1 28  ? 40.599  64.337  63.633  1.00 23.39 ? 2060 THR C CG2   1 
ATOM   9158  N N     . ARG C  1 29  ? 43.005  65.179  65.917  1.00 33.48 ? 2061 ARG C N     1 
ATOM   9159  C CA    . ARG C  1 29  ? 43.228  64.639  67.254  1.00 37.99 ? 2061 ARG C CA    1 
ATOM   9160  C C     . ARG C  1 29  ? 44.703  64.310  67.420  1.00 38.98 ? 2061 ARG C C     1 
ATOM   9161  O O     . ARG C  1 29  ? 45.094  63.615  68.355  1.00 36.58 ? 2061 ARG C O     1 
ATOM   9162  C CB    . ARG C  1 29  ? 42.377  63.379  67.479  1.00 38.97 ? 2061 ARG C CB    1 
ATOM   9163  C CG    . ARG C  1 29  ? 41.054  63.666  68.189  1.00 40.55 ? 2061 ARG C CG    1 
ATOM   9164  C CD    . ARG C  1 29  ? 40.044  62.545  67.980  1.00 41.41 ? 2061 ARG C CD    1 
ATOM   9165  N NE    . ARG C  1 29  ? 39.321  62.669  66.717  1.00 40.65 ? 2061 ARG C NE    1 
ATOM   9166  C CZ    . ARG C  1 29  ? 39.013  61.637  65.944  1.00 43.43 ? 2061 ARG C CZ    1 
ATOM   9167  N NH1   . ARG C  1 29  ? 39.369  60.416  66.308  1.00 43.75 ? 2061 ARG C NH1   1 
ATOM   9168  N NH2   . ARG C  1 29  ? 38.350  61.822  64.815  1.00 45.56 ? 2061 ARG C NH2   1 
ATOM   9169  N N     . THR C  1 30  ? 45.510  64.824  66.496  1.00 39.64 ? 2062 THR C N     1 
ATOM   9170  C CA    . THR C  1 30  ? 46.947  64.607  66.504  1.00 42.19 ? 2062 THR C CA    1 
ATOM   9171  C C     . THR C  1 30  ? 47.613  65.495  67.551  1.00 43.07 ? 2062 THR C C     1 
ATOM   9172  O O     . THR C  1 30  ? 48.423  65.028  68.356  1.00 46.89 ? 2062 THR C O     1 
ATOM   9173  C CB    . THR C  1 30  ? 47.546  64.921  65.125  1.00 42.22 ? 2062 THR C CB    1 
ATOM   9174  O OG1   . THR C  1 30  ? 47.170  66.243  64.722  1.00 45.66 ? 2062 THR C OG1   1 
ATOM   9175  C CG2   . THR C  1 30  ? 47.028  63.944  64.102  1.00 47.48 ? 2062 THR C CG2   1 
ATOM   9176  N N     . GLY C  1 31  ? 47.259  66.777  67.542  1.00 44.53 ? 2063 GLY C N     1 
ATOM   9177  C CA    . GLY C  1 31  ? 47.838  67.714  68.488  1.00 42.94 ? 2063 GLY C CA    1 
ATOM   9178  C C     . GLY C  1 31  ? 48.693  68.722  67.751  1.00 42.87 ? 2063 GLY C C     1 
ATOM   9179  O O     . GLY C  1 31  ? 49.383  69.541  68.360  1.00 44.85 ? 2063 GLY C O     1 
ATOM   9180  N N     . PHE C  1 32  ? 48.647  68.666  66.426  1.00 41.36 ? 2064 PHE C N     1 
ATOM   9181  C CA    . PHE C  1 32  ? 49.440  69.573  65.613  1.00 43.23 ? 2064 PHE C CA    1 
ATOM   9182  C C     . PHE C  1 32  ? 48.680  69.994  64.376  1.00 44.45 ? 2064 PHE C C     1 
ATOM   9183  O O     . PHE C  1 32  ? 47.959  69.185  63.786  1.00 46.64 ? 2064 PHE C O     1 
ATOM   9184  C CB    . PHE C  1 32  ? 50.741  68.903  65.152  1.00 41.81 ? 2064 PHE C CB    1 
ATOM   9185  C CG    . PHE C  1 32  ? 51.465  68.166  66.232  1.00 39.97 ? 2064 PHE C CG    1 
ATOM   9186  C CD1   . PHE C  1 32  ? 51.036  66.912  66.646  1.00 40.66 ? 2064 PHE C CD1   1 
ATOM   9187  C CD2   . PHE C  1 32  ? 52.560  68.731  66.855  1.00 36.93 ? 2064 PHE C CD2   1 
ATOM   9188  C CE1   . PHE C  1 32  ? 51.687  66.239  67.667  1.00 38.66 ? 2064 PHE C CE1   1 
ATOM   9189  C CE2   . PHE C  1 32  ? 53.213  68.063  67.875  1.00 37.52 ? 2064 PHE C CE2   1 
ATOM   9190  C CZ    . PHE C  1 32  ? 52.774  66.817  68.281  1.00 36.55 ? 2064 PHE C CZ    1 
ATOM   9191  N N     . TYR C  1 33  ? 48.829  71.258  63.987  1.00 42.30 ? 2065 TYR C N     1 
ATOM   9192  C CA    . TYR C  1 33  ? 48.195  71.726  62.768  1.00 41.59 ? 2065 TYR C CA    1 
ATOM   9193  C C     . TYR C  1 33  ? 49.306  71.844  61.733  1.00 39.57 ? 2065 TYR C C     1 
ATOM   9194  O O     . TYR C  1 33  ? 50.218  71.021  61.710  1.00 41.71 ? 2065 TYR C O     1 
ATOM   9195  C CB    . TYR C  1 33  ? 47.486  73.075  62.958  1.00 40.45 ? 2065 TYR C CB    1 
ATOM   9196  C CG    . TYR C  1 33  ? 47.986  73.958  64.073  1.00 38.38 ? 2065 TYR C CG    1 
ATOM   9197  C CD1   . TYR C  1 33  ? 48.457  75.250  63.802  1.00 38.18 ? 2065 TYR C CD1   1 
ATOM   9198  C CD2   . TYR C  1 33  ? 47.918  73.545  65.402  1.00 36.47 ? 2065 TYR C CD2   1 
ATOM   9199  C CE1   . TYR C  1 33  ? 48.840  76.107  64.830  1.00 34.49 ? 2065 TYR C CE1   1 
ATOM   9200  C CE2   . TYR C  1 33  ? 48.298  74.393  66.436  1.00 35.94 ? 2065 TYR C CE2   1 
ATOM   9201  C CZ    . TYR C  1 33  ? 48.756  75.670  66.145  1.00 36.30 ? 2065 TYR C CZ    1 
ATOM   9202  O OH    . TYR C  1 33  ? 49.119  76.505  67.173  1.00 34.60 ? 2065 TYR C OH    1 
ATOM   9203  N N     . GLY C  1 34  ? 49.248  72.860  60.885  1.00 38.28 ? 2066 GLY C N     1 
ATOM   9204  C CA    . GLY C  1 34  ? 50.282  73.007  59.882  1.00 38.39 ? 2066 GLY C CA    1 
ATOM   9205  C C     . GLY C  1 34  ? 50.116  71.970  58.791  1.00 38.38 ? 2066 GLY C C     1 
ATOM   9206  O O     . GLY C  1 34  ? 49.649  70.859  59.035  1.00 39.03 ? 2066 GLY C O     1 
ATOM   9207  N N     . GLU C  1 35  ? 50.496  72.343  57.579  1.00 38.60 ? 2067 GLU C N     1 
ATOM   9208  C CA    . GLU C  1 35  ? 50.387  71.467  56.432  1.00 38.09 ? 2067 GLU C CA    1 
ATOM   9209  C C     . GLU C  1 35  ? 50.944  70.072  56.694  1.00 40.63 ? 2067 GLU C C     1 
ATOM   9210  O O     . GLU C  1 35  ? 50.489  69.099  56.092  1.00 45.14 ? 2067 GLU C O     1 
ATOM   9211  C CB    . GLU C  1 35  ? 51.101  72.119  55.243  1.00 38.67 ? 2067 GLU C CB    1 
ATOM   9212  C CG    . GLU C  1 35  ? 51.669  71.171  54.207  1.00 39.87 ? 2067 GLU C CG    1 
ATOM   9213  C CD    . GLU C  1 35  ? 52.339  71.916  53.070  1.00 44.14 ? 2067 GLU C CD    1 
ATOM   9214  O OE1   . GLU C  1 35  ? 52.476  73.153  53.180  1.00 44.92 ? 2067 GLU C OE1   1 
ATOM   9215  O OE2   . GLU C  1 35  ? 52.727  71.273  52.070  1.00 42.19 ? 2067 GLU C OE2   1 
ATOM   9216  N N     . ASN C  1 36  ? 51.909  69.957  57.600  1.00 41.45 ? 2068 ASN C N     1 
ATOM   9217  C CA    . ASN C  1 36  ? 52.509  68.657  57.868  1.00 43.70 ? 2068 ASN C CA    1 
ATOM   9218  C C     . ASN C  1 36  ? 52.209  68.059  59.233  1.00 43.11 ? 2068 ASN C C     1 
ATOM   9219  O O     . ASN C  1 36  ? 52.798  67.042  59.607  1.00 42.41 ? 2068 ASN C O     1 
ATOM   9220  C CB    . ASN C  1 36  ? 54.020  68.742  57.681  1.00 46.99 ? 2068 ASN C CB    1 
ATOM   9221  C CG    . ASN C  1 36  ? 54.418  68.991  56.235  1.00 51.31 ? 2068 ASN C CG    1 
ATOM   9222  O OD1   . ASN C  1 36  ? 53.954  68.296  55.320  1.00 44.96 ? 2068 ASN C OD1   1 
ATOM   9223  N ND2   . ASN C  1 36  ? 55.284  69.988  56.042  1.00 53.62 ? 2068 ASN C ND2   1 
ATOM   9224  N N     . CYS C  1 37  ? 51.300  68.690  59.974  1.00 42.68 ? 2069 CYS C N     1 
ATOM   9225  C CA    . CYS C  1 37  ? 50.901  68.212  61.305  1.00 41.16 ? 2069 CYS C CA    1 
ATOM   9226  C C     . CYS C  1 37  ? 52.057  68.387  62.264  1.00 41.21 ? 2069 CYS C C     1 
ATOM   9227  O O     . CYS C  1 37  ? 52.320  67.543  63.121  1.00 41.41 ? 2069 CYS C O     1 
ATOM   9228  C CB    . CYS C  1 37  ? 50.478  66.733  61.241  1.00 39.17 ? 2069 CYS C CB    1 
ATOM   9229  S SG    . CYS C  1 37  ? 49.132  66.404  60.044  1.00 39.50 ? 2069 CYS C SG    1 
ATOM   9230  N N     . THR C  1 38  ? 52.726  69.519  62.107  1.00 41.50 ? 2070 THR C N     1 
ATOM   9231  C CA    . THR C  1 38  ? 53.891  69.866  62.899  1.00 43.74 ? 2070 THR C CA    1 
ATOM   9232  C C     . THR C  1 38  ? 53.592  70.881  64.000  1.00 39.40 ? 2070 THR C C     1 
ATOM   9233  O O     . THR C  1 38  ? 53.816  70.607  65.178  1.00 36.66 ? 2070 THR C O     1 
ATOM   9234  C CB    . THR C  1 38  ? 54.968  70.417  61.981  1.00 43.83 ? 2070 THR C CB    1 
ATOM   9235  O OG1   . THR C  1 38  ? 54.338  71.062  60.865  1.00 44.64 ? 2070 THR C OG1   1 
ATOM   9236  C CG2   . THR C  1 38  ? 55.847  69.286  61.463  1.00 44.40 ? 2070 THR C CG2   1 
ATOM   9237  N N     . THR C  1 39  ? 53.101  72.057  63.622  1.00 39.04 ? 2071 THR C N     1 
ATOM   9238  C CA    . THR C  1 39  ? 52.762  73.072  64.618  1.00 40.48 ? 2071 THR C CA    1 
ATOM   9239  C C     . THR C  1 39  ? 51.879  72.417  65.676  1.00 41.59 ? 2071 THR C C     1 
ATOM   9240  O O     . THR C  1 39  ? 50.794  71.925  65.372  1.00 42.44 ? 2071 THR C O     1 
ATOM   9241  C CB    . THR C  1 39  ? 51.979  74.250  64.012  1.00 36.85 ? 2071 THR C CB    1 
ATOM   9242  O OG1   . THR C  1 39  ? 52.491  74.548  62.710  1.00 37.27 ? 2071 THR C OG1   1 
ATOM   9243  C CG2   . THR C  1 39  ? 52.109  75.479  64.895  1.00 38.75 ? 2071 THR C CG2   1 
ATOM   9244  N N     . PRO C  1 40  ? 52.334  72.404  66.935  1.00 40.89 ? 2072 PRO C N     1 
ATOM   9245  C CA    . PRO C  1 40  ? 51.546  71.791  68.002  1.00 42.80 ? 2072 PRO C CA    1 
ATOM   9246  C C     . PRO C  1 40  ? 50.584  72.770  68.656  1.00 45.01 ? 2072 PRO C C     1 
ATOM   9247  O O     . PRO C  1 40  ? 50.641  73.977  68.429  1.00 43.50 ? 2072 PRO C O     1 
ATOM   9248  C CB    . PRO C  1 40  ? 52.607  71.320  68.977  1.00 41.25 ? 2072 PRO C CB    1 
ATOM   9249  C CG    . PRO C  1 40  ? 53.694  72.357  68.840  1.00 39.91 ? 2072 PRO C CG    1 
ATOM   9250  C CD    . PRO C  1 40  ? 53.597  72.958  67.451  1.00 38.76 ? 2072 PRO C CD    1 
ATOM   9251  N N     . GLU C  1 41  ? 49.691  72.234  69.471  1.00 47.61 ? 2073 GLU C N     1 
ATOM   9252  C CA    . GLU C  1 41  ? 48.739  73.062  70.180  1.00 52.56 ? 2073 GLU C CA    1 
ATOM   9253  C C     . GLU C  1 41  ? 49.330  73.197  71.561  1.00 51.24 ? 2073 GLU C C     1 
ATOM   9254  O O     . GLU C  1 41  ? 50.301  72.524  71.876  1.00 52.29 ? 2073 GLU C O     1 
ATOM   9255  C CB    . GLU C  1 41  ? 47.372  72.379  70.230  1.00 55.64 ? 2073 GLU C CB    1 
ATOM   9256  C CG    . GLU C  1 41  ? 46.714  72.262  68.856  1.00 64.01 ? 2073 GLU C CG    1 
ATOM   9257  C CD    . GLU C  1 41  ? 45.474  71.386  68.854  1.00 67.67 ? 2073 GLU C CD    1 
ATOM   9258  O OE1   . GLU C  1 41  ? 44.581  71.626  68.009  1.00 68.09 ? 2073 GLU C OE1   1 
ATOM   9259  O OE2   . GLU C  1 41  ? 45.393  70.461  69.691  1.00 68.86 ? 2073 GLU C OE2   1 
ATOM   9260  N N     . PHE C  1 42  ? 48.758  74.058  72.387  1.00 50.89 ? 2074 PHE C N     1 
ATOM   9261  C CA    . PHE C  1 42  ? 49.296  74.248  73.722  1.00 48.94 ? 2074 PHE C CA    1 
ATOM   9262  C C     . PHE C  1 42  ? 49.394  72.975  74.561  1.00 47.94 ? 2074 PHE C C     1 
ATOM   9263  O O     . PHE C  1 42  ? 50.499  72.497  74.832  1.00 48.18 ? 2074 PHE C O     1 
ATOM   9264  C CB    . PHE C  1 42  ? 48.487  75.300  74.476  1.00 49.93 ? 2074 PHE C CB    1 
ATOM   9265  C CG    . PHE C  1 42  ? 49.297  76.076  75.476  1.00 50.83 ? 2074 PHE C CG    1 
ATOM   9266  C CD1   . PHE C  1 42  ? 50.343  76.892  75.058  1.00 51.83 ? 2074 PHE C CD1   1 
ATOM   9267  C CD2   . PHE C  1 42  ? 49.027  75.978  76.839  1.00 51.55 ? 2074 PHE C CD2   1 
ATOM   9268  C CE1   . PHE C  1 42  ? 51.108  77.598  75.981  1.00 52.72 ? 2074 PHE C CE1   1 
ATOM   9269  C CE2   . PHE C  1 42  ? 49.789  76.682  77.774  1.00 53.47 ? 2074 PHE C CE2   1 
ATOM   9270  C CZ    . PHE C  1 42  ? 50.831  77.493  77.343  1.00 52.84 ? 2074 PHE C CZ    1 
ATOM   9271  N N     . LEU C  1 43  ? 48.255  72.424  74.980  1.00 46.14 ? 2075 LEU C N     1 
ATOM   9272  C CA    . LEU C  1 43  ? 48.287  71.217  75.801  1.00 47.57 ? 2075 LEU C CA    1 
ATOM   9273  C C     . LEU C  1 43  ? 49.276  70.226  75.227  1.00 45.53 ? 2075 LEU C C     1 
ATOM   9274  O O     . LEU C  1 43  ? 49.900  69.467  75.968  1.00 45.11 ? 2075 LEU C O     1 
ATOM   9275  C CB    . LEU C  1 43  ? 46.913  70.552  75.902  1.00 50.30 ? 2075 LEU C CB    1 
ATOM   9276  C CG    . LEU C  1 43  ? 46.908  69.201  76.641  1.00 52.23 ? 2075 LEU C CG    1 
ATOM   9277  C CD1   . LEU C  1 43  ? 47.683  69.310  77.954  1.00 55.99 ? 2075 LEU C CD1   1 
ATOM   9278  C CD2   . LEU C  1 43  ? 45.483  68.768  76.909  1.00 52.79 ? 2075 LEU C CD2   1 
ATOM   9279  N N     . THR C  1 44  ? 49.415  70.233  73.905  1.00 42.93 ? 2076 THR C N     1 
ATOM   9280  C CA    . THR C  1 44  ? 50.364  69.343  73.243  1.00 43.27 ? 2076 THR C CA    1 
ATOM   9281  C C     . THR C  1 44  ? 51.741  69.601  73.846  1.00 44.47 ? 2076 THR C C     1 
ATOM   9282  O O     . THR C  1 44  ? 52.409  68.684  74.337  1.00 42.13 ? 2076 THR C O     1 
ATOM   9283  C CB    . THR C  1 44  ? 50.453  69.638  71.739  1.00 42.73 ? 2076 THR C CB    1 
ATOM   9284  O OG1   . THR C  1 44  ? 49.145  69.917  71.224  1.00 40.39 ? 2076 THR C OG1   1 
ATOM   9285  C CG2   . THR C  1 44  ? 51.073  68.457  71.001  1.00 39.73 ? 2076 THR C CG2   1 
ATOM   9286  N N     . ARG C  1 45  ? 52.144  70.869  73.805  1.00 45.77 ? 2077 ARG C N     1 
ATOM   9287  C CA    . ARG C  1 45  ? 53.429  71.304  74.332  1.00 48.91 ? 2077 ARG C CA    1 
ATOM   9288  C C     . ARG C  1 45  ? 53.596  70.833  75.755  1.00 45.88 ? 2077 ARG C C     1 
ATOM   9289  O O     . ARG C  1 45  ? 54.483  70.034  76.047  1.00 44.63 ? 2077 ARG C O     1 
ATOM   9290  C CB    . ARG C  1 45  ? 53.537  72.829  74.298  1.00 54.32 ? 2077 ARG C CB    1 
ATOM   9291  C CG    . ARG C  1 45  ? 52.686  73.486  73.228  1.00 65.31 ? 2077 ARG C CG    1 
ATOM   9292  C CD    . ARG C  1 45  ? 53.481  74.504  72.442  1.00 72.30 ? 2077 ARG C CD    1 
ATOM   9293  N NE    . ARG C  1 45  ? 53.017  74.611  71.062  1.00 83.46 ? 2077 ARG C NE    1 
ATOM   9294  C CZ    . ARG C  1 45  ? 53.044  75.736  70.354  1.00 88.37 ? 2077 ARG C CZ    1 
ATOM   9295  N NH1   . ARG C  1 45  ? 53.513  76.853  70.897  1.00 88.57 ? 2077 ARG C NH1   1 
ATOM   9296  N NH2   . ARG C  1 45  ? 52.610  75.746  69.099  1.00 90.21 ? 2077 ARG C NH2   1 
ATOM   9297  N N     . ILE C  1 46  ? 52.733  71.333  76.635  1.00 44.41 ? 2078 ILE C N     1 
ATOM   9298  C CA    . ILE C  1 46  ? 52.775  70.968  78.051  1.00 45.34 ? 2078 ILE C CA    1 
ATOM   9299  C C     . ILE C  1 46  ? 52.789  69.451  78.227  1.00 47.20 ? 2078 ILE C C     1 
ATOM   9300  O O     . ILE C  1 46  ? 53.338  68.930  79.198  1.00 44.93 ? 2078 ILE C O     1 
ATOM   9301  C CB    . ILE C  1 46  ? 51.558  71.533  78.819  1.00 44.53 ? 2078 ILE C CB    1 
ATOM   9302  C CG1   . ILE C  1 46  ? 50.879  72.629  77.996  1.00 42.44 ? 2078 ILE C CG1   1 
ATOM   9303  C CG2   . ILE C  1 46  ? 52.002  72.062  80.187  1.00 45.58 ? 2078 ILE C CG2   1 
ATOM   9304  C CD1   . ILE C  1 46  ? 51.749  73.836  77.750  1.00 35.17 ? 2078 ILE C CD1   1 
ATOM   9305  N N     . LYS C  1 47  ? 52.175  68.747  77.280  1.00 48.66 ? 2079 LYS C N     1 
ATOM   9306  C CA    . LYS C  1 47  ? 52.127  67.290  77.317  1.00 52.57 ? 2079 LYS C CA    1 
ATOM   9307  C C     . LYS C  1 47  ? 53.514  66.727  77.030  1.00 51.25 ? 2079 LYS C C     1 
ATOM   9308  O O     . LYS C  1 47  ? 53.944  65.754  77.650  1.00 52.31 ? 2079 LYS C O     1 
ATOM   9309  C CB    . LYS C  1 47  ? 51.127  66.761  76.281  1.00 54.95 ? 2079 LYS C CB    1 
ATOM   9310  C CG    . LYS C  1 47  ? 49.718  66.565  76.836  1.00 60.90 ? 2079 LYS C CG    1 
ATOM   9311  C CD    . LYS C  1 47  ? 48.824  65.751  75.900  1.00 64.91 ? 2079 LYS C CD    1 
ATOM   9312  C CE    . LYS C  1 47  ? 47.443  65.539  76.523  1.00 68.93 ? 2079 LYS C CE    1 
ATOM   9313  N NZ    . LYS C  1 47  ? 46.428  65.040  75.557  1.00 70.23 ? 2079 LYS C NZ    1 
ATOM   9314  N N     . LEU C  1 48  ? 54.212  67.351  76.090  1.00 51.26 ? 2080 LEU C N     1 
ATOM   9315  C CA    . LEU C  1 48  ? 55.553  66.915  75.722  1.00 51.67 ? 2080 LEU C CA    1 
ATOM   9316  C C     . LEU C  1 48  ? 56.600  67.364  76.741  1.00 52.29 ? 2080 LEU C C     1 
ATOM   9317  O O     . LEU C  1 48  ? 57.556  66.640  77.033  1.00 51.72 ? 2080 LEU C O     1 
ATOM   9318  C CB    . LEU C  1 48  ? 55.898  67.453  74.337  1.00 48.83 ? 2080 LEU C CB    1 
ATOM   9319  C CG    . LEU C  1 48  ? 54.752  67.234  73.350  1.00 49.98 ? 2080 LEU C CG    1 
ATOM   9320  C CD1   . LEU C  1 48  ? 55.110  67.825  71.993  1.00 48.72 ? 2080 LEU C CD1   1 
ATOM   9321  C CD2   . LEU C  1 48  ? 54.460  65.743  73.240  1.00 49.12 ? 2080 LEU C CD2   1 
