data_1DG6
# 
_entry.id   1DG6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DG6         
RCSB  RCSB010058   
WWPDB D_1000010058 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DG6 
_pdbx_database_status.recvd_initial_deposition_date   1999-11-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hymowitz, S.G.'  1 
;O'ConnelL, M.P.
;
2 
'Ultsch, M.H.'    3 
'de Vos, A.M.'    4 
'Kelley, R.F.'    5 
# 
_citation.id                        primary 
_citation.title                     
'A unique zinc-binding site revealed by a high-resolution X-ray structure of homotrimeric Apo2L/TRAIL.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            39 
_citation.page_first                633 
_citation.page_last                 650 
_citation.year                      2000 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10651627 
_citation.pdbx_database_id_DOI      10.1021/bi992242l 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hymowitz, S.G.'  1 
primary 
;O'Connell, M.P.
;
2 
primary 'Ultsch, M.H.'    3 
primary 'Hurst, A.'       4 
primary 'Totpal, K.'      5 
primary 'Ashkenazi, A.'   6 
primary 'de Vos, A.M.'    7 
primary 'Kelley, R.F.'    8 
# 
_cell.entry_id           1DG6 
_cell.length_a           66.435 
_cell.length_b           66.435 
_cell.length_c           197.727 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DG6 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'APO2L/TNF-RELATED APOPOTIS INDUCING LIGAND (TRAIL)' 22106.832 1   ? D218A 'TRIMERIC JELLY-ROLL DOMAIN OF APO2L' 
? 
2 non-polymer syn 'ZINC ION'                                           65.409    1   ? ?     ?                                     
? 
3 non-polymer syn 'CHLORIDE ION'                                       35.453    1   ? ?     ?                                     
? 
4 water       nat water                                                18.015    226 ? ?     ?                                     
? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLR
NGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPAPILLMKSARNSCWSKDAEYGLYSIYQGGIFEL
KENDRIFVSVTNEHLIDMDHEASFFGAFLVG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLR
NGELVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPAPILLMKSARNSCWSKDAEYGLYSIYQGGIFEL
KENDRIFVSVTNEHLIDMDHEASFFGAFLVG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ILE n 
1 3   LEU n 
1 4   ARG n 
1 5   THR n 
1 6   SER n 
1 7   GLU n 
1 8   GLU n 
1 9   THR n 
1 10  ILE n 
1 11  SER n 
1 12  THR n 
1 13  VAL n 
1 14  GLN n 
1 15  GLU n 
1 16  LYS n 
1 17  GLN n 
1 18  GLN n 
1 19  ASN n 
1 20  ILE n 
1 21  SER n 
1 22  PRO n 
1 23  LEU n 
1 24  VAL n 
1 25  ARG n 
1 26  GLU n 
1 27  ARG n 
1 28  GLY n 
1 29  PRO n 
1 30  GLN n 
1 31  ARG n 
1 32  VAL n 
1 33  ALA n 
1 34  ALA n 
1 35  HIS n 
1 36  ILE n 
1 37  THR n 
1 38  GLY n 
1 39  THR n 
1 40  ARG n 
1 41  GLY n 
1 42  ARG n 
1 43  SER n 
1 44  ASN n 
1 45  THR n 
1 46  LEU n 
1 47  SER n 
1 48  SER n 
1 49  PRO n 
1 50  ASN n 
1 51  SER n 
1 52  LYS n 
1 53  ASN n 
1 54  GLU n 
1 55  LYS n 
1 56  ALA n 
1 57  LEU n 
1 58  GLY n 
1 59  ARG n 
1 60  LYS n 
1 61  ILE n 
1 62  ASN n 
1 63  SER n 
1 64  TRP n 
1 65  GLU n 
1 66  SER n 
1 67  SER n 
1 68  ARG n 
1 69  SER n 
1 70  GLY n 
1 71  HIS n 
1 72  SER n 
1 73  PHE n 
1 74  LEU n 
1 75  SER n 
1 76  ASN n 
1 77  LEU n 
1 78  HIS n 
1 79  LEU n 
1 80  ARG n 
1 81  ASN n 
1 82  GLY n 
1 83  GLU n 
1 84  LEU n 
1 85  VAL n 
1 86  ILE n 
1 87  HIS n 
1 88  GLU n 
1 89  LYS n 
1 90  GLY n 
1 91  PHE n 
1 92  TYR n 
1 93  TYR n 
1 94  ILE n 
1 95  TYR n 
1 96  SER n 
1 97  GLN n 
1 98  THR n 
1 99  TYR n 
1 100 PHE n 
1 101 ARG n 
1 102 PHE n 
1 103 GLN n 
1 104 GLU n 
1 105 GLU n 
1 106 ILE n 
1 107 LYS n 
1 108 GLU n 
1 109 ASN n 
1 110 THR n 
1 111 LYS n 
1 112 ASN n 
1 113 ASP n 
1 114 LYS n 
1 115 GLN n 
1 116 MET n 
1 117 VAL n 
1 118 GLN n 
1 119 TYR n 
1 120 ILE n 
1 121 TYR n 
1 122 LYS n 
1 123 TYR n 
1 124 THR n 
1 125 SER n 
1 126 TYR n 
1 127 PRO n 
1 128 ALA n 
1 129 PRO n 
1 130 ILE n 
1 131 LEU n 
1 132 LEU n 
1 133 MET n 
1 134 LYS n 
1 135 SER n 
1 136 ALA n 
1 137 ARG n 
1 138 ASN n 
1 139 SER n 
1 140 CYS n 
1 141 TRP n 
1 142 SER n 
1 143 LYS n 
1 144 ASP n 
1 145 ALA n 
1 146 GLU n 
1 147 TYR n 
1 148 GLY n 
1 149 LEU n 
1 150 TYR n 
1 151 SER n 
1 152 ILE n 
1 153 TYR n 
1 154 GLN n 
1 155 GLY n 
1 156 GLY n 
1 157 ILE n 
1 158 PHE n 
1 159 GLU n 
1 160 LEU n 
1 161 LYS n 
1 162 GLU n 
1 163 ASN n 
1 164 ASP n 
1 165 ARG n 
1 166 ILE n 
1 167 PHE n 
1 168 VAL n 
1 169 SER n 
1 170 VAL n 
1 171 THR n 
1 172 ASN n 
1 173 GLU n 
1 174 HIS n 
1 175 LEU n 
1 176 ILE n 
1 177 ASP n 
1 178 MET n 
1 179 ASP n 
1 180 HIS n 
1 181 GLU n 
1 182 ALA n 
1 183 SER n 
1 184 PHE n 
1 185 PHE n 
1 186 GLY n 
1 187 ALA n 
1 188 PHE n 
1 189 LEU n 
1 190 VAL n 
1 191 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    'HUMAN PLACENTA' 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               'TRP PROMOTER' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'HUMAN PLACENTA' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TNF10_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P50591 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1DG6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 191 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P50591 
_struct_ref_seq.db_align_beg                  91 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  281 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       91 
_struct_ref_seq.pdbx_auth_seq_align_end       281 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1DG6 
_struct_ref_seq_dif.mon_id                       ALA 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      128 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P50591 
_struct_ref_seq_dif.db_mon_id                    ASP 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          218 
_struct_ref_seq_dif.details                      'ENGINEERED MUTATION' 
_struct_ref_seq_dif.pdbx_auth_seq_num            218 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1DG6 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.9 
_exptl_crystal.density_percent_sol   32.0 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    
'WELL SOLUTION 32% MPD; DROP 1.2MG/ML APO2L, 20MM TRIS HCL PH 7.5, 1% MPD, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   1999-04-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03321 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             1.03321 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DG6 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            1.3 
_reflns.number_obs                   41840 
_reflns.number_all                   41901 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              6.4000000 
_reflns.pdbx_netI_over_sigmaI        12.4 
_reflns.B_iso_Wilson_estimate        12.5 
_reflns.pdbx_redundancy              12.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.30 
_reflns_shell.d_res_low              1.35 
_reflns_shell.percent_possible_all   100 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        34.0000000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1DG6 
_refine.ls_number_reflns_obs                     40934 
_refine.ls_number_reflns_all                     41840 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            1.30 
_refine.ls_percent_reflns_obs                    100 
_refine.ls_R_factor_obs                          0.1410000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1410000 
_refine.ls_R_factor_R_free                       0.1970000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  3346 
_refine.ls_number_parameters                     13240 
_refine.ls_number_restraints                     16022 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'Moews & Krestsinger, J.MOL.BIOL.91(1973)201-228' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'USED CONJUGANT GRADIENT LEAST SQUARES AND ANISOTROPIC B-FACTOR REFINEMENT' 
_refine.pdbx_starting_model                      'truncated model of tnfa pdb code 1tnf' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH & HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1DG6 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      5 
_refine_analyze.occupancy_sum_hydrogen          0.0 
_refine_analyze.occupancy_sum_non_hydrogen      1452.0 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1232 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             226 
_refine_hist.number_atoms_total               1460 
_refine_hist.d_res_high                       1.30 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.014 ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              2.53  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1DG6 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      ? 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     10.0 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.1320000 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.1880000 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   10.0 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               29975 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1DG6 
_struct.title                     'CRYSTAL STRUCTURE OF APO2L/TRAIL' 
_struct.pdbx_descriptor           'APO2L/TNF-RELATED APOPOTIS INDUCING LIGAND (TRAIL)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DG6 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'CYTOKINE, TNF, TRIMER, ZINC-BINDING SITE, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        172 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       HIS 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        174 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         262 
_struct_conf.end_auth_comp_id        HIS 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         264 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 C CL  .   CL ? ? A ZN 300 A CL  406 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 140 SG ? ? A ZN 300 A CYS 230 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 140 SG ? ? A ZN 300 A CYS 230 3_555 ? ? ? ? ? ? ? 2.340 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 C CL  .   CL ? ? A ZN 300 A CL  406 2_555 ? ? ? ? ? ? ? 2.340 ? 
metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 C CL  .   CL ? ? A ZN 300 A CL  406 3_555 ? ? ? ? ? ? ? 2.340 ? 
metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 140 SG ? ? A ZN 300 A CYS 230 2_555 ? ? ? ? ? ? ? 2.340 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 3 ? 
A1 ? 5 ? 
B  ? 4 ? 
B1 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A1 1 2 ? anti-parallel 
A1 2 3 ? anti-parallel 
A1 3 4 ? anti-parallel 
A1 4 5 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B1 1 2 ? anti-parallel 
B1 2 3 ? anti-parallel 
B1 3 4 ? anti-parallel 
B1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 TYR A 147 ? LEU A 160 ? TYR A 237 LEU A 250 
A  2 GLY A 90  ? GLN A 103 ? GLY A 180 GLN A 193 
A  3 ILE A 176 ? ASP A 177 ? ILE A 266 ASP A 267 
A1 1 TYR A 147 ? LEU A 160 ? TYR A 237 LEU A 250 
A1 2 GLY A 90  ? GLN A 103 ? GLY A 180 GLN A 193 
A1 3 PHE A 184 ? LEU A 189 ? PHE A 274 LEU A 279 
A1 4 ALA A 33  ? THR A 37  ? ALA A 123 THR A 127 
A1 5 PHE A 73  ? SER A 75  ? PHE A 163 SER A 165 
B  1 ILE A 130 ? ASN A 138 ? ILE A 220 ASN A 228 
B  2 GLN A 115 ? TYR A 123 ? GLN A 205 TYR A 213 
B  3 ARG A 165 ? VAL A 170 ? ARG A 255 VAL A 260 
B  4 ARG A 59  ? LYS A 60  ? ARG A 149 LYS A 150 
B1 1 ILE A 130 ? ASN A 138 ? ILE A 220 ASN A 228 
B1 2 GLN A 115 ? TYR A 123 ? GLN A 205 TYR A 213 
B1 3 ARG A 165 ? VAL A 170 ? ARG A 255 VAL A 260 
B1 4 GLU A 83  ? ILE A 86  ? GLU A 173 ILE A 176 
B1 5 LEU A 77  ? ARG A 80  ? LEU A 167 ARG A 170 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N LEU A 160 ? N LEU A 250 O GLY A 90  ? O GLY A 180 
A  2 3 O TYR A 99  ? O TYR A 189 N ASP A 177 ? N ASP A 267 
A1 1 2 N LEU A 160 ? N LEU A 250 O GLY A 90  ? O GLY A 180 
A1 2 3 O GLN A 97  ? O GLN A 187 N PHE A 184 ? N PHE A 274 
A1 3 4 O ALA A 187 ? O ALA A 277 N ALA A 34  ? N ALA A 124 
A1 4 5 N HIS A 35  ? N HIS A 125 O PHE A 73  ? O PHE A 163 
B  1 2 O ARG A 137 ? O ARG A 227 N MET A 116 ? N MET A 206 
B  2 3 N TYR A 123 ? N TYR A 213 O ARG A 165 ? O ARG A 255 
B  3 4 O VAL A 170 ? O VAL A 260 N ARG A 59  ? N ARG A 149 
B1 1 2 O ARG A 137 ? O ARG A 227 N MET A 116 ? N MET A 206 
B1 2 3 N TYR A 123 ? N TYR A 213 O ARG A 165 ? O ARG A 255 
B1 3 4 N ILE A 166 ? N ILE A 256 O LEU A 84  ? O LEU A 174 
B1 4 5 N VAL A 85  ? N VAL A 175 O HIS A 78  ? O HIS A 168 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN A 300' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL A 406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 CYS A 140 ? CYS A 230 . ? 2_555 ? 
2  AC1 6 CYS A 140 ? CYS A 230 . ? 3_555 ? 
3  AC1 6 CYS A 140 ? CYS A 230 . ? 1_555 ? 
4  AC1 6 CL  C .   ? CL  A 406 . ? 2_555 ? 
5  AC1 6 CL  C .   ? CL  A 406 . ? 3_555 ? 
6  AC1 6 CL  C .   ? CL  A 406 . ? 1_555 ? 
7  AC2 6 CYS A 140 ? CYS A 230 . ? 2_555 ? 
8  AC2 6 CYS A 140 ? CYS A 230 . ? 3_555 ? 
9  AC2 6 CYS A 140 ? CYS A 230 . ? 1_555 ? 
10 AC2 6 ZN  B .   ? ZN  A 300 . ? 2_555 ? 
11 AC2 6 ZN  B .   ? ZN  A 300 . ? 3_555 ? 
12 AC2 6 ZN  B .   ? ZN  A 300 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1DG6 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DG6 
_atom_sites.fract_transf_matrix[1][1]   0.015052 
_atom_sites.fract_transf_matrix[1][2]   0.008690 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017381 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005057 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 30  ? 4.054   6.965  24.777 1.00 56.42  ? 120 GLN A N   1 
ATOM   2    C  CA  . GLN A 1 30  ? 5.032   5.880  24.896 1.00 51.23  ? 120 GLN A CA  1 
ATOM   3    C  C   . GLN A 1 30  ? 6.089   6.177  25.943 1.00 45.82  ? 120 GLN A C   1 
ATOM   4    O  O   . GLN A 1 30  ? 6.810   7.167  25.893 1.00 41.03  ? 120 GLN A O   1 
ATOM   5    C  CB  . GLN A 1 30  ? 5.672   5.654  23.519 1.00 58.31  ? 120 GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 30  ? 6.171   6.938  22.882 1.00 65.35  ? 120 GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 30  ? 7.686   6.943  22.739 1.00 67.99  ? 120 GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 30  ? 8.197   7.172  21.632 1.00 68.42  ? 120 GLN A OE1 1 
ATOM   9    N  NE2 . GLN A 1 30  ? 8.342   6.696  23.872 1.00 66.61  ? 120 GLN A NE2 1 
ATOM   10   N  N   . ARG A 1 31  ? 6.231   5.327  26.951 1.00 37.22  ? 121 ARG A N   1 
ATOM   11   C  CA  . ARG A 1 31  ? 7.134   5.557  28.057 1.00 30.83  ? 121 ARG A CA  1 
ATOM   12   C  C   . ARG A 1 31  ? 6.897   6.949  28.669 1.00 21.59  ? 121 ARG A C   1 
ATOM   13   O  O   . ARG A 1 31  ? 7.695   7.878  28.558 1.00 20.28  ? 121 ARG A O   1 
ATOM   14   C  CB  . ARG A 1 31  ? 8.603   5.381  27.709 1.00 33.78  ? 121 ARG A CB  1 
ATOM   15   C  CG  . ARG A 1 31  ? 8.834   4.186  26.799 1.00 37.09  ? 121 ARG A CG  1 
ATOM   16   C  CD  . ARG A 1 31  ? 10.289  3.734  26.818 1.00 39.52  ? 121 ARG A CD  1 
ATOM   17   N  NE  . ARG A 1 31  ? 10.601  2.762  27.856 1.00 45.43  ? 121 ARG A NE  1 
ATOM   18   C  CZ  . ARG A 1 31  ? 11.766  2.685  28.483 1.00 45.92  ? 121 ARG A CZ  1 
ATOM   19   N  NH1 . ARG A 1 31  ? 12.693  3.562  28.133 1.00 43.31  ? 121 ARG A NH1 1 
ATOM   20   N  NH2 . ARG A 1 31  ? 11.930  1.748  29.405 1.00 43.31  ? 121 ARG A NH2 1 
ATOM   21   N  N   . VAL A 1 32  ? 5.766   7.021  29.326 1.00 14.74  ? 122 VAL A N   1 
ATOM   22   C  CA  . VAL A 1 32  ? 5.416   8.156  30.165 1.00 13.57  ? 122 VAL A CA  1 
ATOM   23   C  C   . VAL A 1 32  ? 5.356   7.654  31.600 1.00 12.35  ? 122 VAL A C   1 
ATOM   24   O  O   . VAL A 1 32  ? 4.389   6.972  31.975 1.00 13.17  ? 122 VAL A O   1 
ATOM   25   C  CB  . VAL A 1 32  ? 4.082   8.758  29.674 1.00 14.68  ? 122 VAL A CB  1 
ATOM   26   C  CG1 . VAL A 1 32  ? 3.801   10.007 30.510 1.00 16.60  ? 122 VAL A CG1 1 
ATOM   27   C  CG2 . VAL A 1 32  ? 4.101   9.112  28.195 1.00 15.81  ? 122 VAL A CG2 1 
ATOM   28   N  N   . ALA A 1 33  ? 6.412   7.924  32.369 1.00 11.96  ? 123 ALA A N   1 
ATOM   29   C  CA  . ALA A 1 33  ? 6.530   7.386  33.728 1.00 11.81  ? 123 ALA A CA  1 
ATOM   30   C  C   . ALA A 1 33  ? 7.598   8.134  34.507 1.00 11.24  ? 123 ALA A C   1 
ATOM   31   O  O   . ALA A 1 33  ? 8.485   8.726  33.928 1.00 12.50  ? 123 ALA A O   1 
ATOM   32   C  CB  . ALA A 1 33  ? 6.866   5.889  33.668 1.00 14.20  ? 123 ALA A CB  1 
ATOM   33   N  N   . ALA A 1 34  ? 7.514   8.072  35.846 1.00 10.39  ? 124 ALA A N   1 
ATOM   34   C  CA  . ALA A 1 34  ? 8.474   8.721  36.722 1.00 10.56  ? 124 ALA A CA  1 
ATOM   35   C  C   . ALA A 1 34  ? 8.511   7.940  38.054 1.00 9.49   ? 124 ALA A C   1 
ATOM   36   O  O   . ALA A 1 34  ? 7.486   7.455  38.530 1.00 10.49  ? 124 ALA A O   1 
ATOM   37   C  CB  . ALA A 1 34  ? 8.115   10.152 37.023 1.00 13.71  ? 124 ALA A CB  1 
ATOM   38   N  N   . HIS A 1 35  ? 9.702   7.873  38.632 1.00 10.13  ? 125 HIS A N   1 
ATOM   39   C  CA  . HIS A 1 35  ? 9.882   7.405  40.015 1.00 9.97   ? 125 HIS A CA  1 
ATOM   40   C  C   . HIS A 1 35  ? 10.980  8.252  40.605 1.00 9.43   ? 125 HIS A C   1 
ATOM   41   O  O   . HIS A 1 35  ? 12.102  8.209  40.080 1.00 11.11  ? 125 HIS A O   1 
ATOM   42   C  CB  . HIS A 1 35  ? 10.221  5.922  40.074 1.00 11.04  ? 125 HIS A CB  1 
ATOM   43   C  CG  . HIS A 1 35  ? 10.424  5.354  41.451 1.00 9.77   ? 125 HIS A CG  1 
ATOM   44   N  ND1 . HIS A 1 35  ? 9.398   4.806  42.213 1.00 10.54  ? 125 HIS A ND1 1 
ATOM   45   C  CD2 . HIS A 1 35  ? 11.555  5.198  42.190 1.00 10.55  ? 125 HIS A CD2 1 
ATOM   46   C  CE1 . HIS A 1 35  ? 9.914   4.344  43.365 1.00 10.42  ? 125 HIS A CE1 1 
ATOM   47   N  NE2 . HIS A 1 35  ? 11.216  4.586  43.373 1.00 10.21  ? 125 HIS A NE2 1 
ATOM   48   N  N   . ILE A 1 36  ? 10.679  9.006  41.665 1.00 10.45  ? 126 ILE A N   1 
ATOM   49   C  CA  . ILE A 1 36  ? 11.693  9.893  42.257 1.00 12.06  ? 126 ILE A CA  1 
ATOM   50   C  C   . ILE A 1 36  ? 11.759  9.571  43.754 1.00 11.46  ? 126 ILE A C   1 
ATOM   51   O  O   . ILE A 1 36  ? 10.762  9.167  44.364 1.00 11.82  ? 126 ILE A O   1 
ATOM   52   C  CB  . ILE A 1 36  ? 11.429  11.367 41.995 1.00 14.64  ? 126 ILE A CB  1 
ATOM   53   C  CG1 . ILE A 1 36  ? 10.161  11.895 42.641 1.00 15.01  ? 126 ILE A CG1 1 
ATOM   54   C  CG2 . ILE A 1 36  ? 11.443  11.649 40.470 1.00 17.56  ? 126 ILE A CG2 1 
ATOM   55   C  CD1 . ILE A 1 36  ? 9.893   13.353 42.278 1.00 17.39  ? 126 ILE A CD1 1 
ATOM   56   N  N   . THR A 1 37  ? 12.960  9.684  44.320 1.00 12.34  ? 127 THR A N   1 
ATOM   57   C  CA  . THR A 1 37  ? 13.166  9.141  45.637 1.00 11.69  ? 127 THR A CA  1 
ATOM   58   C  C   . THR A 1 37  ? 13.756  10.186 46.585 1.00 11.97  ? 127 THR A C   1 
ATOM   59   O  O   . THR A 1 37  ? 14.231  11.242 46.189 1.00 13.87  ? 127 THR A O   1 
ATOM   60   C  CB  . THR A 1 37  ? 14.150  7.959  45.639 1.00 13.86  ? 127 THR A CB  1 
ATOM   61   O  OG1 . THR A 1 37  ? 15.480  8.422  45.316 1.00 16.39  ? 127 THR A OG1 1 
ATOM   62   C  CG2 . THR A 1 37  ? 13.799  6.979  44.540 1.00 14.80  ? 127 THR A CG2 1 
ATOM   63   N  N   . GLY A 1 38  ? 13.748  9.830  47.870 1.00 13.04  ? 128 GLY A N   1 
ATOM   64   C  CA  . GLY A 1 38  ? 14.541  10.618 48.810 1.00 14.89  ? 128 GLY A CA  1 
ATOM   65   C  C   . GLY A 1 38  ? 16.023  10.597 48.450 1.00 16.75  ? 128 GLY A C   1 
ATOM   66   O  O   . GLY A 1 38  ? 16.505  9.751  47.671 1.00 15.66  ? 128 GLY A O   1 
ATOM   67   N  N   . THR A 1 39  ? 16.780  11.529 49.055 1.00 17.69  ? 129 THR A N   1 
ATOM   68   C  CA  . THR A 1 39  ? 18.187  11.627 48.658 1.00 22.01  ? 129 THR A CA  1 
ATOM   69   C  C   . THR A 1 39  ? 19.167  11.006 49.673 1.00 25.57  ? 129 THR A C   1 
ATOM   70   O  O   . THR A 1 39  ? 20.401  11.101 49.433 1.00 30.24  ? 129 THR A O   1 
ATOM   71   C  CB  . THR A 1 39  ? 18.635  13.079 48.461 1.00 24.38  ? 129 THR A CB  1 
ATOM   72   O  OG1 . THR A 1 39  ? 18.536  13.758 49.745 1.00 25.59  ? 129 THR A OG1 1 
ATOM   73   C  CG2 . THR A 1 39  ? 17.767  13.765 47.431 1.00 27.84  ? 129 THR A CG2 1 
ATOM   74   N  N   . ARG A 1 40  ? 18.609  10.468 50.718 1.00 30.76  ? 130 ARG A N   1 
ATOM   75   C  CA  . ARG A 1 40  ? 19.125  9.698  51.830 1.00 38.97  ? 130 ARG A CA  1 
ATOM   76   C  C   . ARG A 1 40  ? 19.130  10.406 53.179 1.00 43.10  ? 130 ARG A C   1 
ATOM   77   O  O   . ARG A 1 40  ? 18.817  11.585 53.348 1.00 50.17  ? 130 ARG A O   1 
ATOM   78   C  CB  . ARG A 1 40  ? 20.510  9.162  51.449 1.00 44.53  ? 130 ARG A CB  1 
ATOM   79   C  CG  . ARG A 1 40  ? 21.029  8.260  52.552 1.00 50.75  ? 130 ARG A CG  1 
