data_1DGB
# 
_entry.id   1DGB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1DGB         
RCSB  RCSB010062   
WWPDB D_1000010062 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1DGF . unspecified 
PDB 1DGG . unspecified 
PDB 1DGH . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1DGB 
_pdbx_database_status.recvd_initial_deposition_date   1999-11-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Putnam, C.D.' 1 
'Arvai, A.S.'  2 
'Bourne, Y.'   3 
'Tainer, J.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Active and inhibited human catalase structures: ligand and NADPH binding and catalytic mechanism.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            296 
_citation.page_first                295 
_citation.page_last                 309 
_citation.year                      2000 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10656833 
_citation.pdbx_database_id_DOI      10.1006/jmbi.1999.3458 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Putnam, C.D.' 1 
primary 'Arvai, A.S.'  2 
primary 'Bourne, Y.'   3 
primary 'Tainer, J.A.' 4 
# 
_cell.entry_id           1DGB 
_cell.length_a           83.497 
_cell.length_b           139.934 
_cell.length_c           227.891 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1DGB 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat CATALASE                                                    56713.438 4    1.11.1.6 ? ? ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                           616.487   4    ?        ? ? ? 
3 non-polymer syn 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' 745.421   2    ?        ? ? ? 
4 water       nat water                                                       18.015    1109 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFG
YFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPS
FIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIK
NLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPV
NYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPN
YYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFT
EVHPDYGSHIQALLDKYN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFG
YFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPS
FIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIK
NLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPV
NYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPN
YYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFT
EVHPDYGSHIQALLDKYN
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ARG n 
1 3   ASP n 
1 4   PRO n 
1 5   ALA n 
1 6   SER n 
1 7   ASP n 
1 8   GLN n 
1 9   MET n 
1 10  GLN n 
1 11  HIS n 
1 12  TRP n 
1 13  LYS n 
1 14  GLU n 
1 15  GLN n 
1 16  ARG n 
1 17  ALA n 
1 18  ALA n 
1 19  GLN n 
1 20  LYS n 
1 21  ALA n 
1 22  ASP n 
1 23  VAL n 
1 24  LEU n 
1 25  THR n 
1 26  THR n 
1 27  GLY n 
1 28  ALA n 
1 29  GLY n 
1 30  ASN n 
1 31  PRO n 
1 32  VAL n 
1 33  GLY n 
1 34  ASP n 
1 35  LYS n 
1 36  LEU n 
1 37  ASN n 
1 38  VAL n 
1 39  ILE n 
1 40  THR n 
1 41  VAL n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  GLY n 
1 46  PRO n 
1 47  LEU n 
1 48  LEU n 
1 49  VAL n 
1 50  GLN n 
1 51  ASP n 
1 52  VAL n 
1 53  VAL n 
1 54  PHE n 
1 55  THR n 
1 56  ASP n 
1 57  GLU n 
1 58  MET n 
1 59  ALA n 
1 60  HIS n 
1 61  PHE n 
1 62  ASP n 
1 63  ARG n 
1 64  GLU n 
1 65  ARG n 
1 66  ILE n 
1 67  PRO n 
1 68  GLU n 
1 69  ARG n 
1 70  VAL n 
1 71  VAL n 
1 72  HIS n 
1 73  ALA n 
1 74  LYS n 
1 75  GLY n 
1 76  ALA n 
1 77  GLY n 
1 78  ALA n 
1 79  PHE n 
1 80  GLY n 
1 81  TYR n 
1 82  PHE n 
1 83  GLU n 
1 84  VAL n 
1 85  THR n 
1 86  HIS n 
1 87  ASP n 
1 88  ILE n 
1 89  THR n 
1 90  LYS n 
1 91  TYR n 
1 92  SER n 
1 93  LYS n 
1 94  ALA n 
1 95  LYS n 
1 96  VAL n 
1 97  PHE n 
1 98  GLU n 
1 99  HIS n 
1 100 ILE n 
1 101 GLY n 
1 102 LYS n 
1 103 LYS n 
1 104 THR n 
1 105 PRO n 
1 106 ILE n 
1 107 ALA n 
1 108 VAL n 
1 109 ARG n 
1 110 PHE n 
1 111 SER n 
1 112 THR n 
1 113 VAL n 
1 114 ALA n 
1 115 GLY n 
1 116 GLU n 
1 117 SER n 
1 118 GLY n 
1 119 SER n 
1 120 ALA n 
1 121 ASP n 
1 122 THR n 
1 123 VAL n 
1 124 ARG n 
1 125 ASP n 
1 126 PRO n 
1 127 ARG n 
1 128 GLY n 
1 129 PHE n 
1 130 ALA n 
1 131 VAL n 
1 132 LYS n 
1 133 PHE n 
1 134 TYR n 
1 135 THR n 
1 136 GLU n 
1 137 ASP n 
1 138 GLY n 
1 139 ASN n 
1 140 TRP n 
1 141 ASP n 
1 142 LEU n 
1 143 VAL n 
1 144 GLY n 
1 145 ASN n 
1 146 ASN n 
1 147 THR n 
1 148 PRO n 
1 149 ILE n 
1 150 PHE n 
1 151 PHE n 
1 152 ILE n 
1 153 ARG n 
1 154 ASP n 
1 155 PRO n 
1 156 ILE n 
1 157 LEU n 
1 158 PHE n 
1 159 PRO n 
1 160 SER n 
1 161 PHE n 
1 162 ILE n 
1 163 HIS n 
1 164 SER n 
1 165 GLN n 
1 166 LYS n 
1 167 ARG n 
1 168 ASN n 
1 169 PRO n 
1 170 GLN n 
1 171 THR n 
1 172 HIS n 
1 173 LEU n 
1 174 LYS n 
1 175 ASP n 
1 176 PRO n 
1 177 ASP n 
1 178 MET n 
1 179 VAL n 
1 180 TRP n 
1 181 ASP n 
1 182 PHE n 
1 183 TRP n 
1 184 SER n 
1 185 LEU n 
1 186 ARG n 
1 187 PRO n 
1 188 GLU n 
1 189 SER n 
1 190 LEU n 
1 191 HIS n 
1 192 GLN n 
1 193 VAL n 
1 194 SER n 
1 195 PHE n 
1 196 LEU n 
1 197 PHE n 
1 198 SER n 
1 199 ASP n 
1 200 ARG n 
1 201 GLY n 
1 202 ILE n 
1 203 PRO n 
1 204 ASP n 
1 205 GLY n 
1 206 HIS n 
1 207 ARG n 
1 208 HIS n 
1 209 MET n 
1 210 ASN n 
1 211 GLY n 
1 212 TYR n 
1 213 GLY n 
1 214 SER n 
1 215 HIS n 
1 216 THR n 
1 217 PHE n 
1 218 LYS n 
1 219 LEU n 
1 220 VAL n 
1 221 ASN n 
1 222 ALA n 
1 223 ASN n 
1 224 GLY n 
1 225 GLU n 
1 226 ALA n 
1 227 VAL n 
1 228 TYR n 
1 229 CYS n 
1 230 LYS n 
1 231 PHE n 
1 232 HIS n 
1 233 TYR n 
1 234 LYS n 
1 235 THR n 
1 236 ASP n 
1 237 GLN n 
1 238 GLY n 
1 239 ILE n 
1 240 LYS n 
1 241 ASN n 
1 242 LEU n 
1 243 SER n 
1 244 VAL n 
1 245 GLU n 
1 246 ASP n 
1 247 ALA n 
1 248 ALA n 
1 249 ARG n 
1 250 LEU n 
1 251 SER n 
1 252 GLN n 
1 253 GLU n 
1 254 ASP n 
1 255 PRO n 
1 256 ASP n 
1 257 TYR n 
1 258 GLY n 
1 259 ILE n 
1 260 ARG n 
1 261 ASP n 
1 262 LEU n 
1 263 PHE n 
1 264 ASN n 
1 265 ALA n 
1 266 ILE n 
1 267 ALA n 
1 268 THR n 
1 269 GLY n 
1 270 LYS n 
1 271 TYR n 
1 272 PRO n 
1 273 SER n 
1 274 TRP n 
1 275 THR n 
1 276 PHE n 
1 277 TYR n 
1 278 ILE n 
1 279 GLN n 
1 280 VAL n 
1 281 MET n 
1 282 THR n 
1 283 PHE n 
1 284 ASN n 
1 285 GLN n 
1 286 ALA n 
1 287 GLU n 
1 288 THR n 
1 289 PHE n 
1 290 PRO n 
1 291 PHE n 
1 292 ASN n 
1 293 PRO n 
1 294 PHE n 
1 295 ASP n 
1 296 LEU n 
1 297 THR n 
1 298 LYS n 
1 299 VAL n 
1 300 TRP n 
1 301 PRO n 
1 302 HIS n 
1 303 LYS n 
1 304 ASP n 
1 305 TYR n 
1 306 PRO n 
1 307 LEU n 
1 308 ILE n 
1 309 PRO n 
1 310 VAL n 
1 311 GLY n 
1 312 LYS n 
1 313 LEU n 
1 314 VAL n 
1 315 LEU n 
1 316 ASN n 
1 317 ARG n 
1 318 ASN n 
1 319 PRO n 
1 320 VAL n 
1 321 ASN n 
1 322 TYR n 
1 323 PHE n 
1 324 ALA n 
1 325 GLU n 
1 326 VAL n 
1 327 GLU n 
1 328 GLN n 
1 329 ILE n 
1 330 ALA n 
1 331 PHE n 
1 332 ASP n 
1 333 PRO n 
1 334 SER n 
1 335 ASN n 
1 336 MET n 
1 337 PRO n 
1 338 PRO n 
1 339 GLY n 
1 340 ILE n 
1 341 GLU n 
1 342 ALA n 
1 343 SER n 
1 344 PRO n 
1 345 ASP n 
1 346 LYS n 
1 347 MET n 
1 348 LEU n 
1 349 GLN n 
1 350 GLY n 
1 351 ARG n 
1 352 LEU n 
1 353 PHE n 
1 354 ALA n 
1 355 TYR n 
1 356 PRO n 
1 357 ASP n 
1 358 THR n 
1 359 HIS n 
1 360 ARG n 
1 361 HIS n 
1 362 ARG n 
1 363 LEU n 
1 364 GLY n 
1 365 PRO n 
1 366 ASN n 
1 367 TYR n 
1 368 LEU n 
1 369 HIS n 
1 370 ILE n 
1 371 PRO n 
1 372 VAL n 
1 373 ASN n 
1 374 CYS n 
1 375 PRO n 
1 376 TYR n 
1 377 ARG n 
1 378 ALA n 
1 379 ARG n 
1 380 VAL n 
1 381 ALA n 
1 382 ASN n 
1 383 TYR n 
1 384 GLN n 
1 385 ARG n 
1 386 ASP n 
1 387 GLY n 
1 388 PRO n 
1 389 MET n 
1 390 CYS n 
1 391 MET n 
1 392 GLN n 
1 393 ASP n 
1 394 ASN n 
1 395 GLN n 
1 396 GLY n 
1 397 GLY n 
1 398 ALA n 
1 399 PRO n 
1 400 ASN n 
1 401 TYR n 
1 402 TYR n 
1 403 PRO n 
1 404 ASN n 
1 405 SER n 
1 406 PHE n 
1 407 GLY n 
1 408 ALA n 
1 409 PRO n 
1 410 GLU n 
1 411 GLN n 
1 412 GLN n 
1 413 PRO n 
1 414 SER n 
1 415 ALA n 
1 416 LEU n 
1 417 GLU n 
1 418 HIS n 
1 419 SER n 
1 420 ILE n 
1 421 GLN n 
1 422 TYR n 
1 423 SER n 
1 424 GLY n 
1 425 GLU n 
1 426 VAL n 
1 427 ARG n 
1 428 ARG n 
1 429 PHE n 
1 430 ASN n 
1 431 THR n 
1 432 ALA n 
1 433 ASN n 
1 434 ASP n 
1 435 ASP n 
1 436 ASN n 
1 437 VAL n 
1 438 THR n 
1 439 GLN n 
1 440 VAL n 
1 441 ARG n 
1 442 ALA n 
1 443 PHE n 
1 444 TYR n 
1 445 VAL n 
1 446 ASN n 
1 447 VAL n 
1 448 LEU n 
1 449 ASN n 
1 450 GLU n 
1 451 GLU n 
1 452 GLN n 
1 453 ARG n 
1 454 LYS n 
1 455 ARG n 
1 456 LEU n 
1 457 CYS n 
1 458 GLU n 
1 459 ASN n 
1 460 ILE n 
1 461 ALA n 
1 462 GLY n 
1 463 HIS n 
1 464 LEU n 
1 465 LYS n 
1 466 ASP n 
1 467 ALA n 
1 468 GLN n 
1 469 ILE n 
1 470 PHE n 
1 471 ILE n 
1 472 GLN n 
1 473 LYS n 
1 474 LYS n 
1 475 ALA n 
1 476 VAL n 
1 477 LYS n 
1 478 ASN n 
1 479 PHE n 
1 480 THR n 
1 481 GLU n 
1 482 VAL n 
1 483 HIS n 
1 484 PRO n 
1 485 ASP n 
1 486 TYR n 
1 487 GLY n 
1 488 SER n 
1 489 HIS n 
1 490 ILE n 
1 491 GLN n 
1 492 ALA n 
1 493 LEU n 
1 494 LEU n 
1 495 ASP n 
1 496 LYS n 
1 497 TYR n 
1 498 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ERYTHROCYTE 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    CATA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04040 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1DGB A 1 ? 498 ? P04040 4 ? 501 ? 4 501 
2 1 1DGB B 1 ? 498 ? P04040 4 ? 501 ? 4 501 
3 1 1DGB C 1 ? 498 ? P04040 4 ? 501 ? 4 501 
4 1 1DGB D 1 ? 498 ? P04040 4 ? 501 ? 4 501 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                     ?    'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                    ?    'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                  ?    'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                             ?    'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                    ?    'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                   ?    'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                             ?    'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                     ?    'C2 H5 N O2'        75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                           HEME 'C34 H32 Fe N4 O4'  616.487 
HIS 'L-peptide linking' y HISTIDINE                                                   ?    'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                       ?    'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                  ?    'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                     ?    'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                      ?    'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                  ?    'C5 H11 N O2 S'     149.211 
NDP non-polymer         . 'NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE' ?    'C21 H30 N7 O17 P3' 745.421 
PHE 'L-peptide linking' y PHENYLALANINE                                               ?    'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                     ?    'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                      ?    'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                   ?    'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                  ?    'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                    ?    'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                      ?    'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1DGB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   58.06 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    
'6.5 - 8.0% PEG4000, protein at 40 mg/mL in 50 mM TrisCl, pH 8.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           200.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-03-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             0.98 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1DGB 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   123184 
_reflns.number_all                   123184 
_reflns.percent_possible_obs         90.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0750000 
_reflns.pdbx_netI_over_sigmaI        14.0 
_reflns.B_iso_Wilson_estimate        16.6 
_reflns.pdbx_redundancy              2.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   82.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.1310000 
_reflns_shell.meanI_over_sigI_obs    4.20000 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1DGB 
_refine.ls_number_reflns_obs                     123184 
_refine.ls_number_reflns_all                     123016 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.2 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1760000 
_refine.ls_R_factor_all                          0.1760000 
_refine.ls_R_factor_R_work                       0.1720000 
_refine.ls_R_factor_R_free                       0.2270000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.00 
_refine.ls_number_reflns_R_free                  12276 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               62.92 
_refine.aniso_B[1][1]                            5.5339 
_refine.aniso_B[2][2]                            -1.5138 
_refine.aniso_B[3][3]                            -4.0201 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
'BOND ANGLES AND LENGTHS TO THE HEME IRON FROM BOTH THE TYR358 LIGAND AND THE HEME NITROGENS WERE UNCONSTRAINED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            Random 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        16066 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         268 
_refine_hist.number_atoms_solvent             1109 
_refine_hist.number_atoms_total               17443 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d     0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg  1.3   ?   ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it  0.416 1.5 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it 0.755 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it  0.496 2.0 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it 0.820 2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.20 
_refine_ls_shell.d_res_low                        2.30 
_refine_ls_shell.number_reflns_R_work             12606 
_refine_ls_shell.R_factor_R_work                  0.5058000 
_refine_ls_shell.percent_reflns_obs               83.6 
_refine_ls_shell.R_factor_R_free                  0.5465000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            10.00 
_refine_ls_shell.number_reflns_R_free             1415 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1DGB 
_struct.title                     'HUMAN ERYTHROCYTE CATALASE' 
_struct.pdbx_descriptor           'CATALASE (E.C.1.11.1.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1DGB 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'CATALASE, HEME, NADPH, HYDROGEN PEROXIDE, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 2 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 3   ? SER A 6   ? ASP A 6   SER A 9   5 ? 4  
HELX_P HELX_P2  2  ASP A 7   ? GLN A 15  ? ASP A 10  GLN A 18  1 ? 9  
HELX_P HELX_P3  3  ASP A 51  ? ASP A 62  ? ASP A 54  ASP A 65  1 ? 12 
HELX_P HELX_P4  4  ALA A 94  ? GLU A 98  ? ALA A 97  GLU A 101 5 ? 5  
HELX_P HELX_P5  5  ASP A 154 ? ILE A 156 ? ASP A 157 ILE A 159 5 ? 3  
HELX_P HELX_P6  6  LEU A 157 ? LYS A 166 ? LEU A 160 LYS A 169 1 ? 10 
HELX_P HELX_P7  7  ASP A 175 ? ARG A 186 ? ASP A 178 ARG A 189 1 ? 12 
HELX_P HELX_P8  8  SER A 189 ? PHE A 197 ? SER A 192 PHE A 200 1 ? 9  
HELX_P HELX_P9  9  SER A 198 ? ILE A 202 ? SER A 201 ILE A 205 5 ? 5  
HELX_P HELX_P10 10 SER A 243 ? ASP A 254 ? SER A 246 ASP A 257 1 ? 12 
HELX_P HELX_P11 11 ASP A 256 ? THR A 268 ? ASP A 259 THR A 271 1 ? 13 
HELX_P HELX_P12 12 THR A 282 ? PHE A 289 ? THR A 285 PHE A 292 1 ? 8  
HELX_P HELX_P13 13 ASN A 321 ? VAL A 326 ? ASN A 324 VAL A 329 1 ? 6  
HELX_P HELX_P14 14 ASP A 345 ? LEU A 363 ? ASP A 348 LEU A 366 1 ? 19 
HELX_P HELX_P15 15 ASN A 366 ? ILE A 370 ? ASN A 369 ILE A 373 5 ? 5  
HELX_P HELX_P16 16 ILE A 370 ? CYS A 374 ? ILE A 373 CYS A 377 5 ? 5  
HELX_P HELX_P17 17 GLN A 412 ? LEU A 416 ? GLN A 415 LEU A 419 5 ? 5  
HELX_P HELX_P18 18 VAL A 437 ? VAL A 447 ? VAL A 440 VAL A 450 1 ? 11 
HELX_P HELX_P19 19 ASN A 449 ? LYS A 465 ? ASN A 452 LYS A 468 1 ? 17 
HELX_P HELX_P20 20 GLN A 468 ? HIS A 483 ? GLN A 471 HIS A 486 1 ? 16 
HELX_P HELX_P21 21 HIS A 483 ? ASN A 498 ? HIS A 486 ASN A 501 1 ? 16 
HELX_P HELX_P22 22 ASP B 7   ? ARG B 16  ? ASP B 10  ARG B 19  1 ? 10 
HELX_P HELX_P23 23 ASP B 51  ? ASP B 62  ? ASP B 54  ASP B 65  1 ? 12 
HELX_P HELX_P24 24 ALA B 94  ? GLU B 98  ? ALA B 97  GLU B 101 5 ? 5  
HELX_P HELX_P25 25 ASP B 154 ? ILE B 156 ? ASP B 157 ILE B 159 5 ? 3  
HELX_P HELX_P26 26 LEU B 157 ? LYS B 166 ? LEU B 160 LYS B 169 1 ? 10 
HELX_P HELX_P27 27 ASP B 175 ? ARG B 186 ? ASP B 178 ARG B 189 1 ? 12 
HELX_P HELX_P28 28 SER B 189 ? PHE B 197 ? SER B 192 PHE B 200 1 ? 9  
HELX_P HELX_P29 29 SER B 198 ? ILE B 202 ? SER B 201 ILE B 205 5 ? 5  
HELX_P HELX_P30 30 SER B 243 ? ASP B 254 ? SER B 246 ASP B 257 1 ? 12 
HELX_P HELX_P31 31 ASP B 256 ? THR B 268 ? ASP B 259 THR B 271 1 ? 13 
HELX_P HELX_P32 32 THR B 282 ? PHE B 289 ? THR B 285 PHE B 292 1 ? 8  
HELX_P HELX_P33 33 ASN B 321 ? VAL B 326 ? ASN B 324 VAL B 329 1 ? 6  
HELX_P HELX_P34 34 ASP B 345 ? LEU B 363 ? ASP B 348 LEU B 366 1 ? 19 
HELX_P HELX_P35 35 ASN B 366 ? ILE B 370 ? ASN B 369 ILE B 373 5 ? 5  
HELX_P HELX_P36 36 ILE B 370 ? CYS B 374 ? ILE B 373 CYS B 377 5 ? 5  
HELX_P HELX_P37 37 GLN B 412 ? LEU B 416 ? GLN B 415 LEU B 419 5 ? 5  
HELX_P HELX_P38 38 VAL B 437 ? ASN B 446 ? VAL B 440 ASN B 449 1 ? 10 
HELX_P HELX_P39 39 ASN B 449 ? LYS B 465 ? ASN B 452 LYS B 468 1 ? 17 
HELX_P HELX_P40 40 GLN B 468 ? HIS B 483 ? GLN B 471 HIS B 486 1 ? 16 
HELX_P HELX_P41 41 HIS B 483 ? ASN B 498 ? HIS B 486 ASN B 501 1 ? 16 
HELX_P HELX_P42 42 ASP C 7   ? ARG C 16  ? ASP C 10  ARG C 19  1 ? 10 
HELX_P HELX_P43 43 ASP C 51  ? ASP C 62  ? ASP C 54  ASP C 65  1 ? 12 
HELX_P HELX_P44 44 ASP C 154 ? ILE C 156 ? ASP C 157 ILE C 159 5 ? 3  
HELX_P HELX_P45 45 LEU C 157 ? LYS C 166 ? LEU C 160 LYS C 169 1 ? 10 
HELX_P HELX_P46 46 ASP C 175 ? ARG C 186 ? ASP C 178 ARG C 189 1 ? 12 
HELX_P HELX_P47 47 SER C 189 ? PHE C 197 ? SER C 192 PHE C 200 1 ? 9  
HELX_P HELX_P48 48 SER C 198 ? ILE C 202 ? SER C 201 ILE C 205 5 ? 5  
HELX_P HELX_P49 49 SER C 243 ? ASP C 254 ? SER C 246 ASP C 257 1 ? 12 
HELX_P HELX_P50 50 ASP C 256 ? THR C 268 ? ASP C 259 THR C 271 1 ? 13 
HELX_P HELX_P51 51 THR C 282 ? THR C 288 ? THR C 285 THR C 291 1 ? 7  
HELX_P HELX_P52 52 ASN C 321 ? VAL C 326 ? ASN C 324 VAL C 329 1 ? 6  
HELX_P HELX_P53 53 ASP C 345 ? LEU C 363 ? ASP C 348 LEU C 366 1 ? 19 
HELX_P HELX_P54 54 ASN C 366 ? ILE C 370 ? ASN C 369 ILE C 373 5 ? 5  
HELX_P HELX_P55 55 GLN C 412 ? LEU C 416 ? GLN C 415 LEU C 419 5 ? 5  
HELX_P HELX_P56 56 VAL C 437 ? VAL C 447 ? VAL C 440 VAL C 450 1 ? 11 
HELX_P HELX_P57 57 ASN C 449 ? LYS C 465 ? ASN C 452 LYS C 468 1 ? 17 
HELX_P HELX_P58 58 GLN C 468 ? HIS C 483 ? GLN C 471 HIS C 486 1 ? 16 
HELX_P HELX_P59 59 HIS C 483 ? ASN C 498 ? HIS C 486 ASN C 501 1 ? 16 
HELX_P HELX_P60 60 PRO D 4   ? SER D 6   ? PRO D 7   SER D 9   5 ? 3  
HELX_P HELX_P61 61 ASP D 7   ? ALA D 17  ? ASP D 10  ALA D 20  1 ? 11 
HELX_P HELX_P62 62 ASP D 51  ? ASP D 62  ? ASP D 54  ASP D 65  1 ? 12 
HELX_P HELX_P63 63 ALA D 94  ? GLU D 98  ? ALA D 97  GLU D 101 5 ? 5  
HELX_P HELX_P64 64 ASP D 154 ? ILE D 156 ? ASP D 157 ILE D 159 5 ? 3  
HELX_P HELX_P65 65 LEU D 157 ? LYS D 166 ? LEU D 160 LYS D 169 1 ? 10 
HELX_P HELX_P66 66 ASP D 175 ? ARG D 186 ? ASP D 178 ARG D 189 1 ? 12 
HELX_P HELX_P67 67 SER D 189 ? PHE D 197 ? SER D 192 PHE D 200 1 ? 9  
HELX_P HELX_P68 68 SER D 198 ? ILE D 202 ? SER D 201 ILE D 205 5 ? 5  
HELX_P HELX_P69 69 GLY D 205 ? MET D 209 ? GLY D 208 MET D 212 5 ? 5  
HELX_P HELX_P70 70 SER D 243 ? ASP D 254 ? SER D 246 ASP D 257 1 ? 12 
HELX_P HELX_P71 71 ASP D 256 ? THR D 268 ? ASP D 259 THR D 271 1 ? 13 
HELX_P HELX_P72 72 ASN D 284 ? PHE D 289 ? ASN D 287 PHE D 292 1 ? 6  
HELX_P HELX_P73 73 ASN D 321 ? VAL D 326 ? ASN D 324 VAL D 329 1 ? 6  
HELX_P HELX_P74 74 ASP D 345 ? LEU D 363 ? ASP D 348 LEU D 366 1 ? 19 
HELX_P HELX_P75 75 ASN D 366 ? ILE D 370 ? ASN D 369 ILE D 373 5 ? 5  
HELX_P HELX_P76 76 ILE D 370 ? CYS D 374 ? ILE D 373 CYS D 377 5 ? 5  
HELX_P HELX_P77 77 GLN D 412 ? LEU D 416 ? GLN D 415 LEU D 419 5 ? 5  
HELX_P HELX_P78 78 VAL D 437 ? ASN D 446 ? VAL D 440 ASN D 449 1 ? 10 
HELX_P HELX_P79 79 ASN D 449 ? LYS D 465 ? ASN D 452 LYS D 468 1 ? 17 
HELX_P HELX_P80 80 GLN D 468 ? HIS D 483 ? GLN D 471 HIS D 486 1 ? 16 
HELX_P HELX_P81 81 HIS D 483 ? ASN D 498 ? HIS D 486 ASN D 501 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A TYR 355 OH ? ? ? 1_555 E HEM . FE ? ? A TYR 358 A HEM 1200 1_555 ? ? ? ? ? ? ? 1.739 ? 
metalc2 metalc ? ? B TYR 355 OH ? ? ? 1_555 G HEM . FE ? ? B TYR 358 B HEM 1201 1_555 ? ? ? ? ? ? ? 1.758 ? 
metalc3 metalc ? ? C TYR 355 OH ? ? ? 1_555 H HEM . FE ? ? C TYR 358 C HEM 1202 1_555 ? ? ? ? ? ? ? 1.728 ? 
metalc4 metalc ? ? D TYR 355 OH ? ? ? 1_555 J HEM . FE ? ? D TYR 358 D HEM 1203 1_555 ? ? ? ? ? ? ? 1.824 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 402 A . ? TYR 405 A PRO 403 A ? PRO 406 A 1 -0.78 
2 TYR 402 B . ? TYR 405 B PRO 403 B ? PRO 406 B 1 0.20  
3 TYR 402 C . ? TYR 405 C PRO 403 C ? PRO 406 C 1 0.88  
4 TYR 402 D . ? TYR 405 D PRO 403 D ? PRO 406 D 1 1.05  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
C ? 4  ? 
D ? 3  ? 
E ? 11 ? 
F ? 11 ? 
G ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
E 7  8  ? anti-parallel 
E 8  9  ? anti-parallel 
E 9  10 ? anti-parallel 
E 10 11 ? anti-parallel 
F 1  2  ? anti-parallel 
F 2  3  ? anti-parallel 
F 3  4  ? anti-parallel 
F 4  5  ? anti-parallel 
F 5  6  ? anti-parallel 
F 6  7  ? anti-parallel 
F 7  8  ? anti-parallel 
F 8  9  ? anti-parallel 
F 9  10 ? anti-parallel 
F 10 11 ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
G 9  10 ? anti-parallel 
G 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ILE A 39  ? VAL A 41  ? ILE A 42  VAL A 44  
A 2  GLU C 425 ? ARG C 428 ? GLU C 428 ARG C 431 
A 3  ILE D 420 ? GLN D 421 ? ILE D 423 GLN D 424 
B 1  ILE A 340 ? ALA A 342 ? ILE A 343 ALA A 345 
B 2  PHE A 217 ? VAL A 220 ? PHE A 220 VAL A 223 
B 3  ALA A 226 ? THR A 235 ? ALA A 229 THR A 238 
B 4  SER A 273 ? MET A 281 ? SER A 276 MET A 284 
B 5  ILE A 308 ? ARG A 317 ? ILE A 311 ARG A 320 
B 6  GLY A 75  ? VAL A 84  ? GLY A 78  VAL A 87  
B 7  LYS A 103 ? SER A 111 ? LYS A 106 SER A 114 
B 8  GLY A 128 ? THR A 135 ? GLY A 131 THR A 138 
B 9  GLY A 138 ? ASN A 145 ? GLY A 141 ASN A 148 
B 10 GLY A 211 ? TYR A 212 ? GLY A 214 TYR A 215 
B 11 ALA A 226 ? THR A 235 ? ALA A 229 THR A 238 
C 1  ILE C 39  ? VAL C 41  ? ILE C 42  VAL C 44  
C 2  GLN A 421 ? ARG A 428 ? GLN A 424 ARG A 431 
C 3  GLN B 421 ? ARG B 428 ? GLN B 424 ARG B 431 
C 4  ILE D 39  ? VAL D 41  ? ILE D 42  VAL D 44  
D 1  ILE B 39  ? VAL B 41  ? ILE B 42  VAL B 44  
D 2  GLY D 424 ? ARG D 428 ? GLY D 427 ARG D 431 
D 3  GLN C 421 ? TYR C 422 ? GLN C 424 TYR C 425 
E 1  ILE B 340 ? GLU B 341 ? ILE B 343 GLU B 344 
E 2  PHE B 217 ? VAL B 220 ? PHE B 220 VAL B 223 
E 3  ALA B 226 ? THR B 235 ? ALA B 229 THR B 238 
E 4  SER B 273 ? MET B 281 ? SER B 276 MET B 284 
E 5  ILE B 308 ? ARG B 317 ? ILE B 311 ARG B 320 
E 6  GLY B 75  ? VAL B 84  ? GLY B 78  VAL B 87  
E 7  LYS B 103 ? SER B 111 ? LYS B 106 SER B 114 
E 8  GLY B 128 ? THR B 135 ? GLY B 131 THR B 138 
E 9  GLY B 138 ? ASN B 145 ? GLY B 141 ASN B 148 
E 10 GLY B 211 ? TYR B 212 ? GLY B 214 TYR B 215 
E 11 ALA B 226 ? THR B 235 ? ALA B 229 THR B 238 
F 1  ILE C 340 ? GLU C 341 ? ILE C 343 GLU C 344 
F 2  PHE C 217 ? VAL C 220 ? PHE C 220 VAL C 223 
F 3  ALA C 226 ? THR C 235 ? ALA C 229 THR C 238 
F 4  SER C 273 ? MET C 281 ? SER C 276 MET C 284 
F 5  ILE C 308 ? ARG C 317 ? ILE C 311 ARG C 320 
F 6  GLY C 75  ? VAL C 84  ? GLY C 78  VAL C 87  
F 7  LYS C 103 ? SER C 111 ? LYS C 106 SER C 114 
F 8  GLY C 128 ? THR C 135 ? GLY C 131 THR C 138 
F 9  GLY C 138 ? ASN C 145 ? GLY C 141 ASN C 148 
F 10 GLY C 211 ? TYR C 212 ? GLY C 214 TYR C 215 
F 11 ALA C 226 ? THR C 235 ? ALA C 229 THR C 238 
G 1  ILE D 340 ? ALA D 342 ? ILE D 343 ALA D 345 
G 2  PHE D 217 ? VAL D 220 ? PHE D 220 VAL D 223 
G 3  ALA D 226 ? THR D 235 ? ALA D 229 THR D 238 
G 4  SER D 273 ? MET D 281 ? SER D 276 MET D 284 
G 5  ILE D 308 ? ARG D 317 ? ILE D 311 ARG D 320 
G 6  GLY D 75  ? VAL D 84  ? GLY D 78  VAL D 87  
G 7  LYS D 103 ? SER D 111 ? LYS D 106 SER D 114 
G 8  GLY D 128 ? THR D 135 ? GLY D 131 THR D 138 
G 9  GLY D 138 ? ASN D 145 ? GLY D 141 ASN D 148 
G 10 GLY D 211 ? TYR D 212 ? GLY D 214 TYR D 215 
G 11 ALA D 226 ? THR D 235 ? ALA D 229 THR D 238 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  N THR A 40  ? N THR A 43  O ARG C 427 ? O ARG C 430 
A 2  3  N VAL C 426 ? N VAL C 429 O ILE D 420 ? O ILE D 423 
B 1  2  N GLU A 341 ? N GLU A 344 O LYS A 218 ? O LYS A 221 
B 2  3  N LEU A 219 ? N LEU A 222 O VAL A 227 ? O VAL A 230 
B 3  4  O LYS A 234 ? O LYS A 237 N THR A 275 ? N THR A 278 
B 4  5  O ILE A 278 ? O ILE A 281 N ILE A 308 ? N ILE A 311 
B 5  6  O ARG A 317 ? O ARG A 320 N PHE A 79  ? N PHE A 82  
B 6  7  O PHE A 82  ? O PHE A 85  N THR A 104 ? N THR A 107 
B 7  8  O SER A 111 ? O SER A 114 N GLY A 128 ? N GLY A 131 
B 8  9  O THR A 135 ? O THR A 138 N GLY A 138 ? N GLY A 141 
B 9  10 O ASN A 145 ? O ASN A 148 N TYR A 212 ? N TYR A 215 
B 10 11 O GLY A 211 ? O GLY A 214 N TYR A 233 ? N TYR A 236 
C 1  2  N THR C 40  ? N THR C 43  O ARG A 427 ? O ARG A 430 
C 2  3  N GLY A 424 ? N GLY A 427 O TYR B 422 ? O TYR B 425 
C 3  4  O ARG B 427 ? O ARG B 430 N THR D 40  ? N THR D 43  
D 1  2  N THR B 40  ? N THR B 43  O ARG D 427 ? O ARG D 430 
D 2  3  O GLY D 424 ? O GLY D 427 N TYR C 422 ? N TYR C 425 
E 1  2  O GLU B 341 ? O GLU B 344 N LYS B 218 ? N LYS B 221 
E 2  3  N LEU B 219 ? N LEU B 222 O VAL B 227 ? O VAL B 230 
E 3  4  O LYS B 234 ? O LYS B 237 N THR B 275 ? N THR B 278 
E 4  5  O ILE B 278 ? O ILE B 281 N ILE B 308 ? N ILE B 311 
E 5  6  O ARG B 317 ? O ARG B 320 N PHE B 79  ? N PHE B 82  
E 6  7  N PHE B 82  ? N PHE B 85  O THR B 104 ? O THR B 107 
E 7  8  O SER B 111 ? O SER B 114 N GLY B 128 ? N GLY B 131 
E 8  9  O THR B 135 ? O THR B 138 N GLY B 138 ? N GLY B 141 
E 9  10 O ASN B 145 ? O ASN B 148 N TYR B 212 ? N TYR B 215 
E 10 11 O GLY B 211 ? O GLY B 214 N TYR B 233 ? N TYR B 236 
F 1  2  N GLU C 341 ? N GLU C 344 O LYS C 218 ? O LYS C 221 
F 2  3  N LEU C 219 ? N LEU C 222 O VAL C 227 ? O VAL C 230 
F 3  4  O LYS C 234 ? O LYS C 237 N THR C 275 ? N THR C 278 
F 4  5  O ILE C 278 ? O ILE C 281 N ILE C 308 ? N ILE C 311 
F 5  6  O ARG C 317 ? O ARG C 320 N PHE C 79  ? N PHE C 82  
F 6  7  N PHE C 82  ? N PHE C 85  O THR C 104 ? O THR C 107 
F 7  8  O SER C 111 ? O SER C 114 N GLY C 128 ? N GLY C 131 
F 8  9  N THR C 135 ? N THR C 138 O GLY C 138 ? O GLY C 141 
F 9  10 O ASN C 145 ? O ASN C 148 N TYR C 212 ? N TYR C 215 
F 10 11 O GLY C 211 ? O GLY C 214 N TYR C 233 ? N TYR C 236 
G 1  2  N GLU D 341 ? N GLU D 344 O LYS D 218 ? O LYS D 221 
G 2  3  N LEU D 219 ? N LEU D 222 O VAL D 227 ? O VAL D 230 
G 3  4  O LYS D 234 ? O LYS D 237 N THR D 275 ? N THR D 278 
G 4  5  O ILE D 278 ? O ILE D 281 N ILE D 308 ? N ILE D 311 
G 5  6  O ARG D 317 ? O ARG D 320 N PHE D 79  ? N PHE D 82  
G 6  7  O PHE D 82  ? O PHE D 85  N THR D 104 ? N THR D 107 
G 7  8  O SER D 111 ? O SER D 114 N GLY D 128 ? N GLY D 131 
G 8  9  O THR D 135 ? O THR D 138 N GLY D 138 ? N GLY D 141 
G 9  10 O ASN D 145 ? O ASN D 148 N TYR D 212 ? N TYR D 215 
G 10 11 O GLY D 211 ? O GLY D 214 N TYR D 233 ? N TYR D 236 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE HEM A 1200' 
AC2 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE NDP A 1300' 
AC3 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE HEM B 1201' 
AC4 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE HEM C 1202' 
AC5 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE NDP C 1301' 
AC6 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE HEM D 1203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 22 ARG A 69  ? ARG A 72   . ? 1_555 ? 