ATOM   9322  N N     . LEU C  1 49  ? 56.407  68.556  77.289  1.00 52.06 ? 2081 LEU C N     1 
ATOM   9323  C CA    . LEU C  1 49  ? 57.323  69.095  78.281  1.00 52.48 ? 2081 LEU C CA    1 
ATOM   9324  C C     . LEU C  1 49  ? 56.977  68.485  79.624  1.00 47.97 ? 2081 LEU C C     1 
ATOM   9325  O O     . LEU C  1 49  ? 57.032  69.138  80.660  1.00 47.20 ? 2081 LEU C O     1 
ATOM   9326  C CB    . LEU C  1 49  ? 57.200  70.621  78.334  1.00 55.63 ? 2081 LEU C CB    1 
ATOM   9327  C CG    . LEU C  1 49  ? 57.093  71.317  76.967  1.00 58.86 ? 2081 LEU C CG    1 
ATOM   9328  C CD1   . LEU C  1 49  ? 57.313  72.812  77.142  1.00 59.41 ? 2081 LEU C CD1   1 
ATOM   9329  C CD2   . LEU C  1 49  ? 58.115  70.735  75.990  1.00 59.03 ? 2081 LEU C CD2   1 
ATOM   9330  N N     . LEU C  1 50  ? 56.600  67.216  79.570  1.00 48.02 ? 2082 LEU C N     1 
ATOM   9331  C CA    . LEU C  1 50  ? 56.240  66.432  80.739  1.00 49.05 ? 2082 LEU C CA    1 
ATOM   9332  C C     . LEU C  1 50  ? 56.298  64.971  80.295  1.00 47.94 ? 2082 LEU C C     1 
ATOM   9333  O O     . LEU C  1 50  ? 55.829  64.076  80.989  1.00 46.15 ? 2082 LEU C O     1 
ATOM   9334  C CB    . LEU C  1 50  ? 54.826  66.786  81.209  1.00 49.17 ? 2082 LEU C CB    1 
ATOM   9335  C CG    . LEU C  1 50  ? 54.669  68.115  81.954  1.00 50.44 ? 2082 LEU C CG    1 
ATOM   9336  C CD1   . LEU C  1 50  ? 53.200  68.502  82.038  1.00 47.58 ? 2082 LEU C CD1   1 
ATOM   9337  C CD2   . LEU C  1 50  ? 55.264  67.989  83.341  1.00 51.02 ? 2082 LEU C CD2   1 
ATOM   9338  N N     . LYS C  1 51  ? 56.878  64.755  79.116  1.00 49.12 ? 2083 LYS C N     1 
ATOM   9339  C CA    . LYS C  1 51  ? 57.019  63.423  78.544  1.00 49.15 ? 2083 LYS C CA    1 
ATOM   9340  C C     . LYS C  1 51  ? 58.474  62.963  78.634  1.00 46.97 ? 2083 LYS C C     1 
ATOM   9341  O O     . LYS C  1 51  ? 59.319  63.353  77.818  1.00 49.18 ? 2083 LYS C O     1 
ATOM   9342  C CB    . LYS C  1 51  ? 56.569  63.421  77.079  1.00 53.75 ? 2083 LYS C CB    1 
ATOM   9343  C CG    . LYS C  1 51  ? 56.484  62.022  76.463  1.00 57.25 ? 2083 LYS C CG    1 
ATOM   9344  C CD    . LYS C  1 51  ? 56.922  62.016  74.998  1.00 62.29 ? 2083 LYS C CD    1 
ATOM   9345  C CE    . LYS C  1 51  ? 57.473  60.649  74.572  1.00 64.06 ? 2083 LYS C CE    1 
ATOM   9346  N NZ    . LYS C  1 51  ? 57.906  60.616  73.137  1.00 63.96 ? 2083 LYS C NZ    1 
ATOM   9347  N N     . PRO C  1 52  ? 58.782  62.117  79.628  1.00 44.14 ? 2084 PRO C N     1 
ATOM   9348  C CA    . PRO C  1 52  ? 60.126  61.578  79.870  1.00 44.13 ? 2084 PRO C CA    1 
ATOM   9349  C C     . PRO C  1 52  ? 60.558  60.540  78.842  1.00 40.76 ? 2084 PRO C C     1 
ATOM   9350  O O     . PRO C  1 52  ? 59.792  59.635  78.512  1.00 39.72 ? 2084 PRO C O     1 
ATOM   9351  C CB    . PRO C  1 52  ? 60.007  60.969  81.258  1.00 42.91 ? 2084 PRO C CB    1 
ATOM   9352  C CG    . PRO C  1 52  ? 58.583  60.550  81.342  1.00 42.64 ? 2084 PRO C CG    1 
ATOM   9353  C CD    . PRO C  1 52  ? 57.808  61.608  80.607  1.00 42.81 ? 2084 PRO C CD    1 
ATOM   9354  N N     . THR C  1 53  ? 61.789  60.660  78.351  1.00 36.92 ? 2085 THR C N     1 
ATOM   9355  C CA    . THR C  1 53  ? 62.299  59.708  77.360  1.00 37.39 ? 2085 THR C CA    1 
ATOM   9356  C C     . THR C  1 53  ? 62.201  58.255  77.855  1.00 32.53 ? 2085 THR C C     1 
ATOM   9357  O O     . THR C  1 53  ? 62.431  57.958  79.034  1.00 31.61 ? 2085 THR C O     1 
ATOM   9358  C CB    . THR C  1 53  ? 63.770  60.003  76.982  1.00 34.39 ? 2085 THR C CB    1 
ATOM   9359  O OG1   . THR C  1 53  ? 64.628  59.022  77.585  1.00 35.77 ? 2085 THR C OG1   1 
ATOM   9360  C CG2   . THR C  1 53  ? 64.169  61.394  77.442  1.00 35.39 ? 2085 THR C CG2   1 
ATOM   9361  N N     . PRO C  1 54  ? 61.870  57.328  76.945  1.00 29.93 ? 2086 PRO C N     1 
ATOM   9362  C CA    . PRO C  1 54  ? 61.737  55.909  77.294  1.00 31.87 ? 2086 PRO C CA    1 
ATOM   9363  C C     . PRO C  1 54  ? 62.972  55.390  78.017  1.00 31.84 ? 2086 PRO C C     1 
ATOM   9364  O O     . PRO C  1 54  ? 62.873  54.590  78.954  1.00 28.42 ? 2086 PRO C O     1 
ATOM   9365  C CB    . PRO C  1 54  ? 61.527  55.222  75.939  1.00 31.18 ? 2086 PRO C CB    1 
ATOM   9366  C CG    . PRO C  1 54  ? 61.960  56.239  74.904  1.00 30.86 ? 2086 PRO C CG    1 
ATOM   9367  C CD    . PRO C  1 54  ? 61.630  57.564  75.512  1.00 30.79 ? 2086 PRO C CD    1 
ATOM   9368  N N     . ASN C  1 55  ? 64.131  55.860  77.559  1.00 32.33 ? 2087 ASN C N     1 
ATOM   9369  C CA    . ASN C  1 55  ? 65.412  55.473  78.123  1.00 33.15 ? 2087 ASN C CA    1 
ATOM   9370  C C     . ASN C  1 55  ? 65.444  55.923  79.560  1.00 35.86 ? 2087 ASN C C     1 
ATOM   9371  O O     . ASN C  1 55  ? 65.842  55.162  80.447  1.00 36.73 ? 2087 ASN C O     1 
ATOM   9372  C CB    . ASN C  1 55  ? 66.540  56.124  77.340  1.00 34.70 ? 2087 ASN C CB    1 
ATOM   9373  C CG    . ASN C  1 55  ? 66.635  55.596  75.918  1.00 41.24 ? 2087 ASN C CG    1 
ATOM   9374  O OD1   . ASN C  1 55  ? 66.027  54.578  75.579  1.00 40.76 ? 2087 ASN C OD1   1 
ATOM   9375  N ND2   . ASN C  1 55  ? 67.397  56.287  75.080  1.00 45.00 ? 2087 ASN C ND2   1 
ATOM   9376  N N     . THR C  1 56  ? 65.015  57.163  79.786  1.00 34.04 ? 2088 THR C N     1 
ATOM   9377  C CA    . THR C  1 56  ? 64.957  57.717  81.132  1.00 34.78 ? 2088 THR C CA    1 
ATOM   9378  C C     . THR C  1 56  ? 64.171  56.727  81.983  1.00 36.27 ? 2088 THR C C     1 
ATOM   9379  O O     . THR C  1 56  ? 64.691  56.128  82.933  1.00 36.72 ? 2088 THR C O     1 
ATOM   9380  C CB    . THR C  1 56  ? 64.197  59.056  81.161  1.00 35.37 ? 2088 THR C CB    1 
ATOM   9381  O OG1   . THR C  1 56  ? 64.856  60.007  80.315  1.00 38.75 ? 2088 THR C OG1   1 
ATOM   9382  C CG2   . THR C  1 56  ? 64.129  59.590  82.582  1.00 36.20 ? 2088 THR C CG2   1 
ATOM   9383  N N     . VAL C  1 57  ? 62.908  56.555  81.614  1.00 35.91 ? 2089 VAL C N     1 
ATOM   9384  C CA    . VAL C  1 57  ? 62.015  55.650  82.325  1.00 33.25 ? 2089 VAL C CA    1 
ATOM   9385  C C     . VAL C  1 57  ? 62.651  54.285  82.514  1.00 33.50 ? 2089 VAL C C     1 
ATOM   9386  O O     . VAL C  1 57  ? 62.854  53.821  83.643  1.00 31.77 ? 2089 VAL C O     1 
ATOM   9387  C CB    . VAL C  1 57  ? 60.695  55.479  81.568  1.00 31.08 ? 2089 VAL C CB    1 
ATOM   9388  C CG1   . VAL C  1 57  ? 59.568  55.325  82.552  1.00 29.55 ? 2089 VAL C CG1   1 
ATOM   9389  C CG2   . VAL C  1 57  ? 60.454  56.685  80.673  1.00 28.03 ? 2089 VAL C CG2   1 
ATOM   9390  N N     . HIS C  1 58  ? 62.958  53.652  81.391  1.00 33.45 ? 2090 HIS C N     1 
ATOM   9391  C CA    . HIS C  1 58  ? 63.574  52.343  81.408  1.00 35.91 ? 2090 HIS C CA    1 
ATOM   9392  C C     . HIS C  1 58  ? 64.582  52.340  82.535  1.00 34.60 ? 2090 HIS C C     1 
ATOM   9393  O O     . HIS C  1 58  ? 64.633  51.424  83.358  1.00 31.09 ? 2090 HIS C O     1 
ATOM   9394  C CB    . HIS C  1 58  ? 64.286  52.072  80.082  1.00 36.18 ? 2090 HIS C CB    1 
ATOM   9395  C CG    . HIS C  1 58  ? 64.943  50.728  80.026  1.00 40.23 ? 2090 HIS C CG    1 
ATOM   9396  N ND1   . HIS C  1 58  ? 65.058  49.910  81.130  1.00 40.66 ? 2090 HIS C ND1   1 
ATOM   9397  C CD2   . HIS C  1 58  ? 65.509  50.054  79.000  1.00 40.77 ? 2090 HIS C CD2   1 
ATOM   9398  C CE1   . HIS C  1 58  ? 65.666  48.790  80.787  1.00 41.00 ? 2090 HIS C CE1   1 
ATOM   9399  N NE2   . HIS C  1 58  ? 65.951  48.852  79.500  1.00 42.20 ? 2090 HIS C NE2   1 
ATOM   9400  N N     . TYR C  1 59  ? 65.381  53.394  82.562  1.00 34.30 ? 2091 TYR C N     1 
ATOM   9401  C CA    . TYR C  1 59  ? 66.393  53.536  83.578  1.00 34.34 ? 2091 TYR C CA    1 
ATOM   9402  C C     . TYR C  1 59  ? 65.715  53.415  84.940  1.00 29.86 ? 2091 TYR C C     1 
ATOM   9403  O O     . TYR C  1 59  ? 65.913  52.444  85.665  1.00 26.22 ? 2091 TYR C O     1 
ATOM   9404  C CB    . TYR C  1 59  ? 67.080  54.900  83.428  1.00 42.42 ? 2091 TYR C CB    1 
ATOM   9405  C CG    . TYR C  1 59  ? 68.011  55.228  84.566  1.00 53.24 ? 2091 TYR C CG    1 
ATOM   9406  C CD1   . TYR C  1 59  ? 69.387  55.055  84.437  1.00 56.35 ? 2091 TYR C CD1   1 
ATOM   9407  C CD2   . TYR C  1 59  ? 67.510  55.640  85.802  1.00 56.65 ? 2091 TYR C CD2   1 
ATOM   9408  C CE1   . TYR C  1 59  ? 70.236  55.273  85.513  1.00 59.72 ? 2091 TYR C CE1   1 
ATOM   9409  C CE2   . TYR C  1 59  ? 68.348  55.859  86.881  1.00 60.58 ? 2091 TYR C CE2   1 
ATOM   9410  C CZ    . TYR C  1 59  ? 69.707  55.670  86.735  1.00 62.50 ? 2091 TYR C CZ    1 
ATOM   9411  O OH    . TYR C  1 59  ? 70.525  55.854  87.824  1.00 62.09 ? 2091 TYR C OH    1 
ATOM   9412  N N     . ILE C  1 60  ? 64.898  54.404  85.270  1.00 25.59 ? 2092 ILE C N     1 
ATOM   9413  C CA    . ILE C  1 60  ? 64.210  54.411  86.551  1.00 24.31 ? 2092 ILE C CA    1 
ATOM   9414  C C     . ILE C  1 60  ? 63.562  53.080  86.876  1.00 24.54 ? 2092 ILE C C     1 
ATOM   9415  O O     . ILE C  1 60  ? 63.457  52.696  88.038  1.00 24.61 ? 2092 ILE C O     1 
ATOM   9416  C CB    . ILE C  1 60  ? 63.119  55.504  86.610  1.00 19.00 ? 2092 ILE C CB    1 
ATOM   9417  C CG1   . ILE C  1 60  ? 62.961  56.170  85.237  1.00 15.24 ? 2092 ILE C CG1   1 
ATOM   9418  C CG2   . ILE C  1 60  ? 63.453  56.496  87.718  1.00 15.84 ? 2092 ILE C CG2   1 
ATOM   9419  C CD1   . ILE C  1 60  ? 63.306  57.649  85.164  1.00 9.98  ? 2092 ILE C CD1   1 
ATOM   9420  N N     . LEU C  1 61  ? 63.133  52.377  85.842  1.00 25.61 ? 2093 LEU C N     1 
ATOM   9421  C CA    . LEU C  1 61  ? 62.482  51.088  86.017  1.00 28.41 ? 2093 LEU C CA    1 
ATOM   9422  C C     . LEU C  1 61  ? 63.457  50.022  86.483  1.00 29.25 ? 2093 LEU C C     1 
ATOM   9423  O O     . LEU C  1 61  ? 63.108  49.113  87.236  1.00 24.68 ? 2093 LEU C O     1 
ATOM   9424  C CB    . LEU C  1 61  ? 61.882  50.631  84.687  1.00 30.02 ? 2093 LEU C CB    1 
ATOM   9425  C CG    . LEU C  1 61  ? 60.387  50.804  84.463  1.00 33.60 ? 2093 LEU C CG    1 
ATOM   9426  C CD1   . LEU C  1 61  ? 59.639  50.929  85.803  1.00 30.38 ? 2093 LEU C CD1   1 
ATOM   9427  C CD2   . LEU C  1 61  ? 60.195  52.030  83.595  1.00 34.07 ? 2093 LEU C CD2   1 
ATOM   9428  N N     . THR C  1 62  ? 64.687  50.151  86.004  1.00 33.92 ? 2094 THR C N     1 
ATOM   9429  C CA    . THR C  1 62  ? 65.747  49.192  86.281  1.00 35.81 ? 2094 THR C CA    1 
ATOM   9430  C C     . THR C  1 62  ? 66.703  49.594  87.389  1.00 35.10 ? 2094 THR C C     1 
ATOM   9431  O O     . THR C  1 62  ? 67.716  48.937  87.604  1.00 31.60 ? 2094 THR C O     1 
ATOM   9432  C CB    . THR C  1 62  ? 66.560  48.947  85.006  1.00 36.56 ? 2094 THR C CB    1 
ATOM   9433  O OG1   . THR C  1 62  ? 66.687  50.185  84.292  1.00 34.45 ? 2094 THR C OG1   1 
ATOM   9434  C CG2   . THR C  1 62  ? 65.855  47.920  84.112  1.00 37.45 ? 2094 THR C CG2   1 
ATOM   9435  N N     . HIS C  1 63  ? 66.387  50.672  88.092  1.00 36.43 ? 2095 HIS C N     1 
ATOM   9436  C CA    . HIS C  1 63  ? 67.251  51.126  89.169  1.00 38.65 ? 2095 HIS C CA    1 
ATOM   9437  C C     . HIS C  1 63  ? 66.513  51.250  90.490  1.00 37.64 ? 2095 HIS C C     1 
ATOM   9438  O O     . HIS C  1 63  ? 65.504  50.594  90.690  1.00 36.87 ? 2095 HIS C O     1 
ATOM   9439  C CB    . HIS C  1 63  ? 67.896  52.455  88.782  1.00 44.32 ? 2095 HIS C CB    1 
ATOM   9440  C CG    . HIS C  1 63  ? 68.941  52.317  87.723  1.00 49.70 ? 2095 HIS C CG    1 
ATOM   9441  N ND1   . HIS C  1 63  ? 68.636  52.268  86.380  1.00 55.96 ? 2095 HIS C ND1   1 
ATOM   9442  C CD2   . HIS C  1 63  ? 70.281  52.158  87.809  1.00 50.42 ? 2095 HIS C CD2   1 
ATOM   9443  C CE1   . HIS C  1 63  ? 69.743  52.082  85.685  1.00 53.03 ? 2095 HIS C CE1   1 
ATOM   9444  N NE2   . HIS C  1 63  ? 70.755  52.013  86.529  1.00 51.53 ? 2095 HIS C NE2   1 
ATOM   9445  N N     . PHE C  1 64  ? 67.040  52.069  91.394  1.00 33.47 ? 2096 PHE C N     1 
ATOM   9446  C CA    . PHE C  1 64  ? 66.438  52.288  92.700  1.00 31.04 ? 2096 PHE C CA    1 
ATOM   9447  C C     . PHE C  1 64  ? 65.827  51.025  93.304  1.00 28.00 ? 2096 PHE C C     1 
ATOM   9448  O O     . PHE C  1 64  ? 64.930  51.103  94.143  1.00 28.23 ? 2096 PHE C O     1 
ATOM   9449  C CB    . PHE C  1 64  ? 65.381  53.377  92.594  1.00 31.40 ? 2096 PHE C CB    1 
ATOM   9450  C CG    . PHE C  1 64  ? 65.830  54.568  91.812  1.00 34.93 ? 2096 PHE C CG    1 
ATOM   9451  C CD1   . PHE C  1 64  ? 66.069  54.464  90.449  1.00 38.28 ? 2096 PHE C CD1   1 
ATOM   9452  C CD2   . PHE C  1 64  ? 66.021  55.801  92.435  1.00 36.75 ? 2096 PHE C CD2   1 
ATOM   9453  C CE1   . PHE C  1 64  ? 66.494  55.570  89.706  1.00 40.09 ? 2096 PHE C CE1   1 
ATOM   9454  C CE2   . PHE C  1 64  ? 66.444  56.917  91.704  1.00 37.66 ? 2096 PHE C CE2   1 
ATOM   9455  C CZ    . PHE C  1 64  ? 66.681  56.801  90.336  1.00 38.17 ? 2096 PHE C CZ    1 
ATOM   9456  N N     . LYS C  1 65  ? 66.329  49.870  92.875  1.00 26.28 ? 2097 LYS C N     1 
ATOM   9457  C CA    . LYS C  1 65  ? 65.854  48.570  93.344  1.00 23.27 ? 2097 LYS C CA    1 
ATOM   9458  C C     . LYS C  1 65  ? 65.285  48.605  94.764  1.00 24.95 ? 2097 LYS C C     1 
ATOM   9459  O O     . LYS C  1 65  ? 64.261  47.968  95.064  1.00 24.09 ? 2097 LYS C O     1 
ATOM   9460  C CB    . LYS C  1 65  ? 66.994  47.542  93.265  1.00 21.62 ? 2097 LYS C CB    1 
ATOM   9461  C CG    . LYS C  1 65  ? 66.701  46.209  93.938  1.00 19.80 ? 2097 LYS C CG    1 
ATOM   9462  C CD    . LYS C  1 65  ? 67.681  45.133  93.490  1.00 21.65 ? 2097 LYS C CD    1 
ATOM   9463  C CE    . LYS C  1 65  ? 67.441  43.817  94.222  1.00 20.33 ? 2097 LYS C CE    1 
ATOM   9464  N NZ    . LYS C  1 65  ? 68.700  43.216  94.757  1.00 21.82 ? 2097 LYS C NZ    1 
ATOM   9465  N N     . GLY C  1 66  ? 65.949  49.343  95.644  1.00 24.10 ? 2098 GLY C N     1 
ATOM   9466  C CA    . GLY C  1 66  ? 65.463  49.415  97.005  1.00 28.64 ? 2098 GLY C CA    1 
ATOM   9467  C C     . GLY C  1 66  ? 64.023  49.893  97.007  1.00 31.73 ? 2098 GLY C C     1 
ATOM   9468  O O     . GLY C  1 66  ? 63.122  49.219  97.514  1.00 30.20 ? 2098 GLY C O     1 
ATOM   9469  N N     . VAL C  1 67  ? 63.816  51.070  96.424  1.00 34.54 ? 2099 VAL C N     1 
ATOM   9470  C CA    . VAL C  1 67  ? 62.500  51.680  96.336  1.00 32.88 ? 2099 VAL C CA    1 
ATOM   9471  C C     . VAL C  1 67  ? 61.526  50.724  95.667  1.00 33.94 ? 2099 VAL C C     1 
ATOM   9472  O O     . VAL C  1 67  ? 60.456  50.455  96.196  1.00 33.58 ? 2099 VAL C O     1 
ATOM   9473  C CB    . VAL C  1 67  ? 62.579  53.016  95.547  1.00 33.07 ? 2099 VAL C CB    1 
ATOM   9474  C CG1   . VAL C  1 67  ? 61.541  53.049  94.434  1.00 30.89 ? 2099 VAL C CG1   1 
ATOM   9475  C CG2   . VAL C  1 67  ? 62.385  54.180  96.491  1.00 29.41 ? 2099 VAL C CG2   1 
ATOM   9476  N N     . TRP C  1 68  ? 61.907  50.204  94.507  1.00 38.25 ? 2100 TRP C N     1 
ATOM   9477  C CA    . TRP C  1 68  ? 61.042  49.276  93.789  1.00 41.05 ? 2100 TRP C CA    1 
ATOM   9478  C C     . TRP C  1 68  ? 60.606  48.148  94.707  1.00 43.47 ? 2100 TRP C C     1 
ATOM   9479  O O     . TRP C  1 68  ? 59.497  47.638  94.588  1.00 42.69 ? 2100 TRP C O     1 
ATOM   9480  C CB    . TRP C  1 68  ? 61.759  48.698  92.569  1.00 42.09 ? 2100 TRP C CB    1 
ATOM   9481  C CG    . TRP C  1 68  ? 61.761  49.625  91.401  1.00 46.34 ? 2100 TRP C CG    1 
ATOM   9482  C CD1   . TRP C  1 68  ? 62.835  49.983  90.651  1.00 48.25 ? 2100 TRP C CD1   1 
ATOM   9483  C CD2   . TRP C  1 68  ? 60.638  50.324  90.851  1.00 48.24 ? 2100 TRP C CD2   1 
ATOM   9484  N NE1   . TRP C  1 68  ? 62.460  50.863  89.664  1.00 48.54 ? 2100 TRP C NE1   1 
ATOM   9485  C CE2   . TRP C  1 68  ? 61.117  51.091  89.764  1.00 49.63 ? 2100 TRP C CE2   1 