ATOM   80   C  CD  . ARG A 1 40  ? 20.846  6.792  52.235 1.00 56.29  ? 130 ARG A CD  1 
ATOM   81   N  NE  . ARG A 1 40  ? 21.699  6.316  51.150 1.00 62.60  ? 130 ARG A NE  1 
ATOM   82   C  CZ  . ARG A 1 40  ? 22.517  5.271  51.192 1.00 64.71  ? 130 ARG A CZ  1 
ATOM   83   N  NH1 . ARG A 1 40  ? 22.624  4.540  52.299 1.00 73.00  ? 130 ARG A NH1 1 
ATOM   84   N  NH2 . ARG A 1 40  ? 23.255  4.922  50.139 1.00 74.39  ? 130 ARG A NH2 1 
ATOM   85   N  N   . LYS A 1 52  ? -11.479 27.860 46.807 1.00 51.96  ? 142 LYS A N   1 
ATOM   86   C  CA  . LYS A 1 52  ? -10.521 28.459 45.863 1.00 45.51  ? 142 LYS A CA  1 
ATOM   87   C  C   . LYS A 1 52  ? -9.377  29.088 46.651 1.00 43.01  ? 142 LYS A C   1 
ATOM   88   O  O   . LYS A 1 52  ? -8.308  29.442 46.198 1.00 42.23  ? 142 LYS A O   1 
ATOM   89   C  CB  . LYS A 1 52  ? -11.236 29.453 44.948 1.00 46.12  ? 142 LYS A CB  1 
ATOM   90   C  CG  . LYS A 1 52  ? -12.327 28.748 44.131 1.00 48.02  ? 142 LYS A CG  1 
ATOM   91   C  CD  . LYS A 1 52  ? -13.408 29.704 43.707 1.00 48.91  ? 142 LYS A CD  1 
ATOM   92   C  CE  . LYS A 1 52  ? -13.826 29.553 42.248 1.00 51.59  ? 142 LYS A CE  1 
ATOM   93   N  NZ  . LYS A 1 52  ? -14.901 30.535 41.900 1.00 49.21  ? 142 LYS A NZ  1 
ATOM   94   N  N   . ASN A 1 53  ? -9.667  29.200 47.932 1.00 43.29  ? 143 ASN A N   1 
ATOM   95   C  CA  . ASN A 1 53  ? -8.910  29.831 48.986 1.00 43.55  ? 143 ASN A CA  1 
ATOM   96   C  C   . ASN A 1 53  ? -8.165  28.772 49.790 1.00 43.69  ? 143 ASN A C   1 
ATOM   97   O  O   . ASN A 1 53  ? -7.170  29.014 50.471 1.00 44.84  ? 143 ASN A O   1 
ATOM   98   C  CB  . ASN A 1 53  ? -9.905  30.643 49.846 1.00 51.29  ? 143 ASN A CB  1 
ATOM   99   C  CG  . ASN A 1 53  ? -11.348 30.493 49.376 1.00 52.77  ? 143 ASN A CG  1 
ATOM   100  O  OD1 . ASN A 1 53  ? -11.967 29.434 49.604 1.00 63.10  ? 143 ASN A OD1 1 
ATOM   101  N  ND2 . ASN A 1 53  ? -11.927 31.516 48.720 1.00 55.74  ? 143 ASN A ND2 1 
ATOM   102  N  N   . GLU A 1 54  ? -8.660  27.532 49.702 1.00 38.36  ? 144 GLU A N   1 
ATOM   103  C  CA  . GLU A 1 54  ? -8.189  26.496 50.605 1.00 34.75  ? 144 GLU A CA  1 
ATOM   104  C  C   . GLU A 1 54  ? -6.721  26.195 50.407 1.00 31.35  ? 144 GLU A C   1 
ATOM   105  O  O   . GLU A 1 54  ? -6.124  26.138 49.334 1.00 33.96  ? 144 GLU A O   1 
ATOM   106  C  CB  . GLU A 1 54  ? -9.004  25.205 50.444 1.00 37.24  ? 144 GLU A CB  1 
ATOM   107  C  CG  . GLU A 1 54  ? -8.600  24.107 51.428 1.00 45.66  ? 144 GLU A CG  1 
ATOM   108  C  CD  . GLU A 1 54  ? -9.075  22.731 50.980 1.00 55.05  ? 144 GLU A CD  1 
ATOM   109  O  OE1 . GLU A 1 54  ? -8.798  22.343 49.817 1.00 69.09  ? 144 GLU A OE1 1 
ATOM   110  O  OE2 . GLU A 1 54  ? -9.728  22.029 51.788 1.00 66.99  ? 144 GLU A OE2 1 
ATOM   111  N  N   . LYS A 1 55  ? -6.068  25.940 51.521 1.00 26.43  ? 145 LYS A N   1 
ATOM   112  C  CA  . LYS A 1 55  ? -4.641  25.629 51.500 1.00 23.34  ? 145 LYS A CA  1 
ATOM   113  C  C   . LYS A 1 55  ? -4.409  24.136 51.627 1.00 19.21  ? 145 LYS A C   1 
ATOM   114  O  O   . LYS A 1 55  ? -5.199  23.448 52.291 1.00 21.64  ? 145 LYS A O   1 
ATOM   115  C  CB  . LYS A 1 55  ? -3.931  26.332 52.673 1.00 27.57  ? 145 LYS A CB  1 
ATOM   116  C  CG  . LYS A 1 55  ? -4.005  27.874 52.500 1.00 34.27  ? 145 LYS A CG  1 
ATOM   117  C  CD  . LYS A 1 55  ? -4.027  28.075 50.981 1.00 38.50  ? 145 LYS A CD  1 
ATOM   118  C  CE  . LYS A 1 55  ? -2.769  28.775 50.498 1.00 48.78  ? 145 LYS A CE  1 
ATOM   119  N  NZ  . LYS A 1 55  ? -3.069  30.112 49.880 1.00 60.28  ? 145 LYS A NZ  1 
ATOM   120  N  N   . ALA A 1 56  ? -3.346  23.661 50.979 1.00 17.38  ? 146 ALA A N   1 
ATOM   121  C  CA  . ALA A 1 56  ? -2.946  22.261 51.208 1.00 17.68  ? 146 ALA A CA  1 
ATOM   122  C  C   . ALA A 1 56  ? -2.539  22.020 52.640 1.00 16.22  ? 146 ALA A C   1 
ATOM   123  O  O   . ALA A 1 56  ? -1.892  22.879 53.297 1.00 19.01  ? 146 ALA A O   1 
ATOM   124  C  CB  . ALA A 1 56  ? -1.745  21.949 50.312 1.00 15.89  ? 146 ALA A CB  1 
ATOM   125  N  N   . LEU A 1 57  ? -2.922  20.870 53.145 1.00 14.18  ? 147 LEU A N   1 
ATOM   126  C  CA  . LEU A 1 57  ? -2.556  20.361 54.442 1.00 14.74  ? 147 LEU A CA  1 
ATOM   127  C  C   . LEU A 1 57  ? -1.138  19.806 54.448 1.00 15.13  ? 147 LEU A C   1 
ATOM   128  O  O   . LEU A 1 57  ? -0.538  19.500 53.409 1.00 16.65  ? 147 LEU A O   1 
ATOM   129  C  CB  . LEU A 1 57  ? -3.528  19.254 54.841 1.00 16.47  ? 147 LEU A CB  1 
ATOM   130  C  CG  . LEU A 1 57  ? -4.984  19.720 54.960 1.00 18.92  ? 147 LEU A CG  1 
ATOM   131  C  CD1 . LEU A 1 57  ? -5.923  18.533 55.065 1.00 24.19  ? 147 LEU A CD1 1 
ATOM   132  C  CD2 . LEU A 1 57  ? -5.147  20.609 56.185 1.00 22.41  ? 147 LEU A CD2 1 
ATOM   133  N  N   . GLY A 1 58  ? -0.581  19.681 55.664 1.00 16.46  ? 148 GLY A N   1 
ATOM   134  C  CA  . GLY A 1 58  ? 0.748   19.138 55.836 1.00 17.23  ? 148 GLY A CA  1 
ATOM   135  C  C   . GLY A 1 58  ? 1.821   20.084 55.335 1.00 17.56  ? 148 GLY A C   1 
ATOM   136  O  O   . GLY A 1 58  ? 1.605   21.303 55.134 1.00 22.47  ? 148 GLY A O   1 
ATOM   137  N  N   . ARG A 1 59  ? 3.006   19.514 55.121 1.00 15.03  ? 149 ARG A N   1 
ATOM   138  C  CA  . ARG A 1 59  ? 4.148   20.219 54.539 1.00 16.27  ? 149 ARG A CA  1 
ATOM   139  C  C   . ARG A 1 59  ? 4.583   19.502 53.283 1.00 14.37  ? 149 ARG A C   1 
ATOM   140  O  O   . ARG A 1 59  ? 4.804   18.308 53.280 1.00 14.10  ? 149 ARG A O   1 
ATOM   141  C  CB  . ARG A 1 59  ? 5.322   20.308 55.538 1.00 19.85  ? 149 ARG A CB  1 
ATOM   142  C  CG  . ARG A 1 59  ? 4.765   21.115 56.720 1.00 29.78  ? 149 ARG A CG  1 
ATOM   143  C  CD  . ARG A 1 59  ? 5.785   21.436 57.777 1.00 38.41  ? 149 ARG A CD  1 
ATOM   144  N  NE  . ARG A 1 59  ? 7.079   21.924 57.283 1.00 45.30  ? 149 ARG A NE  1 
ATOM   145  C  CZ  . ARG A 1 59  ? 7.619   22.980 57.876 1.00 53.71  ? 149 ARG A CZ  1 
ATOM   146  N  NH1 . ARG A 1 59  ? 6.911   23.494 58.865 1.00 58.17  ? 149 ARG A NH1 1 
ATOM   147  N  NH2 . ARG A 1 59  ? 8.783   23.478 57.488 1.00 63.82  ? 149 ARG A NH2 1 
ATOM   148  N  N   . LYS A 1 60  ? 4.739   20.267 52.221 1.00 15.22  ? 150 LYS A N   1 
ATOM   149  C  CA  . LYS A 1 60  ? 5.096   19.684 50.946 1.00 14.00  ? 150 LYS A CA  1 
ATOM   150  C  C   . LYS A 1 60  ? 6.507   19.147 51.001 1.00 14.70  ? 150 LYS A C   1 
ATOM   151  O  O   . LYS A 1 60  ? 7.433   19.810 51.477 1.00 17.14  ? 150 LYS A O   1 
ATOM   152  C  CB  . LYS A 1 60  ? 4.981   20.774 49.848 1.00 17.73  ? 150 LYS A CB  1 
ATOM   153  C  CG  . LYS A 1 60  ? 5.402   20.293 48.448 1.00 19.70  ? 150 LYS A CG  1 
ATOM   154  C  CD  . LYS A 1 60  ? 4.861   21.281 47.383 1.00 27.97  ? 150 LYS A CD  1 
ATOM   155  C  CE  . LYS A 1 60  ? 5.893   21.763 46.441 1.00 32.44  ? 150 LYS A CE  1 
ATOM   156  N  NZ  . LYS A 1 60  ? 5.281   22.916 45.679 1.00 31.80  ? 150 LYS A NZ  1 
ATOM   157  N  N   . ILE A 1 61  ? 6.679   17.919 50.477 1.00 13.49  ? 151 ILE A N   1 
ATOM   158  C  CA  . ILE A 1 61  ? 8.045   17.403 50.324 1.00 13.69  ? 151 ILE A CA  1 
ATOM   159  C  C   . ILE A 1 61  ? 8.668   17.995 49.086 1.00 14.36  ? 151 ILE A C   1 
ATOM   160  O  O   . ILE A 1 61  ? 8.188   17.902 47.960 1.00 15.94  ? 151 ILE A O   1 
ATOM   161  C  CB  . ILE A 1 61  ? 8.036   15.856 50.277 1.00 12.47  ? 151 ILE A CB  1 
ATOM   162  C  CG1 . ILE A 1 61  ? 7.434   15.266 51.564 1.00 13.22  ? 151 ILE A CG1 1 
ATOM   163  C  CG2 . ILE A 1 61  ? 9.430   15.319 49.975 1.00 12.21  ? 151 ILE A CG2 1 
ATOM   164  C  CD1 . ILE A 1 61  ? 7.228   13.752 51.519 1.00 14.37  ? 151 ILE A CD1 1 
ATOM   165  N  N   . ASN A 1 62  ? 9.824   18.702 49.276 1.00 16.68  ? 152 ASN A N   1 
ATOM   166  C  CA  . ASN A 1 62  ? 10.443  19.220 48.045 1.00 19.40  ? 152 ASN A CA  1 
ATOM   167  C  C   . ASN A 1 62  ? 11.869  18.727 47.907 1.00 20.18  ? 152 ASN A C   1 
ATOM   168  O  O   . ASN A 1 62  ? 12.615  19.298 47.110 1.00 26.96  ? 152 ASN A O   1 
ATOM   169  C  CB  . ASN A 1 62  ? 10.312  20.747 47.994 1.00 23.80  ? 152 ASN A CB  1 
ATOM   170  C  CG  . ASN A 1 62  ? 10.880  21.305 49.273 1.00 28.14  ? 152 ASN A CG  1 
ATOM   171  O  OD1 . ASN A 1 62  ? 11.856  20.790 49.781 1.00 33.99  ? 152 ASN A OD1 1 
ATOM   172  N  ND2 . ASN A 1 62  ? 10.198  22.335 49.746 1.00 42.77  ? 152 ASN A ND2 1 
ATOM   173  N  N   . SER A 1 63  ? 12.275  17.715 48.664 1.00 19.20  ? 153 SER A N   1 
ATOM   174  C  CA  . SER A 1 63  ? 13.673  17.249 48.619 1.00 20.87  ? 153 SER A CA  1 
ATOM   175  C  C   . SER A 1 63  ? 13.832  15.923 47.886 1.00 20.48  ? 153 SER A C   1 
ATOM   176  O  O   . SER A 1 63  ? 14.790  15.170 48.126 1.00 25.05  ? 153 SER A O   1 
ATOM   177  C  CB  . SER A 1 63  ? 14.239  17.095 50.022 1.00 24.11  ? 153 SER A CB  1 
ATOM   178  O  OG  . SER A 1 63  ? 13.345  16.425 50.881 1.00 28.50  ? 153 SER A OG  1 
ATOM   179  N  N   . TRP A 1 64  ? 12.907  15.627 46.998 1.00 19.53  ? 154 TRP A N   1 
ATOM   180  C  CA  . TRP A 1 64  ? 13.068  14.469 46.121 1.00 16.86  ? 154 TRP A CA  1 
ATOM   181  C  C   . TRP A 1 64  ? 14.279  14.680 45.223 1.00 18.39  ? 154 TRP A C   1 
ATOM   182  O  O   . TRP A 1 64  ? 14.574  15.809 44.823 1.00 25.55  ? 154 TRP A O   1 
ATOM   183  C  CB  . TRP A 1 64  ? 11.841  14.328 45.214 1.00 15.66  ? 154 TRP A CB  1 
ATOM   184  C  CG  . TRP A 1 64  ? 10.533  14.152 45.895 1.00 14.00  ? 154 TRP A CG  1 
ATOM   185  C  CD1 . TRP A 1 64  ? 9.447   15.015 45.792 1.00 13.84  ? 154 TRP A CD1 1 
ATOM   186  C  CD2 . TRP A 1 64  ? 10.146  13.090 46.771 1.00 12.98  ? 154 TRP A CD2 1 
ATOM   187  N  NE1 . TRP A 1 64  ? 8.414   14.523 46.554 1.00 13.75  ? 154 TRP A NE1 1 
ATOM   188  C  CE2 . TRP A 1 64  ? 8.803   13.359 47.163 1.00 12.90  ? 154 TRP A CE2 1 
ATOM   189  C  CE3 . TRP A 1 64  ? 10.781  11.946 47.249 1.00 12.32  ? 154 TRP A CE3 1 
ATOM   190  C  CZ2 . TRP A 1 64  ? 8.098   12.510 48.027 1.00 12.95  ? 154 TRP A CZ2 1 
ATOM   191  C  CZ3 . TRP A 1 64  ? 10.073  11.116 48.100 1.00 13.00  ? 154 TRP A CZ3 1 
ATOM   192  C  CH2 . TRP A 1 64  ? 8.747   11.377 48.499 1.00 12.23  ? 154 TRP A CH2 1 
ATOM   193  N  N   . GLU A 1 65  ? 14.923  13.577 44.886 1.00 18.91  ? 155 GLU A N   1 
ATOM   194  C  CA  . GLU A 1 65  ? 16.183  13.602 44.148 1.00 21.50  ? 155 GLU A CA  1 
ATOM   195  C  C   . GLU A 1 65  ? 15.844  14.217 42.808 1.00 23.26  ? 155 GLU A C   1 
ATOM   196  O  O   . GLU A 1 65  ? 14.890  13.780 42.145 1.00 25.79  ? 155 GLU A O   1 
ATOM   197  C  CB  . GLU A 1 65  ? 16.748  12.183 44.078 1.00 21.91  ? 155 GLU A CB  1 
ATOM   198  C  CG  . GLU A 1 65  ? 17.836  12.041 43.017 1.00 22.86  ? 155 GLU A CG  1 
ATOM   199  C  CD  . GLU A 1 65  ? 19.048  12.796 43.564 1.00 27.65  ? 155 GLU A CD  1 
ATOM   200  O  OE1 . GLU A 1 65  ? 19.615  12.297 44.573 1.00 29.55  ? 155 GLU A OE1 1 
ATOM   201  O  OE2 . GLU A 1 65  ? 19.331  13.838 42.948 1.00 30.37  ? 155 GLU A OE2 1 
ATOM   202  N  N   . SER A 1 66  ? 16.573  15.258 42.401 1.00 22.16  ? 156 SER A N   1 
ATOM   203  C  CA  . SER A 1 66  ? 16.233  15.918 41.129 1.00 22.17  ? 156 SER A CA  1 
ATOM   204  C  C   . SER A 1 66  ? 17.235  15.543 40.065 1.00 22.95  ? 156 SER A C   1 
ATOM   205  O  O   . SER A 1 66  ? 17.096  16.021 38.918 1.00 27.98  ? 156 SER A O   1 
ATOM   206  C  CB  . SER A 1 66  ? 16.244  17.437 41.397 1.00 24.86  ? 156 SER A CB  1 
ATOM   207  O  OG  . SER A 1 66  ? 17.574  17.740 41.828 1.00 25.08  ? 156 SER A OG  1 
ATOM   208  N  N   . SER A 1 67  ? 18.203  14.697 40.400 1.00 21.75  ? 157 SER A N   1 
ATOM   209  C  CA  . SER A 1 67  ? 19.177  14.210 39.424 1.00 24.65  ? 157 SER A CA  1 
ATOM   210  C  C   . SER A 1 67  ? 18.806  12.800 38.945 1.00 22.58  ? 157 SER A C   1 
ATOM   211  O  O   . SER A 1 67  ? 18.103  12.049 39.650 1.00 26.30  ? 157 SER A O   1 
ATOM   212  C  CB  . SER A 1 67  ? 20.613  14.097 39.988 1.00 26.42  ? 157 SER A CB  1 
ATOM   213  O  OG  . SER A 1 67  ? 20.941  15.320 40.595 1.00 35.87  ? 157 SER A OG  1 
ATOM   214  N  N   . ARG A 1 68  ? 19.274  12.472 37.765 1.00 20.69  ? 158 ARG A N   1 
ATOM   215  C  CA  . ARG A 1 68  ? 19.113  11.120 37.214 1.00 25.48  ? 158 ARG A CA  1 
ATOM   216  C  C   . ARG A 1 68  ? 20.090  10.261 38.018 1.00 26.93  ? 158 ARG A C   1 
ATOM   217  O  O   . ARG A 1 68  ? 21.305  10.230 37.823 1.00 28.94  ? 158 ARG A O   1 
ATOM   218  C  CB  . ARG A 1 68  ? 19.351  11.127 35.718 1.00 25.01  ? 158 ARG A CB  1 
ATOM   219  C  CG  . ARG A 1 68  ? 19.333  9.917  34.808 1.00 36.90  ? 158 ARG A CG  1 
ATOM   220  C  CD  . ARG A 1 68  ? 20.408  8.891  35.040 1.00 43.43  ? 158 ARG A CD  1 
ATOM   221  N  NE  . ARG A 1 68  ? 20.144  7.535  34.587 1.00 54.58  ? 158 ARG A NE  1 
ATOM   222  C  CZ  . ARG A 1 68  ? 20.461  6.352  35.128 1.00 59.29  ? 158 ARG A CZ  1 
ATOM   223  N  NH1 . ARG A 1 68  ? 21.133  6.233  36.272 1.00 71.10  ? 158 ARG A NH1 1 
ATOM   224  N  NH2 . ARG A 1 68  ? 20.107  5.221  34.521 0.50 55.25  ? 158 ARG A NH2 1 
ATOM   225  N  N   . SER A 1 69  ? 19.529  9.573  39.031 1.00 25.93  ? 159 SER A N   1 
ATOM   226  C  CA  . SER A 1 69  ? 20.553  8.953  39.890 1.00 31.23  ? 159 SER A CA  1 
ATOM   227  C  C   . SER A 1 69  ? 20.117  7.543  40.212 1.00 36.48  ? 159 SER A C   1 
ATOM   228  O  O   . SER A 1 69  ? 20.590  7.053  41.229 1.00 34.07  ? 159 SER A O   1 
ATOM   229  C  CB  . SER A 1 69  ? 20.818  9.827  41.104 1.00 34.71  ? 159 SER A CB  1 
ATOM   230  O  OG  . SER A 1 69  ? 21.075  11.184 40.779 1.00 54.60  ? 159 SER A OG  1 
ATOM   231  N  N   . GLY A 1 70  ? 19.347  6.824  39.360 1.00 36.38  ? 160 GLY A N   1 
ATOM   232  C  CA  . GLY A 1 70  ? 19.207  5.398  39.574 1.00 29.02  ? 160 GLY A CA  1 
ATOM   233  C  C   . GLY A 1 70  ? 18.246  4.760  40.394 1.00 30.07  ? 160 GLY A C   1 
ATOM   234  O  O   . GLY A 1 70  ? 17.512  3.785  40.000 1.00 33.47  ? 160 GLY A O   1 
ATOM   235  N  N   . HIS A 1 71  ? 17.781  5.091  41.665 1.00 23.18  ? 161 HIS A N   1 
ATOM   236  C  CA  . HIS A 1 71  ? 16.419  4.549  41.301 1.00 22.78  ? 161 HIS A CA  1 
ATOM   237  C  C   . HIS A 1 71  ? 15.613  5.690  40.744 1.00 19.99  ? 161 HIS A C   1 
ATOM   238  O  O   . HIS A 1 71  ? 14.412  5.528  40.590 1.00 26.46  ? 161 HIS A O   1 
ATOM   239  C  CB  . HIS A 1 71  ? 15.644  3.936  42.464 1.00 25.53  ? 161 HIS A CB  1 
ATOM   240  C  CG  . HIS A 1 71  ? 16.383  2.782  43.026 1.00 28.04  ? 161 HIS A CG  1 
ATOM   241  N  ND1 . HIS A 1 71  ? 17.069  1.958  42.153 1.00 28.10  ? 161 HIS A ND1 1 
ATOM   242  C  CD2 . HIS A 1 71  ? 16.617  2.342  44.281 1.00 30.26  ? 161 HIS A CD2 1 
ATOM   243  C  CE1 . HIS A 1 71  ? 17.663  1.021  42.878 1.00 28.58  ? 161 HIS A CE1 1 
ATOM   244  N  NE2 . HIS A 1 71  ? 17.415  1.230  44.156 1.00 29.13  ? 161 HIS A NE2 1 
ATOM   245  N  N   . SER A 1 72  ? 16.112  6.915  40.614 1.00 21.09  ? 162 SER A N   1 
ATOM   246  C  CA  . SER A 1 72  ? 15.131  7.937  40.211 1.00 20.97  ? 162 SER A CA  1 
ATOM   247  C  C   . SER A 1 72  ? 15.276  8.300  38.755 1.00 20.80  ? 162 SER A C   1 
ATOM   248  O  O   . SER A 1 72  ? 16.400  8.609  38.273 1.00 21.48  ? 162 SER A O   1 
ATOM   249  C  CB  . SER A 1 72  ? 15.442  9.187  41.010 1.00 22.82  ? 162 SER A CB  1 
ATOM   250  O  OG  . SER A 1 72  ? 16.803  9.029  41.032 1.00 28.27  ? 162 SER A OG  1 
ATOM   251  N  N   . PHE A 1 73  ? 14.129  8.284  38.063 1.00 16.11  ? 163 PHE A N   1 
ATOM   252  C  CA  . PHE A 1 73  ? 14.096  8.637  36.648 1.00 14.58  ? 163 PHE A CA  1 
ATOM   253  C  C   . PHE A 1 73  ? 12.835  9.425  36.312 1.00 13.72  ? 163 PHE A C   1 
ATOM   254  O  O   . PHE A 1 73  ? 11.833  9.334  37.052 1.00 12.18  ? 163 PHE A O   1 
ATOM   255  C  CB  . PHE A 1 73  ? 14.153  7.391  35.747 1.00 16.60  ? 163 PHE A CB  1 
ATOM   256  C  CG  . PHE A 1 73  ? 12.846  6.599  35.680 1.00 16.79  ? 163 PHE A CG  1 
ATOM   257  C  CD1 . PHE A 1 73  ? 12.517  5.654  36.659 1.00 15.81  ? 163 PHE A CD1 1 
ATOM   258  C  CD2 . PHE A 1 73  ? 11.929  6.765  34.648 1.00 16.35  ? 163 PHE A CD2 1 
ATOM   259  C  CE1 . PHE A 1 73  ? 11.306  4.959  36.605 1.00 15.70  ? 163 PHE A CE1 1 
ATOM   260  C  CE2 . PHE A 1 73  ? 10.724  6.108  34.612 1.00 17.46  ? 163 PHE A CE2 1 
ATOM   261  C  CZ  . PHE A 1 73  ? 10.396  5.175  35.593 1.00 16.63  ? 163 PHE A CZ  1 
ATOM   262  N  N   . LEU A 1 74  ? 12.949  10.127 35.189 1.00 12.91  ? 164 LEU A N   1 
ATOM   263  C  CA  . LEU A 1 74  ? 11.783  10.828 34.642 1.00 12.99  ? 164 LEU A CA  1 
ATOM   264  C  C   . LEU A 1 74  ? 11.650  10.493 33.183 1.00 13.43  ? 164 LEU A C   1 
ATOM   265  O  O   . LEU A 1 74  ? 12.699  10.518 32.469 1.00 16.74  ? 164 LEU A O   1 
ATOM   266  C  CB  . LEU A 1 74  ? 11.964  12.341 34.828 1.00 15.06  ? 164 LEU A CB  1 
ATOM   267  C  CG  . LEU A 1 74  ? 12.020  12.812 36.283 1.00 17.00  ? 164 LEU A CG  1 
ATOM   268  C  CD1 . LEU A 1 74  ? 12.693  14.193 36.386 1.00 23.14  ? 164 LEU A CD1 1 
ATOM   269  C  CD2 . LEU A 1 74  ? 10.636  12.905 36.890 1.00 19.34  ? 164 LEU A CD2 1 
ATOM   270  N  N   . SER A 1 75  ? 10.471  10.236 32.668 1.00 12.43  ? 165 SER A N   1 
ATOM   271  C  CA  . SER A 1 75  ? 10.323  9.943  31.226 1.00 13.59  ? 165 SER A CA  1 
ATOM   272  C  C   . SER A 1 75  ? 9.057   10.619 30.752 1.00 13.57  ? 165 SER A C   1 
ATOM   273  O  O   . SER A 1 75  ? 7.946   10.149 31.065 1.00 13.07  ? 165 SER A O   1 
ATOM   274  C  CB  . SER A 1 75  ? 10.314  8.440  30.982 1.00 15.25  ? 165 SER A CB  1 
ATOM   275  O  OG  . SER A 1 75  ? 10.244  8.127  29.569 1.00 16.25  ? 165 SER A OG  1 
ATOM   276  N  N   . ASN A 1 76  ? 9.219   11.730 30.023 1.00 13.86  ? 166 ASN A N   1 
ATOM   277  C  CA  . ASN A 1 76  ? 8.051   12.480 29.516 1.00 15.30  ? 166 ASN A CA  1 
ATOM   278  C  C   . ASN A 1 76  ? 7.185   13.064 30.656 1.00 13.95  ? 166 ASN A C   1 
ATOM   279  O  O   . ASN A 1 76  ? 5.988   13.303 30.458 1.00 15.05  ? 166 ASN A O   1 
ATOM   280  C  CB  . ASN A 1 76  ? 7.181   11.665 28.565 1.00 16.87  ? 166 ASN A CB  1 
ATOM   281  C  CG  . ASN A 1 76  ? 7.783   11.488 27.185 1.00 21.01  ? 166 ASN A CG  1 
ATOM   282  O  OD1 . ASN A 1 76  ? 7.975   12.471 26.449 1.00 21.86  ? 166 ASN A OD1 1 
ATOM   283  N  ND2 . ASN A 1 76  ? 8.086   10.239 26.791 1.00 28.12  ? 166 ASN A ND2 1 
ATOM   284  N  N   . LEU A 1 77  ? 7.841   13.331 31.756 1.00 14.23  ? 167 LEU A N   1 
ATOM   285  C  CA  . LEU A 1 77  ? 7.402   14.134 32.871 1.00 14.62  ? 167 LEU A CA  1 
ATOM   286  C  C   . LEU A 1 77  ? 8.610   14.944 33.311 1.00 14.33  ? 167 LEU A C   1 
ATOM   287  O  O   . LEU A 1 77  ? 9.747   14.529 32.994 1.00 14.58  ? 167 LEU A O   1 
ATOM   288  C  CB  . LEU A 1 77  ? 6.930   13.279 34.087 1.00 18.42  ? 167 LEU A CB  1 
ATOM   289  C  CG  . LEU A 1 77  ? 5.579   12.588 34.058 1.00 16.72  ? 167 LEU A CG  1 
ATOM   290  C  CD1 . LEU A 1 77  ? 5.706   11.185 33.554 1.00 21.66  ? 167 LEU A CD1 1 
ATOM   291  C  CD2 . LEU A 1 77  ? 4.946   12.516 35.460 1.00 18.82  ? 167 LEU A CD2 1 
ATOM   292  N  N   . HIS A 1 78  ? 8.467   16.014 34.093 1.00 13.32  ? 168 HIS A N   1 
ATOM   293  C  CA  . HIS A 1 78  ? 9.683   16.567 34.723 1.00 13.71  ? 168 HIS A CA  1 
ATOM   294  C  C   . HIS A 1 78  ? 9.354   16.945 36.174 1.00 13.09  ? 168 HIS A C   1 
ATOM   295  O  O   . HIS A 1 78  ? 8.206   16.828 36.605 1.00 13.27  ? 168 HIS A O   1 
ATOM   296  C  CB  . HIS A 1 78  ? 10.282  17.721 33.927 1.00 15.61  ? 168 HIS A CB  1 
ATOM   297  C  CG  . HIS A 1 78  ? 9.498   18.997 33.909 1.00 15.86  ? 168 HIS A CG  1 
ATOM   298  N  ND1 . HIS A 1 78  ? 8.514   19.275 32.978 1.00 15.44  ? 168 HIS A ND1 1 
ATOM   299  C  CD2 . HIS A 1 78  ? 9.581   20.098 34.693 1.00 17.38  ? 168 HIS A CD2 1 
ATOM   300  C  CE1 . HIS A 1 78  ? 8.017   20.491 33.190 1.00 16.79  ? 168 HIS A CE1 1 
ATOM   301  N  NE2 . HIS A 1 78  ? 8.651   21.019 34.235 1.00 17.94  ? 168 HIS A NE2 1 
ATOM   302  N  N   . LEU A 1 79  ? 10.401  17.350 36.882 1.00 14.58  ? 169 LEU A N   1 
ATOM   303  C  CA  . LEU A 1 79  ? 10.294  17.676 38.290 1.00 13.44  ? 169 LEU A CA  1 
ATOM   304  C  C   . LEU A 1 79  ? 10.688  19.115 38.511 1.00 14.53  ? 169 LEU A C   1 
ATOM   305  O  O   . LEU A 1 79  ? 11.759  19.534 38.017 1.00 17.08  ? 169 LEU A O   1 
ATOM   306  C  CB  . LEU A 1 79  ? 11.199  16.726 39.106 1.00 14.65  ? 169 LEU A CB  1 
ATOM   307  C  CG  . LEU A 1 79  ? 11.304  17.012 40.583 1.00 14.54  ? 169 LEU A CG  1 
ATOM   308  C  CD1 . LEU A 1 79  ? 10.014  16.709 41.297 1.00 16.45  ? 169 LEU A CD1 1 
ATOM   309  C  CD2 . LEU A 1 79  ? 12.438  16.178 41.198 1.00 19.20  ? 169 LEU A CD2 1 
ATOM   310  N  N   . ARG A 1 80  ? 9.847   19.863 39.205 1.00 15.25  ? 170 ARG A N   1 
ATOM   311  C  CA  . ARG A 1 80  ? 10.234  21.261 39.425 1.00 18.73  ? 170 ARG A CA  1 
ATOM   312  C  C   . ARG A 1 80  ? 9.725   21.620 40.808 1.00 18.89  ? 170 ARG A C   1 
ATOM   313  O  O   . ARG A 1 80  ? 8.519   21.464 41.053 1.00 19.30  ? 170 ARG A O   1 
ATOM   314  C  CB  . ARG A 1 80  ? 9.705   22.123 38.287 1.00 21.49  ? 170 ARG A CB  1 