2   AC1 22 VAL A 70  ? VAL A 73   . ? 1_555 ? 
3   AC1 22 VAL A 71  ? VAL A 74   . ? 1_555 ? 
4   AC1 22 HIS A 72  ? HIS A 75   . ? 1_555 ? 
5   AC1 22 ARG A 109 ? ARG A 112  . ? 1_555 ? 
6   AC1 22 GLY A 128 ? GLY A 131  . ? 1_555 ? 
7   AC1 22 VAL A 143 ? VAL A 146  . ? 1_555 ? 
8   AC1 22 GLY A 144 ? GLY A 147  . ? 1_555 ? 
9   AC1 22 ASN A 145 ? ASN A 148  . ? 1_555 ? 
10  AC1 22 PHE A 158 ? PHE A 161  . ? 1_555 ? 
11  AC1 22 SER A 214 ? SER A 217  . ? 1_555 ? 
12  AC1 22 PHE A 331 ? PHE A 334  . ? 1_555 ? 
13  AC1 22 MET A 347 ? MET A 350  . ? 1_555 ? 
14  AC1 22 ARG A 351 ? ARG A 354  . ? 1_555 ? 
15  AC1 22 TYR A 355 ? TYR A 358  . ? 1_555 ? 
16  AC1 22 THR A 358 ? THR A 361  . ? 1_555 ? 
17  AC1 22 HIS A 359 ? HIS A 362  . ? 1_555 ? 
18  AC1 22 ARG A 362 ? ARG A 365  . ? 1_555 ? 
19  AC1 22 HOH K .   ? HOH A 1450 . ? 1_555 ? 
20  AC1 22 HOH K .   ? HOH A 1509 . ? 1_555 ? 
21  AC1 22 HOH K .   ? HOH A 1522 . ? 1_555 ? 
22  AC1 22 MET C 58  ? MET C 61   . ? 1_555 ? 
23  AC2 21 HIS A 191 ? HIS A 194  . ? 1_555 ? 
24  AC2 21 PHE A 195 ? PHE A 198  . ? 1_555 ? 
25  AC2 21 SER A 198 ? SER A 201  . ? 1_555 ? 
26  AC2 21 ARG A 200 ? ARG A 203  . ? 1_555 ? 
27  AC2 21 ASN A 210 ? ASN A 213  . ? 1_555 ? 
28  AC2 21 HIS A 232 ? HIS A 235  . ? 1_555 ? 
29  AC2 21 LYS A 234 ? LYS A 237  . ? 1_555 ? 
30  AC2 21 VAL A 299 ? VAL A 302  . ? 1_555 ? 
31  AC2 21 TRP A 300 ? TRP A 303  . ? 1_555 ? 
32  AC2 21 PRO A 301 ? PRO A 304  . ? 1_555 ? 
33  AC2 21 HIS A 302 ? HIS A 305  . ? 1_555 ? 
34  AC2 21 GLN A 439 ? GLN A 442  . ? 1_555 ? 
35  AC2 21 PHE A 443 ? PHE A 446  . ? 1_555 ? 
36  AC2 21 VAL A 447 ? VAL A 450  . ? 1_555 ? 
37  AC2 21 HOH K .   ? HOH A 1385 . ? 1_555 ? 
38  AC2 21 HOH K .   ? HOH A 1446 . ? 1_555 ? 
39  AC2 21 HOH K .   ? HOH A 1484 . ? 1_555 ? 
40  AC2 21 HOH K .   ? HOH A 1533 . ? 1_555 ? 
41  AC2 21 HOH K .   ? HOH A 1557 . ? 1_555 ? 
42  AC2 21 HOH K .   ? HOH A 1586 . ? 1_555 ? 
43  AC2 21 HOH K .   ? HOH A 1605 . ? 1_555 ? 
44  AC3 22 ARG B 69  ? ARG B 72   . ? 1_555 ? 
45  AC3 22 VAL B 70  ? VAL B 73   . ? 1_555 ? 
46  AC3 22 VAL B 71  ? VAL B 74   . ? 1_555 ? 
47  AC3 22 HIS B 72  ? HIS B 75   . ? 1_555 ? 
48  AC3 22 ARG B 109 ? ARG B 112  . ? 1_555 ? 
49  AC3 22 GLY B 128 ? GLY B 131  . ? 1_555 ? 
50  AC3 22 VAL B 143 ? VAL B 146  . ? 1_555 ? 
51  AC3 22 GLY B 144 ? GLY B 147  . ? 1_555 ? 
52  AC3 22 ASN B 145 ? ASN B 148  . ? 1_555 ? 
53  AC3 22 PHE B 158 ? PHE B 161  . ? 1_555 ? 
54  AC3 22 SER B 214 ? SER B 217  . ? 1_555 ? 
55  AC3 22 HIS B 215 ? HIS B 218  . ? 1_555 ? 
56  AC3 22 PHE B 331 ? PHE B 334  . ? 1_555 ? 
57  AC3 22 MET B 347 ? MET B 350  . ? 1_555 ? 
58  AC3 22 ARG B 351 ? ARG B 354  . ? 1_555 ? 
59  AC3 22 TYR B 355 ? TYR B 358  . ? 1_555 ? 
60  AC3 22 THR B 358 ? THR B 361  . ? 1_555 ? 
61  AC3 22 HIS B 359 ? HIS B 362  . ? 1_555 ? 
62  AC3 22 ARG B 362 ? ARG B 365  . ? 1_555 ? 
63  AC3 22 HOH L .   ? HOH B 1206 . ? 1_555 ? 
64  AC3 22 HOH L .   ? HOH B 1215 . ? 1_555 ? 
65  AC3 22 HOH L .   ? HOH B 1242 . ? 1_555 ? 
66  AC4 22 ARG C 69  ? ARG C 72   . ? 1_555 ? 
67  AC4 22 VAL C 70  ? VAL C 73   . ? 1_555 ? 
68  AC4 22 VAL C 71  ? VAL C 74   . ? 1_555 ? 
69  AC4 22 HIS C 72  ? HIS C 75   . ? 1_555 ? 
70  AC4 22 ARG C 109 ? ARG C 112  . ? 1_555 ? 
71  AC4 22 GLY C 128 ? GLY C 131  . ? 1_555 ? 
72  AC4 22 VAL C 143 ? VAL C 146  . ? 1_555 ? 
73  AC4 22 GLY C 144 ? GLY C 147  . ? 1_555 ? 
74  AC4 22 ASN C 145 ? ASN C 148  . ? 1_555 ? 
75  AC4 22 PHE C 158 ? PHE C 161  . ? 1_555 ? 
76  AC4 22 GLY C 213 ? GLY C 216  . ? 1_555 ? 
77  AC4 22 SER C 214 ? SER C 217  . ? 1_555 ? 
78  AC4 22 PHE C 331 ? PHE C 334  . ? 1_555 ? 
79  AC4 22 MET C 347 ? MET C 350  . ? 1_555 ? 
80  AC4 22 ARG C 351 ? ARG C 354  . ? 1_555 ? 
81  AC4 22 TYR C 355 ? TYR C 358  . ? 1_555 ? 
82  AC4 22 HIS C 359 ? HIS C 362  . ? 1_555 ? 
83  AC4 22 ARG C 362 ? ARG C 365  . ? 1_555 ? 
84  AC4 22 HOH M .   ? HOH C 1307 . ? 1_555 ? 
85  AC4 22 HOH M .   ? HOH C 1328 . ? 1_555 ? 
86  AC4 22 HOH M .   ? HOH C 1475 . ? 1_555 ? 
87  AC4 22 HOH M .   ? HOH C 1497 . ? 1_555 ? 
88  AC5 17 HIS C 191 ? HIS C 194  . ? 1_555 ? 
89  AC5 17 PHE C 195 ? PHE C 198  . ? 1_555 ? 
90  AC5 17 SER C 198 ? SER C 201  . ? 1_555 ? 
91  AC5 17 ARG C 200 ? ARG C 203  . ? 1_555 ? 
92  AC5 17 ASN C 210 ? ASN C 213  . ? 1_555 ? 
93  AC5 17 LYS C 234 ? LYS C 237  . ? 1_555 ? 
94  AC5 17 VAL C 299 ? VAL C 302  . ? 1_555 ? 
95  AC5 17 TRP C 300 ? TRP C 303  . ? 1_555 ? 
96  AC5 17 PRO C 301 ? PRO C 304  . ? 1_555 ? 
97  AC5 17 HIS C 302 ? HIS C 305  . ? 1_555 ? 
98  AC5 17 GLN C 439 ? GLN C 442  . ? 1_555 ? 
99  AC5 17 PHE C 443 ? PHE C 446  . ? 1_555 ? 
100 AC5 17 VAL C 447 ? VAL C 450  . ? 1_555 ? 
101 AC5 17 HOH M .   ? HOH C 1345 . ? 1_555 ? 
102 AC5 17 HOH M .   ? HOH C 1431 . ? 1_555 ? 
103 AC5 17 HOH M .   ? HOH C 1435 . ? 1_555 ? 
104 AC5 17 HOH M .   ? HOH C 1483 . ? 1_555 ? 
105 AC6 21 ARG D 69  ? ARG D 72   . ? 1_555 ? 
106 AC6 21 VAL D 71  ? VAL D 74   . ? 1_555 ? 
107 AC6 21 HIS D 72  ? HIS D 75   . ? 1_555 ? 
108 AC6 21 ARG D 109 ? ARG D 112  . ? 1_555 ? 
109 AC6 21 GLY D 128 ? GLY D 131  . ? 1_555 ? 
110 AC6 21 VAL D 143 ? VAL D 146  . ? 1_555 ? 
111 AC6 21 GLY D 144 ? GLY D 147  . ? 1_555 ? 
112 AC6 21 ASN D 145 ? ASN D 148  . ? 1_555 ? 
113 AC6 21 PHE D 158 ? PHE D 161  . ? 1_555 ? 
114 AC6 21 SER D 214 ? SER D 217  . ? 1_555 ? 
115 AC6 21 PHE D 331 ? PHE D 334  . ? 1_555 ? 
116 AC6 21 MET D 347 ? MET D 350  . ? 1_555 ? 
117 AC6 21 ARG D 351 ? ARG D 354  . ? 1_555 ? 
118 AC6 21 TYR D 355 ? TYR D 358  . ? 1_555 ? 
119 AC6 21 THR D 358 ? THR D 361  . ? 1_555 ? 
120 AC6 21 HIS D 359 ? HIS D 362  . ? 1_555 ? 
121 AC6 21 ARG D 362 ? ARG D 365  . ? 1_555 ? 
122 AC6 21 HOH N .   ? HOH D 1217 . ? 1_555 ? 
123 AC6 21 HOH N .   ? HOH D 1223 . ? 1_555 ? 
124 AC6 21 HOH N .   ? HOH D 1242 . ? 1_555 ? 
125 AC6 21 HOH N .   ? HOH D 1381 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1DGB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1DGB 
_atom_sites.fract_transf_matrix[1][1]   0.011976 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007146 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004388 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 1   ? -7.362  22.758  76.803  1.00 83.42 ? 4    SER A N   1 
ATOM   2     C  CA  . SER A 1 1   ? -6.400  23.351  75.822  1.00 83.11 ? 4    SER A CA  1 
ATOM   3     C  C   . SER A 1 1   ? -5.033  23.645  76.455  1.00 82.49 ? 4    SER A C   1 
ATOM   4     O  O   . SER A 1 1   ? -4.932  23.906  77.663  1.00 82.80 ? 4    SER A O   1 
ATOM   5     C  CB  . SER A 1 1   ? -6.983  24.634  75.217  1.00 83.62 ? 4    SER A CB  1 
ATOM   6     O  OG  . SER A 1 1   ? -7.145  25.646  76.198  1.00 84.23 ? 4    SER A OG  1 
ATOM   7     N  N   . ARG A 1 2   ? -3.987  23.591  75.630  1.00 81.06 ? 5    ARG A N   1 
ATOM   8     C  CA  . ARG A 1 2   ? -2.623  23.849  76.087  1.00 79.20 ? 5    ARG A CA  1 
ATOM   9     C  C   . ARG A 1 2   ? -2.175  25.219  75.578  1.00 78.64 ? 5    ARG A C   1 
ATOM   10    O  O   . ARG A 1 2   ? -3.013  26.078  75.280  1.00 78.75 ? 5    ARG A O   1 
ATOM   11    C  CB  . ARG A 1 2   ? -1.678  22.771  75.559  1.00 78.29 ? 5    ARG A CB  1 
ATOM   12    C  CG  . ARG A 1 2   ? -2.288  21.383  75.434  1.00 76.70 ? 5    ARG A CG  1 
ATOM   13    C  CD  . ARG A 1 2   ? -2.884  21.171  74.051  1.00 75.36 ? 5    ARG A CD  1 
ATOM   14    N  NE  . ARG A 1 2   ? -2.416  19.925  73.439  1.00 74.12 ? 5    ARG A NE  1 
ATOM   15    C  CZ  . ARG A 1 2   ? -2.496  19.641  72.139  1.00 73.28 ? 5    ARG A CZ  1 
ATOM   16    N  NH1 . ARG A 1 2   ? -3.028  20.511  71.287  1.00 73.04 ? 5    ARG A NH1 1 
ATOM   17    N  NH2 . ARG A 1 2   ? -2.025  18.489  71.686  1.00 72.70 ? 5    ARG A NH2 1 
ATOM   18    N  N   . ASP A 1 3   ? -0.862  25.432  75.479  1.00 77.60 ? 6    ASP A N   1 
ATOM   19    C  CA  . ASP A 1 3   ? -0.347  26.709  74.987  1.00 76.37 ? 6    ASP A CA  1 
ATOM   20    C  C   . ASP A 1 3   ? -0.726  26.902  73.521  1.00 75.37 ? 6    ASP A C   1 
ATOM   21    O  O   . ASP A 1 3   ? -0.736  25.947  72.744  1.00 75.61 ? 6    ASP A O   1 
ATOM   22    C  CB  . ASP A 1 3   ? 1.173   26.814  75.177  1.00 76.62 ? 6    ASP A CB  1 
ATOM   23    C  CG  . ASP A 1 3   ? 1.944   25.764  74.404  1.00 76.71 ? 6    ASP A CG  1 
ATOM   24    O  OD1 . ASP A 1 3   ? 1.793   24.566  74.710  1.00 77.13 ? 6    ASP A OD1 1 
ATOM   25    O  OD2 . ASP A 1 3   ? 2.725   26.141  73.508  1.00 76.62 ? 6    ASP A OD2 1 
ATOM   26    N  N   . PRO A 1 4   ? -1.046  28.144  73.128  1.00 74.03 ? 7    PRO A N   1 
ATOM   27    C  CA  . PRO A 1 4   ? -1.432  28.479  71.755  1.00 72.79 ? 7    PRO A CA  1 
ATOM   28    C  C   . PRO A 1 4   ? -0.587  27.780  70.693  1.00 71.51 ? 7    PRO A C   1 
ATOM   29    O  O   . PRO A 1 4   ? -1.124  27.222  69.739  1.00 71.53 ? 7    PRO A O   1 
ATOM   30    C  CB  . PRO A 1 4   ? -1.248  29.989  71.721  1.00 73.09 ? 7    PRO A CB  1 
ATOM   31    C  CG  . PRO A 1 4   ? -1.658  30.381  73.092  1.00 73.17 ? 7    PRO A CG  1 
ATOM   32    C  CD  . PRO A 1 4   ? -0.964  29.362  73.954  1.00 73.63 ? 7    PRO A CD  1 
ATOM   33    N  N   . ALA A 1 5   ? 0.727   27.763  70.896  1.00 70.14 ? 8    ALA A N   1 
ATOM   34    C  CA  . ALA A 1 5   ? 1.635   27.126  69.954  1.00 68.75 ? 8    ALA A CA  1 
ATOM   35    C  C   . ALA A 1 5   ? 1.211   25.692  69.645  1.00 67.99 ? 8    ALA A C   1 
ATOM   36    O  O   . ALA A 1 5   ? 1.029   25.319  68.484  1.00 67.95 ? 8    ALA A O   1 
ATOM   37    C  CB  . ALA A 1 5   ? 3.037   27.143  70.498  1.00 68.44 ? 8    ALA A CB  1 
ATOM   38    N  N   . SER A 1 6   ? 1.008   24.906  70.689  1.00 67.10 ? 9    SER A N   1 
ATOM   39    C  CA  . SER A 1 6   ? 0.614   23.520  70.517  1.00 66.70 ? 9    SER A CA  1 
ATOM   40    C  C   . SER A 1 6   ? -0.786  23.316  69.942  1.00 66.35 ? 9    SER A C   1 
ATOM   41    O  O   . SER A 1 6   ? -1.076  22.261  69.390  1.00 66.39 ? 9    SER A O   1 
ATOM   42    C  CB  . SER A 1 6   ? 0.748   22.783  71.839  1.00 66.84 ? 9    SER A CB  1 
ATOM   43    O  OG  . SER A 1 6   ? 0.126   23.520  72.871  1.00 67.21 ? 9    SER A OG  1 
ATOM   44    N  N   . ASP A 1 7   ? -1.663  24.305  70.084  1.00 66.12 ? 10   ASP A N   1 
ATOM   45    C  CA  . ASP A 1 7   ? -3.025  24.183  69.552  1.00 65.61 ? 10   ASP A CA  1 
ATOM   46    C  C   . ASP A 1 7   ? -3.128  24.654  68.108  1.00 65.48 ? 10   ASP A C   1 
ATOM   47    O  O   . ASP A 1 7   ? -4.228  24.863  67.587  1.00 65.52 ? 10   ASP A O   1 
ATOM   48    C  CB  . ASP A 1 7   ? -4.014  24.973  70.409  1.00 65.30 ? 10   ASP A CB  1 
ATOM   49    C  CG  . ASP A 1 7   ? -4.284  24.321  71.742  1.00 65.11 ? 10   ASP A CG  1 
ATOM   50    O  OD1 . ASP A 1 7   ? -4.133  23.085  71.853  1.00 64.93 ? 10   ASP A OD1 1 
ATOM   51    O  OD2 . ASP A 1 7   ? -4.665  25.047  72.682  1.00 65.40 ? 10   ASP A OD2 1 
ATOM   52    N  N   . GLN A 1 8   ? -1.976  24.809  67.466  1.00 65.38 ? 11   GLN A N   1 
ATOM   53    C  CA  . GLN A 1 8   ? -1.900  25.275  66.090  1.00 65.32 ? 11   GLN A CA  1 
ATOM   54    C  C   . GLN A 1 8   ? -2.927  24.629  65.148  1.00 65.73 ? 11   GLN A C   1 
ATOM   55    O  O   . GLN A 1 8   ? -3.876  25.283  64.723  1.00 65.80 ? 11   GLN A O   1 
ATOM   56    C  CB  . GLN A 1 8   ? -0.472  25.076  65.573  1.00 64.80 ? 11   GLN A CB  1 
ATOM   57    C  CG  . GLN A 1 8   ? -0.146  25.803  64.279  1.00 64.32 ? 11   GLN A CG  1 
ATOM   58    C  CD  . GLN A 1 8   ? -0.726  25.138  63.046  1.00 64.06 ? 11   GLN A CD  1 
ATOM   59    O  OE1 . GLN A 1 8   ? -0.749  23.911  62.944  1.00 64.24 ? 11   GLN A OE1 1 
ATOM   60    N  NE2 . GLN A 1 8   ? -1.194  25.946  62.101  1.00 63.39 ? 11   GLN A NE2 1 
ATOM   61    N  N   . MET A 1 9   ? -2.754  23.347  64.849  1.00 65.97 ? 12   MET A N   1 
ATOM   62    C  CA  . MET A 1 9   ? -3.658  22.647  63.946  1.00 66.44 ? 12   MET A CA  1 
ATOM   63    C  C   . MET A 1 9   ? -5.121  22.714  64.322  1.00 67.27 ? 12   MET A C   1 
ATOM   64    O  O   . MET A 1 9   ? -5.967  22.951  63.466  1.00 67.56 ? 12   MET A O   1 
ATOM   65    C  CB  . MET A 1 9   ? -3.251  21.190  63.799  1.00 66.05 ? 12   MET A CB  1 
ATOM   66    C  CG  . MET A 1 9   ? -1.937  21.007  63.090  1.00 65.34 ? 12   MET A CG  1 
ATOM   67    S  SD  . MET A 1 9   ? -1.729  19.320  62.598  1.00 64.99 ? 12   MET A SD  1 
ATOM   68    C  CE  . MET A 1 9   ? -1.718  18.570  64.189  1.00 64.70 ? 12   MET A CE  1 
ATOM   69    N  N   . GLN A 1 10  ? -5.421  22.498  65.598  1.00 68.38 ? 13   GLN A N   1 
ATOM   70    C  CA  . GLN A 1 10  ? -6.805  22.538  66.054  1.00 69.36 ? 13   GLN A CA  1 
ATOM   71    C  C   . GLN A 1 10  ? -7.456  23.881  65.729  1.00 70.13 ? 13   GLN A C   1 
ATOM   72    O  O   . GLN A 1 10  ? -8.572  23.918  65.217  1.00 70.57 ? 13   GLN A O   1 
ATOM   73    C  CB  . GLN A 1 10  ? -6.907  22.234  67.553  1.00 69.17 ? 13   GLN A CB  1 
ATOM   74    C  CG  . GLN A 1 10  ? -8.337  21.935  68.052  1.00 69.14 ? 13   GLN A CG  1 
ATOM   75    C  CD  . GLN A 1 10  ? -8.957  20.678  67.425  1.00 69.32 ? 13   GLN A CD  1 
ATOM   76    O  OE1 . GLN A 1 10  ? -10.107 20.694  66.980  1.00 69.35 ? 13   GLN A OE1 1 
ATOM   77    N  NE2 . GLN A 1 10  ? -8.201  19.589  67.400  1.00 69.30 ? 13   GLN A NE2 1 
ATOM   78    N  N   . HIS A 1 11  ? -6.754  24.984  65.976  1.00 70.82 ? 14   HIS A N   1 
ATOM   79    C  CA  . HIS A 1 11  ? -7.326  26.291  65.672  1.00 71.52 ? 14   HIS A CA  1 
ATOM   80    C  C   . HIS A 1 11  ? -7.529  26.454  64.185  1.00 70.82 ? 14   HIS A C   1 
ATOM   81    O  O   . HIS A 1 11  ? -8.571  26.943  63.746  1.00 70.79 ? 14   HIS A O   1 
ATOM   82    C  CB  . HIS A 1 11  ? -6.462  27.419  66.220  1.00 73.57 ? 14   HIS A CB  1 
ATOM   83    C  CG  . HIS A 1 11  ? -6.526  27.541  67.708  1.00 75.95 ? 14   HIS A CG  1 
ATOM   84    N  ND1 . HIS A 1 11  ? -5.514  28.100  68.459  1.00 77.22 ? 14   HIS A ND1 1 
ATOM   85    C  CD2 . HIS A 1 11  ? -7.474  27.141  68.593  1.00 76.91 ? 14   HIS A CD2 1 
ATOM   86    C  CE1 . HIS A 1 11  ? -5.832  28.036  69.741  1.00 77.60 ? 14   HIS A CE1 1 
ATOM   87    N  NE2 . HIS A 1 11  ? -7.016  27.458  69.849  1.00 77.66 ? 14   HIS A NE2 1 
ATOM   88    N  N   . TRP A 1 12  ? -6.547  26.009  63.409  1.00 69.95 ? 15   TRP A N   1 
ATOM   89    C  CA  . TRP A 1 12  ? -6.638  26.093  61.961  1.00 69.12 ? 15   TRP A CA  1 
ATOM   90    C  C   . TRP A 1 12  ? -7.896  25.349  61.551  1.00 69.24 ? 15   TRP A C   1 
ATOM   91    O  O   . TRP A 1 12  ? -8.702  25.848  60.770  1.00 69.48 ? 15   TRP A O   1 
ATOM   92    C  CB  . TRP A 1 12  ? -5.428  25.431  61.311  1.00 67.75 ? 15   TRP A CB  1 
ATOM   93    C  CG  . TRP A 1 12  ? -5.375  25.614  59.827  1.00 66.16 ? 15   TRP A CG  1 
ATOM   94    C  CD1 . TRP A 1 12  ? -4.698  26.582  59.154  1.00 65.64 ? 15   TRP A CD1 1 
ATOM   95    C  CD2 . TRP A 1 12  ? -5.999  24.793  58.830  1.00 65.42 ? 15   TRP A CD2 1 
ATOM   96    N  NE1 . TRP A 1 12  ? -4.850  26.416  57.800  1.00 65.33 ? 15   TRP A NE1 1 
ATOM   97    C  CE2 . TRP A 1 12  ? -5.645  25.324  57.572  1.00 65.13 ? 15   TRP A CE2 1 
ATOM   98    C  CE3 . TRP A 1 12  ? -6.819  23.663  58.876  1.00 65.00 ? 15   TRP A CE3 1 
ATOM   99    C  CZ2 . TRP A 1 12  ? -6.083  24.760  56.366  1.00 64.81 ? 15   TRP A CZ2 1 
ATOM   100   C  CZ3 . TRP A 1 12  ? -7.257  23.102  57.676  1.00 64.67 ? 15   TRP A CZ3 1 
ATOM   101   C  CH2 . TRP A 1 12  ? -6.887  23.653  56.441  1.00 64.42 ? 15   TRP A CH2 1 
ATOM   102   N  N   . LYS A 1 13  ? -8.056  24.153  62.106  1.00 69.37 ? 16   LYS A N   1 
ATOM   103   C  CA  . LYS A 1 13  ? -9.206  23.308  61.827  1.00 69.44 ? 16   LYS A CA  1 
ATOM   104   C  C   . LYS A 1 13  ? -10.495 24.067  62.104  1.00 69.91 ? 16   LYS A C   1 
ATOM   105   O  O   . LYS A 1 13  ? -11.292 24.321  61.193  1.00 69.85 ? 16   LYS A O   1 
ATOM   106   C  CB  . LYS A 1 13  ? -9.144  22.055  62.700  1.00 68.94 ? 16   LYS A CB  1 
ATOM   107   C  CG  . LYS A 1 13  ? -10.355 21.146  62.611  1.00 68.27 ? 16   LYS A CG  1 
ATOM   108   C  CD  . LYS A 1 13  ? -10.167 19.929  63.498  1.00 67.92 ? 16   LYS A CD  1 
ATOM   109   C  CE  . LYS A 1 13  ? -11.264 18.896  63.286  1.00 67.51 ? 16   LYS A CE  1 
ATOM   110   N  NZ  . LYS A 1 13  ? -10.920 17.607  63.966  1.00 66.99 ? 16   LYS A NZ  1 
ATOM   111   N  N   . GLU A 1 14  ? -10.662 24.475  63.357  1.00 70.54 ? 17   GLU A N   1 
ATOM   112   C  CA  . GLU A 1 14  ? -11.853 25.195  63.786  1.00 71.27 ? 17   GLU A CA  1 
ATOM   113   C  C   . GLU A 1 14  ? -12.188 26.395  62.911  1.00 72.07 ? 17   GLU A C   1 
ATOM   114   O  O   . GLU A 1 14  ? -13.353 26.626  62.597  1.00 72.33 ? 17   GLU A O   1 
ATOM   115   C  CB  . GLU A 1 14  ? -11.714 25.611  65.249  1.00 70.87 ? 17   GLU A CB  1 
ATOM   116   C  CG  . GLU A 1 14  ? -11.613 24.425  66.189  1.00 70.38 ? 17   GLU A CG  1 
ATOM   117   C  CD  . GLU A 1 14  ? -11.326 24.817  67.621  1.00 70.44 ? 17   GLU A CD  1 
ATOM   118   O  OE1 . GLU A 1 14  ? -11.603 23.996  68.521  1.00 70.41 ? 17   GLU A OE1 1 
ATOM   119   O  OE2 . GLU A 1 14  ? -10.810 25.932  67.853  1.00 70.74 ? 17   GLU A OE2 1 
ATOM   120   N  N   . GLN A 1 15  ? -11.169 27.130  62.482  1.00 72.97 ? 18   GLN A N   1 
ATOM   121   C  CA  . GLN A 1 15  ? -11.391 28.298  61.637  1.00 73.93 ? 18   GLN A CA  1 
ATOM   122   C  C   . GLN A 1 15  ? -11.969 27.934  60.281  1.00 74.03 ? 18   GLN A C   1 
ATOM   123   O  O   . GLN A 1 15  ? -12.402 28.803  59.534  1.00 73.92 ? 18   GLN A O   1 
ATOM   124   C  CB  . GLN A 1 15  ? -10.098 29.092  61.474  1.00 74.89 ? 18   GLN A CB  1 
ATOM   125   C  CG  . GLN A 1 15  ? -9.758  29.913  62.707  1.00 76.38 ? 18   GLN A CG  1 
ATOM   126   C  CD  . GLN A 1 15  ? -8.293  30.284  62.784  1.00 77.46 ? 18   GLN A CD  1 
ATOM   127   O  OE1 . GLN A 1 15  ? -7.703  30.289  63.873  1.00 77.98 ? 18   GLN A OE1 1 
ATOM   128   N  NE2 . GLN A 1 15  ? -7.691  30.591  61.629  1.00 77.29 ? 18   GLN A NE2 1 
ATOM   129   N  N   . ARG A 1 16  ? -12.001 26.640  59.983  1.00 74.19 ? 19   ARG A N   1 
ATOM   130   C  CA  . ARG A 1 16  ? -12.529 26.159  58.718  1.00 74.45 ? 19   ARG A CA  1 
ATOM   131   C  C   . ARG A 1 16  ? -13.672 25.188  58.911  1.00 75.13 ? 19   ARG A C   1 
ATOM   132   O  O   . ARG A 1 16  ? -14.142 24.573  57.951  1.00 75.56 ? 19   ARG A O   1 
ATOM   133   C  CB  . ARG A 1 16  ? -11.412 25.525  57.902  1.00 73.74 ? 19   ARG A CB  1 
ATOM   134   C  CG  . ARG A 1 16  ? -10.484 26.577  57.379  1.00 72.99 ? 19   ARG A CG  1 
ATOM   135   C  CD  . ARG A 1 16  ? -9.133  26.051  57.005  1.00 71.92 ? 19   ARG A CD  1 
ATOM   136   N  NE  . ARG A 1 16  ? -8.264  27.168  56.643  1.00 71.17 ? 19   ARG A NE  1 
ATOM   137   C  CZ  . ARG A 1 16  ? -7.771  28.054  57.507  1.00 70.57 ? 19   ARG A CZ  1 
ATOM   138   N  NH1 . ARG A 1 16  ? -8.039  27.960  58.804  1.00 70.00 ? 19   ARG A NH1 1 
ATOM   139   N  NH2 . ARG A 1 16  ? -7.052  29.077  57.065  1.00 70.46 ? 19   ARG A NH2 1 
ATOM   140   N  N   . ALA A 1 17  ? -14.140 25.083  60.152  1.00 75.58 ? 20   ALA A N   1 
ATOM   141   C  CA  . ALA A 1 17  ? -15.240 24.190  60.499  1.00 76.08 ? 20   ALA A CA  1 
ATOM   142   C  C   . ALA A 1 17  ? -16.419 24.356  59.553  1.00 76.37 ? 20   ALA A C   1 
ATOM   143   O  O   . ALA A 1 17  ? -17.094 23.382  59.218  1.00 76.35 ? 20   ALA A O   1 
ATOM   144   C  CB  . ALA A 1 17  ? -15.680 24.436  61.932  1.00 75.98 ? 20   ALA A CB  1 
ATOM   145   N  N   . ALA A 1 18  ? -16.618 25.578  59.073  1.00 76.63 ? 21   ALA A N   1 
ATOM   146   C  CA  . ALA A 1 18  ? -17.725 25.865  58.174  1.00 77.00 ? 21   ALA A CA  1 
ATOM   147   C  C   . ALA A 1 18  ? -17.395 25.825  56.679  1.00 77.31 ? 21   ALA A C   1 
ATOM   148   O  O   . ALA A 1 18  ? -17.768 26.745  55.941  1.00 78.08 ? 21   ALA A O   1 
ATOM   149   C  CB  . ALA A 1 18  ? -18.367 27.206  58.546  1.00 76.62 ? 21   ALA A CB  1 
ATOM   150   N  N   . GLN A 1 19  ? -16.700 24.776  56.230  1.00 77.11 ? 22   GLN A N   1 
ATOM   151   C  CA  . GLN A 1 19  ? -16.366 24.616  54.807  1.00 76.42 ? 22   GLN A CA  1 
ATOM   152   C  C   . GLN A 1 19  ? -15.745 23.268  54.466  1.00 76.03 ? 22   GLN A C   1 
ATOM   153   O  O   . GLN A 1 19  ? -14.958 22.711  55.240  1.00 75.95 ? 22   GLN A O   1 
ATOM   154   C  CB  . GLN A 1 19  ? -15.484 25.758  54.289  1.00 76.64 ? 22   GLN A CB  1 
ATOM   155   C  CG  . GLN A 1 19  ? -14.183 25.963  55.032  1.00 76.95 ? 22   GLN A CG  1 
ATOM   156   C  CD  . GLN A 1 19  ? -13.365 27.098  54.443  1.00 77.27 ? 22   GLN A CD  1 
ATOM   157   O  OE1 . GLN A 1 19  ? -13.915 28.108  53.998  1.00 77.22 ? 22   GLN A OE1 1 
ATOM   158   N  NE2 . GLN A 1 19  ? -12.046 26.935  54.428  1.00 77.35 ? 22   GLN A NE2 1 
ATOM   159   N  N   . LYS A 1 20  ? -16.125 22.752  53.301  1.00 75.44 ? 23   LYS A N   1 
ATOM   160   C  CA  . LYS A 1 20  ? -15.642 21.468  52.807  1.00 74.66 ? 23   LYS A CA  1 
ATOM   161   C  C   . LYS A 1 20  ? -14.136 21.527  52.563  1.00 73.61 ? 23   LYS A C   1 
ATOM   162   O  O   . LYS A 1 20  ? -13.599 22.570  52.184  1.00 73.67 ? 23   LYS A O   1 
ATOM   163   C  CB  . LYS A 1 20  ? -16.377 21.118  51.511  1.00 75.38 ? 23   LYS A CB  1 
ATOM   164   C  CG  . LYS A 1 20  ? -16.260 19.664  51.084  1.00 76.13 ? 23   LYS A CG  1 
ATOM   165   C  CD  . LYS A 1 20  ? -17.150 19.368  49.875  1.00 76.74 ? 23   LYS A CD  1 
ATOM   166   C  CE  . LYS A 1 20  ? -17.112 17.880  49.502  1.00 77.22 ? 23   LYS A CE  1 
ATOM   167   N  NZ  . LYS A 1 20  ? -18.021 17.536  48.357  1.00 77.28 ? 23   LYS A NZ  1 
ATOM   168   N  N   . ALA A 1 21  ? -13.454 20.416  52.814  1.00 72.19 ? 24   ALA A N   1 
ATOM   169   C  CA  . ALA A 1 21  ? -12.012 20.349  52.616  1.00 70.68 ? 24   ALA A CA  1 
ATOM   170   C  C   . ALA A 1 21  ? -11.686 20.439  51.138  1.00 69.48 ? 24   ALA A C   1 
ATOM   171   O  O   . ALA A 1 21  ? -12.363 19.839  50.306  1.00 69.57 ? 24   ALA A O   1 
ATOM   172   C  CB  . ALA A 1 21  ? -11.457 19.065  53.193  1.00 70.69 ? 24   ALA A CB  1 
ATOM   173   N  N   . ASP A 1 22  ? -10.636 21.175  50.814  1.00 68.26 ? 25   ASP A N   1 
ATOM   174   C  CA  . ASP A 1 22  ? -10.246 21.339  49.430  1.00 67.15 ? 25   ASP A CA  1 
ATOM   175   C  C   . ASP A 1 22  ? -9.808  20.047  48.754  1.00 66.18 ? 25   ASP A C   1 
ATOM   176   O  O   . ASP A 1 22  ? -9.430  19.074  49.402  1.00 65.83 ? 25   ASP A O   1 
ATOM   177   C  CB  . ASP A 1 22  ? -9.167  22.421  49.298  1.00 67.38 ? 25   ASP A CB  1 
ATOM   178   C  CG  . ASP A 1 22  ? -9.730  23.837  49.449  1.00 67.70 ? 25   ASP A CG  1 
ATOM   179   O  OD1 . ASP A 1 22  ? -9.184  24.623  50.250  1.00 67.96 ? 25   ASP A OD1 1 
ATOM   180   O  OD2 . ASP A 1 22  ? -10.723 24.170  48.766  1.00 67.81 ? 25   ASP A OD2 1 
ATOM   181   N  N   . VAL A 1 23  ? -9.918  20.039  47.433  1.00 65.25 ? 26   VAL A N   1 
ATOM   182   C  CA  . VAL A 1 23  ? -9.541  18.896  46.628  1.00 64.26 ? 26   VAL A CA  1 
ATOM   183   C  C   . VAL A 1 23  ? -8.028  18.811  46.560  1.00 64.08 ? 26   VAL A C   1 
ATOM   184   O  O   . VAL A 1 23  ? -7.358  19.789  46.237  1.00 64.35 ? 26   VAL A O   1 
ATOM   185   C  CB  . VAL A 1 23  ? -10.097 19.034  45.203  1.00 63.78 ? 26   VAL A CB  1 
ATOM   186   C  CG1 . VAL A 1 23  ? -9.585  17.919  44.327  1.00 63.35 ? 26   VAL A CG1 1 
ATOM   187   C  CG2 . VAL A 1 23  ? -11.606 19.004  45.237  1.00 63.32 ? 26   VAL A CG2 1 
ATOM   188   N  N   . LEU A 1 24  ? -7.500  17.638  46.889  1.00 63.56 ? 27   LEU A N   1 
ATOM   189   C  CA  . LEU A 1 24  ? -6.064  17.379  46.866  1.00 62.65 ? 27   LEU A CA  1 
ATOM   190   C  C   . LEU A 1 24  ? -5.589  17.334  45.415  1.00 62.58 ? 27   LEU A C   1 
ATOM   191   O  O   . LEU A 1 24  ? -6.076  16.527  44.619  1.00 62.57 ? 27   LEU A O   1 
ATOM   192   C  CB  . LEU A 1 24  ? -5.794  16.049  47.571  1.00 62.09 ? 27   LEU A CB  1 
ATOM   193   C  CG  . LEU A 1 24  ? -4.390  15.467  47.624  1.00 61.24 ? 27   LEU A CG  1 
ATOM   194   C  CD1 . LEU A 1 24  ? -3.397  16.546  47.923  1.00 61.24 ? 27   LEU A CD1 1 
ATOM   195   C  CD2 . LEU A 1 24  ? -4.353  14.390  48.684  1.00 60.68 ? 27   LEU A CD2 1 
ATOM   196   N  N   . THR A 1 25  ? -4.635  18.192  45.068  1.00 62.28 ? 28   THR A N   1 
ATOM   197   C  CA  . THR A 1 25  ? -4.147  18.234  43.692  1.00 62.00 ? 28   THR A CA  1 
ATOM   198   C  C   . THR A 1 25  ? -2.653  18.032  43.535  1.00 61.98 ? 28   THR A C   1 
ATOM   199   O  O   . THR A 1 25  ? -1.888  18.120  44.497  1.00 61.83 ? 28   THR A O   1 
ATOM   200   C  CB  . THR A 1 25  ? -4.446  19.597  43.018  1.00 61.86 ? 28   THR A CB  1 
ATOM   201   O  OG1 . THR A 1 25  ? -3.546  20.589  43.528  1.00 60.96 ? 28   THR A OG1 1 
ATOM   202   C  CG2 . THR A 1 25  ? -5.873  20.035  43.284  1.00 61.61 ? 28   THR A CG2 1 
ATOM   203   N  N   . THR A 1 26  ? -2.252  17.779  42.292  1.00 61.91 ? 29   THR A N   1 
ATOM   204   C  CA  . THR A 1 26  ? -0.850  17.639  41.944  1.00 61.77 ? 29   THR A CA  1 
ATOM   205   C  C   . THR A 1 26  ? -0.391  19.089  41.904  1.00 61.98 ? 29   THR A C   1 
ATOM   206   O  O   . THR A 1 26  ? -1.205  20.006  42.029  1.00 62.00 ? 29   THR A O   1 
ATOM   207   C  CB  . THR A 1 26  ? -0.667  17.065  40.525  1.00 61.59 ? 29   THR A CB  1 
ATOM   208   O  OG1 . THR A 1 26  ? -1.398  17.867  39.588  1.00 61.80 ? 29   THR A OG1 1 
ATOM   209   C  CG2 . THR A 1 26  ? -1.144  15.629  40.450  1.00 61.43 ? 29   THR A CG2 1 
ATOM   210   N  N   . GLY A 1 27  ? 0.902   19.308  41.724  1.00 62.03 ? 30   GLY A N   1 
ATOM   211   C  CA  . GLY A 1 27  ? 1.387   20.670  41.658  1.00 62.15 ? 30   GLY A CA  1 
ATOM   212   C  C   . GLY A 1 27  ? 0.811   21.352  40.434  1.00 62.46 ? 30   GLY A C   1 
ATOM   213   O  O   . GLY A 1 27  ? 0.650   22.570  40.416  1.00 62.66 ? 30   GLY A O   1 
ATOM   214   N  N   . ALA A 1 28  ? 0.459   20.554  39.428  1.00 62.71 ? 31   ALA A N   1 
ATOM   215   C  CA  . ALA A 1 28  ? -0.102  21.065  38.179  1.00 62.91 ? 31   ALA A CA  1 
ATOM   216   C  C   . ALA A 1 28  ? -1.594  21.349  38.295  1.00 63.07 ? 31   ALA A C   1 
ATOM   217   O  O   . ALA A 1 28  ? -2.242  21.734  37.318  1.00 63.22 ? 31   ALA A O   1 
ATOM   218   C  CB  . ALA A 1 28  ? 0.156   20.079  37.040  1.00 63.06 ? 31   ALA A CB  1 
ATOM   219   N  N   . GLY A 1 29  ? -2.135  21.152  39.490  1.00 63.17 ? 32   GLY A N   1 
ATOM   220   C  CA  . GLY A 1 29  ? -3.547  21.398  39.705  1.00 63.15 ? 32   GLY A CA  1 
ATOM   221   C  C   . GLY A 1 29  ? -4.421  20.229  39.294  1.00 63.28 ? 32   GLY A C   1 
ATOM   222   O  O   . GLY A 1 29  ? -5.645  20.338  39.301  1.00 63.29 ? 32   GLY A O   1 
ATOM   223   N  N   . ASN A 1 30  ? -3.806  19.121  38.897  1.00 63.27 ? 33   ASN A N   1 
ATOM   224   C  CA  . ASN A 1 30  ? -4.573  17.952  38.508  1.00 63.10 ? 33   ASN A CA  1 
ATOM   225   C  C   . ASN A 1 30  ? -5.033  17.255  39.773  1.00 63.10 ? 33   ASN A C   1 
ATOM   226   O  O   . ASN A 1 30  ? -4.240  16.997  40.674  1.00 63.32 ? 33   ASN A O   1 
ATOM   227   C  CB  . ASN A 1 30  ? -3.725  17.016  37.661  1.00 63.23 ? 33   ASN A CB  1 
ATOM   228   C  CG  . ASN A 1 30  ? -3.150  17.704  36.443  1.00 63.53 ? 33   ASN A CG  1 
ATOM   229   O  OD1 . ASN A 1 30  ? -1.961  17.585  36.162  1.00 63.97 ? 33   ASN A OD1 1 
ATOM   230   N  ND2 . ASN A 1 30  ? -3.989  18.447  35.724  1.00 63.55 ? 33   ASN A ND2 1 
ATOM   231   N  N   . PRO A 1 31  ? -6.340  16.996  39.878  1.00 63.09 ? 34   PRO A N   1 
ATOM   232   C  CA  . PRO A 1 31  ? -6.980  16.333  41.017  1.00 63.10 ? 34   PRO A CA  1 
ATOM   233   C  C   . PRO A 1 31  ? -6.447  14.927  41.213  1.00 63.11 ? 34   PRO A C   1 
ATOM   234   O  O   . PRO A 1 31  ? -6.275  14.183  40.252  1.00 63.03 ? 34   PRO A O   1 
ATOM   235   C  CB  . PRO A 1 31  ? -8.448  16.295  40.599  1.00 63.19 ? 34   PRO A CB  1 
ATOM   236   C  CG  . PRO A 1 31  ? -8.583  17.508  39.726  1.00 63.21 ? 34   PRO A CG  1 
ATOM   237   C  CD  . PRO A 1 31  ? -7.347  17.406  38.887  1.00 63.25 ? 34   PRO A CD  1 
ATOM   238   N  N   . VAL A 1 32  ? -6.218  14.557  42.466  1.00 63.11 ? 35   VAL A N   1 