ATOM   9486  C CE3   . TRP C  1 68  ? 59.278  50.379  91.171  1.00 51.82 ? 2100 TRP C CE3   1 
ATOM   9487  C CZ2   . TRP C  1 68  ? 60.283  51.901  88.994  1.00 51.56 ? 2100 TRP C CZ2   1 
ATOM   9488  C CZ3   . TRP C  1 68  ? 58.446  51.186  90.405  1.00 55.63 ? 2100 TRP C CZ3   1 
ATOM   9489  C CH2   . TRP C  1 68  ? 58.955  51.938  89.327  1.00 55.23 ? 2100 TRP C CH2   1 
ATOM   9490  N N     . ASN C  1 69  ? 61.483  47.763  95.626  1.00 43.17 ? 2101 ASN C N     1 
ATOM   9491  C CA    . ASN C  1 69  ? 61.155  46.701  96.561  1.00 44.61 ? 2101 ASN C CA    1 
ATOM   9492  C C     . ASN C  1 69  ? 60.038  47.177  97.477  1.00 42.47 ? 2101 ASN C C     1 
ATOM   9493  O O     . ASN C  1 69  ? 59.162  46.407  97.859  1.00 42.88 ? 2101 ASN C O     1 
ATOM   9494  C CB    . ASN C  1 69  ? 62.375  46.329  97.398  1.00 46.10 ? 2101 ASN C CB    1 
ATOM   9495  C CG    . ASN C  1 69  ? 62.297  44.912  97.932  1.00 50.84 ? 2101 ASN C CG    1 
ATOM   9496  O OD1   . ASN C  1 69  ? 62.342  43.944  97.166  1.00 49.90 ? 2101 ASN C OD1   1 
ATOM   9497  N ND2   . ASN C  1 69  ? 62.173  44.780  99.252  1.00 50.44 ? 2101 ASN C ND2   1 
ATOM   9498  N N     . ILE C  1 70  ? 60.075  48.456  97.825  1.00 41.74 ? 2102 ILE C N     1 
ATOM   9499  C CA    . ILE C  1 70  ? 59.055  49.032  98.691  1.00 42.22 ? 2102 ILE C CA    1 
ATOM   9500  C C     . ILE C  1 70  ? 57.678  48.940  98.028  1.00 42.06 ? 2102 ILE C C     1 
ATOM   9501  O O     . ILE C  1 70  ? 56.730  48.380  98.605  1.00 40.93 ? 2102 ILE C O     1 
ATOM   9502  C CB    . ILE C  1 70  ? 59.360  50.510  98.997  1.00 40.71 ? 2102 ILE C CB    1 
ATOM   9503  C CG1   . ILE C  1 70  ? 60.598  50.606  99.885  1.00 38.57 ? 2102 ILE C CG1   1 
ATOM   9504  C CG2   . ILE C  1 70  ? 58.153  51.174  99.660  1.00 39.86 ? 2102 ILE C CG2   1 
ATOM   9505  C CD1   . ILE C  1 70  ? 61.594  51.655  99.421  1.00 36.50 ? 2102 ILE C CD1   1 
ATOM   9506  N N     . VAL C  1 71  ? 57.575  49.493  96.818  1.00 40.42 ? 2103 VAL C N     1 
ATOM   9507  C CA    . VAL C  1 71  ? 56.321  49.471  96.075  1.00 38.69 ? 2103 VAL C CA    1 
ATOM   9508  C C     . VAL C  1 71  ? 55.885  48.040  95.754  1.00 38.71 ? 2103 VAL C C     1 
ATOM   9509  O O     . VAL C  1 71  ? 54.710  47.706  95.864  1.00 41.71 ? 2103 VAL C O     1 
ATOM   9510  C CB    . VAL C  1 71  ? 56.435  50.279  94.756  1.00 34.96 ? 2103 VAL C CB    1 
ATOM   9511  C CG1   . VAL C  1 71  ? 56.011  49.428  93.550  1.00 35.68 ? 2103 VAL C CG1   1 
ATOM   9512  C CG2   . VAL C  1 71  ? 55.561  51.502  94.844  1.00 34.40 ? 2103 VAL C CG2   1 
ATOM   9513  N N     . ASN C  1 72  ? 56.836  47.197  95.373  1.00 40.20 ? 2104 ASN C N     1 
ATOM   9514  C CA    . ASN C  1 72  ? 56.528  45.822  95.024  1.00 40.77 ? 2104 ASN C CA    1 
ATOM   9515  C C     . ASN C  1 72  ? 55.766  45.073  96.110  1.00 43.85 ? 2104 ASN C C     1 
ATOM   9516  O O     . ASN C  1 72  ? 55.427  43.902  95.936  1.00 43.49 ? 2104 ASN C O     1 
ATOM   9517  C CB    . ASN C  1 72  ? 57.814  45.073  94.680  1.00 39.10 ? 2104 ASN C CB    1 
ATOM   9518  C CG    . ASN C  1 72  ? 58.105  45.074  93.191  1.00 40.51 ? 2104 ASN C CG    1 
ATOM   9519  O OD1   . ASN C  1 72  ? 57.800  46.044  92.482  1.00 35.90 ? 2104 ASN C OD1   1 
ATOM   9520  N ND2   . ASN C  1 72  ? 58.697  43.986  92.703  1.00 40.90 ? 2104 ASN C ND2   1 
ATOM   9521  N N     . ASN C  1 73  ? 55.485  45.745  97.223  1.00 47.66 ? 2105 ASN C N     1 
ATOM   9522  C CA    . ASN C  1 73  ? 54.754  45.119  98.323  1.00 53.17 ? 2105 ASN C CA    1 
ATOM   9523  C C     . ASN C  1 73  ? 53.609  45.990  98.854  1.00 52.35 ? 2105 ASN C C     1 
ATOM   9524  O O     . ASN C  1 73  ? 53.043  45.726  99.917  1.00 49.71 ? 2105 ASN C O     1 
ATOM   9525  C CB    . ASN C  1 73  ? 55.730  44.763  99.444  1.00 60.51 ? 2105 ASN C CB    1 
ATOM   9526  C CG    . ASN C  1 73  ? 56.834  43.825  98.971  1.00 62.95 ? 2105 ASN C CG    1 
ATOM   9527  O OD1   . ASN C  1 73  ? 56.747  42.606  99.131  1.00 64.82 ? 2105 ASN C OD1   1 
ATOM   9528  N ND2   . ASN C  1 73  ? 57.875  44.395  98.380  1.00 64.90 ? 2105 ASN C ND2   1 
ATOM   9529  N N     . ILE C  1 74  C 53.278  47.028  98.097  1.00 50.63 ? 2105 ILE C N     1 
ATOM   9530  C CA    . ILE C  1 74  C 52.193  47.927  98.448  1.00 48.53 ? 2105 ILE C CA    1 
ATOM   9531  C C     . ILE C  1 74  C 51.140  47.831  97.341  1.00 47.71 ? 2105 ILE C C     1 
ATOM   9532  O O     . ILE C  1 74  C 51.069  48.687  96.448  1.00 45.90 ? 2105 ILE C O     1 
ATOM   9533  C CB    . ILE C  1 74  C 52.680  49.382  98.552  1.00 49.34 ? 2105 ILE C CB    1 
ATOM   9534  C CG1   . ILE C  1 74  C 53.715  49.517  99.678  1.00 45.51 ? 2105 ILE C CG1   1 
ATOM   9535  C CG2   . ILE C  1 74  C 51.481  50.304  98.780  1.00 47.27 ? 2105 ILE C CG2   1 
ATOM   9536  C CD1   . ILE C  1 74  C 53.135  49.398  101.083 1.00 43.61 ? 2105 ILE C CD1   1 
ATOM   9537  N N     . PRO C  1 75  ? 50.311  46.773  97.386  1.00 44.30 ? 2106 PRO C N     1 
ATOM   9538  C CA    . PRO C  1 75  ? 49.251  46.523  96.409  1.00 46.25 ? 2106 PRO C CA    1 
ATOM   9539  C C     . PRO C  1 75  ? 48.798  47.742  95.616  1.00 43.34 ? 2106 PRO C C     1 
ATOM   9540  O O     . PRO C  1 75  ? 49.103  47.854  94.431  1.00 43.20 ? 2106 PRO C O     1 
ATOM   9541  C CB    . PRO C  1 75  ? 48.144  45.926  97.260  1.00 43.72 ? 2106 PRO C CB    1 
ATOM   9542  C CG    . PRO C  1 75  ? 48.905  45.150  98.338  1.00 42.03 ? 2106 PRO C CG    1 
ATOM   9543  C CD    . PRO C  1 75  ? 50.314  45.726  98.425  1.00 43.76 ? 2106 PRO C CD    1 
ATOM   9544  N N     . PHE C  1 76  ? 48.087  48.665  96.254  1.00 43.36 ? 2107 PHE C N     1 
ATOM   9545  C CA    . PHE C  1 76  ? 47.630  49.834  95.510  1.00 45.75 ? 2107 PHE C CA    1 
ATOM   9546  C C     . PHE C  1 76  ? 48.764  50.456  94.721  1.00 41.77 ? 2107 PHE C C     1 
ATOM   9547  O O     . PHE C  1 76  ? 48.615  50.761  93.541  1.00 41.61 ? 2107 PHE C O     1 
ATOM   9548  C CB    . PHE C  1 76  ? 46.976  50.893  96.419  1.00 48.60 ? 2107 PHE C CB    1 
ATOM   9549  C CG    . PHE C  1 76  ? 47.660  51.097  97.738  1.00 55.27 ? 2107 PHE C CG    1 
ATOM   9550  C CD1   . PHE C  1 76  ? 48.250  52.324  98.043  1.00 56.52 ? 2107 PHE C CD1   1 
ATOM   9551  C CD2   . PHE C  1 76  ? 47.656  50.092  98.708  1.00 57.77 ? 2107 PHE C CD2   1 
ATOM   9552  C CE1   . PHE C  1 76  ? 48.824  52.553  99.298  1.00 54.59 ? 2107 PHE C CE1   1 
ATOM   9553  C CE2   . PHE C  1 76  ? 48.226  50.306  99.966  1.00 58.63 ? 2107 PHE C CE2   1 
ATOM   9554  C CZ    . PHE C  1 76  ? 48.811  51.543  100.262 1.00 56.44 ? 2107 PHE C CZ    1 
ATOM   9555  N N     . LEU C  1 77  ? 49.906  50.624  95.371  1.00 40.75 ? 2108 LEU C N     1 
ATOM   9556  C CA    . LEU C  1 77  ? 51.049  51.211  94.706  1.00 39.92 ? 2108 LEU C CA    1 
ATOM   9557  C C     . LEU C  1 77  ? 51.416  50.411  93.462  1.00 37.56 ? 2108 LEU C C     1 
ATOM   9558  O O     . LEU C  1 77  ? 51.383  50.931  92.339  1.00 35.07 ? 2108 LEU C O     1 
ATOM   9559  C CB    . LEU C  1 77  ? 52.242  51.269  95.659  1.00 42.18 ? 2108 LEU C CB    1 
ATOM   9560  C CG    . LEU C  1 77  ? 52.352  52.557  96.486  1.00 44.51 ? 2108 LEU C CG    1 
ATOM   9561  C CD1   . LEU C  1 77  ? 53.526  52.441  97.462  1.00 45.13 ? 2108 LEU C CD1   1 
ATOM   9562  C CD2   . LEU C  1 77  ? 52.539  53.755  95.563  1.00 42.48 ? 2108 LEU C CD2   1 
ATOM   9563  N N     . ARG C  1 78  ? 51.757  49.144  93.665  1.00 32.99 ? 2109 ARG C N     1 
ATOM   9564  C CA    . ARG C  1 78  ? 52.145  48.288  92.552  1.00 29.88 ? 2109 ARG C CA    1 
ATOM   9565  C C     . ARG C  1 78  ? 51.179  48.478  91.389  1.00 27.47 ? 2109 ARG C C     1 
ATOM   9566  O O     . ARG C  1 78  ? 51.555  48.916  90.300  1.00 26.97 ? 2109 ARG C O     1 
ATOM   9567  C CB    . ARG C  1 78  ? 52.150  46.823  92.993  1.00 28.96 ? 2109 ARG C CB    1 
ATOM   9568  C CG    . ARG C  1 78  ? 52.370  45.839  91.855  1.00 29.14 ? 2109 ARG C CG    1 
ATOM   9569  C CD    . ARG C  1 78  ? 52.946  44.509  92.338  1.00 28.32 ? 2109 ARG C CD    1 
ATOM   9570  N NE    . ARG C  1 78  ? 53.167  43.580  91.230  1.00 24.13 ? 2109 ARG C NE    1 
ATOM   9571  C CZ    . ARG C  1 78  ? 53.058  42.257  91.322  1.00 25.56 ? 2109 ARG C CZ    1 
ATOM   9572  N NH1   . ARG C  1 78  ? 52.731  41.687  92.473  1.00 23.88 ? 2109 ARG C NH1   1 
ATOM   9573  N NH2   . ARG C  1 78  ? 53.263  41.499  90.254  1.00 26.11 ? 2109 ARG C NH2   1 
ATOM   9574  N N     . SER C  1 79  ? 49.924  48.149  91.646  1.00 26.88 ? 2110 SER C N     1 
ATOM   9575  C CA    . SER C  1 79  ? 48.885  48.271  90.656  1.00 22.05 ? 2110 SER C CA    1 
ATOM   9576  C C     . SER C  1 79  ? 48.924  49.669  90.071  1.00 21.98 ? 2110 SER C C     1 
ATOM   9577  O O     . SER C  1 79  ? 49.071  49.850  88.867  1.00 19.68 ? 2110 SER C O     1 
ATOM   9578  C CB    . SER C  1 79  ? 47.538  47.999  91.313  1.00 19.33 ? 2110 SER C CB    1 
ATOM   9579  O OG    . SER C  1 79  ? 47.623  46.867  92.157  1.00 14.44 ? 2110 SER C OG    1 
ATOM   9580  N N     . LEU C  1 80  ? 48.802  50.662  90.936  1.00 21.42 ? 2111 LEU C N     1 
ATOM   9581  C CA    . LEU C  1 80  ? 48.819  52.048  90.492  1.00 23.87 ? 2111 LEU C CA    1 
ATOM   9582  C C     . LEU C  1 80  ? 49.881  52.234  89.398  1.00 24.90 ? 2111 LEU C C     1 
ATOM   9583  O O     . LEU C  1 80  ? 49.660  52.925  88.400  1.00 22.98 ? 2111 LEU C O     1 
ATOM   9584  C CB    . LEU C  1 80  ? 49.080  52.956  91.698  1.00 23.36 ? 2111 LEU C CB    1 
ATOM   9585  C CG    . LEU C  1 80  ? 50.052  54.121  91.576  1.00 23.35 ? 2111 LEU C CG    1 
ATOM   9586  C CD1   . LEU C  1 80  ? 49.292  55.397  91.253  1.00 24.43 ? 2111 LEU C CD1   1 
ATOM   9587  C CD2   . LEU C  1 80  ? 50.811  54.272  92.881  1.00 22.20 ? 2111 LEU C CD2   1 
ATOM   9588  N N     . ILE C  1 81  ? 51.020  51.578  89.588  1.00 22.93 ? 2112 ILE C N     1 
ATOM   9589  C CA    . ILE C  1 81  ? 52.120  51.644  88.643  1.00 21.09 ? 2112 ILE C CA    1 
ATOM   9590  C C     . ILE C  1 81  ? 51.806  50.821  87.401  1.00 18.78 ? 2112 ILE C C     1 
ATOM   9591  O O     . ILE C  1 81  ? 51.630  51.364  86.309  1.00 14.93 ? 2112 ILE C O     1 
ATOM   9592  C CB    . ILE C  1 81  ? 53.402  51.090  89.282  1.00 23.50 ? 2112 ILE C CB    1 
ATOM   9593  C CG1   . ILE C  1 81  ? 53.681  51.822  90.595  1.00 23.41 ? 2112 ILE C CG1   1 
ATOM   9594  C CG2   . ILE C  1 81  ? 54.575  51.230  88.313  1.00 20.92 ? 2112 ILE C CG2   1 
ATOM   9595  C CD1   . ILE C  1 81  ? 54.058  53.290  90.415  1.00 26.84 ? 2112 ILE C CD1   1 
ATOM   9596  N N     . MET C  1 82  ? 51.757  49.503  87.590  1.00 18.57 ? 2113 MET C N     1 
ATOM   9597  C CA    . MET C  1 82  ? 51.472  48.542  86.525  1.00 16.76 ? 2113 MET C CA    1 
ATOM   9598  C C     . MET C  1 82  ? 50.414  49.090  85.590  1.00 18.44 ? 2113 MET C C     1 
ATOM   9599  O O     . MET C  1 82  ? 50.470  48.936  84.372  1.00 5.32  ? 2113 MET C O     1 
ATOM   9600  C CB    . MET C  1 82  ? 50.980  47.240  87.144  1.00 17.65 ? 2113 MET C CB    1 
ATOM   9601  C CG    . MET C  1 82  ? 50.563  46.206  86.139  1.00 20.12 ? 2113 MET C CG    1 
ATOM   9602  S SD    . MET C  1 82  ? 51.958  45.490  85.302  1.00 26.21 ? 2113 MET C SD    1 
ATOM   9603  C CE    . MET C  1 82  ? 51.635  46.007  83.558  1.00 23.96 ? 2113 MET C CE    1 
ATOM   9604  N N     . LYS C  1 83  ? 49.439  49.739  86.207  1.00 24.30 ? 2114 LYS C N     1 
ATOM   9605  C CA    . LYS C  1 83  ? 48.332  50.345  85.499  1.00 30.35 ? 2114 LYS C CA    1 
ATOM   9606  C C     . LYS C  1 83  ? 48.936  51.427  84.658  1.00 28.19 ? 2114 LYS C C     1 
ATOM   9607  O O     . LYS C  1 83  ? 48.814  51.424  83.441  1.00 26.21 ? 2114 LYS C O     1 
ATOM   9608  C CB    . LYS C  1 83  ? 47.338  50.950  86.494  1.00 35.14 ? 2114 LYS C CB    1 
ATOM   9609  C CG    . LYS C  1 83  ? 46.666  52.234  86.024  1.00 41.36 ? 2114 LYS C CG    1 
ATOM   9610  C CD    . LYS C  1 83  ? 45.296  52.413  86.675  1.00 51.46 ? 2114 LYS C CD    1 
ATOM   9611  C CE    . LYS C  1 83  ? 44.925  53.883  86.811  1.00 57.59 ? 2114 LYS C CE    1 
ATOM   9612  N NZ    . LYS C  1 83  ? 43.889  54.113  87.865  1.00 63.52 ? 2114 LYS C NZ    1 
ATOM   9613  N N     . TYR C  1 84  ? 49.606  52.351  85.327  1.00 29.85 ? 2115 TYR C N     1 
ATOM   9614  C CA    . TYR C  1 84  ? 50.241  53.451  84.631  1.00 31.06 ? 2115 TYR C CA    1 
ATOM   9615  C C     . TYR C  1 84  ? 50.961  52.892  83.420  1.00 26.62 ? 2115 TYR C C     1 
ATOM   9616  O O     . TYR C  1 84  ? 50.839  53.418  82.317  1.00 24.17 ? 2115 TYR C O     1 
ATOM   9617  C CB    . TYR C  1 84  ? 51.273  54.157  85.511  1.00 36.85 ? 2115 TYR C CB    1 
ATOM   9618  C CG    . TYR C  1 84  ? 52.384  54.720  84.664  1.00 47.02 ? 2115 TYR C CG    1 
ATOM   9619  C CD1   . TYR C  1 84  ? 52.200  55.895  83.936  1.00 49.55 ? 2115 TYR C CD1   1 
ATOM   9620  C CD2   . TYR C  1 84  ? 53.570  54.011  84.478  1.00 52.12 ? 2115 TYR C CD2   1 
ATOM   9621  C CE1   . TYR C  1 84  ? 53.162  56.344  83.036  1.00 55.32 ? 2115 TYR C CE1   1 
ATOM   9622  C CE2   . TYR C  1 84  ? 54.541  54.453  83.578  1.00 55.58 ? 2115 TYR C CE2   1 
ATOM   9623  C CZ    . TYR C  1 84  ? 54.328  55.616  82.859  1.00 56.75 ? 2115 TYR C CZ    1 
ATOM   9624  O OH    . TYR C  1 84  ? 55.273  56.031  81.951  1.00 61.30 ? 2115 TYR C OH    1 
ATOM   9625  N N     . VAL C  1 85  ? 51.731  51.834  83.644  1.00 20.60 ? 2116 VAL C N     1 
ATOM   9626  C CA    . VAL C  1 85  ? 52.474  51.224  82.557  1.00 18.88 ? 2116 VAL C CA    1 
ATOM   9627  C C     . VAL C  1 85  ? 51.495  50.751  81.483  1.00 19.28 ? 2116 VAL C C     1 
ATOM   9628  O O     . VAL C  1 85  ? 51.683  51.005  80.282  1.00 20.18 ? 2116 VAL C O     1 
ATOM   9629  C CB    . VAL C  1 85  ? 53.356  50.040  83.057  1.00 17.70 ? 2116 VAL C CB    1 
ATOM   9630  C CG1   . VAL C  1 85  ? 53.353  49.992  84.576  1.00 15.28 ? 2116 VAL C CG1   1 
ATOM   9631  C CG2   . VAL C  1 85  ? 52.890  48.712  82.450  1.00 15.34 ? 2116 VAL C CG2   1 
ATOM   9632  N N     . LEU C  1 86  ? 50.437  50.080  81.925  1.00 18.22 ? 2117 LEU C N     1 
ATOM   9633  C CA    . LEU C  1 86  ? 49.435  49.584  81.008  1.00 14.70 ? 2117 LEU C CA    1 
ATOM   9634  C C     . LEU C  1 86  ? 48.943  50.732  80.150  1.00 18.59 ? 2117 LEU C C     1 
ATOM   9635  O O     . LEU C  1 86  ? 49.056  50.714  78.921  1.00 21.03 ? 2117 LEU C O     1 
ATOM   9636  C CB    . LEU C  1 86  ? 48.273  48.998  81.788  1.00 9.06  ? 2117 LEU C CB    1 
ATOM   9637  C CG    . LEU C  1 86  ? 48.196  47.479  81.771  1.00 7.98  ? 2117 LEU C CG    1 
ATOM   9638  C CD1   . LEU C  1 86  ? 49.060  46.903  80.635  1.00 8.72  ? 2117 LEU C CD1   1 
ATOM   9639  C CD2   . LEU C  1 86  ? 48.637  46.966  83.125  1.00 6.85  ? 2117 LEU C CD2   1 
ATOM   9640  N N     . THR C  1 87  ? 48.421  51.749  80.821  1.00 21.58 ? 2118 THR C N     1 
ATOM   9641  C CA    . THR C  1 87  ? 47.881  52.924  80.159  1.00 24.54 ? 2118 THR C CA    1 
ATOM   9642  C C     . THR C  1 87  ? 48.908  53.724  79.363  1.00 28.14 ? 2118 THR C C     1 
ATOM   9643  O O     . THR C  1 87  ? 48.584  54.287  78.316  1.00 26.60 ? 2118 THR C O     1 
ATOM   9644  C CB    . THR C  1 87  ? 47.219  53.844  81.183  1.00 20.03 ? 2118 THR C CB    1 
ATOM   9645  O OG1   . THR C  1 87  ? 48.133  54.091  82.252  1.00 22.94 ? 2118 THR C OG1   1 
ATOM   9646  C CG2   . THR C  1 87  ? 45.989  53.185  81.757  1.00 19.58 ? 2118 THR C CG2   1 
ATOM   9647  N N     . SER C  1 88  ? 50.145  53.774  79.852  1.00 32.81 ? 2119 SER C N     1 
ATOM   9648  C CA    . SER C  1 88  ? 51.178  54.535  79.164  1.00 34.95 ? 2119 SER C CA    1 
ATOM   9649  C C     . SER C  1 88  ? 51.186  54.112  77.721  1.00 38.83 ? 2119 SER C C     1 