ATOM   315  C  CG  . ARG A 1 80  ? 10.440  23.442 38.095 1.00 23.74  ? 170 ARG A CG  1 
ATOM   316  C  CD  . ARG A 1 80  ? 11.687  23.283 37.196 1.00 27.99  ? 170 ARG A CD  1 
ATOM   317  N  NE  . ARG A 1 80  ? 12.148  24.654 36.848 1.00 29.39  ? 170 ARG A NE  1 
ATOM   318  C  CZ  . ARG A 1 80  ? 13.102  25.254 37.545 1.00 31.02  ? 170 ARG A CZ  1 
ATOM   319  N  NH1 . ARG A 1 80  ? 13.691  24.622 38.564 1.00 30.83  ? 170 ARG A NH1 1 
ATOM   320  N  NH2 . ARG A 1 80  ? 13.482  26.476 37.233 1.00 35.04  ? 170 ARG A NH2 1 
ATOM   321  N  N   . ASN A 1 81  ? 10.646  22.035 41.670 1.00 19.84  ? 171 ASN A N   1 
ATOM   322  C  CA  . ASN A 1 81  ? 10.250  22.438 43.030 1.00 21.30  ? 171 ASN A CA  1 
ATOM   323  C  C   . ASN A 1 81  ? 9.447   21.372 43.738 1.00 18.23  ? 171 ASN A C   1 
ATOM   324  O  O   . ASN A 1 81  ? 8.476   21.621 44.440 1.00 21.84  ? 171 ASN A O   1 
ATOM   325  C  CB  . ASN A 1 81  ? 9.465   23.755 42.909 1.00 28.07  ? 171 ASN A CB  1 
ATOM   326  C  CG  . ASN A 1 81  ? 10.197  24.805 42.087 1.00 36.22  ? 171 ASN A CG  1 
ATOM   327  O  OD1 . ASN A 1 81  ? 11.437  24.874 42.125 1.00 43.74  ? 171 ASN A OD1 1 
ATOM   328  N  ND2 . ASN A 1 81  ? 9.508   25.653 41.311 1.00 46.30  ? 171 ASN A ND2 1 
ATOM   329  N  N   . GLY A 1 82  ? 9.833   20.113 43.604 1.00 17.44  ? 172 GLY A N   1 
ATOM   330  C  CA  . GLY A 1 82  ? 9.244   18.990 44.302 1.00 16.85  ? 172 GLY A CA  1 
ATOM   331  C  C   . GLY A 1 82  ? 7.958   18.444 43.682 1.00 14.51  ? 172 GLY A C   1 
ATOM   332  O  O   . GLY A 1 82  ? 7.340   17.503 44.184 1.00 16.17  ? 172 GLY A O   1 
ATOM   333  N  N   . GLU A 1 83  ? 7.479   19.035 42.587 1.00 12.58  ? 173 GLU A N   1 
ATOM   334  C  CA  . GLU A 1 83  ? 6.279   18.671 41.868 1.00 12.04  ? 173 GLU A CA  1 
ATOM   335  C  C   . GLU A 1 83  ? 6.576   17.918 40.581 1.00 11.26  ? 173 GLU A C   1 
ATOM   336  O  O   . GLU A 1 83  ? 7.450   18.340 39.833 1.00 13.36  ? 173 GLU A O   1 
ATOM   337  C  CB  . GLU A 1 83  ? 5.426   19.909 41.527 1.00 12.59  ? 173 GLU A CB  1 
ATOM   338  C  CG  . GLU A 1 83  ? 5.194   20.830 42.711 1.00 14.02  ? 173 GLU A CG  1 
ATOM   339  C  CD  . GLU A 1 83  ? 4.551   22.154 42.364 1.00 17.37  ? 173 GLU A CD  1 
ATOM   340  O  OE1 . GLU A 1 83  ? 4.495   22.588 41.175 1.00 21.23  ? 173 GLU A OE1 1 
ATOM   341  O  OE2 . GLU A 1 83  ? 4.052   22.725 43.367 1.00 24.03  ? 173 GLU A OE2 1 
ATOM   342  N  N   . LEU A 1 84  ? 5.832   16.838 40.311 1.00 11.39  ? 174 LEU A N   1 
ATOM   343  C  CA  . LEU A 1 84  ? 5.874   16.207 38.998 1.00 10.85  ? 174 LEU A CA  1 
ATOM   344  C  C   . LEU A 1 84  ? 4.933   16.972 38.076 1.00 11.22  ? 174 LEU A C   1 
ATOM   345  O  O   . LEU A 1 84  ? 3.743   17.181 38.394 1.00 12.79  ? 174 LEU A O   1 
ATOM   346  C  CB  . LEU A 1 84  ? 5.420   14.743 39.106 1.00 12.69  ? 174 LEU A CB  1 
ATOM   347  C  CG  . LEU A 1 84  ? 6.478   13.791 39.699 1.00 14.33  ? 174 LEU A CG  1 
ATOM   348  C  CD1 . LEU A 1 84  ? 5.890   12.402 39.969 1.00 17.13  ? 174 LEU A CD1 1 
ATOM   349  C  CD2 . LEU A 1 84  ? 7.704   13.706 38.781 1.00 17.13  ? 174 LEU A CD2 1 
ATOM   350  N  N   . VAL A 1 85  ? 5.519   17.366 36.925 1.00 11.13  ? 175 VAL A N   1 
ATOM   351  C  CA  . VAL A 1 85  ? 4.797   18.200 35.973 1.00 12.65  ? 175 VAL A CA  1 
ATOM   352  C  C   . VAL A 1 85  ? 4.419   17.355 34.754 1.00 11.75  ? 175 VAL A C   1 
ATOM   353  O  O   . VAL A 1 85  ? 5.284   16.711 34.163 1.00 13.84  ? 175 VAL A O   1 
ATOM   354  C  CB  . VAL A 1 85  ? 5.620   19.423 35.542 1.00 13.78  ? 175 VAL A CB  1 
ATOM   355  C  CG1 . VAL A 1 85  ? 4.759   20.259 34.583 1.00 13.63  ? 175 VAL A CG1 1 
ATOM   356  C  CG2 . VAL A 1 85  ? 6.064   20.226 36.756 1.00 15.68  ? 175 VAL A CG2 1 
ATOM   357  N  N   . ILE A 1 86  ? 3.153   17.321 34.404 1.00 12.18  ? 176 ILE A N   1 
ATOM   358  C  CA  . ILE A 1 86  ? 2.638   16.458 33.368 1.00 12.16  ? 176 ILE A CA  1 
ATOM   359  C  C   . ILE A 1 86  ? 2.796   17.099 31.996 1.00 12.83  ? 176 ILE A C   1 
ATOM   360  O  O   . ILE A 1 86  ? 2.481   18.274 31.753 1.00 14.04  ? 176 ILE A O   1 
ATOM   361  C  CB  . ILE A 1 86  ? 1.128   16.175 33.648 1.00 12.57  ? 176 ILE A CB  1 
ATOM   362  C  CG1 . ILE A 1 86  ? 0.909   15.573 35.044 1.00 13.03  ? 176 ILE A CG1 1 
ATOM   363  C  CG2 . ILE A 1 86  ? 0.460   15.314 32.568 1.00 13.09  ? 176 ILE A CG2 1 
ATOM   364  C  CD1 . ILE A 1 86  ? 1.738   14.369 35.396 1.00 15.03  ? 176 ILE A CD1 1 
ATOM   365  N  N   . HIS A 1 87  ? 3.261   16.296 31.055 1.00 11.89  ? 177 HIS A N   1 
ATOM   366  C  CA  . HIS A 1 87  ? 3.408   16.725 29.656 1.00 13.18  ? 177 HIS A CA  1 
ATOM   367  C  C   . HIS A 1 87  ? 2.281   16.177 28.776 1.00 13.95  ? 177 HIS A C   1 
ATOM   368  O  O   . HIS A 1 87  ? 1.914   16.846 27.797 1.00 18.33  ? 177 HIS A O   1 
ATOM   369  C  CB  . HIS A 1 87  ? 4.725   16.211 29.048 1.00 14.62  ? 177 HIS A CB  1 
ATOM   370  C  CG  . HIS A 1 87  ? 5.929   16.778 29.739 1.00 14.91  ? 177 HIS A CG  1 
ATOM   371  N  ND1 . HIS A 1 87  ? 7.196   16.514 29.231 1.00 16.18  ? 177 HIS A ND1 1 
ATOM   372  C  CD2 . HIS A 1 87  ? 6.106   17.568 30.804 1.00 15.20  ? 177 HIS A CD2 1 
ATOM   373  C  CE1 . HIS A 1 87  ? 8.118   17.111 29.980 1.00 16.80  ? 177 HIS A CE1 1 
ATOM   374  N  NE2 . HIS A 1 87  ? 7.462   17.759 30.947 1.00 16.89  ? 177 HIS A NE2 1 
ATOM   375  N  N   . GLU A 1 88  ? 1.765   15.021 29.068 1.00 15.43  ? 178 GLU A N   1 
ATOM   376  C  CA  . GLU A 1 88  ? 0.758   14.372 28.225 1.00 16.27  ? 178 GLU A CA  1 
ATOM   377  C  C   . GLU A 1 88  ? -0.542  14.125 28.976 1.00 14.64  ? 178 GLU A C   1 
ATOM   378  O  O   . GLU A 1 88  ? -0.501  13.464 30.043 1.00 16.41  ? 178 GLU A O   1 
ATOM   379  C  CB  . GLU A 1 88  ? 1.302   13.008 27.730 1.00 19.70  ? 178 GLU A CB  1 
ATOM   380  C  CG  . GLU A 1 88  ? 2.597   13.210 26.915 1.00 25.40  ? 178 GLU A CG  1 
ATOM   381  C  CD  . GLU A 1 88  ? 2.181   13.793 25.572 1.00 31.85  ? 178 GLU A CD  1 
ATOM   382  O  OE1 . GLU A 1 88  ? 1.306   13.152 24.949 1.00 46.35  ? 178 GLU A OE1 1 
ATOM   383  O  OE2 . GLU A 1 88  ? 2.720   14.839 25.186 1.00 44.71  ? 178 GLU A OE2 1 
ATOM   384  N  N   . LYS A 1 89  ? -1.679  14.598 28.488 1.00 14.64  ? 179 LYS A N   1 
ATOM   385  C  CA  . LYS A 1 89  ? -2.943  14.368 29.189 1.00 15.49  ? 179 LYS A CA  1 
ATOM   386  C  C   . LYS A 1 89  ? -3.263  12.885 29.203 1.00 15.23  ? 179 LYS A C   1 
ATOM   387  O  O   . LYS A 1 89  ? -2.953  12.100 28.257 1.00 17.27  ? 179 LYS A O   1 
ATOM   388  C  CB  . LYS A 1 89  ? -4.074  15.214 28.557 1.00 19.62  ? 179 LYS A CB  1 
ATOM   389  C  CG  . LYS A 1 89  ? -4.443  14.740 27.155 1.00 28.13  ? 179 LYS A CG  1 
ATOM   390  C  CD  . LYS A 1 89  ? -5.708  15.414 26.631 1.00 34.66  ? 179 LYS A CD  1 
ATOM   391  C  CE  . LYS A 1 89  ? -6.330  14.597 25.505 1.00 40.45  ? 179 LYS A CE  1 
ATOM   392  N  NZ  . LYS A 1 89  ? -6.762  15.451 24.357 1.00 55.37  ? 179 LYS A NZ  1 
ATOM   393  N  N   . GLY A 1 90  ? -3.919  12.401 30.272 1.00 13.80  ? 180 GLY A N   1 
ATOM   394  C  CA  . GLY A 1 90  ? -4.373  11.008 30.292 1.00 14.98  ? 180 GLY A CA  1 
ATOM   395  C  C   . GLY A 1 90  ? -4.599  10.515 31.719 1.00 12.99  ? 180 GLY A C   1 
ATOM   396  O  O   . GLY A 1 90  ? -4.551  11.341 32.662 1.00 13.06  ? 180 GLY A O   1 
ATOM   397  N  N   . PHE A 1 91  ? -4.854  9.214  31.808 1.00 12.73  ? 181 PHE A N   1 
ATOM   398  C  CA  . PHE A 1 91  ? -5.081  8.589  33.113 1.00 13.39  ? 181 PHE A CA  1 
ATOM   399  C  C   . PHE A 1 91  ? -3.727  8.217  33.713 1.00 12.09  ? 181 PHE A C   1 
ATOM   400  O  O   . PHE A 1 91  ? -2.980  7.510  32.998 1.00 13.66  ? 181 PHE A O   1 
ATOM   401  C  CB  . PHE A 1 91  ? -5.950  7.324  32.975 1.00 15.13  ? 181 PHE A CB  1 
ATOM   402  C  CG  . PHE A 1 91  ? -7.334  7.568  32.464 1.00 19.66  ? 181 PHE A CG  1 
ATOM   403  C  CD1 . PHE A 1 91  ? -8.130  8.575  32.990 1.00 23.81  ? 181 PHE A CD1 1 
ATOM   404  C  CD2 . PHE A 1 91  ? -7.852  6.756  31.468 1.00 27.24  ? 181 PHE A CD2 1 
ATOM   405  C  CE1 . PHE A 1 91  ? -9.407  8.741  32.472 1.00 28.04  ? 181 PHE A CE1 1 
ATOM   406  C  CE2 . PHE A 1 91  ? -9.134  6.880  30.959 1.00 29.59  ? 181 PHE A CE2 1 
ATOM   407  C  CZ  . PHE A 1 91  ? -9.894  7.935  31.458 1.00 31.28  ? 181 PHE A CZ  1 
ATOM   408  N  N   . TYR A 1 92  ? -3.414  8.646  34.926 1.00 10.22  ? 182 TYR A N   1 
ATOM   409  C  CA  . TYR A 1 92  ? -2.136  8.275  35.538 1.00 9.93   ? 182 TYR A CA  1 
ATOM   410  C  C   . TYR A 1 92  ? -2.384  7.490  36.832 1.00 9.22   ? 182 TYR A C   1 
ATOM   411  O  O   . TYR A 1 92  ? -3.160  7.975  37.655 1.00 10.43  ? 182 TYR A O   1 
ATOM   412  C  CB  . TYR A 1 92  ? -1.308  9.495  35.916 1.00 9.90   ? 182 TYR A CB  1 
ATOM   413  C  CG  . TYR A 1 92  ? -0.698  10.172 34.709 1.00 10.10  ? 182 TYR A CG  1 
ATOM   414  C  CD1 . TYR A 1 92  ? -1.467  10.979 33.864 1.00 11.08  ? 182 TYR A CD1 1 
ATOM   415  C  CD2 . TYR A 1 92  ? 0.669   9.965  34.428 1.00 11.65  ? 182 TYR A CD2 1 
ATOM   416  C  CE1 . TYR A 1 92  ? -0.864  11.576 32.756 1.00 12.42  ? 182 TYR A CE1 1 
ATOM   417  C  CE2 . TYR A 1 92  ? 1.261   10.559 33.326 1.00 11.75  ? 182 TYR A CE2 1 
ATOM   418  C  CZ  . TYR A 1 92  ? 0.487   11.368 32.498 1.00 12.80  ? 182 TYR A CZ  1 
ATOM   419  O  OH  . TYR A 1 92  ? 1.128   11.944 31.401 1.00 14.81  ? 182 TYR A OH  1 
ATOM   420  N  N   . TYR A 1 93  ? -1.678  6.369  36.997 1.00 9.09   ? 183 TYR A N   1 
ATOM   421  C  CA  . TYR A 1 93  ? -1.570  5.804  38.335 1.00 9.07   ? 183 TYR A CA  1 
ATOM   422  C  C   . TYR A 1 93  ? -0.470  6.568  39.062 1.00 8.54   ? 183 TYR A C   1 
ATOM   423  O  O   . TYR A 1 93  ? 0.677   6.629  38.577 1.00 10.20  ? 183 TYR A O   1 
ATOM   424  C  CB  . TYR A 1 93  ? -1.260  4.284  38.219 1.00 9.54   ? 183 TYR A CB  1 
ATOM   425  C  CG  . TYR A 1 93  ? -1.166  3.699  39.617 1.00 8.72   ? 183 TYR A CG  1 
ATOM   426  C  CD1 . TYR A 1 93  ? -2.282  3.259  40.310 1.00 8.18   ? 183 TYR A CD1 1 
ATOM   427  C  CD2 . TYR A 1 93  ? 0.080   3.565  40.263 1.00 9.65   ? 183 TYR A CD2 1 
ATOM   428  C  CE1 . TYR A 1 93  ? -2.186  2.724  41.587 1.00 9.17   ? 183 TYR A CE1 1 
ATOM   429  C  CE2 . TYR A 1 93  ? 0.184   3.016  41.544 1.00 9.38   ? 183 TYR A CE2 1 
ATOM   430  C  CZ  . TYR A 1 93  ? -0.966  2.590  42.207 1.00 8.55   ? 183 TYR A CZ  1 
ATOM   431  O  OH  . TYR A 1 93  ? -0.786  2.107  43.483 1.00 9.95   ? 183 TYR A OH  1 
ATOM   432  N  N   . ILE A 1 94  ? -0.833  7.166  40.189 1.00 9.04   ? 184 ILE A N   1 
ATOM   433  C  CA  . ILE A 1 94  ? 0.070   8.027  40.980 1.00 8.45   ? 184 ILE A CA  1 
ATOM   434  C  C   . ILE A 1 94  ? 0.274   7.351  42.326 1.00 8.27   ? 184 ILE A C   1 
ATOM   435  O  O   . ILE A 1 94  ? -0.729  6.859  42.887 1.00 9.31   ? 184 ILE A O   1 
ATOM   436  C  CB  . ILE A 1 94  ? -0.588  9.410  41.197 1.00 8.86   ? 184 ILE A CB  1 
ATOM   437  C  CG1 . ILE A 1 94  ? -0.988  10.100 39.905 1.00 9.99   ? 184 ILE A CG1 1 
ATOM   438  C  CG2 . ILE A 1 94  ? 0.350   10.280 42.048 1.00 11.24  ? 184 ILE A CG2 1 
ATOM   439  C  CD1 . ILE A 1 94  ? -1.932  11.274 40.086 1.00 11.61  ? 184 ILE A CD1 1 
ATOM   440  N  N   . TYR A 1 95  ? 1.492   7.303  42.862 1.00 8.29   ? 185 TYR A N   1 
ATOM   441  C  CA  . TYR A 1 95  ? 1.681   6.654  44.145 1.00 8.71   ? 185 TYR A CA  1 
ATOM   442  C  C   . TYR A 1 95  ? 2.785   7.361  44.923 1.00 8.49   ? 185 TYR A C   1 
ATOM   443  O  O   . TYR A 1 95  ? 3.661   8.052  44.365 1.00 8.68   ? 185 TYR A O   1 
ATOM   444  C  CB  . TYR A 1 95  ? 2.080   5.147  43.945 1.00 8.37   ? 185 TYR A CB  1 
ATOM   445  C  CG  . TYR A 1 95  ? 3.410   5.015  43.214 1.00 8.22   ? 185 TYR A CG  1 
ATOM   446  C  CD1 . TYR A 1 95  ? 3.440   4.979  41.809 1.00 9.10   ? 185 TYR A CD1 1 
ATOM   447  C  CD2 . TYR A 1 95  ? 4.619   4.872  43.890 1.00 8.76   ? 185 TYR A CD2 1 
ATOM   448  C  CE1 . TYR A 1 95  ? 4.629   4.848  41.117 1.00 9.05   ? 185 TYR A CE1 1 
ATOM   449  C  CE2 . TYR A 1 95  ? 5.819   4.789  43.219 1.00 9.25   ? 185 TYR A CE2 1 
ATOM   450  C  CZ  . TYR A 1 95  ? 5.801   4.752  41.851 1.00 9.25   ? 185 TYR A CZ  1 
ATOM   451  O  OH  . TYR A 1 95  ? 6.970   4.658  41.135 1.00 9.54   ? 185 TYR A OH  1 
ATOM   452  N  N   . SER A 1 96  ? 2.805   7.139  46.240 1.00 8.22   ? 186 SER A N   1 
ATOM   453  C  CA  . SER A 1 96  ? 3.913   7.592  47.076 1.00 8.71   ? 186 SER A CA  1 
ATOM   454  C  C   . SER A 1 96  ? 4.068   6.669  48.253 1.00 7.76   ? 186 SER A C   1 
ATOM   455  O  O   . SER A 1 96  ? 3.058   6.180  48.791 1.00 8.38   ? 186 SER A O   1 
ATOM   456  C  CB  . SER A 1 96  ? 3.720   9.036  47.529 1.00 9.24   ? 186 SER A CB  1 
ATOM   457  O  OG  . SER A 1 96  ? 4.836   9.457  48.335 1.00 9.96   ? 186 SER A OG  1 
ATOM   458  N  N   . GLN A 1 97  ? 5.336   6.460  48.690 1.00 8.56   ? 187 GLN A N   1 
ATOM   459  C  CA  . GLN A 1 97  ? 5.621   5.821  49.983 1.00 9.17   ? 187 GLN A CA  1 
ATOM   460  C  C   . GLN A 1 97  ? 6.410   6.839  50.800 1.00 9.26   ? 187 GLN A C   1 
ATOM   461  O  O   . GLN A 1 97  ? 7.369   7.429  50.302 1.00 9.74   ? 187 GLN A O   1 
ATOM   462  C  CB  . GLN A 1 97  ? 6.431   4.512  49.809 1.00 10.32  ? 187 GLN A CB  1 
ATOM   463  C  CG  . GLN A 1 97  ? 6.589   3.823  51.182 1.00 11.42  ? 187 GLN A CG  1 
ATOM   464  C  CD  . GLN A 1 97  ? 6.896   2.366  51.031 1.00 13.22  ? 187 GLN A CD  1 
ATOM   465  O  OE1 . GLN A 1 97  ? 6.056   1.537  51.331 1.00 23.43  ? 187 GLN A OE1 1 
ATOM   466  N  NE2 . GLN A 1 97  ? 8.090   1.957  50.624 1.00 13.46  ? 187 GLN A NE2 1 
ATOM   467  N  N   . THR A 1 98  ? 5.960   7.060  52.022 1.00 8.89   ? 188 THR A N   1 
ATOM   468  C  CA  . THR A 1 98  ? 6.664   7.977  52.908 1.00 8.80   ? 188 THR A CA  1 
ATOM   469  C  C   . THR A 1 98  ? 6.923   7.250  54.214 1.00 8.94   ? 188 THR A C   1 
ATOM   470  O  O   . THR A 1 98  ? 5.991   6.777  54.855 1.00 10.55  ? 188 THR A O   1 
ATOM   471  C  CB  . THR A 1 98  ? 5.846   9.258  53.180 1.00 10.15  ? 188 THR A CB  1 
ATOM   472  O  OG1 . THR A 1 98  ? 4.521   8.919  53.561 1.00 10.33  ? 188 THR A OG1 1 
ATOM   473  C  CG2 . THR A 1 98  ? 5.797   10.123 51.920 1.00 11.35  ? 188 THR A CG2 1 
ATOM   474  N  N   . TYR A 1 99  ? 8.210   7.157  54.587 1.00 9.60   ? 189 TYR A N   1 
ATOM   475  C  CA  . TYR A 1 99  ? 8.594   6.408  55.804 1.00 9.66   ? 189 TYR A CA  1 
ATOM   476  C  C   . TYR A 1 99  ? 8.683   7.317  57.015 1.00 10.14  ? 189 TYR A C   1 
ATOM   477  O  O   . TYR A 1 99  ? 9.615   8.136  57.086 1.00 12.58  ? 189 TYR A O   1 
ATOM   478  C  CB  . TYR A 1 99  ? 9.965   5.781  55.567 1.00 10.13  ? 189 TYR A CB  1 
ATOM   479  C  CG  . TYR A 1 99  ? 10.462  4.796  56.588 1.00 10.62  ? 189 TYR A CG  1 
ATOM   480  C  CD1 . TYR A 1 99  ? 9.616   4.179  57.496 1.00 12.04  ? 189 TYR A CD1 1 
ATOM   481  C  CD2 . TYR A 1 99  ? 11.819  4.451  56.653 1.00 12.95  ? 189 TYR A CD2 1 
ATOM   482  C  CE1 . TYR A 1 99  ? 10.090  3.262  58.422 1.00 13.87  ? 189 TYR A CE1 1 
ATOM   483  C  CE2 . TYR A 1 99  ? 12.308  3.553  57.582 1.00 13.56  ? 189 TYR A CE2 1 
ATOM   484  C  CZ  . TYR A 1 99  ? 11.431  2.954  58.470 1.00 14.41  ? 189 TYR A CZ  1 
ATOM   485  O  OH  . TYR A 1 99  ? 11.838  2.007  59.392 1.00 16.80  ? 189 TYR A OH  1 
ATOM   486  N  N   . PHE A 1 100 ? 7.760   7.160  57.965 1.00 11.79  ? 190 PHE A N   1 
ATOM   487  C  CA  . PHE A 1 100 ? 7.897   7.859  59.250 1.00 12.37  ? 190 PHE A CA  1 
ATOM   488  C  C   . PHE A 1 100 ? 8.679   6.957  60.204 1.00 12.51  ? 190 PHE A C   1 
ATOM   489  O  O   . PHE A 1 100 ? 8.305   5.797  60.398 1.00 14.05  ? 190 PHE A O   1 
ATOM   490  C  CB  . PHE A 1 100 ? 6.515   8.166  59.860 1.00 12.50  ? 190 PHE A CB  1 
ATOM   491  C  CG  . PHE A 1 100 ? 5.651   9.102  59.025 1.00 12.38  ? 190 PHE A CG  1 
ATOM   492  C  CD1 . PHE A 1 100 ? 4.923   8.663  57.908 1.00 12.77  ? 190 PHE A CD1 1 
ATOM   493  C  CD2 . PHE A 1 100 ? 5.579   10.447 59.380 1.00 16.50  ? 190 PHE A CD2 1 
ATOM   494  C  CE1 . PHE A 1 100 ? 4.146   9.528  57.169 1.00 13.86  ? 190 PHE A CE1 1 
ATOM   495  C  CE2 . PHE A 1 100 ? 4.772   11.314 58.654 1.00 16.29  ? 190 PHE A CE2 1 
ATOM   496  C  CZ  . PHE A 1 100 ? 4.072   10.855 57.560 1.00 16.20  ? 190 PHE A CZ  1 
ATOM   497  N  N   . ARG A 1 101 ? 9.750   7.456  60.806 1.00 15.40  ? 191 ARG A N   1 
ATOM   498  C  CA  . ARG A 1 101 ? 10.590  6.655  61.702 1.00 17.65  ? 191 ARG A CA  1 
ATOM   499  C  C   . ARG A 1 101 ? 11.064  7.544  62.836 1.00 18.54  ? 191 ARG A C   1 
ATOM   500  O  O   . ARG A 1 101 ? 11.544  8.652  62.549 1.00 26.16  ? 191 ARG A O   1 
ATOM   501  C  CB  . ARG A 1 101 ? 11.804  6.177  60.909 1.00 20.46  ? 191 ARG A CB  1 
ATOM   502  C  CG  . ARG A 1 101 ? 12.932  5.555  61.666 1.00 23.87  ? 191 ARG A CG  1 
ATOM   503  C  CD  . ARG A 1 101 ? 13.833  4.633  60.866 1.00 26.29  ? 191 ARG A CD  1 
ATOM   504  N  NE  . ARG A 1 101 ? 15.017  5.277  60.334 1.00 29.27  ? 191 ARG A NE  1 
ATOM   505  C  CZ  . ARG A 1 101 ? 16.001  5.881  60.959 1.00 36.59  ? 191 ARG A CZ  1 
ATOM   506  N  NH1 . ARG A 1 101 ? 16.062  6.013  62.274 1.00 39.54  ? 191 ARG A NH1 1 
ATOM   507  N  NH2 . ARG A 1 101 ? 16.996  6.393  60.267 1.00 45.71  ? 191 ARG A NH2 1 
ATOM   508  N  N   . PHE A 1 102 ? 10.943  7.066  64.086 1.00 15.97  ? 192 PHE A N   1 
ATOM   509  C  CA  . PHE A 1 102 ? 11.298  7.950  65.190 1.00 16.42  ? 192 PHE A CA  1 
ATOM   510  C  C   . PHE A 1 102 ? 11.638  7.122  66.427 1.00 17.48  ? 192 PHE A C   1 
ATOM   511  O  O   . PHE A 1 102 ? 11.167  6.018  66.580 1.00 16.98  ? 192 PHE A O   1 
ATOM   512  C  CB  . PHE A 1 102 ? 10.176  8.941  65.573 1.00 19.41  ? 192 PHE A CB  1 
ATOM   513  C  CG  . PHE A 1 102 ? 8.821   8.313  65.852 1.00 21.40  ? 192 PHE A CG  1 
ATOM   514  C  CD1 . PHE A 1 102 ? 8.476   7.880  67.124 1.00 23.10  ? 192 PHE A CD1 1 
ATOM   515  C  CD2 . PHE A 1 102 ? 7.880   8.138  64.837 1.00 24.75  ? 192 PHE A CD2 1 
ATOM   516  C  CE1 . PHE A 1 102 ? 7.262   7.286  67.394 1.00 26.27  ? 192 PHE A CE1 1 
ATOM   517  C  CE2 . PHE A 1 102 ? 6.641   7.538  65.101 1.00 26.50  ? 192 PHE A CE2 1 
ATOM   518  C  CZ  . PHE A 1 102 ? 6.310   7.117  66.384 1.00 26.80  ? 192 PHE A CZ  1 
ATOM   519  N  N   . GLN A 1 103 ? 12.432  7.744  67.297 1.00 21.72  ? 193 GLN A N   1 
ATOM   520  C  CA  . GLN A 1 103 ? 12.577  7.229  68.639 1.00 24.59  ? 193 GLN A CA  1 
ATOM   521  C  C   . GLN A 1 103 ? 11.625  8.001  69.581 1.00 32.37  ? 193 GLN A C   1 
ATOM   522  O  O   . GLN A 1 103 ? 11.370  9.192  69.342 1.00 34.10  ? 193 GLN A O   1 
ATOM   523  C  CB  . GLN A 1 103 ? 14.017  7.357  69.136 1.00 35.76  ? 193 GLN A CB  1 
ATOM   524  C  CG  . GLN A 1 103 ? 14.067  6.883  70.571 1.00 42.79  ? 193 GLN A CG  1 
ATOM   525  C  CD  . GLN A 1 103 ? 14.886  5.614  70.746 1.00 47.12  ? 193 GLN A CD  1 
ATOM   526  O  OE1 . GLN A 1 103 ? 14.428  4.652  71.386 1.00 56.50  ? 193 GLN A OE1 1 
ATOM   527  N  NE2 . GLN A 1 103 ? 16.096  5.644  70.185 1.00 52.41  ? 193 GLN A NE2 1 
ATOM   528  N  N   . GLU A 1 104 ? 11.104  7.340  70.590 1.00 31.33  ? 194 GLU A N   1 
ATOM   529  C  CA  . GLU A 1 104 ? 10.145  7.811  71.566 1.00 33.41  ? 194 GLU A CA  1 
ATOM   530  C  C   . GLU A 1 104 ? 10.862  8.277  72.844 1.00 39.04  ? 194 GLU A C   1 
ATOM   531  O  O   . GLU A 1 104 ? 12.089  8.147  72.880 1.00 46.92  ? 194 GLU A O   1 
ATOM   532  C  CB  . GLU A 1 104 ? 9.135   6.733  71.949 1.00 34.78  ? 194 GLU A CB  1 
ATOM   533  C  CG  . GLU A 1 104 ? 7.983   6.540  70.994 1.00 37.73  ? 194 GLU A CG  1 
ATOM   534  C  CD  . GLU A 1 104 ? 6.911   7.609  71.056 1.00 39.71  ? 194 GLU A CD  1 
ATOM   535  O  OE1 . GLU A 1 104 ? 7.280   8.799  71.194 1.00 42.04  ? 194 GLU A OE1 1 
ATOM   536  O  OE2 . GLU A 1 104 ? 5.712   7.271  70.944 1.00 40.82  ? 194 GLU A OE2 1 
ATOM   537  N  N   . LYS A 1 107 ? 7.953   9.938  78.778 1.00 55.74  ? 197 LYS A N   1 
ATOM   538  C  CA  . LYS A 1 107 ? 7.720   11.218 79.437 1.00 49.48  ? 197 LYS A CA  1 
ATOM   539  C  C   . LYS A 1 107 ? 6.460   11.233 80.289 1.00 47.91  ? 197 LYS A C   1 
ATOM   540  O  O   . LYS A 1 107 ? 5.369   11.069 79.730 1.00 46.38  ? 197 LYS A O   1 
ATOM   541  C  CB  . LYS A 1 107 ? 7.557   12.322 78.376 1.00 58.67  ? 197 LYS A CB  1 
ATOM   542  C  CG  . LYS A 1 107 ? 7.197   11.786 76.995 1.00 63.67  ? 197 LYS A CG  1 
ATOM   543  C  CD  . LYS A 1 107 ? 5.867   11.056 76.934 1.00 64.60  ? 197 LYS A CD  1 
ATOM   544  C  CE  . LYS A 1 107 ? 5.825   9.978  75.870 1.00 64.51  ? 197 LYS A CE  1 
ATOM   545  N  NZ  . LYS A 1 107 ? 4.451   9.482  75.563 1.00 72.27  ? 197 LYS A NZ  1 
ATOM   546  N  N   . GLU A 1 108 ? 6.558   11.453 81.597 1.00 43.51  ? 198 GLU A N   1 
ATOM   547  C  CA  . GLU A 1 108 ? 5.393   11.602 82.461 1.00 42.05  ? 198 GLU A CA  1 
ATOM   548  C  C   . GLU A 1 108 ? 4.466   12.710 81.949 1.00 37.76  ? 198 GLU A C   1 
ATOM   549  O  O   . GLU A 1 108 ? 4.933   13.803 81.631 1.00 34.40  ? 198 GLU A O   1 