ATOM   239   C  CA  . VAL A 1 32  ? -5.704  13.240  42.794  1.00 62.88 ? 35   VAL A CA  1 
ATOM   240   C  C   . VAL A 1 32  ? -6.824  12.290  43.222  1.00 63.11 ? 35   VAL A C   1 
ATOM   241   O  O   . VAL A 1 32  ? -7.674  12.647  44.038  1.00 63.22 ? 35   VAL A O   1 
ATOM   242   C  CB  . VAL A 1 32  ? -4.672  13.341  43.918  1.00 62.62 ? 35   VAL A CB  1 
ATOM   243   C  CG1 . VAL A 1 32  ? -4.055  11.996  44.178  1.00 62.83 ? 35   VAL A CG1 1 
ATOM   244   C  CG2 . VAL A 1 32  ? -3.603  14.348  43.550  1.00 62.32 ? 35   VAL A CG2 1 
ATOM   245   N  N   . GLY A 1 33  ? -6.810  11.077  42.668  1.00 63.23 ? 36   GLY A N   1 
ATOM   246   C  CA  . GLY A 1 33  ? -7.811  10.068  42.993  1.00 62.96 ? 36   GLY A CA  1 
ATOM   247   C  C   . GLY A 1 33  ? -7.515  9.238   44.241  1.00 62.81 ? 36   GLY A C   1 
ATOM   248   O  O   . GLY A 1 33  ? -8.433  8.838   44.961  1.00 63.24 ? 36   GLY A O   1 
ATOM   249   N  N   . ASP A 1 34  ? -6.239  8.954   44.484  1.00 62.15 ? 37   ASP A N   1 
ATOM   250   C  CA  . ASP A 1 34  ? -5.813  8.187   45.647  1.00 61.35 ? 37   ASP A CA  1 
ATOM   251   C  C   . ASP A 1 34  ? -4.353  8.522   45.866  1.00 60.68 ? 37   ASP A C   1 
ATOM   252   O  O   . ASP A 1 34  ? -3.502  8.150   45.061  1.00 60.62 ? 37   ASP A O   1 
ATOM   253   C  CB  . ASP A 1 34  ? -5.967  6.685   45.392  1.00 61.89 ? 37   ASP A CB  1 
ATOM   254   C  CG  . ASP A 1 34  ? -5.451  5.826   46.545  1.00 62.34 ? 37   ASP A CG  1 
ATOM   255   O  OD1 . ASP A 1 34  ? -4.942  6.369   47.553  1.00 62.81 ? 37   ASP A OD1 1 
ATOM   256   O  OD2 . ASP A 1 34  ? -5.559  4.585   46.442  1.00 62.60 ? 37   ASP A OD2 1 
ATOM   257   N  N   . LYS A 1 35  ? -4.065  9.233   46.950  1.00 59.84 ? 38   LYS A N   1 
ATOM   258   C  CA  . LYS A 1 35  ? -2.691  9.611   47.252  1.00 59.08 ? 38   LYS A CA  1 
ATOM   259   C  C   . LYS A 1 35  ? -2.171  8.802   48.431  1.00 58.86 ? 38   LYS A C   1 
ATOM   260   O  O   . LYS A 1 35  ? -1.329  9.265   49.202  1.00 58.84 ? 38   LYS A O   1 
ATOM   261   C  CB  . LYS A 1 35  ? -2.590  11.109  47.553  1.00 58.55 ? 38   LYS A CB  1 
ATOM   262   C  CG  . LYS A 1 35  ? -1.277  11.720  47.075  1.00 58.05 ? 38   LYS A CG  1 
ATOM   263   C  CD  . LYS A 1 35  ? -0.904  12.964  47.848  1.00 57.80 ? 38   LYS A CD  1 
ATOM   264   C  CE  . LYS A 1 35  ? -0.612  12.625  49.299  1.00 58.02 ? 38   LYS A CE  1 
ATOM   265   N  NZ  . LYS A 1 35  ? 0.504   11.637  49.432  1.00 58.29 ? 38   LYS A NZ  1 
ATOM   266   N  N   . LEU A 1 36  ? -2.657  7.578   48.558  1.00 58.77 ? 39   LEU A N   1 
ATOM   267   C  CA  . LEU A 1 36  ? -2.234  6.729   49.648  1.00 58.88 ? 39   LEU A CA  1 
ATOM   268   C  C   . LEU A 1 36  ? -1.674  5.405   49.149  1.00 59.09 ? 39   LEU A C   1 
ATOM   269   O  O   . LEU A 1 36  ? -1.229  4.574   49.938  1.00 59.30 ? 39   LEU A O   1 
ATOM   270   C  CB  . LEU A 1 36  ? -3.404  6.509   50.606  1.00 58.92 ? 39   LEU A CB  1 
ATOM   271   C  CG  . LEU A 1 36  ? -3.877  7.794   51.297  1.00 58.62 ? 39   LEU A CG  1 
ATOM   272   C  CD1 . LEU A 1 36  ? -5.110  7.551   52.139  1.00 58.47 ? 39   LEU A CD1 1 
ATOM   273   C  CD2 . LEU A 1 36  ? -2.759  8.326   52.167  1.00 58.81 ? 39   LEU A CD2 1 
ATOM   274   N  N   . ASN A 1 37  ? -1.688  5.216   47.834  1.00 59.43 ? 40   ASN A N   1 
ATOM   275   C  CA  . ASN A 1 37  ? -1.173  3.992   47.225  1.00 59.71 ? 40   ASN A CA  1 
ATOM   276   C  C   . ASN A 1 37  ? -0.608  4.308   45.849  1.00 59.82 ? 40   ASN A C   1 
ATOM   277   O  O   . ASN A 1 37  ? -1.151  5.147   45.128  1.00 60.04 ? 40   ASN A O   1 
ATOM   278   C  CB  . ASN A 1 37  ? -2.287  2.959   47.076  1.00 59.84 ? 40   ASN A CB  1 
ATOM   279   C  CG  . ASN A 1 37  ? -2.999  2.673   48.385  1.00 60.03 ? 40   ASN A CG  1 
ATOM   280   O  OD1 . ASN A 1 37  ? -2.468  1.989   49.262  1.00 59.84 ? 40   ASN A OD1 1 
ATOM   281   N  ND2 . ASN A 1 37  ? -4.208  3.203   48.523  1.00 60.12 ? 40   ASN A ND2 1 
ATOM   282   N  N   . VAL A 1 38  ? 0.492   3.648   45.492  1.00 59.77 ? 41   VAL A N   1 
ATOM   283   C  CA  . VAL A 1 38  ? 1.114   3.866   44.190  1.00 59.28 ? 41   VAL A CA  1 
ATOM   284   C  C   . VAL A 1 38  ? 0.570   2.915   43.154  1.00 59.51 ? 41   VAL A C   1 
ATOM   285   O  O   . VAL A 1 38  ? -0.090  1.937   43.489  1.00 59.43 ? 41   VAL A O   1 
ATOM   286   C  CB  . VAL A 1 38  ? 2.631   3.684   44.235  1.00 58.78 ? 41   VAL A CB  1 
ATOM   287   C  CG1 . VAL A 1 38  ? 3.270   4.823   44.996  1.00 58.13 ? 41   VAL A CG1 1 
ATOM   288   C  CG2 . VAL A 1 38  ? 2.977   2.343   44.861  1.00 58.26 ? 41   VAL A CG2 1 
ATOM   289   N  N   . ILE A 1 39  ? 0.846   3.211   41.890  1.00 59.84 ? 42   ILE A N   1 
ATOM   290   C  CA  . ILE A 1 39  ? 0.381   2.366   40.807  1.00 60.45 ? 42   ILE A CA  1 
ATOM   291   C  C   . ILE A 1 39  ? 1.398   1.255   40.597  1.00 61.27 ? 42   ILE A C   1 
ATOM   292   O  O   . ILE A 1 39  ? 2.593   1.528   40.440  1.00 61.75 ? 42   ILE A O   1 
ATOM   293   C  CB  . ILE A 1 39  ? 0.260   3.147   39.490  1.00 60.02 ? 42   ILE A CB  1 
ATOM   294   C  CG1 . ILE A 1 39  ? -0.571  4.413   39.689  1.00 59.88 ? 42   ILE A CG1 1 
ATOM   295   C  CG2 . ILE A 1 39  ? -0.396  2.277   38.432  1.00 60.10 ? 42   ILE A CG2 1 
ATOM   296   C  CD1 . ILE A 1 39  ? -0.797  5.213   38.410  1.00 59.13 ? 42   ILE A CD1 1 
ATOM   297   N  N   . THR A 1 40  ? 0.934   0.006   40.629  1.00 61.65 ? 43   THR A N   1 
ATOM   298   C  CA  . THR A 1 40  ? 1.803   -1.153  40.414  1.00 61.69 ? 43   THR A CA  1 
ATOM   299   C  C   . THR A 1 40  ? 1.060   -2.163  39.555  1.00 62.10 ? 43   THR A C   1 
ATOM   300   O  O   . THR A 1 40  ? -0.166  -2.127  39.465  1.00 62.28 ? 43   THR A O   1 
ATOM   301   C  CB  . THR A 1 40  ? 2.186   -1.866  41.735  1.00 61.70 ? 43   THR A CB  1 
ATOM   302   O  OG1 . THR A 1 40  ? 1.006   -2.364  42.375  1.00 61.47 ? 43   THR A OG1 1 
ATOM   303   C  CG2 . THR A 1 40  ? 2.918   -0.925  42.677  1.00 61.27 ? 43   THR A CG2 1 
ATOM   304   N  N   . VAL A 1 41  ? 1.802   -3.041  38.893  1.00 62.80 ? 44   VAL A N   1 
ATOM   305   C  CA  . VAL A 1 41  ? 1.185   -4.069  38.069  1.00 63.34 ? 44   VAL A CA  1 
ATOM   306   C  C   . VAL A 1 41  ? 0.890   -5.244  38.984  1.00 63.41 ? 44   VAL A C   1 
ATOM   307   O  O   . VAL A 1 41  ? 1.780   -6.034  39.302  1.00 63.42 ? 44   VAL A O   1 
ATOM   308   C  CB  . VAL A 1 41  ? 2.102   -4.502  36.898  1.00 63.39 ? 44   VAL A CB  1 
ATOM   309   C  CG1 . VAL A 1 41  ? 3.535   -4.645  37.367  1.00 63.34 ? 44   VAL A CG1 1 
ATOM   310   C  CG2 . VAL A 1 41  ? 1.600   -5.806  36.290  1.00 63.64 ? 44   VAL A CG2 1 
ATOM   311   N  N   . GLY A 1 42  ? -0.358  -5.339  39.431  1.00 63.40 ? 45   GLY A N   1 
ATOM   312   C  CA  . GLY A 1 42  ? -0.726  -6.406  40.339  1.00 63.47 ? 45   GLY A CA  1 
ATOM   313   C  C   . GLY A 1 42  ? -0.455  -5.961  41.767  1.00 63.46 ? 45   GLY A C   1 
ATOM   314   O  O   . GLY A 1 42  ? 0.259   -4.983  41.989  1.00 63.45 ? 45   GLY A O   1 
ATOM   315   N  N   . PRO A 1 43  ? -1.005  -6.668  42.759  1.00 63.50 ? 46   PRO A N   1 
ATOM   316   C  CA  . PRO A 1 43  ? -0.849  -6.373  44.184  1.00 63.53 ? 46   PRO A CA  1 
ATOM   317   C  C   . PRO A 1 43  ? 0.588   -6.435  44.641  1.00 63.72 ? 46   PRO A C   1 
ATOM   318   O  O   . PRO A 1 43  ? 0.990   -5.700  45.538  1.00 63.82 ? 46   PRO A O   1 
ATOM   319   C  CB  . PRO A 1 43  ? -1.654  -7.483  44.850  1.00 63.51 ? 46   PRO A CB  1 
ATOM   320   C  CG  . PRO A 1 43  ? -2.668  -7.844  43.807  1.00 63.59 ? 46   PRO A CG  1 
ATOM   321   C  CD  . PRO A 1 43  ? -1.837  -7.862  42.569  1.00 63.40 ? 46   PRO A CD  1 
ATOM   322   N  N   . ARG A 1 44  ? 1.356   -7.331  44.035  1.00 63.83 ? 47   ARG A N   1 
ATOM   323   C  CA  . ARG A 1 44  ? 2.754   -7.497  44.411  1.00 63.80 ? 47   ARG A CA  1 
ATOM   324   C  C   . ARG A 1 44  ? 3.697   -7.280  43.241  1.00 63.61 ? 47   ARG A C   1 
ATOM   325   O  O   . ARG A 1 44  ? 4.673   -8.010  43.067  1.00 63.60 ? 47   ARG A O   1 
ATOM   326   C  CB  . ARG A 1 44  ? 2.954   -8.874  45.043  1.00 64.01 ? 47   ARG A CB  1 
ATOM   327   C  CG  . ARG A 1 44  ? 2.100   -9.054  46.291  1.00 64.17 ? 47   ARG A CG  1 
ATOM   328   C  CD  . ARG A 1 44  ? 2.127   -10.466 46.835  1.00 64.30 ? 47   ARG A CD  1 
ATOM   329   N  NE  . ARG A 1 44  ? 1.337   -10.559 48.061  1.00 64.54 ? 47   ARG A NE  1 
ATOM   330   C  CZ  . ARG A 1 44  ? 1.414   -11.555 48.941  1.00 64.64 ? 47   ARG A CZ  1 
ATOM   331   N  NH1 . ARG A 1 44  ? 0.652   -11.539 50.028  1.00 64.83 ? 47   ARG A NH1 1 
ATOM   332   N  NH2 . ARG A 1 44  ? 2.242   -12.571 48.737  1.00 64.42 ? 47   ARG A NH2 1 
ATOM   333   N  N   . GLY A 1 45  ? 3.398   -6.251  42.452  1.00 63.23 ? 48   GLY A N   1 
ATOM   334   C  CA  . GLY A 1 45  ? 4.217   -5.926  41.300  1.00 62.52 ? 48   GLY A CA  1 
ATOM   335   C  C   . GLY A 1 45  ? 5.016   -4.649  41.475  1.00 62.01 ? 48   GLY A C   1 
ATOM   336   O  O   . GLY A 1 45  ? 4.801   -3.908  42.430  1.00 61.99 ? 48   GLY A O   1 
ATOM   337   N  N   . PRO A 1 46  ? 5.948   -4.365  40.553  1.00 61.63 ? 49   PRO A N   1 
ATOM   338   C  CA  . PRO A 1 46  ? 6.810   -3.180  40.563  1.00 61.51 ? 49   PRO A CA  1 
ATOM   339   C  C   . PRO A 1 46  ? 6.081   -1.871  40.278  1.00 61.64 ? 49   PRO A C   1 
ATOM   340   O  O   . PRO A 1 46  ? 4.972   -1.864  39.738  1.00 62.00 ? 49   PRO A O   1 
ATOM   341   C  CB  . PRO A 1 46  ? 7.828   -3.505  39.479  1.00 61.36 ? 49   PRO A CB  1 
ATOM   342   C  CG  . PRO A 1 46  ? 7.034   -4.328  38.522  1.00 61.35 ? 49   PRO A CG  1 
ATOM   343   C  CD  . PRO A 1 46  ? 6.310   -5.257  39.443  1.00 61.38 ? 49   PRO A CD  1 
ATOM   344   N  N   . LEU A 1 47  ? 6.733   -0.763  40.623  1.00 61.28 ? 50   LEU A N   1 
ATOM   345   C  CA  . LEU A 1 47  ? 6.172   0.569   40.446  1.00 60.74 ? 50   LEU A CA  1 
ATOM   346   C  C   . LEU A 1 47  ? 6.288   1.069   39.012  1.00 60.61 ? 50   LEU A C   1 
ATOM   347   O  O   . LEU A 1 47  ? 7.268   0.773   38.323  1.00 60.91 ? 50   LEU A O   1 
ATOM   348   C  CB  . LEU A 1 47  ? 6.874   1.527   41.405  1.00 60.45 ? 50   LEU A CB  1 
ATOM   349   C  CG  . LEU A 1 47  ? 6.549   3.016   41.404  1.00 60.12 ? 50   LEU A CG  1 
ATOM   350   C  CD1 . LEU A 1 47  ? 5.089   3.242   41.678  1.00 59.92 ? 50   LEU A CD1 1 
ATOM   351   C  CD2 . LEU A 1 47  ? 7.395   3.686   42.467  1.00 59.98 ? 50   LEU A CD2 1 
ATOM   352   N  N   . LEU A 1 48  ? 5.289   1.830   38.569  1.00 60.34 ? 51   LEU A N   1 
ATOM   353   C  CA  . LEU A 1 48  ? 5.285   2.372   37.211  1.00 59.97 ? 51   LEU A CA  1 
ATOM   354   C  C   . LEU A 1 48  ? 5.613   3.856   37.151  1.00 59.89 ? 51   LEU A C   1 
ATOM   355   O  O   . LEU A 1 48  ? 5.251   4.631   38.039  1.00 59.99 ? 51   LEU A O   1 
ATOM   356   C  CB  . LEU A 1 48  ? 3.931   2.159   36.537  1.00 59.65 ? 51   LEU A CB  1 
ATOM   357   C  CG  . LEU A 1 48  ? 3.389   0.749   36.332  1.00 59.00 ? 51   LEU A CG  1 
ATOM   358   C  CD1 . LEU A 1 48  ? 2.147   0.867   35.510  1.00 58.93 ? 51   LEU A CD1 1 
ATOM   359   C  CD2 . LEU A 1 48  ? 4.381   -0.110  35.599  1.00 58.99 ? 51   LEU A CD2 1 
ATOM   360   N  N   . VAL A 1 49  ? 6.266   4.251   36.066  1.00 59.60 ? 52   VAL A N   1 
ATOM   361   C  CA  . VAL A 1 49  ? 6.630   5.641   35.866  1.00 59.11 ? 52   VAL A CA  1 
ATOM   362   C  C   . VAL A 1 49  ? 5.349   6.433   35.663  1.00 59.33 ? 52   VAL A C   1 
ATOM   363   O  O   . VAL A 1 49  ? 5.272   7.611   36.001  1.00 59.23 ? 52   VAL A O   1 
ATOM   364   C  CB  . VAL A 1 49  ? 7.522   5.793   34.633  1.00 58.82 ? 52   VAL A CB  1 
ATOM   365   C  CG1 . VAL A 1 49  ? 7.810   7.248   34.377  1.00 58.39 ? 52   VAL A CG1 1 
ATOM   366   C  CG2 . VAL A 1 49  ? 8.814   5.030   34.828  1.00 58.17 ? 52   VAL A CG2 1 
ATOM   367   N  N   . GLN A 1 50  ? 4.337   5.757   35.130  1.00 59.37 ? 53   GLN A N   1 
ATOM   368   C  CA  . GLN A 1 50  ? 3.034   6.353   34.874  1.00 59.34 ? 53   GLN A CA  1 
ATOM   369   C  C   . GLN A 1 50  ? 2.498   7.088   36.077  1.00 59.40 ? 53   GLN A C   1 
ATOM   370   O  O   . GLN A 1 50  ? 1.719   8.028   35.943  1.00 59.39 ? 53   GLN A O   1 
ATOM   371   C  CB  . GLN A 1 50  ? 2.041   5.263   34.528  1.00 59.44 ? 53   GLN A CB  1 
ATOM   372   C  CG  . GLN A 1 50  ? 1.687   5.214   33.082  1.00 59.53 ? 53   GLN A CG  1 
ATOM   373   C  CD  . GLN A 1 50  ? 0.812   4.029   32.759  1.00 59.51 ? 53   GLN A CD  1 
ATOM   374   O  OE1 . GLN A 1 50  ? 0.008   3.583   33.583  1.00 59.15 ? 53   GLN A OE1 1 
ATOM   375   N  NE2 . GLN A 1 50  ? 0.970   3.503   31.554  1.00 59.86 ? 53   GLN A NE2 1 
ATOM   376   N  N   . ASP A 1 51  ? 2.862   6.604   37.257  1.00 59.30 ? 54   ASP A N   1 
ATOM   377   C  CA  . ASP A 1 51  ? 2.403   7.221   38.481  1.00 59.04 ? 54   ASP A CA  1 
ATOM   378   C  C   . ASP A 1 51  ? 3.095   8.548   38.665  1.00 58.81 ? 54   ASP A C   1 
ATOM   379   O  O   . ASP A 1 51  ? 4.041   8.658   39.439  1.00 58.76 ? 54   ASP A O   1 
ATOM   380   C  CB  . ASP A 1 51  ? 2.682   6.329   39.683  1.00 59.50 ? 54   ASP A CB  1 
ATOM   381   C  CG  . ASP A 1 51  ? 1.940   6.784   40.928  1.00 59.81 ? 54   ASP A CG  1 
ATOM   382   O  OD1 . ASP A 1 51  ? 1.708   5.931   41.805  1.00 60.15 ? 54   ASP A OD1 1 
ATOM   383   O  OD2 . ASP A 1 51  ? 1.579   7.981   41.041  1.00 60.42 ? 54   ASP A OD2 1 
ATOM   384   N  N   . VAL A 1 52  ? 2.603   9.563   37.966  1.00 58.51 ? 55   VAL A N   1 
ATOM   385   C  CA  . VAL A 1 52  ? 3.181   10.897  38.063  1.00 58.14 ? 55   VAL A CA  1 
ATOM   386   C  C   . VAL A 1 52  ? 2.751   11.585  39.350  1.00 58.00 ? 55   VAL A C   1 
ATOM   387   O  O   . VAL A 1 52  ? 3.374   12.563  39.779  1.00 58.19 ? 55   VAL A O   1 
ATOM   388   C  CB  . VAL A 1 52  ? 2.804   11.777  36.857  1.00 57.78 ? 55   VAL A CB  1 
ATOM   389   C  CG1 . VAL A 1 52  ? 3.273   11.129  35.585  1.00 57.62 ? 55   VAL A CG1 1 
ATOM   390   C  CG2 . VAL A 1 52  ? 1.315   11.979  36.804  1.00 58.35 ? 55   VAL A CG2 1 
ATOM   391   N  N   . VAL A 1 53  ? 1.682   11.079  39.962  1.00 57.49 ? 56   VAL A N   1 
ATOM   392   C  CA  . VAL A 1 53  ? 1.202   11.657  41.209  1.00 57.01 ? 56   VAL A CA  1 
ATOM   393   C  C   . VAL A 1 53  ? 2.289   11.469  42.243  1.00 56.89 ? 56   VAL A C   1 
ATOM   394   O  O   . VAL A 1 53  ? 2.697   12.413  42.919  1.00 57.12 ? 56   VAL A O   1 
ATOM   395   C  CB  . VAL A 1 53  ? -0.069  10.963  41.711  1.00 57.08 ? 56   VAL A CB  1 
ATOM   396   C  CG1 . VAL A 1 53  ? -0.437  11.495  43.089  1.00 56.81 ? 56   VAL A CG1 1 
ATOM   397   C  CG2 . VAL A 1 53  ? -1.220  11.211  40.744  1.00 56.80 ? 56   VAL A CG2 1 
ATOM   398   N  N   . PHE A 1 54  ? 2.772   10.239  42.332  1.00 56.68 ? 57   PHE A N   1 
ATOM   399   C  CA  . PHE A 1 54  ? 3.829   9.892   43.266  1.00 56.41 ? 57   PHE A CA  1 
ATOM   400   C  C   . PHE A 1 54  ? 5.093   10.689  42.972  1.00 56.64 ? 57   PHE A C   1 
ATOM   401   O  O   . PHE A 1 54  ? 5.669   11.330  43.857  1.00 56.84 ? 57   PHE A O   1 
ATOM   402   C  CB  . PHE A 1 54  ? 4.135   8.400   43.165  1.00 55.85 ? 57   PHE A CB  1 
ATOM   403   C  CG  . PHE A 1 54  ? 5.416   8.007   43.826  1.00 54.91 ? 57   PHE A CG  1 
ATOM   404   C  CD1 . PHE A 1 54  ? 5.494   7.901   45.207  1.00 54.66 ? 57   PHE A CD1 1 
ATOM   405   C  CD2 . PHE A 1 54  ? 6.560   7.785   43.070  1.00 54.50 ? 57   PHE A CD2 1 
ATOM   406   C  CE1 . PHE A 1 54  ? 6.694   7.586   45.827  1.00 54.17 ? 57   PHE A CE1 1 
ATOM   407   C  CE2 . PHE A 1 54  ? 7.761   7.470   43.681  1.00 53.92 ? 57   PHE A CE2 1 
ATOM   408   C  CZ  . PHE A 1 54  ? 7.829   7.372   45.060  1.00 53.95 ? 57   PHE A CZ  1 
ATOM   409   N  N   . THR A 1 55  ? 5.526   10.644  41.720  1.00 56.41 ? 58   THR A N   1 
ATOM   410   C  CA  . THR A 1 55  ? 6.723   11.354  41.325  1.00 56.44 ? 58   THR A CA  1 
ATOM   411   C  C   . THR A 1 55  ? 6.591   12.844  41.630  1.00 56.79 ? 58   THR A C   1 
ATOM   412   O  O   . THR A 1 55  ? 7.449   13.431  42.299  1.00 56.98 ? 58   THR A O   1 
ATOM   413   C  CB  . THR A 1 55  ? 6.996   11.161  39.839  1.00 56.10 ? 58   THR A CB  1 
ATOM   414   O  OG1 . THR A 1 55  ? 6.997   9.763   39.534  1.00 55.99 ? 58   THR A OG1 1 
ATOM   415   C  CG2 . THR A 1 55  ? 8.340   11.740  39.475  1.00 56.17 ? 58   THR A CG2 1 
ATOM   416   N  N   . ASP A 1 56  ? 5.491   13.445  41.193  1.00 56.94 ? 59   ASP A N   1 
ATOM   417   C  CA  . ASP A 1 56  ? 5.299   14.861  41.436  1.00 57.40 ? 59   ASP A CA  1 
ATOM   418   C  C   . ASP A 1 56  ? 5.496   15.216  42.895  1.00 57.69 ? 59   ASP A C   1 
ATOM   419   O  O   . ASP A 1 56  ? 6.302   16.080  43.223  1.00 57.90 ? 59   ASP A O   1 
ATOM   420   C  CB  . ASP A 1 56  ? 3.916   15.319  41.004  1.00 57.98 ? 59   ASP A CB  1 
ATOM   421   C  CG  . ASP A 1 56  ? 3.673   16.788  41.320  1.00 58.62 ? 59   ASP A CG  1 
ATOM   422   O  OD1 . ASP A 1 56  ? 2.723   17.097  42.070  1.00 59.12 ? 59   ASP A OD1 1 
ATOM   423   O  OD2 . ASP A 1 56  ? 4.449   17.635  40.830  1.00 58.63 ? 59   ASP A OD2 1 
ATOM   424   N  N   . GLU A 1 57  ? 4.760   14.549  43.772  1.00 57.75 ? 60   GLU A N   1 
ATOM   425   C  CA  . GLU A 1 57  ? 4.883   14.838  45.181  1.00 58.04 ? 60   GLU A CA  1 
ATOM   426   C  C   . GLU A 1 57  ? 6.280   14.534  45.684  1.00 58.19 ? 60   GLU A C   1 
ATOM   427   O  O   . GLU A 1 57  ? 6.900   15.355  46.363  1.00 58.44 ? 60   GLU A O   1 
ATOM   428   C  CB  . GLU A 1 57  ? 3.880   14.036  45.988  1.00 58.47 ? 60   GLU A CB  1 
ATOM   429   C  CG  . GLU A 1 57  ? 3.935   14.389  47.461  1.00 59.68 ? 60   GLU A CG  1 
ATOM   430   C  CD  . GLU A 1 57  ? 2.975   13.583  48.311  1.00 60.36 ? 60   GLU A CD  1 
ATOM   431   O  OE1 . GLU A 1 57  ? 2.260   14.189  49.136  1.00 60.89 ? 60   GLU A OE1 1 
ATOM   432   O  OE2 . GLU A 1 57  ? 2.950   12.342  48.185  1.00 60.97 ? 60   GLU A OE2 1 
ATOM   433   N  N   . MET A 1 58  ? 6.790   13.362  45.330  1.00 58.22 ? 61   MET A N   1 
ATOM   434   C  CA  . MET A 1 58  ? 8.113   12.955  45.781  1.00 58.16 ? 61   MET A CA  1 
ATOM   435   C  C   . MET A 1 58  ? 9.200   13.904  45.333  1.00 58.23 ? 61   MET A C   1 
ATOM   436   O  O   . MET A 1 58  ? 9.982   14.389  46.148  1.00 58.47 ? 61   MET A O   1 
ATOM   437   C  CB  . MET A 1 58  ? 8.433   11.547  45.291  1.00 58.39 ? 61   MET A CB  1 
ATOM   438   C  CG  . MET A 1 58  ? 9.753   10.990  45.805  1.00 58.27 ? 61   MET A CG  1 
ATOM   439   S  SD  . MET A 1 58  ? 9.893   11.069  47.600  1.00 59.17 ? 61   MET A SD  1 
ATOM   440   C  CE  . MET A 1 58  ? 8.670   9.841   48.087  1.00 58.40 ? 61   MET A CE  1 
ATOM   441   N  N   . ALA A 1 59  ? 9.238   14.184  44.038  1.00 58.10 ? 62   ALA A N   1 
ATOM   442   C  CA  . ALA A 1 59  ? 10.255  15.060  43.491  1.00 58.26 ? 62   ALA A CA  1 
ATOM   443   C  C   . ALA A 1 59  ? 10.362  16.335  44.293  1.00 58.65 ? 62   ALA A C   1 
ATOM   444   O  O   . ALA A 1 59  ? 11.463  16.785  44.594  1.00 58.77 ? 62   ALA A O   1 
ATOM   445   C  CB  . ALA A 1 59  ? 9.957   15.370  42.056  1.00 58.30 ? 62   ALA A CB  1 
ATOM   446   N  N   . HIS A 1 60  ? 9.218   16.896  44.675  1.00 58.97 ? 63   HIS A N   1 
ATOM   447   C  CA  . HIS A 1 60  ? 9.221   18.130  45.443  1.00 59.21 ? 63   HIS A CA  1 
ATOM   448   C  C   . HIS A 1 60  ? 9.730   17.892  46.844  1.00 59.13 ? 63   HIS A C   1 
ATOM   449   O  O   . HIS A 1 60  ? 10.453  18.721  47.406  1.00 59.34 ? 63   HIS A O   1 
ATOM   450   C  CB  . HIS A 1 60  ? 7.838   18.757  45.524  1.00 60.30 ? 63   HIS A CB  1 
ATOM   451   C  CG  . HIS A 1 60  ? 7.841   20.112  46.168  1.00 61.68 ? 63   HIS A CG  1 
ATOM   452   N  ND1 . HIS A 1 60  ? 7.830   21.283  45.441  1.00 62.37 ? 63   HIS A ND1 1 
ATOM   453   C  CD2 . HIS A 1 60  ? 7.910   20.480  47.469  1.00 62.49 ? 63   HIS A CD2 1 
ATOM   454   C  CE1 . HIS A 1 60  ? 7.895   22.314  46.266  1.00 62.72 ? 63   HIS A CE1 1 
ATOM   455   N  NE2 . HIS A 1 60  ? 7.944   21.854  47.504  1.00 62.90 ? 63   HIS A NE2 1 
ATOM   456   N  N   . PHE A 1 61  ? 9.310   16.785  47.436  1.00 58.54 ? 64   PHE A N   1 
ATOM   457   C  CA  . PHE A 1 61  ? 9.765   16.470  48.772  1.00 57.98 ? 64   PHE A CA  1 
ATOM   458   C  C   . PHE A 1 61  ? 11.282  16.432  48.742  1.00 57.77 ? 64   PHE A C   1 
ATOM   459   O  O   . PHE A 1 61  ? 11.948  16.988  49.606  1.00 58.11 ? 64   PHE A O   1 
ATOM   460   C  CB  . PHE A 1 61  ? 9.237   15.117  49.207  1.00 57.83 ? 64   PHE A CB  1 
ATOM   461   C  CG  . PHE A 1 61  ? 9.862   14.620  50.465  1.00 57.69 ? 64   PHE A CG  1 
ATOM   462   C  CD1 . PHE A 1 61  ? 9.529   15.181  51.684  1.00 58.11 ? 64   PHE A CD1 1 
ATOM   463   C  CD2 . PHE A 1 61  ? 10.814  13.613  50.430  1.00 57.72 ? 64   PHE A CD2 1 
ATOM   464   C  CE1 . PHE A 1 61  ? 10.140  14.745  52.858  1.00 58.19 ? 64   PHE A CE1 1 
ATOM   465   C  CE2 . PHE A 1 61  ? 11.433  13.170  51.598  1.00 57.59 ? 64   PHE A CE2 1 
ATOM   466   C  CZ  . PHE A 1 61  ? 11.097  13.736  52.812  1.00 57.69 ? 64   PHE A CZ  1 
ATOM   467   N  N   . ASP A 1 62  ? 11.822  15.825  47.695  1.00 57.42 ? 65   ASP A N   1 
ATOM   468   C  CA  . ASP A 1 62  ? 13.261  15.703  47.533  1.00 57.06 ? 65   ASP A CA  1 
ATOM   469   C  C   . ASP A 1 62  ? 13.987  17.040  47.459  1.00 56.92 ? 65   ASP A C   1 
ATOM   470   O  O   . ASP A 1 62  ? 15.205  17.097  47.625  1.00 57.04 ? 65   ASP A O   1 
ATOM   471   C  CB  . ASP A 1 62  ? 13.574  14.888  46.274  1.00 57.16 ? 65   ASP A CB  1 
ATOM   472   C  CG  . ASP A 1 62  ? 13.213  13.411  46.415  1.00 57.04 ? 65   ASP A CG  1 
ATOM   473   O  OD1 . ASP A 1 62  ? 13.236  12.690  45.392  1.00 57.44 ? 65   ASP A OD1 1 
ATOM   474   O  OD2 . ASP A 1 62  ? 12.919  12.961  47.543  1.00 56.57 ? 65   ASP A OD2 1 
ATOM   475   N  N   . ARG A 1 63  ? 13.244  18.118  47.243  1.00 56.98 ? 66   ARG A N   1 
ATOM   476   C  CA  . ARG A 1 63  ? 13.859  19.433  47.118  1.00 56.96 ? 66   ARG A CA  1 
ATOM   477   C  C   . ARG A 1 63  ? 13.440  20.460  48.161  1.00 57.16 ? 66   ARG A C   1 
ATOM   478   O  O   . ARG A 1 63  ? 13.756  21.645  48.036  1.00 57.23 ? 66   ARG A O   1 
ATOM   479   C  CB  . ARG A 1 63  ? 13.590  19.971  45.718  1.00 56.59 ? 66   ARG A CB  1 
ATOM   480   C  CG  . ARG A 1 63  ? 14.130  19.058  44.646  1.00 56.08 ? 66   ARG A CG  1 
ATOM   481   C  CD  . ARG A 1 63  ? 13.712  19.474  43.245  1.00 56.17 ? 66   ARG A CD  1 
ATOM   482   N  NE  . ARG A 1 63  ? 14.482  18.744  42.239  1.00 56.40 ? 66   ARG A NE  1 
ATOM   483   C  CZ  . ARG A 1 63  ? 14.360  17.442  41.993  1.00 56.85 ? 66   ARG A CZ  1 
ATOM   484   N  NH1 . ARG A 1 63  ? 13.478  16.702  42.664  1.00 57.23 ? 66   ARG A NH1 1 
ATOM   485   N  NH2 . ARG A 1 63  ? 15.172  16.860  41.123  1.00 56.82 ? 66   ARG A NH2 1 
ATOM   486   N  N   . GLU A 1 64  ? 12.775  20.000  49.213  1.00 57.26 ? 67   GLU A N   1 
ATOM   487   C  CA  . GLU A 1 64  ? 12.314  20.890  50.265  1.00 57.40 ? 67   GLU A CA  1 
ATOM   488   C  C   . GLU A 1 64  ? 13.391  21.768  50.873  1.00 57.85 ? 67   GLU A C   1 
ATOM   489   O  O   . GLU A 1 64  ? 13.157  22.942  51.145  1.00 58.30 ? 67   GLU A O   1 
ATOM   490   C  CB  . GLU A 1 64  ? 11.652  20.088  51.373  1.00 56.93 ? 67   GLU A CB  1 
ATOM   491   C  CG  . GLU A 1 64  ? 10.337  19.479  50.959  1.00 56.68 ? 67   GLU A CG  1 
ATOM   492   C  CD  . GLU A 1 64  ? 9.581   18.876  52.120  1.00 56.77 ? 67   GLU A CD  1 
ATOM   493   O  OE1 . GLU A 1 64  ? 10.005  19.032  53.282  1.00 57.04 ? 67   GLU A OE1 1 
ATOM   494   O  OE2 . GLU A 1 64  ? 8.549   18.234  51.872  1.00 57.09 ? 67   GLU A OE2 1 
ATOM   495   N  N   . ARG A 1 65  ? 14.580  21.213  51.060  1.00 58.13 ? 68   ARG A N   1 
ATOM   496   C  CA  . ARG A 1 65  ? 15.669  21.955  51.681  1.00 58.17 ? 68   ARG A CA  1 
ATOM   497   C  C   . ARG A 1 65  ? 16.478  22.880  50.790  1.00 58.57 ? 68   ARG A C   1 
ATOM   498   O  O   . ARG A 1 65  ? 16.672  22.632  49.600  1.00 58.82 ? 68   ARG A O   1 
ATOM   499   C  CB  . ARG A 1 65  ? 16.633  20.990  52.366  1.00 58.05 ? 68   ARG A CB  1 
ATOM   500   C  CG  . ARG A 1 65  ? 15.973  19.986  53.294  1.00 57.42 ? 68   ARG A CG  1 
ATOM   501   C  CD  . ARG A 1 65  ? 15.387  20.647  54.526  1.00 57.13 ? 68   ARG A CD  1 
ATOM   502   N  NE  . ARG A 1 65  ? 14.759  19.643  55.375  1.00 57.05 ? 68   ARG A NE  1 
ATOM   503   C  CZ  . ARG A 1 65  ? 13.479  19.302  55.295  1.00 57.14 ? 68   ARG A CZ  1 
ATOM   504   N  NH1 . ARG A 1 65  ? 12.685  19.904  54.419  1.00 57.17 ? 68   ARG A NH1 1 
ATOM   505   N  NH2 . ARG A 1 65  ? 13.015  18.296  56.020  1.00 57.19 ? 68   ARG A NH2 1 
ATOM   506   N  N   . ILE A 1 66  ? 16.964  23.944  51.417  1.00 58.87 ? 69   ILE A N   1 
ATOM   507   C  CA  . ILE A 1 66  ? 17.812  24.947  50.796  1.00 59.38 ? 69   ILE A CA  1 
ATOM   508   C  C   . ILE A 1 66  ? 18.919  25.164  51.842  1.00 59.64 ? 69   ILE A C   1 
ATOM   509   O  O   . ILE A 1 66  ? 18.743  24.831  53.014  1.00 59.94 ? 69   ILE A O   1 
ATOM   510   C  CB  . ILE A 1 66  ? 17.048  26.253  50.529  1.00 59.32 ? 69   ILE A CB  1 
ATOM   511   C  CG1 . ILE A 1 66  ? 16.581  26.876  51.840  1.00 59.56 ? 69   ILE A CG1 1 
ATOM   512   C  CG2 . ILE A 1 66  ? 15.833  25.983  49.672  1.00 59.47 ? 69   ILE A CG2 1 
ATOM   513   C  CD1 . ILE A 1 66  ? 15.953  28.243  51.659  1.00 59.69 ? 69   ILE A CD1 1 
ATOM   514   N  N   . PRO A 1 67  ? 20.065  25.724  51.445  1.00 59.77 ? 70   PRO A N   1 
ATOM   515   C  CA  . PRO A 1 67  ? 21.159  25.946  52.399  1.00 60.00 ? 70   PRO A CA  1 
ATOM   516   C  C   . PRO A 1 67  ? 20.784  26.849  53.562  1.00 59.98 ? 70   PRO A C   1 
ATOM   517   O  O   . PRO A 1 67  ? 20.249  27.936  53.352  1.00 60.39 ? 70   PRO A O   1 
ATOM   518   C  CB  . PRO A 1 67  ? 22.223  26.618  51.535  1.00 60.17 ? 70   PRO A CB  1 
ATOM   519   C  CG  . PRO A 1 67  ? 21.893  26.145  50.150  1.00 60.21 ? 70   PRO A CG  1 
ATOM   520   C  CD  . PRO A 1 67  ? 20.414  26.252  50.122  1.00 59.81 ? 70   PRO A CD  1 
ATOM   521   N  N   . GLU A 1 68  ? 21.077  26.417  54.785  1.00 60.07 ? 71   GLU A N   1 
ATOM   522   C  CA  . GLU A 1 68  ? 20.770  27.235  55.954  1.00 60.05 ? 71   GLU A CA  1 
ATOM   523   C  C   . GLU A 1 68  ? 21.727  28.416  55.977  1.00 60.18 ? 71   GLU A C   1 
ATOM   524   O  O   . GLU A 1 68  ? 22.760  28.386  55.309  1.00 60.33 ? 71   GLU A O   1 
ATOM   525   C  CB  . GLU A 1 68  ? 20.904  26.425  57.245  1.00 60.01 ? 71   GLU A CB  1 
ATOM   526   C  CG  . GLU A 1 68  ? 22.320  26.031  57.614  1.00 60.04 ? 71   GLU A CG  1 
ATOM   527   C  CD  . GLU A 1 68  ? 22.441  25.605  59.066  1.00 60.04 ? 71   GLU A CD  1 
ATOM   528   O  OE1 . GLU A 1 68  ? 21.491  24.986  59.592  1.00 60.12 ? 71   GLU A OE1 1 
ATOM   529   O  OE2 . GLU A 1 68  ? 23.483  25.900  59.690  1.00 59.68 ? 71   GLU A OE2 1 
ATOM   530   N  N   . ARG A 1 69  ? 21.373  29.464  56.715  1.00 60.10 ? 72   ARG A N   1 
ATOM   531   C  CA  . ARG A 1 69  ? 22.222  30.648  56.811  1.00 60.22 ? 72   ARG A CA  1 
ATOM   532   C  C   . ARG A 1 69  ? 23.598  30.218  57.262  1.00 60.47 ? 72   ARG A C   1 
ATOM   533   O  O   . ARG A 1 69  ? 23.722  29.393  58.168  1.00 60.88 ? 72   ARG A O   1 
ATOM   534   C  CB  . ARG A 1 69  ? 21.657  31.630  57.831  1.00 60.15 ? 72   ARG A CB  1 
ATOM   535   C  CG  . ARG A 1 69  ? 20.363  32.258  57.410  1.00 60.10 ? 72   ARG A CG  1 
ATOM   536   C  CD  . ARG A 1 69  ? 19.683  32.934  58.572  1.00 59.76 ? 72   ARG A CD  1 
ATOM   537   N  NE  . ARG A 1 69  ? 18.505  33.666  58.125  1.00 59.49 ? 72   ARG A NE  1 
ATOM   538   C  CZ  . ARG A 1 69  ? 17.325  33.113  57.872  1.00 59.43 ? 72   ARG A CZ  1 
ATOM   539   N  NH1 . ARG A 1 69  ? 17.144  31.808  58.030  1.00 59.44 ? 72   ARG A NH1 1 
ATOM   540   N  NH2 . ARG A 1 69  ? 16.327  33.866  57.437  1.00 59.60 ? 72   ARG A NH2 1 
ATOM   541   N  N   . VAL A 1 70  ? 24.634  30.769  56.639  1.00 60.65 ? 73   VAL A N   1 
ATOM   542   C  CA  . VAL A 1 70  ? 25.994  30.411  57.005  1.00 60.39 ? 73   VAL A CA  1 
ATOM   543   C  C   . VAL A 1 70  ? 26.224  30.660  58.502  1.00 60.71 ? 73   VAL A C   1 