ATOM   9650  O O     . SER C  1 88  ? 51.126  54.950  76.825  1.00 41.26 ? 2119 SER C O     1 
ATOM   9651  C CB    . SER C  1 88  ? 52.554  54.283  79.766  1.00 31.51 ? 2119 SER C CB    1 
ATOM   9652  O OG    . SER C  1 88  ? 52.511  53.219  80.679  1.00 29.96 ? 2119 SER C OG    1 
ATOM   9653  N N     . ARG C  1 89  ? 51.253  52.802  77.499  1.00 44.30 ? 2120 ARG C N     1 
ATOM   9654  C CA    . ARG C  1 89  ? 51.259  52.265  76.141  1.00 50.25 ? 2120 ARG C CA    1 
ATOM   9655  C C     . ARG C  1 89  ? 49.897  52.537  75.515  1.00 51.53 ? 2120 ARG C C     1 
ATOM   9656  O O     . ARG C  1 89  ? 49.696  53.575  74.872  1.00 52.94 ? 2120 ARG C O     1 
ATOM   9657  C CB    . ARG C  1 89  ? 51.543  50.761  76.173  1.00 49.17 ? 2120 ARG C CB    1 
ATOM   9658  C CG    . ARG C  1 89  ? 52.736  50.397  77.047  1.00 54.14 ? 2120 ARG C CG    1 
ATOM   9659  C CD    . ARG C  1 89  ? 53.962  50.009  76.202  1.00 54.95 ? 2120 ARG C CD    1 
ATOM   9660  N NE    . ARG C  1 89  ? 55.133  50.864  76.441  1.00 54.57 ? 2120 ARG C NE    1 
ATOM   9661  C CZ    . ARG C  1 89  ? 56.208  50.507  77.145  1.00 52.76 ? 2120 ARG C CZ    1 
ATOM   9662  N NH1   . ARG C  1 89  ? 56.282  49.305  77.698  1.00 50.68 ? 2120 ARG C NH1   1 
ATOM   9663  N NH2   . ARG C  1 89  ? 57.215  51.357  77.301  1.00 54.88 ? 2120 ARG C NH2   1 
ATOM   9664  N N     . SER C  1 90  ? 48.972  51.601  75.710  1.00 50.23 ? 2121 SER C N     1 
ATOM   9665  C CA    . SER C  1 90  ? 47.601  51.719  75.208  1.00 49.75 ? 2121 SER C CA    1 
ATOM   9666  C C     . SER C  1 90  ? 47.369  52.683  74.037  1.00 48.15 ? 2121 SER C C     1 
ATOM   9667  O O     . SER C  1 90  ? 47.224  52.256  72.894  1.00 49.35 ? 2121 SER C O     1 
ATOM   9668  C CB    . SER C  1 90  ? 46.683  52.111  76.365  1.00 49.42 ? 2121 SER C CB    1 
ATOM   9669  O OG    . SER C  1 90  ? 47.401  52.112  77.587  1.00 47.88 ? 2121 SER C OG    1 
ATOM   9670  N N     . TYR C  1 91  ? 47.329  53.977  74.332  1.00 47.64 ? 2122 TYR C N     1 
ATOM   9671  C CA    . TYR C  1 91  ? 47.093  54.994  73.319  1.00 49.59 ? 2122 TYR C CA    1 
ATOM   9672  C C     . TYR C  1 91  ? 47.994  54.929  72.086  1.00 45.07 ? 2122 TYR C C     1 
ATOM   9673  O O     . TYR C  1 91  ? 48.003  55.846  71.271  1.00 46.71 ? 2122 TYR C O     1 
ATOM   9674  C CB    . TYR C  1 91  ? 47.206  56.382  73.956  1.00 58.69 ? 2122 TYR C CB    1 
ATOM   9675  C CG    . TYR C  1 91  ? 48.570  57.018  73.802  1.00 66.10 ? 2122 TYR C CG    1 
ATOM   9676  C CD1   . TYR C  1 91  ? 48.782  58.050  72.879  1.00 67.34 ? 2122 TYR C CD1   1 
ATOM   9677  C CD2   . TYR C  1 91  ? 49.659  56.567  74.549  1.00 66.84 ? 2122 TYR C CD2   1 
ATOM   9678  C CE1   . TYR C  1 91  ? 50.044  58.611  72.703  1.00 68.54 ? 2122 TYR C CE1   1 
ATOM   9679  C CE2   . TYR C  1 91  ? 50.925  57.121  74.382  1.00 68.48 ? 2122 TYR C CE2   1 
ATOM   9680  C CZ    . TYR C  1 91  ? 51.113  58.142  73.455  1.00 72.22 ? 2122 TYR C CZ    1 
ATOM   9681  O OH    . TYR C  1 91  ? 52.370  58.686  73.269  1.00 72.22 ? 2122 TYR C OH    1 
ATOM   9682  N N     . LEU C  1 92  ? 48.742  53.851  71.932  1.00 44.01 ? 2123 LEU C N     1 
ATOM   9683  C CA    . LEU C  1 92  ? 49.635  53.737  70.797  1.00 44.16 ? 2123 LEU C CA    1 
ATOM   9684  C C     . LEU C  1 92  ? 49.123  52.966  69.584  1.00 45.03 ? 2123 LEU C C     1 
ATOM   9685  O O     . LEU C  1 92  ? 49.190  53.469  68.458  1.00 44.67 ? 2123 LEU C O     1 
ATOM   9686  C CB    . LEU C  1 92  ? 50.956  53.129  71.252  1.00 46.61 ? 2123 LEU C CB    1 
ATOM   9687  C CG    . LEU C  1 92  ? 52.199  53.958  70.922  1.00 46.39 ? 2123 LEU C CG    1 
ATOM   9688  C CD1   . LEU C  1 92  ? 52.026  55.393  71.423  1.00 46.62 ? 2123 LEU C CD1   1 
ATOM   9689  C CD2   . LEU C  1 92  ? 53.412  53.294  71.560  1.00 46.00 ? 2123 LEU C CD2   1 
ATOM   9690  N N     . ILE C  1 93  ? 48.631  51.747  69.807  1.00 45.51 ? 2124 ILE C N     1 
ATOM   9691  C CA    . ILE C  1 93  ? 48.124  50.909  68.710  1.00 47.80 ? 2124 ILE C CA    1 
ATOM   9692  C C     . ILE C  1 93  ? 46.855  51.423  68.014  1.00 48.26 ? 2124 ILE C C     1 
ATOM   9693  O O     . ILE C  1 93  ? 46.082  52.213  68.570  1.00 46.79 ? 2124 ILE C O     1 
ATOM   9694  C CB    . ILE C  1 93  ? 47.842  49.460  69.171  1.00 47.37 ? 2124 ILE C CB    1 
ATOM   9695  C CG1   . ILE C  1 93  ? 48.810  49.067  70.287  1.00 47.76 ? 2124 ILE C CG1   1 
ATOM   9696  C CG2   . ILE C  1 93  ? 47.940  48.515  67.981  1.00 47.25 ? 2124 ILE C CG2   1 
ATOM   9697  C CD1   . ILE C  1 93  ? 50.112  48.490  69.804  1.00 42.58 ? 2124 ILE C CD1   1 
ATOM   9698  N N     . ASP C  1 94  ? 46.654  50.951  66.787  1.00 48.22 ? 2125 ASP C N     1 
ATOM   9699  C CA    . ASP C  1 94  ? 45.502  51.347  65.997  1.00 47.10 ? 2125 ASP C CA    1 
ATOM   9700  C C     . ASP C  1 94  ? 44.371  50.323  66.103  1.00 44.27 ? 2125 ASP C C     1 
ATOM   9701  O O     . ASP C  1 94  ? 44.103  49.593  65.152  1.00 47.04 ? 2125 ASP C O     1 
ATOM   9702  C CB    . ASP C  1 94  ? 45.907  51.519  64.523  1.00 48.12 ? 2125 ASP C CB    1 
ATOM   9703  C CG    . ASP C  1 94  ? 46.147  52.975  64.148  1.00 52.63 ? 2125 ASP C CG    1 
ATOM   9704  O OD1   . ASP C  1 94  ? 45.865  53.858  64.984  1.00 52.73 ? 2125 ASP C OD1   1 
ATOM   9705  O OD2   . ASP C  1 94  ? 46.619  53.238  63.020  1.00 51.79 ? 2125 ASP C OD2   1 
ATOM   9706  N N     . SER C  1 95  ? 43.712  50.260  67.257  1.00 39.93 ? 2126 SER C N     1 
ATOM   9707  C CA    . SER C  1 95  ? 42.597  49.330  67.423  1.00 36.39 ? 2126 SER C CA    1 
ATOM   9708  C C     . SER C  1 95  ? 41.301  50.121  67.560  1.00 29.63 ? 2126 SER C C     1 
ATOM   9709  O O     . SER C  1 95  ? 41.198  51.014  68.396  1.00 31.87 ? 2126 SER C O     1 
ATOM   9710  C CB    . SER C  1 95  ? 42.787  48.440  68.654  1.00 35.03 ? 2126 SER C CB    1 
ATOM   9711  O OG    . SER C  1 95  ? 41.995  47.270  68.550  1.00 34.17 ? 2126 SER C OG    1 
ATOM   9712  N N     . PRO C  1 96  ? 40.291  49.794  66.743  1.00 23.89 ? 2127 PRO C N     1 
ATOM   9713  C CA    . PRO C  1 96  ? 40.302  48.741  65.719  1.00 27.69 ? 2127 PRO C CA    1 
ATOM   9714  C C     . PRO C  1 96  ? 41.308  48.960  64.576  1.00 21.10 ? 2127 PRO C C     1 
ATOM   9715  O O     . PRO C  1 96  ? 41.573  50.102  64.176  1.00 16.99 ? 2127 PRO C O     1 
ATOM   9716  C CB    . PRO C  1 96  ? 38.862  48.728  65.213  1.00 24.69 ? 2127 PRO C CB    1 
ATOM   9717  C CG    . PRO C  1 96  ? 38.383  50.125  65.460  1.00 26.65 ? 2127 PRO C CG    1 
ATOM   9718  C CD    . PRO C  1 96  ? 39.006  50.505  66.774  1.00 24.98 ? 2127 PRO C CD    1 
ATOM   9719  N N     . PRO C  1 97  ? 41.860  47.853  64.031  1.00 11.52 ? 2128 PRO C N     1 
ATOM   9720  C CA    . PRO C  1 97  ? 42.840  47.765  62.942  1.00 15.67 ? 2128 PRO C CA    1 
ATOM   9721  C C     . PRO C  1 97  ? 42.614  48.725  61.798  1.00 13.37 ? 2128 PRO C C     1 
ATOM   9722  O O     . PRO C  1 97  ? 41.494  49.147  61.553  1.00 13.85 ? 2128 PRO C O     1 
ATOM   9723  C CB    . PRO C  1 97  ? 42.745  46.309  62.471  1.00 10.56 ? 2128 PRO C CB    1 
ATOM   9724  C CG    . PRO C  1 97  ? 41.720  45.661  63.307  1.00 13.12 ? 2128 PRO C CG    1 
ATOM   9725  C CD    . PRO C  1 97  ? 41.517  46.510  64.520  1.00 18.97 ? 2128 PRO C CD    1 
ATOM   9726  N N     . THR C  1 98  ? 43.689  49.062  61.097  1.00 12.53 ? 2129 THR C N     1 
ATOM   9727  C CA    . THR C  1 98  ? 43.598  49.971  59.968  1.00 12.95 ? 2129 THR C CA    1 
ATOM   9728  C C     . THR C  1 98  ? 44.207  49.366  58.709  1.00 16.86 ? 2129 THR C C     1 
ATOM   9729  O O     . THR C  1 98  ? 43.591  48.501  58.085  1.00 17.26 ? 2129 THR C O     1 
ATOM   9730  C CB    . THR C  1 98  ? 44.287  51.306  60.264  1.00 13.61 ? 2129 THR C CB    1 
ATOM   9731  O OG1   . THR C  1 98  ? 45.635  51.057  60.670  1.00 23.52 ? 2129 THR C OG1   1 
ATOM   9732  C CG2   . THR C  1 98  ? 43.556  52.055  61.376  1.00 16.88 ? 2129 THR C CG2   1 
ATOM   9733  N N     . TYR C  1 99  ? 45.421  49.791  58.347  1.00 18.09 ? 2130 TYR C N     1 
ATOM   9734  C CA    . TYR C  1 99  ? 46.075  49.305  57.122  1.00 16.33 ? 2130 TYR C CA    1 
ATOM   9735  C C     . TYR C  1 99  ? 46.670  47.914  57.159  1.00 17.27 ? 2130 TYR C C     1 
ATOM   9736  O O     . TYR C  1 99  ? 46.759  47.274  58.209  1.00 19.65 ? 2130 TYR C O     1 
ATOM   9737  C CB    . TYR C  1 99  ? 47.175  50.265  56.674  1.00 14.45 ? 2130 TYR C CB    1 
ATOM   9738  C CG    . TYR C  1 99  ? 46.930  51.703  57.031  1.00 10.10 ? 2130 TYR C CG    1 
ATOM   9739  C CD1   . TYR C  1 99  ? 47.217  52.188  58.305  1.00 9.05  ? 2130 TYR C CD1   1 
ATOM   9740  C CD2   . TYR C  1 99  ? 46.438  52.583  56.092  1.00 6.94  ? 2130 TYR C CD2   1 
ATOM   9741  C CE1   . TYR C  1 99  ? 47.017  53.528  58.629  1.00 9.02  ? 2130 TYR C CE1   1 
ATOM   9742  C CE2   . TYR C  1 99  ? 46.234  53.929  56.399  1.00 5.70  ? 2130 TYR C CE2   1 
ATOM   9743  C CZ    . TYR C  1 99  ? 46.525  54.395  57.663  1.00 8.18  ? 2130 TYR C CZ    1 
ATOM   9744  O OH    . TYR C  1 99  ? 46.318  55.732  57.943  1.00 2.00  ? 2130 TYR C OH    1 
ATOM   9745  N N     . ASN C  1 100 ? 47.078  47.457  55.981  1.00 15.22 ? 2131 ASN C N     1 
ATOM   9746  C CA    . ASN C  1 100 ? 47.689  46.149  55.833  1.00 16.09 ? 2131 ASN C CA    1 
ATOM   9747  C C     . ASN C  1 100 ? 48.551  46.193  54.590  1.00 16.31 ? 2131 ASN C C     1 
ATOM   9748  O O     . ASN C  1 100 ? 48.710  47.251  53.972  1.00 17.58 ? 2131 ASN C O     1 
ATOM   9749  C CB    . ASN C  1 100 ? 46.629  45.055  55.674  1.00 16.63 ? 2131 ASN C CB    1 
ATOM   9750  C CG    . ASN C  1 100 ? 45.925  45.102  54.312  1.00 18.44 ? 2131 ASN C CG    1 
ATOM   9751  O OD1   . ASN C  1 100 ? 46.417  45.690  53.353  1.00 16.42 ? 2131 ASN C OD1   1 
ATOM   9752  N ND2   . ASN C  1 100 ? 44.764  44.473  54.234  1.00 20.02 ? 2131 ASN C ND2   1 
ATOM   9753  N N     . VAL C  1 101 ? 49.079  45.031  54.217  1.00 14.86 ? 2132 VAL C N     1 
ATOM   9754  C CA    . VAL C  1 101 ? 49.936  44.911  53.055  1.00 14.55 ? 2132 VAL C CA    1 
ATOM   9755  C C     . VAL C  1 101 ? 49.433  45.713  51.872  1.00 16.23 ? 2132 VAL C C     1 
ATOM   9756  O O     . VAL C  1 101 ? 50.035  46.712  51.494  1.00 17.91 ? 2132 VAL C O     1 
ATOM   9757  C CB    . VAL C  1 101 ? 50.069  43.448  52.607  1.00 14.48 ? 2132 VAL C CB    1 
ATOM   9758  C CG1   . VAL C  1 101 ? 50.376  43.387  51.105  1.00 16.86 ? 2132 VAL C CG1   1 
ATOM   9759  C CG2   . VAL C  1 101 ? 51.191  42.768  53.381  1.00 16.71 ? 2132 VAL C CG2   1 
ATOM   9760  N N     . HIS C  1 102 ? 48.318  45.275  51.301  1.00 16.10 ? 2133 HIS C N     1 
ATOM   9761  C CA    . HIS C  1 102 ? 47.761  45.921  50.133  1.00 15.06 ? 2133 HIS C CA    1 
ATOM   9762  C C     . HIS C  1 102 ? 47.056  47.235  50.339  1.00 17.06 ? 2133 HIS C C     1 
ATOM   9763  O O     . HIS C  1 102 ? 46.790  47.931  49.368  1.00 18.81 ? 2133 HIS C O     1 
ATOM   9764  C CB    . HIS C  1 102 ? 46.802  44.971  49.438  1.00 22.29 ? 2133 HIS C CB    1 
ATOM   9765  C CG    . HIS C  1 102 ? 47.449  43.718  48.950  1.00 29.17 ? 2133 HIS C CG    1 
ATOM   9766  N ND1   . HIS C  1 102 ? 47.124  42.471  49.439  1.00 29.51 ? 2133 HIS C ND1   1 
ATOM   9767  C CD2   . HIS C  1 102 ? 48.414  43.521  48.020  1.00 29.42 ? 2133 HIS C CD2   1 
ATOM   9768  C CE1   . HIS C  1 102 ? 47.861  41.557  48.833  1.00 32.89 ? 2133 HIS C CE1   1 
ATOM   9769  N NE2   . HIS C  1 102 ? 48.652  42.169  47.968  1.00 33.44 ? 2133 HIS C NE2   1 
ATOM   9770  N N     . TYR C  1 103 ? 46.750  47.606  51.575  1.00 15.34 ? 2134 TYR C N     1 
ATOM   9771  C CA    . TYR C  1 103 ? 46.024  48.854  51.758  1.00 16.38 ? 2134 TYR C CA    1 
ATOM   9772  C C     . TYR C  1 103 ? 46.709  49.917  52.599  1.00 18.41 ? 2134 TYR C C     1 
ATOM   9773  O O     . TYR C  1 103 ? 46.921  49.749  53.815  1.00 17.50 ? 2134 TYR C O     1 
ATOM   9774  C CB    . TYR C  1 103 ? 44.615  48.573  52.308  1.00 15.44 ? 2134 TYR C CB    1 
ATOM   9775  C CG    . TYR C  1 103 ? 43.715  47.811  51.338  1.00 12.34 ? 2134 TYR C CG    1 
ATOM   9776  C CD1   . TYR C  1 103 ? 43.596  46.418  51.413  1.00 10.45 ? 2134 TYR C CD1   1 
ATOM   9777  C CD2   . TYR C  1 103 ? 43.024  48.471  50.321  1.00 7.02  ? 2134 TYR C CD2   1 
ATOM   9778  C CE1   . TYR C  1 103 ? 42.821  45.705  50.500  1.00 10.24 ? 2134 TYR C CE1   1 
ATOM   9779  C CE2   . TYR C  1 103 ? 42.245  47.767  49.403  1.00 4.79  ? 2134 TYR C CE2   1 
ATOM   9780  C CZ    . TYR C  1 103 ? 42.151  46.379  49.497  1.00 10.25 ? 2134 TYR C CZ    1 
ATOM   9781  O OH    . TYR C  1 103 ? 41.400  45.647  48.589  1.00 11.56 ? 2134 TYR C OH    1 
ATOM   9782  N N     . GLY C  1 104 ? 47.034  51.020  51.919  1.00 16.94 ? 2135 GLY C N     1 
ATOM   9783  C CA    . GLY C  1 104 ? 47.686  52.161  52.542  1.00 13.15 ? 2135 GLY C CA    1 
ATOM   9784  C C     . GLY C  1 104 ? 46.691  53.195  53.045  1.00 13.84 ? 2135 GLY C C     1 
ATOM   9785  O O     . GLY C  1 104 ? 47.058  54.154  53.746  1.00 13.72 ? 2135 GLY C O     1 
ATOM   9786  N N     . TYR C  1 105 ? 45.427  53.021  52.666  1.00 12.31 ? 2136 TYR C N     1 
ATOM   9787  C CA    . TYR C  1 105 ? 44.367  53.915  53.131  1.00 12.04 ? 2136 TYR C CA    1 
ATOM   9788  C C     . TYR C  1 105 ? 43.450  52.991  53.929  1.00 9.83  ? 2136 TYR C C     1 
ATOM   9789  O O     . TYR C  1 105 ? 43.543  51.756  53.781  1.00 6.50  ? 2136 TYR C O     1 
ATOM   9790  C CB    . TYR C  1 105 ? 43.610  54.542  51.943  1.00 9.61  ? 2136 TYR C CB    1 
ATOM   9791  C CG    . TYR C  1 105 ? 43.279  53.573  50.820  1.00 7.71  ? 2136 TYR C CG    1 
ATOM   9792  C CD1   . TYR C  1 105 ? 42.716  52.326  51.089  1.00 9.97  ? 2136 TYR C CD1   1 
ATOM   9793  C CD2   . TYR C  1 105 ? 43.535  53.901  49.493  1.00 2.00  ? 2136 TYR C CD2   1 
ATOM   9794  C CE1   . TYR C  1 105 ? 42.423  51.432  50.070  1.00 8.95  ? 2136 TYR C CE1   1 
ATOM   9795  C CE2   . TYR C  1 105 ? 43.247  53.012  48.465  1.00 2.00  ? 2136 TYR C CE2   1 
ATOM   9796  C CZ    . TYR C  1 105 ? 42.694  51.781  48.761  1.00 2.00  ? 2136 TYR C CZ    1 
ATOM   9797  O OH    . TYR C  1 105 ? 42.441  50.875  47.762  1.00 2.00  ? 2136 TYR C OH    1 
ATOM   9798  N N     . LYS C  1 106 ? 42.610  53.557  54.801  1.00 9.60  ? 2137 LYS C N     1 
ATOM   9799  C CA    . LYS C  1 106 ? 41.684  52.713  55.559  1.00 6.52  ? 2137 LYS C CA    1 
ATOM   9800  C C     . LYS C  1 106 ? 40.696  52.200  54.530  1.00 6.82  ? 2137 LYS C C     1 
ATOM   9801  O O     . LYS C  1 106 ? 40.313  52.914  53.598  1.00 4.32  ? 2137 LYS C O     1 
ATOM   9802  C CB    . LYS C  1 106 ? 40.942  53.498  56.635  1.00 7.96  ? 2137 LYS C CB    1 
ATOM   9803  C CG    . LYS C  1 106 ? 41.760  53.799  57.862  1.00 9.37  ? 2137 LYS C CG    1 
ATOM   9804  C CD    . LYS C  1 106 ? 42.053  55.295  57.962  1.00 2.00  ? 2137 LYS C CD    1 
ATOM   9805  C CE    . LYS C  1 106 ? 42.101  55.715  59.409  1.00 8.95  ? 2137 LYS C CE    1 
ATOM   9806  N NZ    . LYS C  1 106 ? 41.446  57.031  59.642  1.00 12.69 ? 2137 LYS C NZ    1 
ATOM   9807  N N     . SER C  1 107 ? 40.313  50.946  54.680  1.00 4.34  ? 2138 SER C N     1 
ATOM   9808  C CA    . SER C  1 107 ? 39.381  50.338  53.756  1.00 8.02  ? 2138 SER C CA    1 
ATOM   9809  C C     . SER C  1 107 ? 38.625  49.215  54.466  1.00 8.93  ? 2138 SER C C     1 
ATOM   9810  O O     . SER C  1 107 ? 39.123  48.619  55.438  1.00 6.35  ? 2138 SER C O     1 
ATOM   9811  C CB    . SER C  1 107 ? 40.132  49.786  52.532  1.00 9.40  ? 2138 SER C CB    1 
ATOM   9812  O OG    . SER C  1 107 ? 40.131  48.355  52.519  1.00 15.21 ? 2138 SER C OG    1 
ATOM   9813  N N     . TRP C  1 108 ? 37.413  48.936  53.989  1.00 9.16  ? 2139 TRP C N     1 
ATOM   9814  C CA    . TRP C  1 108 ? 36.622  47.883  54.603  1.00 12.42 ? 2139 TRP C CA    1 