ATOM   550  C  CB  . GLU A 1 108 ? 5.799   11.958 83.887 1.00 47.97  ? 198 GLU A CB  1 
ATOM   551  C  CG  . GLU A 1 108 ? 5.703   10.940 84.998 1.00 56.93  ? 198 GLU A CG  1 
ATOM   552  C  CD  . GLU A 1 108 ? 6.192   11.472 86.338 1.00 62.32  ? 198 GLU A CD  1 
ATOM   553  O  OE1 . GLU A 1 108 ? 6.924   12.493 86.354 1.00 67.46  ? 198 GLU A OE1 1 
ATOM   554  O  OE2 . GLU A 1 108 ? 5.880   10.918 87.419 1.00 74.01  ? 198 GLU A OE2 1 
ATOM   555  N  N   . ASN A 1 109 ? 3.165   12.451 81.916 1.00 33.16  ? 199 ASN A N   1 
ATOM   556  C  CA  . ASN A 1 109 ? 2.170   13.501 81.688 1.00 33.35  ? 199 ASN A CA  1 
ATOM   557  C  C   . ASN A 1 109 ? 2.411   14.191 80.363 1.00 37.05  ? 199 ASN A C   1 
ATOM   558  O  O   . ASN A 1 109 ? 2.404   15.417 80.227 1.00 43.93  ? 199 ASN A O   1 
ATOM   559  C  CB  . ASN A 1 109 ? 2.202   14.593 82.769 1.00 30.14  ? 199 ASN A CB  1 
ATOM   560  C  CG  . ASN A 1 109 ? 1.694   14.009 84.086 1.00 32.13  ? 199 ASN A CG  1 
ATOM   561  O  OD1 . ASN A 1 109 ? 0.560   13.527 84.202 1.00 37.62  ? 199 ASN A OD1 1 
ATOM   562  N  ND2 . ASN A 1 109 ? 2.567   14.035 85.068 1.00 32.00  ? 199 ASN A ND2 1 
ATOM   563  N  N   . THR A 1 110 ? 2.629   13.264 79.431 1.00 38.09  ? 200 THR A N   1 
ATOM   564  C  CA  . THR A 1 110 ? 3.042   13.710 78.110 1.00 46.29  ? 200 THR A CA  1 
ATOM   565  C  C   . THR A 1 110 ? 2.481   12.706 77.116 1.00 55.84  ? 200 THR A C   1 
ATOM   566  O  O   . THR A 1 110 ? 2.241   11.541 77.495 1.00 64.15  ? 200 THR A O   1 
ATOM   567  C  CB  . THR A 1 110 ? 4.574   13.854 78.089 1.00 48.23  ? 200 THR A CB  1 
ATOM   568  O  OG1 . THR A 1 110 ? 4.965   14.871 79.033 1.00 42.85  ? 200 THR A OG1 1 
ATOM   569  C  CG2 . THR A 1 110 ? 5.020   14.240 76.684 1.00 59.45  ? 200 THR A CG2 1 
ATOM   570  N  N   . LYS A 1 111 ? 1.527   13.204 76.311 1.00 58.30  ? 201 LYS A N   1 
ATOM   571  C  CA  . LYS A 1 111 ? 0.649   12.145 75.759 1.00 57.94  ? 201 LYS A CA  1 
ATOM   572  C  C   . LYS A 1 111 ? 1.152   11.529 74.458 1.00 55.43  ? 201 LYS A C   1 
ATOM   573  O  O   . LYS A 1 111 ? 0.784   10.393 74.084 1.00 55.83  ? 201 LYS A O   1 
ATOM   574  C  CB  . LYS A 1 111 ? -0.727  12.809 75.680 1.00 62.28  ? 201 LYS A CB  1 
ATOM   575  C  CG  . LYS A 1 111 ? -1.822  11.922 75.138 1.00 62.07  ? 201 LYS A CG  1 
ATOM   576  C  CD  . LYS A 1 111 ? -3.169  12.346 75.695 1.00 64.26  ? 201 LYS A CD  1 
ATOM   577  C  CE  . LYS A 1 111 ? -4.123  12.518 74.521 1.00 64.96  ? 201 LYS A CE  1 
ATOM   578  N  NZ  . LYS A 1 111 ? -4.974  13.719 74.691 1.00 69.33  ? 201 LYS A NZ  1 
ATOM   579  N  N   . ASN A 1 112 ? 1.990   12.244 73.753 1.00 50.24  ? 202 ASN A N   1 
ATOM   580  C  CA  . ASN A 1 112 ? 2.785   12.053 72.570 1.00 46.23  ? 202 ASN A CA  1 
ATOM   581  C  C   . ASN A 1 112 ? 2.168   11.342 71.375 1.00 41.37  ? 202 ASN A C   1 
ATOM   582  O  O   . ASN A 1 112 ? 2.930   10.758 70.578 1.00 39.62  ? 202 ASN A O   1 
ATOM   583  C  CB  . ASN A 1 112 ? 4.086   11.272 72.957 1.00 52.65  ? 202 ASN A CB  1 
ATOM   584  C  CG  . ASN A 1 112 ? 4.952   12.354 73.601 1.00 59.11  ? 202 ASN A CG  1 
ATOM   585  O  OD1 . ASN A 1 112 ? 4.758   13.509 73.198 1.00 62.98  ? 202 ASN A OD1 1 
ATOM   586  N  ND2 . ASN A 1 112 ? 5.798   11.997 74.542 1.00 61.82  ? 202 ASN A ND2 1 
ATOM   587  N  N   . ASP A 1 113 ? 0.848   11.403 71.233 1.00 34.81  ? 203 ASP A N   1 
ATOM   588  C  CA  . ASP A 1 113 ? 0.214   10.748 70.093 1.00 27.96  ? 203 ASP A CA  1 
ATOM   589  C  C   . ASP A 1 113 ? 0.556   11.456 68.791 1.00 25.45  ? 203 ASP A C   1 
ATOM   590  O  O   . ASP A 1 113 ? 0.549   12.671 68.698 1.00 30.14  ? 203 ASP A O   1 
ATOM   591  C  CB  . ASP A 1 113 ? -1.319  10.717 70.246 1.00 29.67  ? 203 ASP A CB  1 
ATOM   592  C  CG  . ASP A 1 113 ? -1.908  12.068 70.599 1.00 30.40  ? 203 ASP A CG  1 
ATOM   593  O  OD1 . ASP A 1 113 ? -1.465  12.680 71.616 1.00 31.53  ? 203 ASP A OD1 1 
ATOM   594  O  OD2 . ASP A 1 113 ? -2.835  12.544 69.886 1.00 29.57  ? 203 ASP A OD2 1 
ATOM   595  N  N   . LYS A 1 114 ? 0.823   10.648 67.760 1.00 18.97  ? 204 LYS A N   1 
ATOM   596  C  CA  . LYS A 1 114 ? 1.162   11.230 66.488 1.00 17.67  ? 204 LYS A CA  1 
ATOM   597  C  C   . LYS A 1 114 ? 0.132   10.805 65.443 1.00 16.47  ? 204 LYS A C   1 
ATOM   598  O  O   . LYS A 1 114 ? -0.185  9.611  65.366 1.00 17.78  ? 204 LYS A O   1 
ATOM   599  C  CB  . LYS A 1 114 ? 2.558   10.752 66.039 1.00 20.58  ? 204 LYS A CB  1 
ATOM   600  C  CG  . LYS A 1 114 ? 3.682   11.328 66.911 1.00 25.34  ? 204 LYS A CG  1 
ATOM   601  C  CD  . LYS A 1 114 ? 4.979   10.548 66.677 1.00 27.52  ? 204 LYS A CD  1 
ATOM   602  C  CE  . LYS A 1 114 ? 6.121   11.070 67.503 1.00 29.61  ? 204 LYS A CE  1 
ATOM   603  N  NZ  . LYS A 1 114 ? 5.991   10.785 68.965 1.00 30.11  ? 204 LYS A NZ  1 
ATOM   604  N  N   . GLN A 1 115 ? -0.324  11.802 64.657 1.00 14.61  ? 205 GLN A N   1 
ATOM   605  C  CA  . GLN A 1 115 ? -1.069  11.533 63.428 1.00 13.94  ? 205 GLN A CA  1 
ATOM   606  C  C   . GLN A 1 115 ? -0.119  11.642 62.255 1.00 13.80  ? 205 GLN A C   1 
ATOM   607  O  O   . GLN A 1 115 ? 0.332   12.745 61.949 1.00 18.63  ? 205 GLN A O   1 
ATOM   608  C  CB  . GLN A 1 115 ? -2.188  12.572 63.298 1.00 16.43  ? 205 GLN A CB  1 
ATOM   609  C  CG  . GLN A 1 115 ? -3.139  12.482 64.493 1.00 21.27  ? 205 GLN A CG  1 
ATOM   610  C  CD  . GLN A 1 115 ? -4.311  13.439 64.344 1.00 27.79  ? 205 GLN A CD  1 
ATOM   611  O  OE1 . GLN A 1 115 ? -5.265  13.399 65.137 1.00 39.19  ? 205 GLN A OE1 1 
ATOM   612  N  NE2 . GLN A 1 115 ? -4.229  14.298 63.355 1.00 34.65  ? 205 GLN A NE2 1 
ATOM   613  N  N   . MET A 1 116 ? 0.199   10.524 61.608 1.00 11.92  ? 206 MET A N   1 
ATOM   614  C  CA  . MET A 1 116 ? 1.092   10.521 60.459 1.00 11.41  ? 206 MET A CA  1 
ATOM   615  C  C   . MET A 1 116 ? 0.227   10.403 59.211 1.00 11.40  ? 206 MET A C   1 
ATOM   616  O  O   . MET A 1 116 ? -0.404  9.359  59.049 1.00 12.09  ? 206 MET A O   1 
ATOM   617  C  CB  . MET A 1 116 ? 2.041   9.333  60.603 1.00 12.17  ? 206 MET A CB  1 
ATOM   618  C  CG  . MET A 1 116 ? 3.019   9.559  61.784 1.00 12.86  ? 206 MET A CG  1 
ATOM   619  S  SD  . MET A 1 116 ? 3.771   8.000  62.327 1.00 14.35  ? 206 MET A SD  1 
ATOM   620  C  CE  . MET A 1 116 ? 2.405   7.224  63.195 1.00 13.46  ? 206 MET A CE  1 
ATOM   621  N  N   . VAL A 1 117 ? 0.171   11.459 58.413 1.00 9.72   ? 207 VAL A N   1 
ATOM   622  C  CA  . VAL A 1 117 ? -0.715  11.496 57.249 1.00 9.53   ? 207 VAL A CA  1 
ATOM   623  C  C   . VAL A 1 117 ? 0.105   11.862 55.998 1.00 10.03  ? 207 VAL A C   1 
ATOM   624  O  O   . VAL A 1 117 ? 0.945   12.770 56.043 1.00 10.46  ? 207 VAL A O   1 
ATOM   625  C  CB  . VAL A 1 117 ? -1.853  12.509 57.435 1.00 10.40  ? 207 VAL A CB  1 
ATOM   626  C  CG1 . VAL A 1 117 ? -2.904  12.375 56.333 1.00 12.72  ? 207 VAL A CG1 1 
ATOM   627  C  CG2 . VAL A 1 117 ? -2.491  12.364 58.839 1.00 12.41  ? 207 VAL A CG2 1 
ATOM   628  N  N   . GLN A 1 118 ? -0.182  11.119 54.925 1.00 9.26   ? 208 GLN A N   1 
ATOM   629  C  CA  . GLN A 1 118 ? 0.392   11.452 53.607 1.00 8.87   ? 208 GLN A CA  1 
ATOM   630  C  C   . GLN A 1 118 ? -0.737  11.950 52.721 1.00 8.96   ? 208 GLN A C   1 
ATOM   631  O  O   . GLN A 1 118 ? -1.785  11.288 52.614 1.00 9.90   ? 208 GLN A O   1 
ATOM   632  C  CB  . GLN A 1 118 ? 1.044   10.179 53.013 1.00 9.11   ? 208 GLN A CB  1 
ATOM   633  C  CG  . GLN A 1 118 ? 1.799   10.460 51.703 1.00 9.31   ? 208 GLN A CG  1 
ATOM   634  C  CD  . GLN A 1 118 ? 1.854   9.238  50.798 1.00 8.92   ? 208 GLN A CD  1 
ATOM   635  O  OE1 . GLN A 1 118 ? 1.126   9.135  49.800 1.00 10.30  ? 208 GLN A OE1 1 
ATOM   636  N  NE2 . GLN A 1 118 ? 2.701   8.244  51.179 1.00 9.79   ? 208 GLN A NE2 1 
ATOM   637  N  N   . TYR A 1 119 ? -0.500  13.099 52.089 1.00 8.95   ? 209 TYR A N   1 
ATOM   638  C  CA  . TYR A 1 119 ? -1.421  13.713 51.168 1.00 8.81   ? 209 TYR A CA  1 
ATOM   639  C  C   . TYR A 1 119 ? -0.806  13.785 49.744 1.00 8.64   ? 209 TYR A C   1 
ATOM   640  O  O   . TYR A 1 119 ? 0.396   14.119 49.667 1.00 10.33  ? 209 TYR A O   1 
ATOM   641  C  CB  . TYR A 1 119 ? -1.688  15.163 51.598 1.00 9.78   ? 209 TYR A CB  1 
ATOM   642  C  CG  . TYR A 1 119 ? -2.259  15.346 52.990 1.00 10.12  ? 209 TYR A CG  1 
ATOM   643  C  CD1 . TYR A 1 119 ? -3.598  15.183 53.266 1.00 11.43  ? 209 TYR A CD1 1 
ATOM   644  C  CD2 . TYR A 1 119 ? -1.415  15.708 54.039 1.00 11.86  ? 209 TYR A CD2 1 
ATOM   645  C  CE1 . TYR A 1 119 ? -4.156  15.359 54.523 1.00 13.70  ? 209 TYR A CE1 1 
ATOM   646  C  CE2 . TYR A 1 119 ? -1.941  15.887 55.287 1.00 14.11  ? 209 TYR A CE2 1 
ATOM   647  C  CZ  . TYR A 1 119 ? -3.289  15.717 55.549 1.00 15.53  ? 209 TYR A CZ  1 
ATOM   648  O  OH  . TYR A 1 119 ? -3.746  15.907 56.847 1.00 20.01  ? 209 TYR A OH  1 
ATOM   649  N  N   . ILE A 1 120 ? -1.592  13.484 48.709 1.00 8.57   ? 210 ILE A N   1 
ATOM   650  C  CA  . ILE A 1 120 ? -1.134  13.670 47.335 1.00 8.45   ? 210 ILE A CA  1 
ATOM   651  C  C   . ILE A 1 120 ? -2.093  14.673 46.703 1.00 8.22   ? 210 ILE A C   1 
ATOM   652  O  O   . ILE A 1 120 ? -3.318  14.461 46.702 1.00 9.35   ? 210 ILE A O   1 
ATOM   653  C  CB  . ILE A 1 120 ? -1.083  12.340 46.556 1.00 9.14   ? 210 ILE A CB  1 
ATOM   654  C  CG1 . ILE A 1 120 ? -0.085  11.391 47.229 1.00 9.38   ? 210 ILE A CG1 1 
ATOM   655  C  CG2 . ILE A 1 120 ? -0.733  12.625 45.103 1.00 10.54  ? 210 ILE A CG2 1 
ATOM   656  C  CD1 . ILE A 1 120 ? -0.052  9.954  46.676 1.00 10.99  ? 210 ILE A CD1 1 
ATOM   657  N  N   . TYR A 1 121 ? -1.506  15.776 46.287 1.00 9.08   ? 211 TYR A N   1 
ATOM   658  C  CA  . TYR A 1 121 ? -2.209  16.933 45.783 1.00 9.39   ? 211 TYR A CA  1 
ATOM   659  C  C   . TYR A 1 121 ? -1.922  17.175 44.290 1.00 9.19   ? 211 TYR A C   1 
ATOM   660  O  O   . TYR A 1 121 ? -0.864  16.792 43.770 1.00 10.51  ? 211 TYR A O   1 
ATOM   661  C  CB  . TYR A 1 121 ? -1.705  18.202 46.514 1.00 10.18  ? 211 TYR A CB  1 
ATOM   662  C  CG  . TYR A 1 121 ? -2.418  18.451 47.831 1.00 10.44  ? 211 TYR A CG  1 
ATOM   663  C  CD1 . TYR A 1 121 ? -3.670  19.050 47.855 1.00 11.09  ? 211 TYR A CD1 1 
ATOM   664  C  CD2 . TYR A 1 121 ? -1.850  18.069 49.064 1.00 10.55  ? 211 TYR A CD2 1 
ATOM   665  C  CE1 . TYR A 1 121 ? -4.349  19.287 49.055 1.00 11.83  ? 211 TYR A CE1 1 
ATOM   666  C  CE2 . TYR A 1 121 ? -2.527  18.285 50.267 1.00 11.31  ? 211 TYR A CE2 1 
ATOM   667  C  CZ  . TYR A 1 121 ? -3.761  18.904 50.260 1.00 12.39  ? 211 TYR A CZ  1 
ATOM   668  O  OH  . TYR A 1 121 ? -4.441  19.097 51.474 1.00 14.98  ? 211 TYR A OH  1 
ATOM   669  N  N   . LYS A 1 122 ? -2.860  17.870 43.653 1.00 10.62  ? 212 LYS A N   1 
ATOM   670  C  CA  . LYS A 1 122 ? -2.718  18.332 42.266 1.00 11.71  ? 212 LYS A CA  1 
ATOM   671  C  C   . LYS A 1 122 ? -2.936  19.836 42.144 1.00 11.40  ? 212 LYS A C   1 
ATOM   672  O  O   . LYS A 1 122 ? -3.915  20.361 42.680 1.00 13.82  ? 212 LYS A O   1 
ATOM   673  C  CB  . LYS A 1 122 ? -3.801  17.629 41.406 1.00 13.46  ? 212 LYS A CB  1 
ATOM   674  C  CG  . LYS A 1 122 ? -3.855  18.100 39.955 1.00 12.98  ? 212 LYS A CG  1 
ATOM   675  C  CD  . LYS A 1 122 ? -5.015  17.412 39.255 1.00 15.05  ? 212 LYS A CD  1 
ATOM   676  C  CE  . LYS A 1 122 ? -6.418  17.886 39.615 1.00 15.03  ? 212 LYS A CE  1 
ATOM   677  N  NZ  . LYS A 1 122 ? -7.457  17.294 38.694 1.00 16.12  ? 212 LYS A NZ  1 
ATOM   678  N  N   . TYR A 1 123 ? -2.059  20.510 41.398 1.00 11.50  ? 213 TYR A N   1 
ATOM   679  C  CA  . TYR A 1 123 ? -2.393  21.810 40.877 1.00 12.64  ? 213 TYR A CA  1 
ATOM   680  C  C   . TYR A 1 123 ? -2.832  21.715 39.433 1.00 13.75  ? 213 TYR A C   1 
ATOM   681  O  O   . TYR A 1 123 ? -2.136  21.081 38.625 1.00 15.21  ? 213 TYR A O   1 
ATOM   682  C  CB  . TYR A 1 123 ? -1.205  22.752 40.919 1.00 16.16  ? 213 TYR A CB  1 
ATOM   683  C  CG  . TYR A 1 123 ? -1.019  23.538 42.188 1.00 18.99  ? 213 TYR A CG  1 
ATOM   684  C  CD1 . TYR A 1 123 ? -1.924  24.520 42.585 1.00 21.66  ? 213 TYR A CD1 1 
ATOM   685  C  CD2 . TYR A 1 123 ? 0.080   23.284 43.006 1.00 21.12  ? 213 TYR A CD2 1 
ATOM   686  C  CE1 . TYR A 1 123 ? -1.734  25.234 43.734 1.00 26.05  ? 213 TYR A CE1 1 
ATOM   687  C  CE2 . TYR A 1 123 ? 0.271   23.994 44.176 1.00 25.88  ? 213 TYR A CE2 1 
ATOM   688  C  CZ  . TYR A 1 123 ? -0.637  24.972 44.533 1.00 29.01  ? 213 TYR A CZ  1 
ATOM   689  O  OH  . TYR A 1 123 ? -0.467  25.690 45.697 1.00 37.66  ? 213 TYR A OH  1 
ATOM   690  N  N   . THR A 1 124 ? -3.957  22.324 39.099 1.00 14.03  ? 214 THR A N   1 
ATOM   691  C  CA  . THR A 1 124 ? -4.406  22.360 37.695 1.00 14.87  ? 214 THR A CA  1 
ATOM   692  C  C   . THR A 1 124 ? -4.787  23.799 37.417 1.00 17.74  ? 214 THR A C   1 
ATOM   693  O  O   . THR A 1 124 ? -4.254  24.673 38.103 1.00 18.13  ? 214 THR A O   1 
ATOM   694  C  CB  . THR A 1 124 ? -5.516  21.300 37.481 1.00 16.86  ? 214 THR A CB  1 
ATOM   695  O  OG1 . THR A 1 124 ? -5.869  21.306 36.088 1.00 18.67  ? 214 THR A OG1 1 
ATOM   696  C  CG2 . THR A 1 124 ? -6.810  21.526 38.290 1.00 17.64  ? 214 THR A CG2 1 
ATOM   697  N  N   . SER A 1 125 ? -5.679  24.065 36.483 1.00 18.30  ? 215 SER A N   1 
ATOM   698  C  CA  . SER A 1 125 ? -6.099  25.426 36.145 1.00 20.10  ? 215 SER A CA  1 
ATOM   699  C  C   . SER A 1 125 ? -7.232  25.831 37.097 1.00 21.92  ? 215 SER A C   1 
ATOM   700  O  O   . SER A 1 125 ? -8.381  26.027 36.659 1.00 26.59  ? 215 SER A O   1 
ATOM   701  C  CB  A SER A 1 125 ? -6.571  25.538 34.705 0.50 21.73  ? 215 SER A CB  1 
ATOM   702  C  CB  B SER A 1 125 ? -6.577  25.514 34.704 0.50 21.91  ? 215 SER A CB  1 
ATOM   703  O  OG  A SER A 1 125 ? -5.491  25.443 33.794 0.50 22.70  ? 215 SER A OG  1 
ATOM   704  O  OG  B SER A 1 125 ? -7.410  24.385 34.490 0.50 29.43  ? 215 SER A OG  1 
ATOM   705  N  N   . TYR A 1 126 ? -6.886  25.891 38.353 1.00 20.37  ? 216 TYR A N   1 
ATOM   706  C  CA  . TYR A 1 126 ? -7.767  26.286 39.444 1.00 22.43  ? 216 TYR A CA  1 
ATOM   707  C  C   . TYR A 1 126 ? -6.871  26.929 40.491 1.00 22.30  ? 216 TYR A C   1 
ATOM   708  O  O   . TYR A 1 126 ? -5.702  26.545 40.617 1.00 22.08  ? 216 TYR A O   1 
ATOM   709  C  CB  . TYR A 1 126 ? -8.505  25.057 39.944 1.00 23.06  ? 216 TYR A CB  1 
ATOM   710  C  CG  . TYR A 1 126 ? -9.561  25.284 40.981 1.00 24.61  ? 216 TYR A CG  1 
ATOM   711  C  CD1 . TYR A 1 126 ? -10.780 25.809 40.556 1.00 26.14  ? 216 TYR A CD1 1 
ATOM   712  C  CD2 . TYR A 1 126 ? -9.393  24.981 42.323 1.00 27.90  ? 216 TYR A CD2 1 
ATOM   713  C  CE1 . TYR A 1 126 ? -11.795 26.032 41.478 1.00 28.56  ? 216 TYR A CE1 1 
ATOM   714  C  CE2 . TYR A 1 126 ? -10.412 25.201 43.260 1.00 31.42  ? 216 TYR A CE2 1 
ATOM   715  C  CZ  . TYR A 1 126 ? -11.605 25.727 42.812 1.00 31.83  ? 216 TYR A CZ  1 
ATOM   716  O  OH  . TYR A 1 126 ? -12.654 25.978 43.653 1.00 37.50  ? 216 TYR A OH  1 
ATOM   717  N  N   . PRO A 1 127 ? -7.338  27.899 41.248 1.00 24.65  ? 217 PRO A N   1 
ATOM   718  C  CA  . PRO A 1 127 ? -6.448  28.595 42.187 1.00 26.58  ? 217 PRO A CA  1 
ATOM   719  C  C   . PRO A 1 127 ? -5.909  27.780 43.345 1.00 26.24  ? 217 PRO A C   1 
ATOM   720  O  O   . PRO A 1 127 ? -4.819  28.086 43.844 1.00 36.79  ? 217 PRO A O   1 
ATOM   721  C  CB  . PRO A 1 127 ? -7.345  29.703 42.789 1.00 30.60  ? 217 PRO A CB  1 
ATOM   722  C  CG  . PRO A 1 127 ? -8.394  29.876 41.750 1.00 29.39  ? 217 PRO A CG  1 
ATOM   723  C  CD  . PRO A 1 127 ? -8.697  28.499 41.238 1.00 26.08  ? 217 PRO A CD  1 
ATOM   724  N  N   . ALA A 1 128 ? -6.627  26.766 43.802 1.00 21.38  ? 218 ALA A N   1 
ATOM   725  C  CA  . ALA A 1 128 ? -6.184  26.075 45.013 1.00 18.67  ? 218 ALA A CA  1 
ATOM   726  C  C   . ALA A 1 128 ? -5.703  24.684 44.660 1.00 16.03  ? 218 ALA A C   1 
ATOM   727  O  O   . ALA A 1 128 ? -6.183  24.088 43.701 1.00 15.49  ? 218 ALA A O   1 
ATOM   728  C  CB  . ALA A 1 128 ? -7.375  26.007 45.965 1.00 21.36  ? 218 ALA A CB  1 
ATOM   729  N  N   . PRO A 1 129 ? -4.767  24.090 45.426 1.00 16.35  ? 219 PRO A N   1 
ATOM   730  C  CA  . PRO A 1 129 ? -4.390  22.725 45.153 1.00 15.28  ? 219 PRO A CA  1 
ATOM   731  C  C   . PRO A 1 129 ? -5.585  21.814 45.506 1.00 14.09  ? 219 PRO A C   1 
ATOM   732  O  O   . PRO A 1 129 ? -6.388  22.142 46.405 1.00 17.48  ? 219 PRO A O   1 
ATOM   733  C  CB  . PRO A 1 129 ? -3.271  22.480 46.152 1.00 17.97  ? 219 PRO A CB  1 
ATOM   734  C  CG  . PRO A 1 129 ? -3.533  23.440 47.271 1.00 20.23  ? 219 PRO A CG  1 
ATOM   735  C  CD  . PRO A 1 129 ? -4.040  24.677 46.572 1.00 18.04  ? 219 PRO A CD  1 
ATOM   736  N  N   . ILE A 1 130 ? -5.674  20.706 44.803 1.00 11.94  ? 220 ILE A N   1 
ATOM   737  C  CA  . ILE A 1 130 ? -6.793  19.771 44.936 1.00 11.74  ? 220 ILE A CA  1 
ATOM   738  C  C   . ILE A 1 130 ? -6.275  18.462 45.518 1.00 11.26  ? 220 ILE A C   1 
ATOM   739  O  O   . ILE A 1 130 ? -5.411  17.814 44.929 1.00 11.19  ? 220 ILE A O   1 
ATOM   740  C  CB  . ILE A 1 130 ? -7.508  19.584 43.597 1.00 13.63  ? 220 ILE A CB  1 
ATOM   741  C  CG1 . ILE A 1 130 ? -8.157  20.899 43.088 1.00 17.59  ? 220 ILE A CG1 1 
ATOM   742  C  CG2 . ILE A 1 130 ? -8.563  18.466 43.647 1.00 16.06  ? 220 ILE A CG2 1 
ATOM   743  C  CD1 . ILE A 1 130 ? -8.417  20.904 41.609 1.00 21.46  ? 220 ILE A CD1 1 
ATOM   744  N  N   . LEU A 1 131 ? -6.796  18.057 46.666 1.00 10.97  ? 221 LEU A N   1 
ATOM   745  C  CA  . LEU A 1 131 ? -6.350  16.792 47.266 1.00 10.19  ? 221 LEU A CA  1 
ATOM   746  C  C   . LEU A 1 131 ? -6.886  15.628 46.459 1.00 9.67   ? 221 LEU A C   1 
ATOM   747  O  O   . LEU A 1 131 ? -8.107  15.547 46.198 1.00 11.56  ? 221 LEU A O   1 
ATOM   748  C  CB  . LEU A 1 131 ? -6.913  16.750 48.720 1.00 10.63  ? 221 LEU A CB  1 
ATOM   749  C  CG  . LEU A 1 131 ? -6.495  15.469 49.511 1.00 11.05  ? 221 LEU A CG  1 
ATOM   750  C  CD1 . LEU A 1 131 ? -4.975  15.356 49.621 1.00 12.05  ? 221 LEU A CD1 1 
ATOM   751  C  CD2 . LEU A 1 131 ? -7.109  15.535 50.900 1.00 13.96  ? 221 LEU A CD2 1 
ATOM   752  N  N   . LEU A 1 132 ? -5.981  14.734 46.064 1.00 9.29   ? 222 LEU A N   1 
ATOM   753  C  CA  . LEU A 1 132 ? -6.384  13.513 45.370 1.00 8.99   ? 222 LEU A CA  1 
ATOM   754  C  C   . LEU A 1 132 ? -6.562  12.333 46.335 1.00 8.99   ? 222 LEU A C   1 
ATOM   755  O  O   . LEU A 1 132 ? -7.547  11.595 46.221 1.00 11.32  ? 222 LEU A O   1 
ATOM   756  C  CB  . LEU A 1 132 ? -5.353  13.111 44.328 1.00 9.52   ? 222 LEU A CB  1 
ATOM   757  C  CG  . LEU A 1 132 ? -5.066  14.172 43.276 1.00 10.14  ? 222 LEU A CG  1 
ATOM   758  C  CD1 . LEU A 1 132 ? -4.088  13.568 42.255 1.00 13.61  ? 222 LEU A CD1 1 
ATOM   759  C  CD2 . LEU A 1 132 ? -6.329  14.657 42.622 1.00 13.08  ? 222 LEU A CD2 1 
ATOM   760  N  N   . MET A 1 133 ? -5.596  12.143 47.240 1.00 9.37   ? 223 MET A N   1 
ATOM   761  C  CA  . MET A 1 133 ? -5.555  10.939 48.098 1.00 9.70   ? 223 MET A CA  1 
ATOM   762  C  C   . MET A 1 133 ? -4.953  11.297 49.446 1.00 9.46   ? 223 MET A C   1 
ATOM   763  O  O   . MET A 1 133 ? -4.008  12.104 49.542 1.00 10.05  ? 223 MET A O   1 
ATOM   764  C  CB  . MET A 1 133 ? -4.638  9.853  47.506 1.00 11.15  ? 223 MET A CB  1 
ATOM   765  C  CG  . MET A 1 133 ? -5.188  9.250  46.211 1.00 11.77  ? 223 MET A CG  1 
ATOM   766  S  SD  . MET A 1 133 ? -3.996  8.085  45.475 1.00 11.19  ? 223 MET A SD  1 
ATOM   767  C  CE  . MET A 1 133 ? -2.932  9.184  44.556 1.00 11.34  ? 223 MET A CE  1 
ATOM   768  N  N   . LYS A 1 134 ? -5.517  10.682 50.484 1.00 9.12   ? 224 LYS A N   1 
ATOM   769  C  CA  . LYS A 1 134 ? -4.884  10.811 51.814 1.00 9.89   ? 224 LYS A CA  1 
ATOM   770  C  C   . LYS A 1 134 ? -4.846  9.453  52.492 1.00 9.28   ? 224 LYS A C   1 
ATOM   771  O  O   . LYS A 1 134 ? -5.802  8.668  52.360 1.00 10.24  ? 224 LYS A O   1 
ATOM   772  C  CB  . LYS A 1 134 ? -5.621  11.817 52.668 1.00 13.97  ? 224 LYS A CB  1 
ATOM   773  C  CG  . LYS A 1 134 ? -6.993  11.498 53.140 1.00 19.33  ? 224 LYS A CG  1 
ATOM   774  C  CD  . LYS A 1 134 ? -7.428  12.557 54.186 1.00 27.64  ? 224 LYS A CD  1 
ATOM   775  C  CE  . LYS A 1 134 ? -7.859  11.813 55.451 1.00 33.90  ? 224 LYS A CE  1 
ATOM   776  N  NZ  . LYS A 1 134 ? -9.058  10.954 55.189 1.00 47.17  ? 224 LYS A NZ  1 
ATOM   777  N  N   . SER A 1 135 ? -3.777  9.186  53.263 1.00 9.11   ? 225 SER A N   1 
ATOM   778  C  CA  . SER A 1 135 ? -3.587  7.932  53.986 1.00 9.35   ? 225 SER A CA  1 
ATOM   779  C  C   . SER A 1 135 ? -2.990  8.242  55.357 1.00 9.36   ? 225 SER A C   1 
ATOM   780  O  O   . SER A 1 135 ? -2.072  9.043  55.432 1.00 10.65  ? 225 SER A O   1 
ATOM   781  C  CB  A SER A 1 135 ? -2.672  7.036  53.144 0.30 10.79  ? 225 SER A CB  1 
ATOM   782  C  CB  B SER A 1 135 ? -2.689  6.992  53.157 0.70 9.31   ? 225 SER A CB  1 
ATOM   783  O  OG  A SER A 1 135 ? -1.390  7.647  53.121 0.30 17.18  ? 225 SER A OG  1 
ATOM   784  O  OG  B SER A 1 135 ? -2.485  5.777  53.884 0.70 7.46   ? 225 SER A OG  1 