ATOM   544   O  O   . VAL A 1 70  ? 27.008  29.957  59.144  1.00 60.55 ? 73   VAL A O   1 
ATOM   545   C  CB  . VAL A 1 70  ? 27.014  31.139  56.119  1.00 60.23 ? 73   VAL A CB  1 
ATOM   546   C  CG1 . VAL A 1 70  ? 27.021  32.620  56.408  1.00 59.86 ? 73   VAL A CG1 1 
ATOM   547   C  CG2 . VAL A 1 70  ? 28.376  30.523  56.291  1.00 60.04 ? 73   VAL A CG2 1 
ATOM   548   N  N   . VAL A 1 71  ? 25.492  31.632  59.051  1.00 60.79 ? 74   VAL A N   1 
ATOM   549   C  CA  . VAL A 1 71  ? 25.525  31.982  60.480  1.00 60.97 ? 74   VAL A CA  1 
ATOM   550   C  C   . VAL A 1 71  ? 24.132  32.447  60.901  1.00 61.03 ? 74   VAL A C   1 
ATOM   551   O  O   . VAL A 1 71  ? 23.345  32.900  60.060  1.00 60.89 ? 74   VAL A O   1 
ATOM   552   C  CB  . VAL A 1 71  ? 26.540  33.096  60.833  1.00 60.80 ? 74   VAL A CB  1 
ATOM   553   C  CG1 . VAL A 1 71  ? 27.947  32.566  60.758  1.00 60.76 ? 74   VAL A CG1 1 
ATOM   554   C  CG2 . VAL A 1 71  ? 26.367  34.289  59.925  1.00 60.68 ? 74   VAL A CG2 1 
ATOM   555   N  N   . HIS A 1 72  ? 23.851  32.364  62.204  1.00 60.86 ? 75   HIS A N   1 
ATOM   556   C  CA  . HIS A 1 72  ? 22.549  32.737  62.748  1.00 60.56 ? 75   HIS A CA  1 
ATOM   557   C  C   . HIS A 1 72  ? 21.516  31.836  62.098  1.00 60.34 ? 75   HIS A C   1 
ATOM   558   O  O   . HIS A 1 72  ? 20.474  32.297  61.632  1.00 60.64 ? 75   HIS A O   1 
ATOM   559   C  CB  . HIS A 1 72  ? 22.203  34.187  62.425  1.00 60.61 ? 75   HIS A CB  1 
ATOM   560   C  CG  . HIS A 1 72  ? 23.066  35.191  63.115  1.00 60.75 ? 75   HIS A CG  1 
ATOM   561   N  ND1 . HIS A 1 72  ? 22.673  35.839  64.264  1.00 60.84 ? 75   HIS A ND1 1 
ATOM   562   C  CD2 . HIS A 1 72  ? 24.261  35.726  62.770  1.00 60.73 ? 75   HIS A CD2 1 
ATOM   563   C  CE1 . HIS A 1 72  ? 23.583  36.739  64.594  1.00 60.85 ? 75   HIS A CE1 1 
ATOM   564   N  NE2 . HIS A 1 72  ? 24.557  36.691  63.700  1.00 60.85 ? 75   HIS A NE2 1 
ATOM   565   N  N   . ALA A 1 73  ? 21.827  30.551  62.026  1.00 59.90 ? 76   ALA A N   1 
ATOM   566   C  CA  . ALA A 1 73  ? 20.912  29.611  61.413  1.00 59.73 ? 76   ALA A CA  1 
ATOM   567   C  C   . ALA A 1 73  ? 19.659  29.392  62.262  1.00 59.88 ? 76   ALA A C   1 
ATOM   568   O  O   . ALA A 1 73  ? 18.546  29.371  61.730  1.00 60.22 ? 76   ALA A O   1 
ATOM   569   C  CB  . ALA A 1 73  ? 21.618  28.287  61.150  1.00 59.70 ? 76   ALA A CB  1 
ATOM   570   N  N   . LYS A 1 74  ? 19.840  29.245  63.577  1.00 59.57 ? 77   LYS A N   1 
ATOM   571   C  CA  . LYS A 1 74  ? 18.725  28.998  64.503  1.00 59.07 ? 77   LYS A CA  1 
ATOM   572   C  C   . LYS A 1 74  ? 18.022  30.293  64.885  1.00 59.19 ? 77   LYS A C   1 
ATOM   573   O  O   . LYS A 1 74  ? 18.582  31.116  65.609  1.00 59.43 ? 77   LYS A O   1 
ATOM   574   C  CB  . LYS A 1 74  ? 19.239  28.315  65.775  1.00 58.67 ? 77   LYS A CB  1 
ATOM   575   C  CG  . LYS A 1 74  ? 18.521  27.029  66.162  1.00 58.07 ? 77   LYS A CG  1 
ATOM   576   C  CD  . LYS A 1 74  ? 17.026  27.245  66.246  1.00 58.01 ? 77   LYS A CD  1 
ATOM   577   C  CE  . LYS A 1 74  ? 16.307  26.003  66.733  1.00 57.60 ? 77   LYS A CE  1 
ATOM   578   N  NZ  . LYS A 1 74  ? 16.196  25.971  68.217  1.00 57.64 ? 77   LYS A NZ  1 
ATOM   579   N  N   . GLY A 1 75  ? 16.781  30.462  64.446  1.00 59.07 ? 78   GLY A N   1 
ATOM   580   C  CA  . GLY A 1 75  ? 16.086  31.687  64.779  1.00 58.59 ? 78   GLY A CA  1 
ATOM   581   C  C   . GLY A 1 75  ? 14.576  31.636  64.805  1.00 58.57 ? 78   GLY A C   1 
ATOM   582   O  O   . GLY A 1 75  ? 13.952  30.623  64.476  1.00 58.71 ? 78   GLY A O   1 
ATOM   583   N  N   . ALA A 1 76  ? 13.993  32.752  65.223  1.00 58.51 ? 79   ALA A N   1 
ATOM   584   C  CA  . ALA A 1 76  ? 12.552  32.887  65.306  1.00 58.56 ? 79   ALA A CA  1 
ATOM   585   C  C   . ALA A 1 76  ? 12.184  34.214  64.677  1.00 58.77 ? 79   ALA A C   1 
ATOM   586   O  O   . ALA A 1 76  ? 12.987  35.150  64.660  1.00 58.66 ? 79   ALA A O   1 
ATOM   587   C  CB  . ALA A 1 76  ? 12.108  32.849  66.744  1.00 58.32 ? 79   ALA A CB  1 
ATOM   588   N  N   . GLY A 1 77  ? 10.969  34.295  64.156  1.00 59.01 ? 80   GLY A N   1 
ATOM   589   C  CA  . GLY A 1 77  ? 10.544  35.522  63.519  1.00 59.31 ? 80   GLY A CA  1 
ATOM   590   C  C   . GLY A 1 77  ? 9.159   35.976  63.917  1.00 59.44 ? 80   GLY A C   1 
ATOM   591   O  O   . GLY A 1 77  ? 8.323   35.188  64.357  1.00 59.52 ? 80   GLY A O   1 
ATOM   592   N  N   . ALA A 1 78  ? 8.921   37.267  63.736  1.00 59.56 ? 81   ALA A N   1 
ATOM   593   C  CA  . ALA A 1 78  ? 7.647   37.874  64.064  1.00 59.80 ? 81   ALA A CA  1 
ATOM   594   C  C   . ALA A 1 78  ? 7.505   39.141  63.239  1.00 60.12 ? 81   ALA A C   1 
ATOM   595   O  O   . ALA A 1 78  ? 8.463   39.596  62.599  1.00 60.31 ? 81   ALA A O   1 
ATOM   596   C  CB  . ALA A 1 78  ? 7.587   38.194  65.545  1.00 59.82 ? 81   ALA A CB  1 
ATOM   597   N  N   . PHE A 1 79  ? 6.301   39.702  63.244  1.00 60.21 ? 82   PHE A N   1 
ATOM   598   C  CA  . PHE A 1 79  ? 6.023   40.908  62.488  1.00 60.04 ? 82   PHE A CA  1 
ATOM   599   C  C   . PHE A 1 79  ? 5.303   41.918  63.350  1.00 60.09 ? 82   PHE A C   1 
ATOM   600   O  O   . PHE A 1 79  ? 4.645   41.565  64.332  1.00 60.18 ? 82   PHE A O   1 
ATOM   601   C  CB  . PHE A 1 79  ? 5.180   40.563  61.272  1.00 59.95 ? 82   PHE A CB  1 
ATOM   602   C  CG  . PHE A 1 79  ? 5.798   39.528  60.403  1.00 60.41 ? 82   PHE A CG  1 
ATOM   603   C  CD1 . PHE A 1 79  ? 5.727   38.185  60.751  1.00 60.58 ? 82   PHE A CD1 1 
ATOM   604   C  CD2 . PHE A 1 79  ? 6.502   39.893  59.268  1.00 60.60 ? 82   PHE A CD2 1 
ATOM   605   C  CE1 . PHE A 1 79  ? 6.354   37.218  59.983  1.00 60.86 ? 82   PHE A CE1 1 
ATOM   606   C  CE2 . PHE A 1 79  ? 7.133   38.935  58.489  1.00 61.01 ? 82   PHE A CE2 1 
ATOM   607   C  CZ  . PHE A 1 79  ? 7.060   37.590  58.848  1.00 61.04 ? 82   PHE A CZ  1 
ATOM   608   N  N   . GLY A 1 80  ? 5.444   43.183  62.982  1.00 60.22 ? 83   GLY A N   1 
ATOM   609   C  CA  . GLY A 1 80  ? 4.805   44.238  63.731  1.00 60.25 ? 83   GLY A CA  1 
ATOM   610   C  C   . GLY A 1 80  ? 5.034   45.559  63.045  1.00 60.48 ? 83   GLY A C   1 
ATOM   611   O  O   . GLY A 1 80  ? 4.995   45.643  61.814  1.00 60.64 ? 83   GLY A O   1 
ATOM   612   N  N   . TYR A 1 81  ? 5.354   46.579  63.830  1.00 60.53 ? 84   TYR A N   1 
ATOM   613   C  CA  . TYR A 1 81  ? 5.562   47.898  63.267  1.00 60.73 ? 84   TYR A CA  1 
ATOM   614   C  C   . TYR A 1 81  ? 6.491   48.767  64.088  1.00 60.74 ? 84   TYR A C   1 
ATOM   615   O  O   . TYR A 1 81  ? 6.762   48.492  65.262  1.00 60.73 ? 84   TYR A O   1 
ATOM   616   C  CB  . TYR A 1 81  ? 4.218   48.616  63.127  1.00 60.97 ? 84   TYR A CB  1 
ATOM   617   C  CG  . TYR A 1 81  ? 3.506   48.882  64.449  1.00 61.35 ? 84   TYR A CG  1 
ATOM   618   C  CD1 . TYR A 1 81  ? 3.911   49.920  65.287  1.00 61.28 ? 84   TYR A CD1 1 
ATOM   619   C  CD2 . TYR A 1 81  ? 2.416   48.108  64.853  1.00 61.32 ? 84   TYR A CD2 1 
ATOM   620   C  CE1 . TYR A 1 81  ? 3.254   50.183  66.490  1.00 61.29 ? 84   TYR A CE1 1 
ATOM   621   C  CE2 . TYR A 1 81  ? 1.751   48.368  66.061  1.00 61.38 ? 84   TYR A CE2 1 
ATOM   622   C  CZ  . TYR A 1 81  ? 2.178   49.410  66.870  1.00 61.27 ? 84   TYR A CZ  1 
ATOM   623   O  OH  . TYR A 1 81  ? 1.525   49.698  68.051  1.00 61.30 ? 84   TYR A OH  1 
ATOM   624   N  N   . PHE A 1 82  ? 6.975   49.821  63.440  1.00 60.68 ? 85   PHE A N   1 
ATOM   625   C  CA  . PHE A 1 82  ? 7.840   50.807  64.062  1.00 60.29 ? 85   PHE A CA  1 
ATOM   626   C  C   . PHE A 1 82  ? 7.002   52.071  64.074  1.00 60.24 ? 85   PHE A C   1 
ATOM   627   O  O   . PHE A 1 82  ? 6.340   52.391  63.085  1.00 60.13 ? 85   PHE A O   1 
ATOM   628   C  CB  . PHE A 1 82  ? 9.099   51.034  63.228  1.00 59.72 ? 85   PHE A CB  1 
ATOM   629   C  CG  . PHE A 1 82  ? 9.871   52.267  63.621  1.00 59.49 ? 85   PHE A CG  1 
ATOM   630   C  CD1 . PHE A 1 82  ? 10.649  52.281  64.776  1.00 59.32 ? 85   PHE A CD1 1 
ATOM   631   C  CD2 . PHE A 1 82  ? 9.813   53.421  62.841  1.00 59.06 ? 85   PHE A CD2 1 
ATOM   632   C  CE1 . PHE A 1 82  ? 11.359  53.428  65.148  1.00 58.78 ? 85   PHE A CE1 1 
ATOM   633   C  CE2 . PHE A 1 82  ? 10.516  54.565  63.204  1.00 58.45 ? 85   PHE A CE2 1 
ATOM   634   C  CZ  . PHE A 1 82  ? 11.289  54.567  64.359  1.00 58.48 ? 85   PHE A CZ  1 
ATOM   635   N  N   . GLU A 1 83  ? 7.010   52.772  65.199  1.00 60.30 ? 86   GLU A N   1 
ATOM   636   C  CA  . GLU A 1 83  ? 6.243   53.999  65.336  1.00 60.33 ? 86   GLU A CA  1 
ATOM   637   C  C   . GLU A 1 83  ? 7.151   55.087  65.862  1.00 60.20 ? 86   GLU A C   1 
ATOM   638   O  O   . GLU A 1 83  ? 7.888   54.879  66.829  1.00 60.33 ? 86   GLU A O   1 
ATOM   639   C  CB  . GLU A 1 83  ? 5.090   53.783  66.309  1.00 60.95 ? 86   GLU A CB  1 
ATOM   640   C  CG  . GLU A 1 83  ? 4.266   55.029  66.603  1.00 61.81 ? 86   GLU A CG  1 
ATOM   641   C  CD  . GLU A 1 83  ? 3.175   54.782  67.636  1.00 62.27 ? 86   GLU A CD  1 
ATOM   642   O  OE1 . GLU A 1 83  ? 2.734   55.752  68.284  1.00 62.96 ? 86   GLU A OE1 1 
ATOM   643   O  OE2 . GLU A 1 83  ? 2.756   53.616  67.811  1.00 62.84 ? 86   GLU A OE2 1 
ATOM   644   N  N   . VAL A 1 84  ? 7.114   56.242  65.210  1.00 59.90 ? 87   VAL A N   1 
ATOM   645   C  CA  . VAL A 1 84  ? 7.938   57.366  65.627  1.00 59.77 ? 87   VAL A CA  1 
ATOM   646   C  C   . VAL A 1 84  ? 7.305   58.075  66.822  1.00 59.89 ? 87   VAL A C   1 
ATOM   647   O  O   . VAL A 1 84  ? 6.091   58.288  66.853  1.00 59.46 ? 87   VAL A O   1 
ATOM   648   C  CB  . VAL A 1 84  ? 8.133   58.360  64.473  1.00 59.95 ? 87   VAL A CB  1 
ATOM   649   C  CG1 . VAL A 1 84  ? 8.958   59.557  64.930  1.00 59.83 ? 87   VAL A CG1 1 
ATOM   650   C  CG2 . VAL A 1 84  ? 8.809   57.663  63.307  1.00 59.57 ? 87   VAL A CG2 1 
ATOM   651   N  N   . THR A 1 85  ? 8.134   58.431  67.802  1.00 60.19 ? 88   THR A N   1 
ATOM   652   C  CA  . THR A 1 85  ? 7.670   59.111  69.009  1.00 60.18 ? 88   THR A CA  1 
ATOM   653   C  C   . THR A 1 85  ? 8.357   60.461  69.257  1.00 60.63 ? 88   THR A C   1 
ATOM   654   O  O   . THR A 1 85  ? 7.913   61.247  70.098  1.00 60.52 ? 88   THR A O   1 
ATOM   655   C  CB  . THR A 1 85  ? 7.852   58.219  70.245  1.00 59.88 ? 88   THR A CB  1 
ATOM   656   O  OG1 . THR A 1 85  ? 9.242   57.926  70.427  1.00 59.73 ? 88   THR A OG1 1 
ATOM   657   C  CG2 . THR A 1 85  ? 7.098   56.923  70.066  1.00 59.39 ? 88   THR A CG2 1 
ATOM   658   N  N   . HIS A 1 86  ? 9.452   60.717  68.548  1.00 60.97 ? 89   HIS A N   1 
ATOM   659   C  CA  . HIS A 1 86  ? 10.179  61.976  68.689  1.00 61.49 ? 89   HIS A CA  1 
ATOM   660   C  C   . HIS A 1 86  ? 10.744  62.415  67.359  1.00 62.15 ? 89   HIS A C   1 
ATOM   661   O  O   . HIS A 1 86  ? 10.899  61.604  66.447  1.00 62.01 ? 89   HIS A O   1 
ATOM   662   C  CB  . HIS A 1 86  ? 11.321  61.848  69.691  1.00 61.52 ? 89   HIS A CB  1 
ATOM   663   C  CG  . HIS A 1 86  ? 10.869  61.565  71.080  1.00 61.43 ? 89   HIS A CG  1 
ATOM   664   N  ND1 . HIS A 1 86  ? 10.353  60.344  71.457  1.00 61.47 ? 89   HIS A ND1 1 
ATOM   665   C  CD2 . HIS A 1 86  ? 10.863  62.336  72.191  1.00 61.14 ? 89   HIS A CD2 1 
ATOM   666   C  CE1 . HIS A 1 86  ? 10.054  60.373  72.742  1.00 61.42 ? 89   HIS A CE1 1 
ATOM   667   N  NE2 . HIS A 1 86  ? 10.354  61.571  73.211  1.00 61.65 ? 89   HIS A NE2 1 
ATOM   668   N  N   . ASP A 1 87  ? 11.105  63.693  67.273  1.00 63.02 ? 90   ASP A N   1 
ATOM   669   C  CA  . ASP A 1 87  ? 11.643  64.238  66.040  1.00 63.84 ? 90   ASP A CA  1 
ATOM   670   C  C   . ASP A 1 87  ? 13.154  64.279  65.957  1.00 64.14 ? 90   ASP A C   1 
ATOM   671   O  O   . ASP A 1 87  ? 13.816  64.966  66.743  1.00 64.21 ? 90   ASP A O   1 
ATOM   672   C  CB  . ASP A 1 87  ? 11.102  65.639  65.783  1.00 64.39 ? 90   ASP A CB  1 
ATOM   673   C  CG  . ASP A 1 87  ? 11.445  66.144  64.386  1.00 65.28 ? 90   ASP A CG  1 
ATOM   674   O  OD1 . ASP A 1 87  ? 12.651  66.271  64.053  1.00 65.76 ? 90   ASP A OD1 1 
ATOM   675   O  OD2 . ASP A 1 87  ? 10.500  66.406  63.612  1.00 65.58 ? 90   ASP A OD2 1 
ATOM   676   N  N   . ILE A 1 88  ? 13.677  63.617  64.929  1.00 64.21 ? 91   ILE A N   1 
ATOM   677   C  CA  . ILE A 1 88  ? 15.110  63.579  64.674  1.00 64.10 ? 91   ILE A CA  1 
ATOM   678   C  C   . ILE A 1 88  ? 15.372  63.958  63.220  1.00 64.11 ? 91   ILE A C   1 
ATOM   679   O  O   . ILE A 1 88  ? 16.432  63.655  62.669  1.00 63.94 ? 91   ILE A O   1 
ATOM   680   C  CB  . ILE A 1 88  ? 15.717  62.190  64.953  1.00 63.99 ? 91   ILE A CB  1 
ATOM   681   C  CG1 . ILE A 1 88  ? 15.074  61.147  64.045  1.00 63.92 ? 91   ILE A CG1 1 
ATOM   682   C  CG2 . ILE A 1 88  ? 15.540  61.817  66.423  1.00 63.98 ? 91   ILE A CG2 1 
ATOM   683   C  CD1 . ILE A 1 88  ? 15.668  59.777  64.195  1.00 63.79 ? 91   ILE A CD1 1 
ATOM   684   N  N   . THR A 1 89  ? 14.398  64.633  62.607  1.00 64.23 ? 92   THR A N   1 
ATOM   685   C  CA  . THR A 1 89  ? 14.523  65.059  61.217  1.00 64.35 ? 92   THR A CA  1 
ATOM   686   C  C   . THR A 1 89  ? 15.639  66.073  61.073  1.00 64.45 ? 92   THR A C   1 
ATOM   687   O  O   . THR A 1 89  ? 16.045  66.403  59.960  1.00 64.52 ? 92   THR A O   1 
ATOM   688   C  CB  . THR A 1 89  ? 13.234  65.671  60.676  1.00 64.36 ? 92   THR A CB  1 
ATOM   689   O  OG1 . THR A 1 89  ? 12.874  66.799  61.476  1.00 64.60 ? 92   THR A OG1 1 
ATOM   690   C  CG2 . THR A 1 89  ? 12.114  64.656  60.702  1.00 64.35 ? 92   THR A CG2 1 
ATOM   691   N  N   . LYS A 1 90  ? 16.091  66.624  62.192  1.00 64.46 ? 93   LYS A N   1 
ATOM   692   C  CA  . LYS A 1 90  ? 17.197  67.556  62.130  1.00 64.39 ? 93   LYS A CA  1 
ATOM   693   C  C   . LYS A 1 90  ? 18.451  66.730  61.910  1.00 63.78 ? 93   LYS A C   1 
ATOM   694   O  O   . LYS A 1 90  ? 19.468  67.236  61.454  1.00 63.59 ? 93   LYS A O   1 
ATOM   695   C  CB  . LYS A 1 90  ? 17.307  68.385  63.405  1.00 65.62 ? 93   LYS A CB  1 
ATOM   696   C  CG  . LYS A 1 90  ? 17.205  67.630  64.718  1.00 67.04 ? 93   LYS A CG  1 
ATOM   697   C  CD  . LYS A 1 90  ? 17.578  68.592  65.853  1.00 68.58 ? 93   LYS A CD  1 
ATOM   698   C  CE  . LYS A 1 90  ? 16.965  68.202  67.194  1.00 69.71 ? 93   LYS A CE  1 
ATOM   699   N  NZ  . LYS A 1 90  ? 17.561  66.963  67.768  1.00 70.74 ? 93   LYS A NZ  1 
ATOM   700   N  N   . TYR A 1 91  ? 18.358  65.441  62.213  1.00 63.35 ? 94   TYR A N   1 
ATOM   701   C  CA  . TYR A 1 91  ? 19.477  64.533  62.030  1.00 63.01 ? 94   TYR A CA  1 
ATOM   702   C  C   . TYR A 1 91  ? 19.333  63.720  60.741  1.00 62.92 ? 94   TYR A C   1 
ATOM   703   O  O   . TYR A 1 91  ? 20.301  63.565  59.990  1.00 63.05 ? 94   TYR A O   1 
ATOM   704   C  CB  . TYR A 1 91  ? 19.595  63.585  63.225  1.00 62.73 ? 94   TYR A CB  1 
ATOM   705   C  CG  . TYR A 1 91  ? 19.895  64.272  64.536  1.00 62.27 ? 94   TYR A CG  1 
ATOM   706   C  CD1 . TYR A 1 91  ? 19.139  64.005  65.668  1.00 62.12 ? 94   TYR A CD1 1 
ATOM   707   C  CD2 . TYR A 1 91  ? 20.934  65.186  64.645  1.00 62.16 ? 94   TYR A CD2 1 
ATOM   708   C  CE1 . TYR A 1 91  ? 19.407  64.628  66.879  1.00 62.10 ? 94   TYR A CE1 1 
ATOM   709   C  CE2 . TYR A 1 91  ? 21.211  65.818  65.857  1.00 62.15 ? 94   TYR A CE2 1 
ATOM   710   C  CZ  . TYR A 1 91  ? 20.440  65.531  66.967  1.00 62.11 ? 94   TYR A CZ  1 
ATOM   711   O  OH  . TYR A 1 91  ? 20.694  66.151  68.167  1.00 62.30 ? 94   TYR A OH  1 
ATOM   712   N  N   . SER A 1 92  ? 18.136  63.200  60.477  1.00 62.33 ? 95   SER A N   1 
ATOM   713   C  CA  . SER A 1 92  ? 17.932  62.408  59.272  1.00 61.73 ? 95   SER A CA  1 
ATOM   714   C  C   . SER A 1 92  ? 16.684  62.764  58.498  1.00 61.48 ? 95   SER A C   1 
ATOM   715   O  O   . SER A 1 92  ? 15.641  63.047  59.080  1.00 61.51 ? 95   SER A O   1 
ATOM   716   C  CB  . SER A 1 92  ? 17.891  60.923  59.602  1.00 61.96 ? 95   SER A CB  1 
ATOM   717   O  OG  . SER A 1 92  ? 17.684  60.168  58.419  1.00 62.73 ? 95   SER A OG  1 
ATOM   718   N  N   . LYS A 1 93  ? 16.798  62.688  57.176  1.00 61.34 ? 96   LYS A N   1 
ATOM   719   C  CA  . LYS A 1 93  ? 15.698  62.989  56.264  1.00 61.24 ? 96   LYS A CA  1 
ATOM   720   C  C   . LYS A 1 93  ? 14.959  61.722  55.843  1.00 61.37 ? 96   LYS A C   1 
ATOM   721   O  O   . LYS A 1 93  ? 14.042  61.763  55.014  1.00 61.29 ? 96   LYS A O   1 
ATOM   722   C  CB  . LYS A 1 93  ? 16.233  63.676  55.011  1.00 60.95 ? 96   LYS A CB  1 
ATOM   723   C  CG  . LYS A 1 93  ? 17.073  62.776  54.122  1.00 60.32 ? 96   LYS A CG  1 
ATOM   724   C  CD  . LYS A 1 93  ? 17.495  63.515  52.873  1.00 60.21 ? 96   LYS A CD  1 
ATOM   725   C  CE  . LYS A 1 93  ? 18.292  62.617  51.954  1.00 60.28 ? 96   LYS A CE  1 
ATOM   726   N  NZ  . LYS A 1 93  ? 18.644  63.321  50.689  1.00 60.66 ? 96   LYS A NZ  1 
ATOM   727   N  N   . ALA A 1 94  ? 15.396  60.589  56.379  1.00 61.59 ? 97   ALA A N   1 
ATOM   728   C  CA  . ALA A 1 94  ? 14.777  59.316  56.055  1.00 61.93 ? 97   ALA A CA  1 
ATOM   729   C  C   . ALA A 1 94  ? 13.268  59.403  56.270  1.00 62.43 ? 97   ALA A C   1 
ATOM   730   O  O   . ALA A 1 94  ? 12.805  59.949  57.272  1.00 62.95 ? 97   ALA A O   1 
ATOM   731   C  CB  . ALA A 1 94  ? 15.383  58.216  56.903  1.00 61.43 ? 97   ALA A CB  1 
ATOM   732   N  N   . LYS A 1 95  ? 12.506  58.903  55.301  1.00 63.26 ? 98   LYS A N   1 
ATOM   733   C  CA  . LYS A 1 95  ? 11.050  58.927  55.376  1.00 63.80 ? 98   LYS A CA  1 
ATOM   734   C  C   . LYS A 1 95  ? 10.492  58.211  56.586  1.00 63.53 ? 98   LYS A C   1 
ATOM   735   O  O   . LYS A 1 95  ? 9.495   58.636  57.167  1.00 63.78 ? 98   LYS A O   1 
ATOM   736   C  CB  . LYS A 1 95  ? 10.435  58.345  54.111  1.00 64.61 ? 98   LYS A CB  1 
ATOM   737   C  CG  . LYS A 1 95  ? 10.252  59.383  53.032  1.00 66.29 ? 98   LYS A CG  1 
ATOM   738   C  CD  . LYS A 1 95  ? 9.388   58.869  51.893  1.00 67.76 ? 98   LYS A CD  1 
ATOM   739   C  CE  . LYS A 1 95  ? 8.866   60.032  51.044  1.00 68.59 ? 98   LYS A CE  1 
ATOM   740   N  NZ  . LYS A 1 95  ? 7.895   60.879  51.816  1.00 69.42 ? 98   LYS A NZ  1 
ATOM   741   N  N   . VAL A 1 96  ? 11.149  57.135  56.982  1.00 63.08 ? 99   VAL A N   1 
ATOM   742   C  CA  . VAL A 1 96  ? 10.700  56.375  58.126  1.00 62.96 ? 99   VAL A CA  1 
ATOM   743   C  C   . VAL A 1 96  ? 10.657  57.232  59.399  1.00 63.00 ? 99   VAL A C   1 
ATOM   744   O  O   . VAL A 1 96  ? 10.005  56.859  60.372  1.00 63.13 ? 99   VAL A O   1 
ATOM   745   C  CB  . VAL A 1 96  ? 11.603  55.161  58.339  1.00 62.82 ? 99   VAL A CB  1 
ATOM   746   C  CG1 . VAL A 1 96  ? 12.959  55.604  58.823  1.00 62.97 ? 99   VAL A CG1 1 
ATOM   747   C  CG2 . VAL A 1 96  ? 10.969  54.189  59.304  1.00 63.23 ? 99   VAL A CG2 1 
ATOM   748   N  N   . PHE A 1 97  ? 11.322  58.386  59.388  1.00 63.11 ? 100  PHE A N   1 
ATOM   749   C  CA  . PHE A 1 97  ? 11.345  59.272  60.560  1.00 63.29 ? 100  PHE A CA  1 
ATOM   750   C  C   . PHE A 1 97  ? 10.654  60.604  60.329  1.00 63.87 ? 100  PHE A C   1 
ATOM   751   O  O   . PHE A 1 97  ? 10.573  61.415  61.248  1.00 63.97 ? 100  PHE A O   1 
ATOM   752   C  CB  . PHE A 1 97  ? 12.780  59.638  60.955  1.00 62.78 ? 100  PHE A CB  1 
ATOM   753   C  CG  . PHE A 1 97  ? 13.713  58.476  61.064  1.00 62.44 ? 100  PHE A CG  1 
ATOM   754   C  CD1 . PHE A 1 97  ? 13.471  57.449  61.962  1.00 62.30 ? 100  PHE A CD1 1 
ATOM   755   C  CD2 . PHE A 1 97  ? 14.861  58.429  60.287  1.00 62.01 ? 100  PHE A CD2 1 
ATOM   756   C  CE1 . PHE A 1 97  ? 14.363  56.394  62.086  1.00 61.91 ? 100  PHE A CE1 1 
ATOM   757   C  CE2 . PHE A 1 97  ? 15.755  57.382  60.404  1.00 61.72 ? 100  PHE A CE2 1 
ATOM   758   C  CZ  . PHE A 1 97  ? 15.507  56.361  61.305  1.00 61.74 ? 100  PHE A CZ  1 
ATOM   759   N  N   . GLU A 1 98  ? 10.182  60.850  59.113  1.00 64.51 ? 101  GLU A N   1 
ATOM   760   C  CA  . GLU A 1 98  ? 9.586   62.139  58.791  1.00 65.10 ? 101  GLU A CA  1 
ATOM   761   C  C   . GLU A 1 98  ? 8.618   62.787  59.772  1.00 65.21 ? 101  GLU A C   1 
ATOM   762   O  O   . GLU A 1 98  ? 8.617   64.005  59.896  1.00 65.41 ? 101  GLU A O   1 
ATOM   763   C  CB  . GLU A 1 98  ? 9.012   62.158  57.375  1.00 65.77 ? 101  GLU A CB  1 
ATOM   764   C  CG  . GLU A 1 98  ? 7.634   61.569  57.233  1.00 67.00 ? 101  GLU A CG  1 
ATOM   765   C  CD  . GLU A 1 98  ? 6.909   62.089  56.007  1.00 67.70 ? 101  GLU A CD  1 
ATOM   766   O  OE1 . GLU A 1 98  ? 5.666   61.971  55.972  1.00 68.31 ? 101  GLU A OE1 1 
ATOM   767   O  OE2 . GLU A 1 98  ? 7.569   62.618  55.082  1.00 67.96 ? 101  GLU A OE2 1 
ATOM   768   N  N   . HIS A 1 99  ? 7.803   62.012  60.477  1.00 65.32 ? 102  HIS A N   1 
ATOM   769   C  CA  . HIS A 1 99  ? 6.884   62.634  61.427  1.00 65.42 ? 102  HIS A CA  1 
ATOM   770   C  C   . HIS A 1 99  ? 6.471   61.742  62.586  1.00 65.32 ? 102  HIS A C   1 
ATOM   771   O  O   . HIS A 1 99  ? 6.379   60.520  62.454  1.00 65.63 ? 102  HIS A O   1 
ATOM   772   C  CB  . HIS A 1 99  ? 5.633   63.152  60.713  1.00 65.59 ? 102  HIS A CB  1 
ATOM   773   C  CG  . HIS A 1 99  ? 4.698   62.071  60.278  1.00 65.73 ? 102  HIS A CG  1 
ATOM   774   N  ND1 . HIS A 1 99  ? 4.650   61.605  58.982  1.00 65.77 ? 102  HIS A ND1 1 
ATOM   775   C  CD2 . HIS A 1 99  ? 3.775   61.355  60.970  1.00 66.15 ? 102  HIS A CD2 1 
ATOM   776   C  CE1 . HIS A 1 99  ? 3.739   60.651  58.894  1.00 65.98 ? 102  HIS A CE1 1 
ATOM   777   N  NE2 . HIS A 1 99  ? 3.195   60.479  60.085  1.00 65.94 ? 102  HIS A NE2 1 
ATOM   778   N  N   . ILE A 1 100 ? 6.184   62.371  63.717  1.00 64.85 ? 103  ILE A N   1 
ATOM   779   C  CA  . ILE A 1 100 ? 5.762   61.646  64.901  1.00 64.25 ? 103  ILE A CA  1 
ATOM   780   C  C   . ILE A 1 100 ? 4.433   60.956  64.621  1.00 63.95 ? 103  ILE A C   1 
ATOM   781   O  O   . ILE A 1 100 ? 3.531   61.533  64.010  1.00 63.89 ? 103  ILE A O   1 
ATOM   782   C  CB  . ILE A 1 100 ? 5.623   62.600  66.099  1.00 64.17 ? 103  ILE A CB  1 
ATOM   783   C  CG1 . ILE A 1 100 ? 6.981   63.225  66.421  1.00 63.96 ? 103  ILE A CG1 1 
ATOM   784   C  CG2 . ILE A 1 100 ? 5.100   61.861  67.315  1.00 64.32 ? 103  ILE A CG2 1 
ATOM   785   C  CD1 . ILE A 1 100 ? 6.936   64.251  67.537  1.00 63.72 ? 103  ILE A CD1 1 
ATOM   786   N  N   . GLY A 1 101 ? 4.332   59.705  65.048  1.00 63.71 ? 104  GLY A N   1 
ATOM   787   C  CA  . GLY A 1 101 ? 3.118   58.953  64.826  1.00 63.15 ? 104  GLY A CA  1 
ATOM   788   C  C   . GLY A 1 101 ? 3.206   58.111  63.572  1.00 62.89 ? 104  GLY A C   1 
ATOM   789   O  O   . GLY A 1 101 ? 2.345   57.263  63.338  1.00 63.03 ? 104  GLY A O   1 
ATOM   790   N  N   . LYS A 1 102 ? 4.222   58.348  62.746  1.00 62.26 ? 105  LYS A N   1 
ATOM   791   C  CA  . LYS A 1 102 ? 4.371   57.561  61.532  1.00 61.79 ? 105  LYS A CA  1 
ATOM   792   C  C   . LYS A 1 102 ? 4.748   56.122  61.870  1.00 61.85 ? 105  LYS A C   1 
ATOM   793   O  O   . LYS A 1 102 ? 5.736   55.873  62.569  1.00 61.90 ? 105  LYS A O   1 
ATOM   794   C  CB  . LYS A 1 102 ? 5.431   58.157  60.613  1.00 61.43 ? 105  LYS A CB  1 
ATOM   795   C  CG  . LYS A 1 102 ? 5.517   57.452  59.271  1.00 60.70 ? 105  LYS A CG  1 
ATOM   796   C  CD  . LYS A 1 102 ? 6.618   58.030  58.414  1.00 60.43 ? 105  LYS A CD  1 
ATOM   797   C  CE  . LYS A 1 102 ? 6.721   57.306  57.083  1.00 60.11 ? 105  LYS A CE  1 
ATOM   798   N  NZ  . LYS A 1 102 ? 5.528   57.555  56.239  1.00 59.85 ? 105  LYS A NZ  1 
ATOM   799   N  N   . LYS A 1 103 ? 3.929   55.185  61.397  1.00 61.96 ? 106  LYS A N   1 
ATOM   800   C  CA  . LYS A 1 103 ? 4.159   53.759  61.619  1.00 61.87 ? 106  LYS A CA  1 
ATOM   801   C  C   . LYS A 1 103 ? 4.717   53.131  60.351  1.00 61.63 ? 106  LYS A C   1 
ATOM   802   O  O   . LYS A 1 103 ? 4.318   53.486  59.244  1.00 61.87 ? 106  LYS A O   1 
ATOM   803   C  CB  . LYS A 1 103 ? 2.857   53.035  61.967  1.00 62.23 ? 106  LYS A CB  1 
ATOM   804   C  CG  . LYS A 1 103 ? 2.157   53.508  63.224  1.00 62.85 ? 106  LYS A CG  1 
ATOM   805   C  CD  . LYS A 1 103 ? 1.031   52.541  63.587  1.00 63.40 ? 106  LYS A CD  1 
ATOM   806   C  CE  . LYS A 1 103 ? -0.107  53.236  64.325  1.00 63.79 ? 106  LYS A CE  1 
ATOM   807   N  NZ  . LYS A 1 103 ? 0.221   53.632  65.718  1.00 64.23 ? 106  LYS A NZ  1 
ATOM   808   N  N   . THR A 1 104 ? 5.607   52.163  60.514  1.00 60.93 ? 107  THR A N   1 
ATOM   809   C  CA  . THR A 1 104 ? 6.186   51.493  59.371  1.00 60.31 ? 107  THR A CA  1 
ATOM   810   C  C   . THR A 1 104 ? 6.207   50.003  59.644  1.00 59.91 ? 107  THR A C   1 
ATOM   811   O  O   . THR A 1 104 ? 6.685   49.559  60.684  1.00 60.00 ? 107  THR A O   1 
ATOM   812   C  CB  . THR A 1 104 ? 7.597   52.014  59.103  1.00 60.34 ? 107  THR A CB  1 
ATOM   813   O  OG1 . THR A 1 104 ? 7.518   53.386  58.691  1.00 60.32 ? 107  THR A OG1 1 
ATOM   814   C  CG2 . THR A 1 104 ? 8.280   51.195  58.021  1.00 60.31 ? 107  THR A CG2 1 
ATOM   815   N  N   . PRO A 1 105 ? 5.653   49.208  58.724  1.00 59.49 ? 108  PRO A N   1 
ATOM   816   C  CA  . PRO A 1 105 ? 5.624   47.757  58.897  1.00 59.44 ? 108  PRO A CA  1 
ATOM   817   C  C   . PRO A 1 105 ? 7.041   47.229  59.019  1.00 59.27 ? 108  PRO A C   1 
ATOM   818   O  O   . PRO A 1 105 ? 7.949   47.711  58.335  1.00 59.71 ? 108  PRO A O   1 
ATOM   819   C  CB  . PRO A 1 105 ? 4.979   47.275  57.600  1.00 59.31 ? 108  PRO A CB  1 
ATOM   820   C  CG  . PRO A 1 105 ? 4.144   48.441  57.171  1.00 59.43 ? 108  PRO A CG  1 
ATOM   821   C  CD  . PRO A 1 105 ? 5.052   49.596  57.439  1.00 59.51 ? 108  PRO A CD  1 
ATOM   822   N  N   . ILE A 1 106 ? 7.244   46.267  59.909  1.00 58.80 ? 109  ILE A N   1 
ATOM   823   C  CA  . ILE A 1 106 ? 8.569   45.696  60.078  1.00 58.23 ? 109  ILE A CA  1 
ATOM   824   C  C   . ILE A 1 106 ? 8.534   44.187  60.208  1.00 58.44 ? 109  ILE A C   1 
ATOM   825   O  O   . ILE A 1 106 ? 7.542   43.594  60.635  1.00 58.39 ? 109  ILE A O   1 
ATOM   826   C  CB  . ILE A 1 106 ? 9.265   46.223  61.329  1.00 57.53 ? 109  ILE A CB  1 
ATOM   827   C  CG1 . ILE A 1 106 ? 8.474   45.806  62.568  1.00 57.07 ? 109  ILE A CG1 1 
ATOM   828   C  CG2 . ILE A 1 106 ? 9.433   47.725  61.245  1.00 57.48 ? 109  ILE A CG2 1 
ATOM   829   C  CD1 . ILE A 1 106 ? 9.203   46.035  63.857  1.00 56.24 ? 109  ILE A CD1 1 
ATOM   830   N  N   . ALA A 1 107 ? 9.645   43.571  59.850  1.00 58.55 ? 110  ALA A N   1 
ATOM   831   C  CA  . ALA A 1 107 ? 9.788   42.132  59.954  1.00 58.84 ? 110  ALA A CA  1 
ATOM   832   C  C   . ALA A 1 107 ? 11.013  41.960  60.830  1.00 59.10 ? 110  ALA A C   1 
ATOM   833   O  O   . ALA A 1 107 ? 11.978  42.718  60.700  1.00 59.52 ? 110  ALA A O   1 
ATOM   834   C  CB  . ALA A 1 107 ? 10.028  41.535  58.596  1.00 58.96 ? 110  ALA A CB  1 
ATOM   835   N  N   . VAL A 1 108 ? 10.978  40.994  61.738  1.00 59.09 ? 111  VAL A N   1 
ATOM   836   C  CA  . VAL A 1 108 ? 12.108  40.791  62.629  1.00 58.96 ? 111  VAL A CA  1 
ATOM   837   C  C   . VAL A 1 108 ? 12.470  39.322  62.737  1.00 59.30 ? 111  VAL A C   1 
ATOM   838   O  O   . VAL A 1 108 ? 11.604  38.449  62.605  1.00 59.39 ? 111  VAL A O   1 
ATOM   839   C  CB  . VAL A 1 108 ? 11.783  41.325  64.052  1.00 58.83 ? 111  VAL A CB  1 
ATOM   840   C  CG1 . VAL A 1 108 ? 12.945  41.085  65.005  1.00 58.71 ? 111  VAL A CG1 1 
ATOM   841   C  CG2 . VAL A 1 108 ? 11.466  42.800  64.004  1.00 58.39 ? 111  VAL A CG2 1 
ATOM   842   N  N   . ARG A 1 109 ? 13.757  39.052  62.931  1.00 59.31 ? 112  ARG A N   1 
ATOM   843   C  CA  . ARG A 1 109 ? 14.220  37.686  63.113  1.00 59.72 ? 112  ARG A CA  1 
ATOM   844   C  C   . ARG A 1 109 ? 15.276  37.677  64.201  1.00 60.04 ? 112  ARG A C   1 
ATOM   845   O  O   . ARG A 1 109 ? 16.180  38.517  64.201  1.00 60.22 ? 112  ARG A O   1 
ATOM   846   C  CB  . ARG A 1 109 ? 14.792  37.092  61.825  1.00 59.47 ? 112  ARG A CB  1 
ATOM   847   C  CG  . ARG A 1 109 ? 15.162  35.602  61.961  1.00 58.94 ? 112  ARG A CG  1 