ATOM   9815  C C     . TRP C  1 108 ? 37.342  46.568  54.385  1.00 10.10 ? 2139 TRP C C     1 
ATOM   9816  O O     . TRP C  1 108 ? 37.631  45.840  55.344  1.00 2.00  ? 2139 TRP C O     1 
ATOM   9817  C CB    . TRP C  1 108 ? 35.207  47.790  54.016  1.00 8.64  ? 2139 TRP C CB    1 
ATOM   9818  C CG    . TRP C  1 108 ? 34.397  46.835  54.833  1.00 8.04  ? 2139 TRP C CG    1 
ATOM   9819  C CD1   . TRP C  1 108 ? 34.214  45.497  54.596  1.00 2.00  ? 2139 TRP C CD1   1 
ATOM   9820  C CD2   . TRP C  1 108 ? 33.845  47.088  56.137  1.00 5.01  ? 2139 TRP C CD2   1 
ATOM   9821  N NE1   . TRP C  1 108 ? 33.601  44.903  55.677  1.00 3.41  ? 2139 TRP C NE1   1 
ATOM   9822  C CE2   . TRP C  1 108 ? 33.362  45.858  56.636  1.00 4.70  ? 2139 TRP C CE2   1 
ATOM   9823  C CE3   . TRP C  1 108 ? 33.724  48.240  56.930  1.00 2.00  ? 2139 TRP C CE3   1 
ATOM   9824  C CZ2   . TRP C  1 108 ? 32.759  45.743  57.899  1.00 2.00  ? 2139 TRP C CZ2   1 
ATOM   9825  C CZ3   . TRP C  1 108 ? 33.125  48.122  58.187  1.00 6.18  ? 2139 TRP C CZ3   1 
ATOM   9826  C CH2   . TRP C  1 108 ? 32.650  46.881  58.654  1.00 2.00  ? 2139 TRP C CH2   1 
ATOM   9827  N N     . GLU C  1 109 ? 37.640  46.285  53.114  1.00 11.20 ? 2140 GLU C N     1 
ATOM   9828  C CA    . GLU C  1 109 ? 38.342  45.061  52.731  1.00 12.19 ? 2140 GLU C CA    1 
ATOM   9829  C C     . GLU C  1 109 ? 39.463  44.881  53.730  1.00 8.83  ? 2140 GLU C C     1 
ATOM   9830  O O     . GLU C  1 109 ? 39.754  43.764  54.176  1.00 2.00  ? 2140 GLU C O     1 
ATOM   9831  C CB    . GLU C  1 109 ? 38.939  45.193  51.336  1.00 12.64 ? 2140 GLU C CB    1 
ATOM   9832  C CG    . GLU C  1 109 ? 39.905  44.080  51.017  1.00 11.32 ? 2140 GLU C CG    1 
ATOM   9833  C CD    . GLU C  1 109 ? 39.277  42.689  51.178  1.00 12.99 ? 2140 GLU C CD    1 
ATOM   9834  O OE1   . GLU C  1 109 ? 39.977  41.746  51.612  1.00 11.41 ? 2140 GLU C OE1   1 
ATOM   9835  O OE2   . GLU C  1 109 ? 38.081  42.526  50.864  1.00 13.20 ? 2140 GLU C OE2   1 
ATOM   9836  N N     . ALA C  1 110 ? 40.087  46.006  54.070  1.00 8.87  ? 2141 ALA C N     1 
ATOM   9837  C CA    . ALA C  1 110 ? 41.154  46.010  55.044  1.00 11.10 ? 2141 ALA C CA    1 
ATOM   9838  C C     . ALA C  1 110 ? 40.551  45.506  56.348  1.00 11.26 ? 2141 ALA C C     1 
ATOM   9839  O O     . ALA C  1 110 ? 40.601  44.316  56.645  1.00 17.09 ? 2141 ALA C O     1 
ATOM   9840  C CB    . ALA C  1 110 ? 41.699  47.416  55.226  1.00 6.83  ? 2141 ALA C CB    1 
ATOM   9841  N N     . PHE C  1 111 ? 39.955  46.415  57.103  1.00 13.02 ? 2142 PHE C N     1 
ATOM   9842  C CA    . PHE C  1 111 ? 39.350  46.083  58.384  1.00 11.87 ? 2142 PHE C CA    1 
ATOM   9843  C C     . PHE C  1 111 ? 38.625  44.742  58.469  1.00 12.46 ? 2142 PHE C C     1 
ATOM   9844  O O     . PHE C  1 111 ? 38.510  44.167  59.544  1.00 13.18 ? 2142 PHE C O     1 
ATOM   9845  C CB    . PHE C  1 111 ? 38.373  47.182  58.791  1.00 12.84 ? 2142 PHE C CB    1 
ATOM   9846  C CG    . PHE C  1 111 ? 37.452  46.769  59.889  1.00 16.47 ? 2142 PHE C CG    1 
ATOM   9847  C CD1   . PHE C  1 111 ? 37.817  46.944  61.216  1.00 20.31 ? 2142 PHE C CD1   1 
ATOM   9848  C CD2   . PHE C  1 111 ? 36.246  46.137  59.603  1.00 16.91 ? 2142 PHE C CD2   1 
ATOM   9849  C CE1   . PHE C  1 111 ? 36.992  46.489  62.246  1.00 21.23 ? 2142 PHE C CE1   1 
ATOM   9850  C CE2   . PHE C  1 111 ? 35.428  45.686  60.618  1.00 16.06 ? 2142 PHE C CE2   1 
ATOM   9851  C CZ    . PHE C  1 111 ? 35.799  45.858  61.938  1.00 18.53 ? 2142 PHE C CZ    1 
ATOM   9852  N N     . SER C  1 112 ? 38.123  44.252  57.345  1.00 11.36 ? 2143 SER C N     1 
ATOM   9853  C CA    . SER C  1 112 ? 37.374  42.999  57.322  1.00 12.81 ? 2143 SER C CA    1 
ATOM   9854  C C     . SER C  1 112 ? 38.229  41.749  57.224  1.00 12.98 ? 2143 SER C C     1 
ATOM   9855  O O     . SER C  1 112 ? 38.217  40.926  58.134  1.00 13.91 ? 2143 SER C O     1 
ATOM   9856  C CB    . SER C  1 112 ? 36.391  43.008  56.156  1.00 13.89 ? 2143 SER C CB    1 
ATOM   9857  O OG    . SER C  1 112 ? 37.092  43.089  54.920  1.00 17.07 ? 2143 SER C OG    1 
ATOM   9858  N N     . ASN C  1 113 ? 38.956  41.602  56.114  1.00 13.40 ? 2144 ASN C N     1 
ATOM   9859  C CA    . ASN C  1 113 ? 39.802  40.423  55.890  1.00 13.76 ? 2144 ASN C CA    1 
ATOM   9860  C C     . ASN C  1 113 ? 40.636  40.051  57.128  1.00 14.96 ? 2144 ASN C C     1 
ATOM   9861  O O     . ASN C  1 113 ? 41.412  40.845  57.656  1.00 15.47 ? 2144 ASN C O     1 
ATOM   9862  C CB    . ASN C  1 113 ? 40.701  40.636  54.656  1.00 6.17  ? 2144 ASN C CB    1 
ATOM   9863  C CG    . ASN C  1 113 ? 40.973  39.339  53.902  1.00 6.33  ? 2144 ASN C CG    1 
ATOM   9864  O OD1   . ASN C  1 113 ? 41.238  38.318  54.543  1.00 6.76  ? 2144 ASN C OD1   1 
ATOM   9865  N ND2   . ASN C  1 113 ? 40.909  39.373  52.564  1.00 2.00  ? 2144 ASN C ND2   1 
ATOM   9866  N N     . LEU C  1 114 ? 40.458  38.832  57.604  1.00 17.33 ? 2145 LEU C N     1 
ATOM   9867  C CA    . LEU C  1 114 ? 41.180  38.411  58.786  1.00 17.83 ? 2145 LEU C CA    1 
ATOM   9868  C C     . LEU C  1 114 ? 42.425  37.601  58.482  1.00 19.07 ? 2145 LEU C C     1 
ATOM   9869  O O     . LEU C  1 114 ? 43.199  37.276  59.392  1.00 17.93 ? 2145 LEU C O     1 
ATOM   9870  C CB    . LEU C  1 114 ? 40.242  37.616  59.691  1.00 16.07 ? 2145 LEU C CB    1 
ATOM   9871  C CG    . LEU C  1 114 ? 39.152  38.472  60.342  1.00 11.58 ? 2145 LEU C CG    1 
ATOM   9872  C CD1   . LEU C  1 114 ? 38.681  37.807  61.636  1.00 8.45  ? 2145 LEU C CD1   1 
ATOM   9873  C CD2   . LEU C  1 114 ? 39.691  39.874  60.624  1.00 9.26  ? 2145 LEU C CD2   1 
ATOM   9874  N N     . SER C  1 115 ? 42.616  37.271  57.207  1.00 19.56 ? 2146 SER C N     1 
ATOM   9875  C CA    . SER C  1 115 ? 43.784  36.500  56.801  1.00 21.14 ? 2146 SER C CA    1 
ATOM   9876  C C     . SER C  1 115 ? 45.000  37.438  56.671  1.00 23.93 ? 2146 SER C C     1 
ATOM   9877  O O     . SER C  1 115 ? 46.147  36.987  56.641  1.00 19.85 ? 2146 SER C O     1 
ATOM   9878  C CB    . SER C  1 115 ? 43.509  35.774  55.475  1.00 21.19 ? 2146 SER C CB    1 
ATOM   9879  O OG    . SER C  1 115 ? 42.279  36.182  54.898  1.00 21.21 ? 2146 SER C OG    1 
ATOM   9880  N N     . TYR C  1 116 ? 44.737  38.743  56.602  1.00 23.41 ? 2147 TYR C N     1 
ATOM   9881  C CA    . TYR C  1 116 ? 45.803  39.743  56.506  1.00 24.03 ? 2147 TYR C CA    1 
ATOM   9882  C C     . TYR C  1 116 ? 46.439  39.960  57.876  1.00 18.86 ? 2147 TYR C C     1 
ATOM   9883  O O     . TYR C  1 116 ? 45.930  39.484  58.885  1.00 23.98 ? 2147 TYR C O     1 
ATOM   9884  C CB    . TYR C  1 116 ? 45.246  41.088  56.047  1.00 30.58 ? 2147 TYR C CB    1 
ATOM   9885  C CG    . TYR C  1 116 ? 45.151  41.288  54.556  1.00 36.06 ? 2147 TYR C CG    1 
ATOM   9886  C CD1   . TYR C  1 116 ? 44.129  40.703  53.824  1.00 41.44 ? 2147 TYR C CD1   1 
ATOM   9887  C CD2   . TYR C  1 116 ? 46.029  42.135  53.891  1.00 40.04 ? 2147 TYR C CD2   1 
ATOM   9888  C CE1   . TYR C  1 116 ? 43.972  40.963  52.463  1.00 40.60 ? 2147 TYR C CE1   1 
ATOM   9889  C CE2   . TYR C  1 116 ? 45.884  42.407  52.530  1.00 40.27 ? 2147 TYR C CE2   1 
ATOM   9890  C CZ    . TYR C  1 116 ? 44.849  41.821  51.823  1.00 42.42 ? 2147 TYR C CZ    1 
ATOM   9891  O OH    . TYR C  1 116 ? 44.663  42.114  50.487  1.00 40.77 ? 2147 TYR C OH    1 
ATOM   9892  N N     . TYR C  1 117 ? 47.552  40.683  57.900  1.00 14.98 ? 2148 TYR C N     1 
ATOM   9893  C CA    . TYR C  1 117 ? 48.253  41.010  59.136  1.00 2.00  ? 2148 TYR C CA    1 
ATOM   9894  C C     . TYR C  1 117 ? 48.080  42.518  59.096  1.00 6.18  ? 2148 TYR C C     1 
ATOM   9895  O O     . TYR C  1 117 ? 48.300  43.144  58.043  1.00 2.00  ? 2148 TYR C O     1 
ATOM   9896  C CB    . TYR C  1 117 ? 49.743  40.691  59.014  1.00 10.15 ? 2148 TYR C CB    1 
ATOM   9897  C CG    . TYR C  1 117 ? 50.240  39.355  59.559  1.00 8.47  ? 2148 TYR C CG    1 
ATOM   9898  C CD1   . TYR C  1 117 ? 50.292  39.114  60.931  1.00 4.11  ? 2148 TYR C CD1   1 
ATOM   9899  C CD2   . TYR C  1 117 ? 50.774  38.376  58.699  1.00 6.07  ? 2148 TYR C CD2   1 
ATOM   9900  C CE1   . TYR C  1 117 ? 50.875  37.939  61.444  1.00 6.01  ? 2148 TYR C CE1   1 
ATOM   9901  C CE2   . TYR C  1 117 ? 51.360  37.198  59.195  1.00 4.88  ? 2148 TYR C CE2   1 
ATOM   9902  C CZ    . TYR C  1 117 ? 51.413  36.984  60.574  1.00 7.70  ? 2148 TYR C CZ    1 
ATOM   9903  O OH    . TYR C  1 117 ? 52.016  35.841  61.088  1.00 9.11  ? 2148 TYR C OH    1 
ATOM   9904  N N     . THR C  1 118 ? 47.671  43.124  60.201  1.00 8.74  ? 2149 THR C N     1 
ATOM   9905  C CA    . THR C  1 118 ? 47.484  44.572  60.163  1.00 10.40 ? 2149 THR C CA    1 
ATOM   9906  C C     . THR C  1 118 ? 48.861  45.217  60.168  1.00 14.79 ? 2149 THR C C     1 
ATOM   9907  O O     . THR C  1 118 ? 49.834  44.601  60.595  1.00 16.49 ? 2149 THR C O     1 
ATOM   9908  C CB    . THR C  1 118 ? 46.651  45.079  61.358  1.00 8.89  ? 2149 THR C CB    1 
ATOM   9909  O OG1   . THR C  1 118 ? 46.649  46.518  61.360  1.00 11.57 ? 2149 THR C OG1   1 
ATOM   9910  C CG2   . THR C  1 118 ? 47.212  44.533  62.682  1.00 6.39  ? 2149 THR C CG2   1 
ATOM   9911  N N     . ARG C  1 119 ? 48.964  46.446  59.682  1.00 13.94 ? 2150 ARG C N     1 
ATOM   9912  C CA    . ARG C  1 119 ? 50.264  47.092  59.661  1.00 16.33 ? 2150 ARG C CA    1 
ATOM   9913  C C     . ARG C  1 119 ? 50.272  48.417  60.413  1.00 17.93 ? 2150 ARG C C     1 
ATOM   9914  O O     . ARG C  1 119 ? 49.526  49.339  60.072  1.00 24.14 ? 2150 ARG C O     1 
ATOM   9915  C CB    . ARG C  1 119 ? 50.726  47.286  58.208  1.00 18.33 ? 2150 ARG C CB    1 
ATOM   9916  C CG    . ARG C  1 119 ? 51.492  46.083  57.630  1.00 17.16 ? 2150 ARG C CG    1 
ATOM   9917  C CD    . ARG C  1 119 ? 52.997  46.245  57.802  1.00 14.70 ? 2150 ARG C CD    1 
ATOM   9918  N NE    . ARG C  1 119 ? 53.482  47.445  57.125  1.00 17.62 ? 2150 ARG C NE    1 
ATOM   9919  C CZ    . ARG C  1 119 ? 53.867  47.498  55.849  1.00 16.19 ? 2150 ARG C CZ    1 
ATOM   9920  N NH1   . ARG C  1 119 ? 53.825  46.414  55.080  1.00 8.27  ? 2150 ARG C NH1   1 
ATOM   9921  N NH2   . ARG C  1 119 ? 54.274  48.653  55.330  1.00 11.57 ? 2150 ARG C NH2   1 
ATOM   9922  N N     . ALA C  1 120 ? 51.120  48.498  61.436  1.00 17.01 ? 2151 ALA C N     1 
ATOM   9923  C CA    . ALA C  1 120 ? 51.248  49.693  62.264  1.00 15.10 ? 2151 ALA C CA    1 
ATOM   9924  C C     . ALA C  1 120 ? 51.546  50.912  61.424  1.00 13.48 ? 2151 ALA C C     1 
ATOM   9925  O O     . ALA C  1 120 ? 51.322  52.040  61.845  1.00 18.73 ? 2151 ALA C O     1 
ATOM   9926  C CB    . ALA C  1 120 ? 52.350  49.493  63.279  1.00 19.87 ? 2151 ALA C CB    1 
ATOM   9927  N N     . LEU C  1 121 ? 52.093  50.680  60.243  1.00 11.45 ? 2152 LEU C N     1 
ATOM   9928  C CA    . LEU C  1 121 ? 52.401  51.765  59.335  1.00 10.97 ? 2152 LEU C CA    1 
ATOM   9929  C C     . LEU C  1 121 ? 52.094  51.276  57.943  1.00 8.04  ? 2152 LEU C C     1 
ATOM   9930  O O     . LEU C  1 121 ? 52.393  50.137  57.574  1.00 4.44  ? 2152 LEU C O     1 
ATOM   9931  C CB    . LEU C  1 121 ? 53.871  52.179  59.419  1.00 14.78 ? 2152 LEU C CB    1 
ATOM   9932  C CG    . LEU C  1 121 ? 54.276  53.252  60.426  1.00 12.95 ? 2152 LEU C CG    1 
ATOM   9933  C CD1   . LEU C  1 121 ? 55.725  53.606  60.145  1.00 11.04 ? 2152 LEU C CD1   1 
ATOM   9934  C CD2   . LEU C  1 121 ? 53.380  54.473  60.330  1.00 10.32 ? 2152 LEU C CD2   1 
ATOM   9935  N N     . PRO C  1 122 ? 51.518  52.155  57.132  1.00 10.64 ? 2153 PRO C N     1 
ATOM   9936  C CA    . PRO C  1 122 ? 51.149  51.821  55.757  1.00 15.63 ? 2153 PRO C CA    1 
ATOM   9937  C C     . PRO C  1 122 ? 52.330  51.429  54.902  1.00 11.91 ? 2153 PRO C C     1 
ATOM   9938  O O     . PRO C  1 122 ? 53.462  51.827  55.171  1.00 15.11 ? 2153 PRO C O     1 
ATOM   9939  C CB    . PRO C  1 122 ? 50.505  53.101  55.242  1.00 12.35 ? 2153 PRO C CB    1 
ATOM   9940  C CG    . PRO C  1 122 ? 51.131  54.174  56.079  1.00 11.63 ? 2153 PRO C CG    1 
ATOM   9941  C CD    . PRO C  1 122 ? 51.236  53.562  57.448  1.00 10.80 ? 2153 PRO C CD    1 
ATOM   9942  N N     . PRO C  1 123 ? 52.089  50.599  53.881  1.00 10.86 ? 2154 PRO C N     1 
ATOM   9943  C CA    . PRO C  1 123 ? 53.200  50.207  53.013  1.00 15.68 ? 2154 PRO C CA    1 
ATOM   9944  C C     . PRO C  1 123 ? 53.540  51.424  52.165  1.00 15.12 ? 2154 PRO C C     1 
ATOM   9945  O O     . PRO C  1 123 ? 53.069  52.537  52.441  1.00 14.25 ? 2154 PRO C O     1 
ATOM   9946  C CB    . PRO C  1 123 ? 52.626  49.074  52.173  1.00 12.72 ? 2154 PRO C CB    1 
ATOM   9947  C CG    . PRO C  1 123 ? 51.150  49.324  52.177  1.00 12.35 ? 2154 PRO C CG    1 
ATOM   9948  C CD    . PRO C  1 123 ? 50.826  49.944  53.505  1.00 10.11 ? 2154 PRO C CD    1 
ATOM   9949  N N     . VAL C  1 124 ? 54.339  51.219  51.127  1.00 14.35 ? 2155 VAL C N     1 
ATOM   9950  C CA    . VAL C  1 124 ? 54.712  52.326  50.269  1.00 16.60 ? 2155 VAL C CA    1 
ATOM   9951  C C     . VAL C  1 124 ? 54.185  52.103  48.869  1.00 18.84 ? 2155 VAL C C     1 
ATOM   9952  O O     . VAL C  1 124 ? 54.339  51.016  48.303  1.00 18.99 ? 2155 VAL C O     1 
ATOM   9953  C CB    . VAL C  1 124 ? 56.228  52.492  50.200  1.00 17.38 ? 2155 VAL C CB    1 
ATOM   9954  C CG1   . VAL C  1 124 ? 56.554  53.906  49.764  1.00 15.37 ? 2155 VAL C CG1   1 
ATOM   9955  C CG2   . VAL C  1 124 ? 56.856  52.175  51.559  1.00 13.83 ? 2155 VAL C CG2   1 
ATOM   9956  N N     . ALA C  1 125 ? 53.561  53.137  48.314  1.00 20.53 ? 2156 ALA C N     1 
ATOM   9957  C CA    . ALA C  1 125 ? 52.996  53.046  46.972  1.00 25.67 ? 2156 ALA C CA    1 
ATOM   9958  C C     . ALA C  1 125 ? 53.980  52.388  46.030  1.00 28.11 ? 2156 ALA C C     1 
ATOM   9959  O O     . ALA C  1 125 ? 55.134  52.816  45.917  1.00 27.66 ? 2156 ALA C O     1 
ATOM   9960  C CB    . ALA C  1 125 ? 52.630  54.439  46.445  1.00 21.49 ? 2156 ALA C CB    1 
ATOM   9961  N N     . ASP C  1 126 ? 53.526  51.338  45.362  1.00 29.50 ? 2157 ASP C N     1 
ATOM   9962  C CA    . ASP C  1 126 ? 54.380  50.652  44.416  1.00 35.81 ? 2157 ASP C CA    1 
ATOM   9963  C C     . ASP C  1 126 ? 54.742  51.651  43.328  1.00 37.81 ? 2157 ASP C C     1 
ATOM   9964  O O     . ASP C  1 126 ? 55.645  51.422  42.523  1.00 45.39 ? 2157 ASP C O     1 
ATOM   9965  C CB    . ASP C  1 126 ? 53.639  49.460  43.839  1.00 37.16 ? 2157 ASP C CB    1 
ATOM   9966  C CG    . ASP C  1 126 ? 53.081  48.568  44.922  1.00 42.95 ? 2157 ASP C CG    1 
ATOM   9967  O OD1   . ASP C  1 126 ? 53.634  48.612  46.049  1.00 41.33 ? 2157 ASP C OD1   1 
ATOM   9968  O OD2   . ASP C  1 126 ? 52.100  47.833  44.661  1.00 41.94 ? 2157 ASP C OD2   1 
ATOM   9969  N N     . ASP C  1 127 ? 54.033  52.773  43.324  1.00 37.60 ? 2158 ASP C N     1 
ATOM   9970  C CA    . ASP C  1 127 ? 54.267  53.830  42.357  1.00 34.80 ? 2158 ASP C CA    1 
ATOM   9971  C C     . ASP C  1 127 ? 55.349  54.791  42.869  1.00 35.56 ? 2158 ASP C C     1 
ATOM   9972  O O     . ASP C  1 127 ? 55.875  55.615  42.118  1.00 35.48 ? 2158 ASP C O     1 
ATOM   9973  C CB    . ASP C  1 127 ? 52.946  54.562  42.085  1.00 34.11 ? 2158 ASP C CB    1 
ATOM   9974  C CG    . ASP C  1 127 ? 52.995  56.031  42.455  1.00 36.68 ? 2158 ASP C CG    1 
ATOM   9975  O OD1   . ASP C  1 127 ? 53.262  56.357  43.641  1.00 32.29 ? 2158 ASP C OD1   1 
ATOM   9976  O OD2   . ASP C  1 127 ? 52.760  56.857  41.544  1.00 38.78 ? 2158 ASP C OD2   1 
ATOM   9977  N N     . CYS C  1 128 ? 55.668  54.683  44.153  1.00 31.88 ? 2159 CYS C N     1 
ATOM   9978  C CA    . CYS C  1 128 ? 56.702  55.513  44.765  1.00 32.67 ? 2159 CYS C CA    1 