ATOM   785  N  N   . ALA A 1 136 ? -3.563  7.666  56.415 1.00 10.39  ? 226 ALA A N   1 
ATOM   786  C  CA  . ALA A 1 136 ? -3.193  8.040  57.782 1.00 10.39  ? 226 ALA A CA  1 
ATOM   787  C  C   . ALA A 1 136 ? -2.935  6.841  58.687 1.00 10.61  ? 226 ALA A C   1 
ATOM   788  O  O   . ALA A 1 136 ? -3.500  5.743  58.520 1.00 11.62  ? 226 ALA A O   1 
ATOM   789  C  CB  . ALA A 1 136 ? -4.303  8.888  58.432 1.00 12.91  ? 226 ALA A CB  1 
ATOM   790  N  N   . ARG A 1 137 ? -2.051  7.090  59.654 1.00 11.12  ? 227 ARG A N   1 
ATOM   791  C  CA  . ARG A 1 137 ? -1.777  6.173  60.757 1.00 11.13  ? 227 ARG A CA  1 
ATOM   792  C  C   . ARG A 1 137 ? -1.669  6.967  62.043 1.00 10.76  ? 227 ARG A C   1 
ATOM   793  O  O   . ARG A 1 137 ? -1.226  8.120  62.015 1.00 13.36  ? 227 ARG A O   1 
ATOM   794  C  CB  A ARG A 1 137 ? -0.488  5.379  60.574 0.50 12.05  ? 227 ARG A CB  1 
ATOM   795  C  CB  B ARG A 1 137 ? -0.448  5.446  60.566 0.50 12.18  ? 227 ARG A CB  1 
ATOM   796  C  CG  A ARG A 1 137 ? -0.593  4.252  59.549 0.50 14.03  ? 227 ARG A CG  1 
ATOM   797  C  CG  B ARG A 1 137 ? -0.247  4.881  59.165 0.50 13.88  ? 227 ARG A CG  1 
ATOM   798  C  CD  A ARG A 1 137 ? -1.474  3.108  59.997 0.50 15.63  ? 227 ARG A CD  1 
ATOM   799  C  CD  B ARG A 1 137 ? -1.059  3.622  58.910 0.50 15.40  ? 227 ARG A CD  1 
ATOM   800  N  NE  A ARG A 1 137 ? -0.958  2.470  61.202 0.50 18.97  ? 227 ARG A NE  1 
ATOM   801  N  NE  B ARG A 1 137 ? -0.626  3.015  57.612 0.50 12.32  ? 227 ARG A NE  1 
ATOM   802  C  CZ  A ARG A 1 137 ? -1.349  2.573  62.462 0.50 14.85  ? 227 ARG A CZ  1 
ATOM   803  C  CZ  B ARG A 1 137 ? -0.954  3.562  56.438 0.50 11.47  ? 227 ARG A CZ  1 
ATOM   804  N  NH1 A ARG A 1 137 ? -2.356  3.340  62.789 0.50 10.36  ? 227 ARG A NH1 1 
ATOM   805  N  NH1 B ARG A 1 137 ? -1.680  4.643  56.348 0.50 5.85   ? 227 ARG A NH1 1 
ATOM   806  N  NH2 A ARG A 1 137 ? -0.714  1.891  63.419 0.50 16.59  ? 227 ARG A NH2 1 
ATOM   807  N  NH2 B ARG A 1 137 ? -0.493  2.931  55.365 0.50 14.94  ? 227 ARG A NH2 1 
ATOM   808  N  N   . ASN A 1 138 ? -2.006  6.346  63.145 1.00 12.83  ? 228 ASN A N   1 
ATOM   809  C  CA  . ASN A 1 138 ? -1.631  6.846  64.461 1.00 11.27  ? 228 ASN A CA  1 
ATOM   810  C  C   . ASN A 1 138 ? -0.476  6.036  65.040 1.00 11.67  ? 228 ASN A C   1 
ATOM   811  O  O   . ASN A 1 138 ? -0.350  4.855  64.723 1.00 14.14  ? 228 ASN A O   1 
ATOM   812  C  CB  . ASN A 1 138 ? -2.800  6.819  65.466 1.00 12.71  ? 228 ASN A CB  1 
ATOM   813  C  CG  . ASN A 1 138 ? -3.296  5.435  65.764 1.00 13.04  ? 228 ASN A CG  1 
ATOM   814  O  OD1 . ASN A 1 138 ? -4.065  4.815  65.039 1.00 14.08  ? 228 ASN A OD1 1 
ATOM   815  N  ND2 . ASN A 1 138 ? -2.810  4.845  66.870 1.00 13.64  ? 228 ASN A ND2 1 
ATOM   816  N  N   . SER A 1 139 ? 0.342   6.653  65.888 1.00 11.87  ? 229 SER A N   1 
ATOM   817  C  CA  . SER A 1 139 ? 1.429   5.901  66.537 1.00 12.86  ? 229 SER A CA  1 
ATOM   818  C  C   . SER A 1 139 ? 0.854   5.104  67.693 1.00 13.72  ? 229 SER A C   1 
ATOM   819  O  O   . SER A 1 139 ? -0.222  5.388  68.238 1.00 14.04  ? 229 SER A O   1 
ATOM   820  C  CB  . SER A 1 139 ? 2.496   6.893  66.998 1.00 15.20  ? 229 SER A CB  1 
ATOM   821  O  OG  . SER A 1 139 ? 1.887   7.801  67.918 1.00 18.26  ? 229 SER A OG  1 
ATOM   822  N  N   . CYS A 1 140 ? 1.581   4.061  68.088 1.00 13.11  ? 230 CYS A N   1 
ATOM   823  C  CA  . CYS A 1 140 ? 1.230   3.254  69.260 1.00 12.52  ? 230 CYS A CA  1 
ATOM   824  C  C   . CYS A 1 140 ? 1.045   4.132  70.501 1.00 13.61  ? 230 CYS A C   1 
ATOM   825  O  O   . CYS A 1 140 ? 1.895   5.009  70.760 1.00 15.01  ? 230 CYS A O   1 
ATOM   826  C  CB  . CYS A 1 140 ? 2.329   2.212  69.518 1.00 13.04  ? 230 CYS A CB  1 
ATOM   827  S  SG  . CYS A 1 140 ? 1.950   1.095  70.910 1.00 12.94  ? 230 CYS A SG  1 
ATOM   828  N  N   . TRP A 1 141 ? -0.042  3.890  71.255 1.00 12.53  ? 231 TRP A N   1 
ATOM   829  C  CA  . TRP A 1 141 ? -0.324  4.698  72.437 1.00 13.53  ? 231 TRP A CA  1 
ATOM   830  C  C   . TRP A 1 141 ? 0.367   4.207  73.681 1.00 14.29  ? 231 TRP A C   1 
ATOM   831  O  O   . TRP A 1 141 ? 0.322   4.844  74.762 1.00 16.98  ? 231 TRP A O   1 
ATOM   832  C  CB  . TRP A 1 141 ? -1.837  4.701  72.691 1.00 14.01  ? 231 TRP A CB  1 
ATOM   833  C  CG  . TRP A 1 141 ? -2.643  5.447  71.668 1.00 13.35  ? 231 TRP A CG  1 
ATOM   834  C  CD1 . TRP A 1 141 ? -3.123  4.955  70.467 1.00 13.68  ? 231 TRP A CD1 1 
ATOM   835  C  CD2 . TRP A 1 141 ? -3.074  6.800  71.741 1.00 13.24  ? 231 TRP A CD2 1 
ATOM   836  N  NE1 . TRP A 1 141 ? -3.828  5.925  69.785 1.00 13.04  ? 231 TRP A NE1 1 
ATOM   837  C  CE2 . TRP A 1 141 ? -3.808  7.090  70.583 1.00 14.35  ? 231 TRP A CE2 1 
ATOM   838  C  CE3 . TRP A 1 141 ? -2.921  7.808  72.704 1.00 14.99  ? 231 TRP A CE3 1 
ATOM   839  C  CZ2 . TRP A 1 141 ? -4.369  8.352  70.363 1.00 15.56  ? 231 TRP A CZ2 1 
ATOM   840  C  CZ3 . TRP A 1 141 ? -3.468  9.037  72.497 1.00 15.76  ? 231 TRP A CZ3 1 
ATOM   841  C  CH2 . TRP A 1 141 ? -4.196  9.324  71.335 1.00 17.89  ? 231 TRP A CH2 1 
ATOM   842  N  N   . SER A 1 142 ? 1.023   3.066  73.646 1.00 14.31  ? 232 SER A N   1 
ATOM   843  C  CA  . SER A 1 142 ? 1.640   2.534  74.855 1.00 15.67  ? 232 SER A CA  1 
ATOM   844  C  C   . SER A 1 142 ? 2.764   3.401  75.371 1.00 15.34  ? 232 SER A C   1 
ATOM   845  O  O   . SER A 1 142 ? 3.643   3.879  74.653 1.00 16.83  ? 232 SER A O   1 
ATOM   846  C  CB  . SER A 1 142 ? 2.302   1.188  74.531 1.00 16.53  ? 232 SER A CB  1 
ATOM   847  O  OG  . SER A 1 142 ? 2.912   0.712  75.735 1.00 17.88  ? 232 SER A OG  1 
ATOM   848  N  N   . LYS A 1 143 ? 2.727   3.568  76.699 1.00 19.96  ? 233 LYS A N   1 
ATOM   849  C  CA  . LYS A 1 143 ? 3.804   4.316  77.329 1.00 22.86  ? 233 LYS A CA  1 
ATOM   850  C  C   . LYS A 1 143 ? 5.118   3.533  77.283 1.00 21.86  ? 233 LYS A C   1 
ATOM   851  O  O   . LYS A 1 143 ? 6.164   4.126  77.570 1.00 28.01  ? 233 LYS A O   1 
ATOM   852  C  CB  . LYS A 1 143 ? 3.420   4.637  78.776 1.00 25.63  ? 233 LYS A CB  1 
ATOM   853  C  CG  . LYS A 1 143 ? 3.298   3.346  79.619 1.00 26.96  ? 233 LYS A CG  1 
ATOM   854  C  CD  . LYS A 1 143 ? 3.454   3.798  81.078 1.00 32.02  ? 233 LYS A CD  1 
ATOM   855  C  CE  . LYS A 1 143 ? 3.253   2.649  82.057 1.00 35.78  ? 233 LYS A CE  1 
ATOM   856  N  NZ  . LYS A 1 143 ? 2.217   1.686  81.556 1.00 58.67  ? 233 LYS A NZ  1 
ATOM   857  N  N   . ASP A 1 144 ? 5.064   2.251  76.917 1.00 20.35  ? 234 ASP A N   1 
ATOM   858  C  CA  . ASP A 1 144 ? 6.294   1.466  76.728 1.00 20.07  ? 234 ASP A CA  1 
ATOM   859  C  C   . ASP A 1 144 ? 6.877   1.643  75.312 1.00 18.66  ? 234 ASP A C   1 
ATOM   860  O  O   . ASP A 1 144 ? 7.923   1.031  74.953 1.00 19.08  ? 234 ASP A O   1 
ATOM   861  C  CB  . ASP A 1 144 ? 6.015   -0.014 77.013 1.00 21.03  ? 234 ASP A CB  1 
ATOM   862  C  CG  . ASP A 1 144 ? 5.821   -0.331 78.484 1.00 25.39  ? 234 ASP A CG  1 
ATOM   863  O  OD1 . ASP A 1 144 ? 6.230   0.472  79.358 1.00 30.68  ? 234 ASP A OD1 1 
ATOM   864  O  OD2 . ASP A 1 144 ? 5.249   -1.398 78.819 1.00 33.26  ? 234 ASP A OD2 1 
ATOM   865  N  N   . ALA A 1 145 ? 6.230   2.433  74.448 1.00 17.36  ? 235 ALA A N   1 
ATOM   866  C  CA  . ALA A 1 145 ? 6.756   2.536  73.072 1.00 15.55  ? 235 ALA A CA  1 
ATOM   867  C  C   . ALA A 1 145 ? 8.107   3.227  73.055 1.00 17.88  ? 235 ALA A C   1 
ATOM   868  O  O   . ALA A 1 145 ? 8.214   4.331  73.557 1.00 24.21  ? 235 ALA A O   1 
ATOM   869  C  CB  . ALA A 1 145 ? 5.759   3.279  72.202 1.00 15.43  ? 235 ALA A CB  1 
ATOM   870  N  N   . GLU A 1 146 ? 9.146   2.619  72.510 1.00 16.02  ? 236 GLU A N   1 
ATOM   871  C  CA  . GLU A 1 146 ? 10.491  3.203  72.482 1.00 15.90  ? 236 GLU A CA  1 
ATOM   872  C  C   . GLU A 1 146 ? 10.830  3.743  71.075 1.00 15.07  ? 236 GLU A C   1 
ATOM   873  O  O   . GLU A 1 146 ? 11.742  4.561  70.978 1.00 20.00  ? 236 GLU A O   1 
ATOM   874  C  CB  . GLU A 1 146 ? 11.503  2.123  72.841 1.00 16.94  ? 236 GLU A CB  1 
ATOM   875  C  CG  . GLU A 1 146 ? 11.293  1.560  74.231 1.00 20.31  ? 236 GLU A CG  1 
ATOM   876  C  CD  . GLU A 1 146 ? 12.288  0.545  74.741 1.00 22.43  ? 236 GLU A CD  1 
ATOM   877  O  OE1 . GLU A 1 146 ? 13.279  0.281  74.041 1.00 26.80  ? 236 GLU A OE1 1 
ATOM   878  O  OE2 . GLU A 1 146 ? 12.080  -0.019 75.848 1.00 25.42  ? 236 GLU A OE2 1 
ATOM   879  N  N   . TYR A 1 147 ? 10.132  3.271  70.043 1.00 14.09  ? 237 TYR A N   1 
ATOM   880  C  CA  . TYR A 1 147 ? 10.360  3.749  68.672 1.00 14.16  ? 237 TYR A CA  1 
ATOM   881  C  C   . TYR A 1 147 ? 9.099   3.437  67.837 1.00 12.94  ? 237 TYR A C   1 
ATOM   882  O  O   . TYR A 1 147 ? 8.236   2.671  68.262 1.00 13.52  ? 237 TYR A O   1 
ATOM   883  C  CB  . TYR A 1 147 ? 11.620  3.171  67.997 1.00 16.48  ? 237 TYR A CB  1 
ATOM   884  C  CG  . TYR A 1 147 ? 11.642  1.662  67.875 1.00 15.84  ? 237 TYR A CG  1 
ATOM   885  C  CD1 . TYR A 1 147 ? 11.013  0.953  66.863 1.00 16.81  ? 237 TYR A CD1 1 
ATOM   886  C  CD2 . TYR A 1 147 ? 12.363  0.891  68.803 1.00 16.72  ? 237 TYR A CD2 1 
ATOM   887  C  CE1 . TYR A 1 147 ? 11.027  -0.421 66.750 1.00 18.47  ? 237 TYR A CE1 1 
ATOM   888  C  CE2 . TYR A 1 147 ? 12.408  -0.489 68.699 1.00 16.75  ? 237 TYR A CE2 1 
ATOM   889  C  CZ  . TYR A 1 147 ? 11.739  -1.148 67.687 1.00 17.50  ? 237 TYR A CZ  1 
ATOM   890  O  OH  . TYR A 1 147 ? 11.768  -2.509 67.595 1.00 22.39  ? 237 TYR A OH  1 
ATOM   891  N  N   . GLY A 1 148 ? 9.108   4.061  66.655 1.00 12.92  ? 238 GLY A N   1 
ATOM   892  C  CA  . GLY A 1 148 ? 7.979   3.837  65.723 1.00 13.29  ? 238 GLY A CA  1 
ATOM   893  C  C   . GLY A 1 148 ? 8.547   3.772  64.304 1.00 11.32  ? 238 GLY A C   1 
ATOM   894  O  O   . GLY A 1 148 ? 9.417   4.537  63.918 1.00 14.02  ? 238 GLY A O   1 
ATOM   895  N  N   . LEU A 1 149 ? 8.011   2.790  63.555 1.00 10.98  ? 239 LEU A N   1 
ATOM   896  C  CA  . LEU A 1 149 ? 8.337   2.546  62.139 1.00 11.15  ? 239 LEU A CA  1 
ATOM   897  C  C   . LEU A 1 149 ? 6.981   2.530  61.405 1.00 10.39  ? 239 LEU A C   1 
ATOM   898  O  O   . LEU A 1 149 ? 6.231   1.570  61.663 1.00 11.59  ? 239 LEU A O   1 
ATOM   899  C  CB  . LEU A 1 149 ? 9.090   1.239  61.922 1.00 11.56  ? 239 LEU A CB  1 
ATOM   900  C  CG  . LEU A 1 149 ? 10.205  0.899  62.897 1.00 13.32  ? 239 LEU A CG  1 
ATOM   901  C  CD1 . LEU A 1 149 ? 10.737  -0.493 62.518 1.00 16.25  ? 239 LEU A CD1 1 
ATOM   902  C  CD2 . LEU A 1 149 ? 11.280  1.966  62.793 1.00 15.89  ? 239 LEU A CD2 1 
ATOM   903  N  N   . TYR A 1 150 ? 6.690   3.541  60.600 1.00 10.86  ? 240 TYR A N   1 
ATOM   904  C  CA  . TYR A 1 150 ? 5.383   3.619  59.951 1.00 11.49  ? 240 TYR A CA  1 
ATOM   905  C  C   . TYR A 1 150 ? 5.596   4.014  58.472 1.00 11.53  ? 240 TYR A C   1 
ATOM   906  O  O   . TYR A 1 150 ? 5.571   5.189  58.101 1.00 13.19  ? 240 TYR A O   1 
ATOM   907  C  CB  . TYR A 1 150 ? 4.454   4.679  60.615 1.00 12.33  ? 240 TYR A CB  1 
ATOM   908  C  CG  . TYR A 1 150 ? 4.163   4.276  62.043 1.00 12.22  ? 240 TYR A CG  1 
ATOM   909  C  CD1 . TYR A 1 150 ? 5.051   4.668  63.053 1.00 12.61  ? 240 TYR A CD1 1 
ATOM   910  C  CD2 . TYR A 1 150 ? 3.070   3.511  62.411 1.00 12.98  ? 240 TYR A CD2 1 
ATOM   911  C  CE1 . TYR A 1 150 ? 4.857   4.333  64.391 1.00 14.36  ? 240 TYR A CE1 1 
ATOM   912  C  CE2 . TYR A 1 150 ? 2.865   3.167  63.735 1.00 14.56  ? 240 TYR A CE2 1 
ATOM   913  C  CZ  . TYR A 1 150 ? 3.744   3.581  64.734 1.00 14.67  ? 240 TYR A CZ  1 
ATOM   914  O  OH  . TYR A 1 150 ? 3.533   3.198  66.051 1.00 16.63  ? 240 TYR A OH  1 
ATOM   915  N  N   . SER A 1 151 ? 5.798   3.039  57.610 1.00 10.21  ? 241 SER A N   1 
ATOM   916  C  CA  . SER A 1 151 ? 5.850   3.313  56.159 1.00 9.81   ? 241 SER A CA  1 
ATOM   917  C  C   . SER A 1 151 ? 4.395   3.400  55.667 1.00 9.90   ? 241 SER A C   1 
ATOM   918  O  O   . SER A 1 151 ? 3.612   2.444  55.900 1.00 14.51  ? 241 SER A O   1 
ATOM   919  C  CB  . SER A 1 151 ? 6.515   2.155  55.409 1.00 10.61  ? 241 SER A CB  1 
ATOM   920  O  OG  . SER A 1 151 ? 7.879   2.064  55.797 1.00 11.94  ? 241 SER A OG  1 
ATOM   921  N  N   . ILE A 1 152 ? 4.082   4.475  54.958 1.00 9.34   ? 242 ILE A N   1 
ATOM   922  C  CA  . ILE A 1 152 ? 2.753   4.681  54.367 1.00 8.63   ? 242 ILE A CA  1 
ATOM   923  C  C   . ILE A 1 152 ? 2.858   4.699  52.853 1.00 8.37   ? 242 ILE A C   1 
ATOM   924  O  O   . ILE A 1 152 ? 3.559   5.577  52.309 1.00 9.74   ? 242 ILE A O   1 
ATOM   925  C  CB  . ILE A 1 152 ? 2.141   6.006  54.876 1.00 9.78   ? 242 ILE A CB  1 
ATOM   926  C  CG1 . ILE A 1 152 ? 1.920   5.898  56.406 1.00 11.31  ? 242 ILE A CG1 1 
ATOM   927  C  CG2 . ILE A 1 152 ? 0.870   6.278  54.103 1.00 11.14  ? 242 ILE A CG2 1 
ATOM   928  C  CD1 . ILE A 1 152 ? 1.279   7.179  56.964 1.00 17.01  ? 242 ILE A CD1 1 
ATOM   929  N  N   . TYR A 1 153 ? 2.163   3.769  52.206 1.00 8.98   ? 243 TYR A N   1 
ATOM   930  C  CA  . TYR A 1 153 ? 2.066   3.687  50.760 1.00 8.76   ? 243 TYR A CA  1 
ATOM   931  C  C   . TYR A 1 153 ? 0.586   3.969  50.422 1.00 8.75   ? 243 TYR A C   1 
ATOM   932  O  O   . TYR A 1 153 ? -0.282  3.276  50.960 1.00 10.15  ? 243 TYR A O   1 
ATOM   933  C  CB  . TYR A 1 153 ? 2.522   2.303  50.208 1.00 9.11   ? 243 TYR A CB  1 
ATOM   934  C  CG  . TYR A 1 153 ? 2.314   2.205  48.700 1.00 9.46   ? 243 TYR A CG  1 
ATOM   935  C  CD1 . TYR A 1 153 ? 1.080   1.884  48.119 1.00 9.38   ? 243 TYR A CD1 1 
ATOM   936  C  CD2 . TYR A 1 153 ? 3.362   2.468  47.804 1.00 9.46   ? 243 TYR A CD2 1 
ATOM   937  C  CE1 . TYR A 1 153 ? 0.846   1.811  46.772 1.00 9.46   ? 243 TYR A CE1 1 
ATOM   938  C  CE2 . TYR A 1 153 ? 3.158   2.394  46.428 1.00 8.88   ? 243 TYR A CE2 1 
ATOM   939  C  CZ  . TYR A 1 153 ? 1.917   2.065  45.931 1.00 9.16   ? 243 TYR A CZ  1 
ATOM   940  O  OH  . TYR A 1 153 ? 1.700   2.007  44.570 1.00 10.65  ? 243 TYR A OH  1 
ATOM   941  N  N   . GLN A 1 154 ? 0.336   4.744  49.356 1.00 8.69   ? 244 GLN A N   1 
ATOM   942  C  CA  . GLN A 1 154 ? -0.973  4.743  48.705 1.00 8.49   ? 244 GLN A CA  1 
ATOM   943  C  C   . GLN A 1 154 ? -0.779  5.059  47.241 1.00 7.80   ? 244 GLN A C   1 
ATOM   944  O  O   . GLN A 1 154 ? 0.266   5.600  46.823 1.00 8.80   ? 244 GLN A O   1 
ATOM   945  C  CB  . GLN A 1 154 ? -1.944  5.761  49.296 1.00 9.31   ? 244 GLN A CB  1 
ATOM   946  C  CG  . GLN A 1 154 ? -1.536  7.211  49.002 1.00 11.00  ? 244 GLN A CG  1 
ATOM   947  C  CD  . GLN A 1 154 ? -2.397  8.241  49.773 1.00 9.63   ? 244 GLN A CD  1 
ATOM   948  O  OE1 . GLN A 1 154 ? -3.541  7.978  50.088 1.00 9.84   ? 244 GLN A OE1 1 
ATOM   949  N  NE2 . GLN A 1 154 ? -1.749  9.367  50.074 1.00 9.65   ? 244 GLN A NE2 1 
ATOM   950  N  N   . GLY A 1 155 ? -1.792  4.726  46.446 1.00 8.37   ? 245 GLY A N   1 
ATOM   951  C  CA  . GLY A 1 155 ? -1.789  5.170  45.051 1.00 9.16   ? 245 GLY A CA  1 
ATOM   952  C  C   . GLY A 1 155 ? -3.187  5.043  44.450 1.00 8.02   ? 245 GLY A C   1 
ATOM   953  O  O   . GLY A 1 155 ? -4.082  4.435  45.070 1.00 9.47   ? 245 GLY A O   1 
ATOM   954  N  N   . GLY A 1 156 ? -3.357  5.559  43.257 1.00 8.13   ? 246 GLY A N   1 
ATOM   955  C  CA  . GLY A 1 156 ? -4.675  5.494  42.598 1.00 9.30   ? 246 GLY A CA  1 
ATOM   956  C  C   . GLY A 1 156 ? -4.603  6.155  41.222 1.00 8.35   ? 246 GLY A C   1 
ATOM   957  O  O   . GLY A 1 156 ? -3.592  6.789  40.895 1.00 9.21   ? 246 GLY A O   1 
ATOM   958  N  N   . ILE A 1 157 ? -5.646  5.948  40.419 1.00 9.32   ? 247 ILE A N   1 
ATOM   959  C  CA  . ILE A 1 157 ? -5.621  6.473  39.066 1.00 9.87   ? 247 ILE A CA  1 
ATOM   960  C  C   . ILE A 1 157 ? -6.447  7.743  38.951 1.00 10.70  ? 247 ILE A C   1 
ATOM   961  O  O   . ILE A 1 157 ? -7.586  7.764  39.437 1.00 11.14  ? 247 ILE A O   1 
ATOM   962  C  CB  . ILE A 1 157 ? -6.240  5.460  38.071 1.00 13.19  ? 247 ILE A CB  1 
ATOM   963  C  CG1 . ILE A 1 157 ? -5.738  4.053  38.167 1.00 13.97  ? 247 ILE A CG1 1 
ATOM   964  C  CG2 . ILE A 1 157 ? -6.057  6.046  36.648 1.00 16.93  ? 247 ILE A CG2 1 
ATOM   965  C  CD1 . ILE A 1 157 ? -6.787  3.079  37.633 1.00 18.30  ? 247 ILE A CD1 1 
ATOM   966  N  N   . PHE A 1 158 ? -5.847  8.783  38.350 1.00 10.95  ? 248 PHE A N   1 
ATOM   967  C  CA  . PHE A 1 158 ? -6.474  10.094 38.187 1.00 10.80  ? 248 PHE A CA  1 
ATOM   968  C  C   . PHE A 1 158 ? -6.272  10.622 36.785 1.00 11.71  ? 248 PHE A C   1 
ATOM   969  O  O   . PHE A 1 158 ? -5.202  10.427 36.168 1.00 12.76  ? 248 PHE A O   1 
ATOM   970  C  CB  . PHE A 1 158 ? -5.877  11.108 39.222 1.00 11.41  ? 248 PHE A CB  1 
ATOM   971  C  CG  . PHE A 1 158 ? -6.235  10.693 40.645 1.00 11.82  ? 248 PHE A CG  1 
ATOM   972  C  CD1 . PHE A 1 158 ? -5.433  9.745  41.307 1.00 12.38  ? 248 PHE A CD1 1 
ATOM   973  C  CD2 . PHE A 1 158 ? -7.385  11.166 41.263 1.00 12.72  ? 248 PHE A CD2 1 
ATOM   974  C  CE1 . PHE A 1 158 ? -5.819  9.257  42.545 1.00 12.17  ? 248 PHE A CE1 1 
ATOM   975  C  CE2 . PHE A 1 158 ? -7.746  10.720 42.541 1.00 12.18  ? 248 PHE A CE2 1 
ATOM   976  C  CZ  . PHE A 1 158 ? -6.979  9.741  43.167 1.00 12.50  ? 248 PHE A CZ  1 
ATOM   977  N  N   . GLU A 1 159 ? -7.315  11.325 36.303 1.00 12.21  ? 249 GLU A N   1 
ATOM   978  C  CA  . GLU A 1 159 ? -7.168  11.997 34.995 1.00 13.92  ? 249 GLU A CA  1 
ATOM   979  C  C   . GLU A 1 159 ? -6.414  13.283 35.163 1.00 13.06  ? 249 GLU A C   1 
ATOM   980  O  O   . GLU A 1 159 ? -6.808  14.157 35.951 1.00 15.69  ? 249 GLU A O   1 
ATOM   981  C  CB  . GLU A 1 159 ? -8.533  12.281 34.356 1.00 17.94  ? 249 GLU A CB  1 
ATOM   982  C  CG  . GLU A 1 159 ? -8.252  12.760 32.916 1.00 29.24  ? 249 GLU A CG  1 
ATOM   983  C  CD  . GLU A 1 159 ? -9.011  12.021 31.849 1.00 37.58  ? 249 GLU A CD  1 
ATOM   984  O  OE1 . GLU A 1 159 ? -10.270 12.067 31.800 1.00 48.54  ? 249 GLU A OE1 1 
ATOM   985  O  OE2 . GLU A 1 159 ? -8.377  11.335 30.995 1.00 55.28  ? 249 GLU A OE2 1 
ATOM   986  N  N   . LEU A 1 160 ? -5.315  13.420 34.428 1.00 12.39  ? 250 LEU A N   1 
ATOM   987  C  CA  . LEU A 1 160 ? -4.518  14.633 34.530 1.00 12.74  ? 250 LEU A CA  1 
ATOM   988  C  C   . LEU A 1 160 ? -4.404  15.332 33.171 1.00 13.11  ? 250 LEU A C   1 
ATOM   989  O  O   . LEU A 1 160 ? -4.492  14.676 32.126 1.00 16.50  ? 250 LEU A O   1 
ATOM   990  C  CB  . LEU A 1 160 ? -3.102  14.343 35.038 1.00 12.02  ? 250 LEU A CB  1 
ATOM   991  C  CG  . LEU A 1 160 ? -2.975  13.586 36.360 1.00 11.82  ? 250 LEU A CG  1 
ATOM   992  C  CD1 . LEU A 1 160 ? -1.510  13.304 36.697 1.00 14.38  ? 250 LEU A CD1 1 
ATOM   993  C  CD2 . LEU A 1 160 ? -3.643  14.408 37.465 1.00 14.01  ? 250 LEU A CD2 1 
ATOM   994  N  N   . LYS A 1 161 ? -4.246  16.642 33.232 1.00 12.84  ? 251 LYS A N   1 
ATOM   995  C  CA  . LYS A 1 161 ? -4.119  17.458 32.021 1.00 14.09  ? 251 LYS A CA  1 
ATOM   996  C  C   . LYS A 1 161 ? -2.669  17.883 31.837 1.00 13.62  ? 251 LYS A C   1 
ATOM   997  O  O   . LYS A 1 161 ? -1.917  17.943 32.806 1.00 13.21  ? 251 LYS A O   1 
ATOM   998  C  CB  . LYS A 1 161 ? -5.005  18.728 32.131 1.00 15.54  ? 251 LYS A CB  1 
ATOM   999  C  CG  . LYS A 1 161 ? -6.514  18.430 32.220 1.00 19.57  ? 251 LYS A CG  1 
ATOM   1000 C  CD  . LYS A 1 161 ? -7.266  19.754 32.127 1.00 23.84  ? 251 LYS A CD  1 
ATOM   1001 C  CE  . LYS A 1 161 ? -8.754  19.663 32.301 1.00 30.06  ? 251 LYS A CE  1 
ATOM   1002 N  NZ  . LYS A 1 161 ? -9.305  18.356 31.895 1.00 45.53  ? 251 LYS A NZ  1 
ATOM   1003 N  N   . GLU A 1 162 ? -2.269  18.191 30.577 1.00 14.51  ? 252 GLU A N   1 
ATOM   1004 C  CA  . GLU A 1 162 ? -0.981  18.815 30.353 1.00 14.58  ? 252 GLU A CA  1 
ATOM   1005 C  C   . GLU A 1 162 ? -0.772  20.009 31.274 1.00 14.38  ? 252 GLU A C   1 
ATOM   1006 O  O   . GLU A 1 162 ? -1.676  20.827 31.406 1.00 15.87  ? 252 GLU A O   1 
ATOM   1007 C  CB  . GLU A 1 162 ? -0.893  19.367 28.920 1.00 15.66  ? 252 GLU A CB  1 
ATOM   1008 C  CG  . GLU A 1 162 ? 0.488   19.938 28.606 1.00 20.39  ? 252 GLU A CG  1 
ATOM   1009 C  CD  . GLU A 1 162 ? 0.661   20.106 27.099 1.00 26.87  ? 252 GLU A CD  1 
ATOM   1010 O  OE1 . GLU A 1 162 ? -0.249  19.622 26.364 1.00 37.14  ? 252 GLU A OE1 1 
ATOM   1011 O  OE2 . GLU A 1 162 ? 1.702   20.656 26.676 1.00 30.06  ? 252 GLU A OE2 1 
ATOM   1012 N  N   . ASN A 1 163 ? 0.392   20.125 31.892 1.00 14.74  ? 253 ASN A N   1 
ATOM   1013 C  CA  . ASN A 1 163 ? 0.857   21.159 32.810 1.00 13.60  ? 253 ASN A CA  1 
ATOM   1014 C  C   . ASN A 1 163 ? 0.240   21.046 34.196 1.00 14.75  ? 253 ASN A C   1 
ATOM   1015 O  O   . ASN A 1 163 ? 0.525   21.903 35.035 1.00 15.19  ? 253 ASN A O   1 
ATOM   1016 C  CB  . ASN A 1 163 ? 0.590   22.581 32.233 1.00 17.89  ? 253 ASN A CB  1 
ATOM   1017 C  CG  . ASN A 1 163 ? 1.361   22.750 30.924 1.00 20.59  ? 253 ASN A CG  1 
ATOM   1018 O  OD1 . ASN A 1 163 ? 2.521   22.335 30.844 1.00 24.84  ? 253 ASN A OD1 1 
ATOM   1019 N  ND2 . ASN A 1 163 ? 0.700   23.384 29.942 1.00 29.19  ? 253 ASN A ND2 1 