ATOM   848   C  CD  . ARG A 1 109 ? 15.599  34.981  60.630  1.00 58.42 ? 112  ARG A CD  1 
ATOM   849   N  NE  . ARG A 1 109 ? 15.957  33.565  60.749  1.00 57.13 ? 112  ARG A NE  1 
ATOM   850   C  CZ  . ARG A 1 109 ? 17.165  33.123  61.084  1.00 56.38 ? 112  ARG A CZ  1 
ATOM   851   N  NH1 . ARG A 1 109 ? 17.398  31.822  61.169  1.00 56.11 ? 112  ARG A NH1 1 
ATOM   852   N  NH2 . ARG A 1 109 ? 18.148  33.981  61.311  1.00 56.29 ? 112  ARG A NH2 1 
ATOM   853   N  N   . PHE A 1 110 ? 15.096  36.784  65.171  1.00 60.54 ? 113  PHE A N   1 
ATOM   854   C  CA  . PHE A 1 110 ? 16.033  36.629  66.278  1.00 60.92 ? 113  PHE A CA  1 
ATOM   855   C  C   . PHE A 1 110 ? 16.801  35.362  66.019  1.00 60.78 ? 113  PHE A C   1 
ATOM   856   O  O   . PHE A 1 110 ? 16.307  34.489  65.315  1.00 60.97 ? 113  PHE A O   1 
ATOM   857   C  CB  . PHE A 1 110 ? 15.287  36.490  67.594  1.00 60.97 ? 113  PHE A CB  1 
ATOM   858   C  CG  . PHE A 1 110 ? 14.498  37.693  67.954  1.00 61.46 ? 113  PHE A CG  1 
ATOM   859   C  CD1 . PHE A 1 110 ? 13.133  37.726  67.737  1.00 61.55 ? 113  PHE A CD1 1 
ATOM   860   C  CD2 . PHE A 1 110 ? 15.120  38.814  68.483  1.00 61.59 ? 113  PHE A CD2 1 
ATOM   861   C  CE1 . PHE A 1 110 ? 12.394  38.867  68.039  1.00 61.60 ? 113  PHE A CE1 1 
ATOM   862   C  CE2 . PHE A 1 110 ? 14.390  39.959  68.789  1.00 61.60 ? 113  PHE A CE2 1 
ATOM   863   C  CZ  . PHE A 1 110 ? 13.027  39.985  68.565  1.00 61.56 ? 113  PHE A CZ  1 
ATOM   864   N  N   . SER A 1 111 ? 17.979  35.234  66.620  1.00 60.85 ? 114  SER A N   1 
ATOM   865   C  CA  . SER A 1 111 ? 18.782  34.040  66.407  1.00 60.86 ? 114  SER A CA  1 
ATOM   866   C  C   . SER A 1 111 ? 20.016  33.939  67.281  1.00 60.86 ? 114  SER A C   1 
ATOM   867   O  O   . SER A 1 111 ? 20.354  34.847  68.034  1.00 60.73 ? 114  SER A O   1 
ATOM   868   C  CB  . SER A 1 111 ? 19.243  33.999  64.952  1.00 60.89 ? 114  SER A CB  1 
ATOM   869   O  OG  . SER A 1 111 ? 20.077  35.114  64.670  1.00 61.31 ? 114  SER A OG  1 
ATOM   870   N  N   . THR A 1 112 ? 20.664  32.789  67.185  1.00 60.93 ? 115  THR A N   1 
ATOM   871   C  CA  . THR A 1 112 ? 21.908  32.540  67.883  1.00 61.31 ? 115  THR A CA  1 
ATOM   872   C  C   . THR A 1 112 ? 22.949  32.770  66.787  1.00 61.51 ? 115  THR A C   1 
ATOM   873   O  O   . THR A 1 112 ? 22.675  33.486  65.814  1.00 61.70 ? 115  THR A O   1 
ATOM   874   C  CB  . THR A 1 112 ? 21.996  31.094  68.378  1.00 61.60 ? 115  THR A CB  1 
ATOM   875   O  OG1 . THR A 1 112 ? 21.706  30.202  67.295  1.00 61.94 ? 115  THR A OG1 1 
ATOM   876   C  CG2 . THR A 1 112 ? 21.023  30.859  69.508  1.00 61.59 ? 115  THR A CG2 1 
ATOM   877   N  N   . VAL A 1 113 ? 24.107  32.127  66.884  1.00 61.43 ? 116  VAL A N   1 
ATOM   878   C  CA  . VAL A 1 113 ? 25.129  32.355  65.876  1.00 60.96 ? 116  VAL A CA  1 
ATOM   879   C  C   . VAL A 1 113 ? 25.826  31.123  65.339  1.00 60.88 ? 116  VAL A C   1 
ATOM   880   O  O   . VAL A 1 113 ? 25.733  30.813  64.153  1.00 60.78 ? 116  VAL A O   1 
ATOM   881   C  CB  . VAL A 1 113 ? 26.226  33.288  66.408  1.00 61.07 ? 116  VAL A CB  1 
ATOM   882   C  CG1 . VAL A 1 113 ? 27.227  33.579  65.317  1.00 61.26 ? 116  VAL A CG1 1 
ATOM   883   C  CG2 . VAL A 1 113 ? 25.626  34.576  66.930  1.00 61.02 ? 116  VAL A CG2 1 
ATOM   884   N  N   . ALA A 1 114 ? 26.552  30.443  66.212  1.00 60.66 ? 117  ALA A N   1 
ATOM   885   C  CA  . ALA A 1 114 ? 27.325  29.278  65.820  1.00 60.83 ? 117  ALA A CA  1 
ATOM   886   C  C   . ALA A 1 114 ? 26.555  28.015  65.458  1.00 61.17 ? 117  ALA A C   1 
ATOM   887   O  O   . ALA A 1 114 ? 26.885  27.343  64.480  1.00 61.41 ? 117  ALA A O   1 
ATOM   888   C  CB  . ALA A 1 114 ? 28.353  28.970  66.893  1.00 60.55 ? 117  ALA A CB  1 
ATOM   889   N  N   . GLY A 1 115 ? 25.531  27.695  66.246  1.00 61.30 ? 118  GLY A N   1 
ATOM   890   C  CA  . GLY A 1 115 ? 24.743  26.486  66.023  1.00 61.51 ? 118  GLY A CA  1 
ATOM   891   C  C   . GLY A 1 115 ? 23.950  26.390  64.729  1.00 61.51 ? 118  GLY A C   1 
ATOM   892   O  O   . GLY A 1 115 ? 23.518  27.406  64.182  1.00 61.74 ? 118  GLY A O   1 
ATOM   893   N  N   . GLU A 1 116 ? 23.773  25.159  64.238  1.00 61.34 ? 119  GLU A N   1 
ATOM   894   C  CA  . GLU A 1 116 ? 23.022  24.900  63.017  1.00 60.56 ? 119  GLU A CA  1 
ATOM   895   C  C   . GLU A 1 116 ? 21.551  24.792  63.340  1.00 59.57 ? 119  GLU A C   1 
ATOM   896   O  O   . GLU A 1 116 ? 21.159  24.811  64.503  1.00 60.13 ? 119  GLU A O   1 
ATOM   897   C  CB  . GLU A 1 116 ? 23.472  23.594  62.355  1.00 60.97 ? 119  GLU A CB  1 
ATOM   898   C  CG  . GLU A 1 116 ? 24.943  23.541  61.989  1.00 61.43 ? 119  GLU A CG  1 
ATOM   899   C  CD  . GLU A 1 116 ? 25.834  23.238  63.177  1.00 61.96 ? 119  GLU A CD  1 
ATOM   900   O  OE1 . GLU A 1 116 ? 25.317  22.891  64.264  1.00 61.99 ? 119  GLU A OE1 1 
ATOM   901   O  OE2 . GLU A 1 116 ? 27.067  23.328  63.020  1.00 62.36 ? 119  GLU A OE2 1 
ATOM   902   N  N   A SER A 1 117 ? 20.725  24.667  62.303  0.50 59.30 ? 120  SER A N   1 
ATOM   903   N  N   B SER A 1 117 ? 20.733  24.606  62.286  0.50 59.44 ? 120  SER A N   1 
ATOM   904   C  CA  A SER A 1 117 ? 19.269  24.602  62.450  0.50 58.58 ? 120  SER A CA  1 
ATOM   905   C  CA  B SER A 1 117 ? 19.312  24.417  62.455  0.50 58.81 ? 120  SER A CA  1 
ATOM   906   C  C   A SER A 1 117 ? 18.666  23.747  63.576  0.50 58.47 ? 120  SER A C   1 
ATOM   907   C  C   B SER A 1 117 ? 19.207  23.125  63.243  0.50 58.54 ? 120  SER A C   1 
ATOM   908   O  O   A SER A 1 117 ? 17.709  24.170  64.210  0.50 58.41 ? 120  SER A O   1 
ATOM   909   O  O   B SER A 1 117 ? 19.821  22.117  62.916  0.50 58.37 ? 120  SER A O   1 
ATOM   910   C  CB  A SER A 1 117 ? 18.611  24.270  61.112  0.50 58.28 ? 120  SER A CB  1 
ATOM   911   C  CB  B SER A 1 117 ? 18.614  24.280  61.100  0.50 58.88 ? 120  SER A CB  1 
ATOM   912   O  OG  A SER A 1 117 ? 18.879  25.283  60.175  0.50 57.54 ? 120  SER A OG  1 
ATOM   913   O  OG  B SER A 1 117 ? 18.853  25.453  60.323  0.50 58.48 ? 120  SER A OG  1 
ATOM   914   N  N   A GLY A 1 118 ? 19.219  22.565  63.826  0.50 58.21 ? 121  GLY A N   1 
ATOM   915   N  N   B GLY A 1 118 ? 18.394  23.141  64.286  0.50 58.35 ? 121  GLY A N   1 
ATOM   916   C  CA  A GLY A 1 118 ? 18.688  21.716  64.878  0.50 58.43 ? 121  GLY A CA  1 
ATOM   917   C  CA  B GLY A 1 118 ? 18.260  21.942  65.097  0.50 58.06 ? 121  GLY A CA  1 
ATOM   918   C  C   A GLY A 1 118 ? 19.301  21.921  66.247  0.50 58.59 ? 121  GLY A C   1 
ATOM   919   C  C   B GLY A 1 118 ? 18.920  22.193  66.436  0.50 58.18 ? 121  GLY A C   1 
ATOM   920   O  O   A GLY A 1 118 ? 19.197  21.051  67.121  0.50 58.41 ? 121  GLY A O   1 
ATOM   921   O  O   B GLY A 1 118 ? 18.519  21.612  67.456  0.50 58.31 ? 121  GLY A O   1 
ATOM   922   N  N   . SER A 1 119 ? 19.912  23.087  66.456  1.00 58.19 ? 122  SER A N   1 
ATOM   923   C  CA  . SER A 1 119 ? 20.589  23.396  67.707  1.00 58.25 ? 122  SER A CA  1 
ATOM   924   C  C   . SER A 1 119 ? 19.657  24.050  68.709  1.00 58.18 ? 122  SER A C   1 
ATOM   925   O  O   . SER A 1 119 ? 18.602  24.564  68.348  1.00 58.21 ? 122  SER A O   1 
ATOM   926   C  CB  . SER A 1 119 ? 21.804  24.280  67.456  1.00 58.17 ? 122  SER A CB  1 
ATOM   927   O  OG  . SER A 1 119 ? 21.431  25.501  66.856  1.00 58.92 ? 122  SER A OG  1 
ATOM   928   N  N   . ALA A 1 120 ? 20.084  24.060  69.966  1.00 58.08 ? 123  ALA A N   1 
ATOM   929   C  CA  . ALA A 1 120 ? 19.299  24.612  71.056  1.00 58.18 ? 123  ALA A CA  1 
ATOM   930   C  C   . ALA A 1 120 ? 19.322  26.114  71.050  1.00 58.48 ? 123  ALA A C   1 
ATOM   931   O  O   . ALA A 1 120 ? 20.312  26.721  70.655  1.00 58.67 ? 123  ALA A O   1 
ATOM   932   C  CB  . ALA A 1 120 ? 19.815  24.102  72.380  1.00 58.28 ? 123  ALA A CB  1 
ATOM   933   N  N   . ASP A 1 121 ? 18.246  26.709  71.551  1.00 58.95 ? 124  ASP A N   1 
ATOM   934   C  CA  . ASP A 1 121 ? 18.128  28.154  71.602  1.00 58.95 ? 124  ASP A CA  1 
ATOM   935   C  C   . ASP A 1 121 ? 18.851  28.775  72.774  1.00 59.46 ? 124  ASP A C   1 
ATOM   936   O  O   . ASP A 1 121 ? 19.593  29.742  72.623  1.00 59.47 ? 124  ASP A O   1 
ATOM   937   C  CB  . ASP A 1 121 ? 16.661  28.561  71.675  1.00 59.02 ? 124  ASP A CB  1 
ATOM   938   C  CG  . ASP A 1 121 ? 16.003  28.626  70.320  1.00 59.40 ? 124  ASP A CG  1 
ATOM   939   O  OD1 . ASP A 1 121 ? 16.718  28.651  69.293  1.00 59.59 ? 124  ASP A OD1 1 
ATOM   940   O  OD2 . ASP A 1 121 ? 14.755  28.672  70.287  1.00 59.67 ? 124  ASP A OD2 1 
ATOM   941   N  N   . THR A 1 122 ? 18.614  28.226  73.954  1.00 59.88 ? 125  THR A N   1 
ATOM   942   C  CA  . THR A 1 122 ? 19.208  28.760  75.164  1.00 60.55 ? 125  THR A CA  1 
ATOM   943   C  C   . THR A 1 122 ? 20.653  28.365  75.394  1.00 60.82 ? 125  THR A C   1 
ATOM   944   O  O   . THR A 1 122 ? 20.940  27.512  76.234  1.00 60.93 ? 125  THR A O   1 
ATOM   945   C  CB  . THR A 1 122 ? 18.371  28.371  76.384  1.00 60.76 ? 125  THR A CB  1 
ATOM   946   O  OG1 . THR A 1 122 ? 18.276  26.942  76.472  1.00 61.01 ? 125  THR A OG1 1 
ATOM   947   C  CG2 . THR A 1 122 ? 16.976  28.967  76.254  1.00 61.02 ? 125  THR A CG2 1 
ATOM   948   N  N   . VAL A 1 123 ? 21.563  29.003  74.666  1.00 60.34 ? 126  VAL A N   1 
ATOM   949   C  CA  . VAL A 1 123 ? 22.981  28.707  74.799  1.00 60.12 ? 126  VAL A CA  1 
ATOM   950   C  C   . VAL A 1 123 ? 23.792  29.983  74.819  1.00 60.05 ? 126  VAL A C   1 
ATOM   951   O  O   . VAL A 1 123 ? 23.322  31.040  74.395  1.00 60.23 ? 126  VAL A O   1 
ATOM   952   C  CB  . VAL A 1 123 ? 23.495  27.824  73.641  1.00 60.24 ? 126  VAL A CB  1 
ATOM   953   C  CG1 . VAL A 1 123 ? 22.824  26.461  73.670  1.00 60.27 ? 126  VAL A CG1 1 
ATOM   954   C  CG2 . VAL A 1 123 ? 23.250  28.503  72.309  1.00 59.77 ? 126  VAL A CG2 1 
ATOM   955   N  N   . ARG A 1 124 ? 24.994  29.888  75.370  1.00 60.44 ? 127  ARG A N   1 
ATOM   956   C  CA  . ARG A 1 124 ? 25.902  31.019  75.432  1.00 60.44 ? 127  ARG A CA  1 
ATOM   957   C  C   . ARG A 1 124 ? 26.314  31.269  73.994  1.00 60.66 ? 127  ARG A C   1 
ATOM   958   O  O   . ARG A 1 124 ? 26.919  30.402  73.352  1.00 60.67 ? 127  ARG A O   1 
ATOM   959   C  CB  . ARG A 1 124 ? 27.140  30.673  76.255  1.00 60.43 ? 127  ARG A CB  1 
ATOM   960   C  CG  . ARG A 1 124 ? 28.220  31.746  76.223  1.00 60.03 ? 127  ARG A CG  1 
ATOM   961   C  CD  . ARG A 1 124 ? 28.132  32.615  77.440  1.00 59.77 ? 127  ARG A CD  1 
ATOM   962   N  NE  . ARG A 1 124 ? 28.117  31.802  78.646  1.00 58.87 ? 127  ARG A NE  1 
ATOM   963   C  CZ  . ARG A 1 124 ? 27.718  32.232  79.833  1.00 58.63 ? 127  ARG A CZ  1 
ATOM   964   N  NH1 . ARG A 1 124 ? 27.730  31.408  80.868  1.00 58.87 ? 127  ARG A NH1 1 
ATOM   965   N  NH2 . ARG A 1 124 ? 27.327  33.487  79.992  1.00 58.74 ? 127  ARG A NH2 1 
ATOM   966   N  N   . ASP A 1 125 ? 25.965  32.452  73.499  1.00 60.36 ? 128  ASP A N   1 
ATOM   967   C  CA  . ASP A 1 125 ? 26.259  32.858  72.131  1.00 59.91 ? 128  ASP A CA  1 
ATOM   968   C  C   . ASP A 1 125 ? 25.546  34.195  71.957  1.00 59.82 ? 128  ASP A C   1 
ATOM   969   O  O   . ASP A 1 125 ? 24.579  34.474  72.669  1.00 59.73 ? 128  ASP A O   1 
ATOM   970   C  CB  . ASP A 1 125 ? 25.654  31.828  71.166  1.00 59.50 ? 128  ASP A CB  1 
ATOM   971   C  CG  . ASP A 1 125 ? 26.325  31.811  69.817  1.00 58.78 ? 128  ASP A CG  1 
ATOM   972   O  OD1 . ASP A 1 125 ? 25.688  31.344  68.863  1.00 58.64 ? 128  ASP A OD1 1 
ATOM   973   O  OD2 . ASP A 1 125 ? 27.489  32.232  69.705  1.00 58.81 ? 128  ASP A OD2 1 
ATOM   974   N  N   . PRO A 1 126 ? 26.073  35.090  71.104  1.00 59.73 ? 129  PRO A N   1 
ATOM   975   C  CA  . PRO A 1 126 ? 25.339  36.352  70.960  1.00 59.68 ? 129  PRO A CA  1 
ATOM   976   C  C   . PRO A 1 126 ? 23.982  36.092  70.289  1.00 59.91 ? 129  PRO A C   1 
ATOM   977   O  O   . PRO A 1 126 ? 23.683  34.957  69.894  1.00 59.94 ? 129  PRO A O   1 
ATOM   978   C  CB  . PRO A 1 126 ? 26.272  37.203  70.093  1.00 59.40 ? 129  PRO A CB  1 
ATOM   979   C  CG  . PRO A 1 126 ? 27.163  36.204  69.417  1.00 59.41 ? 129  PRO A CG  1 
ATOM   980   C  CD  . PRO A 1 126 ? 27.402  35.183  70.477  1.00 59.70 ? 129  PRO A CD  1 
ATOM   981   N  N   . ARG A 1 127 ? 23.132  37.116  70.230  1.00 60.05 ? 130  ARG A N   1 
ATOM   982   C  CA  . ARG A 1 127 ? 21.816  36.968  69.616  1.00 59.83 ? 130  ARG A CA  1 
ATOM   983   C  C   . ARG A 1 127 ? 21.600  37.971  68.487  1.00 59.82 ? 130  ARG A C   1 
ATOM   984   O  O   . ARG A 1 127 ? 21.874  39.171  68.630  1.00 59.92 ? 130  ARG A O   1 
ATOM   985   C  CB  . ARG A 1 127 ? 20.705  37.129  70.657  1.00 59.62 ? 130  ARG A CB  1 
ATOM   986   C  CG  . ARG A 1 127 ? 20.726  36.121  71.800  1.00 59.46 ? 130  ARG A CG  1 
ATOM   987   C  CD  . ARG A 1 127 ? 20.319  34.722  71.354  1.00 59.34 ? 130  ARG A CD  1 
ATOM   988   N  NE  . ARG A 1 127 ? 20.160  33.822  72.499  1.00 59.15 ? 130  ARG A NE  1 
ATOM   989   C  CZ  . ARG A 1 127 ? 21.148  33.119  73.051  1.00 59.08 ? 130  ARG A CZ  1 
ATOM   990   N  NH1 . ARG A 1 127 ? 22.379  33.199  72.566  1.00 59.19 ? 130  ARG A NH1 1 
ATOM   991   N  NH2 . ARG A 1 127 ? 20.910  32.338  74.096  1.00 59.01 ? 130  ARG A NH2 1 
ATOM   992   N  N   . GLY A 1 128 ? 21.149  37.460  67.347  1.00 59.83 ? 131  GLY A N   1 
ATOM   993   C  CA  . GLY A 1 128 ? 20.885  38.324  66.218  1.00 59.69 ? 131  GLY A CA  1 
ATOM   994   C  C   . GLY A 1 128 ? 19.538  38.970  66.444  1.00 59.69 ? 131  GLY A C   1 
ATOM   995   O  O   . GLY A 1 128 ? 18.612  38.329  66.941  1.00 59.68 ? 131  GLY A O   1 
ATOM   996   N  N   . PHE A 1 129 ? 19.433  40.251  66.118  1.00 59.75 ? 132  PHE A N   1 
ATOM   997   C  CA  . PHE A 1 129 ? 18.183  40.975  66.282  1.00 59.44 ? 132  PHE A CA  1 
ATOM   998   C  C   . PHE A 1 129 ? 18.097  41.859  65.053  1.00 59.10 ? 132  PHE A C   1 
ATOM   999   O  O   . PHE A 1 129 ? 18.476  43.026  65.087  1.00 59.03 ? 132  PHE A O   1 
ATOM   1000  C  CB  . PHE A 1 129 ? 18.241  41.809  67.558  1.00 59.35 ? 132  PHE A CB  1 
ATOM   1001  C  CG  . PHE A 1 129 ? 16.920  42.370  67.983  1.00 59.53 ? 132  PHE A CG  1 
ATOM   1002  C  CD1 . PHE A 1 129 ? 15.893  42.556  67.071  1.00 59.57 ? 132  PHE A CD1 1 
ATOM   1003  C  CD2 . PHE A 1 129 ? 16.714  42.741  69.301  1.00 59.40 ? 132  PHE A CD2 1 
ATOM   1004  C  CE1 . PHE A 1 129 ? 14.683  43.107  67.469  1.00 59.72 ? 132  PHE A CE1 1 
ATOM   1005  C  CE2 . PHE A 1 129 ? 15.508  43.293  69.709  1.00 59.45 ? 132  PHE A CE2 1 
ATOM   1006  C  CZ  . PHE A 1 129 ? 14.493  43.477  68.794  1.00 59.59 ? 132  PHE A CZ  1 
ATOM   1007  N  N   . ALA A 1 130 ? 17.630  41.268  63.959  1.00 58.91 ? 133  ALA A N   1 
ATOM   1008  C  CA  . ALA A 1 130 ? 17.527  41.964  62.686  1.00 58.88 ? 133  ALA A CA  1 
ATOM   1009  C  C   . ALA A 1 130 ? 16.155  42.557  62.436  1.00 58.99 ? 133  ALA A C   1 
ATOM   1010  O  O   . ALA A 1 130 ? 15.138  41.895  62.653  1.00 59.46 ? 133  ALA A O   1 
ATOM   1011  C  CB  . ALA A 1 130 ? 17.892  41.018  61.560  1.00 58.99 ? 133  ALA A CB  1 
ATOM   1012  N  N   . VAL A 1 131 ? 16.130  43.792  61.943  1.00 58.97 ? 134  VAL A N   1 
ATOM   1013  C  CA  . VAL A 1 131 ? 14.870  44.466  61.654  1.00 58.94 ? 134  VAL A CA  1 
ATOM   1014  C  C   . VAL A 1 131 ? 14.794  44.948  60.205  1.00 59.09 ? 134  VAL A C   1 
ATOM   1015  O  O   . VAL A 1 131 ? 15.760  45.503  59.669  1.00 59.09 ? 134  VAL A O   1 
ATOM   1016  C  CB  . VAL A 1 131 ? 14.658  45.674  62.575  1.00 59.11 ? 134  VAL A CB  1 
ATOM   1017  C  CG1 . VAL A 1 131 ? 13.242  46.189  62.436  1.00 58.87 ? 134  VAL A CG1 1 
ATOM   1018  C  CG2 . VAL A 1 131 ? 14.939  45.303  64.009  1.00 58.81 ? 134  VAL A CG2 1 
ATOM   1019  N  N   . LYS A 1 132 ? 13.640  44.725  59.580  1.00 59.12 ? 135  LYS A N   1 
ATOM   1020  C  CA  . LYS A 1 132 ? 13.402  45.142  58.205  1.00 59.23 ? 135  LYS A CA  1 
ATOM   1021  C  C   . LYS A 1 132 ? 12.214  46.100  58.192  1.00 60.19 ? 135  LYS A C   1 
ATOM   1022  O  O   . LYS A 1 132 ? 11.092  45.711  58.526  1.00 60.55 ? 135  LYS A O   1 
ATOM   1023  C  CB  . LYS A 1 132 ? 13.085  43.931  57.327  1.00 58.16 ? 135  LYS A CB  1 
ATOM   1024  C  CG  . LYS A 1 132 ? 12.747  44.297  55.894  1.00 57.31 ? 135  LYS A CG  1 
ATOM   1025  C  CD  . LYS A 1 132 ? 12.309  43.097  55.065  1.00 56.88 ? 135  LYS A CD  1 
ATOM   1026  C  CE  . LYS A 1 132 ? 13.444  42.136  54.794  1.00 56.35 ? 135  LYS A CE  1 
ATOM   1027  N  NZ  . LYS A 1 132 ? 14.549  42.828  54.100  1.00 56.50 ? 135  LYS A NZ  1 
ATOM   1028  N  N   . PHE A 1 133 ? 12.465  47.358  57.845  1.00 60.95 ? 136  PHE A N   1 
ATOM   1029  C  CA  . PHE A 1 133 ? 11.402  48.353  57.789  1.00 61.56 ? 136  PHE A CA  1 
ATOM   1030  C  C   . PHE A 1 133 ? 10.988  48.484  56.344  1.00 61.93 ? 136  PHE A C   1 
ATOM   1031  O  O   . PHE A 1 133 ? 11.800  48.869  55.499  1.00 62.14 ? 136  PHE A O   1 
ATOM   1032  C  CB  . PHE A 1 133 ? 11.897  49.724  58.247  1.00 62.16 ? 136  PHE A CB  1 
ATOM   1033  C  CG  . PHE A 1 133 ? 12.581  49.714  59.572  1.00 62.64 ? 136  PHE A CG  1 
ATOM   1034  C  CD1 . PHE A 1 133 ? 13.816  49.094  59.728  1.00 62.78 ? 136  PHE A CD1 1 
ATOM   1035  C  CD2 . PHE A 1 133 ? 12.000  50.335  60.665  1.00 62.78 ? 136  PHE A CD2 1 
ATOM   1036  C  CE1 . PHE A 1 133 ? 14.460  49.095  60.957  1.00 62.81 ? 136  PHE A CE1 1 
ATOM   1037  C  CE2 . PHE A 1 133 ? 12.634  50.342  61.898  1.00 62.93 ? 136  PHE A CE2 1 
ATOM   1038  C  CZ  . PHE A 1 133 ? 13.866  49.721  62.046  1.00 62.76 ? 136  PHE A CZ  1 
ATOM   1039  N  N   . TYR A 1 134 ? 9.743   48.149  56.044  1.00 62.01 ? 137  TYR A N   1 
ATOM   1040  C  CA  . TYR A 1 134 ? 9.260   48.278  54.681  1.00 62.19 ? 137  TYR A CA  1 
ATOM   1041  C  C   . TYR A 1 134 ? 8.897   49.743  54.505  1.00 62.45 ? 137  TYR A C   1 
ATOM   1042  O  O   . TYR A 1 134 ? 7.801   50.141  54.877  1.00 62.87 ? 137  TYR A O   1 
ATOM   1043  C  CB  . TYR A 1 134 ? 8.022   47.416  54.487  1.00 61.52 ? 137  TYR A CB  1 
ATOM   1044  C  CG  . TYR A 1 134 ? 8.272   45.944  54.665  1.00 60.75 ? 137  TYR A CG  1 
ATOM   1045  C  CD1 . TYR A 1 134 ? 8.678   45.152  53.592  1.00 60.27 ? 137  TYR A CD1 1 
ATOM   1046  C  CD2 . TYR A 1 134 ? 8.065   45.335  55.895  1.00 60.39 ? 137  TYR A CD2 1 
ATOM   1047  C  CE1 . TYR A 1 134 ? 8.868   43.789  53.741  1.00 59.96 ? 137  TYR A CE1 1 
ATOM   1048  C  CE2 . TYR A 1 134 ? 8.252   43.974  56.056  1.00 60.05 ? 137  TYR A CE2 1 
ATOM   1049  C  CZ  . TYR A 1 134 ? 8.651   43.209  54.975  1.00 59.93 ? 137  TYR A CZ  1 
ATOM   1050  O  OH  . TYR A 1 134 ? 8.823   41.860  55.140  1.00 59.77 ? 137  TYR A OH  1 
ATOM   1051  N  N   . THR A 1 135 ? 9.818   50.550  53.978  1.00 62.71 ? 138  THR A N   1 
ATOM   1052  C  CA  . THR A 1 135 ? 9.554   51.978  53.810  1.00 62.58 ? 138  THR A CA  1 
ATOM   1053  C  C   . THR A 1 135 ? 9.192   52.363  52.385  1.00 62.87 ? 138  THR A C   1 
ATOM   1054  O  O   . THR A 1 135 ? 9.424   51.604  51.448  1.00 62.74 ? 138  THR A O   1 
ATOM   1055  C  CB  . THR A 1 135 ? 10.751  52.845  54.269  1.00 62.38 ? 138  THR A CB  1 
ATOM   1056  O  OG1 . THR A 1 135 ? 11.655  53.042  53.177  1.00 62.08 ? 138  THR A OG1 1 
ATOM   1057  C  CG2 . THR A 1 135 ? 11.499  52.177  55.409  1.00 61.81 ? 138  THR A CG2 1 
ATOM   1058  N  N   . GLU A 1 136 ? 8.633   53.562  52.242  1.00 63.35 ? 139  GLU A N   1 
ATOM   1059  C  CA  . GLU A 1 136 ? 8.227   54.100  50.950  1.00 63.94 ? 139  GLU A CA  1 
ATOM   1060  C  C   . GLU A 1 136 ? 9.411   54.313  50.035  1.00 63.65 ? 139  GLU A C   1 
ATOM   1061  O  O   . GLU A 1 136 ? 9.249   54.399  48.818  1.00 63.65 ? 139  GLU A O   1 
ATOM   1062  C  CB  . GLU A 1 136 ? 7.508   55.424  51.132  1.00 65.26 ? 139  GLU A CB  1 
ATOM   1063  C  CG  . GLU A 1 136 ? 6.196   55.284  51.857  1.00 67.79 ? 139  GLU A CG  1 
ATOM   1064  C  CD  . GLU A 1 136 ? 6.134   56.139  53.103  1.00 69.21 ? 139  GLU A CD  1 
ATOM   1065  O  OE1 . GLU A 1 136 ? 5.913   57.365  52.973  1.00 70.71 ? 139  GLU A OE1 1 
ATOM   1066  O  OE2 . GLU A 1 136 ? 6.306   55.592  54.213  1.00 69.81 ? 139  GLU A OE2 1 
ATOM   1067  N  N   . ASP A 1 137 ? 10.591  54.466  50.630  1.00 63.18 ? 140  ASP A N   1 
ATOM   1068  C  CA  . ASP A 1 137 ? 11.821  54.655  49.867  1.00 62.56 ? 140  ASP A CA  1 
ATOM   1069  C  C   . ASP A 1 137 ? 12.552  53.328  49.764  1.00 62.15 ? 140  ASP A C   1 
ATOM   1070  O  O   . ASP A 1 137 ? 13.761  53.280  49.541  1.00 62.04 ? 140  ASP A O   1 
ATOM   1071  C  CB  . ASP A 1 137 ? 12.725  55.715  50.515  1.00 62.68 ? 140  ASP A CB  1 
ATOM   1072  C  CG  . ASP A 1 137 ? 12.308  57.143  50.169  1.00 62.83 ? 140  ASP A CG  1 
ATOM   1073  O  OD1 . ASP A 1 137 ? 12.845  58.091  50.783  1.00 63.24 ? 140  ASP A OD1 1 
ATOM   1074  O  OD2 . ASP A 1 137 ? 11.451  57.331  49.279  1.00 62.89 ? 140  ASP A OD2 1 
ATOM   1075  N  N   . GLY A 1 138 ? 11.793  52.247  49.880  1.00 61.65 ? 141  GLY A N   1 
ATOM   1076  C  CA  . GLY A 1 138 ? 12.382  50.928  49.804  1.00 61.19 ? 141  GLY A CA  1 
ATOM   1077  C  C   . GLY A 1 138 ? 12.536  50.337  51.188  1.00 60.86 ? 141  GLY A C   1 
ATOM   1078  O  O   . GLY A 1 138 ? 12.164  50.958  52.186  1.00 60.91 ? 141  GLY A O   1 
ATOM   1079  N  N   . ASN A 1 139 ? 13.074  49.127  51.255  1.00 60.20 ? 142  ASN A N   1 
ATOM   1080  C  CA  . ASN A 1 139 ? 13.256  48.474  52.535  1.00 59.67 ? 142  ASN A CA  1 
ATOM   1081  C  C   . ASN A 1 139 ? 14.520  48.961  53.205  1.00 59.66 ? 142  ASN A C   1 
ATOM   1082  O  O   . ASN A 1 139 ? 15.483  49.336  52.534  1.00 59.59 ? 142  ASN A O   1 
ATOM   1083  C  CB  . ASN A 1 139 ? 13.312  46.961  52.354  1.00 59.10 ? 142  ASN A CB  1 
ATOM   1084  C  CG  . ASN A 1 139 ? 11.998  46.387  51.879  1.00 58.86 ? 142  ASN A CG  1 
ATOM   1085  O  OD1 . ASN A 1 139 ? 10.994  47.096  51.803  1.00 59.02 ? 142  ASN A OD1 1 
ATOM   1086  N  ND2 . ASN A 1 139 ? 11.991  45.097  51.562  1.00 58.92 ? 142  ASN A ND2 1 
ATOM   1087  N  N   . TRP A 1 140 ? 14.497  48.996  54.535  1.00 59.67 ? 143  TRP A N   1 
ATOM   1088  C  CA  . TRP A 1 140 ? 15.656  49.412  55.315  1.00 59.45 ? 143  TRP A CA  1 
ATOM   1089  C  C   . TRP A 1 140 ? 15.965  48.291  56.279  1.00 59.32 ? 143  TRP A C   1 
ATOM   1090  O  O   . TRP A 1 140 ? 15.187  48.034  57.204  1.00 59.70 ? 143  TRP A O   1 
ATOM   1091  C  CB  . TRP A 1 140 ? 15.378  50.691  56.110  1.00 59.40 ? 143  TRP A CB  1 
ATOM   1092  C  CG  . TRP A 1 140 ? 16.505  51.044  57.041  1.00 58.96 ? 143  TRP A CG  1 
ATOM   1093  C  CD1 . TRP A 1 140 ? 17.834  50.865  56.811  1.00 58.79 ? 143  TRP A CD1 1 
ATOM   1094  C  CD2 . TRP A 1 140 ? 16.397  51.579  58.365  1.00 58.82 ? 143  TRP A CD2 1 
ATOM   1095  N  NE1 . TRP A 1 140 ? 18.560  51.245  57.908  1.00 58.88 ? 143  TRP A NE1 1 
ATOM   1096  C  CE2 . TRP A 1 140 ? 17.703  51.688  58.878  1.00 58.79 ? 143  TRP A CE2 1 
ATOM   1097  C  CE3 . TRP A 1 140 ? 15.322  51.972  59.170  1.00 58.68 ? 143  TRP A CE3 1 
ATOM   1098  C  CZ2 . TRP A 1 140 ? 17.969  52.175  60.165  1.00 58.90 ? 143  TRP A CZ2 1 
ATOM   1099  C  CZ3 . TRP A 1 140 ? 15.589  52.459  60.456  1.00 58.77 ? 143  TRP A CZ3 1 
ATOM   1100  C  CH2 . TRP A 1 140 ? 16.903  52.553  60.936  1.00 58.45 ? 143  TRP A CH2 1 
ATOM   1101  N  N   . ASP A 1 141 ? 17.095  47.628  56.068  1.00 58.99 ? 144  ASP A N   1 
ATOM   1102  C  CA  . ASP A 1 141 ? 17.476  46.529  56.931  1.00 58.69 ? 144  ASP A CA  1 
ATOM   1103  C  C   . ASP A 1 141 ? 18.475  46.946  57.970  1.00 58.55 ? 144  ASP A C   1 
ATOM   1104  O  O   . ASP A 1 141 ? 19.598  47.302  57.645  1.00 59.02 ? 144  ASP A O   1 
ATOM   1105  C  CB  . ASP A 1 141 ? 18.052  45.374  56.117  1.00 58.64 ? 144  ASP A CB  1 
ATOM   1106  C  CG  . ASP A 1 141 ? 17.001  44.660  55.296  1.00 58.35 ? 144  ASP A CG  1 
ATOM   1107  O  OD1 . ASP A 1 141 ? 17.317  44.225  54.167  1.00 58.19 ? 144  ASP A OD1 1 
ATOM   1108  O  OD2 . ASP A 1 141 ? 15.861  44.519  55.786  1.00 58.22 ? 144  ASP A OD2 1 
ATOM   1109  N  N   . LEU A 1 142 ? 18.049  46.953  59.221  1.00 58.41 ? 145  LEU A N   1 
ATOM   1110  C  CA  . LEU A 1 142 ? 18.955  47.288  60.300  1.00 58.27 ? 145  LEU A CA  1 
ATOM   1111  C  C   . LEU A 1 142 ? 19.264  45.944  60.933  1.00 58.39 ? 145  LEU A C   1 
ATOM   1112  O  O   . LEU A 1 142 ? 18.499  45.454  61.764  1.00 58.74 ? 145  LEU A O   1 
ATOM   1113  C  CB  . LEU A 1 142 ? 18.292  48.216  61.309  1.00 57.74 ? 145  LEU A CB  1 
ATOM   1114  C  CG  . LEU A 1 142 ? 19.249  48.597  62.435  1.00 57.57 ? 145  LEU A CG  1 
ATOM   1115  C  CD1 . LEU A 1 142 ? 20.534  49.183  61.860  1.00 57.06 ? 145  LEU A CD1 1 
ATOM   1116  C  CD2 . LEU A 1 142 ? 18.577  49.572  63.369  1.00 57.43 ? 145  LEU A CD2 1 
ATOM   1117  N  N   . VAL A 1 143 ? 20.359  45.334  60.484  1.00 58.16 ? 146  VAL A N   1 
ATOM   1118  C  CA  . VAL A 1 143 ? 20.799  44.018  60.941  1.00 57.65 ? 146  VAL A CA  1 
ATOM   1119  C  C   . VAL A 1 143 ? 21.664  44.091  62.189  1.00 58.09 ? 146  VAL A C   1 
ATOM   1120  O  O   . VAL A 1 143 ? 22.891  43.985  62.107  1.00 58.36 ? 146  VAL A O   1 
ATOM   1121  C  CB  . VAL A 1 143 ? 21.601  43.319  59.836  1.00 56.96 ? 146  VAL A CB  1 
ATOM   1122  C  CG1 . VAL A 1 143 ? 21.664  41.834  60.092  1.00 56.73 ? 146  VAL A CG1 1 
ATOM   1123  C  CG2 . VAL A 1 143 ? 20.986  43.609  58.485  1.00 56.57 ? 146  VAL A CG2 1 
ATOM   1124  N  N   . GLY A 1 144 ? 21.027  44.197  63.351  1.00 58.29 ? 147  GLY A N   1 
ATOM   1125  C  CA  . GLY A 1 144 ? 21.789  44.301  64.583  1.00 58.74 ? 147  GLY A CA  1 
ATOM   1126  C  C   . GLY A 1 144 ? 21.894  43.060  65.445  1.00 59.13 ? 147  GLY A C   1 
ATOM   1127  O  O   . GLY A 1 144 ? 21.422  41.986  65.076  1.00 59.31 ? 147  GLY A O   1 
ATOM   1128  N  N   . ASN A 1 145 ? 22.549  43.214  66.592  1.00 59.27 ? 148  ASN A N   1 
ATOM   1129  C  CA  . ASN A 1 145 ? 22.717  42.131  67.553  1.00 59.46 ? 148  ASN A CA  1 
ATOM   1130  C  C   . ASN A 1 145 ? 22.242  42.591  68.911  1.00 59.51 ? 148  ASN A C   1 
ATOM   1131  O  O   . ASN A 1 145 ? 21.874  43.752  69.091  1.00 59.52 ? 148  ASN A O   1 
ATOM   1132  C  CB  . ASN A 1 145 ? 24.182  41.735  67.669  1.00 59.50 ? 148  ASN A CB  1 
ATOM   1133  C  CG  . ASN A 1 145 ? 24.613  40.788  66.588  1.00 59.58 ? 148  ASN A CG  1 
ATOM   1134  O  OD1 . ASN A 1 145 ? 23.783  40.200  65.895  1.00 60.08 ? 148  ASN A OD1 1 
ATOM   1135  N  ND2 . ASN A 1 145 ? 25.922  40.612  66.448  1.00 59.41 ? 148  ASN A ND2 1 
ATOM   1136  N  N   . ASN A 1 146 ? 22.278  41.676  69.873  1.00 59.68 ? 149  ASN A N   1 
ATOM   1137  C  CA  . ASN A 1 146 ? 21.862  41.990  71.230  1.00 59.80 ? 149  ASN A CA  1 
ATOM   1138  C  C   . ASN A 1 146 ? 23.039  42.592  71.975  1.00 59.92 ? 149  ASN A C   1 
ATOM   1139  O  O   . ASN A 1 146 ? 23.072  42.577  73.199  1.00 59.97 ? 149  ASN A O   1 
ATOM   1140  C  CB  . ASN A 1 146 ? 21.389  40.733  71.954  1.00 59.87 ? 149  ASN A CB  1 
ATOM   1141  C  CG  . ASN A 1 146 ? 22.521  39.775  72.254  1.00 60.02 ? 149  ASN A CG  1 
ATOM   1142  O  OD1 . ASN A 1 146 ? 23.472  39.665  71.483  1.00 60.14 ? 149  ASN A OD1 1 
ATOM   1143  N  ND2 . ASN A 1 146 ? 22.427  39.076  73.380  1.00 60.29 ? 149  ASN A ND2 1 
ATOM   1144  N  N   . THR A 1 147 ? 24.029  43.064  71.221  1.00 60.25 ? 150  THR A N   1 
ATOM   1145  C  CA  . THR A 1 147 ? 25.229  43.691  71.782  1.00 60.60 ? 150  THR A CA  1 
ATOM   1146  C  C   . THR A 1 147 ? 25.622  44.892  70.932  1.00 60.57 ? 150  THR A C   1 
ATOM   1147  O  O   . THR A 1 147 ? 25.388  44.906  69.727  1.00 61.00 ? 150  THR A O   1 
ATOM   1148  C  CB  . THR A 1 147 ? 26.429  42.724  71.826  1.00 60.52 ? 150  THR A CB  1 
ATOM   1149  O  OG1 . THR A 1 147 ? 27.636  43.473  72.033  1.00 60.43 ? 150  THR A OG1 1 
ATOM   1150  C  CG2 . THR A 1 147 ? 26.538  41.941  70.531  1.00 60.27 ? 150  THR A CG2 1 
ATOM   1151  N  N   . PRO A 1 148 ? 26.210  45.922  71.550  1.00 60.30 ? 151  PRO A N   1 
ATOM   1152  C  CA  . PRO A 1 148 ? 26.617  47.116  70.802  1.00 60.30 ? 151  PRO A CA  1 