ATOM   9979  C C     . CYS C  1 128 ? 58.035  55.265  44.027  1.00 35.76 ? 2159 CYS C C     1 
ATOM   9980  O O     . CYS C  1 128 ? 58.269  54.167  43.505  1.00 37.41 ? 2159 CYS C O     1 
ATOM   9981  C CB    . CYS C  1 128 ? 56.841  55.148  46.245  1.00 29.91 ? 2159 CYS C CB    1 
ATOM   9982  S SG    . CYS C  1 128 ? 55.711  56.042  47.352  1.00 25.55 ? 2159 CYS C SG    1 
ATOM   9983  N N     . PRO C  1 129 ? 58.928  56.277  43.981  1.00 37.10 ? 2160 PRO C N     1 
ATOM   9984  C CA    . PRO C  1 129 ? 60.229  56.170  43.300  1.00 34.14 ? 2160 PRO C CA    1 
ATOM   9985  C C     . PRO C  1 129 ? 61.268  55.284  43.956  1.00 31.99 ? 2160 PRO C C     1 
ATOM   9986  O O     . PRO C  1 129 ? 61.850  54.417  43.309  1.00 30.81 ? 2160 PRO C O     1 
ATOM   9987  C CB    . PRO C  1 129 ? 60.711  57.615  43.211  1.00 34.18 ? 2160 PRO C CB    1 
ATOM   9988  C CG    . PRO C  1 129 ? 60.086  58.279  44.385  1.00 37.33 ? 2160 PRO C CG    1 
ATOM   9989  C CD    . PRO C  1 129 ? 58.741  57.612  44.580  1.00 39.01 ? 2160 PRO C CD    1 
ATOM   9990  N N     . THR C  1 130 ? 61.509  55.518  45.238  1.00 30.80 ? 2161 THR C N     1 
ATOM   9991  C CA    . THR C  1 130 ? 62.492  54.735  45.969  1.00 29.76 ? 2161 THR C CA    1 
ATOM   9992  C C     . THR C  1 130 ? 61.841  53.865  47.026  1.00 29.45 ? 2161 THR C C     1 
ATOM   9993  O O     . THR C  1 130 ? 60.820  54.230  47.603  1.00 28.02 ? 2161 THR C O     1 
ATOM   9994  C CB    . THR C  1 130 ? 63.537  55.650  46.640  1.00 31.77 ? 2161 THR C CB    1 
ATOM   9995  O OG1   . THR C  1 130 ? 63.221  55.820  48.028  1.00 29.84 ? 2161 THR C OG1   1 
ATOM   9996  C CG2   . THR C  1 130 ? 63.553  57.002  45.954  1.00 30.78 ? 2161 THR C CG2   1 
ATOM   9997  N N     . PRO C  1 131 ? 62.426  52.690  47.277  1.00 30.17 ? 2162 PRO C N     1 
ATOM   9998  C CA    . PRO C  1 131 ? 61.954  51.707  48.261  1.00 29.29 ? 2162 PRO C CA    1 
ATOM   9999  C C     . PRO C  1 131 ? 61.470  52.280  49.597  1.00 27.74 ? 2162 PRO C C     1 
ATOM   10000 O O     . PRO C  1 131 ? 60.652  51.664  50.276  1.00 29.18 ? 2162 PRO C O     1 
ATOM   10001 C CB    . PRO C  1 131 ? 63.148  50.773  48.434  1.00 28.47 ? 2162 PRO C CB    1 
ATOM   10002 C CG    . PRO C  1 131 ? 63.856  50.836  47.119  1.00 30.20 ? 2162 PRO C CG    1 
ATOM   10003 C CD    . PRO C  1 131 ? 63.629  52.224  46.562  1.00 29.43 ? 2162 PRO C CD    1 
ATOM   10004 N N     . MET C  1 132 ? 61.978  53.439  49.991  1.00 24.30 ? 2163 MET C N     1 
ATOM   10005 C CA    . MET C  1 132 ? 61.537  54.038  51.245  1.00 24.19 ? 2163 MET C CA    1 
ATOM   10006 C C     . MET C  1 132 ? 60.771  55.298  50.896  1.00 27.17 ? 2163 MET C C     1 
ATOM   10007 O O     . MET C  1 132 ? 60.750  56.270  51.661  1.00 30.12 ? 2163 MET C O     1 
ATOM   10008 C CB    . MET C  1 132 ? 62.723  54.403  52.144  1.00 21.39 ? 2163 MET C CB    1 
ATOM   10009 C CG    . MET C  1 132 ? 63.506  53.229  52.665  1.00 18.57 ? 2163 MET C CG    1 
ATOM   10010 S SD    . MET C  1 132 ? 62.585  52.189  53.810  1.00 22.04 ? 2163 MET C SD    1 
ATOM   10011 C CE    . MET C  1 132 ? 62.182  50.773  52.708  1.00 15.54 ? 2163 MET C CE    1 
ATOM   10012 N N     . GLY C  1 133 ? 60.145  55.275  49.727  1.00 26.72 ? 2164 GLY C N     1 
ATOM   10013 C CA    . GLY C  1 133 ? 59.383  56.422  49.278  1.00 29.82 ? 2164 GLY C CA    1 
ATOM   10014 C C     . GLY C  1 133 ? 60.189  57.265  48.319  1.00 32.19 ? 2164 GLY C C     1 
ATOM   10015 O O     . GLY C  1 133 ? 60.071  57.129  47.102  1.00 28.33 ? 2164 GLY C O     1 
ATOM   10016 N N     . VAL C  1 134 ? 61.023  58.135  48.875  1.00 35.07 ? 2165 VAL C N     1 
ATOM   10017 C CA    . VAL C  1 134 ? 61.861  59.011  48.065  1.00 38.26 ? 2165 VAL C CA    1 
ATOM   10018 C C     . VAL C  1 134 ? 63.331  58.991  48.486  1.00 37.76 ? 2165 VAL C C     1 
ATOM   10019 O O     . VAL C  1 134 ? 64.218  58.958  47.637  1.00 38.54 ? 2165 VAL C O     1 
ATOM   10020 C CB    . VAL C  1 134 ? 61.353  60.459  48.121  1.00 41.17 ? 2165 VAL C CB    1 
ATOM   10021 C CG1   . VAL C  1 134 ? 60.301  60.669  47.044  1.00 43.11 ? 2165 VAL C CG1   1 
ATOM   10022 C CG2   . VAL C  1 134 ? 60.790  60.763  49.511  1.00 41.19 ? 2165 VAL C CG2   1 
ATOM   10023 N N     . LYS C  1 135 ? 63.595  59.018  49.791  1.00 38.03 ? 2166 LYS C N     1 
ATOM   10024 C CA    . LYS C  1 135 ? 64.972  59.001  50.266  1.00 36.19 ? 2166 LYS C CA    1 
ATOM   10025 C C     . LYS C  1 135 ? 65.603  57.649  49.962  1.00 38.29 ? 2166 LYS C C     1 
ATOM   10026 O O     . LYS C  1 135 ? 64.991  56.604  50.182  1.00 37.32 ? 2166 LYS C O     1 
ATOM   10027 C CB    . LYS C  1 135 ? 65.023  59.282  51.765  1.00 32.21 ? 2166 LYS C CB    1 
ATOM   10028 C CG    . LYS C  1 135 ? 64.778  60.742  52.113  1.00 30.23 ? 2166 LYS C CG    1 
ATOM   10029 C CD    . LYS C  1 135 ? 65.165  61.049  53.550  1.00 25.77 ? 2166 LYS C CD    1 
ATOM   10030 C CE    . LYS C  1 135 ? 63.931  61.343  54.387  1.00 28.24 ? 2166 LYS C CE    1 
ATOM   10031 N NZ    . LYS C  1 135 ? 64.188  62.318  55.502  1.00 27.02 ? 2166 LYS C NZ    1 
ATOM   10032 N N     . GLY C  1 136 ? 66.825  57.672  49.439  1.00 39.67 ? 2167 GLY C N     1 
ATOM   10033 C CA    . GLY C  1 136 ? 67.501  56.429  49.122  1.00 40.35 ? 2167 GLY C CA    1 
ATOM   10034 C C     . GLY C  1 136 ? 67.728  56.233  47.638  1.00 41.72 ? 2167 GLY C C     1 
ATOM   10035 O O     . GLY C  1 136 ? 67.474  57.130  46.837  1.00 40.28 ? 2167 GLY C O     1 
ATOM   10036 N N     . ASN C  1 137 ? 68.195  55.048  47.267  1.00 42.45 ? 2168 ASN C N     1 
ATOM   10037 C CA    . ASN C  1 137 ? 68.475  54.762  45.871  1.00 44.96 ? 2168 ASN C CA    1 
ATOM   10038 C C     . ASN C  1 137 ? 67.389  53.933  45.227  1.00 43.81 ? 2168 ASN C C     1 
ATOM   10039 O O     . ASN C  1 137 ? 66.456  53.495  45.895  1.00 45.59 ? 2168 ASN C O     1 
ATOM   10040 C CB    . ASN C  1 137 ? 69.807  54.023  45.744  1.00 49.37 ? 2168 ASN C CB    1 
ATOM   10041 C CG    . ASN C  1 137 ? 70.992  54.924  45.983  1.00 49.86 ? 2168 ASN C CG    1 
ATOM   10042 O OD1   . ASN C  1 137 ? 71.472  55.585  45.067  1.00 50.41 ? 2168 ASN C OD1   1 
ATOM   10043 N ND2   . ASN C  1 137 ? 71.471  54.960  47.221  1.00 53.78 ? 2168 ASN C ND2   1 
ATOM   10044 N N     . LYS C  1 138 ? 67.531  53.719  43.922  1.00 45.11 ? 2169 LYS C N     1 
ATOM   10045 C CA    . LYS C  1 138 ? 66.583  52.928  43.156  1.00 47.57 ? 2169 LYS C CA    1 
ATOM   10046 C C     . LYS C  1 138 ? 66.390  51.591  43.848  1.00 47.98 ? 2169 LYS C C     1 
ATOM   10047 O O     . LYS C  1 138 ? 65.449  50.857  43.556  1.00 47.86 ? 2169 LYS C O     1 
ATOM   10048 C CB    . LYS C  1 138 ? 67.105  52.702  41.737  1.00 50.38 ? 2169 LYS C CB    1 
ATOM   10049 C CG    . LYS C  1 138 ? 66.744  53.809  40.761  1.00 56.94 ? 2169 LYS C CG    1 
ATOM   10050 C CD    . LYS C  1 138 ? 67.941  54.210  39.906  1.00 61.81 ? 2169 LYS C CD    1 
ATOM   10051 C CE    . LYS C  1 138 ? 67.833  55.661  39.456  1.00 62.29 ? 2169 LYS C CE    1 
ATOM   10052 N NZ    . LYS C  1 138 ? 68.306  55.841  38.060  1.00 65.74 ? 2169 LYS C NZ    1 
ATOM   10053 N N     . GLU C  1 139 ? 67.296  51.272  44.764  1.00 45.10 ? 2170 GLU C N     1 
ATOM   10054 C CA    . GLU C  1 139 ? 67.195  50.028  45.504  1.00 43.84 ? 2170 GLU C CA    1 
ATOM   10055 C C     . GLU C  1 139 ? 67.786  50.113  46.893  1.00 38.42 ? 2170 GLU C C     1 
ATOM   10056 O O     . GLU C  1 139 ? 68.205  51.176  47.359  1.00 38.20 ? 2170 GLU C O     1 
ATOM   10057 C CB    . GLU C  1 139 ? 67.887  48.903  44.759  1.00 49.36 ? 2170 GLU C CB    1 
ATOM   10058 C CG    . GLU C  1 139 ? 67.092  48.346  43.626  1.00 54.38 ? 2170 GLU C CG    1 
ATOM   10059 C CD    . GLU C  1 139 ? 67.928  48.240  42.390  1.00 61.32 ? 2170 GLU C CD    1 
ATOM   10060 O OE1   . GLU C  1 139 ? 68.368  47.114  42.070  1.00 62.56 ? 2170 GLU C OE1   1 
ATOM   10061 O OE2   . GLU C  1 139 ? 68.153  49.290  41.748  1.00 61.57 ? 2170 GLU C OE2   1 
ATOM   10062 N N     . LEU C  1 140 ? 67.822  48.954  47.536  1.00 34.97 ? 2171 LEU C N     1 
ATOM   10063 C CA    . LEU C  1 140 ? 68.341  48.813  48.883  1.00 30.15 ? 2171 LEU C CA    1 
ATOM   10064 C C     . LEU C  1 140 ? 69.539  47.859  48.892  1.00 24.92 ? 2171 LEU C C     1 
ATOM   10065 O O     . LEU C  1 140 ? 69.652  46.955  48.045  1.00 20.68 ? 2171 LEU C O     1 
ATOM   10066 C CB    . LEU C  1 140 ? 67.248  48.255  49.818  1.00 27.11 ? 2171 LEU C CB    1 
ATOM   10067 C CG    . LEU C  1 140 ? 66.275  49.179  50.553  1.00 28.83 ? 2171 LEU C CG    1 
ATOM   10068 C CD1   . LEU C  1 140 ? 66.811  49.511  51.937  1.00 29.33 ? 2171 LEU C CD1   1 
ATOM   10069 C CD2   . LEU C  1 140 ? 66.078  50.445  49.754  1.00 33.12 ? 2171 LEU C CD2   1 
ATOM   10070 N N     . PRO C  1 141 ? 70.449  48.056  49.857  1.00 19.46 ? 2172 PRO C N     1 
ATOM   10071 C CA    . PRO C  1 141 ? 71.629  47.206  49.982  1.00 19.28 ? 2172 PRO C CA    1 
ATOM   10072 C C     . PRO C  1 141 ? 71.220  45.755  49.819  1.00 19.20 ? 2172 PRO C C     1 
ATOM   10073 O O     . PRO C  1 141 ? 70.173  45.348  50.309  1.00 20.55 ? 2172 PRO C O     1 
ATOM   10074 C CB    . PRO C  1 141 ? 72.125  47.482  51.401  1.00 16.03 ? 2172 PRO C CB    1 
ATOM   10075 C CG    . PRO C  1 141 ? 71.096  48.426  52.029  1.00 16.71 ? 2172 PRO C CG    1 
ATOM   10076 C CD    . PRO C  1 141 ? 70.426  49.101  50.894  1.00 17.84 ? 2172 PRO C CD    1 
ATOM   10077 N N     . ASP C  1 142 ? 72.020  44.975  49.108  1.00 21.71 ? 2173 ASP C N     1 
ATOM   10078 C CA    . ASP C  1 142 ? 71.690  43.574  48.955  1.00 24.35 ? 2173 ASP C CA    1 
ATOM   10079 C C     . ASP C  1 142 ? 71.616  43.067  50.397  1.00 26.85 ? 2173 ASP C C     1 
ATOM   10080 O O     . ASP C  1 142 ? 72.346  43.549  51.269  1.00 26.63 ? 2173 ASP C O     1 
ATOM   10081 C CB    . ASP C  1 142 ? 72.782  42.858  48.156  1.00 21.10 ? 2173 ASP C CB    1 
ATOM   10082 C CG    . ASP C  1 142 ? 72.983  41.424  48.595  1.00 27.00 ? 2173 ASP C CG    1 
ATOM   10083 O OD1   . ASP C  1 142 ? 72.824  40.501  47.762  1.00 24.21 ? 2173 ASP C OD1   1 
ATOM   10084 O OD2   . ASP C  1 142 ? 73.307  41.218  49.781  1.00 28.88 ? 2173 ASP C OD2   1 
ATOM   10085 N N     . SER C  1 143 ? 70.724  42.115  50.655  1.00 30.29 ? 2174 SER C N     1 
ATOM   10086 C CA    . SER C  1 143 ? 70.556  41.569  52.000  1.00 30.27 ? 2174 SER C CA    1 
ATOM   10087 C C     . SER C  1 143 ? 71.734  40.688  52.421  1.00 34.28 ? 2174 SER C C     1 
ATOM   10088 O O     . SER C  1 143 ? 72.228  40.810  53.549  1.00 32.41 ? 2174 SER C O     1 
ATOM   10089 C CB    . SER C  1 143 ? 69.247  40.767  52.092  1.00 32.35 ? 2174 SER C CB    1 
ATOM   10090 O OG    . SER C  1 143 ? 69.126  39.811  51.048  1.00 29.97 ? 2174 SER C OG    1 
ATOM   10091 N N     . LYS C  1 144 ? 72.165  39.803  51.518  1.00 34.04 ? 2175 LYS C N     1 
ATOM   10092 C CA    . LYS C  1 144 ? 73.296  38.906  51.773  1.00 33.26 ? 2175 LYS C CA    1 
ATOM   10093 C C     . LYS C  1 144 ? 74.380  39.692  52.499  1.00 28.74 ? 2175 LYS C C     1 
ATOM   10094 O O     . LYS C  1 144 ? 74.880  39.279  53.542  1.00 26.97 ? 2175 LYS C O     1 
ATOM   10095 C CB    . LYS C  1 144 ? 73.844  38.361  50.448  1.00 35.62 ? 2175 LYS C CB    1 
ATOM   10096 C CG    . LYS C  1 144 ? 74.802  37.186  50.596  1.00 40.82 ? 2175 LYS C CG    1 
ATOM   10097 C CD    . LYS C  1 144 ? 75.880  37.198  49.518  1.00 45.23 ? 2175 LYS C CD    1 
ATOM   10098 C CE    . LYS C  1 144 ? 76.757  35.957  49.590  1.00 44.93 ? 2175 LYS C CE    1 
ATOM   10099 N NZ    . LYS C  1 144 ? 76.356  34.931  48.580  1.00 46.74 ? 2175 LYS C NZ    1 
ATOM   10100 N N     . GLU C  1 145 ? 74.721  40.842  51.933  1.00 24.31 ? 2176 GLU C N     1 
ATOM   10101 C CA    . GLU C  1 145 ? 75.716  41.711  52.519  1.00 26.06 ? 2176 GLU C CA    1 
ATOM   10102 C C     . GLU C  1 145 ? 75.291  41.961  53.946  1.00 21.25 ? 2176 GLU C C     1 
ATOM   10103 O O     . GLU C  1 145 ? 75.699  41.226  54.837  1.00 22.61 ? 2176 GLU C O     1 
ATOM   10104 C CB    . GLU C  1 145 ? 75.794  43.034  51.755  1.00 31.18 ? 2176 GLU C CB    1 
ATOM   10105 C CG    . GLU C  1 145 ? 76.179  42.870  50.303  1.00 41.56 ? 2176 GLU C CG    1 
ATOM   10106 C CD    . GLU C  1 145 ? 77.583  43.350  50.027  1.00 48.79 ? 2176 GLU C CD    1 
ATOM   10107 O OE1   . GLU C  1 145 ? 78.480  43.068  50.854  1.00 51.07 ? 2176 GLU C OE1   1 
ATOM   10108 O OE2   . GLU C  1 145 ? 77.783  44.012  48.981  1.00 51.69 ? 2176 GLU C OE2   1 
ATOM   10109 N N     . VAL C  1 146 ? 74.474  42.994  54.151  1.00 16.77 ? 2177 VAL C N     1 
ATOM   10110 C CA    . VAL C  1 146 ? 73.958  43.364  55.475  1.00 11.42 ? 2177 VAL C CA    1 
ATOM   10111 C C     . VAL C  1 146 ? 73.949  42.156  56.427  1.00 10.24 ? 2177 VAL C C     1 
ATOM   10112 O O     . VAL C  1 146 ? 74.490  42.209  57.552  1.00 3.01  ? 2177 VAL C O     1 
ATOM   10113 C CB    . VAL C  1 146 ? 72.501  43.916  55.365  1.00 11.85 ? 2177 VAL C CB    1 
ATOM   10114 C CG1   . VAL C  1 146 ? 72.268  44.955  56.445  1.00 5.48  ? 2177 VAL C CG1   1 
ATOM   10115 C CG2   . VAL C  1 146 ? 72.240  44.521  53.955  1.00 4.09  ? 2177 VAL C CG2   1 
ATOM   10116 N N     . LEU C  1 147 ? 73.317  41.084  55.942  1.00 8.55  ? 2178 LEU C N     1 
ATOM   10117 C CA    . LEU C  1 147 ? 73.198  39.798  56.629  1.00 9.07  ? 2178 LEU C CA    1 
ATOM   10118 C C     . LEU C  1 147 ? 74.533  39.461  57.256  1.00 9.61  ? 2178 LEU C C     1 
ATOM   10119 O O     . LEU C  1 147 ? 74.661  39.333  58.470  1.00 6.95  ? 2178 LEU C O     1 
ATOM   10120 C CB    . LEU C  1 147 ? 72.850  38.713  55.606  1.00 10.84 ? 2178 LEU C CB    1 
ATOM   10121 C CG    . LEU C  1 147 ? 72.080  37.464  56.054  1.00 11.95 ? 2178 LEU C CG    1 
ATOM   10122 C CD1   . LEU C  1 147 ? 72.461  36.313  55.150  1.00 11.25 ? 2178 LEU C CD1   1 
ATOM   10123 C CD2   . LEU C  1 147 ? 72.380  37.130  57.507  1.00 11.22 ? 2178 LEU C CD2   1 
ATOM   10124 N N     . GLU C  1 148 ? 75.525  39.301  56.388  1.00 12.89 ? 2179 GLU C N     1 
ATOM   10125 C CA    . GLU C  1 148 ? 76.894  39.013  56.796  1.00 15.38 ? 2179 GLU C CA    1 
ATOM   10126 C C     . GLU C  1 148 ? 77.493  40.266  57.424  1.00 13.08 ? 2179 GLU C C     1 
ATOM   10127 O O     . GLU C  1 148 ? 77.773  40.299  58.618  1.00 14.14 ? 2179 GLU C O     1 
ATOM   10128 C CB    . GLU C  1 148 ? 77.739  38.627  55.586  1.00 14.14 ? 2179 GLU C CB    1 
ATOM   10129 C CG    . GLU C  1 148 ? 77.100  37.644  54.637  1.00 14.26 ? 2179 GLU C CG    1 
ATOM   10130 C CD    . GLU C  1 148 ? 77.733  37.720  53.265  1.00 19.44 ? 2179 GLU C CD    1 
ATOM   10131 O OE1   . GLU C  1 148 ? 78.165  38.839  52.881  1.00 17.18 ? 2179 GLU C OE1   1 
ATOM   10132 O OE2   . GLU C  1 148 ? 77.806  36.674  52.579  1.00 19.07 ? 2179 GLU C OE2   1 
ATOM   10133 N N     . LYS C  1 149 ? 77.683  41.284  56.591  1.00 12.16 ? 2180 LYS C N     1 
ATOM   10134 C CA    . LYS C  1 149 ? 78.246  42.560  57.009  1.00 16.26 ? 2180 LYS C CA    1 
ATOM   10135 C C     . LYS C  1 149 ? 77.901  43.031  58.420  1.00 18.30 ? 2180 LYS C C     1 
ATOM   10136 O O     . LYS C  1 149 ? 78.596  43.896  58.950  1.00 21.69 ? 2180 LYS C O     1 
ATOM   10137 C CB    . LYS C  1 149 ? 77.855  43.665  56.026  1.00 17.05 ? 2180 LYS C CB    1 
ATOM   10138 C CG    . LYS C  1 149 ? 78.328  43.436  54.608  1.00 26.51 ? 2180 LYS C CG    1 
ATOM   10139 C CD    . LYS C  1 149 ? 79.781  43.819  54.438  1.00 32.51 ? 2180 LYS C CD    1 
ATOM   10140 C CE    . LYS C  1 149 ? 80.075  44.214  53.004  1.00 33.99 ? 2180 LYS C CE    1 
ATOM   10141 N NZ    . LYS C  1 149 ? 81.488  43.950  52.653  1.00 35.71 ? 2180 LYS C NZ    1 
ATOM   10142 N N     . VAL C  1 150 ? 76.845  42.507  59.038  1.00 16.50 ? 2181 VAL C N     1 