ATOM   1020 N  N   . ASP A 1 164 ? -0.563  20.022 34.475 1.00 12.98  ? 254 ASP A N   1 
ATOM   1021 C  CA  . ASP A 1 164 ? -0.912  19.772 35.895 1.00 11.51  ? 254 ASP A CA  1 
ATOM   1022 C  C   . ASP A 1 164 ? 0.376   19.448 36.669 1.00 11.81  ? 254 ASP A C   1 
ATOM   1023 O  O   . ASP A 1 164 ? 1.375   18.969 36.102 1.00 12.38  ? 254 ASP A O   1 
ATOM   1024 C  CB  . ASP A 1 164 ? -1.885  18.597 36.023 1.00 12.59  ? 254 ASP A CB  1 
ATOM   1025 C  CG  . ASP A 1 164 ? -3.311  18.982 35.624 1.00 13.46  ? 254 ASP A CG  1 
ATOM   1026 O  OD1 . ASP A 1 164 ? -3.606  20.177 35.339 1.00 14.68  ? 254 ASP A OD1 1 
ATOM   1027 O  OD2 . ASP A 1 164 ? -4.150  18.036 35.669 1.00 14.92  ? 254 ASP A OD2 1 
ATOM   1028 N  N   . ARG A 1 165 ? 0.360   19.710 37.974 1.00 11.54  ? 255 ARG A N   1 
ATOM   1029 C  CA  . ARG A 1 165 ? 1.503   19.513 38.841 1.00 12.09  ? 255 ARG A CA  1 
ATOM   1030 C  C   . ARG A 1 165 ? 1.078   18.650 40.029 1.00 11.78  ? 255 ARG A C   1 
ATOM   1031 O  O   . ARG A 1 165 ? 0.053   18.961 40.648 1.00 15.02  ? 255 ARG A O   1 
ATOM   1032 C  CB  . ARG A 1 165 ? 2.060   20.848 39.329 1.00 15.96  ? 255 ARG A CB  1 
ATOM   1033 C  CG  . ARG A 1 165 ? 2.432   21.805 38.241 1.00 18.49  ? 255 ARG A CG  1 
ATOM   1034 C  CD  . ARG A 1 165 ? 2.347   23.279 38.605 1.00 25.56  ? 255 ARG A CD  1 
ATOM   1035 N  NE  . ARG A 1 165 ? 2.637   23.811 39.886 1.00 28.42  ? 255 ARG A NE  1 
ATOM   1036 C  CZ  . ARG A 1 165 ? 2.181   24.767 40.674 1.00 31.26  ? 255 ARG A CZ  1 
ATOM   1037 N  NH1 . ARG A 1 165 ? 1.137   25.513 40.294 1.00 34.53  ? 255 ARG A NH1 1 
ATOM   1038 N  NH2 . ARG A 1 165 ? 2.680   25.081 41.891 1.00 31.08  ? 255 ARG A NH2 1 
ATOM   1039 N  N   . ILE A 1 166 ? 1.803   17.598 40.361 1.00 11.14  ? 256 ILE A N   1 
ATOM   1040 C  CA  . ILE A 1 166 ? 1.386   16.740 41.496 1.00 11.33  ? 256 ILE A CA  1 
ATOM   1041 C  C   . ILE A 1 166 ? 2.454   16.750 42.545 1.00 10.48  ? 256 ILE A C   1 
ATOM   1042 O  O   . ILE A 1 166 ? 3.659   16.796 42.237 1.00 11.12  ? 256 ILE A O   1 
ATOM   1043 C  CB  A ILE A 1 166 ? 1.260   15.293 40.956 0.50 12.00  ? 256 ILE A CB  1 
ATOM   1044 C  CB  B ILE A 1 166 ? 0.998   15.335 41.019 0.50 12.05  ? 256 ILE A CB  1 
ATOM   1045 C  CG1 A ILE A 1 166 ? 0.535   15.167 39.604 0.50 12.18  ? 256 ILE A CG1 1 
ATOM   1046 C  CG1 B ILE A 1 166 ? 2.059   14.693 40.138 0.50 12.24  ? 256 ILE A CG1 1 
ATOM   1047 C  CG2 A ILE A 1 166 ? 0.570   14.378 41.940 0.50 12.86  ? 256 ILE A CG2 1 
ATOM   1048 C  CG2 B ILE A 1 166 ? -0.366  15.414 40.325 0.50 14.48  ? 256 ILE A CG2 1 
ATOM   1049 C  CD1 A ILE A 1 166 ? -0.920  15.625 39.719 0.50 14.74  ? 256 ILE A CD1 1 
ATOM   1050 C  CD1 B ILE A 1 166 ? 1.704   13.254 39.827 0.50 11.69  ? 256 ILE A CD1 1 
ATOM   1051 N  N   . PHE A 1 167 ? 2.039   16.760 43.825 1.00 9.77   ? 257 PHE A N   1 
ATOM   1052 C  CA  . PHE A 1 167 ? 3.059   16.748 44.874 1.00 9.79   ? 257 PHE A CA  1 
ATOM   1053 C  C   . PHE A 1 167 ? 2.568   15.965 46.082 1.00 9.28   ? 257 PHE A C   1 
ATOM   1054 O  O   . PHE A 1 167 ? 1.373   15.680 46.195 1.00 9.95   ? 257 PHE A O   1 
ATOM   1055 C  CB  . PHE A 1 167 ? 3.435   18.172 45.239 1.00 11.17  ? 257 PHE A CB  1 
ATOM   1056 C  CG  . PHE A 1 167 ? 2.379   19.058 45.851 1.00 11.39  ? 257 PHE A CG  1 
ATOM   1057 C  CD1 . PHE A 1 167 ? 2.144   19.066 47.220 1.00 12.61  ? 257 PHE A CD1 1 
ATOM   1058 C  CD2 . PHE A 1 167 ? 1.628   19.894 45.017 1.00 12.55  ? 257 PHE A CD2 1 
ATOM   1059 C  CE1 . PHE A 1 167 ? 1.238   19.955 47.793 1.00 12.56  ? 257 PHE A CE1 1 
ATOM   1060 C  CE2 . PHE A 1 167 ? 0.703   20.758 45.585 1.00 13.12  ? 257 PHE A CE2 1 
ATOM   1061 C  CZ  . PHE A 1 167 ? 0.521   20.822 46.974 1.00 13.12  ? 257 PHE A CZ  1 
ATOM   1062 N  N   . VAL A 1 168 ? 3.539   15.634 46.945 1.00 9.44   ? 258 VAL A N   1 
ATOM   1063 C  CA  . VAL A 1 168 ? 3.259   14.914 48.204 1.00 9.17   ? 258 VAL A CA  1 
ATOM   1064 C  C   . VAL A 1 168 ? 3.470   15.852 49.390 1.00 8.95   ? 258 VAL A C   1 
ATOM   1065 O  O   . VAL A 1 168 ? 4.490   16.555 49.399 1.00 11.09  ? 258 VAL A O   1 
ATOM   1066 C  CB  . VAL A 1 168 ? 4.154   13.692 48.320 1.00 9.63   ? 258 VAL A CB  1 
ATOM   1067 C  CG1 . VAL A 1 168 ? 3.788   12.880 49.573 1.00 11.00  ? 258 VAL A CG1 1 
ATOM   1068 C  CG2 . VAL A 1 168 ? 4.041   12.800 47.081 1.00 9.83   ? 258 VAL A CG2 1 
ATOM   1069 N  N   . SER A 1 169 ? 2.543   15.823 50.348 1.00 9.96   ? 259 SER A N   1 
ATOM   1070 C  CA  . SER A 1 169 ? 2.749   16.538 51.608 1.00 10.81  ? 259 SER A CA  1 
ATOM   1071 C  C   . SER A 1 169 ? 2.493   15.591 52.763 1.00 10.56  ? 259 SER A C   1 
ATOM   1072 O  O   . SER A 1 169 ? 1.775   14.587 52.620 1.00 11.60  ? 259 SER A O   1 
ATOM   1073 C  CB  A SER A 1 169 ? 1.888   17.793 51.645 0.50 13.22  ? 259 SER A CB  1 
ATOM   1074 C  CB  B SER A 1 169 ? 1.715   17.666 51.686 0.50 11.72  ? 259 SER A CB  1 
ATOM   1075 O  OG  A SER A 1 169 ? 0.543   17.481 51.869 0.50 15.22  ? 259 SER A OG  1 
ATOM   1076 O  OG  B SER A 1 169 ? 1.934   18.542 50.593 0.50 11.61  ? 259 SER A OG  1 
ATOM   1077 N  N   . VAL A 1 170 ? 3.089   15.911 53.906 1.00 10.60  ? 260 VAL A N   1 
ATOM   1078 C  CA  . VAL A 1 170 ? 2.970   15.039 55.057 1.00 10.09  ? 260 VAL A CA  1 
ATOM   1079 C  C   . VAL A 1 170 ? 2.787   15.878 56.321 1.00 11.45  ? 260 VAL A C   1 
ATOM   1080 O  O   . VAL A 1 170 ? 3.240   17.027 56.417 1.00 13.21  ? 260 VAL A O   1 
ATOM   1081 C  CB  . VAL A 1 170 ? 4.235   14.160 55.266 1.00 11.56  ? 260 VAL A CB  1 
ATOM   1082 C  CG1 . VAL A 1 170 ? 4.274   13.086 54.146 1.00 13.47  ? 260 VAL A CG1 1 
ATOM   1083 C  CG2 . VAL A 1 170 ? 5.522   14.976 55.276 1.00 13.88  ? 260 VAL A CG2 1 
ATOM   1084 N  N   . THR A 1 171 ? 2.150   15.274 57.324 1.00 10.72  ? 261 THR A N   1 
ATOM   1085 C  CA  . THR A 1 171 ? 2.270   15.827 58.678 1.00 12.61  ? 261 THR A CA  1 
ATOM   1086 C  C   . THR A 1 171 ? 3.581   15.334 59.288 1.00 14.22  ? 261 THR A C   1 
ATOM   1087 O  O   . THR A 1 171 ? 4.215   14.411 58.707 1.00 15.12  ? 261 THR A O   1 
ATOM   1088 C  CB  . THR A 1 171 ? 1.106   15.361 59.569 1.00 13.21  ? 261 THR A CB  1 
ATOM   1089 O  OG1 . THR A 1 171 ? 1.189   13.947 59.638 1.00 14.62  ? 261 THR A OG1 1 
ATOM   1090 C  CG2 . THR A 1 171 ? -0.231  15.788 58.950 1.00 15.80  ? 261 THR A CG2 1 
ATOM   1091 N  N   . ASN A 1 172 ? 3.983   15.907 60.407 1.00 15.72  ? 262 ASN A N   1 
ATOM   1092 C  CA  . ASN A 1 172 ? 5.192   15.452 61.102 1.00 18.08  ? 262 ASN A CA  1 
ATOM   1093 C  C   . ASN A 1 172 ? 6.376   15.277 60.178 1.00 19.26  ? 262 ASN A C   1 
ATOM   1094 O  O   . ASN A 1 172 ? 6.998   14.223 60.223 1.00 18.08  ? 262 ASN A O   1 
ATOM   1095 C  CB  . ASN A 1 172 ? 4.853   14.130 61.814 1.00 20.16  ? 262 ASN A CB  1 
ATOM   1096 C  CG  . ASN A 1 172 ? 3.943   14.409 62.988 1.00 22.15  ? 262 ASN A CG  1 
ATOM   1097 O  OD1 . ASN A 1 172 ? 4.427   15.099 63.897 1.00 28.15  ? 262 ASN A OD1 1 
ATOM   1098 N  ND2 . ASN A 1 172 ? 2.708   13.954 63.023 1.00 25.07  ? 262 ASN A ND2 1 
ATOM   1099 N  N   . GLU A 1 173 ? 6.638   16.263 59.314 1.00 18.37  ? 263 GLU A N   1 
ATOM   1100 C  CA  . GLU A 1 173 ? 7.673   16.026 58.315 1.00 19.64  ? 263 GLU A CA  1 
ATOM   1101 C  C   . GLU A 1 173 ? 9.059   15.762 58.893 1.00 19.34  ? 263 GLU A C   1 
ATOM   1102 O  O   . GLU A 1 173 ? 9.961   15.188 58.304 1.00 20.55  ? 263 GLU A O   1 
ATOM   1103 C  CB  . GLU A 1 173 ? 7.779   17.264 57.387 1.00 22.42  ? 263 GLU A CB  1 
ATOM   1104 C  CG  . GLU A 1 173 ? 8.479   18.352 58.194 1.00 33.83  ? 263 GLU A CG  1 
ATOM   1105 C  CD  . GLU A 1 173 ? 9.087   19.460 57.373 1.00 42.57  ? 263 GLU A CD  1 
ATOM   1106 O  OE1 . GLU A 1 173 ? 9.534   19.241 56.228 1.00 55.91  ? 263 GLU A OE1 1 
ATOM   1107 O  OE2 . GLU A 1 173 ? 9.103   20.602 57.913 1.00 43.55  ? 263 GLU A OE2 1 
ATOM   1108 N  N   . HIS A 1 174 ? 9.292   16.188 60.123 1.00 21.04  ? 264 HIS A N   1 
ATOM   1109 C  CA  . HIS A 1 174 ? 10.596  15.986 60.753 1.00 22.03  ? 264 HIS A CA  1 
ATOM   1110 C  C   . HIS A 1 174 ? 10.827  14.537 61.148 1.00 22.55  ? 264 HIS A C   1 
ATOM   1111 O  O   . HIS A 1 174 ? 11.945  14.174 61.547 1.00 25.20  ? 264 HIS A O   1 
ATOM   1112 C  CB  . HIS A 1 174 ? 10.660  16.866 62.010 1.00 25.29  ? 264 HIS A CB  1 
ATOM   1113 C  CG  . HIS A 1 174 ? 9.647   16.485 63.053 1.00 25.91  ? 264 HIS A CG  1 
ATOM   1114 N  ND1 . HIS A 1 174 ? 8.282   16.714 62.890 1.00 27.42  ? 264 HIS A ND1 1 
ATOM   1115 C  CD2 . HIS A 1 174 ? 9.771   15.894 64.272 1.00 28.62  ? 264 HIS A CD2 1 
ATOM   1116 C  CE1 . HIS A 1 174 ? 7.618   16.283 63.940 1.00 29.33  ? 264 HIS A CE1 1 
ATOM   1117 N  NE2 . HIS A 1 174 ? 8.497   15.778 64.803 1.00 31.34  ? 264 HIS A NE2 1 
ATOM   1118 N  N   . LEU A 1 175 ? 9.743   13.756 61.040 1.00 19.39  ? 265 LEU A N   1 
ATOM   1119 C  CA  . LEU A 1 175 ? 9.880   12.311 61.292 1.00 18.39  ? 265 LEU A CA  1 
ATOM   1120 C  C   . LEU A 1 175 ? 10.098  11.484 60.045 1.00 17.05  ? 265 LEU A C   1 
ATOM   1121 O  O   . LEU A 1 175 ? 10.165  10.240 60.133 1.00 17.74  ? 265 LEU A O   1 
ATOM   1122 C  CB  . LEU A 1 175 ? 8.648   11.794 62.034 1.00 19.75  ? 265 LEU A CB  1 
ATOM   1123 C  CG  . LEU A 1 175 ? 8.284   12.499 63.344 1.00 21.27  ? 265 LEU A CG  1 
ATOM   1124 C  CD1 . LEU A 1 175 ? 7.088   11.830 63.999 1.00 25.51  ? 265 LEU A CD1 1 
ATOM   1125 C  CD2 . LEU A 1 175 ? 9.470   12.527 64.301 1.00 25.79  ? 265 LEU A CD2 1 
ATOM   1126 N  N   . ILE A 1 176 ? 10.177  12.095 58.878 1.00 18.05  ? 266 ILE A N   1 
ATOM   1127 C  CA  . ILE A 1 176 ? 10.299  11.321 57.634 1.00 17.00  ? 266 ILE A CA  1 
ATOM   1128 C  C   . ILE A 1 176 ? 11.739  10.908 57.365 1.00 16.86  ? 266 ILE A C   1 
ATOM   1129 O  O   . ILE A 1 176 ? 12.658  11.749 57.424 1.00 21.20  ? 266 ILE A O   1 
ATOM   1130 C  CB  . ILE A 1 176 ? 9.816   12.126 56.409 1.00 20.16  ? 266 ILE A CB  1 
ATOM   1131 C  CG1 . ILE A 1 176 ? 8.344   12.503 56.508 1.00 19.74  ? 266 ILE A CG1 1 
ATOM   1132 C  CG2 . ILE A 1 176 ? 10.025  11.393 55.092 1.00 24.73  ? 266 ILE A CG2 1 
ATOM   1133 C  CD1 . ILE A 1 176 ? 7.491   11.242 56.345 1.00 20.47  ? 266 ILE A CD1 1 
ATOM   1134 N  N   . ASP A 1 177 ? 11.931  9.682  57.020 1.00 14.45  ? 267 ASP A N   1 
ATOM   1135 C  CA  . ASP A 1 177 ? 13.240  9.139  56.669 1.00 13.98  ? 267 ASP A CA  1 
ATOM   1136 C  C   . ASP A 1 177 ? 13.328  9.146  55.142 1.00 15.75  ? 267 ASP A C   1 
ATOM   1137 O  O   . ASP A 1 177 ? 12.572  8.391  54.484 1.00 14.54  ? 267 ASP A O   1 
ATOM   1138 C  CB  . ASP A 1 177 ? 13.367  7.735  57.222 1.00 15.47  ? 267 ASP A CB  1 
ATOM   1139 C  CG  . ASP A 1 177 ? 14.673  7.027  56.858 1.00 18.10  ? 267 ASP A CG  1 
ATOM   1140 O  OD1 . ASP A 1 177 ? 15.416  7.443  55.957 1.00 22.02  ? 267 ASP A OD1 1 
ATOM   1141 O  OD2 . ASP A 1 177 ? 14.979  6.003  57.506 1.00 22.29  ? 267 ASP A OD2 1 
ATOM   1142 N  N   . MET A 1 178 ? 14.204  9.970  54.584 1.00 15.67  ? 268 MET A N   1 
ATOM   1143 C  CA  . MET A 1 178 ? 14.284  10.165 53.147 1.00 15.25  ? 268 MET A CA  1 
ATOM   1144 C  C   . MET A 1 178 ? 15.284  9.209  52.526 1.00 15.56  ? 268 MET A C   1 
ATOM   1145 O  O   . MET A 1 178 ? 15.754  9.546  51.444 1.00 17.21  ? 268 MET A O   1 
ATOM   1146 C  CB  . MET A 1 178 ? 14.585  11.650 52.824 1.00 16.82  ? 268 MET A CB  1 
ATOM   1147 C  CG  . MET A 1 178 ? 13.380  12.551 53.113 1.00 16.98  ? 268 MET A CG  1 
ATOM   1148 S  SD  . MET A 1 178 ? 11.872  12.295 52.145 1.00 20.54  ? 268 MET A SD  1 
ATOM   1149 C  CE  . MET A 1 178 ? 12.289  13.060 50.566 1.00 20.53  ? 268 MET A CE  1 
ATOM   1150 N  N   . ASP A 1 179 ? 15.631  8.069  53.092 1.00 15.70  ? 269 ASP A N   1 
ATOM   1151 C  CA  . ASP A 1 179 ? 16.388  7.049  52.367 1.00 16.34  ? 269 ASP A CA  1 
ATOM   1152 C  C   . ASP A 1 179 ? 15.755  6.740  51.015 1.00 14.27  ? 269 ASP A C   1 
ATOM   1153 O  O   . ASP A 1 179 ? 14.500  6.637  50.955 1.00 14.92  ? 269 ASP A O   1 
ATOM   1154 C  CB  . ASP A 1 179 ? 16.419  5.717  53.148 1.00 21.17  ? 269 ASP A CB  1 
ATOM   1155 C  CG  . ASP A 1 179 ? 17.653  5.620  54.014 1.00 26.33  ? 269 ASP A CG  1 
ATOM   1156 O  OD1 . ASP A 1 179 ? 18.392  6.630  54.061 1.00 28.99  ? 269 ASP A OD1 1 
ATOM   1157 O  OD2 . ASP A 1 179 ? 17.805  4.535  54.619 1.00 27.34  ? 269 ASP A OD2 1 
ATOM   1158 N  N   . HIS A 1 180 ? 16.533  6.563  49.959 1.00 16.36  ? 270 HIS A N   1 
ATOM   1159 C  CA  . HIS A 1 180 ? 15.906  6.480  48.629 1.00 17.47  ? 270 HIS A CA  1 
ATOM   1160 C  C   . HIS A 1 180 ? 15.096  5.212  48.435 1.00 15.32  ? 270 HIS A C   1 
ATOM   1161 O  O   . HIS A 1 180 ? 14.205  5.200  47.566 1.00 17.21  ? 270 HIS A O   1 
ATOM   1162 C  CB  . HIS A 1 180 ? 16.914  6.647  47.496 1.00 21.50  ? 270 HIS A CB  1 
ATOM   1163 C  CG  . HIS A 1 180 ? 17.889  5.532  47.289 1.00 25.85  ? 270 HIS A CG  1 
ATOM   1164 N  ND1 . HIS A 1 180 ? 19.135  5.492  47.864 1.00 31.97  ? 270 HIS A ND1 1 
ATOM   1165 C  CD2 . HIS A 1 180 ? 17.810  4.409  46.543 1.00 24.62  ? 270 HIS A CD2 1 
ATOM   1166 C  CE1 . HIS A 1 180 ? 19.781  4.381  47.486 1.00 30.48  ? 270 HIS A CE1 1 
ATOM   1167 N  NE2 . HIS A 1 180 ? 19.007  3.715  46.680 1.00 27.38  ? 270 HIS A NE2 1 
ATOM   1168 N  N   . GLU A 1 181 ? 15.339  4.160  49.230 1.00 14.24  ? 271 GLU A N   1 
ATOM   1169 C  CA  . GLU A 1 181 ? 14.550  2.944  49.043 1.00 12.70  ? 271 GLU A CA  1 
ATOM   1170 C  C   . GLU A 1 181 ? 13.258  3.007  49.896 1.00 12.25  ? 271 GLU A C   1 
ATOM   1171 O  O   . GLU A 1 181 ? 12.343  2.193  49.709 1.00 12.60  ? 271 GLU A O   1 
ATOM   1172 C  CB  . GLU A 1 181 ? 15.311  1.682  49.473 1.00 14.81  ? 271 GLU A CB  1 
ATOM   1173 C  CG  . GLU A 1 181 ? 16.694  1.562  48.861 1.00 17.79  ? 271 GLU A CG  1 
ATOM   1174 C  CD  . GLU A 1 181 ? 17.786  2.087  49.783 1.00 23.71  ? 271 GLU A CD  1 
ATOM   1175 O  OE1 . GLU A 1 181 ? 17.552  3.108  50.501 1.00 27.35  ? 271 GLU A OE1 1 
ATOM   1176 O  OE2 . GLU A 1 181 ? 18.889  1.507  49.878 1.00 33.18  ? 271 GLU A OE2 1 
ATOM   1177 N  N   . ALA A 1 182 ? 13.206  3.959  50.846 1.00 10.09  ? 272 ALA A N   1 
ATOM   1178 C  CA  . ALA A 1 182 ? 12.085  3.971  51.803 1.00 10.21  ? 272 ALA A CA  1 
ATOM   1179 C  C   . ALA A 1 182 ? 11.000  4.989  51.440 1.00 9.54   ? 272 ALA A C   1 
ATOM   1180 O  O   . ALA A 1 182 ? 9.826   4.740  51.750 1.00 10.83  ? 272 ALA A O   1 
ATOM   1181 C  CB  . ALA A 1 182 ? 12.604  4.244  53.195 1.00 12.38  ? 272 ALA A CB  1 
ATOM   1182 N  N   . SER A 1 183 ? 11.410  6.110  50.863 1.00 9.89   ? 273 SER A N   1 
ATOM   1183 C  CA  . SER A 1 183 ? 10.464  7.201  50.587 1.00 9.26   ? 273 SER A CA  1 
ATOM   1184 C  C   . SER A 1 183 ? 10.612  7.564  49.108 1.00 8.98   ? 273 SER A C   1 
ATOM   1185 O  O   . SER A 1 183 ? 11.746  7.786  48.631 1.00 10.24  ? 273 SER A O   1 
ATOM   1186 C  CB  . SER A 1 183 ? 10.678  8.435  51.445 1.00 10.25  ? 273 SER A CB  1 
ATOM   1187 O  OG  . SER A 1 183 ? 10.384  8.121  52.835 1.00 11.18  ? 273 SER A OG  1 
ATOM   1188 N  N   . PHE A 1 184 ? 9.487   7.648  48.404 1.00 9.18   ? 274 PHE A N   1 
ATOM   1189 C  CA  . PHE A 1 184 ? 9.505   7.872  46.958 1.00 8.79   ? 274 PHE A CA  1 
ATOM   1190 C  C   . PHE A 1 184 ? 8.135   8.263  46.463 1.00 8.77   ? 274 PHE A C   1 
ATOM   1191 O  O   . PHE A 1 184 ? 7.125   8.179  47.195 1.00 9.03   ? 274 PHE A O   1 
ATOM   1192 C  CB  . PHE A 1 184 ? 10.054  6.626  46.227 1.00 9.86   ? 274 PHE A CB  1 
ATOM   1193 C  CG  . PHE A 1 184 ? 9.392   5.295  46.614 1.00 8.99   ? 274 PHE A CG  1 
ATOM   1194 C  CD1 . PHE A 1 184 ? 8.126   4.977  46.199 1.00 9.52   ? 274 PHE A CD1 1 
ATOM   1195 C  CD2 . PHE A 1 184 ? 10.068  4.362  47.393 1.00 9.83   ? 274 PHE A CD2 1 
ATOM   1196 C  CE1 . PHE A 1 184 ? 7.523   3.734  46.442 1.00 9.91   ? 274 PHE A CE1 1 
ATOM   1197 C  CE2 . PHE A 1 184 ? 9.492   3.156  47.674 1.00 9.81   ? 274 PHE A CE2 1 
ATOM   1198 C  CZ  . PHE A 1 184 ? 8.249   2.797  47.227 1.00 10.21  ? 274 PHE A CZ  1 
ATOM   1199 N  N   . PHE A 1 185 ? 8.087   8.707  45.222 1.00 8.76   ? 275 PHE A N   1 
ATOM   1200 C  CA  . PHE A 1 185 ? 6.889   9.264  44.591 1.00 9.51   ? 275 PHE A CA  1 
ATOM   1201 C  C   . PHE A 1 185 ? 6.959   8.966  43.105 1.00 9.15   ? 275 PHE A C   1 
ATOM   1202 O  O   . PHE A 1 185 ? 8.035   9.152  42.514 1.00 10.35  ? 275 PHE A O   1 
ATOM   1203 C  CB  . PHE A 1 185 ? 6.924   10.773 44.841 1.00 11.90  ? 275 PHE A CB  1 
ATOM   1204 C  CG  . PHE A 1 185 ? 5.894   11.696 44.235 1.00 11.23  ? 275 PHE A CG  1 
ATOM   1205 C  CD1 . PHE A 1 185 ? 4.585   11.301 44.021 1.00 12.96  ? 275 PHE A CD1 1 
ATOM   1206 C  CD2 . PHE A 1 185 ? 6.221   13.016 43.895 1.00 13.07  ? 275 PHE A CD2 1 
ATOM   1207 C  CE1 . PHE A 1 185 ? 3.634   12.169 43.522 1.00 13.01  ? 275 PHE A CE1 1 
ATOM   1208 C  CE2 . PHE A 1 185 ? 5.326   13.913 43.384 1.00 13.57  ? 275 PHE A CE2 1 
ATOM   1209 C  CZ  . PHE A 1 185 ? 4.023   13.453 43.211 1.00 14.17  ? 275 PHE A CZ  1 
ATOM   1210 N  N   . GLY A 1 186 ? 5.880   8.535  42.496 1.00 8.74   ? 276 GLY A N   1 
ATOM   1211 C  CA  . GLY A 1 186 ? 5.965   8.196  41.079 1.00 9.35   ? 276 GLY A CA  1 
ATOM   1212 C  C   . GLY A 1 186 ? 4.598   8.237  40.447 1.00 8.74   ? 276 GLY A C   1 
ATOM   1213 O  O   . GLY A 1 186 ? 3.549   8.402  41.064 1.00 9.48   ? 276 GLY A O   1 
ATOM   1214 N  N   . ALA A 1 187 ? 4.617   8.034  39.116 1.00 9.63   ? 277 ALA A N   1 
ATOM   1215 C  CA  . ALA A 1 187 ? 3.389   7.993  38.351 1.00 10.36  ? 277 ALA A CA  1 
ATOM   1216 C  C   . ALA A 1 187 ? 3.639   7.364  36.990 1.00 10.11  ? 277 ALA A C   1 
ATOM   1217 O  O   . ALA A 1 187 ? 4.769   7.496  36.476 1.00 11.53  ? 277 ALA A O   1 
ATOM   1218 C  CB  . ALA A 1 187 ? 2.851   9.407  38.164 1.00 11.36  ? 277 ALA A CB  1 
ATOM   1219 N  N   . PHE A 1 188 ? 2.617   6.781  36.382 1.00 11.03  ? 278 PHE A N   1 
ATOM   1220 C  CA  . PHE A 1 188 ? 2.780   6.312  35.013 1.00 10.74  ? 278 PHE A CA  1 
ATOM   1221 C  C   . PHE A 1 188 ? 1.436   6.413  34.303 1.00 10.27  ? 278 PHE A C   1 
ATOM   1222 O  O   . PHE A 1 188 ? 0.393   6.312  34.899 1.00 9.75   ? 278 PHE A O   1 
ATOM   1223 C  CB  . PHE A 1 188 ? 3.297   4.873  34.886 1.00 13.71  ? 278 PHE A CB  1 
ATOM   1224 C  CG  . PHE A 1 188 ? 2.510   3.782  35.601 1.00 15.84  ? 278 PHE A CG  1 
ATOM   1225 C  CD1 . PHE A 1 188 ? 2.789   3.459  36.951 1.00 20.08  ? 278 PHE A CD1 1 
ATOM   1226 C  CD2 . PHE A 1 188 ? 1.534   3.068  34.941 1.00 20.44  ? 278 PHE A CD2 1 
ATOM   1227 C  CE1 . PHE A 1 188 ? 2.084   2.437  37.577 1.00 20.34  ? 278 PHE A CE1 1 
ATOM   1228 C  CE2 . PHE A 1 188 ? 0.763   2.071  35.574 1.00 21.73  ? 278 PHE A CE2 1 
ATOM   1229 C  CZ  . PHE A 1 188 ? 1.072   1.796  36.896 1.00 24.88  ? 278 PHE A CZ  1 
ATOM   1230 N  N   . LEU A 1 189 ? 1.576   6.624  32.982 1.00 11.07  ? 279 LEU A N   1 
ATOM   1231 C  CA  . LEU A 1 189 ? 0.366   6.767  32.139 1.00 12.07  ? 279 LEU A CA  1 
ATOM   1232 C  C   . LEU A 1 189 ? -0.257  5.411  31.892 1.00 13.20  ? 279 LEU A C   1 
ATOM   1233 O  O   . LEU A 1 189 ? 0.435   4.465  31.481 1.00 18.87  ? 279 LEU A O   1 
ATOM   1234 C  CB  . LEU A 1 189 ? 0.827   7.447  30.860 1.00 14.25  ? 279 LEU A CB  1 
ATOM   1235 C  CG  . LEU A 1 189 ? -0.259  7.721  29.824 1.00 16.48  ? 279 LEU A CG  1 
ATOM   1236 C  CD1 . LEU A 1 189 ? -1.230  8.770  30.341 1.00 18.54  ? 279 LEU A CD1 1 
ATOM   1237 C  CD2 . LEU A 1 189 ? 0.404   8.156  28.516 1.00 20.96  ? 279 LEU A CD2 1 
ATOM   1238 N  N   . VAL A 1 190 ? -1.552  5.287  32.241 1.00 15.07  ? 280 VAL A N   1 
ATOM   1239 C  CA  . VAL A 1 190 ? -2.190  3.991  32.049 1.00 23.32  ? 280 VAL A CA  1 
ATOM   1240 C  C   . VAL A 1 190 ? -3.000  4.134  30.761 1.00 27.62  ? 280 VAL A C   1 
ATOM   1241 O  O   . VAL A 1 190 ? -3.159  3.118  30.115 1.00 40.33  ? 280 VAL A O   1 
ATOM   1242 C  CB  . VAL A 1 190 ? -3.009  3.393  33.208 1.00 27.67  ? 280 VAL A CB  1 
ATOM   1243 C  CG1 . VAL A 1 190 ? -3.049  4.110  34.526 1.00 35.89  ? 280 VAL A CG1 1 
ATOM   1244 C  CG2 . VAL A 1 190 ? -4.450  3.143  32.696 1.00 31.43  ? 280 VAL A CG2 1 
ATOM   1245 N  N   . GLY A 1 191 ? -3.469  5.308  30.373 1.00 26.26  ? 281 GLY A N   1 
ATOM   1246 C  CA  . GLY A 1 191 ? -3.995  5.296  29.007 1.00 31.37  ? 281 GLY A CA  1 
ATOM   1247 C  C   . GLY A 1 191 ? -4.799  6.559  28.780 1.00 32.89  ? 281 GLY A C   1 
ATOM   1248 O  O   . GLY A 1 191 ? -5.611  6.438  27.851 1.00 40.62  ? 281 GLY A O   1 
ATOM   1249 O  OXT . GLY A 1 191 ? -4.631  7.567  29.476 1.00 22.24  ? 281 GLY A OXT 1 
HETATM 1250 ZN ZN  . ZN  B 2 .   ? 0.000   0.000  70.220 0.33 11.78  ? 300 ZN  A ZN  1 
HETATM 1251 CL CL  . CL  C 3 .   ? 0.000   0.000  67.880 0.33 14.29  ? 406 CL  A CL  1 
HETATM 1252 O  O   . HOH D 4 .   ? 9.253   2.791  53.623 1.00 11.80  ? 407 HOH A O   1 
HETATM 1253 O  O   . HOH D 4 .   ? 6.293   16.507 46.512 1.00 13.11  ? 408 HOH A O   1 