ATOM   1153  C  C   . PRO A 1 148 ? 27.969  46.976  70.116  1.00 60.44 ? 151  PRO A C   1 
ATOM   1154  O  O   . PRO A 1 148 ? 28.354  47.836  69.321  1.00 60.36 ? 151  PRO A O   1 
ATOM   1155  C  CB  . PRO A 1 148 ? 26.683  48.172  71.891  1.00 60.14 ? 151  PRO A CB  1 
ATOM   1156  C  CG  . PRO A 1 148 ? 27.213  47.380  73.052  1.00 59.79 ? 151  PRO A CG  1 
ATOM   1157  C  CD  . PRO A 1 148 ? 26.383  46.126  72.999  1.00 59.99 ? 151  PRO A CD  1 
ATOM   1158  N  N   . ILE A 1 149 ? 28.664  45.877  70.401  1.00 60.44 ? 152  ILE A N   1 
ATOM   1159  C  CA  . ILE A 1 149 ? 30.000  45.633  69.857  1.00 60.48 ? 152  ILE A CA  1 
ATOM   1160  C  C   . ILE A 1 149 ? 30.167  44.234  69.258  1.00 60.70 ? 152  ILE A C   1 
ATOM   1161  O  O   . ILE A 1 149 ? 29.202  43.466  69.187  1.00 60.99 ? 152  ILE A O   1 
ATOM   1162  C  CB  . ILE A 1 149 ? 31.047  45.799  70.972  1.00 60.17 ? 152  ILE A CB  1 
ATOM   1163  C  CG1 . ILE A 1 149 ? 30.653  44.936  72.177  1.00 59.69 ? 152  ILE A CG1 1 
ATOM   1164  C  CG2 . ILE A 1 149 ? 31.130  47.255  71.401  1.00 60.16 ? 152  ILE A CG2 1 
ATOM   1165  C  CD1 . ILE A 1 149 ? 31.695  44.887  73.277  1.00 59.31 ? 152  ILE A CD1 1 
ATOM   1166  N  N   . PHE A 1 150 ? 31.393  43.911  68.829  1.00 60.72 ? 153  PHE A N   1 
ATOM   1167  C  CA  . PHE A 1 150 ? 31.699  42.598  68.253  1.00 60.64 ? 153  PHE A CA  1 
ATOM   1168  C  C   . PHE A 1 150 ? 33.113  42.140  68.605  1.00 60.21 ? 153  PHE A C   1 
ATOM   1169  O  O   . PHE A 1 150 ? 33.929  42.921  69.081  1.00 60.48 ? 153  PHE A O   1 
ATOM   1170  C  CB  . PHE A 1 150 ? 31.521  42.604  66.733  1.00 61.12 ? 153  PHE A CB  1 
ATOM   1171  C  CG  . PHE A 1 150 ? 31.285  41.242  66.154  1.00 61.90 ? 153  PHE A CG  1 
ATOM   1172  C  CD1 . PHE A 1 150 ? 32.288  40.584  65.455  1.00 62.24 ? 153  PHE A CD1 1 
ATOM   1173  C  CD2 . PHE A 1 150 ? 30.071  40.591  66.350  1.00 62.24 ? 153  PHE A CD2 1 
ATOM   1174  C  CE1 . PHE A 1 150 ? 32.088  39.286  64.958  1.00 62.38 ? 153  PHE A CE1 1 
ATOM   1175  C  CE2 . PHE A 1 150 ? 29.862  39.298  65.859  1.00 62.42 ? 153  PHE A CE2 1 
ATOM   1176  C  CZ  . PHE A 1 150 ? 30.879  38.648  65.162  1.00 62.35 ? 153  PHE A CZ  1 
ATOM   1177  N  N   . PHE A 1 151 ? 33.400  40.869  68.354  1.00 59.67 ? 154  PHE A N   1 
ATOM   1178  C  CA  . PHE A 1 151 ? 34.700  40.288  68.662  1.00 59.15 ? 154  PHE A CA  1 
ATOM   1179  C  C   . PHE A 1 151 ? 35.870  40.820  67.865  1.00 59.32 ? 154  PHE A C   1 
ATOM   1180  O  O   . PHE A 1 151 ? 36.986  40.856  68.372  1.00 59.47 ? 154  PHE A O   1 
ATOM   1181  C  CB  . PHE A 1 151 ? 34.647  38.781  68.473  1.00 58.19 ? 154  PHE A CB  1 
ATOM   1182  C  CG  . PHE A 1 151 ? 33.551  38.121  69.239  1.00 57.57 ? 154  PHE A CG  1 
ATOM   1183  C  CD1 . PHE A 1 151 ? 32.296  37.975  68.680  1.00 57.23 ? 154  PHE A CD1 1 
ATOM   1184  C  CD2 . PHE A 1 151 ? 33.773  37.637  70.519  1.00 57.41 ? 154  PHE A CD2 1 
ATOM   1185  C  CE1 . PHE A 1 151 ? 31.275  37.357  69.382  1.00 57.02 ? 154  PHE A CE1 1 
ATOM   1186  C  CE2 . PHE A 1 151 ? 32.756  37.018  71.229  1.00 57.09 ? 154  PHE A CE2 1 
ATOM   1187  C  CZ  . PHE A 1 151 ? 31.507  36.876  70.659  1.00 56.99 ? 154  PHE A CZ  1 
ATOM   1188  N  N   . ILE A 1 152 ? 35.641  41.177  66.607  1.00 59.49 ? 155  ILE A N   1 
ATOM   1189  C  CA  . ILE A 1 152 ? 36.724  41.672  65.759  1.00 59.63 ? 155  ILE A CA  1 
ATOM   1190  C  C   . ILE A 1 152 ? 36.402  43.020  65.153  1.00 59.96 ? 155  ILE A C   1 
ATOM   1191  O  O   . ILE A 1 152 ? 35.254  43.452  65.187  1.00 60.40 ? 155  ILE A O   1 
ATOM   1192  C  CB  . ILE A 1 152 ? 37.045  40.686  64.624  1.00 59.58 ? 155  ILE A CB  1 
ATOM   1193  C  CG1 . ILE A 1 152 ? 35.814  40.472  63.742  1.00 59.28 ? 155  ILE A CG1 1 
ATOM   1194  C  CG2 . ILE A 1 152 ? 37.512  39.358  65.200  1.00 59.59 ? 155  ILE A CG2 1 
ATOM   1195  C  CD1 . ILE A 1 152 ? 36.048  39.526  62.587  1.00 59.20 ? 155  ILE A CD1 1 
ATOM   1196  N  N   . ARG A 1 153 ? 37.409  43.672  64.576  1.00 60.17 ? 156  ARG A N   1 
ATOM   1197  C  CA  . ARG A 1 153 ? 37.211  44.987  63.980  1.00 60.47 ? 156  ARG A CA  1 
ATOM   1198  C  C   . ARG A 1 153 ? 37.493  45.072  62.481  1.00 60.99 ? 156  ARG A C   1 
ATOM   1199  O  O   . ARG A 1 153 ? 37.295  46.128  61.888  1.00 61.21 ? 156  ARG A O   1 
ATOM   1200  C  CB  . ARG A 1 153 ? 38.023  46.045  64.732  1.00 60.30 ? 156  ARG A CB  1 
ATOM   1201  C  CG  . ARG A 1 153 ? 39.517  45.783  64.768  1.00 60.30 ? 156  ARG A CG  1 
ATOM   1202  C  CD  . ARG A 1 153 ? 40.246  46.875  65.525  1.00 59.93 ? 156  ARG A CD  1 
ATOM   1203  N  NE  . ARG A 1 153 ? 39.810  46.950  66.915  1.00 60.22 ? 156  ARG A NE  1 
ATOM   1204  C  CZ  . ARG A 1 153 ? 40.595  46.693  67.955  1.00 60.27 ? 156  ARG A CZ  1 
ATOM   1205  N  NH1 . ARG A 1 153 ? 41.864  46.344  67.765  1.00 60.28 ? 156  ARG A NH1 1 
ATOM   1206  N  NH2 . ARG A 1 153 ? 40.109  46.773  69.190  1.00 60.35 ? 156  ARG A NH2 1 
ATOM   1207  N  N   . ASP A 1 154 ? 37.982  43.989  61.878  1.00 61.15 ? 157  ASP A N   1 
ATOM   1208  C  CA  . ASP A 1 154 ? 38.251  43.971  60.440  1.00 61.13 ? 157  ASP A CA  1 
ATOM   1209  C  C   . ASP A 1 154 ? 37.529  42.778  59.822  1.00 61.14 ? 157  ASP A C   1 
ATOM   1210  O  O   . ASP A 1 154 ? 37.653  41.645  60.293  1.00 61.54 ? 157  ASP A O   1 
ATOM   1211  C  CB  . ASP A 1 154 ? 39.746  43.885  60.149  1.00 61.34 ? 157  ASP A CB  1 
ATOM   1212  C  CG  . ASP A 1 154 ? 40.057  44.019  58.668  1.00 62.05 ? 157  ASP A CG  1 
ATOM   1213  O  OD1 . ASP A 1 154 ? 40.657  45.037  58.275  1.00 62.36 ? 157  ASP A OD1 1 
ATOM   1214  O  OD2 . ASP A 1 154 ? 39.692  43.117  57.885  1.00 62.75 ? 157  ASP A OD2 1 
ATOM   1215  N  N   . PRO A 1 155 ? 36.814  43.011  58.713  1.00 60.94 ? 158  PRO A N   1 
ATOM   1216  C  CA  . PRO A 1 155 ? 36.028  42.031  57.949  1.00 60.68 ? 158  PRO A CA  1 
ATOM   1217  C  C   . PRO A 1 155 ? 36.733  40.744  57.524  1.00 60.21 ? 158  PRO A C   1 
ATOM   1218  O  O   . PRO A 1 155 ? 36.191  39.645  57.652  1.00 60.22 ? 158  PRO A O   1 
ATOM   1219  C  CB  . PRO A 1 155 ? 35.611  42.832  56.721  1.00 60.87 ? 158  PRO A CB  1 
ATOM   1220  C  CG  . PRO A 1 155 ? 35.560  44.226  57.220  1.00 60.63 ? 158  PRO A CG  1 
ATOM   1221  C  CD  . PRO A 1 155 ? 36.792  44.323  58.045  1.00 60.70 ? 158  PRO A CD  1 
ATOM   1222  N  N   . ILE A 1 156 ? 37.944  40.889  57.009  1.00 59.66 ? 159  ILE A N   1 
ATOM   1223  C  CA  . ILE A 1 156 ? 38.695  39.752  56.525  1.00 59.24 ? 159  ILE A CA  1 
ATOM   1224  C  C   . ILE A 1 156 ? 38.920  38.654  57.559  1.00 59.24 ? 159  ILE A C   1 
ATOM   1225  O  O   . ILE A 1 156 ? 39.201  37.512  57.191  1.00 59.53 ? 159  ILE A O   1 
ATOM   1226  C  CB  . ILE A 1 156 ? 40.023  40.215  55.919  1.00 58.86 ? 159  ILE A CB  1 
ATOM   1227  C  CG1 . ILE A 1 156 ? 40.426  39.296  54.775  1.00 58.52 ? 159  ILE A CG1 1 
ATOM   1228  C  CG2 . ILE A 1 156 ? 41.109  40.265  56.973  1.00 58.88 ? 159  ILE A CG2 1 
ATOM   1229  C  CD1 . ILE A 1 156 ? 41.552  39.858  53.943  1.00 58.11 ? 159  ILE A CD1 1 
ATOM   1230  N  N   . LEU A 1 157 ? 38.795  38.992  58.843  1.00 58.96 ? 160  LEU A N   1 
ATOM   1231  C  CA  . LEU A 1 157 ? 38.989  38.008  59.911  1.00 58.57 ? 160  LEU A CA  1 
ATOM   1232  C  C   . LEU A 1 157 ? 37.711  37.279  60.296  1.00 58.66 ? 160  LEU A C   1 
ATOM   1233  O  O   . LEU A 1 157 ? 37.734  36.329  61.090  1.00 58.63 ? 160  LEU A O   1 
ATOM   1234  C  CB  . LEU A 1 157 ? 39.557  38.666  61.162  1.00 58.21 ? 160  LEU A CB  1 
ATOM   1235  C  CG  . LEU A 1 157 ? 41.017  39.092  61.127  1.00 57.85 ? 160  LEU A CG  1 
ATOM   1236  C  CD1 . LEU A 1 157 ? 41.124  40.495  60.576  1.00 57.74 ? 160  LEU A CD1 1 
ATOM   1237  C  CD2 . LEU A 1 157 ? 41.568  39.043  62.536  1.00 57.68 ? 160  LEU A CD2 1 
ATOM   1238  N  N   . PHE A 1 158 ? 36.597  37.731  59.733  1.00 58.57 ? 161  PHE A N   1 
ATOM   1239  C  CA  . PHE A 1 158 ? 35.301  37.145  60.034  1.00 58.17 ? 161  PHE A CA  1 
ATOM   1240  C  C   . PHE A 1 158 ? 35.174  35.646  59.731  1.00 57.83 ? 161  PHE A C   1 
ATOM   1241  O  O   . PHE A 1 158 ? 34.862  34.853  60.627  1.00 57.95 ? 161  PHE A O   1 
ATOM   1242  C  CB  . PHE A 1 158 ? 34.203  37.931  59.332  1.00 58.13 ? 161  PHE A CB  1 
ATOM   1243  C  CG  . PHE A 1 158 ? 32.835  37.609  59.829  1.00 58.72 ? 161  PHE A CG  1 
ATOM   1244  C  CD1 . PHE A 1 158 ? 31.991  36.780  59.099  1.00 58.85 ? 161  PHE A CD1 1 
ATOM   1245  C  CD2 . PHE A 1 158 ? 32.394  38.112  61.042  1.00 58.74 ? 161  PHE A CD2 1 
ATOM   1246  C  CE1 . PHE A 1 158 ? 30.725  36.457  59.575  1.00 58.45 ? 161  PHE A CE1 1 
ATOM   1247  C  CE2 . PHE A 1 158 ? 31.132  37.795  61.526  1.00 58.59 ? 161  PHE A CE2 1 
ATOM   1248  C  CZ  . PHE A 1 158 ? 30.297  36.965  60.790  1.00 58.47 ? 161  PHE A CZ  1 
ATOM   1249  N  N   . PRO A 1 159 ? 35.442  35.232  58.479  1.00 57.25 ? 162  PRO A N   1 
ATOM   1250  C  CA  . PRO A 1 159 ? 35.333  33.810  58.144  1.00 56.82 ? 162  PRO A CA  1 
ATOM   1251  C  C   . PRO A 1 159 ? 36.087  32.976  59.161  1.00 56.57 ? 162  PRO A C   1 
ATOM   1252  O  O   . PRO A 1 159 ? 35.540  32.046  59.756  1.00 56.62 ? 162  PRO A O   1 
ATOM   1253  C  CB  . PRO A 1 159 ? 35.999  33.738  56.775  1.00 56.73 ? 162  PRO A CB  1 
ATOM   1254  C  CG  . PRO A 1 159 ? 35.674  35.070  56.190  1.00 56.70 ? 162  PRO A CG  1 
ATOM   1255  C  CD  . PRO A 1 159 ? 35.968  35.993  57.333  1.00 56.95 ? 162  PRO A CD  1 
ATOM   1256  N  N   . SER A 1 160 ? 37.323  33.385  59.420  1.00 56.62 ? 163  SER A N   1 
ATOM   1257  C  CA  . SER A 1 160 ? 38.172  32.687  60.373  1.00 56.79 ? 163  SER A CA  1 
ATOM   1258  C  C   . SER A 1 160 ? 37.466  32.618  61.707  1.00 57.00 ? 163  SER A C   1 
ATOM   1259  O  O   . SER A 1 160 ? 37.235  31.531  62.243  1.00 57.19 ? 163  SER A O   1 
ATOM   1260  C  CB  . SER A 1 160 ? 39.499  33.424  60.549  1.00 56.88 ? 163  SER A CB  1 
ATOM   1261  O  OG  . SER A 1 160 ? 40.278  33.395  59.366  1.00 57.25 ? 163  SER A OG  1 
ATOM   1262  N  N   . PHE A 1 161 ? 37.086  33.782  62.221  1.00 57.10 ? 164  PHE A N   1 
ATOM   1263  C  CA  . PHE A 1 161 ? 36.402  33.842  63.497  1.00 57.30 ? 164  PHE A CA  1 
ATOM   1264  C  C   . PHE A 1 161 ? 35.287  32.815  63.547  1.00 57.67 ? 164  PHE A C   1 
ATOM   1265  O  O   . PHE A 1 161 ? 35.263  31.950  64.421  1.00 57.75 ? 164  PHE A O   1 
ATOM   1266  C  CB  . PHE A 1 161 ? 35.809  35.224  63.727  1.00 57.20 ? 164  PHE A CB  1 
ATOM   1267  C  CG  . PHE A 1 161 ? 34.957  35.305  64.963  1.00 57.31 ? 164  PHE A CG  1 
ATOM   1268  C  CD1 . PHE A 1 161 ? 33.686  35.875  64.924  1.00 57.37 ? 164  PHE A CD1 1 
ATOM   1269  C  CD2 . PHE A 1 161 ? 35.413  34.764  66.163  1.00 57.48 ? 164  PHE A CD2 1 
ATOM   1270  C  CE1 . PHE A 1 161 ? 32.882  35.899  66.064  1.00 57.36 ? 164  PHE A CE1 1 
ATOM   1271  C  CE2 . PHE A 1 161 ? 34.620  34.784  67.304  1.00 57.37 ? 164  PHE A CE2 1 
ATOM   1272  C  CZ  . PHE A 1 161 ? 33.354  35.351  67.253  1.00 57.47 ? 164  PHE A CZ  1 
ATOM   1273  N  N   . ILE A 1 162 ? 34.382  32.893  62.578  1.00 57.88 ? 165  ILE A N   1 
ATOM   1274  C  CA  . ILE A 1 162 ? 33.264  31.971  62.530  1.00 57.86 ? 165  ILE A CA  1 
ATOM   1275  C  C   . ILE A 1 162 ? 33.751  30.546  62.491  1.00 58.19 ? 165  ILE A C   1 
ATOM   1276  O  O   . ILE A 1 162 ? 33.258  29.697  63.232  1.00 58.55 ? 165  ILE A O   1 
ATOM   1277  C  CB  . ILE A 1 162 ? 32.368  32.249  61.332  1.00 57.41 ? 165  ILE A CB  1 
ATOM   1278  C  CG1 . ILE A 1 162 ? 31.659  33.583  61.539  1.00 56.80 ? 165  ILE A CG1 1 
ATOM   1279  C  CG2 . ILE A 1 162 ? 31.348  31.136  61.161  1.00 57.34 ? 165  ILE A CG2 1 
ATOM   1280  C  CD1 . ILE A 1 162 ? 30.916  33.660  62.857  1.00 55.92 ? 165  ILE A CD1 1 
ATOM   1281  N  N   . HIS A 1 163 ? 34.736  30.286  61.644  1.00 58.25 ? 166  HIS A N   1 
ATOM   1282  C  CA  . HIS A 1 163 ? 35.281  28.947  61.551  1.00 58.27 ? 166  HIS A CA  1 
ATOM   1283  C  C   . HIS A 1 163 ? 35.685  28.476  62.940  1.00 58.40 ? 166  HIS A C   1 
ATOM   1284  O  O   . HIS A 1 163 ? 35.329  27.377  63.341  1.00 58.65 ? 166  HIS A O   1 
ATOM   1285  C  CB  . HIS A 1 163 ? 36.489  28.920  60.617  1.00 58.15 ? 166  HIS A CB  1 
ATOM   1286  C  CG  . HIS A 1 163 ? 36.127  28.843  59.165  1.00 57.49 ? 166  HIS A CG  1 
ATOM   1287  N  ND1 . HIS A 1 163 ? 37.076  28.752  58.168  1.00 57.14 ? 166  HIS A ND1 1 
ATOM   1288  C  CD2 . HIS A 1 163 ? 34.926  28.824  58.545  1.00 57.34 ? 166  HIS A CD2 1 
ATOM   1289  C  CE1 . HIS A 1 163 ? 36.473  28.682  56.995  1.00 57.20 ? 166  HIS A CE1 1 
ATOM   1290  N  NE2 . HIS A 1 163 ? 35.167  28.722  57.194  1.00 57.39 ? 166  HIS A NE2 1 
ATOM   1291  N  N   . SER A 1 164 ? 36.341  29.348  63.705  1.00 58.49 ? 167  SER A N   1 
ATOM   1292  C  CA  . SER A 1 164 ? 36.794  29.004  65.057  1.00 58.66 ? 167  SER A CA  1 
ATOM   1293  C  C   . SER A 1 164 ? 35.648  28.773  66.043  1.00 59.24 ? 167  SER A C   1 
ATOM   1294  O  O   . SER A 1 164 ? 35.830  28.107  67.068  1.00 59.59 ? 167  SER A O   1 
ATOM   1295  C  CB  . SER A 1 164 ? 37.706  30.093  65.611  1.00 58.00 ? 167  SER A CB  1 
ATOM   1296  O  OG  . SER A 1 164 ? 36.949  31.231  65.978  1.00 57.16 ? 167  SER A OG  1 
ATOM   1297  N  N   . GLN A 1 165 ? 34.486  29.350  65.752  1.00 59.49 ? 168  GLN A N   1 
ATOM   1298  C  CA  . GLN A 1 165 ? 33.323  29.199  66.615  1.00 59.64 ? 168  GLN A CA  1 
ATOM   1299  C  C   . GLN A 1 165 ? 32.559  27.923  66.306  1.00 60.07 ? 168  GLN A C   1 
ATOM   1300  O  O   . GLN A 1 165 ? 31.872  27.369  67.168  1.00 60.53 ? 168  GLN A O   1 
ATOM   1301  C  CB  . GLN A 1 165 ? 32.398  30.393  66.440  1.00 59.36 ? 168  GLN A CB  1 
ATOM   1302  C  CG  . GLN A 1 165 ? 32.956  31.671  66.999  1.00 59.10 ? 168  GLN A CG  1 
ATOM   1303  C  CD  . GLN A 1 165 ? 33.029  31.649  68.513  1.00 59.29 ? 168  GLN A CD  1 
ATOM   1304  O  OE1 . GLN A 1 165 ? 34.115  31.723  69.098  1.00 59.44 ? 168  GLN A OE1 1 
ATOM   1305  N  NE2 . GLN A 1 165 ? 31.870  31.557  69.161  1.00 58.56 ? 168  GLN A NE2 1 
ATOM   1306  N  N   . LYS A 1 166 ? 32.701  27.435  65.080  1.00 60.21 ? 169  LYS A N   1 
ATOM   1307  C  CA  . LYS A 1 166 ? 31.991  26.235  64.669  1.00 59.98 ? 169  LYS A CA  1 
ATOM   1308  C  C   . LYS A 1 166 ? 32.722  24.910  64.881  1.00 59.67 ? 169  LYS A C   1 
ATOM   1309  O  O   . LYS A 1 166 ? 33.472  24.758  65.841  1.00 60.20 ? 169  LYS A O   1 
ATOM   1310  C  CB  . LYS A 1 166 ? 31.486  26.401  63.238  1.00 60.55 ? 169  LYS A CB  1 
ATOM   1311  C  CG  . LYS A 1 166 ? 30.403  27.485  63.128  1.00 60.82 ? 169  LYS A CG  1 
ATOM   1312  C  CD  . LYS A 1 166 ? 29.960  27.722  61.690  1.00 60.76 ? 169  LYS A CD  1 
ATOM   1313  C  CE  . LYS A 1 166 ? 28.882  28.796  61.595  1.00 60.67 ? 169  LYS A CE  1 
ATOM   1314  N  NZ  . LYS A 1 166 ? 27.563  28.325  62.095  1.00 60.80 ? 169  LYS A NZ  1 
ATOM   1315  N  N   . ARG A 1 167 ? 32.504  23.951  63.991  1.00 58.73 ? 170  ARG A N   1 
ATOM   1316  C  CA  . ARG A 1 167 ? 33.108  22.637  64.139  1.00 57.90 ? 170  ARG A CA  1 
ATOM   1317  C  C   . ARG A 1 167 ? 34.480  22.441  63.560  1.00 57.73 ? 170  ARG A C   1 
ATOM   1318  O  O   . ARG A 1 167 ? 34.895  23.143  62.652  1.00 57.55 ? 170  ARG A O   1 
ATOM   1319  C  CB  . ARG A 1 167 ? 32.179  21.594  63.558  1.00 57.56 ? 170  ARG A CB  1 
ATOM   1320  C  CG  . ARG A 1 167 ? 30.831  21.632  64.190  1.00 57.40 ? 170  ARG A CG  1 
ATOM   1321  C  CD  . ARG A 1 167 ? 29.809  21.004  63.297  1.00 57.61 ? 170  ARG A CD  1 
ATOM   1322  N  NE  . ARG A 1 167 ? 28.491  21.174  63.879  1.00 58.60 ? 170  ARG A NE  1 
ATOM   1323  C  CZ  . ARG A 1 167 ? 27.963  20.355  64.779  1.00 59.38 ? 170  ARG A CZ  1 
ATOM   1324  N  NH1 . ARG A 1 167 ? 28.641  19.295  65.200  1.00 59.56 ? 170  ARG A NH1 1 
ATOM   1325  N  NH2 . ARG A 1 167 ? 26.757  20.603  65.269  1.00 60.11 ? 170  ARG A NH2 1 
ATOM   1326  N  N   . ASN A 1 168 ? 35.181  21.454  64.098  1.00 57.67 ? 171  ASN A N   1 
ATOM   1327  C  CA  . ASN A 1 168 ? 36.509  21.125  63.630  1.00 57.67 ? 171  ASN A CA  1 
ATOM   1328  C  C   . ASN A 1 168 ? 36.288  20.457  62.283  1.00 57.50 ? 171  ASN A C   1 
ATOM   1329  O  O   . ASN A 1 168 ? 35.466  19.559  62.156  1.00 57.76 ? 171  ASN A O   1 
ATOM   1330  C  CB  . ASN A 1 168 ? 37.182  20.172  64.614  1.00 58.18 ? 171  ASN A CB  1 
ATOM   1331  C  CG  . ASN A 1 168 ? 38.528  19.702  64.137  1.00 58.85 ? 171  ASN A CG  1 
ATOM   1332  O  OD1 . ASN A 1 168 ? 38.629  18.984  63.144  1.00 60.03 ? 171  ASN A OD1 1 
ATOM   1333  N  ND2 . ASN A 1 168 ? 39.577  20.089  64.847  1.00 59.08 ? 171  ASN A ND2 1 
ATOM   1334  N  N   . PRO A 1 169 ? 37.041  20.871  61.265  1.00 57.47 ? 172  PRO A N   1 
ATOM   1335  C  CA  . PRO A 1 169 ? 36.955  20.348  59.897  1.00 57.43 ? 172  PRO A CA  1 
ATOM   1336  C  C   . PRO A 1 169 ? 37.085  18.836  59.716  1.00 57.53 ? 172  PRO A C   1 
ATOM   1337  O  O   . PRO A 1 169 ? 36.562  18.265  58.750  1.00 57.67 ? 172  PRO A O   1 
ATOM   1338  C  CB  . PRO A 1 169 ? 38.069  21.105  59.178  1.00 57.48 ? 172  PRO A CB  1 
ATOM   1339  C  CG  . PRO A 1 169 ? 39.059  21.359  60.277  1.00 57.47 ? 172  PRO A CG  1 
ATOM   1340  C  CD  . PRO A 1 169 ? 38.172  21.800  61.396  1.00 57.54 ? 172  PRO A CD  1 
ATOM   1341  N  N   . GLN A 1 170 ? 37.787  18.180  60.627  1.00 57.38 ? 173  GLN A N   1 
ATOM   1342  C  CA  . GLN A 1 170 ? 37.948  16.747  60.504  1.00 57.09 ? 173  GLN A CA  1 
ATOM   1343  C  C   . GLN A 1 170 ? 36.981  16.016  61.385  1.00 57.04 ? 173  GLN A C   1 
ATOM   1344  O  O   . GLN A 1 170 ? 36.157  15.251  60.900  1.00 57.11 ? 173  GLN A O   1 
ATOM   1345  C  CB  . GLN A 1 170 ? 39.361  16.319  60.873  1.00 57.17 ? 173  GLN A CB  1 
ATOM   1346  C  CG  . GLN A 1 170 ? 39.535  14.807  60.875  1.00 57.37 ? 173  GLN A CG  1 
ATOM   1347  C  CD  . GLN A 1 170 ? 40.984  14.383  60.943  1.00 57.41 ? 173  GLN A CD  1 
ATOM   1348  O  OE1 . GLN A 1 170 ? 41.865  15.180  61.268  1.00 57.99 ? 173  GLN A OE1 1 
ATOM   1349  N  NE2 . GLN A 1 170 ? 41.242  13.122  60.626  1.00 57.33 ? 173  GLN A NE2 1 
ATOM   1350  N  N   . THR A 1 171 ? 37.094  16.258  62.686  1.00 57.16 ? 174  THR A N   1 
ATOM   1351  C  CA  . THR A 1 171 ? 36.258  15.598  63.680  1.00 57.76 ? 174  THR A CA  1 
ATOM   1352  C  C   . THR A 1 171 ? 34.803  16.038  63.662  1.00 58.30 ? 174  THR A C   1 
ATOM   1353  O  O   . THR A 1 171 ? 33.924  15.324  64.149  1.00 58.66 ? 174  THR A O   1 
ATOM   1354  C  CB  . THR A 1 171 ? 36.794  15.851  65.079  1.00 57.57 ? 174  THR A CB  1 
ATOM   1355  O  OG1 . THR A 1 171 ? 36.503  17.197  65.449  1.00 58.34 ? 174  THR A OG1 1 
ATOM   1356  C  CG2 . THR A 1 171 ? 38.293  15.665  65.107  1.00 57.59 ? 174  THR A CG2 1 
ATOM   1357  N  N   . HIS A 1 172 ? 34.563  17.239  63.150  1.00 59.01 ? 175  HIS A N   1 
ATOM   1358  C  CA  . HIS A 1 172 ? 33.220  17.799  63.071  1.00 59.49 ? 175  HIS A CA  1 
ATOM   1359  C  C   . HIS A 1 172 ? 32.614  18.127  64.434  1.00 60.04 ? 175  HIS A C   1 
ATOM   1360  O  O   . HIS A 1 172 ? 31.394  18.163  64.585  1.00 60.01 ? 175  HIS A O   1 
ATOM   1361  C  CB  . HIS A 1 172 ? 32.292  16.858  62.320  1.00 59.16 ? 175  HIS A CB  1 
ATOM   1362  C  CG  . HIS A 1 172 ? 31.095  17.541  61.754  1.00 59.26 ? 175  HIS A CG  1 
ATOM   1363  N  ND1 . HIS A 1 172 ? 31.190  18.514  60.783  1.00 59.23 ? 175  HIS A ND1 1 
ATOM   1364  C  CD2 . HIS A 1 172 ? 29.778  17.418  62.038  1.00 59.05 ? 175  HIS A CD2 1 
ATOM   1365  C  CE1 . HIS A 1 172 ? 29.983  18.964  60.495  1.00 59.18 ? 175  HIS A CE1 1 
ATOM   1366  N  NE2 . HIS A 1 172 ? 29.108  18.315  61.242  1.00 59.30 ? 175  HIS A NE2 1 
ATOM   1367  N  N   . LEU A 1 173 ? 33.472  18.405  65.412  1.00 60.73 ? 176  LEU A N   1 
ATOM   1368  C  CA  . LEU A 1 173 ? 33.032  18.731  66.764  1.00 61.24 ? 176  LEU A CA  1 
ATOM   1369  C  C   . LEU A 1 173 ? 33.428  20.149  67.150  1.00 61.66 ? 176  LEU A C   1 
ATOM   1370  O  O   . LEU A 1 173 ? 34.190  20.812  66.444  1.00 61.57 ? 176  LEU A O   1 
ATOM   1371  C  CB  . LEU A 1 173 ? 33.690  17.783  67.761  1.00 61.15 ? 176  LEU A CB  1 
ATOM   1372  C  CG  . LEU A 1 173 ? 33.565  16.282  67.541  1.00 61.14 ? 176  LEU A CG  1 
ATOM   1373  C  CD1 . LEU A 1 173 ? 34.484  15.556  68.506  1.00 61.12 ? 176  LEU A CD1 1 
ATOM   1374  C  CD2 . LEU A 1 173 ? 32.130  15.853  67.751  1.00 61.61 ? 176  LEU A CD2 1 
ATOM   1375  N  N   . LYS A 1 174 ? 32.898  20.610  68.277  1.00 62.48 ? 177  LYS A N   1 
ATOM   1376  C  CA  . LYS A 1 174 ? 33.232  21.927  68.781  1.00 63.35 ? 177  LYS A CA  1 
ATOM   1377  C  C   . LYS A 1 174 ? 34.650  21.803  69.282  1.00 63.27 ? 177  LYS A C   1 
ATOM   1378  O  O   . LYS A 1 174 ? 35.014  20.786  69.861  1.00 63.05 ? 177  LYS A O   1 
ATOM   1379  C  CB  . LYS A 1 174 ? 32.289  22.328  69.910  1.00 64.50 ? 177  LYS A CB  1 
ATOM   1380  C  CG  . LYS A 1 174 ? 31.117  23.156  69.415  1.00 65.85 ? 177  LYS A CG  1 
ATOM   1381  C  CD  . LYS A 1 174 ? 30.325  22.414  68.347  1.00 67.35 ? 177  LYS A CD  1 
ATOM   1382  C  CE  . LYS A 1 174 ? 29.562  23.374  67.431  1.00 68.41 ? 177  LYS A CE  1 
ATOM   1383  N  NZ  . LYS A 1 174 ? 28.639  24.281  68.172  1.00 69.05 ? 177  LYS A NZ  1 
ATOM   1384  N  N   . ASP A 1 175 ? 35.453  22.831  69.055  1.00 63.44 ? 178  ASP A N   1 
ATOM   1385  C  CA  . ASP A 1 175 ? 36.846  22.766  69.453  1.00 63.78 ? 178  ASP A CA  1 
ATOM   1386  C  C   . ASP A 1 175 ? 37.340  23.972  70.247  1.00 63.78 ? 178  ASP A C   1 
ATOM   1387  O  O   . ASP A 1 175 ? 37.699  25.009  69.681  1.00 64.11 ? 178  ASP A O   1 
ATOM   1388  C  CB  . ASP A 1 175 ? 37.705  22.570  68.203  1.00 64.10 ? 178  ASP A CB  1 
ATOM   1389  C  CG  . ASP A 1 175 ? 39.108  22.100  68.517  1.00 64.39 ? 178  ASP A CG  1 
ATOM   1390  O  OD1 . ASP A 1 175 ? 39.564  22.256  69.672  1.00 64.87 ? 178  ASP A OD1 1 
ATOM   1391  O  OD2 . ASP A 1 175 ? 39.763  21.567  67.595  1.00 64.58 ? 178  ASP A OD2 1 
ATOM   1392  N  N   . PRO A 1 176 ? 37.389  23.835  71.578  1.00 63.68 ? 179  PRO A N   1 
ATOM   1393  C  CA  . PRO A 1 176 ? 37.853  24.916  72.450  1.00 63.46 ? 179  PRO A CA  1 
ATOM   1394  C  C   . PRO A 1 176 ? 39.236  25.426  72.077  1.00 63.27 ? 179  PRO A C   1 
ATOM   1395  O  O   . PRO A 1 176 ? 39.537  26.601  72.287  1.00 63.34 ? 179  PRO A O   1 
ATOM   1396  C  CB  . PRO A 1 176 ? 37.809  24.284  73.845  1.00 63.76 ? 179  PRO A CB  1 
ATOM   1397  C  CG  . PRO A 1 176 ? 37.704  22.799  73.585  1.00 63.71 ? 179  PRO A CG  1 
ATOM   1398  C  CD  . PRO A 1 176 ? 36.854  22.724  72.371  1.00 63.64 ? 179  PRO A CD  1 
ATOM   1399  N  N   . ASP A 1 177 ? 40.072  24.557  71.513  1.00 63.04 ? 180  ASP A N   1 
ATOM   1400  C  CA  . ASP A 1 177 ? 41.402  24.984  71.080  1.00 62.92 ? 180  ASP A CA  1 
ATOM   1401  C  C   . ASP A 1 177 ? 41.207  25.994  69.949  1.00 62.65 ? 180  ASP A C   1 
ATOM   1402  O  O   . ASP A 1 177 ? 41.801  27.069  69.962  1.00 62.58 ? 180  ASP A O   1 
ATOM   1403  C  CB  . ASP A 1 177 ? 42.245  23.797  70.587  1.00 63.43 ? 180  ASP A CB  1 
ATOM   1404  C  CG  . ASP A 1 177 ? 43.049  23.117  71.707  1.00 64.11 ? 180  ASP A CG  1 
ATOM   1405  O  OD1 . ASP A 1 177 ? 43.939  22.286  71.394  1.00 63.87 ? 180  ASP A OD1 1 
ATOM   1406  O  OD2 . ASP A 1 177 ? 42.802  23.411  72.899  1.00 64.83 ? 180  ASP A OD2 1 
ATOM   1407  N  N   . MET A 1 178 ? 40.345  25.657  68.990  1.00 62.25 ? 181  MET A N   1 
ATOM   1408  C  CA  . MET A 1 178 ? 40.059  26.551  67.875  1.00 61.92 ? 181  MET A CA  1 
ATOM   1409  C  C   . MET A 1 178 ? 39.496  27.850  68.410  1.00 61.59 ? 181  MET A C   1 
ATOM   1410  O  O   . MET A 1 178 ? 39.982  28.928  68.081  1.00 61.72 ? 181  MET A O   1 
ATOM   1411  C  CB  . MET A 1 178 ? 39.041  25.928  66.926  1.00 62.35 ? 181  MET A CB  1 
ATOM   1412  C  CG  . MET A 1 178 ? 39.613  24.881  66.005  1.00 62.88 ? 181  MET A CG  1 
ATOM   1413  S  SD  . MET A 1 178 ? 38.369  24.142  64.939  1.00 64.06 ? 181  MET A SD  1 
ATOM   1414  C  CE  . MET A 1 178 ? 37.655  25.571  64.174  1.00 63.63 ? 181  MET A CE  1 
ATOM   1415  N  N   . VAL A 1 179 ? 38.488  27.735  69.266  1.00 61.35 ? 182  VAL A N   1 
ATOM   1416  C  CA  . VAL A 1 179 ? 37.843  28.897  69.854  1.00 61.18 ? 182  VAL A CA  1 
ATOM   1417  C  C   . VAL A 1 179 ? 38.813  29.855  70.533  1.00 61.49 ? 182  VAL A C   1 
ATOM   1418  O  O   . VAL A 1 179 ? 38.936  31.016  70.134  1.00 61.74 ? 182  VAL A O   1 
ATOM   1419  C  CB  . VAL A 1 179 ? 36.778  28.470  70.875  1.00 60.84 ? 182  VAL A CB  1 
ATOM   1420  C  CG1 . VAL A 1 179 ? 36.236  29.670  71.632  1.00 60.35 ? 182  VAL A CG1 1 
ATOM   1421  C  CG2 . VAL A 1 179 ? 35.657  27.761  70.167  1.00 60.90 ? 182  VAL A CG2 1 
ATOM   1422  N  N   . TRP A 1 180 ? 39.529  29.361  71.536  1.00 61.56 ? 183  TRP A N   1 
ATOM   1423  C  CA  . TRP A 1 180 ? 40.452  30.202  72.290  1.00 61.62 ? 183  TRP A CA  1 
ATOM   1424  C  C   . TRP A 1 180 ? 41.765  30.592  71.632  1.00 61.77 ? 183  TRP A C   1 
ATOM   1425  O  O   . TRP A 1 180 ? 42.331  31.646  71.945  1.00 62.04 ? 183  TRP A O   1 
ATOM   1426  C  CB  . TRP A 1 180 ? 40.693  29.590  73.657  1.00 61.17 ? 183  TRP A CB  1 
ATOM   1427  C  CG  . TRP A 1 180 ? 39.485  29.675  74.472  1.00 60.58 ? 183  TRP A CG  1 
ATOM   1428  C  CD1 . TRP A 1 180 ? 38.591  28.681  74.721  1.00 60.47 ? 183  TRP A CD1 1 
ATOM   1429  C  CD2 . TRP A 1 180 ? 38.981  30.848  75.107  1.00 60.19 ? 183  TRP A CD2 1 
ATOM   1430  N  NE1 . TRP A 1 180 ? 37.549  29.166  75.474  1.00 60.45 ? 183  TRP A NE1 1 
ATOM   1431  C  CE2 . TRP A 1 180 ? 37.766  30.496  75.723  1.00 60.21 ? 183  TRP A CE2 1 
ATOM   1432  C  CE3 . TRP A 1 180 ? 39.439  32.166  75.214  1.00 59.84 ? 183  TRP A CE3 1 
ATOM   1433  C  CZ2 . TRP A 1 180 ? 36.995  31.417  76.440  1.00 59.93 ? 183  TRP A CZ2 1 
ATOM   1434  C  CZ3 . TRP A 1 180 ? 38.675  33.084  75.927  1.00 59.72 ? 183  TRP A CZ3 1 
ATOM   1435  C  CH2 . TRP A 1 180 ? 37.466  32.703  76.530  1.00 59.56 ? 183  TRP A CH2 1 
ATOM   1436  N  N   . ASP A 1 181 ? 42.254  29.757  70.720  1.00 61.67 ? 184  ASP A N   1 
ATOM   1437  C  CA  . ASP A 1 181 ? 43.498  30.072  70.038  1.00 61.33 ? 184  ASP A CA  1 
ATOM   1438  C  C   . ASP A 1 181 ? 43.286  31.402  69.326  1.00 61.26 ? 184  ASP A C   1 
ATOM   1439  O  O   . ASP A 1 181 ? 44.042  32.356  69.509  1.00 61.06 ? 184  ASP A O   1 
ATOM   1440  C  CB  . ASP A 1 181 ? 43.854  28.975  69.033  1.00 61.22 ? 184  ASP A CB  1 
ATOM   1441  C  CG  . ASP A 1 181 ? 45.240  29.149  68.456  1.00 61.25 ? 184  ASP A CG  1 
ATOM   1442  O  OD1 . ASP A 1 181 ? 46.131  29.616  69.194  1.00 61.21 ? 184  ASP A OD1 1 
ATOM   1443  O  OD2 . ASP A 1 181 ? 45.448  28.828  67.269  1.00 61.36 ? 184  ASP A OD2 1 
ATOM   1444  N  N   . PHE A 1 182 ? 42.189  31.484  68.591  1.00 61.49 ? 185  PHE A N   1 
ATOM   1445  C  CA  . PHE A 1 182 ? 41.855  32.690  67.863  1.00 61.94 ? 185  PHE A CA  1 
ATOM   1446  C  C   . PHE A 1 182 ? 41.727  33.891  68.790  1.00 62.10 ? 185  PHE A C   1 
ATOM   1447  O  O   . PHE A 1 182 ? 42.426  34.886  68.620  1.00 62.12 ? 185  PHE A O   1 
ATOM   1448  C  CB  . PHE A 1 182 ? 40.550  32.496  67.113  1.00 62.03 ? 185  PHE A CB  1 
ATOM   1449  C  CG  . PHE A 1 182 ? 40.164  33.675  66.285  1.00 62.22 ? 185  PHE A CG  1 
ATOM   1450  C  CD1 . PHE A 1 182 ? 39.191  34.562  66.725  1.00 62.25 ? 185  PHE A CD1 1 
ATOM   1451  C  CD2 . PHE A 1 182 ? 40.788  33.910  65.065  1.00 62.40 ? 185  PHE A CD2 1 
ATOM   1452  C  CE1 . PHE A 1 182 ? 38.841  35.672  65.961  1.00 62.31 ? 185  PHE A CE1 1 
ATOM   1453  C  CE2 . PHE A 1 182 ? 40.446  35.017  64.294  1.00 62.60 ? 185  PHE A CE2 1 
ATOM   1454  C  CZ  . PHE A 1 182 ? 39.469  35.901  64.744  1.00 62.38 ? 185  PHE A CZ  1 
ATOM   1455  N  N   . TRP A 1 183 ? 40.831  33.797  69.766  1.00 62.30 ? 186  TRP A N   1 
ATOM   1456  C  CA  . TRP A 1 183 ? 40.625  34.888  70.711  1.00 62.46 ? 186  TRP A CA  1 
ATOM   1457  C  C   . TRP A 1 183 ? 41.909  35.314  71.409  1.00 62.12 ? 186  TRP A C   1 