ATOM   10143 C CA    . VAL C  1 150 ? 76.533  42.969  60.391  1.00 13.14 ? 2181 VAL C CA    1 
ATOM   10144 C C     . VAL C  1 150 ? 75.564  42.095  61.171  1.00 15.15 ? 2181 VAL C C     1 
ATOM   10145 O O     . VAL C  1 150 ? 75.255  42.395  62.326  1.00 16.73 ? 2181 VAL C O     1 
ATOM   10146 C CB    . VAL C  1 150 ? 75.943  44.402  60.375  1.00 14.07 ? 2181 VAL C CB    1 
ATOM   10147 C CG1   . VAL C  1 150 ? 77.035  45.420  60.571  1.00 15.38 ? 2181 VAL C CG1   1 
ATOM   10148 C CG2   . VAL C  1 150 ? 75.208  44.643  59.073  1.00 15.88 ? 2181 VAL C CG2   1 
ATOM   10149 N N     . LEU C  1 151 ? 75.088  41.016  60.571  1.00 10.96 ? 2182 LEU C N     1 
ATOM   10150 C CA    . LEU C  1 151 ? 74.131  40.197  61.292  1.00 16.33 ? 2182 LEU C CA    1 
ATOM   10151 C C     . LEU C  1 151 ? 74.625  38.868  61.804  1.00 18.97 ? 2182 LEU C C     1 
ATOM   10152 O O     . LEU C  1 151 ? 74.585  38.615  63.006  1.00 16.79 ? 2182 LEU C O     1 
ATOM   10153 C CB    . LEU C  1 151 ? 72.887  39.963  60.436  1.00 18.55 ? 2182 LEU C CB    1 
ATOM   10154 C CG    . LEU C  1 151 ? 72.072  41.206  60.062  1.00 21.51 ? 2182 LEU C CG    1 
ATOM   10155 C CD1   . LEU C  1 151 ? 70.948  40.764  59.147  1.00 15.34 ? 2182 LEU C CD1   1 
ATOM   10156 C CD2   . LEU C  1 151 ? 71.518  41.924  61.303  1.00 17.11 ? 2182 LEU C CD2   1 
ATOM   10157 N N     . LEU C  1 152 ? 75.062  38.008  60.890  1.00 22.14 ? 2183 LEU C N     1 
ATOM   10158 C CA    . LEU C  1 152 ? 75.560  36.690  61.259  1.00 22.79 ? 2183 LEU C CA    1 
ATOM   10159 C C     . LEU C  1 152 ? 76.529  36.703  62.444  1.00 23.55 ? 2183 LEU C C     1 
ATOM   10160 O O     . LEU C  1 152 ? 77.461  37.506  62.514  1.00 22.81 ? 2183 LEU C O     1 
ATOM   10161 C CB    . LEU C  1 152 ? 76.219  36.050  60.058  1.00 24.41 ? 2183 LEU C CB    1 
ATOM   10162 C CG    . LEU C  1 152 ? 75.171  35.587  59.052  1.00 26.67 ? 2183 LEU C CG    1 
ATOM   10163 C CD1   . LEU C  1 152 ? 75.592  36.035  57.659  1.00 27.55 ? 2183 LEU C CD1   1 
ATOM   10164 C CD2   . LEU C  1 152 ? 75.011  34.059  59.126  1.00 25.41 ? 2183 LEU C CD2   1 
ATOM   10165 N N     . ARG C  1 153 ? 76.291  35.797  63.378  1.00 23.49 ? 2184 ARG C N     1 
ATOM   10166 C CA    . ARG C  1 153 ? 77.106  35.705  64.569  1.00 23.67 ? 2184 ARG C CA    1 
ATOM   10167 C C     . ARG C  1 153 ? 78.467  35.112  64.266  1.00 25.76 ? 2184 ARG C C     1 
ATOM   10168 O O     . ARG C  1 153 ? 78.576  34.061  63.625  1.00 22.36 ? 2184 ARG C O     1 
ATOM   10169 C CB    . ARG C  1 153 ? 76.391  34.842  65.617  1.00 24.10 ? 2184 ARG C CB    1 
ATOM   10170 C CG    . ARG C  1 153 ? 77.260  34.356  66.754  1.00 28.40 ? 2184 ARG C CG    1 
ATOM   10171 C CD    . ARG C  1 153 ? 76.588  33.231  67.511  1.00 32.62 ? 2184 ARG C CD    1 
ATOM   10172 N NE    . ARG C  1 153 ? 75.209  33.564  67.839  1.00 39.16 ? 2184 ARG C NE    1 
ATOM   10173 C CZ    . ARG C  1 153 ? 74.218  32.681  67.908  1.00 43.77 ? 2184 ARG C CZ    1 
ATOM   10174 N NH1   . ARG C  1 153 ? 74.445  31.393  67.671  1.00 43.15 ? 2184 ARG C NH1   1 
ATOM   10175 N NH2   . ARG C  1 153 ? 72.991  33.097  68.201  1.00 42.36 ? 2184 ARG C NH2   1 
ATOM   10176 N N     . ARG C  1 154 ? 79.509  35.801  64.723  1.00 29.13 ? 2185 ARG C N     1 
ATOM   10177 C CA    . ARG C  1 154 ? 80.880  35.326  64.565  1.00 28.95 ? 2185 ARG C CA    1 
ATOM   10178 C C     . ARG C  1 154 ? 81.136  34.593  65.873  1.00 29.18 ? 2185 ARG C C     1 
ATOM   10179 O O     . ARG C  1 154 ? 81.103  33.368  65.927  1.00 27.48 ? 2185 ARG C O     1 
ATOM   10180 C CB    . ARG C  1 154 ? 81.854  36.497  64.417  1.00 28.11 ? 2185 ARG C CB    1 
ATOM   10181 C CG    . ARG C  1 154 ? 81.194  37.808  64.080  1.00 34.93 ? 2185 ARG C CG    1 
ATOM   10182 C CD    . ARG C  1 154 ? 81.295  38.119  62.596  1.00 39.11 ? 2185 ARG C CD    1 
ATOM   10183 N NE    . ARG C  1 154 ? 80.923  39.507  62.323  1.00 49.36 ? 2185 ARG C NE    1 
ATOM   10184 C CZ    . ARG C  1 154 ? 80.336  39.931  61.205  1.00 50.82 ? 2185 ARG C CZ    1 
ATOM   10185 N NH1   . ARG C  1 154 ? 80.042  39.080  60.227  1.00 51.56 ? 2185 ARG C NH1   1 
ATOM   10186 N NH2   . ARG C  1 154 ? 80.037  41.214  61.069  1.00 50.83 ? 2185 ARG C NH2   1 
ATOM   10187 N N     . GLU C  1 155 ? 81.374  35.360  66.929  1.00 31.19 ? 2186 GLU C N     1 
ATOM   10188 C CA    . GLU C  1 155 ? 81.599  34.796  68.248  1.00 35.85 ? 2186 GLU C CA    1 
ATOM   10189 C C     . GLU C  1 155 ? 80.250  34.853  68.948  1.00 36.16 ? 2186 GLU C C     1 
ATOM   10190 O O     . GLU C  1 155 ? 79.652  35.926  69.063  1.00 35.00 ? 2186 GLU C O     1 
ATOM   10191 C CB    . GLU C  1 155 ? 82.621  35.640  69.027  1.00 43.27 ? 2186 GLU C CB    1 
ATOM   10192 C CG    . GLU C  1 155 ? 83.974  34.961  69.243  1.00 55.15 ? 2186 GLU C CG    1 
ATOM   10193 C CD    . GLU C  1 155 ? 85.010  35.880  69.888  1.00 62.95 ? 2186 GLU C CD    1 
ATOM   10194 O OE1   . GLU C  1 155 ? 84.972  36.030  71.134  1.00 63.90 ? 2186 GLU C OE1   1 
ATOM   10195 O OE2   . GLU C  1 155 ? 85.859  36.443  69.151  1.00 62.62 ? 2186 GLU C OE2   1 
ATOM   10196 N N     . PHE C  1 156 ? 79.758  33.710  69.408  1.00 32.96 ? 2187 PHE C N     1 
ATOM   10197 C CA    . PHE C  1 156 ? 78.466  33.691  70.086  1.00 34.23 ? 2187 PHE C CA    1 
ATOM   10198 C C     . PHE C  1 156 ? 78.435  34.746  71.180  1.00 31.97 ? 2187 PHE C C     1 
ATOM   10199 O O     . PHE C  1 156 ? 79.324  34.794  72.031  1.00 34.54 ? 2187 PHE C O     1 
ATOM   10200 C CB    . PHE C  1 156 ? 78.189  32.314  70.695  1.00 35.16 ? 2187 PHE C CB    1 
ATOM   10201 C CG    . PHE C  1 156 ? 77.066  32.302  71.706  1.00 38.46 ? 2187 PHE C CG    1 
ATOM   10202 C CD1   . PHE C  1 156 ? 77.246  32.832  72.984  1.00 40.12 ? 2187 PHE C CD1   1 
ATOM   10203 C CD2   . PHE C  1 156 ? 75.841  31.726  71.390  1.00 41.91 ? 2187 PHE C CD2   1 
ATOM   10204 C CE1   . PHE C  1 156 ? 76.226  32.789  73.931  1.00 42.09 ? 2187 PHE C CE1   1 
ATOM   10205 C CE2   . PHE C  1 156 ? 74.813  31.675  72.331  1.00 40.18 ? 2187 PHE C CE2   1 
ATOM   10206 C CZ    . PHE C  1 156 ? 75.008  32.209  73.606  1.00 41.84 ? 2187 PHE C CZ    1 
ATOM   10207 N N     . ILE C  1 157 ? 77.417  35.598  71.156  1.00 29.36 ? 2188 ILE C N     1 
ATOM   10208 C CA    . ILE C  1 157 ? 77.298  36.619  72.175  1.00 26.85 ? 2188 ILE C CA    1 
ATOM   10209 C C     . ILE C  1 157 ? 76.189  36.187  73.104  1.00 28.16 ? 2188 ILE C C     1 
ATOM   10210 O O     . ILE C  1 157 ? 75.061  35.985  72.671  1.00 30.32 ? 2188 ILE C O     1 
ATOM   10211 C CB    . ILE C  1 157 ? 76.931  37.964  71.578  1.00 25.66 ? 2188 ILE C CB    1 
ATOM   10212 C CG1   . ILE C  1 157 ? 77.888  38.288  70.433  1.00 28.22 ? 2188 ILE C CG1   1 
ATOM   10213 C CG2   . ILE C  1 157 ? 76.945  39.030  72.663  1.00 28.64 ? 2188 ILE C CG2   1 
ATOM   10214 C CD1   . ILE C  1 157 ? 77.261  39.133  69.334  1.00 29.80 ? 2188 ILE C CD1   1 
ATOM   10215 N N     . PRO C  1 158 ? 76.489  36.039  74.401  1.00 30.95 ? 2189 PRO C N     1 
ATOM   10216 C CA    . PRO C  1 158 ? 75.435  35.619  75.324  1.00 31.72 ? 2189 PRO C CA    1 
ATOM   10217 C C     . PRO C  1 158 ? 74.602  36.831  75.696  1.00 31.04 ? 2189 PRO C C     1 
ATOM   10218 O O     . PRO C  1 158 ? 75.098  37.967  75.705  1.00 30.73 ? 2189 PRO C O     1 
ATOM   10219 C CB    . PRO C  1 158 ? 76.207  35.093  76.520  1.00 30.56 ? 2189 PRO C CB    1 
ATOM   10220 C CG    . PRO C  1 158 ? 77.390  36.012  76.574  1.00 33.24 ? 2189 PRO C CG    1 
ATOM   10221 C CD    . PRO C  1 158 ? 77.753  36.286  75.112  1.00 32.46 ? 2189 PRO C CD    1 
ATOM   10222 N N     . ASP C  1 159 ? 73.332  36.602  75.988  1.00 26.75 ? 2190 ASP C N     1 
ATOM   10223 C CA    . ASP C  1 159 ? 72.514  37.721  76.381  1.00 24.26 ? 2190 ASP C CA    1 
ATOM   10224 C C     . ASP C  1 159 ? 72.953  38.088  77.792  1.00 19.47 ? 2190 ASP C C     1 
ATOM   10225 O O     . ASP C  1 159 ? 72.992  37.241  78.684  1.00 18.61 ? 2190 ASP C O     1 
ATOM   10226 C CB    . ASP C  1 159 ? 71.031  37.363  76.416  1.00 19.43 ? 2190 ASP C CB    1 
ATOM   10227 C CG    . ASP C  1 159 ? 70.305  38.089  77.534  1.00 16.29 ? 2190 ASP C CG    1 
ATOM   10228 O OD1   . ASP C  1 159 ? 70.125  39.326  77.408  1.00 6.44  ? 2190 ASP C OD1   1 
ATOM   10229 O OD2   . ASP C  1 159 ? 69.945  37.422  78.535  1.00 7.75  ? 2190 ASP C OD2   1 
ATOM   10230 N N     . PRO C  1 160 ? 73.340  39.343  77.999  1.00 16.91 ? 2191 PRO C N     1 
ATOM   10231 C CA    . PRO C  1 160 ? 73.751  39.743  79.345  1.00 19.00 ? 2191 PRO C CA    1 
ATOM   10232 C C     . PRO C  1 160 ? 72.638  39.475  80.360  1.00 19.39 ? 2191 PRO C C     1 
ATOM   10233 O O     . PRO C  1 160 ? 72.914  39.222  81.532  1.00 18.37 ? 2191 PRO C O     1 
ATOM   10234 C CB    . PRO C  1 160 ? 74.032  41.240  79.215  1.00 17.92 ? 2191 PRO C CB    1 
ATOM   10235 C CG    . PRO C  1 160 ? 73.445  41.649  77.874  1.00 19.58 ? 2191 PRO C CG    1 
ATOM   10236 C CD    . PRO C  1 160 ? 73.483  40.431  77.018  1.00 17.33 ? 2191 PRO C CD    1 
ATOM   10237 N N     . GLN C  1 161 ? 71.385  39.517  79.896  1.00 18.57 ? 2192 GLN C N     1 
ATOM   10238 C CA    . GLN C  1 161 ? 70.214  39.324  80.767  1.00 20.31 ? 2192 GLN C CA    1 
ATOM   10239 C C     . GLN C  1 161 ? 69.999  37.925  81.342  1.00 20.48 ? 2192 GLN C C     1 
ATOM   10240 O O     . GLN C  1 161 ? 69.153  37.742  82.213  1.00 19.38 ? 2192 GLN C O     1 
ATOM   10241 C CB    . GLN C  1 161 ? 68.941  39.778  80.050  1.00 19.78 ? 2192 GLN C CB    1 
ATOM   10242 C CG    . GLN C  1 161 ? 69.067  41.146  79.385  1.00 26.74 ? 2192 GLN C CG    1 
ATOM   10243 C CD    . GLN C  1 161 ? 67.818  41.999  79.543  1.00 25.67 ? 2192 GLN C CD    1 
ATOM   10244 O OE1   . GLN C  1 161 ? 67.532  42.870  78.716  1.00 23.15 ? 2192 GLN C OE1   1 
ATOM   10245 N NE2   . GLN C  1 161 ? 67.066  41.750  80.614  1.00 28.98 ? 2192 GLN C NE2   1 
ATOM   10246 N N     . GLY C  1 162 ? 70.747  36.943  80.856  1.00 20.83 ? 2193 GLY C N     1 
ATOM   10247 C CA    . GLY C  1 162 ? 70.624  35.601  81.401  1.00 24.19 ? 2193 GLY C CA    1 
ATOM   10248 C C     . GLY C  1 162 ? 69.592  34.714  80.757  1.00 23.88 ? 2193 GLY C C     1 
ATOM   10249 O O     . GLY C  1 162 ? 69.312  33.610  81.233  1.00 18.20 ? 2193 GLY C O     1 
ATOM   10250 N N     . SER C  1 163 ? 69.038  35.202  79.657  1.00 26.31 ? 2194 SER C N     1 
ATOM   10251 C CA    . SER C  1 163 ? 68.014  34.469  78.920  1.00 27.41 ? 2194 SER C CA    1 
ATOM   10252 C C     . SER C  1 163 ? 68.428  33.037  78.586  1.00 26.73 ? 2194 SER C C     1 
ATOM   10253 O O     . SER C  1 163 ? 69.189  32.814  77.653  1.00 25.94 ? 2194 SER C O     1 
ATOM   10254 C CB    . SER C  1 163 ? 67.672  35.225  77.638  1.00 25.56 ? 2194 SER C CB    1 
ATOM   10255 O OG    . SER C  1 163 ? 67.331  36.572  77.926  1.00 28.06 ? 2194 SER C OG    1 
ATOM   10256 N N     . ASN C  1 164 ? 67.923  32.070  79.348  1.00 26.88 ? 2195 ASN C N     1 
ATOM   10257 C CA    . ASN C  1 164 ? 68.253  30.666  79.109  1.00 27.42 ? 2195 ASN C CA    1 
ATOM   10258 C C     . ASN C  1 164 ? 67.505  30.132  77.897  1.00 26.63 ? 2195 ASN C C     1 
ATOM   10259 O O     . ASN C  1 164 ? 66.813  30.873  77.206  1.00 28.82 ? 2195 ASN C O     1 
ATOM   10260 C CB    . ASN C  1 164 ? 67.889  29.821  80.328  1.00 26.32 ? 2195 ASN C CB    1 
ATOM   10261 C CG    . ASN C  1 164 ? 66.518  30.139  80.854  1.00 27.13 ? 2195 ASN C CG    1 
ATOM   10262 O OD1   . ASN C  1 164 ? 65.559  30.226  80.093  1.00 27.45 ? 2195 ASN C OD1   1 
ATOM   10263 N ND2   . ASN C  1 164 ? 66.414  30.322  82.163  1.00 28.05 ? 2195 ASN C ND2   1 
ATOM   10264 N N     . MET C  1 165 ? 67.645  28.836  77.651  1.00 25.88 ? 2196 MET C N     1 
ATOM   10265 C CA    . MET C  1 165 ? 66.968  28.190  76.525  1.00 23.42 ? 2196 MET C CA    1 
ATOM   10266 C C     . MET C  1 165 ? 65.444  28.127  76.757  1.00 25.07 ? 2196 MET C C     1 
ATOM   10267 O O     . MET C  1 165 ? 64.659  28.224  75.805  1.00 19.95 ? 2196 MET C O     1 
ATOM   10268 C CB    . MET C  1 165 ? 67.540  26.777  76.312  1.00 22.59 ? 2196 MET C CB    1 
ATOM   10269 C CG    . MET C  1 165 ? 68.746  26.732  75.379  1.00 21.73 ? 2196 MET C CG    1 
ATOM   10270 S SD    . MET C  1 165 ? 68.491  27.564  73.781  1.00 25.32 ? 2196 MET C SD    1 
ATOM   10271 C CE    . MET C  1 165 ? 68.952  29.288  74.214  1.00 18.80 ? 2196 MET C CE    1 
ATOM   10272 N N     . MET C  1 166 ? 65.044  27.957  78.025  1.00 25.08 ? 2197 MET C N     1 
ATOM   10273 C CA    . MET C  1 166 ? 63.632  27.912  78.394  1.00 21.00 ? 2197 MET C CA    1 
ATOM   10274 C C     . MET C  1 166 ? 63.022  29.115  77.699  1.00 19.97 ? 2197 MET C C     1 
ATOM   10275 O O     . MET C  1 166 ? 62.297  28.984  76.717  1.00 21.28 ? 2197 MET C O     1 
ATOM   10276 C CB    . MET C  1 166 ? 63.458  28.076  79.903  1.00 19.12 ? 2197 MET C CB    1 
ATOM   10277 C CG    . MET C  1 166 ? 63.355  26.779  80.673  1.00 28.00 ? 2197 MET C CG    1 
ATOM   10278 S SD    . MET C  1 166 ? 62.808  25.361  79.695  1.00 37.34 ? 2197 MET C SD    1 
ATOM   10279 C CE    . MET C  1 166 ? 62.142  24.345  80.995  1.00 33.09 ? 2197 MET C CE    1 
ATOM   10280 N N     . PHE C  1 167 ? 63.357  30.297  78.195  1.00 15.93 ? 2198 PHE C N     1 
ATOM   10281 C CA    . PHE C  1 167 ? 62.838  31.505  77.604  1.00 14.61 ? 2198 PHE C CA    1 
ATOM   10282 C C     . PHE C  1 167 ? 62.782  31.401  76.096  1.00 11.70 ? 2198 PHE C C     1 
ATOM   10283 O O     . PHE C  1 167 ? 61.719  31.514  75.503  1.00 20.00 ? 2198 PHE C O     1 
ATOM   10284 C CB    . PHE C  1 167 ? 63.679  32.705  77.981  1.00 6.04  ? 2198 PHE C CB    1 
ATOM   10285 C CG    . PHE C  1 167 ? 63.260  33.956  77.283  1.00 2.00  ? 2198 PHE C CG    1 
ATOM   10286 C CD1   . PHE C  1 167 ? 62.588  34.967  77.964  1.00 2.00  ? 2198 PHE C CD1   1 
ATOM   10287 C CD2   . PHE C  1 167 ? 63.539  34.126  75.933  1.00 2.00  ? 2198 PHE C CD2   1 
ATOM   10288 C CE1   . PHE C  1 167 ? 62.199  36.143  77.304  1.00 10.02 ? 2198 PHE C CE1   1 
ATOM   10289 C CE2   . PHE C  1 167 ? 63.162  35.291  75.255  1.00 8.39  ? 2198 PHE C CE2   1 
ATOM   10290 C CZ    . PHE C  1 167 ? 62.490  36.303  75.940  1.00 12.75 ? 2198 PHE C CZ    1 
ATOM   10291 N N     . ALA C  1 168 ? 63.922  31.191  75.465  1.00 11.99 ? 2199 ALA C N     1 
ATOM   10292 C CA    . ALA C  1 168 ? 63.941  31.091  74.010  1.00 11.83 ? 2199 ALA C CA    1 
ATOM   10293 C C     . ALA C  1 168 ? 62.787  30.250  73.465  1.00 13.65 ? 2199 ALA C C     1 
ATOM   10294 O O     . ALA C  1 168 ? 61.874  30.772  72.827  1.00 17.28 ? 2199 ALA C O     1 
ATOM   10295 C CB    . ALA C  1 168 ? 65.260  30.509  73.544  1.00 12.04 ? 2199 ALA C CB    1 
ATOM   10296 N N     . PHE C  1 169 ? 62.827  28.951  73.719  1.00 12.55 ? 2200 PHE C N     1 
ATOM   10297 C CA    . PHE C  1 169 ? 61.779  28.060  73.248  1.00 14.18 ? 2200 PHE C CA    1 
ATOM   10298 C C     . PHE C  1 169 ? 60.373  28.493  73.647  1.00 13.98 ? 2200 PHE C C     1 
ATOM   10299 O O     . PHE C  1 169 ? 59.415  28.228  72.926  1.00 16.36 ? 2200 PHE C O     1 
ATOM   10300 C CB    . PHE C  1 169 ? 62.045  26.639  73.737  1.00 17.51 ? 2200 PHE C CB    1 
ATOM   10301 C CG    . PHE C  1 169 ? 63.052  25.925  72.915  1.00 23.00 ? 2200 PHE C CG    1 
ATOM   10302 C CD1   . PHE C  1 169 ? 62.959  25.949  71.523  1.00 28.43 ? 2200 PHE C CD1   1 
ATOM   10303 C CD2   . PHE C  1 169 ? 64.122  25.273  73.509  1.00 26.91 ? 2200 PHE C CD2   1 
ATOM   10304 C CE1   . PHE C  1 169 ? 63.926  25.338  70.721  1.00 29.96 ? 2200 PHE C CE1   1 
ATOM   10305 C CE2   . PHE C  1 169 ? 65.099  24.654  72.717  1.00 31.08 ? 2200 PHE C CE2   1 
ATOM   10306 C CZ    . PHE C  1 169 ? 64.997  24.690  71.316  1.00 30.09 ? 2200 PHE C CZ    1 