HETATM 1254 O  O   . HOH D 4 .   ? 13.094  3.692  39.445 1.00 12.91  ? 409 HOH A O   1 
HETATM 1255 O  O   . HOH D 4 .   ? 0.000   0.000  77.905 0.33 17.50  ? 410 HOH A O   1 
HETATM 1256 O  O   . HOH D 4 .   ? 3.432   13.456 31.104 1.00 14.62  ? 411 HOH A O   1 
HETATM 1257 O  O   . HOH D 4 .   ? -7.378  14.506 38.674 1.00 15.25  ? 412 HOH A O   1 
HETATM 1258 O  O   . HOH D 4 .   ? -9.726  11.624 37.781 1.00 14.60  ? 413 HOH A O   1 
HETATM 1259 O  O   . HOH D 4 .   ? 13.102  17.536 35.807 1.00 16.11  ? 414 HOH A O   1 
HETATM 1260 O  O   . HOH D 4 .   ? -4.416  18.741 28.413 1.00 18.76  ? 415 HOH A O   1 
HETATM 1261 O  O   . HOH D 4 .   ? -5.318  23.719 41.083 1.00 16.64  ? 416 HOH A O   1 
HETATM 1262 O  O   . HOH D 4 .   ? 4.449   5.245  69.575 1.00 16.62  ? 417 HOH A O   1 
HETATM 1263 O  O   . HOH D 4 .   ? -3.100  22.050 33.530 1.00 18.56  ? 418 HOH A O   1 
HETATM 1264 O  O   . HOH D 4 .   ? 12.274  14.840 32.102 1.00 17.97  ? 419 HOH A O   1 
HETATM 1265 O  O   . HOH D 4 .   ? -2.318  3.365  52.647 1.00 20.95  ? 420 HOH A O   1 
HETATM 1266 O  O   . HOH D 4 .   ? 5.391   3.275  67.983 1.00 17.16  ? 421 HOH A O   1 
HETATM 1267 O  O   . HOH D 4 .   ? -10.345 16.951 46.911 1.00 19.15  ? 422 HOH A O   1 
HETATM 1268 O  O   . HOH D 4 .   ? 12.642  17.837 44.659 1.00 27.45  ? 423 HOH A O   1 
HETATM 1269 O  O   . HOH D 4 .   ? 0.471   14.603 65.240 1.00 24.10  ? 424 HOH A O   1 
HETATM 1270 O  O   . HOH D 4 .   ? -6.789  18.283 36.129 1.00 19.32  ? 425 HOH A O   1 
HETATM 1271 O  O   . HOH D 4 .   ? 15.737  10.248 34.313 1.00 21.64  ? 426 HOH A O   1 
HETATM 1272 O  O   . HOH D 4 .   ? -8.971  19.562 47.978 1.00 23.21  ? 427 HOH A O   1 
HETATM 1273 O  O   . HOH D 4 .   ? 12.585  19.681 42.549 1.00 23.16  ? 428 HOH A O   1 
HETATM 1274 O  O   . HOH D 4 .   ? 1.253   1.502  53.819 1.00 21.20  ? 429 HOH A O   1 
HETATM 1275 O  O   . HOH D 4 .   ? -1.613  16.153 26.034 1.00 24.28  ? 430 HOH A O   1 
HETATM 1276 O  O   . HOH D 4 .   ? 2.441   23.750 35.133 1.00 29.13  ? 431 HOH A O   1 
HETATM 1277 O  O   . HOH D 4 .   ? -1.588  25.737 49.632 1.00 26.41  ? 432 HOH A O   1 
HETATM 1278 O  O   . HOH D 4 .   ? 0.000   0.000  51.589 0.33 25.92  ? 433 HOH A O   1 
HETATM 1279 O  O   . HOH D 4 .   ? 15.547  11.780 56.391 1.00 27.74  ? 434 HOH A O   1 
HETATM 1280 O  O   . HOH D 4 .   ? 4.698   18.180 58.495 1.00 28.00  ? 435 HOH A O   1 
HETATM 1281 O  O   . HOH D 4 .   ? 11.920  12.655 29.722 1.00 22.42  ? 436 HOH A O   1 
HETATM 1282 O  O   . HOH D 4 .   ? 13.896  19.702 39.872 1.00 24.87  ? 437 HOH A O   1 
HETATM 1283 O  O   . HOH D 4 .   ? 13.326  22.410 40.655 1.00 30.06  ? 438 HOH A O   1 
HETATM 1284 O  O   . HOH D 4 .   ? 2.370   2.206  58.330 1.00 27.51  ? 439 HOH A O   1 
HETATM 1285 O  O   . HOH D 4 .   ? -8.339  16.305 35.120 1.00 27.68  ? 440 HOH A O   1 
HETATM 1286 O  O   . HOH D 4 .   ? 14.377  1.225  58.989 1.00 30.36  ? 441 HOH A O   1 
HETATM 1287 O  O   . HOH D 4 .   ? 15.915  13.715 50.404 1.00 24.70  ? 442 HOH A O   1 
HETATM 1288 O  O   . HOH D 4 .   ? 16.289  11.157 38.577 1.00 50.46  ? 443 HOH A O   1 
HETATM 1289 O  O   . HOH D 4 .   ? 9.509   -0.630 76.375 1.00 31.46  ? 444 HOH A O   1 
HETATM 1290 O  O   . HOH D 4 .   ? 3.964   8.314  69.544 1.00 35.63  ? 445 HOH A O   1 
HETATM 1291 O  O   . HOH D 4 .   ? -1.504  19.764 58.367 1.00 37.96  ? 446 HOH A O   1 
HETATM 1292 O  O   . HOH D 4 .   ? 17.355  8.079  43.464 1.00 27.50  ? 447 HOH A O   1 
HETATM 1293 O  O   . HOH D 4 .   ? 8.148   23.654 35.109 1.00 26.15  ? 448 HOH A O   1 
HETATM 1294 O  O   . HOH D 4 .   ? -0.917  23.482 36.868 1.00 28.15  ? 449 HOH A O   1 
HETATM 1295 O  O   . HOH D 4 .   ? -0.631  7.640  69.772 1.00 40.39  ? 450 HOH A O   1 
HETATM 1296 O  O   . HOH D 4 .   ? 15.042  17.708 37.730 1.00 26.34  ? 451 HOH A O   1 
HETATM 1297 O  O   . HOH D 4 .   ? 3.981   4.982  28.931 1.00 32.66  ? 452 HOH A O   1 
HETATM 1298 O  O   . HOH D 4 .   ? -8.810  20.305 35.448 1.00 31.24  ? 453 HOH A O   1 
HETATM 1299 O  O   . HOH D 4 .   ? 10.804  18.890 51.955 1.00 36.58  ? 454 HOH A O   1 
HETATM 1300 O  O   . HOH D 4 .   ? 13.326  9.930  60.461 1.00 36.26  ? 455 HOH A O   1 
HETATM 1301 O  O   . HOH D 4 .   ? -1.737  12.406 25.710 1.00 42.68  ? 456 HOH A O   1 
HETATM 1302 O  O   . HOH D 4 .   ? 16.076  15.062 52.845 1.00 28.67  ? 457 HOH A O   1 
HETATM 1303 O  O   . HOH D 4 .   ? 6.330   22.878 39.549 1.00 26.63  ? 458 HOH A O   1 
HETATM 1304 O  O   . HOH D 4 .   ? 6.506   24.106 37.252 1.00 44.58  ? 459 HOH A O   1 
HETATM 1305 O  O   . HOH D 4 .   ? -6.762  20.310 51.338 1.00 37.11  ? 460 HOH A O   1 
HETATM 1306 O  O   . HOH D 4 .   ? 3.126   4.372  30.973 1.00 36.09  ? 461 HOH A O   1 
HETATM 1307 O  O   . HOH D 4 .   ? -6.396  15.537 57.211 1.00 37.05  ? 462 HOH A O   1 
HETATM 1308 O  O   . HOH D 4 .   ? -0.298  25.018 52.481 1.00 44.25  ? 463 HOH A O   1 
HETATM 1309 O  O   . HOH D 4 .   ? 13.586  10.196 66.416 1.00 34.80  ? 464 HOH A O   1 
HETATM 1310 O  O   . HOH D 4 .   ? 0.000   0.000  58.663 0.33 49.72  ? 465 HOH A O   1 
HETATM 1311 O  O   . HOH D 4 .   ? -2.115  14.370 73.819 1.00 63.56  ? 466 HOH A O   1 
HETATM 1312 O  O   . HOH D 4 .   ? 1.092   20.885 51.489 1.00 31.90  ? 467 HOH A O   1 
HETATM 1313 O  O   . HOH D 4 .   ? 2.673   26.598 45.520 1.00 52.01  ? 468 HOH A O   1 
HETATM 1314 O  O   . HOH D 4 .   ? -0.067  7.387  75.481 1.00 41.74  ? 469 HOH A O   1 
HETATM 1315 O  O   . HOH D 4 .   ? -9.924  18.298 39.765 1.00 35.63  ? 470 HOH A O   1 
HETATM 1316 O  O   . HOH D 4 .   ? 5.047   15.199 25.273 1.00 36.58  ? 471 HOH A O   1 
HETATM 1317 O  O   . HOH D 4 .   ? 19.302  9.297  44.289 1.00 47.60  ? 472 HOH A O   1 
HETATM 1318 O  O   . HOH D 4 .   ? 0.984   8.217  72.663 1.00 42.46  ? 473 HOH A O   1 
HETATM 1319 O  O   . HOH D 4 .   ? -2.917  18.344 26.051 1.00 32.32  ? 474 HOH A O   1 
HETATM 1320 O  O   . HOH D 4 .   ? 14.848  -4.343 76.313 1.00 146.84 ? 475 HOH A O   1 
HETATM 1321 O  O   . HOH D 4 .   ? 9.893   11.300 21.411 1.00 37.34  ? 476 HOH A O   1 
HETATM 1322 O  O   . HOH D 4 .   ? 8.494   -3.084 76.373 1.00 33.97  ? 477 HOH A O   1 
HETATM 1323 O  O   . HOH D 4 .   ? 5.779   14.439 66.513 1.00 37.80  ? 478 HOH A O   1 
HETATM 1324 O  O   . HOH D 4 .   ? -7.729  14.344 64.137 1.00 56.32  ? 479 HOH A O   1 
HETATM 1325 O  O   . HOH D 4 .   ? -2.453  22.953 27.274 1.00 45.01  ? 480 HOH A O   1 
HETATM 1326 O  O   . HOH D 4 .   ? 18.135  8.378  56.383 1.00 43.65  ? 481 HOH A O   1 
HETATM 1327 O  O   . HOH D 4 .   ? 10.991  16.083 53.855 1.00 51.27  ? 482 HOH A O   1 
HETATM 1328 O  O   . HOH D 4 .   ? -2.480  27.816 45.174 1.00 40.69  ? 483 HOH A O   1 
HETATM 1329 O  O   . HOH D 4 .   ? 11.020  27.241 39.626 1.00 49.02  ? 484 HOH A O   1 
HETATM 1330 O  O   . HOH D 4 .   ? -8.353  21.042 27.907 1.00 53.48  ? 485 HOH A O   1 
HETATM 1331 O  O   . HOH D 4 .   ? 6.261   25.501 42.341 1.00 48.05  ? 486 HOH A O   1 
HETATM 1332 O  O   . HOH D 4 .   ? -3.717  21.482 29.481 1.00 28.28  ? 487 HOH A O   1 
HETATM 1333 O  O   . HOH D 4 .   ? 16.015  -3.564 73.113 1.00 32.71  ? 488 HOH A O   1 
HETATM 1334 O  O   . HOH D 4 .   ? 13.182  10.576 63.340 1.00 43.04  ? 489 HOH A O   1 
HETATM 1335 O  O   . HOH D 4 .   ? -3.229  17.461 58.686 1.00 34.90  ? 490 HOH A O   1 
HETATM 1336 O  O   . HOH D 4 .   ? -8.334  22.323 34.101 1.00 38.29  ? 491 HOH A O   1 
HETATM 1337 O  O   . HOH D 4 .   ? 16.231  14.238 55.362 1.00 43.97  ? 492 HOH A O   1 
HETATM 1338 O  O   . HOH D 4 .   ? -10.993 16.243 35.062 1.00 50.23  ? 493 HOH A O   1 
HETATM 1339 O  O   . HOH D 4 .   ? -8.452  15.741 54.499 1.00 47.86  ? 494 HOH A O   1 
HETATM 1340 O  O   . HOH D 4 .   ? -2.503  24.434 34.691 1.00 33.61  ? 495 HOH A O   1 
HETATM 1341 O  O   . HOH D 4 .   ? 5.329   -2.958 80.853 1.00 44.13  ? 496 HOH A O   1 
HETATM 1342 O  O   . HOH D 4 .   ? -9.134  18.220 52.998 1.00 44.00  ? 497 HOH A O   1 
HETATM 1343 O  O   . HOH D 4 .   ? -7.132  26.370 54.026 1.00 38.57  ? 498 HOH A O   1 
HETATM 1344 O  O   . HOH D 4 .   ? 16.065  25.011 40.176 1.00 39.47  ? 499 HOH A O   1 
HETATM 1345 O  O   . HOH D 4 .   ? -1.546  14.457 67.880 1.00 42.58  ? 500 HOH A O   1 
HETATM 1346 O  O   . HOH D 4 .   ? 1.650   9.766  24.811 1.00 49.34  ? 501 HOH A O   1 
HETATM 1347 O  O   . HOH D 4 .   ? 7.244   24.909 40.115 1.00 42.48  ? 502 HOH A O   1 
HETATM 1348 O  O   . HOH D 4 .   ? 13.081  21.708 45.175 1.00 51.19  ? 503 HOH A O   1 
HETATM 1349 O  O   . HOH D 4 .   ? -12.131 19.098 42.671 1.00 51.48  ? 504 HOH A O   1 
HETATM 1350 O  O   . HOH D 4 .   ? 15.153  14.179 38.439 1.00 42.41  ? 505 HOH A O   1 
HETATM 1351 O  O   . HOH D 4 .   ? -12.030 12.093 36.346 1.00 20.34  ? 506 HOH A O   1 
HETATM 1352 O  O   . HOH D 4 .   ? 0.122   28.004 41.635 1.00 46.23  ? 507 HOH A O   1 
HETATM 1353 O  O   . HOH D 4 .   ? 11.450  12.342 67.944 1.00 48.35  ? 508 HOH A O   1 
HETATM 1354 O  O   . HOH D 4 .   ? -0.278  1.360  77.923 0.50 22.47  ? 509 HOH A O   1 
HETATM 1355 O  O   . HOH D 4 .   ? -8.920  12.268 66.232 1.00 56.82  ? 510 HOH A O   1 
HETATM 1356 O  O   . HOH D 4 .   ? 1.193   17.136 24.387 1.00 49.28  ? 511 HOH A O   1 
HETATM 1357 O  O   . HOH D 4 .   ? 8.364   10.693 69.743 1.00 56.24  ? 512 HOH A O   1 
HETATM 1358 O  O   . HOH D 4 .   ? 0.226   3.722  28.595 1.00 49.83  ? 513 HOH A O   1 
HETATM 1359 O  O   . HOH D 4 .   ? 2.365   -0.182 65.876 1.00 36.66  ? 514 HOH A O   1 
HETATM 1360 O  O   . HOH D 4 .   ? 14.975  1.041  72.074 1.00 49.08  ? 515 HOH A O   1 
HETATM 1361 O  O   . HOH D 4 .   ? 7.172   14.976 26.882 1.00 25.70  ? 516 HOH A O   1 
HETATM 1362 O  O   . HOH D 4 .   ? 13.093  3.602  45.467 1.00 13.59  ? 517 HOH A O   1 
HETATM 1363 O  O   . HOH D 4 .   ? -5.608  22.955 32.921 1.00 32.50  ? 518 HOH A O   1 
HETATM 1364 O  O   . HOH D 4 .   ? -10.351 25.177 35.502 1.00 38.62  ? 519 HOH A O   1 
HETATM 1365 O  O   . HOH D 4 .   ? 7.877   14.566 67.443 1.00 47.14  ? 520 HOH A O   1 
HETATM 1366 O  O   . HOH D 4 .   ? -6.351  23.454 49.017 1.00 39.36  ? 521 HOH A O   1 
HETATM 1367 O  O   . HOH D 4 .   ? 9.429   3.982  76.622 1.00 49.34  ? 522 HOH A O   1 
HETATM 1368 O  O   . HOH D 4 .   ? 10.576  1.689  77.563 1.00 44.20  ? 523 HOH A O   1 
HETATM 1369 O  O   . HOH D 4 .   ? 10.841  22.260 52.936 1.00 51.34  ? 524 HOH A O   1 
HETATM 1370 O  O   . HOH D 4 .   ? 3.821   26.923 38.216 1.00 53.67  ? 525 HOH A O   1 
HETATM 1371 O  O   . HOH D 4 .   ? 3.187   14.477 67.225 1.00 61.08  ? 526 HOH A O   1 
HETATM 1372 O  O   . HOH D 4 .   ? 3.581   6.326  73.167 1.00 32.94  ? 527 HOH A O   1 
HETATM 1373 O  O   . HOH D 4 .   ? -10.520 14.110 53.060 1.00 44.20  ? 528 HOH A O   1 
HETATM 1374 O  O   . HOH D 4 .   ? -6.199  29.724 38.543 1.00 43.21  ? 529 HOH A O   1 
HETATM 1375 O  O   . HOH D 4 .   ? 0.917   1.210  56.852 1.00 54.94  ? 530 HOH A O   1 
HETATM 1376 O  O   . HOH D 4 .   ? -2.836  15.934 61.449 1.00 39.02  ? 531 HOH A O   1 
HETATM 1377 O  O   . HOH D 4 .   ? 1.328   19.336 59.854 1.00 45.17  ? 532 HOH A O   1 
HETATM 1378 O  O   . HOH D 4 .   ? -2.657  26.748 39.146 1.00 39.66  ? 533 HOH A O   1 
HETATM 1379 O  O   . HOH D 4 .   ? 12.726  14.664 57.484 1.00 40.47  ? 534 HOH A O   1 
HETATM 1380 O  O   . HOH D 4 .   ? 2.575   17.893 61.818 1.00 41.78  ? 535 HOH A O   1 
HETATM 1381 O  O   . HOH D 4 .   ? 14.433  21.860 50.586 1.00 54.80  ? 536 HOH A O   1 
HETATM 1382 O  O   . HOH D 4 .   ? -7.648  12.200 29.003 1.00 41.50  ? 537 HOH A O   1 
HETATM 1383 O  O   . HOH D 4 .   ? -3.419  9.965  27.212 1.00 39.57  ? 538 HOH A O   1 
HETATM 1384 O  O   . HOH D 4 .   ? 8.757   -0.273 79.747 1.00 51.89  ? 539 HOH A O   1 
HETATM 1385 O  O   . HOH D 4 .   ? 17.309  8.105  35.448 1.00 36.53  ? 540 HOH A O   1 
HETATM 1386 O  O   . HOH D 4 .   ? -14.730 29.811 46.161 1.00 46.78  ? 541 HOH A O   1 
HETATM 1387 O  O   . HOH D 4 .   ? -5.611  28.236 47.862 1.00 49.33  ? 542 HOH A O   1 
HETATM 1388 O  O   . HOH D 4 .   ? 0.966   1.565  31.453 1.00 50.43  ? 543 HOH A O   1 
HETATM 1389 O  O   . HOH D 4 .   ? 9.449   17.769 54.109 1.00 45.16  ? 544 HOH A O   1 
HETATM 1390 O  O   . HOH D 4 .   ? -11.098 27.955 52.562 1.00 48.32  ? 545 HOH A O   1 
HETATM 1391 O  O   . HOH D 4 .   ? 13.099  5.621  73.017 1.00 45.97  ? 546 HOH A O   1 
HETATM 1392 O  O   . HOH D 4 .   ? 19.737  3.803  51.796 1.00 60.27  ? 547 HOH A O   1 
HETATM 1393 O  O   . HOH D 4 .   ? 17.263  5.138  57.181 1.00 42.17  ? 548 HOH A O   1 
HETATM 1394 O  O   . HOH D 4 .   ? 16.140  2.362  58.047 1.00 43.10  ? 549 HOH A O   1 
HETATM 1395 O  O   . HOH D 4 .   ? 10.205  26.985 32.749 1.00 46.19  ? 550 HOH A O   1 
HETATM 1396 O  O   . HOH D 4 .   ? -6.370  11.275 27.258 1.00 48.31  ? 551 HOH A O   1 
HETATM 1397 O  O   . HOH D 4 .   ? -0.506  16.383 63.076 1.00 43.67  ? 552 HOH A O   1 
HETATM 1398 O  O   . HOH D 4 .   ? 20.702  2.192  55.362 1.00 54.77  ? 553 HOH A O   1 
HETATM 1399 O  O   . HOH D 4 .   ? 13.641  -3.335 71.906 1.00 58.48  ? 554 HOH A O   1 
HETATM 1400 O  O   . HOH D 4 .   ? -11.895 11.707 33.932 1.00 28.88  ? 555 HOH A O   1 
HETATM 1401 O  O   . HOH D 4 .   ? 16.051  12.404 36.667 1.00 43.23  ? 556 HOH A O   1 
HETATM 1402 O  O   . HOH D 4 .   ? -9.120  15.868 32.249 1.00 34.06  ? 557 HOH A O   1 
HETATM 1403 O  O   . HOH D 4 .   ? 1.996   10.308 82.413 1.00 43.91  ? 558 HOH A O   1 
HETATM 1404 O  O   . HOH D 4 .   ? 15.011  12.356 32.955 0.50 42.74  ? 559 HOH A O   1 
HETATM 1405 O  O   . HOH D 4 .   ? 6.590   6.688  75.154 1.00 52.51  ? 560 HOH A O   1 
HETATM 1406 O  O   . HOH D 4 .   ? 9.627   11.929 83.600 1.00 52.12  ? 561 HOH A O   1 
HETATM 1407 O  O   . HOH D 4 .   ? -13.664 17.519 48.602 1.00 51.15  ? 562 HOH A O   1 
HETATM 1408 O  O   . HOH D 4 .   ? -5.682  19.300 62.692 1.00 50.40  ? 563 HOH A O   1 
HETATM 1409 O  O   . HOH D 4 .   ? -12.395 18.097 46.155 1.00 45.50  ? 564 HOH A O   1 
HETATM 1410 O  O   . HOH D 4 .   ? 18.811  5.775  32.955 0.25 24.12  ? 565 HOH A O   1 
HETATM 1411 O  O   . HOH D 4 .   ? -6.611  34.635 36.435 1.00 53.33  ? 566 HOH A O   1 
HETATM 1412 O  O   . HOH D 4 .   ? -10.180 10.713 64.850 1.00 54.64  ? 567 HOH A O   1 
HETATM 1413 O  O   . HOH D 4 .   ? -7.195  14.085 30.700 1.00 54.32  ? 568 HOH A O   1 
HETATM 1414 O  O   . HOH D 4 .   ? -2.411  19.910 22.856 1.00 49.38  ? 569 HOH A O   1 
HETATM 1415 O  O   . HOH D 4 .   ? -3.071  28.164 41.697 1.00 52.80  ? 570 HOH A O   1 
HETATM 1416 O  O   . HOH D 4 .   ? -12.094 31.928 39.236 1.00 62.10  ? 571 HOH A O   1 
HETATM 1417 O  O   . HOH D 4 .   ? -11.985 13.955 34.408 1.00 41.91  ? 572 HOH A O   1 
HETATM 1418 O  O   . HOH D 4 .   ? -9.258  20.322 55.009 1.00 51.39  ? 573 HOH A O   1 
HETATM 1419 O  O   . HOH D 4 .   ? 7.685   14.372 82.659 1.00 54.64  ? 574 HOH A O   1 
HETATM 1420 O  O   . HOH D 4 .   ? -4.673  17.368 64.557 1.00 58.14  ? 575 HOH A O   1 
HETATM 1421 O  O   . HOH D 4 .   ? -9.135  19.933 50.981 1.00 55.09  ? 576 HOH A O   1 
HETATM 1422 O  O   . HOH D 4 .   ? -4.731  36.008 38.147 1.00 64.53  ? 577 HOH A O   1 
HETATM 1423 O  O   . HOH D 4 .   ? -5.059  7.618  24.634 1.00 58.98  ? 578 HOH A O   1 
HETATM 1424 O  O   . HOH D 4 .   ? -5.759  18.894 60.003 1.00 48.53  ? 579 HOH A O   1 
HETATM 1425 O  O   . HOH D 4 .   ? 1.463   26.446 34.441 1.00 55.71  ? 580 HOH A O   1 
HETATM 1426 O  O   . HOH D 4 .   ? -2.400  24.853 30.767 1.00 58.40  ? 581 HOH A O   1 
HETATM 1427 O  O   . HOH D 4 .   ? 17.746  1.745  39.036 1.00 50.01  ? 582 HOH A O   1 
HETATM 1428 O  O   . HOH D 4 .   ? -9.052  28.027 53.579 1.00 57.27  ? 583 HOH A O   1 
HETATM 1429 O  O   . HOH D 4 .   ? 15.495  25.739 43.292 1.00 52.78  ? 584 HOH A O   1 
HETATM 1430 O  O   . HOH D 4 .   ? 13.795  4.133  75.124 1.00 50.57  ? 585 HOH A O   1 
HETATM 1431 O  O   . HOH D 4 .   ? 26.698  3.938  58.654 1.00 53.59  ? 586 HOH A O   1 
HETATM 1432 O  O   . HOH D 4 .   ? -7.012  23.891 54.266 1.00 53.94  ? 587 HOH A O   1 
HETATM 1433 O  O   . HOH D 4 .   ? 21.112  1.641  50.925 1.00 56.30  ? 588 HOH A O   1 
HETATM 1434 O  O   . HOH D 4 .   ? 2.146   28.699 39.972 1.00 54.29  ? 589 HOH A O   1 
HETATM 1435 O  O   . HOH D 4 .   ? 1.598   28.238 43.380 1.00 66.57  ? 590 HOH A O   1 
HETATM 1436 O  O   . HOH D 4 .   ? 7.539   8.140  77.110 1.00 64.47  ? 591 HOH A O   1 
HETATM 1437 O  O   . HOH D 4 .   ? -6.059  16.872 62.304 1.00 55.62  ? 592 HOH A O   1 
HETATM 1438 O  O   . HOH D 4 .   ? 0.000   38.356 31.973 0.33 90.01  ? 593 HOH A O   1 
HETATM 1439 O  O   . HOH D 4 .   ? 13.671  -1.204 60.015 1.00 80.19  ? 594 HOH A O   1 
HETATM 1440 O  O   . HOH D 4 .   ? 6.238   -0.445 81.424 1.00 155.70 ? 595 HOH A O   1 
HETATM 1441 O  O   . HOH D 4 .   ? 11.024  29.039 45.750 1.00 56.28  ? 596 HOH A O   1 
HETATM 1442 O  O   . HOH D 4 .   ? 10.126  25.337 34.495 1.00 57.42  ? 597 HOH A O   1 
HETATM 1443 O  O   . HOH D 4 .   ? 4.416   26.946 40.735 1.00 66.61  ? 598 HOH A O   1 
HETATM 1444 O  O   . HOH D 4 .   ? 10.851  4.590  23.939 1.00 57.55  ? 599 HOH A O   1 
HETATM 1445 O  O   . HOH D 4 .   ? -2.188  17.183 66.291 1.00 64.99  ? 600 HOH A O   1 
HETATM 1446 O  O   . HOH D 4 .   ? -13.035 20.356 48.884 1.00 103.75 ? 601 HOH A O   1 
HETATM 1447 O  O   . HOH D 4 .   ? 10.650  29.264 41.617 1.00 62.92  ? 602 HOH A O   1 
HETATM 1448 O  O   . HOH D 4 .   ? 0.000   38.356 25.925 0.33 73.18  ? 603 HOH A O   1 
HETATM 1449 O  O   . HOH D 4 .   ? 8.010   26.676 36.709 1.00 53.20  ? 604 HOH A O   1 
HETATM 1450 O  O   . HOH D 4 .   ? -3.460  4.756  23.762 1.00 94.44  ? 605 HOH A O   1 
HETATM 1451 O  O   . HOH D 4 .   ? -7.953  31.484 37.558 1.00 57.37  ? 606 HOH A O   1 
HETATM 1452 O  O   . HOH D 4 .   ? 15.281  10.812 78.000 1.00 61.77  ? 607 HOH A O   1 
HETATM 1453 O  O   . HOH D 4 .   ? 14.695  7.860  64.681 1.00 92.06  ? 608 HOH A O   1 
HETATM 1454 O  O   . HOH D 4 .   ? -2.464  18.998 62.996 1.00 83.81  ? 609 HOH A O   1 
HETATM 1455 O  O   . HOH D 4 .   ? 8.382   12.501 68.284 1.00 97.35  ? 610 HOH A O   1 
HETATM 1456 O  O   . HOH D 4 .   ? 0.000   38.356 28.871 0.33 81.57  ? 611 HOH A O   1 
HETATM 1457 O  O   . HOH D 4 .   ? -6.415  28.690 35.411 1.00 75.24  ? 612 HOH A O   1 
HETATM 1458 O  O   . HOH D 4 .   ? 24.864  3.456  52.502 1.00 59.90  ? 613 HOH A O   1 
HETATM 1459 O  O   . HOH D 4 .   ? 23.960  7.717  40.940 1.00 61.01  ? 614 HOH A O   1 
HETATM 1460 O  O   . HOH D 4 .   ? 13.872  16.725 53.733 1.00 54.58  ? 615 HOH A O   1 
HETATM 1461 O  O   . HOH D 4 .   ? 12.803  18.205 56.913 1.00 124.16 ? 616 HOH A O   1 
HETATM 1462 O  O   . HOH D 4 .   ? 10.604  23.609 45.796 1.00 65.98  ? 617 HOH A O   1 
HETATM 1463 O  O   . HOH D 4 .   ? -16.963 31.942 41.811 1.00 48.23  ? 618 HOH A O   1 
HETATM 1464 O  O   . HOH D 4 .   ? 7.890   30.534 46.731 1.00 52.00  ? 619 HOH A O   1 
HETATM 1465 O  O   . HOH D 4 .   ? -8.433  15.129 61.522 1.00 81.08  ? 620 HOH A O   1 
HETATM 1466 O  O   . HOH D 4 .   ? 8.288   21.352 53.294 1.00 49.97  ? 621 HOH A O   1 
HETATM 1467 O  O   . HOH D 4 .   ? -0.645  18.458 22.545 1.00 67.58  ? 622 HOH A O   1 
HETATM 1468 O  O   . HOH D 4 .   ? -9.675  13.070 62.457 1.00 58.37  ? 623 HOH A O   1 
HETATM 1469 O  O   . HOH D 4 .   ? -6.040  33.084 40.233 1.00 106.07 ? 624 HOH A O   1 
HETATM 1470 O  O   . HOH D 4 .   ? -4.843  2.827  27.836 1.00 66.84  ? 625 HOH A O   1 
HETATM 1471 O  O   . HOH D 4 .   ? 16.082  12.508 58.503 1.00 80.04  ? 626 HOH A O   1 
HETATM 1472 O  O   . HOH D 4 .   ? 21.394  13.049 51.493 1.00 80.91  ? 627 HOH A O   1 
HETATM 1473 O  O   . HOH D 4 .   ? 2.178   5.940  26.070 1.00 73.79  ? 628 HOH A O   1 
HETATM 1474 O  O   . HOH D 4 .   ? 16.287  10.322 67.488 1.00 58.35  ? 629 HOH A O   1 
HETATM 1475 O  O   . HOH D 4 .   ? 24.040  4.159  56.335 1.00 68.12  ? 630 HOH A O   1 
HETATM 1476 O  O   . HOH D 4 .   ? -6.770  13.976 22.021 1.00 56.86  ? 631 HOH A O   1 
HETATM 1477 O  O   . HOH D 4 .   ? -10.072 14.792 29.425 1.00 120.28 ? 632 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   91  ?   ?   ?   A . n 
A 1 2   ILE 2   92  ?   ?   ?   A . n 
A 1 3   LEU 3   93  ?   ?   ?   A . n 
A 1 4   ARG 4   94  ?   ?   ?   A . n 
A 1 5   THR 5   95  ?   ?   ?   A . n 
A 1 6   SER 6   96  ?   ?   ?   A . n 
A 1 7   GLU 7   97  ?   ?   ?   A . n 
A 1 8   GLU 8   98  ?   ?   ?   A . n 
A 1 9   THR 9   99  ?   ?   ?   A . n 
A 1 10  ILE 10  100 ?   ?   ?   A . n 
A 1 11  SER 11  101 ?   ?   ?   A . n 
A 1 12  THR 12  102 ?   ?   ?   A . n 
A 1 13  VAL 13  103 ?   ?   ?   A . n 
A 1 14  GLN 14  104 ?   ?   ?   A . n 
A 1 15  GLU 15  105 ?   ?   ?   A . n 
A 1 16  LYS 16  106 ?   ?   ?   A . n 
A 1 17  GLN 17  107 ?   ?   ?   A . n 
A 1 18  GLN 18  108 ?   ?   ?   A . n 
A 1 19  ASN 19  109 ?   ?   ?   A . n 
A 1 20  ILE 20  110 ?   ?   ?   A . n 
A 1 21  SER 21  111 ?   ?   ?   A . n 
A 1 22  PRO 22  112 ?   ?   ?   A . n 
A 1 23  LEU 23  113 ?   ?   ?   A . n 
A 1 24  VAL 24  114 ?   ?   ?   A . n 
A 1 25  ARG 25  115 ?   ?   ?   A . n 