ATOM   1458  O  O   . TRP A 1 183 ? 42.239  36.500  71.424  1.00 62.56 ? 186  TRP A O   1 
ATOM   1459  C  CB  . TRP A 1 183 ? 39.564  34.511  71.741  1.00 63.09 ? 186  TRP A CB  1 
ATOM   1460  C  CG  . TRP A 1 183 ? 38.160  34.617  71.213  1.00 63.87 ? 186  TRP A CG  1 
ATOM   1461  C  CD1 . TRP A 1 183 ? 37.752  35.299  70.104  1.00 63.86 ? 186  TRP A CD1 1 
ATOM   1462  C  CD2 . TRP A 1 183 ? 36.978  34.056  71.794  1.00 64.07 ? 186  TRP A CD2 1 
ATOM   1463  N  NE1 . TRP A 1 183 ? 36.391  35.205  69.962  1.00 64.08 ? 186  TRP A NE1 1 
ATOM   1464  C  CE2 . TRP A 1 183 ? 35.889  34.447  70.984  1.00 64.07 ? 186  TRP A CE2 1 
ATOM   1465  C  CE3 . TRP A 1 183 ? 36.733  33.260  72.921  1.00 64.18 ? 186  TRP A CE3 1 
ATOM   1466  C  CZ2 . TRP A 1 183 ? 34.575  34.071  71.265  1.00 64.31 ? 186  TRP A CZ2 1 
ATOM   1467  C  CZ3 . TRP A 1 183 ? 35.422  32.882  73.201  1.00 64.14 ? 186  TRP A CZ3 1 
ATOM   1468  C  CH2 . TRP A 1 183 ? 34.358  33.290  72.373  1.00 64.17 ? 186  TRP A CH2 1 
ATOM   1469  N  N   . SER A 1 184 ? 42.654  34.350  71.945  1.00 61.77 ? 187  SER A N   1 
ATOM   1470  C  CA  . SER A 1 184 ? 43.906  34.650  72.638  1.00 61.15 ? 187  SER A CA  1 
ATOM   1471  C  C   . SER A 1 184 ? 44.883  35.339  71.694  1.00 61.19 ? 187  SER A C   1 
ATOM   1472  O  O   . SER A 1 184 ? 45.654  36.200  72.108  1.00 61.19 ? 187  SER A O   1 
ATOM   1473  C  CB  . SER A 1 184 ? 44.540  33.374  73.166  1.00 60.75 ? 187  SER A CB  1 
ATOM   1474  O  OG  . SER A 1 184 ? 44.934  32.572  72.079  1.00 60.31 ? 187  SER A OG  1 
ATOM   1475  N  N   . LEU A 1 185 ? 44.852  34.947  70.424  1.00 60.93 ? 188  LEU A N   1 
ATOM   1476  C  CA  . LEU A 1 185 ? 45.730  35.543  69.423  1.00 60.84 ? 188  LEU A CA  1 
ATOM   1477  C  C   . LEU A 1 185 ? 45.235  36.910  68.974  1.00 61.24 ? 188  LEU A C   1 
ATOM   1478  O  O   . LEU A 1 185 ? 46.015  37.743  68.511  1.00 61.46 ? 188  LEU A O   1 
ATOM   1479  C  CB  . LEU A 1 185 ? 45.849  34.631  68.204  1.00 60.43 ? 188  LEU A CB  1 
ATOM   1480  C  CG  . LEU A 1 185 ? 46.680  33.363  68.393  1.00 59.90 ? 188  LEU A CG  1 
ATOM   1481  C  CD1 . LEU A 1 185 ? 46.588  32.503  67.152  1.00 59.75 ? 188  LEU A CD1 1 
ATOM   1482  C  CD2 . LEU A 1 185 ? 48.130  33.713  68.690  1.00 59.51 ? 188  LEU A CD2 1 
ATOM   1483  N  N   . ARG A 1 186 ? 43.932  37.133  69.082  1.00 61.59 ? 189  ARG A N   1 
ATOM   1484  C  CA  . ARG A 1 186 ? 43.346  38.399  68.670  1.00 61.95 ? 189  ARG A CA  1 
ATOM   1485  C  C   . ARG A 1 186 ? 42.659  39.061  69.854  1.00 62.43 ? 189  ARG A C   1 
ATOM   1486  O  O   . ARG A 1 186 ? 41.443  38.955  70.011  1.00 62.54 ? 189  ARG A O   1 
ATOM   1487  C  CB  . ARG A 1 186 ? 42.327  38.158  67.560  1.00 61.77 ? 189  ARG A CB  1 
ATOM   1488  C  CG  . ARG A 1 186 ? 42.865  37.379  66.386  1.00 62.19 ? 189  ARG A CG  1 
ATOM   1489  C  CD  . ARG A 1 186 ? 43.963  38.145  65.710  1.00 62.59 ? 189  ARG A CD  1 
ATOM   1490  N  NE  . ARG A 1 186 ? 43.487  39.455  65.293  1.00 63.24 ? 189  ARG A NE  1 
ATOM   1491  C  CZ  . ARG A 1 186 ? 44.125  40.246  64.440  1.00 63.41 ? 189  ARG A CZ  1 
ATOM   1492  N  NH1 . ARG A 1 186 ? 45.274  39.856  63.903  1.00 63.44 ? 189  ARG A NH1 1 
ATOM   1493  N  NH2 . ARG A 1 186 ? 43.618  41.436  64.139  1.00 63.65 ? 189  ARG A NH2 1 
ATOM   1494  N  N   . PRO A 1 187 ? 43.423  39.771  70.700  1.00 62.81 ? 190  PRO A N   1 
ATOM   1495  C  CA  . PRO A 1 187 ? 42.875  40.452  71.879  1.00 63.14 ? 190  PRO A CA  1 
ATOM   1496  C  C   . PRO A 1 187 ? 41.791  41.517  71.650  1.00 63.55 ? 190  PRO A C   1 
ATOM   1497  O  O   . PRO A 1 187 ? 41.254  42.066  72.613  1.00 63.69 ? 190  PRO A O   1 
ATOM   1498  C  CB  . PRO A 1 187 ? 44.125  41.023  72.549  1.00 63.07 ? 190  PRO A CB  1 
ATOM   1499  C  CG  . PRO A 1 187 ? 45.065  41.219  71.401  1.00 62.96 ? 190  PRO A CG  1 
ATOM   1500  C  CD  . PRO A 1 187 ? 44.882  39.942  70.641  1.00 62.95 ? 190  PRO A CD  1 
ATOM   1501  N  N   . GLU A 1 188 ? 41.440  41.790  70.394  1.00 64.10 ? 191  GLU A N   1 
ATOM   1502  C  CA  . GLU A 1 188 ? 40.387  42.773  70.105  1.00 64.54 ? 191  GLU A CA  1 
ATOM   1503  C  C   . GLU A 1 188 ? 39.090  42.270  70.721  1.00 64.40 ? 191  GLU A C   1 
ATOM   1504  O  O   . GLU A 1 188 ? 38.254  43.050  71.171  1.00 64.95 ? 191  GLU A O   1 
ATOM   1505  C  CB  . GLU A 1 188 ? 40.140  42.910  68.598  1.00 64.90 ? 191  GLU A CB  1 
ATOM   1506  C  CG  . GLU A 1 188 ? 41.374  43.084  67.741  1.00 66.14 ? 191  GLU A CG  1 
ATOM   1507  C  CD  . GLU A 1 188 ? 41.928  41.760  67.251  1.00 66.51 ? 191  GLU A CD  1 
ATOM   1508  O  OE1 . GLU A 1 188 ? 41.312  41.163  66.344  1.00 66.23 ? 191  GLU A OE1 1 
ATOM   1509  O  OE2 . GLU A 1 188 ? 42.983  41.324  67.765  1.00 67.28 ? 191  GLU A OE2 1 
ATOM   1510  N  N   . SER A 1 189 ? 38.952  40.948  70.718  1.00 63.89 ? 192  SER A N   1 
ATOM   1511  C  CA  . SER A 1 189 ? 37.789  40.230  71.218  1.00 63.23 ? 192  SER A CA  1 
ATOM   1512  C  C   . SER A 1 189 ? 37.468  40.382  72.690  1.00 63.02 ? 192  SER A C   1 
ATOM   1513  O  O   . SER A 1 189 ? 36.349  40.100  73.113  1.00 63.20 ? 192  SER A O   1 
ATOM   1514  C  CB  . SER A 1 189 ? 37.981  38.752  70.929  1.00 63.40 ? 192  SER A CB  1 
ATOM   1515  O  OG  . SER A 1 189 ? 39.176  38.295  71.540  1.00 63.08 ? 192  SER A OG  1 
ATOM   1516  N  N   . LEU A 1 190 ? 38.456  40.780  73.477  1.00 62.74 ? 193  LEU A N   1 
ATOM   1517  C  CA  . LEU A 1 190 ? 38.262  40.930  74.911  1.00 62.35 ? 193  LEU A CA  1 
ATOM   1518  C  C   . LEU A 1 190 ? 36.940  41.550  75.300  1.00 62.19 ? 193  LEU A C   1 
ATOM   1519  O  O   . LEU A 1 190 ? 36.153  40.937  76.023  1.00 62.23 ? 193  LEU A O   1 
ATOM   1520  C  CB  . LEU A 1 190 ? 39.395  41.744  75.509  1.00 62.37 ? 193  LEU A CB  1 
ATOM   1521  C  CG  . LEU A 1 190 ? 40.692  40.946  75.605  1.00 62.40 ? 193  LEU A CG  1 
ATOM   1522  C  CD1 . LEU A 1 190 ? 41.815  41.849  76.077  1.00 62.60 ? 193  LEU A CD1 1 
ATOM   1523  C  CD2 . LEU A 1 190 ? 40.505  39.754  76.542  1.00 62.09 ? 193  LEU A CD2 1 
ATOM   1524  N  N   . HIS A 1 191 ? 36.682  42.742  74.776  1.00 61.69 ? 194  HIS A N   1 
ATOM   1525  C  CA  . HIS A 1 191 ? 35.454  43.459  75.079  1.00 61.28 ? 194  HIS A CA  1 
ATOM   1526  C  C   . HIS A 1 191 ? 34.210  42.597  74.891  1.00 61.08 ? 194  HIS A C   1 
ATOM   1527  O  O   . HIS A 1 191 ? 33.487  42.316  75.850  1.00 61.27 ? 194  HIS A O   1 
ATOM   1528  C  CB  . HIS A 1 191 ? 35.352  44.715  74.216  1.00 61.20 ? 194  HIS A CB  1 
ATOM   1529  C  CG  . HIS A 1 191 ? 34.551  45.811  74.846  1.00 61.32 ? 194  HIS A CG  1 
ATOM   1530  N  ND1 . HIS A 1 191 ? 34.390  47.049  74.259  1.00 61.31 ? 194  HIS A ND1 1 
ATOM   1531  C  CD2 . HIS A 1 191 ? 33.897  45.868  76.029  1.00 61.30 ? 194  HIS A CD2 1 
ATOM   1532  C  CE1 . HIS A 1 191 ? 33.675  47.821  75.060  1.00 61.28 ? 194  HIS A CE1 1 
ATOM   1533  N  NE2 . HIS A 1 191 ? 33.363  47.131  76.139  1.00 61.35 ? 194  HIS A NE2 1 
ATOM   1534  N  N   . GLN A 1 192 ? 33.985  42.145  73.661  1.00 60.75 ? 195  GLN A N   1 
ATOM   1535  C  CA  . GLN A 1 192 ? 32.822  41.326  73.351  1.00 60.27 ? 195  GLN A CA  1 
ATOM   1536  C  C   . GLN A 1 192 ? 32.814  39.982  74.070  1.00 60.16 ? 195  GLN A C   1 
ATOM   1537  O  O   . GLN A 1 192 ? 31.755  39.484  74.442  1.00 59.98 ? 195  GLN A O   1 
ATOM   1538  C  CB  . GLN A 1 192 ? 32.684  41.144  71.838  1.00 60.35 ? 195  GLN A CB  1 
ATOM   1539  C  CG  . GLN A 1 192 ? 31.444  40.374  71.406  1.00 60.54 ? 195  GLN A CG  1 
ATOM   1540  C  CD  . GLN A 1 192 ? 30.196  40.783  72.170  1.00 60.80 ? 195  GLN A CD  1 
ATOM   1541  O  OE1 . GLN A 1 192 ? 30.113  41.886  72.703  1.00 61.51 ? 195  GLN A OE1 1 
ATOM   1542  N  NE2 . GLN A 1 192 ? 29.225  39.884  72.244  1.00 60.45 ? 195  GLN A NE2 1 
ATOM   1543  N  N   . VAL A 1 193 ? 33.988  39.400  74.279  1.00 60.08 ? 196  VAL A N   1 
ATOM   1544  C  CA  . VAL A 1 193 ? 34.070  38.127  74.988  1.00 59.93 ? 196  VAL A CA  1 
ATOM   1545  C  C   . VAL A 1 193 ? 33.575  38.338  76.406  1.00 60.15 ? 196  VAL A C   1 
ATOM   1546  O  O   . VAL A 1 193 ? 32.863  37.498  76.956  1.00 60.30 ? 196  VAL A O   1 
ATOM   1547  C  CB  . VAL A 1 193 ? 35.509  37.587  75.049  1.00 59.92 ? 196  VAL A CB  1 
ATOM   1548  C  CG1 . VAL A 1 193 ? 35.595  36.438  76.036  1.00 59.24 ? 196  VAL A CG1 1 
ATOM   1549  C  CG2 . VAL A 1 193 ? 35.950  37.113  73.673  1.00 59.33 ? 196  VAL A CG2 1 
ATOM   1550  N  N   . SER A 1 194 ? 33.944  39.472  76.989  1.00 60.20 ? 197  SER A N   1 
ATOM   1551  C  CA  . SER A 1 194 ? 33.526  39.801  78.342  1.00 60.43 ? 197  SER A CA  1 
ATOM   1552  C  C   . SER A 1 194 ? 32.012  39.868  78.397  1.00 60.41 ? 197  SER A C   1 
ATOM   1553  O  O   . SER A 1 194 ? 31.387  39.360  79.332  1.00 60.63 ? 197  SER A O   1 
ATOM   1554  C  CB  . SER A 1 194 ? 34.125  41.133  78.764  1.00 60.63 ? 197  SER A CB  1 
ATOM   1555  O  OG  . SER A 1 194 ? 35.537  41.033  78.850  1.00 61.52 ? 197  SER A OG  1 
ATOM   1556  N  N   . PHE A 1 195 ? 31.418  40.490  77.387  1.00 60.38 ? 198  PHE A N   1 
ATOM   1557  C  CA  . PHE A 1 195 ? 29.970  40.578  77.330  1.00 60.43 ? 198  PHE A CA  1 
ATOM   1558  C  C   . PHE A 1 195 ? 29.374  39.190  77.222  1.00 60.34 ? 198  PHE A C   1 
ATOM   1559  O  O   . PHE A 1 195 ? 28.474  38.829  77.975  1.00 60.22 ? 198  PHE A O   1 
ATOM   1560  C  CB  . PHE A 1 195 ? 29.543  41.379  76.116  1.00 61.04 ? 198  PHE A CB  1 
ATOM   1561  C  CG  . PHE A 1 195 ? 29.647  42.846  76.306  1.00 61.73 ? 198  PHE A CG  1 
ATOM   1562  C  CD1 . PHE A 1 195 ? 28.811  43.710  75.609  1.00 61.92 ? 198  PHE A CD1 1 
ATOM   1563  C  CD2 . PHE A 1 195 ? 30.575  43.375  77.196  1.00 62.15 ? 198  PHE A CD2 1 
ATOM   1564  C  CE1 . PHE A 1 195 ? 28.898  45.089  75.797  1.00 62.41 ? 198  PHE A CE1 1 
ATOM   1565  C  CE2 . PHE A 1 195 ? 30.673  44.752  77.394  1.00 62.49 ? 198  PHE A CE2 1 
ATOM   1566  C  CZ  . PHE A 1 195 ? 29.834  45.612  76.696  1.00 62.46 ? 198  PHE A CZ  1 
ATOM   1567  N  N   . LEU A 1 196 ? 29.913  38.411  76.292  1.00 60.34 ? 199  LEU A N   1 
ATOM   1568  C  CA  . LEU A 1 196 ? 29.455  37.056  76.025  1.00 60.31 ? 199  LEU A CA  1 
ATOM   1569  C  C   . LEU A 1 196 ? 29.423  36.168  77.249  1.00 60.35 ? 199  LEU A C   1 
ATOM   1570  O  O   . LEU A 1 196 ? 28.487  35.397  77.442  1.00 60.25 ? 199  LEU A O   1 
ATOM   1571  C  CB  . LEU A 1 196 ? 30.341  36.408  74.964  1.00 60.34 ? 199  LEU A CB  1 
ATOM   1572  C  CG  . LEU A 1 196 ? 30.051  34.939  74.663  1.00 60.44 ? 199  LEU A CG  1 
ATOM   1573  C  CD1 . LEU A 1 196 ? 28.642  34.778  74.134  1.00 60.47 ? 199  LEU A CD1 1 
ATOM   1574  C  CD2 . LEU A 1 196 ? 31.055  34.425  73.654  1.00 60.67 ? 199  LEU A CD2 1 
ATOM   1575  N  N   . PHE A 1 197 ? 30.460  36.245  78.065  1.00 60.43 ? 200  PHE A N   1 
ATOM   1576  C  CA  . PHE A 1 197 ? 30.500  35.411  79.244  1.00 60.62 ? 200  PHE A CA  1 
ATOM   1577  C  C   . PHE A 1 197 ? 29.865  36.019  80.467  1.00 60.97 ? 200  PHE A C   1 
ATOM   1578  O  O   . PHE A 1 197 ? 29.908  35.431  81.547  1.00 61.22 ? 200  PHE A O   1 
ATOM   1579  C  CB  . PHE A 1 197 ? 31.918  34.954  79.518  1.00 60.69 ? 200  PHE A CB  1 
ATOM   1580  C  CG  . PHE A 1 197 ? 32.370  33.855  78.604  1.00 60.79 ? 200  PHE A CG  1 
ATOM   1581  C  CD1 . PHE A 1 197 ? 32.928  34.150  77.368  1.00 60.76 ? 200  PHE A CD1 1 
ATOM   1582  C  CD2 . PHE A 1 197 ? 32.207  32.519  78.964  1.00 60.65 ? 200  PHE A CD2 1 
ATOM   1583  C  CE1 . PHE A 1 197 ? 33.316  33.125  76.502  1.00 60.64 ? 200  PHE A CE1 1 
ATOM   1584  C  CE2 . PHE A 1 197 ? 32.589  31.493  78.107  1.00 60.34 ? 200  PHE A CE2 1 
ATOM   1585  C  CZ  . PHE A 1 197 ? 33.144  31.796  76.874  1.00 60.30 ? 200  PHE A CZ  1 
ATOM   1586  N  N   . SER A 1 198 ? 29.282  37.203  80.303  1.00 61.44 ? 201  SER A N   1 
ATOM   1587  C  CA  . SER A 1 198 ? 28.600  37.855  81.411  1.00 61.81 ? 201  SER A CA  1 
ATOM   1588  C  C   . SER A 1 198 ? 27.248  37.168  81.546  1.00 62.26 ? 201  SER A C   1 
ATOM   1589  O  O   . SER A 1 198 ? 26.969  36.185  80.854  1.00 62.28 ? 201  SER A O   1 
ATOM   1590  C  CB  . SER A 1 198 ? 28.401  39.346  81.138  1.00 61.59 ? 201  SER A CB  1 
ATOM   1591  O  OG  . SER A 1 198 ? 27.336  39.566  80.233  1.00 61.56 ? 201  SER A OG  1 
ATOM   1592  N  N   . ASP A 1 199 ? 26.397  37.695  82.414  1.00 62.66 ? 202  ASP A N   1 
ATOM   1593  C  CA  . ASP A 1 199 ? 25.082  37.107  82.619  1.00 62.93 ? 202  ASP A CA  1 
ATOM   1594  C  C   . ASP A 1 199 ? 24.191  37.250  81.389  1.00 62.90 ? 202  ASP A C   1 
ATOM   1595  O  O   . ASP A 1 199 ? 23.329  36.411  81.138  1.00 63.07 ? 202  ASP A O   1 
ATOM   1596  C  CB  . ASP A 1 199 ? 24.398  37.737  83.835  1.00 63.11 ? 202  ASP A CB  1 
ATOM   1597  C  CG  . ASP A 1 199 ? 25.058  37.352  85.150  1.00 63.25 ? 202  ASP A CG  1 
ATOM   1598  O  OD1 . ASP A 1 199 ? 25.842  36.382  85.179  1.00 63.62 ? 202  ASP A OD1 1 
ATOM   1599  O  OD2 . ASP A 1 199 ? 24.780  38.016  86.170  1.00 63.22 ? 202  ASP A OD2 1 
ATOM   1600  N  N   . ARG A 1 200 ? 24.402  38.306  80.612  1.00 62.94 ? 203  ARG A N   1 
ATOM   1601  C  CA  . ARG A 1 200 ? 23.581  38.514  79.428  1.00 62.68 ? 203  ARG A CA  1 
ATOM   1602  C  C   . ARG A 1 200 ? 23.958  37.584  78.287  1.00 62.36 ? 203  ARG A C   1 
ATOM   1603  O  O   . ARG A 1 200 ? 23.406  37.674  77.194  1.00 62.43 ? 203  ARG A O   1 
ATOM   1604  C  CB  . ARG A 1 200 ? 23.632  39.977  78.990  1.00 62.89 ? 203  ARG A CB  1 
ATOM   1605  C  CG  . ARG A 1 200 ? 23.046  40.921  80.031  1.00 62.96 ? 203  ARG A CG  1 
ATOM   1606  C  CD  . ARG A 1 200 ? 22.903  42.338  79.511  1.00 63.36 ? 203  ARG A CD  1 
ATOM   1607  N  NE  . ARG A 1 200 ? 22.465  43.255  80.564  1.00 64.10 ? 203  ARG A NE  1 
ATOM   1608  C  CZ  . ARG A 1 200 ? 22.014  44.492  80.353  1.00 64.36 ? 203  ARG A CZ  1 
ATOM   1609  N  NH1 . ARG A 1 200 ? 21.639  45.250  81.378  1.00 64.76 ? 203  ARG A NH1 1 
ATOM   1610  N  NH2 . ARG A 1 200 ? 21.929  44.973  79.120  1.00 64.20 ? 203  ARG A NH2 1 
ATOM   1611  N  N   . GLY A 1 201 ? 24.865  36.654  78.559  1.00 62.13 ? 204  GLY A N   1 
ATOM   1612  C  CA  . GLY A 1 201 ? 25.285  35.719  77.533  1.00 61.51 ? 204  GLY A CA  1 
ATOM   1613  C  C   . GLY A 1 201 ? 24.149  34.807  77.124  1.00 61.16 ? 204  GLY A C   1 
ATOM   1614  O  O   . GLY A 1 201 ? 24.158  34.240  76.028  1.00 61.11 ? 204  GLY A O   1 
ATOM   1615  N  N   . ILE A 1 202 ? 23.165  34.671  78.006  1.00 60.80 ? 205  ILE A N   1 
ATOM   1616  C  CA  . ILE A 1 202 ? 22.017  33.819  77.736  1.00 60.68 ? 205  ILE A CA  1 
ATOM   1617  C  C   . ILE A 1 202 ? 20.735  34.517  78.180  1.00 60.75 ? 205  ILE A C   1 
ATOM   1618  O  O   . ILE A 1 202 ? 20.241  34.298  79.284  1.00 61.10 ? 205  ILE A O   1 
ATOM   1619  C  CB  . ILE A 1 202 ? 22.143  32.475  78.478  1.00 60.35 ? 205  ILE A CB  1 
ATOM   1620  C  CG1 . ILE A 1 202 ? 23.529  31.871  78.246  1.00 60.06 ? 205  ILE A CG1 1 
ATOM   1621  C  CG2 . ILE A 1 202 ? 21.087  31.506  77.986  1.00 60.14 ? 205  ILE A CG2 1 
ATOM   1622  C  CD1 . ILE A 1 202 ? 23.765  30.576  78.989  1.00 59.86 ? 205  ILE A CD1 1 
ATOM   1623  N  N   . PRO A 1 203 ? 20.175  35.374  77.322  1.00 60.69 ? 206  PRO A N   1 
ATOM   1624  C  CA  . PRO A 1 203 ? 18.948  36.071  77.694  1.00 60.85 ? 206  PRO A CA  1 
ATOM   1625  C  C   . PRO A 1 203 ? 17.774  35.103  77.828  1.00 61.15 ? 206  PRO A C   1 
ATOM   1626  O  O   . PRO A 1 203 ? 17.762  34.035  77.216  1.00 61.20 ? 206  PRO A O   1 
ATOM   1627  C  CB  . PRO A 1 203 ? 18.757  37.044  76.535  1.00 60.56 ? 206  PRO A CB  1 
ATOM   1628  C  CG  . PRO A 1 203 ? 19.333  36.300  75.377  1.00 60.29 ? 206  PRO A CG  1 
ATOM   1629  C  CD  . PRO A 1 203 ? 20.593  35.733  75.957  1.00 60.59 ? 206  PRO A CD  1 
ATOM   1630  N  N   . ASP A 1 204 ? 16.810  35.466  78.666  1.00 61.41 ? 207  ASP A N   1 
ATOM   1631  C  CA  . ASP A 1 204 ? 15.639  34.639  78.880  1.00 61.41 ? 207  ASP A CA  1 
ATOM   1632  C  C   . ASP A 1 204 ? 14.695  34.867  77.716  1.00 61.25 ? 207  ASP A C   1 
ATOM   1633  O  O   . ASP A 1 204 ? 13.784  35.690  77.791  1.00 61.13 ? 207  ASP A O   1 
ATOM   1634  C  CB  . ASP A 1 204 ? 14.961  35.010  80.201  1.00 62.10 ? 207  ASP A CB  1 
ATOM   1635  C  CG  . ASP A 1 204 ? 13.881  34.019  80.605  1.00 63.13 ? 207  ASP A CG  1 
ATOM   1636  O  OD1 . ASP A 1 204 ? 13.468  34.016  81.788  1.00 63.33 ? 207  ASP A OD1 1 
ATOM   1637  O  OD2 . ASP A 1 204 ? 13.442  33.228  79.742  1.00 64.05 ? 207  ASP A OD2 1 
ATOM   1638  N  N   . GLY A 1 205 ? 14.925  34.137  76.635  1.00 61.33 ? 208  GLY A N   1 
ATOM   1639  C  CA  . GLY A 1 205 ? 14.084  34.286  75.464  1.00 61.55 ? 208  GLY A CA  1 
ATOM   1640  C  C   . GLY A 1 205 ? 14.500  35.516  74.690  1.00 61.93 ? 208  GLY A C   1 
ATOM   1641  O  O   . GLY A 1 205 ? 15.455  36.191  75.081  1.00 62.02 ? 208  GLY A O   1 
ATOM   1642  N  N   . HIS A 1 206 ? 13.778  35.823  73.614  1.00 62.00 ? 209  HIS A N   1 
ATOM   1643  C  CA  . HIS A 1 206 ? 14.096  36.978  72.773  1.00 62.04 ? 209  HIS A CA  1 
ATOM   1644  C  C   . HIS A 1 206 ? 13.528  38.300  73.262  1.00 62.00 ? 209  HIS A C   1 
ATOM   1645  O  O   . HIS A 1 206 ? 14.004  39.372  72.884  1.00 62.14 ? 209  HIS A O   1 
ATOM   1646  C  CB  . HIS A 1 206 ? 13.591  36.745  71.356  1.00 62.00 ? 209  HIS A CB  1 
ATOM   1647  C  CG  . HIS A 1 206 ? 14.217  35.571  70.684  1.00 62.10 ? 209  HIS A CG  1 
ATOM   1648  N  ND1 . HIS A 1 206 ? 15.581  35.399  70.611  1.00 61.81 ? 209  HIS A ND1 1 
ATOM   1649  C  CD2 . HIS A 1 206 ? 13.668  34.506  70.056  1.00 62.06 ? 209  HIS A CD2 1 
ATOM   1650  C  CE1 . HIS A 1 206 ? 15.846  34.278  69.968  1.00 62.38 ? 209  HIS A CE1 1 
ATOM   1651  N  NE2 . HIS A 1 206 ? 14.700  33.715  69.618  1.00 62.23 ? 209  HIS A NE2 1 
ATOM   1652  N  N   . ARG A 1 207 ? 12.504  38.225  74.096  1.00 61.81 ? 210  ARG A N   1 
ATOM   1653  C  CA  . ARG A 1 207 ? 11.859  39.424  74.580  1.00 61.52 ? 210  ARG A CA  1 
ATOM   1654  C  C   . ARG A 1 207 ? 12.576  40.127  75.713  1.00 61.15 ? 210  ARG A C   1 
ATOM   1655  O  O   . ARG A 1 207 ? 12.271  41.279  76.010  1.00 61.32 ? 210  ARG A O   1 
ATOM   1656  C  CB  . ARG A 1 207 ? 10.422  39.098  74.966  1.00 61.82 ? 210  ARG A CB  1 
ATOM   1657  C  CG  . ARG A 1 207 ? 9.630   38.496  73.810  1.00 62.13 ? 210  ARG A CG  1 
ATOM   1658  C  CD  . ARG A 1 207 ? 8.233   38.076  74.215  1.00 62.36 ? 210  ARG A CD  1 
ATOM   1659  N  NE  . ARG A 1 207 ? 8.258   37.021  75.221  1.00 62.79 ? 210  ARG A NE  1 
ATOM   1660  C  CZ  . ARG A 1 207 ? 7.945   37.205  76.500  1.00 63.14 ? 210  ARG A CZ  1 
ATOM   1661  N  NH1 . ARG A 1 207 ? 7.578   38.409  76.927  1.00 62.91 ? 210  ARG A NH1 1 
ATOM   1662  N  NH2 . ARG A 1 207 ? 7.992   36.187  77.348  1.00 63.33 ? 210  ARG A NH2 1 
ATOM   1663  N  N   . HIS A 1 208 ? 13.556  39.473  76.319  1.00 60.46 ? 211  HIS A N   1 
ATOM   1664  C  CA  . HIS A 1 208 ? 14.256  40.096  77.432  1.00 59.91 ? 211  HIS A CA  1 
ATOM   1665  C  C   . HIS A 1 208 ? 15.702  40.464  77.185  1.00 59.42 ? 211  HIS A C   1 
ATOM   1666  O  O   . HIS A 1 208 ? 16.555  40.319  78.066  1.00 59.38 ? 211  HIS A O   1 
ATOM   1667  C  CB  . HIS A 1 208 ? 14.123  39.233  78.675  1.00 60.15 ? 211  HIS A CB  1 
ATOM   1668  C  CG  . HIS A 1 208 ? 12.721  39.132  79.176  1.00 60.23 ? 211  HIS A CG  1 
ATOM   1669  N  ND1 . HIS A 1 208 ? 11.956  37.997  79.018  1.00 60.38 ? 211  HIS A ND1 1 
ATOM   1670  C  CD2 . HIS A 1 208 ? 11.943  40.026  79.828  1.00 60.26 ? 211  HIS A CD2 1 
ATOM   1671  C  CE1 . HIS A 1 208 ? 10.764  38.194  79.556  1.00 60.37 ? 211  HIS A CE1 1 
ATOM   1672  N  NE2 . HIS A 1 208 ? 10.731  39.419  80.055  1.00 60.46 ? 211  HIS A NE2 1 
ATOM   1673  N  N   . MET A 1 209 ? 15.961  40.988  75.996  1.00 59.09 ? 212  MET A N   1 
ATOM   1674  C  CA  . MET A 1 209 ? 17.304  41.407  75.625  1.00 58.90 ? 212  MET A CA  1 
ATOM   1675  C  C   . MET A 1 209 ? 17.203  42.673  74.792  1.00 58.68 ? 212  MET A C   1 
ATOM   1676  O  O   . MET A 1 209 ? 16.148  42.982  74.246  1.00 58.78 ? 212  MET A O   1 
ATOM   1677  C  CB  . MET A 1 209 ? 17.992  40.320  74.807  1.00 58.85 ? 212  MET A CB  1 
ATOM   1678  C  CG  . MET A 1 209 ? 17.315  40.040  73.476  1.00 58.81 ? 212  MET A CG  1 
ATOM   1679  S  SD  . MET A 1 209 ? 18.109  38.709  72.579  1.00 59.05 ? 212  MET A SD  1 
ATOM   1680  C  CE  . MET A 1 209 ? 17.579  39.097  70.930  1.00 58.70 ? 212  MET A CE  1 
ATOM   1681  N  N   . ASN A 1 210 ? 18.301  43.405  74.690  1.00 58.43 ? 213  ASN A N   1 
ATOM   1682  C  CA  . ASN A 1 210 ? 18.298  44.624  73.907  1.00 58.33 ? 213  ASN A CA  1 
ATOM   1683  C  C   . ASN A 1 210 ? 18.735  44.346  72.482  1.00 58.01 ? 213  ASN A C   1 
ATOM   1684  O  O   . ASN A 1 210 ? 19.045  43.209  72.119  1.00 57.99 ? 213  ASN A O   1 
ATOM   1685  C  CB  . ASN A 1 210 ? 19.223  45.660  74.534  1.00 58.87 ? 213  ASN A CB  1 
ATOM   1686  C  CG  . ASN A 1 210 ? 18.739  46.124  75.888  1.00 59.32 ? 213  ASN A CG  1 
ATOM   1687  O  OD1 . ASN A 1 210 ? 17.537  46.098  76.172  1.00 59.91 ? 213  ASN A OD1 1 
ATOM   1688  N  ND2 . ASN A 1 210 ? 19.671  46.562  76.735  1.00 59.38 ? 213  ASN A ND2 1 
ATOM   1689  N  N   . GLY A 1 211 ? 18.759  45.405  71.682  1.00 57.74 ? 214  GLY A N   1 
ATOM   1690  C  CA  . GLY A 1 211 ? 19.176  45.291  70.301  1.00 57.32 ? 214  GLY A CA  1 
ATOM   1691  C  C   . GLY A 1 211 ? 19.909  46.562  69.939  1.00 57.16 ? 214  GLY A C   1 
ATOM   1692  O  O   . GLY A 1 211 ? 19.541  47.650  70.386  1.00 57.06 ? 214  GLY A O   1 
ATOM   1693  N  N   . TYR A 1 212 ? 20.985  46.421  69.176  1.00 57.26 ? 215  TYR A N   1 
ATOM   1694  C  CA  . TYR A 1 212 ? 21.765  47.572  68.757  1.00 57.42 ? 215  TYR A CA  1 
ATOM   1695  C  C   . TYR A 1 212 ? 22.192  47.372  67.313  1.00 57.90 ? 215  TYR A C   1 
ATOM   1696  O  O   . TYR A 1 212 ? 22.276  46.239  66.828  1.00 58.06 ? 215  TYR A O   1 
ATOM   1697  C  CB  . TYR A 1 212 ? 23.040  47.714  69.594  1.00 56.84 ? 215  TYR A CB  1 
ATOM   1698  C  CG  . TYR A 1 212 ? 22.888  47.516  71.084  1.00 56.54 ? 215  TYR A CG  1 
ATOM   1699  C  CD1 . TYR A 1 212 ? 22.927  48.598  71.955  1.00 56.35 ? 215  TYR A CD1 1 
ATOM   1700  C  CD2 . TYR A 1 212 ? 22.776  46.239  71.628  1.00 56.47 ? 215  TYR A CD2 1 
ATOM   1701  C  CE1 . TYR A 1 212 ? 22.866  48.413  73.335  1.00 56.12 ? 215  TYR A CE1 1 
ATOM   1702  C  CE2 . TYR A 1 212 ? 22.717  46.044  73.002  1.00 56.17 ? 215  TYR A CE2 1 
ATOM   1703  C  CZ  . TYR A 1 212 ? 22.766  47.135  73.849  1.00 56.14 ? 215  TYR A CZ  1 
ATOM   1704  O  OH  . TYR A 1 212 ? 22.747  46.949  75.213  1.00 56.17 ? 215  TYR A OH  1 
ATOM   1705  N  N   . GLY A 1 213 ? 22.444  48.479  66.622  1.00 58.41 ? 216  GLY A N   1 
ATOM   1706  C  CA  . GLY A 1 213 ? 22.919  48.393  65.256  1.00 58.91 ? 216  GLY A CA  1 
ATOM   1707  C  C   . GLY A 1 213 ? 24.419  48.141  65.328  1.00 59.25 ? 216  GLY A C   1 
ATOM   1708  O  O   . GLY A 1 213 ? 25.048  47.801  64.324  1.00 59.69 ? 216  GLY A O   1 
ATOM   1709  N  N   . SER A 1 214 ? 24.980  48.303  66.529  1.00 59.18 ? 217  SER A N   1 
ATOM   1710  C  CA  . SER A 1 214 ? 26.403  48.117  66.814  1.00 59.05 ? 217  SER A CA  1 
ATOM   1711  C  C   . SER A 1 214 ? 27.274  49.118  66.089  1.00 59.62 ? 217  SER A C   1 
ATOM   1712  O  O   . SER A 1 214 ? 28.015  49.870  66.725  1.00 59.88 ? 217  SER A O   1 
ATOM   1713  C  CB  . SER A 1 214 ? 26.864  46.708  66.466  1.00 58.68 ? 217  SER A CB  1 
ATOM   1714  O  OG  . SER A 1 214 ? 26.148  45.751  67.214  1.00 58.30 ? 217  SER A OG  1 
ATOM   1715  N  N   . HIS A 1 215 ? 27.191  49.111  64.759  1.00 59.92 ? 218  HIS A N   1 
ATOM   1716  C  CA  . HIS A 1 215 ? 27.970  50.005  63.914  1.00 59.93 ? 218  HIS A CA  1 
ATOM   1717  C  C   . HIS A 1 215 ? 27.605  51.461  64.061  1.00 59.98 ? 218  HIS A C   1 
ATOM   1718  O  O   . HIS A 1 215 ? 26.494  51.815  64.445  1.00 60.19 ? 218  HIS A O   1 
ATOM   1719  C  CB  . HIS A 1 215 ? 27.773  49.677  62.443  1.00 59.87 ? 218  HIS A CB  1 
ATOM   1720  C  CG  . HIS A 1 215 ? 28.218  48.311  62.060  1.00 60.14 ? 218  HIS A CG  1 
ATOM   1721  N  ND1 . HIS A 1 215 ? 29.546  47.953  62.004  1.00 60.24 ? 218  HIS A ND1 1 
ATOM   1722  C  CD2 . HIS A 1 215 ? 27.513  47.222  61.678  1.00 60.42 ? 218  HIS A CD2 1 
ATOM   1723  C  CE1 . HIS A 1 215 ? 29.640  46.699  61.598  1.00 60.62 ? 218  HIS A CE1 1 
ATOM   1724  N  NE2 . HIS A 1 215 ? 28.421  46.232  61.393  1.00 60.58 ? 218  HIS A NE2 1 
ATOM   1725  N  N   . THR A 1 216 ? 28.569  52.298  63.721  1.00 59.87 ? 219  THR A N   1 
ATOM   1726  C  CA  . THR A 1 216 ? 28.380  53.725  63.719  1.00 60.08 ? 219  THR A CA  1 
ATOM   1727  C  C   . THR A 1 216 ? 27.841  53.939  62.313  1.00 59.92 ? 219  THR A C   1 
ATOM   1728  O  O   . THR A 1 216 ? 28.387  53.380  61.363  1.00 60.21 ? 219  THR A O   1 
ATOM   1729  C  CB  . THR A 1 216 ? 29.734  54.432  63.809  1.00 60.31 ? 219  THR A CB  1 
ATOM   1730  O  OG1 . THR A 1 216 ? 30.337  54.172  65.083  1.00 61.05 ? 219  THR A OG1 1 
ATOM   1731  C  CG2 . THR A 1 216 ? 29.568  55.920  63.598  1.00 60.20 ? 219  THR A CG2 1 
ATOM   1732  N  N   . PHE A 1 217 ? 26.739  54.664  62.171  1.00 59.55 ? 220  PHE A N   1 
ATOM   1733  C  CA  . PHE A 1 217 ? 26.198  54.923  60.840  1.00 59.09 ? 220  PHE A CA  1 
ATOM   1734  C  C   . PHE A 1 217 ? 26.217  56.406  60.573  1.00 59.19 ? 220  PHE A C   1 
ATOM   1735  O  O   . PHE A 1 217 ? 26.608  57.193  61.433  1.00 59.06 ? 220  PHE A O   1 
ATOM   1736  C  CB  . PHE A 1 217 ? 24.773  54.409  60.706  1.00 58.99 ? 220  PHE A CB  1 
ATOM   1737  C  CG  . PHE A 1 217 ? 24.670  52.918  60.644  1.00 58.55 ? 220  PHE A CG  1 
ATOM   1738  C  CD1 . PHE A 1 217 ? 24.713  52.258  59.418  1.00 58.56 ? 220  PHE A CD1 1 
ATOM   1739  C  CD2 . PHE A 1 217 ? 24.489  52.172  61.806  1.00 58.46 ? 220  PHE A CD2 1 
ATOM   1740  C  CE1 . PHE A 1 217 ? 24.571  50.871  59.347  1.00 58.48 ? 220  PHE A CE1 1 
ATOM   1741  C  CE2 . PHE A 1 217 ? 24.346  50.784  61.750  1.00 58.36 ? 220  PHE A CE2 1 
ATOM   1742  C  CZ  . PHE A 1 217 ? 24.387  50.132  60.515  1.00 58.43 ? 220  PHE A CZ  1 
ATOM   1743  N  N   . LYS A 1 218 ? 25.785  56.792  59.381  1.00 59.41 ? 221  LYS A N   1 
ATOM   1744  C  CA  . LYS A 1 218 ? 25.765  58.196  59.025  1.00 59.88 ? 221  LYS A CA  1 
ATOM   1745  C  C   . LYS A 1 218 ? 24.356  58.644  58.687  1.00 60.51 ? 221  LYS A C   1 
ATOM   1746  O  O   . LYS A 1 218 ? 23.646  57.971  57.936  1.00 61.02 ? 221  LYS A O   1 
ATOM   1747  C  CB  . LYS A 1 218 ? 26.691  58.455  57.845  1.00 59.79 ? 221  LYS A CB  1 
ATOM   1748  C  CG  . LYS A 1 218 ? 26.829  59.923  57.511  1.00 59.95 ? 221  LYS A CG  1 
ATOM   1749  C  CD  . LYS A 1 218 ? 27.922  60.171  56.490  1.00 60.00 ? 221  LYS A CD  1 
ATOM   1750  C  CE  . LYS A 1 218 ? 27.581  59.559  55.154  1.00 59.70 ? 221  LYS A CE  1 
ATOM   1751  N  NZ  . LYS A 1 218 ? 28.495  60.039  54.081  1.00 59.56 ? 221  LYS A NZ  1 
ATOM   1752  N  N   . LEU A 1 219 ? 23.944  59.766  59.275  1.00 60.72 ? 222  LEU A N   1 
ATOM   1753  C  CA  . LEU A 1 219 ? 22.619  60.326  59.041  1.00 60.57 ? 222  LEU A CA  1 
ATOM   1754  C  C   . LEU A 1 219 ? 22.755  61.643  58.304  1.00 61.08 ? 222  LEU A C   1 
ATOM   1755  O  O   . LEU A 1 219 ? 23.585  62.493  58.662  1.00 61.04 ? 222  LEU A O   1 
ATOM   1756  C  CB  . LEU A 1 219 ? 21.889  60.579  60.357  1.00 60.15 ? 222  LEU A CB  1 
ATOM   1757  C  CG  . LEU A 1 219 ? 21.633  59.377  61.254  1.00 59.61 ? 222  LEU A CG  1 
ATOM   1758  C  CD1 . LEU A 1 219 ? 20.879  59.807  62.503  1.00 58.93 ? 222  LEU A CD1 1 
ATOM   1759  C  CD2 . LEU A 1 219 ? 20.852  58.343  60.467  1.00 59.43 ? 222  LEU A CD2 1 
ATOM   1760  N  N   . VAL A 1 220 ? 21.934  61.806  57.273  1.00 61.52 ? 223  VAL A N   1 
ATOM   1761  C  CA  . VAL A 1 220 ? 21.941  63.021  56.478  1.00 61.66 ? 223  VAL A CA  1 
ATOM   1762  C  C   . VAL A 1 220 ? 20.544  63.631  56.515  1.00 61.95 ? 223  VAL A C   1 