ATOM   10307 N N     . PHE C  1 170 ? 60.237  29.132  74.802  1.00 14.54 ? 2201 PHE C N     1 
ATOM   10308 C CA    . PHE C  1 170 ? 58.931  29.601  75.202  1.00 11.95 ? 2201 PHE C CA    1 
ATOM   10309 C C     . PHE C  1 170 ? 58.596  30.625  74.133  1.00 11.77 ? 2201 PHE C C     1 
ATOM   10310 O O     . PHE C  1 170 ? 57.857  30.336  73.207  1.00 13.54 ? 2201 PHE C O     1 
ATOM   10311 C CB    . PHE C  1 170 ? 58.985  30.254  76.576  1.00 14.92 ? 2201 PHE C CB    1 
ATOM   10312 C CG    . PHE C  1 170 ? 57.638  30.648  77.105  1.00 22.64 ? 2201 PHE C CG    1 
ATOM   10313 C CD1   . PHE C  1 170 ? 57.050  29.928  78.144  1.00 24.03 ? 2201 PHE C CD1   1 
ATOM   10314 C CD2   . PHE C  1 170 ? 56.954  31.745  76.571  1.00 22.03 ? 2201 PHE C CD2   1 
ATOM   10315 C CE1   . PHE C  1 170 ? 55.796  30.295  78.654  1.00 23.83 ? 2201 PHE C CE1   1 
ATOM   10316 C CE2   . PHE C  1 170 ? 55.701  32.123  77.071  1.00 23.52 ? 2201 PHE C CE2   1 
ATOM   10317 C CZ    . PHE C  1 170 ? 55.121  31.400  78.112  1.00 23.84 ? 2201 PHE C CZ    1 
ATOM   10318 N N     . ALA C  1 171 ? 59.155  31.816  74.261  1.00 11.57 ? 2202 ALA C N     1 
ATOM   10319 C CA    . ALA C  1 171 ? 58.940  32.858  73.280  1.00 11.59 ? 2202 ALA C CA    1 
ATOM   10320 C C     . ALA C  1 171 ? 58.673  32.229  71.923  1.00 15.78 ? 2202 ALA C C     1 
ATOM   10321 O O     . ALA C  1 171 ? 57.684  32.549  71.262  1.00 17.40 ? 2202 ALA C O     1 
ATOM   10322 C CB    . ALA C  1 171 ? 60.161  33.732  73.198  1.00 13.53 ? 2202 ALA C CB    1 
ATOM   10323 N N     . GLN C  1 172 ? 59.556  31.325  71.512  1.00 16.98 ? 2203 GLN C N     1 
ATOM   10324 C CA    . GLN C  1 172 ? 59.399  30.657  70.225  1.00 23.75 ? 2203 GLN C CA    1 
ATOM   10325 C C     . GLN C  1 172 ? 58.022  29.992  70.148  1.00 23.71 ? 2203 GLN C C     1 
ATOM   10326 O O     . GLN C  1 172 ? 57.179  30.357  69.321  1.00 22.28 ? 2203 GLN C O     1 
ATOM   10327 C CB    . GLN C  1 172 ? 60.494  29.598  70.038  1.00 27.82 ? 2203 GLN C CB    1 
ATOM   10328 C CG    . GLN C  1 172 ? 60.129  28.487  69.051  1.00 34.97 ? 2203 GLN C CG    1 
ATOM   10329 C CD    . GLN C  1 172 ? 61.006  28.491  67.804  1.00 42.86 ? 2203 GLN C CD    1 
ATOM   10330 O OE1   . GLN C  1 172 ? 61.008  29.454  67.028  1.00 44.96 ? 2203 GLN C OE1   1 
ATOM   10331 N NE2   . GLN C  1 172 ? 61.758  27.409  67.606  1.00 43.27 ? 2203 GLN C NE2   1 
ATOM   10332 N N     . HIS C  1 173 ? 57.818  29.013  71.024  1.00 23.95 ? 2204 HIS C N     1 
ATOM   10333 C CA    . HIS C  1 173 ? 56.576  28.254  71.125  1.00 24.48 ? 2204 HIS C CA    1 
ATOM   10334 C C     . HIS C  1 173 ? 55.377  29.179  71.242  1.00 22.50 ? 2204 HIS C C     1 
ATOM   10335 O O     . HIS C  1 173 ? 54.471  29.128  70.417  1.00 25.43 ? 2204 HIS C O     1 
ATOM   10336 C CB    . HIS C  1 173 ? 56.660  27.341  72.348  1.00 26.98 ? 2204 HIS C CB    1 
ATOM   10337 C CG    . HIS C  1 173 ? 55.403  26.588  72.644  1.00 31.25 ? 2204 HIS C CG    1 
ATOM   10338 N ND1   . HIS C  1 173 ? 54.373  27.119  73.389  1.00 31.90 ? 2204 HIS C ND1   1 
ATOM   10339 C CD2   . HIS C  1 173 ? 55.049  25.307  72.374  1.00 32.73 ? 2204 HIS C CD2   1 
ATOM   10340 C CE1   . HIS C  1 173 ? 53.440  26.202  73.571  1.00 32.30 ? 2204 HIS C CE1   1 
ATOM   10341 N NE2   . HIS C  1 173 ? 53.827  25.093  72.963  1.00 33.52 ? 2204 HIS C NE2   1 
ATOM   10342 N N     . PHE C  1 174 ? 55.384  30.025  72.266  1.00 20.71 ? 2205 PHE C N     1 
ATOM   10343 C CA    . PHE C  1 174 ? 54.299  30.962  72.510  1.00 19.46 ? 2205 PHE C CA    1 
ATOM   10344 C C     . PHE C  1 174 ? 53.965  31.816  71.297  1.00 18.10 ? 2205 PHE C C     1 
ATOM   10345 O O     . PHE C  1 174 ? 52.888  31.712  70.746  1.00 16.85 ? 2205 PHE C O     1 
ATOM   10346 C CB    . PHE C  1 174 ? 54.654  31.859  73.694  1.00 22.97 ? 2205 PHE C CB    1 
ATOM   10347 C CG    . PHE C  1 174 ? 53.716  33.028  73.889  1.00 27.28 ? 2205 PHE C CG    1 
ATOM   10348 C CD1   . PHE C  1 174 ? 52.378  32.830  74.217  1.00 30.11 ? 2205 PHE C CD1   1 
ATOM   10349 C CD2   . PHE C  1 174 ? 54.189  34.334  73.792  1.00 28.65 ? 2205 PHE C CD2   1 
ATOM   10350 C CE1   . PHE C  1 174 ? 51.530  33.924  74.450  1.00 31.50 ? 2205 PHE C CE1   1 
ATOM   10351 C CE2   . PHE C  1 174 ? 53.353  35.419  74.022  1.00 29.51 ? 2205 PHE C CE2   1 
ATOM   10352 C CZ    . PHE C  1 174 ? 52.025  35.221  74.351  1.00 28.67 ? 2205 PHE C CZ    1 
ATOM   10353 N N     . THR C  1 175 ? 54.887  32.661  70.872  1.00 17.13 ? 2206 THR C N     1 
ATOM   10354 C CA    . THR C  1 175 ? 54.613  33.514  69.726  1.00 19.45 ? 2206 THR C CA    1 
ATOM   10355 C C     . THR C  1 175 ? 54.117  32.752  68.498  1.00 21.40 ? 2206 THR C C     1 
ATOM   10356 O O     . THR C  1 175 ? 53.599  33.352  67.557  1.00 21.05 ? 2206 THR C O     1 
ATOM   10357 C CB    . THR C  1 175 ? 55.863  34.316  69.292  1.00 19.37 ? 2206 THR C CB    1 
ATOM   10358 O OG1   . THR C  1 175 ? 56.888  33.406  68.869  1.00 20.02 ? 2206 THR C OG1   1 
ATOM   10359 C CG2   . THR C  1 175 ? 56.375  35.195  70.443  1.00 17.80 ? 2206 THR C CG2   1 
ATOM   10360 N N     . HIS C  1 176 ? 54.256  31.432  68.505  1.00 25.97 ? 2207 HIS C N     1 
ATOM   10361 C CA    . HIS C  1 176 ? 53.858  30.661  67.338  1.00 28.06 ? 2207 HIS C CA    1 
ATOM   10362 C C     . HIS C  1 176 ? 52.382  30.441  67.109  1.00 25.40 ? 2207 HIS C C     1 
ATOM   10363 O O     . HIS C  1 176 ? 51.996  29.732  66.176  1.00 22.13 ? 2207 HIS C O     1 
ATOM   10364 C CB    . HIS C  1 176 ? 54.606  29.332  67.301  1.00 34.50 ? 2207 HIS C CB    1 
ATOM   10365 C CG    . HIS C  1 176 ? 55.725  29.321  66.308  1.00 44.75 ? 2207 HIS C CG    1 
ATOM   10366 N ND1   . HIS C  1 176 ? 56.593  30.384  66.161  1.00 46.97 ? 2207 HIS C ND1   1 
ATOM   10367 C CD2   . HIS C  1 176 ? 56.087  28.408  65.376  1.00 48.33 ? 2207 HIS C CD2   1 
ATOM   10368 C CE1   . HIS C  1 176 ? 57.441  30.126  65.182  1.00 50.40 ? 2207 HIS C CE1   1 
ATOM   10369 N NE2   . HIS C  1 176 ? 57.156  28.934  64.689  1.00 52.01 ? 2207 HIS C NE2   1 
ATOM   10370 N N     . GLN C  1 177 ? 51.554  31.036  67.967  1.00 25.90 ? 2208 GLN C N     1 
ATOM   10371 C CA    . GLN C  1 177 ? 50.109  30.948  67.800  1.00 21.24 ? 2208 GLN C CA    1 
ATOM   10372 C C     . GLN C  1 177 ? 49.744  32.175  66.979  1.00 20.86 ? 2208 GLN C C     1 
ATOM   10373 O O     . GLN C  1 177 ? 49.226  32.034  65.881  1.00 17.37 ? 2208 GLN C O     1 
ATOM   10374 C CB    . GLN C  1 177 ? 49.368  30.962  69.136  1.00 15.83 ? 2208 GLN C CB    1 
ATOM   10375 C CG    . GLN C  1 177 ? 50.054  31.717  70.236  1.00 15.99 ? 2208 GLN C CG    1 
ATOM   10376 C CD    . GLN C  1 177 ? 49.382  31.538  71.592  1.00 18.82 ? 2208 GLN C CD    1 
ATOM   10377 O OE1   . GLN C  1 177 ? 48.170  31.676  71.719  1.00 21.62 ? 2208 GLN C OE1   1 
ATOM   10378 N NE2   . GLN C  1 177 ? 50.174  31.236  72.613  1.00 16.69 ? 2208 GLN C NE2   1 
ATOM   10379 N N     . PHE C  1 178 ? 50.055  33.374  67.472  1.00 19.86 ? 2209 PHE C N     1 
ATOM   10380 C CA    . PHE C  1 178 ? 49.720  34.565  66.700  1.00 22.83 ? 2209 PHE C CA    1 
ATOM   10381 C C     . PHE C  1 178 ? 50.421  34.606  65.348  1.00 23.80 ? 2209 PHE C C     1 
ATOM   10382 O O     . PHE C  1 178 ? 49.765  34.669  64.314  1.00 28.79 ? 2209 PHE C O     1 
ATOM   10383 C CB    . PHE C  1 178 ? 50.018  35.875  67.438  1.00 28.99 ? 2209 PHE C CB    1 
ATOM   10384 C CG    . PHE C  1 178 ? 50.831  35.728  68.673  1.00 33.47 ? 2209 PHE C CG    1 
ATOM   10385 C CD1   . PHE C  1 178 ? 50.381  34.963  69.740  1.00 38.47 ? 2209 PHE C CD1   1 
ATOM   10386 C CD2   . PHE C  1 178 ? 52.029  36.418  68.797  1.00 36.20 ? 2209 PHE C CD2   1 
ATOM   10387 C CE1   . PHE C  1 178 ? 51.117  34.889  70.922  1.00 40.70 ? 2209 PHE C CE1   1 
ATOM   10388 C CE2   . PHE C  1 178 ? 52.768  36.354  69.965  1.00 41.36 ? 2209 PHE C CE2   1 
ATOM   10389 C CZ    . PHE C  1 178 ? 52.313  35.588  71.033  1.00 40.72 ? 2209 PHE C CZ    1 
ATOM   10390 N N     . PHE C  1 179 ? 51.749  34.597  65.339  1.00 23.61 ? 2210 PHE C N     1 
ATOM   10391 C CA    . PHE C  1 179 ? 52.471  34.608  64.070  1.00 21.65 ? 2210 PHE C CA    1 
ATOM   10392 C C     . PHE C  1 179 ? 52.302  33.210  63.518  1.00 22.02 ? 2210 PHE C C     1 
ATOM   10393 O O     . PHE C  1 179 ? 52.543  32.229  64.221  1.00 21.66 ? 2210 PHE C O     1 
ATOM   10394 C CB    . PHE C  1 179 ? 53.960  34.894  64.274  1.00 20.13 ? 2210 PHE C CB    1 
ATOM   10395 C CG    . PHE C  1 179 ? 54.237  36.052  65.188  1.00 22.55 ? 2210 PHE C CG    1 
ATOM   10396 C CD1   . PHE C  1 179 ? 53.788  37.333  64.864  1.00 23.60 ? 2210 PHE C CD1   1 
ATOM   10397 C CD2   . PHE C  1 179 ? 54.934  35.861  66.380  1.00 23.54 ? 2210 PHE C CD2   1 
ATOM   10398 C CE1   . PHE C  1 179 ? 54.027  38.406  65.712  1.00 24.32 ? 2210 PHE C CE1   1 
ATOM   10399 C CE2   . PHE C  1 179 ? 55.178  36.924  67.232  1.00 24.26 ? 2210 PHE C CE2   1 
ATOM   10400 C CZ    . PHE C  1 179 ? 54.723  38.204  66.897  1.00 25.72 ? 2210 PHE C CZ    1 
ATOM   10401 N N     . LYS C  1 180 ? 51.874  33.116  62.269  1.00 22.32 ? 2211 LYS C N     1 
ATOM   10402 C CA    . LYS C  1 180 ? 51.661  31.821  61.642  1.00 23.30 ? 2211 LYS C CA    1 
ATOM   10403 C C     . LYS C  1 180 ? 51.531  32.033  60.148  1.00 27.89 ? 2211 LYS C C     1 
ATOM   10404 O O     . LYS C  1 180 ? 50.847  31.279  59.449  1.00 26.67 ? 2211 LYS C O     1 
ATOM   10405 C CB    . LYS C  1 180 ? 50.391  31.171  62.185  1.00 18.62 ? 2211 LYS C CB    1 
ATOM   10406 C CG    . LYS C  1 180 ? 50.641  30.277  63.375  1.00 20.45 ? 2211 LYS C CG    1 
ATOM   10407 C CD    . LYS C  1 180 ? 49.345  29.874  64.075  1.00 18.93 ? 2211 LYS C CD    1 
ATOM   10408 C CE    . LYS C  1 180 ? 48.512  28.933  63.214  1.00 20.33 ? 2211 LYS C CE    1 
ATOM   10409 N NZ    . LYS C  1 180 ? 47.065  29.024  63.547  1.00 17.26 ? 2211 LYS C NZ    1 
ATOM   10410 N N     . THR C  1 181 ? 52.211  33.069  59.670  1.00 29.75 ? 2212 THR C N     1 
ATOM   10411 C CA    . THR C  1 181 ? 52.192  33.435  58.266  1.00 31.46 ? 2212 THR C CA    1 
ATOM   10412 C C     . THR C  1 181 ? 51.880  32.298  57.309  1.00 35.76 ? 2212 THR C C     1 
ATOM   10413 O O     . THR C  1 181 ? 52.507  31.238  57.348  1.00 35.55 ? 2212 THR C O     1 
ATOM   10414 C CB    . THR C  1 181 ? 53.518  34.056  57.869  1.00 28.02 ? 2212 THR C CB    1 
ATOM   10415 O OG1   . THR C  1 181 ? 53.959  34.906  58.933  1.00 29.18 ? 2212 THR C OG1   1 
ATOM   10416 C CG2   . THR C  1 181 ? 53.363  34.883  56.596  1.00 24.92 ? 2212 THR C CG2   1 
ATOM   10417 N N     . ASP C  1 182 ? 50.881  32.526  56.465  1.00 40.43 ? 2213 ASP C N     1 
ATOM   10418 C CA    . ASP C  1 182 ? 50.493  31.548  55.473  1.00 47.32 ? 2213 ASP C CA    1 
ATOM   10419 C C     . ASP C  1 182 ? 51.241  31.969  54.225  1.00 49.78 ? 2213 ASP C C     1 
ATOM   10420 O O     . ASP C  1 182 ? 50.867  32.941  53.566  1.00 53.31 ? 2213 ASP C O     1 
ATOM   10421 C CB    . ASP C  1 182 ? 48.996  31.606  55.219  1.00 49.90 ? 2213 ASP C CB    1 
ATOM   10422 C CG    . ASP C  1 182 ? 48.598  30.867  53.965  1.00 54.85 ? 2213 ASP C CG    1 
ATOM   10423 O OD1   . ASP C  1 182 ? 49.354  29.957  53.546  1.00 54.47 ? 2213 ASP C OD1   1 
ATOM   10424 O OD2   . ASP C  1 182 ? 47.534  31.201  53.403  1.00 56.56 ? 2213 ASP C OD2   1 
ATOM   10425 N N     . HIS C  1 183 ? 52.301  31.238  53.907  1.00 52.24 ? 2214 HIS C N     1 
ATOM   10426 C CA    . HIS C  1 183 ? 53.128  31.563  52.754  1.00 53.76 ? 2214 HIS C CA    1 
ATOM   10427 C C     . HIS C  1 183 ? 52.464  31.294  51.413  1.00 49.86 ? 2214 HIS C C     1 
ATOM   10428 O O     . HIS C  1 183 ? 52.704  32.024  50.444  1.00 49.46 ? 2214 HIS C O     1 
ATOM   10429 C CB    . HIS C  1 183 ? 54.460  30.822  52.865  1.00 58.09 ? 2214 HIS C CB    1 
ATOM   10430 C CG    . HIS C  1 183 ? 55.256  31.225  54.065  1.00 61.64 ? 2214 HIS C CG    1 
ATOM   10431 N ND1   . HIS C  1 183 ? 55.175  30.555  55.268  1.00 62.47 ? 2214 HIS C ND1   1 
ATOM   10432 C CD2   . HIS C  1 183 ? 56.100  32.263  54.268  1.00 62.32 ? 2214 HIS C CD2   1 
ATOM   10433 C CE1   . HIS C  1 183 ? 55.935  31.166  56.161  1.00 64.45 ? 2214 HIS C CE1   1 
ATOM   10434 N NE2   . HIS C  1 183 ? 56.507  32.205  55.579  1.00 64.02 ? 2214 HIS C NE2   1 
ATOM   10435 N N     . LYS C  1 184 ? 51.631  30.260  51.352  1.00 46.95 ? 2215 LYS C N     1 
ATOM   10436 C CA    . LYS C  1 184 ? 50.944  29.957  50.106  1.00 44.12 ? 2215 LYS C CA    1 
ATOM   10437 C C     . LYS C  1 184 ? 50.296  31.264  49.637  1.00 41.31 ? 2215 LYS C C     1 
ATOM   10438 O O     . LYS C  1 184 ? 50.257  31.574  48.445  1.00 41.99 ? 2215 LYS C O     1 
ATOM   10439 C CB    . LYS C  1 184 ? 49.872  28.889  50.334  1.00 47.80 ? 2215 LYS C CB    1 
ATOM   10440 C CG    . LYS C  1 184 ? 50.143  27.977  51.520  1.00 51.15 ? 2215 LYS C CG    1 
ATOM   10441 C CD    . LYS C  1 184 ? 50.609  26.607  51.060  1.00 52.57 ? 2215 LYS C CD    1 
ATOM   10442 C CE    . LYS C  1 184 ? 50.260  25.538  52.081  1.00 54.24 ? 2215 LYS C CE    1 
ATOM   10443 N NZ    . LYS C  1 184 ? 49.553  24.379  51.458  1.00 58.55 ? 2215 LYS C NZ    1 
ATOM   10444 N N     . ARG C  1 185 ? 49.812  32.041  50.600  1.00 36.27 ? 2216 ARG C N     1 
ATOM   10445 C CA    . ARG C  1 185 ? 49.160  33.310  50.316  1.00 31.94 ? 2216 ARG C CA    1 
ATOM   10446 C C     . ARG C  1 185 ? 50.190  34.418  50.165  1.00 28.59 ? 2216 ARG C C     1 
ATOM   10447 O O     . ARG C  1 185 ? 50.252  35.114  49.150  1.00 24.10 ? 2216 ARG C O     1 
ATOM   10448 C CB    . ARG C  1 185 ? 48.183  33.663  51.447  1.00 35.44 ? 2216 ARG C CB    1 
ATOM   10449 C CG    . ARG C  1 185 ? 46.759  33.146  51.218  1.00 43.02 ? 2216 ARG C CG    1 
ATOM   10450 C CD    . ARG C  1 185 ? 45.733  33.694  52.226  1.00 47.57 ? 2216 ARG C CD    1 
ATOM   10451 N NE    . ARG C  1 185 ? 44.410  33.076  52.061  1.00 50.89 ? 2216 ARG C NE    1 
ATOM   10452 C CZ    . ARG C  1 185 ? 43.577  33.327  51.052  1.00 53.25 ? 2216 ARG C CZ    1 
ATOM   10453 N NH1   . ARG C  1 185 ? 43.913  34.187  50.101  1.00 55.63 ? 2216 ARG C NH1   1 
ATOM   10454 N NH2   . ARG C  1 185 ? 42.403  32.717  50.991  1.00 56.45 ? 2216 ARG C NH2   1 
ATOM   10455 N N     . GLY C  1 186 ? 51.013  34.579  51.187  1.00 24.82 ? 2217 GLY C N     1 
ATOM   10456 C CA    . GLY C  1 186 ? 52.012  35.621  51.132  1.00 22.53 ? 2217 GLY C CA    1 
ATOM   10457 C C     . GLY C  1 186 ? 52.600  35.910  52.496  1.00 20.52 ? 2217 GLY C C     1 
ATOM   10458 O O     . GLY C  1 186 ? 52.203  35.308  53.496  1.00 19.45 ? 2217 GLY C O     1 
ATOM   10459 N N     . PRO C  1 187 ? 53.569  36.838  52.559  1.00 20.79 ? 2218 PRO C N     1 
ATOM   10460 C CA    . PRO C  1 187 ? 54.225  37.215  53.814  1.00 17.83 ? 2218 PRO C CA    1 
ATOM   10461 C C     . PRO C  1 187 ? 53.286  37.960  54.732  1.00 16.10 ? 2218 PRO C C     1 
ATOM   10462 O O     . PRO C  1 187 ? 53.339  37.778  55.951  1.00 16.71 ? 2218 PRO C O     1 
ATOM   10463 C CB    . PRO C  1 187 ? 55.392  38.104  53.372  1.00 15.73 ? 2218 PRO C CB    1 
ATOM   10464 C CG    . PRO C  1 187 ? 55.474  37.955  51.877  1.00 15.13 ? 2218 PRO C CG    1 
ATOM   10465 C CD    . PRO C  1 187 ? 54.114  37.583  51.410  1.00 18.14 ? 2218 PRO C CD    1 
ATOM   10466 N N     . GLY C  1 188 ? 52.439  38.798  54.132  1.00 12.72 ? 2219 GLY C N     1 
ATOM   10467 C CA    . GLY C  1 188 ? 51.490  39.598  54.894  1.00 12.08 ? 2219 GLY C CA    1 
ATOM   10468 C C     . GLY C  1 188 ? 50.283  38.890  55.502  1.00 12.86 ? 2219 GLY C C     1 
ATOM   10469 O O     . GLY C  1 188 ? 49.616  39.456  56.367  1.00 8.37  ? 2219 GLY C O     1 
ATOM   10470 N N     . PHE C  1 189 ? 50.003  37.658  55.084  1.00 11.58 ? 2220 PHE C N     1 
ATOM   10471 C CA    . PHE C  1 189 ? 48.843  36.942  55.596  1.00