A 1 26  GLU 26  116 ?   ?   ?   A . n 
A 1 27  ARG 27  117 ?   ?   ?   A . n 
A 1 28  GLY 28  118 ?   ?   ?   A . n 
A 1 29  PRO 29  119 ?   ?   ?   A . n 
A 1 30  GLN 30  120 120 GLN GLN A . n 
A 1 31  ARG 31  121 121 ARG ARG A . n 
A 1 32  VAL 32  122 122 VAL VAL A . n 
A 1 33  ALA 33  123 123 ALA ALA A . n 
A 1 34  ALA 34  124 124 ALA ALA A . n 
A 1 35  HIS 35  125 125 HIS HIS A . n 
A 1 36  ILE 36  126 126 ILE ILE A . n 
A 1 37  THR 37  127 127 THR THR A . n 
A 1 38  GLY 38  128 128 GLY GLY A . n 
A 1 39  THR 39  129 129 THR THR A . n 
A 1 40  ARG 40  130 130 ARG ARG A . n 
A 1 41  GLY 41  131 ?   ?   ?   A . n 
A 1 42  ARG 42  132 ?   ?   ?   A . n 
A 1 43  SER 43  133 ?   ?   ?   A . n 
A 1 44  ASN 44  134 ?   ?   ?   A . n 
A 1 45  THR 45  135 ?   ?   ?   A . n 
A 1 46  LEU 46  136 ?   ?   ?   A . n 
A 1 47  SER 47  137 ?   ?   ?   A . n 
A 1 48  SER 48  138 ?   ?   ?   A . n 
A 1 49  PRO 49  139 ?   ?   ?   A . n 
A 1 50  ASN 50  140 ?   ?   ?   A . n 
A 1 51  SER 51  141 ?   ?   ?   A . n 
A 1 52  LYS 52  142 142 LYS LYS A . n 
A 1 53  ASN 53  143 143 ASN ASN A . n 
A 1 54  GLU 54  144 144 GLU GLU A . n 
A 1 55  LYS 55  145 145 LYS LYS A . n 
A 1 56  ALA 56  146 146 ALA ALA A . n 
A 1 57  LEU 57  147 147 LEU LEU A . n 
A 1 58  GLY 58  148 148 GLY GLY A . n 
A 1 59  ARG 59  149 149 ARG ARG A . n 
A 1 60  LYS 60  150 150 LYS LYS A . n 
A 1 61  ILE 61  151 151 ILE ILE A . n 
A 1 62  ASN 62  152 152 ASN ASN A . n 
A 1 63  SER 63  153 153 SER SER A . n 
A 1 64  TRP 64  154 154 TRP TRP A . n 
A 1 65  GLU 65  155 155 GLU GLU A . n 
A 1 66  SER 66  156 156 SER SER A . n 
A 1 67  SER 67  157 157 SER SER A . n 
A 1 68  ARG 68  158 158 ARG ARG A . n 
A 1 69  SER 69  159 159 SER SER A . n 
A 1 70  GLY 70  160 160 GLY GLY A . n 
A 1 71  HIS 71  161 161 HIS HIS A . n 
A 1 72  SER 72  162 162 SER SER A . n 
A 1 73  PHE 73  163 163 PHE PHE A . n 
A 1 74  LEU 74  164 164 LEU LEU A . n 
A 1 75  SER 75  165 165 SER SER A . n 
A 1 76  ASN 76  166 166 ASN ASN A . n 
A 1 77  LEU 77  167 167 LEU LEU A . n 
A 1 78  HIS 78  168 168 HIS HIS A . n 
A 1 79  LEU 79  169 169 LEU LEU A . n 
A 1 80  ARG 80  170 170 ARG ARG A . n 
A 1 81  ASN 81  171 171 ASN ASN A . n 
A 1 82  GLY 82  172 172 GLY GLY A . n 
A 1 83  GLU 83  173 173 GLU GLU A . n 
A 1 84  LEU 84  174 174 LEU LEU A . n 
A 1 85  VAL 85  175 175 VAL VAL A . n 
A 1 86  ILE 86  176 176 ILE ILE A . n 
A 1 87  HIS 87  177 177 HIS HIS A . n 
A 1 88  GLU 88  178 178 GLU GLU A . n 
A 1 89  LYS 89  179 179 LYS LYS A . n 
A 1 90  GLY 90  180 180 GLY GLY A . n 
A 1 91  PHE 91  181 181 PHE PHE A . n 
A 1 92  TYR 92  182 182 TYR TYR A . n 
A 1 93  TYR 93  183 183 TYR TYR A . n 
A 1 94  ILE 94  184 184 ILE ILE A . n 
A 1 95  TYR 95  185 185 TYR TYR A . n 
A 1 96  SER 96  186 186 SER SER A . n 
A 1 97  GLN 97  187 187 GLN GLN A . n 
A 1 98  THR 98  188 188 THR THR A . n 
A 1 99  TYR 99  189 189 TYR TYR A . n 
A 1 100 PHE 100 190 190 PHE PHE A . n 
A 1 101 ARG 101 191 191 ARG ARG A . n 
A 1 102 PHE 102 192 192 PHE PHE A . n 
A 1 103 GLN 103 193 193 GLN GLN A . n 
A 1 104 GLU 104 194 194 GLU GLU A . n 
A 1 105 GLU 105 195 ?   ?   ?   A . n 
A 1 106 ILE 106 196 ?   ?   ?   A . n 
A 1 107 LYS 107 197 197 LYS LYS A . n 
A 1 108 GLU 108 198 198 GLU GLU A . n 
A 1 109 ASN 109 199 199 ASN ASN A . n 
A 1 110 THR 110 200 200 THR THR A . n 
A 1 111 LYS 111 201 201 LYS LYS A . n 
A 1 112 ASN 112 202 202 ASN ASN A . n 
A 1 113 ASP 113 203 203 ASP ASP A . n 
A 1 114 LYS 114 204 204 LYS LYS A . n 
A 1 115 GLN 115 205 205 GLN GLN A . n 
A 1 116 MET 116 206 206 MET MET A . n 
A 1 117 VAL 117 207 207 VAL VAL A . n 
A 1 118 GLN 118 208 208 GLN GLN A . n 
A 1 119 TYR 119 209 209 TYR TYR A . n 
A 1 120 ILE 120 210 210 ILE ILE A . n 
A 1 121 TYR 121 211 211 TYR TYR A . n 
A 1 122 LYS 122 212 212 LYS LYS A . n 
A 1 123 TYR 123 213 213 TYR TYR A . n 
A 1 124 THR 124 214 214 THR THR A . n 
A 1 125 SER 125 215 215 SER SER A . n 
A 1 126 TYR 126 216 216 TYR TYR A . n 
A 1 127 PRO 127 217 217 PRO PRO A . n 
A 1 128 ALA 128 218 218 ALA ALA A . n 
A 1 129 PRO 129 219 219 PRO PRO A . n 
A 1 130 ILE 130 220 220 ILE ILE A . n 
A 1 131 LEU 131 221 221 LEU LEU A . n 
A 1 132 LEU 132 222 222 LEU LEU A . n 
A 1 133 MET 133 223 223 MET MET A . n 
A 1 134 LYS 134 224 224 LYS LYS A . n 
A 1 135 SER 135 225 225 SER SER A . n 
A 1 136 ALA 136 226 226 ALA ALA A . n 
A 1 137 ARG 137 227 227 ARG ARG A . n 
A 1 138 ASN 138 228 228 ASN ASN A . n 
A 1 139 SER 139 229 229 SER SER A . n 
A 1 140 CYS 140 230 230 CYS CYS A . n 
A 1 141 TRP 141 231 231 TRP TRP A . n 
A 1 142 SER 142 232 232 SER SER A . n 
A 1 143 LYS 143 233 233 LYS LYS A . n 
A 1 144 ASP 144 234 234 ASP ASP A . n 
A 1 145 ALA 145 235 235 ALA ALA A . n 
A 1 146 GLU 146 236 236 GLU GLU A . n 
A 1 147 TYR 147 237 237 TYR TYR A . n 
A 1 148 GLY 148 238 238 GLY GLY A . n 
A 1 149 LEU 149 239 239 LEU LEU A . n 
A 1 150 TYR 150 240 240 TYR TYR A . n 
A 1 151 SER 151 241 241 SER SER A . n 
A 1 152 ILE 152 242 242 ILE ILE A . n 
A 1 153 TYR 153 243 243 TYR TYR A . n 
A 1 154 GLN 154 244 244 GLN GLN A . n 
A 1 155 GLY 155 245 245 GLY GLY A . n 
A 1 156 GLY 156 246 246 GLY GLY A . n 
A 1 157 ILE 157 247 247 ILE ILE A . n 
A 1 158 PHE 158 248 248 PHE PHE A . n 
A 1 159 GLU 159 249 249 GLU GLU A . n 
A 1 160 LEU 160 250 250 LEU LEU A . n 
A 1 161 LYS 161 251 251 LYS LYS A . n 
A 1 162 GLU 162 252 252 GLU GLU A . n 
A 1 163 ASN 163 253 253 ASN ASN A . n 
A 1 164 ASP 164 254 254 ASP ASP A . n 
A 1 165 ARG 165 255 255 ARG ARG A . n 
A 1 166 ILE 166 256 256 ILE ILE A . n 
A 1 167 PHE 167 257 257 PHE PHE A . n 
A 1 168 VAL 168 258 258 VAL VAL A . n 
A 1 169 SER 169 259 259 SER SER A . n 
A 1 170 VAL 170 260 260 VAL VAL A . n 
A 1 171 THR 171 261 261 THR THR A . n 
A 1 172 ASN 172 262 262 ASN ASN A . n 
A 1 173 GLU 173 263 263 GLU GLU A . n 
A 1 174 HIS 174 264 264 HIS HIS A . n 
A 1 175 LEU 175 265 265 LEU LEU A . n 
A 1 176 ILE 176 266 266 ILE ILE A . n 
A 1 177 ASP 177 267 267 ASP ASP A . n 
A 1 178 MET 178 268 268 MET MET A . n 
A 1 179 ASP 179 269 269 ASP ASP A . n 
A 1 180 HIS 180 270 270 HIS HIS A . n 
A 1 181 GLU 181 271 271 GLU GLU A . n 
A 1 182 ALA 182 272 272 ALA ALA A . n 
A 1 183 SER 183 273 273 SER SER A . n 
A 1 184 PHE 184 274 274 PHE PHE A . n 
A 1 185 PHE 185 275 275 PHE PHE A . n 
A 1 186 GLY 186 276 276 GLY GLY A . n 
A 1 187 ALA 187 277 277 ALA ALA A . n 
A 1 188 PHE 188 278 278 PHE PHE A . n 
A 1 189 LEU 189 279 279 LEU LEU A . n 
A 1 190 VAL 190 280 280 VAL VAL A . n 
A 1 191 GLY 191 281 281 GLY GLY A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   300 300 ZN  ZN  A . 
C 3 CL  1   406 406 CL  CL  A . 
D 4 HOH 1   407 1   HOH HOH A . 
D 4 HOH 2   408 2   HOH HOH A . 
D 4 HOH 3   409 3   HOH HOH A . 
D 4 HOH 4   410 4   HOH HOH A . 
D 4 HOH 5   411 5   HOH HOH A . 
D 4 HOH 6   412 6   HOH HOH A . 
D 4 HOH 7   413 7   HOH HOH A . 
D 4 HOH 8   414 8   HOH HOH A . 
D 4 HOH 9   415 9   HOH HOH A . 
D 4 HOH 10  416 10  HOH HOH A . 
D 4 HOH 11  417 11  HOH HOH A . 
D 4 HOH 12  418 12  HOH HOH A . 
D 4 HOH 13  419 13  HOH HOH A . 
D 4 HOH 14  420 14  HOH HOH A . 
D 4 HOH 15  421 15  HOH HOH A . 
D 4 HOH 16  422 16  HOH HOH A . 
D 4 HOH 17  423 17  HOH HOH A . 
D 4 HOH 18  424 18  HOH HOH A . 
D 4 HOH 19  425 19  HOH HOH A . 
D 4 HOH 20  426 20  HOH HOH A . 
D 4 HOH 21  427 21  HOH HOH A . 
D 4 HOH 22  428 22  HOH HOH A . 
D 4 HOH 23  429 23  HOH HOH A . 
D 4 HOH 24  430 24  HOH HOH A . 
D 4 HOH 25  431 25  HOH HOH A . 
D 4 HOH 26  432 26  HOH HOH A . 
D 4 HOH 27  433 27  HOH HOH A . 
D 4 HOH 28  434 28  HOH HOH A . 
D 4 HOH 29  435 29  HOH HOH A . 
D 4 HOH 30  436 30  HOH HOH A . 
D 4 HOH 31  437 31  HOH HOH A . 
D 4 HOH 32  438 32  HOH HOH A . 
D 4 HOH 33  439 33  HOH HOH A . 
D 4 HOH 34  440 34  HOH HOH A . 
D 4 HOH 35  441 35  HOH HOH A . 
D 4 HOH 36  442 36  HOH HOH A . 
D 4 HOH 37  443 37  HOH HOH A . 
D 4 HOH 38  444 38  HOH HOH A . 
D 4 HOH 39  445 39  HOH HOH A . 
D 4 HOH 40  446 40  HOH HOH A . 
D 4 HOH 41  447 41  HOH HOH A . 
D 4 HOH 42  448 42  HOH HOH A . 
D 4 HOH 43  449 43  HOH HOH A . 
D 4 HOH 44  450 44  HOH HOH A . 
D 4 HOH 45  451 45  HOH HOH A . 
D 4 HOH 46  452 46  HOH HOH A . 
D 4 HOH 47  453 47  HOH HOH A . 
D 4 HOH 48  454 48  HOH HOH A . 
D 4 HOH 49  455 49  HOH HOH A . 
D 4 HOH 50  456 50  HOH HOH A . 
D 4 HOH 51  457 51  HOH HOH A . 
D 4 HOH 52  458 52  HOH HOH A . 
D 4 HOH 53  459 53  HOH HOH A . 
D 4 HOH 54  460 54  HOH HOH A . 
D 4 HOH 55  461 55  HOH HOH A . 
D 4 HOH 56  462 56  HOH HOH A . 
D 4 HOH 57  463 57  HOH HOH A . 
D 4 HOH 58  464 58  HOH HOH A . 
D 4 HOH 59  465 59  HOH HOH A . 
D 4 HOH 60  466 60  HOH HOH A . 
D 4 HOH 61  467 61  HOH HOH A . 
D 4 HOH 62  468 62  HOH HOH A . 
D 4 HOH 63  469 63  HOH HOH A . 
D 4 HOH 64  470 64  HOH HOH A . 
D 4 HOH 65  471 65  HOH HOH A . 
D 4 HOH 66  472 66  HOH HOH A . 
D 4 HOH 67  473 67  HOH HOH A . 
D 4 HOH 68  474 68  HOH HOH A . 
D 4 HOH 69  475 69  HOH HOH A . 
D 4 HOH 70  476 70  HOH HOH A . 
D 4 HOH 71  477 71  HOH HOH A . 
D 4 HOH 72  478 72  HOH HOH A . 
D 4 HOH 73  479 73  HOH HOH A . 
D 4 HOH 74  480 74  HOH HOH A . 
D 4 HOH 75  481 75  HOH HOH A . 
D 4 HOH 76  482 76  HOH HOH A . 
D 4 HOH 77  483 77  HOH HOH A . 
D 4 HOH 78  484 78  HOH HOH A . 
D 4 HOH 79  485 79  HOH HOH A . 
D 4 HOH 80  486 80  HOH HOH A . 
D 4 HOH 81  487 81  HOH HOH A . 
D 4 HOH 82  488 82  HOH HOH A . 
D 4 HOH 83  489 83  HOH HOH A . 
D 4 HOH 84  490 84  HOH HOH A . 
D 4 HOH 85  491 85  HOH HOH A . 
D 4 HOH 86  492 86  HOH HOH A . 
D 4 HOH 87  493 87  HOH HOH A . 
D 4 HOH 88  494 88  HOH HOH A . 
D 4 HOH 89  495 89  HOH HOH A . 
D 4 HOH 90  496 90  HOH HOH A . 
D 4 HOH 91  497 91  HOH HOH A . 
D 4 HOH 92  498 92  HOH HOH A . 
D 4 HOH 93  499 93  HOH HOH A . 
D 4 HOH 94  500 94  HOH HOH A . 
D 4 HOH 95  501 95  HOH HOH A . 
D 4 HOH 96  502 96  HOH HOH A . 
D 4 HOH 97  503 97  HOH HOH A . 
D 4 HOH 98  504 98  HOH HOH A . 
D 4 HOH 99  505 99  HOH HOH A . 
D 4 HOH 100 506 100 HOH HOH A . 
D 4 HOH 101 507 101 HOH HOH A . 
D 4 HOH 102 508 102 HOH HOH A . 
D 4 HOH 103 509 103 HOH HOH A . 
D 4 HOH 104 510 104 HOH HOH A . 
D 4 HOH 105 511 105 HOH HOH A . 
D 4 HOH 106 512 106 HOH HOH A . 
D 4 HOH 107 513 107 HOH HOH A . 
D 4 HOH 108 514 108 HOH HOH A . 
D 4 HOH 109 515 109 HOH HOH A . 
D 4 HOH 110 516 110 HOH HOH A . 
D 4 HOH 111 517 111 HOH HOH A . 
D 4 HOH 112 518 112 HOH HOH A . 
D 4 HOH 113 519 113 HOH HOH A . 
D 4 HOH 114 520 114 HOH HOH A . 
D 4 HOH 115 521 115 HOH HOH A . 
D 4 HOH 116 522 116 HOH HOH A . 
D 4 HOH 117 523 117 HOH HOH A . 
D 4 HOH 118 524 118 HOH HOH A . 
D 4 HOH 119 525 119 HOH HOH A . 
D 4 HOH 120 526 120 HOH HOH A . 
D 4 HOH 121 527 121 HOH HOH A . 
D 4 HOH 122 528 122 HOH HOH A . 
D 4 HOH 123 529 123 HOH HOH A . 
D 4 HOH 124 530 124 HOH HOH A . 
D 4 HOH 125 531 125 HOH HOH A . 
D 4 HOH 126 532 126 HOH HOH A . 
D 4 HOH 127 533 127 HOH HOH A . 
D 4 HOH 128 534 128 HOH HOH A . 
D 4 HOH 129 535 129 HOH HOH A . 
D 4 HOH 130 536 130 HOH HOH A . 
D 4 HOH 131 537 131 HOH HOH A . 
D 4 HOH 132 538 132 HOH HOH A . 
D 4 HOH 133 539 133 HOH HOH A . 
D 4 HOH 134 540 134 HOH HOH A . 
D 4 HOH 135 541 135 HOH HOH A . 
D 4 HOH 136 542 136 HOH HOH A . 
D 4 HOH 137 543 137 HOH HOH A . 
D 4 HOH 138 544 138 HOH HOH A . 
D 4 HOH 139 545 139 HOH HOH A . 
D 4 HOH 140 546 140 HOH HOH A . 
D 4 HOH 141 547 141 HOH HOH A . 
D 4 HOH 142 548 142 HOH HOH A . 
D 4 HOH 143 549 143 HOH HOH A . 
D 4 HOH 144 550 144 HOH HOH A . 
D 4 HOH 145 551 145 HOH HOH A . 
D 4 HOH 146 552 146 HOH HOH A . 
D 4 HOH 147 553 147 HOH HOH A . 
D 4 HOH 148 554 148 HOH HOH A . 
D 4 HOH 149 555 149 HOH HOH A . 
D 4 HOH 150 556 150 HOH HOH A . 
D 4 HOH 151 557 151 HOH HOH A . 
D 4 HOH 152 558 152 HOH HOH A . 
D 4 HOH 153 559 153 HOH HOH A . 
D 4 HOH 154 560 154 HOH HOH A . 
D 4 HOH 155 561 155 HOH HOH A . 
D 4 HOH 156 562 156 HOH HOH A . 
D 4 HOH 157 563 157 HOH HOH A . 
D 4 HOH 158 564 158 HOH HOH A . 
D 4 HOH 159 565 159 HOH HOH A . 
D 4 HOH 160 566 160 HOH HOH A . 
D 4 HOH 161 567 161 HOH HOH A . 
D 4 HOH 162 568 162 HOH HOH A . 
D 4 HOH 163 569 163 HOH HOH A . 
D 4 HOH 164 570 164 HOH HOH A . 
D 4 HOH 165 571 165 HOH HOH A . 
D 4 HOH 166 572 166 HOH HOH A . 
D 4 HOH 167 573 167 HOH HOH A . 
D 4 HOH 168 574 168 HOH HOH A . 
D 4 HOH 169 575 169 HOH HOH A . 
D 4 HOH 170 576 170 HOH HOH A . 
D 4 HOH 171 577 171 HOH HOH A . 
D 4 HOH 172 578 172 HOH HOH A . 
D 4 HOH 173 579 173 HOH HOH A . 
D 4 HOH 174 580 174 HOH HOH A . 
D 4 HOH 175 581 175 HOH HOH A . 
D 4 HOH 176 582 176 HOH HOH A . 
D 4 HOH 177 583 177 HOH HOH A . 
D 4 HOH 178 584 178 HOH HOH A . 
D 4 HOH 179 585 179 HOH HOH A . 
D 4 HOH 180 586 180 HOH HOH A . 
D 4 HOH 181 587 181 HOH HOH A . 
D 4 HOH 182 588 182 HOH HOH A . 
D 4 HOH 183 589 183 HOH HOH A . 
D 4 HOH 184 590 184 HOH HOH A . 
D 4 HOH 185 591 185 HOH HOH A . 
D 4 HOH 186 592 186 HOH HOH A . 
D 4 HOH 187 593 187 HOH HOH A . 
D 4 HOH 188 594 188 HOH HOH A . 
D 4 HOH 189 595 189 HOH HOH A . 
D 4 HOH 190 596 190 HOH HOH A . 
D 4 HOH 191 597 191 HOH HOH A . 
D 4 HOH 192 598 192 HOH HOH A . 
D 4 HOH 193 599 193 HOH HOH A . 
D 4 HOH 194 600 194 HOH HOH A . 
D 4 HOH 195 601 195 HOH HOH A . 
D 4 HOH 196 602 196 HOH HOH A . 
D 4 HOH 197 603 197 HOH HOH A . 
D 4 HOH 198 604 198 HOH HOH A . 
D 4 HOH 199 605 199 HOH HOH A . 
D 4 HOH 200 606 200 HOH HOH A . 
D 4 HOH 201 607 201 HOH HOH A . 
D 4 HOH 202 608 202 HOH HOH A . 
D 4 HOH 203 609 203 HOH HOH A . 
D 4 HOH 204 610 204 HOH HOH A . 
D 4 HOH 205 611 205 HOH HOH A . 
D 4 HOH 206 612 206 HOH HOH A . 
D 4 HOH 207 613 207 HOH HOH A . 
D 4 HOH 208 614 208 HOH HOH A . 
D 4 HOH 209 615 209 HOH HOH A . 
D 4 HOH 210 616 210 HOH HOH A . 
D 4 HOH 211 617 211 HOH HOH A . 
D 4 HOH 212 618 212 HOH HOH A . 
D 4 HOH 213 619 213 HOH HOH A . 
D 4 HOH 214 620 214 HOH HOH A . 
D 4 HOH 215 621 215 HOH HOH A . 
D 4 HOH 216 622 216 HOH HOH A . 
D 4 HOH 217 623 217 HOH HOH A . 
D 4 HOH 218 624 218 HOH HOH A . 
D 4 HOH 219 625 219 HOH HOH A . 
D 4 HOH 220 626 220 HOH HOH A . 
D 4 HOH 221 627 221 HOH HOH A . 
D 4 HOH 222 628 222 HOH HOH A . 
D 4 HOH 223 629 223 HOH HOH A . 
D 4 HOH 224 630 224 HOH HOH A . 
D 4 HOH 225 631 225 HOH HOH A . 
D 4 HOH 226 632 226 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7730  ? 
1 MORE         -126  ? 
1 'SSA (A^2)'  19360 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555 -y,x-y,z  -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038  -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -x+y,-x,z -0.5000000000 0.8660254038  0.0000000000 0.0000000000 -0.8660254038 -0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1  1 A ZN  300 ? B ZN  . 
2  1 A CL  406 ? C CL  . 
3  1 A HOH 410 ? D HOH . 
4  1 A HOH 433 ? D HOH . 
5  1 A HOH 465 ? D HOH . 
6  1 A HOH 559 ? D HOH . 
7  1 A HOH 565 ? D HOH . 
8  1 A HOH 593 ? D HOH . 
9  1 A HOH 603 ? D HOH . 
10 1 A HOH 611 ? D HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  CL ? C CL  .   ? A CL  406 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 1_555 107.1 ? 
2  CL ? C CL  .   ? A CL  406 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 3_555 107.1 ? 
3  SG ? A CYS 140 ? A CYS 230 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 3_555 111.7 ? 
4  CL ? C CL  .   ? A CL  406 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 CL ? C CL  .   ? A CL  406 ? 2_555 0.0   ? 
5  SG ? A CYS 140 ? A CYS 230 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 CL ? C CL  .   ? A CL  406 ? 2_555 107.1 ? 
6  SG ? A CYS 140 ? A CYS 230 ? 3_555 ZN ? B ZN . ? A ZN 300 ? 1_555 CL ? C CL  .   ? A CL  406 ? 2_555 107.1 ? 
7  CL ? C CL  .   ? A CL  406 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 CL ? C CL  .   ? A CL  406 ? 3_555 0.0   ? 
8  SG ? A CYS 140 ? A CYS 230 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 CL ? C CL  .   ? A CL  406 ? 3_555 107.1 ? 
9  SG ? A CYS 140 ? A CYS 230 ? 3_555 ZN ? B ZN . ? A ZN 300 ? 1_555 CL ? C CL  .   ? A CL  406 ? 3_555 107.1 ? 
10 CL ? C CL  .   ? A CL  406 ? 2_555 ZN ? B ZN . ? A ZN 300 ? 1_555 CL ? C CL  .   ? A CL  406 ? 3_555 0.0   ? 
11 CL ? C CL  .   ? A CL  406 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 2_555 107.1 ? 
12 SG ? A CYS 140 ? A CYS 230 ? 1_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 2_555 111.7 ? 
13 SG ? A CYS 140 ? A CYS 230 ? 3_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 2_555 111.7 ? 
14 CL ? C CL  .   ? A CL  406 ? 2_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 2_555 107.1 ? 
15 CL ? C CL  .   ? A CL  406 ? 3_555 ZN ? B ZN . ? A ZN 300 ? 1_555 SG ? A CYS 140 ? A CYS 230 ? 2_555 107.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-01-26 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2018-03-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Database references'       
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            struct_ref_seq_dif 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
SHELXL-97 refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CA 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLY 
_pdbx_validate_rmsd_bond.auth_seq_id_1             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            C 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLY 
_pdbx_validate_rmsd_bond.auth_seq_id_2             160 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.415 
_pdbx_validate_rmsd_bond.bond_target_value         1.514 
_pdbx_validate_rmsd_bond.bond_deviation            -0.099 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.016 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 121 ? ? CZ A ARG 121 ? ? NH1 A ARG 121 ? ? 116.88 120.30 -3.42  0.50 N 
2  1 NE A ARG 149 ? ? CZ A ARG 149 ? ? NH1 A ARG 149 ? ? 115.25 120.30 -5.05  0.50 N 
3  1 O  A GLY 160 ? ? C  A GLY 160 ? ? N   A HIS 161 ? ? 105.66 122.70 -17.04 1.60 Y 
4  1 C  A GLY 160 ? ? N  A HIS 161 ? ? CA  A HIS 161 ? ? 89.76  121.70 -31.94 2.50 Y 
5  1 NE A ARG 191 ? ? CZ A ARG 191 ? ? NH1 A ARG 191 ? ? 123.62 120.30 3.32   0.50 N 
6  1 O  A THR 200 ? ? C  A THR 200 ? ? N   A LYS 201 ? ? 113.03 122.70 -9.67  1.60 Y 
7  1 NE A ARG 227 ? B CZ A ARG 227 ? B NH2 A ARG 227 ? B 115.49 120.30 -4.81  0.50 N 
8  1 CG A ARG 255 ? ? CD A ARG 255 ? ? NE  A ARG 255 ? ? 124.67 111.80 12.87  2.10 N 
9  1 CD A ARG 255 ? ? NE A ARG 255 ? ? CZ  A ARG 255 ? ? 137.80 123.60 14.20  1.40 N 
10 1 NE A ARG 255 ? ? CZ A ARG 255 ? ? NH2 A ARG 255 ? ? 125.30 120.30 5.00   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 121 ? ? 51.69   71.03   
2 1 ASN A 202 ? ? 42.69   26.60   
3 1 THR A 214 ? ? -132.45 -153.66 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLY 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    160 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   HIS 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    161 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            146.78 
# 
_pdbx_validate_main_chain_plane.id                       1 
_pdbx_validate_main_chain_plane.PDB_model_num            1 
_pdbx_validate_main_chain_plane.auth_comp_id             THR 
_pdbx_validate_main_chain_plane.auth_asym_id             A 
_pdbx_validate_main_chain_plane.auth_seq_id              200 
_pdbx_validate_main_chain_plane.PDB_ins_code             ? 
_pdbx_validate_main_chain_plane.label_alt_id             ? 
_pdbx_validate_main_chain_plane.improper_torsion_angle   22.27 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 91  ? A MET 1   
2  1 Y 1 A ILE 92  ? A ILE 2   
3  1 Y 1 A LEU 93  ? A LEU 3   
4  1 Y 1 A ARG 94  ? A ARG 4   
5  1 Y 1 A THR 95  ? A THR 5   
6  1 Y 1 A SER 96  ? A SER 6   
7  1 Y 1 A GLU 97  ? A GLU 7   
8  1 Y 1 A GLU 98  ? A GLU 8   
9  1 Y 1 A THR 99  ? A THR 9   
10 1 Y 1 A ILE 100 ? A ILE 10  
11 1 Y 1 A SER 101 ? A SER 11  
12 1 Y 1 A THR 102 ? A THR 12  
13 1 Y 1 A VAL 103 ? A VAL 13  
14 1 Y 1 A GLN 104 ? A GLN 14  
15 1 Y 1 A GLU 105 ? A GLU 15  
16 1 Y 1 A LYS 106 ? A LYS 16  
17 1 Y 1 A GLN 107 ? A GLN 17  
18 1 Y 1 A GLN 108 ? A GLN 18  
19 1 Y 1 A ASN 109 ? A ASN 19  
20 1 Y 1 A ILE 110 ? A ILE 20  
21 1 Y 1 A SER 111 ? A SER 21  
22 1 Y 1 A PRO 112 ? A PRO 22  
23 1 Y 1 A LEU 113 ? A LEU 23  
24 1 Y 1 A VAL 114 ? A VAL 24  
25 1 Y 1 A ARG 115 ? A ARG 25  
26 1 Y 1 A GLU 116 ? A GLU 26  
27 1 Y 1 A ARG 117 ? A ARG 27  
28 1 Y 1 A GLY 118 ? A GLY 28  
29 1 Y 1 A PRO 119 ? A PRO 29  
30 1 Y 1 A GLY 131 ? A GLY 41  
31 1 Y 1 A ARG 132 ? A ARG 42  
32 1 Y 1 A SER 133 ? A SER 43  
33 1 Y 1 A ASN 134 ? A ASN 44  
34 1 Y 1 A THR 135 ? A THR 45  
35 1 Y 1 A LEU 136 ? A LEU 46  
36 1 Y 1 A SER 137 ? A SER 47  
37 1 Y 1 A SER 138 ? A SER 48  
38 1 Y 1 A PRO 139 ? A PRO 49  
39 1 Y 1 A ASN 140 ? A ASN 50  
40 1 Y 1 A SER 141 ? A SER 51  
41 1 Y 1 A GLU 195 ? A GLU 105 
42 1 Y 1 A ILE 196 ? A ILE 106 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'     ZN  
3 'CHLORIDE ION' CL  
4 water          HOH 
#