ATOM   1763  O  O   . VAL A 1 220 ? 19.540  62.918  56.383  1.00 61.68 ? 223  VAL A O   1 
ATOM   1764  C  CB  . VAL A 1 220 ? 22.325  62.725  55.025  1.00 61.62 ? 223  VAL A CB  1 
ATOM   1765  C  CG1 . VAL A 1 220 ? 22.616  64.026  54.284  1.00 61.30 ? 223  VAL A CG1 1 
ATOM   1766  C  CG2 . VAL A 1 220 ? 23.529  61.794  54.981  1.00 61.26 ? 223  VAL A CG2 1 
ATOM   1767  N  N   . ASN A 1 221 ? 20.483  64.943  56.716  1.00 62.25 ? 224  ASN A N   1 
ATOM   1768  C  CA  . ASN A 1 221 ? 19.205  65.634  56.790  1.00 62.71 ? 224  ASN A CA  1 
ATOM   1769  C  C   . ASN A 1 221 ? 18.809  66.292  55.486  1.00 62.84 ? 224  ASN A C   1 
ATOM   1770  O  O   . ASN A 1 221 ? 19.548  66.259  54.502  1.00 62.92 ? 224  ASN A O   1 
ATOM   1771  C  CB  . ASN A 1 221 ? 19.223  66.675  57.908  1.00 62.75 ? 224  ASN A CB  1 
ATOM   1772  C  CG  . ASN A 1 221 ? 20.204  67.792  57.647  1.00 62.84 ? 224  ASN A CG  1 
ATOM   1773  O  OD1 . ASN A 1 221 ? 20.649  68.004  56.515  1.00 63.47 ? 224  ASN A OD1 1 
ATOM   1774  N  ND2 . ASN A 1 221 ? 20.548  68.518  58.694  1.00 63.02 ? 224  ASN A ND2 1 
ATOM   1775  N  N   . ALA A 1 222 ? 17.661  66.951  55.519  1.00 63.43 ? 225  ALA A N   1 
ATOM   1776  C  CA  . ALA A 1 222 ? 17.129  67.632  54.353  1.00 64.30 ? 225  ALA A CA  1 
ATOM   1777  C  C   . ALA A 1 222 ? 18.040  68.748  53.854  1.00 64.94 ? 225  ALA A C   1 
ATOM   1778  O  O   . ALA A 1 222 ? 17.917  69.179  52.704  1.00 65.34 ? 225  ALA A O   1 
ATOM   1779  C  CB  . ALA A 1 222 ? 15.746  68.177  54.656  1.00 64.21 ? 225  ALA A CB  1 
ATOM   1780  N  N   . ASN A 1 223 ? 18.948  69.218  54.706  1.00 65.43 ? 226  ASN A N   1 
ATOM   1781  C  CA  . ASN A 1 223 ? 19.860  70.287  54.307  1.00 65.85 ? 226  ASN A CA  1 
ATOM   1782  C  C   . ASN A 1 223 ? 21.209  69.792  53.823  1.00 66.16 ? 226  ASN A C   1 
ATOM   1783  O  O   . ASN A 1 223 ? 22.061  70.599  53.436  1.00 66.35 ? 226  ASN A O   1 
ATOM   1784  C  CB  . ASN A 1 223 ? 20.063  71.293  55.437  1.00 65.94 ? 226  ASN A CB  1 
ATOM   1785  C  CG  . ASN A 1 223 ? 18.886  72.233  55.597  1.00 66.18 ? 226  ASN A CG  1 
ATOM   1786  O  OD1 . ASN A 1 223 ? 18.660  72.776  56.678  1.00 66.35 ? 226  ASN A OD1 1 
ATOM   1787  N  ND2 . ASN A 1 223 ? 18.129  72.435  54.519  1.00 66.21 ? 226  ASN A ND2 1 
ATOM   1788  N  N   . GLY A 1 224 ? 21.398  68.473  53.830  1.00 66.26 ? 227  GLY A N   1 
ATOM   1789  C  CA  . GLY A 1 224 ? 22.659  67.907  53.383  1.00 65.89 ? 227  GLY A CA  1 
ATOM   1790  C  C   . GLY A 1 224 ? 23.746  67.896  54.445  1.00 65.79 ? 227  GLY A C   1 
ATOM   1791  O  O   . GLY A 1 224 ? 24.917  67.680  54.133  1.00 65.69 ? 227  GLY A O   1 
ATOM   1792  N  N   . GLU A 1 225 ? 23.375  68.183  55.687  1.00 65.78 ? 228  GLU A N   1 
ATOM   1793  C  CA  . GLU A 1 225 ? 24.331  68.169  56.786  1.00 65.61 ? 228  GLU A CA  1 
ATOM   1794  C  C   . GLU A 1 225 ? 24.331  66.737  57.285  1.00 65.38 ? 228  GLU A C   1 
ATOM   1795  O  O   . GLU A 1 225 ? 23.284  66.085  57.297  1.00 65.46 ? 228  GLU A O   1 
ATOM   1796  C  CB  . GLU A 1 225 ? 23.887  69.109  57.907  1.00 66.46 ? 228  GLU A CB  1 
ATOM   1797  C  CG  . GLU A 1 225 ? 23.756  70.571  57.489  1.00 67.67 ? 228  GLU A CG  1 
ATOM   1798  C  CD  . GLU A 1 225 ? 23.196  71.461  58.600  1.00 68.67 ? 228  GLU A CD  1 
ATOM   1799  O  OE1 . GLU A 1 225 ? 22.090  71.167  59.113  1.00 68.66 ? 228  GLU A OE1 1 
ATOM   1800  O  OE2 . GLU A 1 225 ? 23.862  72.461  58.956  1.00 69.50 ? 228  GLU A OE2 1 
ATOM   1801  N  N   . ALA A 1 226 ? 25.495  66.239  57.687  1.00 64.76 ? 229  ALA A N   1 
ATOM   1802  C  CA  . ALA A 1 226 ? 25.589  64.866  58.158  1.00 64.25 ? 229  ALA A CA  1 
ATOM   1803  C  C   . ALA A 1 226 ? 26.227  64.748  59.523  1.00 64.10 ? 229  ALA A C   1 
ATOM   1804  O  O   . ALA A 1 226 ? 27.007  65.606  59.939  1.00 64.17 ? 229  ALA A O   1 
ATOM   1805  C  CB  . ALA A 1 226 ? 26.360  64.028  57.164  1.00 64.37 ? 229  ALA A CB  1 
ATOM   1806  N  N   . VAL A 1 227 ? 25.857  63.685  60.227  1.00 63.56 ? 230  VAL A N   1 
ATOM   1807  C  CA  . VAL A 1 227 ? 26.394  63.391  61.547  1.00 63.20 ? 230  VAL A CA  1 
ATOM   1808  C  C   . VAL A 1 227 ? 26.531  61.883  61.609  1.00 63.32 ? 230  VAL A C   1 
ATOM   1809  O  O   . VAL A 1 227 ? 26.122  61.185  60.679  1.00 63.61 ? 230  VAL A O   1 
ATOM   1810  C  CB  . VAL A 1 227 ? 25.438  63.829  62.678  1.00 63.01 ? 230  VAL A CB  1 
ATOM   1811  C  CG1 . VAL A 1 227 ? 25.171  65.319  62.604  1.00 62.60 ? 230  VAL A CG1 1 
ATOM   1812  C  CG2 . VAL A 1 227 ? 24.136  63.055  62.599  1.00 62.80 ? 230  VAL A CG2 1 
ATOM   1813  N  N   . TYR A 1 228 ? 27.135  61.381  62.680  1.00 63.34 ? 231  TYR A N   1 
ATOM   1814  C  CA  . TYR A 1 228 ? 27.285  59.943  62.853  1.00 63.33 ? 231  TYR A CA  1 
ATOM   1815  C  C   . TYR A 1 228 ? 26.341  59.507  63.966  1.00 63.12 ? 231  TYR A C   1 
ATOM   1816  O  O   . TYR A 1 228 ? 25.923  60.333  64.786  1.00 63.16 ? 231  TYR A O   1 
ATOM   1817  C  CB  . TYR A 1 228 ? 28.731  59.583  63.188  1.00 63.23 ? 231  TYR A CB  1 
ATOM   1818  C  CG  . TYR A 1 228 ? 29.673  59.746  62.018  1.00 63.47 ? 231  TYR A CG  1 
ATOM   1819  C  CD1 . TYR A 1 228 ? 29.503  59.002  60.851  1.00 63.57 ? 231  TYR A CD1 1 
ATOM   1820  C  CD2 . TYR A 1 228 ? 30.722  60.657  62.066  1.00 63.51 ? 231  TYR A CD2 1 
ATOM   1821  C  CE1 . TYR A 1 228 ? 30.356  59.166  59.764  1.00 63.68 ? 231  TYR A CE1 1 
ATOM   1822  C  CE2 . TYR A 1 228 ? 31.576  60.827  60.986  1.00 63.67 ? 231  TYR A CE2 1 
ATOM   1823  C  CZ  . TYR A 1 228 ? 31.386  60.083  59.841  1.00 63.86 ? 231  TYR A CZ  1 
ATOM   1824  O  OH  . TYR A 1 228 ? 32.224  60.277  58.766  1.00 64.31 ? 231  TYR A OH  1 
ATOM   1825  N  N   . CYS A 1 229 ? 25.985  58.226  63.995  1.00 62.69 ? 232  CYS A N   1 
ATOM   1826  C  CA  . CYS A 1 229 ? 25.075  57.763  65.027  1.00 62.37 ? 232  CYS A CA  1 
ATOM   1827  C  C   . CYS A 1 229 ? 25.209  56.294  65.367  1.00 62.52 ? 232  CYS A C   1 
ATOM   1828  O  O   . CYS A 1 229 ? 25.936  55.544  64.709  1.00 62.85 ? 232  CYS A O   1 
ATOM   1829  C  CB  . CYS A 1 229 ? 23.639  58.016  64.600  1.00 61.99 ? 232  CYS A CB  1 
ATOM   1830  S  SG  . CYS A 1 229 ? 23.092  56.861  63.332  1.00 61.79 ? 232  CYS A SG  1 
ATOM   1831  N  N   . LYS A 1 230 ? 24.481  55.909  66.410  1.00 62.62 ? 233  LYS A N   1 
ATOM   1832  C  CA  . LYS A 1 230 ? 24.417  54.541  66.901  1.00 62.33 ? 233  LYS A CA  1 
ATOM   1833  C  C   . LYS A 1 230 ? 22.937  54.257  67.083  1.00 62.57 ? 233  LYS A C   1 
ATOM   1834  O  O   . LYS A 1 230 ? 22.149  55.161  67.363  1.00 62.51 ? 233  LYS A O   1 
ATOM   1835  C  CB  . LYS A 1 230 ? 25.092  54.417  68.260  1.00 62.23 ? 233  LYS A CB  1 
ATOM   1836  C  CG  . LYS A 1 230 ? 26.589  54.553  68.243  1.00 61.50 ? 233  LYS A CG  1 
ATOM   1837  C  CD  . LYS A 1 230 ? 27.231  53.368  67.577  1.00 61.29 ? 233  LYS A CD  1 
ATOM   1838  C  CE  . LYS A 1 230 ? 28.718  53.356  67.863  1.00 61.06 ? 233  LYS A CE  1 
ATOM   1839  N  NZ  . LYS A 1 230 ? 29.389  52.236  67.160  1.00 61.10 ? 233  LYS A NZ  1 
ATOM   1840  N  N   . PHE A 1 231 ? 22.554  53.005  66.907  1.00 62.73 ? 234  PHE A N   1 
ATOM   1841  C  CA  . PHE A 1 231 ? 21.165  52.632  67.068  1.00 62.85 ? 234  PHE A CA  1 
ATOM   1842  C  C   . PHE A 1 231 ? 21.050  51.678  68.240  1.00 62.61 ? 234  PHE A C   1 
ATOM   1843  O  O   . PHE A 1 231 ? 21.803  50.705  68.326  1.00 62.44 ? 234  PHE A O   1 
ATOM   1844  C  CB  . PHE A 1 231 ? 20.652  51.954  65.803  1.00 63.49 ? 234  PHE A CB  1 
ATOM   1845  C  CG  . PHE A 1 231 ? 20.479  52.885  64.639  1.00 63.73 ? 234  PHE A CG  1 
ATOM   1846  C  CD1 . PHE A 1 231 ? 19.524  53.894  64.675  1.00 63.87 ? 234  PHE A CD1 1 
ATOM   1847  C  CD2 . PHE A 1 231 ? 21.236  52.719  63.483  1.00 63.83 ? 234  PHE A CD2 1 
ATOM   1848  C  CE1 . PHE A 1 231 ? 19.321  54.720  63.572  1.00 63.80 ? 234  PHE A CE1 1 
ATOM   1849  C  CE2 . PHE A 1 231 ? 21.039  53.541  62.375  1.00 63.54 ? 234  PHE A CE2 1 
ATOM   1850  C  CZ  . PHE A 1 231 ? 20.081  54.540  62.420  1.00 63.61 ? 234  PHE A CZ  1 
ATOM   1851  N  N   . HIS A 1 232 ? 20.129  51.982  69.152  1.00 62.31 ? 235  HIS A N   1 
ATOM   1852  C  CA  . HIS A 1 232 ? 19.892  51.157  70.332  1.00 61.90 ? 235  HIS A CA  1 
ATOM   1853  C  C   . HIS A 1 232 ? 18.397  50.974  70.465  1.00 61.54 ? 235  HIS A C   1 
ATOM   1854  O  O   . HIS A 1 232 ? 17.634  51.917  70.257  1.00 61.55 ? 235  HIS A O   1 
ATOM   1855  C  CB  . HIS A 1 232 ? 20.332  51.858  71.630  1.00 61.88 ? 235  HIS A CB  1 
ATOM   1856  C  CG  . HIS A 1 232 ? 21.758  52.319  71.658  1.00 62.02 ? 235  HIS A CG  1 
ATOM   1857  N  ND1 . HIS A 1 232 ? 22.640  51.930  72.645  1.00 61.78 ? 235  HIS A ND1 1 
ATOM   1858  C  CD2 . HIS A 1 232 ? 22.430  53.203  70.880  1.00 62.13 ? 235  HIS A CD2 1 
ATOM   1859  C  CE1 . HIS A 1 232 ? 23.792  52.559  72.476  1.00 62.16 ? 235  HIS A CE1 1 
ATOM   1860  N  NE2 . HIS A 1 232 ? 23.690  53.337  71.412  1.00 62.02 ? 235  HIS A NE2 1 
ATOM   1861  N  N   . TYR A 1 233 ? 17.976  49.758  70.772  1.00 61.36 ? 236  TYR A N   1 
ATOM   1862  C  CA  . TYR A 1 233 ? 16.571  49.504  71.009  1.00 61.61 ? 236  TYR A CA  1 
ATOM   1863  C  C   . TYR A 1 233 ? 16.515  48.662  72.260  1.00 61.73 ? 236  TYR A C   1 
ATOM   1864  O  O   . TYR A 1 233 ? 16.864  47.483  72.251  1.00 61.87 ? 236  TYR A O   1 
ATOM   1865  C  CB  . TYR A 1 233 ? 15.838  48.838  69.834  1.00 61.88 ? 236  TYR A CB  1 
ATOM   1866  C  CG  . TYR A 1 233 ? 16.667  48.098  68.805  1.00 62.44 ? 236  TYR A CG  1 
ATOM   1867  C  CD1 . TYR A 1 233 ? 16.445  46.742  68.555  1.00 62.61 ? 236  TYR A CD1 1 
ATOM   1868  C  CD2 . TYR A 1 233 ? 17.624  48.763  68.031  1.00 62.77 ? 236  TYR A CD2 1 
ATOM   1869  C  CE1 . TYR A 1 233 ? 17.149  46.071  67.563  1.00 62.71 ? 236  TYR A CE1 1 
ATOM   1870  C  CE2 . TYR A 1 233 ? 18.336  48.097  67.032  1.00 62.68 ? 236  TYR A CE2 1 
ATOM   1871  C  CZ  . TYR A 1 233 ? 18.092  46.754  66.807  1.00 62.85 ? 236  TYR A CZ  1 
ATOM   1872  O  OH  . TYR A 1 233 ? 18.789  46.087  65.824  1.00 63.52 ? 236  TYR A OH  1 
ATOM   1873  N  N   . LYS A 1 234 ? 16.168  49.320  73.358  1.00 61.59 ? 237  LYS A N   1 
ATOM   1874  C  CA  . LYS A 1 234 ? 16.093  48.687  74.659  1.00 61.50 ? 237  LYS A CA  1 
ATOM   1875  C  C   . LYS A 1 234 ? 14.773  47.976  74.842  1.00 61.34 ? 237  LYS A C   1 
ATOM   1876  O  O   . LYS A 1 234 ? 13.709  48.504  74.507  1.00 61.53 ? 237  LYS A O   1 
ATOM   1877  C  CB  . LYS A 1 234 ? 16.268  49.739  75.748  1.00 62.12 ? 237  LYS A CB  1 
ATOM   1878  C  CG  . LYS A 1 234 ? 17.379  50.750  75.450  1.00 62.85 ? 237  LYS A CG  1 
ATOM   1879  C  CD  . LYS A 1 234 ? 18.772  50.136  75.512  1.00 63.28 ? 237  LYS A CD  1 
ATOM   1880  C  CE  . LYS A 1 234 ? 19.227  49.955  76.954  1.00 63.80 ? 237  LYS A CE  1 
ATOM   1881  N  NZ  . LYS A 1 234 ? 19.235  51.253  77.690  1.00 64.04 ? 237  LYS A NZ  1 
ATOM   1882  N  N   . THR A 1 235 ? 14.850  46.773  75.392  1.00 61.25 ? 238  THR A N   1 
ATOM   1883  C  CA  . THR A 1 235 ? 13.668  45.965  75.626  1.00 61.08 ? 238  THR A CA  1 
ATOM   1884  C  C   . THR A 1 235 ? 12.751  46.619  76.631  1.00 61.31 ? 238  THR A C   1 
ATOM   1885  O  O   . THR A 1 235 ? 13.186  46.996  77.716  1.00 61.52 ? 238  THR A O   1 
ATOM   1886  C  CB  . THR A 1 235 ? 14.039  44.562  76.148  1.00 60.89 ? 238  THR A CB  1 
ATOM   1887  O  OG1 . THR A 1 235 ? 12.856  43.907  76.623  1.00 60.70 ? 238  THR A OG1 1 
ATOM   1888  C  CG2 . THR A 1 235 ? 15.064  44.651  77.283  1.00 60.35 ? 238  THR A CG2 1 
ATOM   1889  N  N   . ASP A 1 236 ? 11.482  46.751  76.269  1.00 61.16 ? 239  ASP A N   1 
ATOM   1890  C  CA  . ASP A 1 236 ? 10.509  47.337  77.170  1.00 61.32 ? 239  ASP A CA  1 
ATOM   1891  C  C   . ASP A 1 236 ? 9.994   46.290  78.150  1.00 61.75 ? 239  ASP A C   1 
ATOM   1892  O  O   . ASP A 1 236 ? 9.175   46.577  79.020  1.00 61.90 ? 239  ASP A O   1 
ATOM   1893  C  CB  . ASP A 1 236 ? 9.376   47.972  76.380  1.00 60.79 ? 239  ASP A CB  1 
ATOM   1894  C  CG  . ASP A 1 236 ? 9.839   49.172  75.583  1.00 60.57 ? 239  ASP A CG  1 
ATOM   1895  O  OD1 . ASP A 1 236 ? 9.184   49.499  74.570  1.00 60.56 ? 239  ASP A OD1 1 
ATOM   1896  O  OD2 . ASP A 1 236 ? 10.866  49.778  75.967  1.00 60.44 ? 239  ASP A OD2 1 
ATOM   1897  N  N   . GLN A 1 237 ? 10.496  45.072  78.013  1.00 62.43 ? 240  GLN A N   1 
ATOM   1898  C  CA  . GLN A 1 237 ? 10.112  43.983  78.896  1.00 63.22 ? 240  GLN A CA  1 
ATOM   1899  C  C   . GLN A 1 237 ? 11.158  43.841  80.006  1.00 63.66 ? 240  GLN A C   1 
ATOM   1900  O  O   . GLN A 1 237 ? 10.952  43.117  80.986  1.00 63.73 ? 240  GLN A O   1 
ATOM   1901  C  CB  . GLN A 1 237 ? 9.999   42.673  78.105  1.00 63.36 ? 240  GLN A CB  1 
ATOM   1902  C  CG  . GLN A 1 237 ? 8.854   42.632  77.081  1.00 63.71 ? 240  GLN A CG  1 
ATOM   1903  C  CD  . GLN A 1 237 ? 9.044   43.602  75.919  1.00 64.03 ? 240  GLN A CD  1 
ATOM   1904  O  OE1 . GLN A 1 237 ? 8.355   44.623  75.822  1.00 64.44 ? 240  GLN A OE1 1 
ATOM   1905  N  NE2 . GLN A 1 237 ? 9.980   43.284  75.032  1.00 63.75 ? 240  GLN A NE2 1 
ATOM   1906  N  N   . GLY A 1 238 ? 12.278  44.544  79.843  1.00 63.98 ? 241  GLY A N   1 
ATOM   1907  C  CA  . GLY A 1 238 ? 13.349  44.485  80.819  1.00 64.34 ? 241  GLY A CA  1 
ATOM   1908  C  C   . GLY A 1 238 ? 14.290  43.308  80.605  1.00 64.64 ? 241  GLY A C   1 
ATOM   1909  O  O   . GLY A 1 238 ? 13.883  42.242  80.130  1.00 64.52 ? 241  GLY A O   1 
ATOM   1910  N  N   . ILE A 1 239 ? 15.559  43.518  80.943  1.00 65.18 ? 242  ILE A N   1 
ATOM   1911  C  CA  . ILE A 1 239 ? 16.589  42.494  80.818  1.00 65.51 ? 242  ILE A CA  1 
ATOM   1912  C  C   . ILE A 1 239 ? 16.280  41.354  81.777  1.00 66.10 ? 242  ILE A C   1 
ATOM   1913  O  O   . ILE A 1 239 ? 16.034  41.580  82.962  1.00 66.30 ? 242  ILE A O   1 
ATOM   1914  C  CB  . ILE A 1 239 ? 17.975  43.055  81.193  1.00 65.25 ? 242  ILE A CB  1 
ATOM   1915  C  CG1 . ILE A 1 239 ? 18.342  44.221  80.276  1.00 65.24 ? 242  ILE A CG1 1 
ATOM   1916  C  CG2 . ILE A 1 239 ? 19.023  41.966  81.106  1.00 65.12 ? 242  ILE A CG2 1 
ATOM   1917  C  CD1 . ILE A 1 239 ? 18.383  43.842  78.805  1.00 65.64 ? 242  ILE A CD1 1 
ATOM   1918  N  N   . LYS A 1 240 ? 16.264  40.136  81.259  1.00 66.54 ? 243  LYS A N   1 
ATOM   1919  C  CA  . LYS A 1 240 ? 16.005  38.968  82.082  1.00 67.10 ? 243  LYS A CA  1 
ATOM   1920  C  C   . LYS A 1 240 ? 16.881  37.886  81.491  1.00 67.09 ? 243  LYS A C   1 
ATOM   1921  O  O   . LYS A 1 240 ? 16.833  37.631  80.288  1.00 67.17 ? 243  LYS A O   1 
ATOM   1922  C  CB  . LYS A 1 240 ? 14.534  38.581  82.005  1.00 67.88 ? 243  LYS A CB  1 
ATOM   1923  C  CG  . LYS A 1 240 ? 14.092  37.511  82.990  1.00 69.05 ? 243  LYS A CG  1 
ATOM   1924  C  CD  . LYS A 1 240 ? 12.594  37.244  82.827  1.00 70.17 ? 243  LYS A CD  1 
ATOM   1925  C  CE  . LYS A 1 240 ? 12.086  36.165  83.773  1.00 70.95 ? 243  LYS A CE  1 
ATOM   1926  N  NZ  . LYS A 1 240 ? 12.187  36.572  85.205  1.00 71.63 ? 243  LYS A NZ  1 
ATOM   1927  N  N   . ASN A 1 241 ? 17.727  37.298  82.326  1.00 67.08 ? 244  ASN A N   1 
ATOM   1928  C  CA  . ASN A 1 241 ? 18.651  36.268  81.878  1.00 67.03 ? 244  ASN A CA  1 
ATOM   1929  C  C   . ASN A 1 241 ? 18.416  34.920  82.512  1.00 67.04 ? 244  ASN A C   1 
ATOM   1930  O  O   . ASN A 1 241 ? 17.732  34.804  83.529  1.00 67.46 ? 244  ASN A O   1 
ATOM   1931  C  CB  . ASN A 1 241 ? 20.082  36.706  82.159  1.00 66.78 ? 244  ASN A CB  1 
ATOM   1932  C  CG  . ASN A 1 241 ? 20.377  38.072  81.599  1.00 66.68 ? 244  ASN A CG  1 
ATOM   1933  O  OD1 . ASN A 1 241 ? 20.243  38.304  80.397  1.00 67.09 ? 244  ASN A OD1 1 
ATOM   1934  N  ND2 . ASN A 1 241 ? 20.747  38.999  82.470  1.00 66.16 ? 244  ASN A ND2 1 
ATOM   1935  N  N   . LEU A 1 242 ? 19.005  33.900  81.904  1.00 66.82 ? 245  LEU A N   1 
ATOM   1936  C  CA  . LEU A 1 242 ? 18.882  32.542  82.400  1.00 66.65 ? 245  LEU A CA  1 
ATOM   1937  C  C   . LEU A 1 242 ? 20.205  32.095  83.004  1.00 66.71 ? 245  LEU A C   1 
ATOM   1938  O  O   . LEU A 1 242 ? 21.276  32.430  82.496  1.00 66.95 ? 245  LEU A O   1 
ATOM   1939  C  CB  . LEU A 1 242 ? 18.499  31.599  81.263  1.00 66.32 ? 245  LEU A CB  1 
ATOM   1940  C  CG  . LEU A 1 242 ? 17.136  31.799  80.602  1.00 65.98 ? 245  LEU A CG  1 
ATOM   1941  C  CD1 . LEU A 1 242 ? 17.065  30.981  79.333  1.00 65.49 ? 245  LEU A CD1 1 
ATOM   1942  C  CD2 . LEU A 1 242 ? 16.018  31.405  81.554  1.00 65.88 ? 245  LEU A CD2 1 
ATOM   1943  N  N   . SER A 1 243 ? 20.131  31.354  84.103  1.00 66.59 ? 246  SER A N   1 
ATOM   1944  C  CA  . SER A 1 243 ? 21.334  30.861  84.744  1.00 66.38 ? 246  SER A CA  1 
ATOM   1945  C  C   . SER A 1 243 ? 21.821  29.710  83.897  1.00 66.47 ? 246  SER A C   1 
ATOM   1946  O  O   . SER A 1 243 ? 21.054  29.115  83.140  1.00 66.49 ? 246  SER A O   1 
ATOM   1947  C  CB  . SER A 1 243 ? 21.035  30.366  86.158  1.00 66.09 ? 246  SER A CB  1 
ATOM   1948  O  OG  . SER A 1 243 ? 20.234  29.199  86.124  1.00 65.86 ? 246  SER A OG  1 
ATOM   1949  N  N   . VAL A 1 244 ? 23.101  29.403  84.024  1.00 66.95 ? 247  VAL A N   1 
ATOM   1950  C  CA  . VAL A 1 244 ? 23.712  28.311  83.290  1.00 67.33 ? 247  VAL A CA  1 
ATOM   1951  C  C   . VAL A 1 244 ? 22.896  27.022  83.450  1.00 67.58 ? 247  VAL A C   1 
ATOM   1952  O  O   . VAL A 1 244 ? 22.475  26.423  82.464  1.00 67.65 ? 247  VAL A O   1 
ATOM   1953  C  CB  . VAL A 1 244 ? 25.149  28.096  83.797  1.00 67.67 ? 247  VAL A CB  1 
ATOM   1954  C  CG1 . VAL A 1 244 ? 25.821  26.973  83.049  1.00 67.93 ? 247  VAL A CG1 1 
ATOM   1955  C  CG2 . VAL A 1 244 ? 25.946  29.384  83.655  1.00 67.63 ? 247  VAL A CG2 1 
ATOM   1956  N  N   . GLU A 1 245 ? 22.618  26.644  84.696  1.00 67.85 ? 248  GLU A N   1 
ATOM   1957  C  CA  . GLU A 1 245 ? 21.863  25.430  84.996  1.00 68.26 ? 248  GLU A CA  1 
ATOM   1958  C  C   . GLU A 1 245 ? 20.591  25.374  84.185  1.00 67.69 ? 248  GLU A C   1 
ATOM   1959  O  O   . GLU A 1 245 ? 20.344  24.409  83.470  1.00 67.54 ? 248  GLU A O   1 
ATOM   1960  C  CB  . GLU A 1 245 ? 21.499  25.351  86.486  1.00 69.63 ? 248  GLU A CB  1 
ATOM   1961  C  CG  . GLU A 1 245 ? 22.680  25.324  87.462  1.00 72.10 ? 248  GLU A CG  1 
ATOM   1962  C  CD  . GLU A 1 245 ? 23.216  26.717  87.833  1.00 73.84 ? 248  GLU A CD  1 
ATOM   1963  O  OE1 . GLU A 1 245 ? 22.891  27.722  87.151  1.00 74.61 ? 248  GLU A OE1 1 
ATOM   1964  O  OE2 . GLU A 1 245 ? 23.970  26.808  88.830  1.00 74.76 ? 248  GLU A OE2 1 
ATOM   1965  N  N   . ASP A 1 246 ? 19.801  26.436  84.279  1.00 67.54 ? 249  ASP A N   1 
ATOM   1966  C  CA  . ASP A 1 246 ? 18.534  26.511  83.562  1.00 67.56 ? 249  ASP A CA  1 
ATOM   1967  C  C   . ASP A 1 246 ? 18.703  26.403  82.053  1.00 67.09 ? 249  ASP A C   1 
ATOM   1968  O  O   . ASP A 1 246 ? 18.016  25.611  81.408  1.00 67.20 ? 249  ASP A O   1 
ATOM   1969  C  CB  . ASP A 1 246 ? 17.788  27.799  83.922  1.00 68.23 ? 249  ASP A CB  1 
ATOM   1970  C  CG  . ASP A 1 246 ? 17.280  27.804  85.361  1.00 69.07 ? 249  ASP A CG  1 
ATOM   1971  O  OD1 . ASP A 1 246 ? 17.236  28.892  85.980  1.00 69.54 ? 249  ASP A OD1 1 
ATOM   1972  O  OD2 . ASP A 1 246 ? 16.917  26.723  85.874  1.00 69.63 ? 249  ASP A OD2 1 
ATOM   1973  N  N   . ALA A 1 247 ? 19.621  27.192  81.501  1.00 66.51 ? 250  ALA A N   1 
ATOM   1974  C  CA  . ALA A 1 247 ? 19.887  27.177  80.070  1.00 65.90 ? 250  ALA A CA  1 
ATOM   1975  C  C   . ALA A 1 247 ? 20.219  25.751  79.670  1.00 65.68 ? 250  ALA A C   1 
ATOM   1976  O  O   . ALA A 1 247 ? 19.720  25.242  78.668  1.00 65.71 ? 250  ALA A O   1 
ATOM   1977  C  CB  . ALA A 1 247 ? 21.048  28.100  79.748  1.00 65.79 ? 250  ALA A CB  1 
ATOM   1978  N  N   . ALA A 1 248 ? 21.032  25.100  80.493  1.00 65.55 ? 251  ALA A N   1 
ATOM   1979  C  CA  . ALA A 1 248 ? 21.433  23.728  80.251  1.00 65.66 ? 251  ALA A CA  1 
ATOM   1980  C  C   . ALA A 1 248 ? 20.213  22.821  80.262  1.00 65.98 ? 251  ALA A C   1 
ATOM   1981  O  O   . ALA A 1 248 ? 20.030  22.000  79.364  1.00 66.07 ? 251  ALA A O   1 
ATOM   1982  C  CB  . ALA A 1 248 ? 22.421  23.285  81.306  1.00 65.46 ? 251  ALA A CB  1 
ATOM   1983  N  N   . ARG A 1 249 ? 19.364  22.982  81.269  1.00 66.41 ? 252  ARG A N   1 
ATOM   1984  C  CA  . ARG A 1 249 ? 18.168  22.159  81.370  1.00 66.76 ? 252  ARG A CA  1 
ATOM   1985  C  C   . ARG A 1 249 ? 17.275  22.387  80.154  1.00 66.59 ? 252  ARG A C   1 
ATOM   1986  O  O   . ARG A 1 249 ? 16.986  21.462  79.398  1.00 66.54 ? 252  ARG A O   1 
ATOM   1987  C  CB  . ARG A 1 249 ? 17.403  22.491  82.649  1.00 67.89 ? 252  ARG A CB  1 
ATOM   1988  C  CG  . ARG A 1 249 ? 16.367  21.442  83.015  1.00 70.08 ? 252  ARG A CG  1 
ATOM   1989  C  CD  . ARG A 1 249 ? 15.503  21.870  84.191  1.00 71.94 ? 252  ARG A CD  1 
ATOM   1990  N  NE  . ARG A 1 249 ? 14.609  22.962  83.818  1.00 74.13 ? 252  ARG A NE  1 
ATOM   1991  C  CZ  . ARG A 1 249 ? 14.631  24.169  84.374  1.00 75.15 ? 252  ARG A CZ  1 
ATOM   1992  N  NH1 . ARG A 1 249 ? 15.502  24.443  85.342  1.00 75.61 ? 252  ARG A NH1 1 
ATOM   1993  N  NH2 . ARG A 1 249 ? 13.789  25.108  83.956  1.00 75.80 ? 252  ARG A NH2 1 
ATOM   1994  N  N   . LEU A 1 250 ? 16.887  23.640  79.945  1.00 66.30 ? 253  LEU A N   1 
ATOM   1995  C  CA  . LEU A 1 250 ? 16.029  24.017  78.831  1.00 65.99 ? 253  LEU A CA  1 
ATOM   1996  C  C   . LEU A 1 250 ? 16.538  23.579  77.471  1.00 66.40 ? 253  LEU A C   1 
ATOM   1997  O  O   . LEU A 1 250 ? 15.774  23.074  76.652  1.00 66.59 ? 253  LEU A O   1 
ATOM   1998  C  CB  . LEU A 1 250 ? 15.803  25.522  78.836  1.00 65.15 ? 253  LEU A CB  1 
ATOM   1999  C  CG  . LEU A 1 250 ? 14.871  25.964  79.957  1.00 64.60 ? 253  LEU A CG  1 
ATOM   2000  C  CD1 . LEU A 1 250 ? 14.777  27.472  79.996  1.00 64.39 ? 253  LEU A CD1 1 
ATOM   2001  C  CD2 . LEU A 1 250 ? 13.499  25.346  79.736  1.00 64.48 ? 253  LEU A CD2 1 
ATOM   2002  N  N   . SER A 1 251 ? 17.829  23.763  77.226  1.00 66.81 ? 254  SER A N   1 
ATOM   2003  C  CA  . SER A 1 251 ? 18.402  23.371  75.948  1.00 67.37 ? 254  SER A CA  1 
ATOM   2004  C  C   . SER A 1 251 ? 18.080  21.914  75.662  1.00 67.46 ? 254  SER A C   1 
ATOM   2005  O  O   . SER A 1 251 ? 18.182  21.468  74.525  1.00 67.56 ? 254  SER A O   1 
ATOM   2006  C  CB  . SER A 1 251 ? 19.912  23.576  75.954  1.00 67.69 ? 254  SER A CB  1 
ATOM   2007  O  OG  . SER A 1 251 ? 20.525  22.743  76.920  1.00 68.68 ? 254  SER A OG  1 
ATOM   2008  N  N   . GLN A 1 252 ? 17.706  21.178  76.704  1.00 67.76 ? 255  GLN A N   1 
ATOM   2009  C  CA  . GLN A 1 252 ? 17.352  19.774  76.566  1.00 68.16 ? 255  GLN A CA  1 
ATOM   2010  C  C   . GLN A 1 252 ? 15.839  19.601  76.553  1.00 67.89 ? 255  GLN A C   1 
ATOM   2011  O  O   . GLN A 1 252 ? 15.293  18.963  75.657  1.00 67.76 ? 255  GLN A O   1 
ATOM   2012  C  CB  . GLN A 1 252 ? 17.973  18.957  77.701  1.00 69.28 ? 255  GLN A CB  1 
ATOM   2013  C  CG  . GLN A 1 252 ? 17.705  17.441  77.646  1.00 71.17 ? 255  GLN A CG  1 
ATOM   2014  C  CD  . GLN A 1 252 ? 16.306  17.050  78.129  1.00 72.25 ? 255  GLN A CD  1 
ATOM   2015  O  OE1 . GLN A 1 252 ? 15.469  16.604  77.339  1.00 72.96 ? 255  GLN A OE1 1 
ATOM   2016  N  NE2 . GLN A 1 252 ? 16.046  17.229  79.426  1.00 72.63 ? 255  GLN A NE2 1 
ATOM   2017  N  N   . GLU A 1 253 ? 15.169  20.141  77.568  1.00 67.88 ? 256  GLU A N   1 
ATOM   2018  C  CA  . GLU A 1 253 ? 13.716  20.037  77.675  1.00 68.04 ? 256  GLU A CA  1 
ATOM   2019  C  C   . GLU A 1 253 ? 13.029  20.720  76.506  1.00 67.99 ? 256  GLU A C   1 
ATOM   2020  O  O   . GLU A 1 253 ? 11.960  20.287  76.075  1.00 68.06 ? 256  GLU A O   1 
ATOM   2021  C  CB  . GLU A 1 253 ? 13.218  20.675  78.973  1.00 68.77 ? 256  GLU A CB  1 
ATOM   2022  C  CG  . GLU A 1 253 ? 13.782  20.056  80.244  1.00 69.93 ? 256  GLU A CG  1 
ATOM   2023  C  CD  . GLU A 1 253 ? 13.118  20.590  81.509  1.00 70.56 ? 256  GLU A CD  1 
ATOM   2024  O  OE1 . GLU A 1 253 ? 12.724  21.783  81.538  1.00 70.37 ? 256  GLU A OE1 1 
ATOM   2025  O  OE2 . GLU A 1 253 ? 12.993  19.807  82.481  1.00 70.85 ? 256  GLU A OE2 1 
ATOM   2026  N  N   . ASP A 1 254 ? 13.637  21.797  76.012  1.00 67.56 ? 257  ASP A N   1 
ATOM   2027  C  CA  . ASP A 1 254 ? 13.079  22.550  74.896  1.00 66.70 ? 257  ASP A CA  1 
ATOM   2028  C  C   . ASP A 1 254 ? 14.127  23.359  74.146  1.00 66.21 ? 257  ASP A C   1 
ATOM   2029  O  O   . ASP A 1 254 ? 14.387  24.520  74.462  1.00 66.36 ? 257  ASP A O   1 
ATOM   2030  C  CB  . ASP A 1 254 ? 11.964  23.474  75.383  1.00 66.73 ? 257  ASP A CB  1 
ATOM   2031  C  CG  . ASP A 1 254 ? 11.256  24.181  74.246  1.00 67.00 ? 257  ASP A CG  1 
ATOM   2032  O  OD1 . ASP A 1 254 ? 11.499  23.844  73.064  1.00 67.01 ? 257  ASP A OD1 1 
ATOM   2033  O  OD2 . ASP A 1 254 ? 10.448  25.085  74.534  1.00 67.45 ? 257  ASP A OD2 1 
ATOM   2034  N  N   . PRO A 1 255 ? 14.715  22.761  73.110  1.00 65.69 ? 258  PRO A N   1 
ATOM   2035  C  CA  . PRO A 1 255 ? 15.743  23.375  72.267  1.00 65.38 ? 258  PRO A CA  1 
ATOM   2036  C  C   . PRO A 1 255 ? 15.209  24.590  71.522  1.00 65.21 ? 258  PRO A C   1 
ATOM   2037  O  O   . PRO A 1 255 ? 15.976  25.458  71.113  1.00 65.44 ? 258  PRO A O   1 
ATOM   2038  C  CB  . PRO A 1 255 ? 16.073  22.265  71.279  1.00 65.15 ? 258  PRO A CB  1 
ATOM   2039  C  CG  . PRO A 1 255 ? 15.782  21.025  72.054  1.00 65.36 ? 258  PRO A CG  1 
ATOM   2040  C  CD  . PRO A 1 255 ? 14.498  21.357  72.731  1.00 65.28 ? 258  PRO A CD  1 
ATOM   2041  N  N   . ASP A 1 256 ? 13.893  24.640  71.341  1.00 64.91 ? 259  ASP A N   1 
ATOM   2042  C  CA  . ASP A 1 256 ? 13.257  25.736  70.623  1.00 64.62 ? 259  ASP A CA  1 
ATOM   2043  C  C   . ASP A 1 256 ? 12.551  26.708  71.547  1.00 64.47 ? 259  ASP A C   1 
ATOM   2044  O  O   . ASP A 1 256 ? 11.702  27.487  71.113  1.00 64.29 ? 259  ASP A O   1 
ATOM   2045  C  CB  . ASP A 1 256 ? 12.262  25.177  69.614  1.00 64.75 ? 259  ASP A CB  1 
ATOM   2046  C  CG  . ASP A 1 256 ? 12.883  24.143  68.710  1.00 64.94 ? 259  ASP A CG  1 
ATOM   2047  O  OD1 . ASP A 1 256 ? 14.007  24.379  68.224  1.00 65.17 ? 259  ASP A OD1 1 
ATOM   2048  O  OD2 . ASP A 1 256 ? 12.255  23.084  68.501  1.00 65.10 ? 259  ASP A OD2 1 
ATOM   2049  N  N   . TYR A 1 257 ? 12.934  26.672  72.816  1.00 64.59 ? 260  TYR A N   1 
ATOM   2050  C  CA  . TYR A 1 257 ? 12.361  27.531  73.844  1.00 64.81 ? 260  TYR A CA  1 
ATOM   2051  C  C   . TYR A 1 257 ? 12.163  28.963  73.373  1.00 64.89 ? 260  TYR A C   1 
ATOM   2052  O  O   . TYR A 1 257 ? 11.152  29.593  73.681  1.00 65.12 ? 260  TYR A O   1 
ATOM   2053  C  CB  . TYR A 1 257 ? 13.267  27.508  75.069  1.00 65.29 ? 260  TYR A CB  1 
ATOM   2054  C  CG  . TYR A 1 257 ? 12.841  28.409  76.202  1.00 66.22 ? 260  TYR A CG  1 
ATOM   2055  C  CD1 . TYR A 1 257 ? 13.324  29.714  76.298  1.00 66.52 ? 260  TYR A CD1 1 
ATOM   2056  C  CD2 . TYR A 1 257 ? 12.006  27.942  77.215  1.00 66.71 ? 260  TYR A CD2 1 
ATOM   2057  C  CE1 . TYR A 1 257 ? 12.994  30.531  77.379  1.00 66.79 ? 260  TYR A CE1 1 
ATOM   2058  C  CE2 . TYR A 1 257 ? 11.669  28.753  78.302  1.00 66.99 ? 260  TYR A CE2 1 
ATOM   2059  C  CZ  . TYR A 1 257 ? 12.171  30.043  78.374  1.00 66.99 ? 260  TYR A CZ  1 
ATOM   2060  O  OH  . TYR A 1 257 ? 11.867  30.836  79.454  1.00 67.32 ? 260  TYR A OH  1 
ATOM   2061  N  N   . GLY A 1 258 ? 13.128  29.470  72.615  1.00 64.77 ? 261  GLY A N   1 
ATOM   2062  C  CA  . GLY A 1 258 ? 13.028  30.828  72.119  1.00 64.65 ? 261  GLY A CA  1 
ATOM   2063  C  C   . GLY A 1 258 ? 11.822  31.009  71.224  1.00 64.64 ? 261  GLY A C   1 
ATOM   2064  O  O   . GLY A 1 258 ? 11.016  31.919  71.431  1.00 64.96 ? 261  GLY A O   1 
ATOM   2065  N  N   . ILE A 1 259 ? 11.687  30.116  70.249  1.00 64.29 ? 262  ILE A N   1 
ATOM   2066  C  CA  . ILE A 1 259 ? 10.583  30.162  69.301  1.00 63.66 ? 262  ILE A CA  1 
ATOM   2067  C  C   . ILE A 1 259 ? 9.241   30.139  70.016  1.00 63.49 ? 262  ILE A C   1 
ATOM   2068  O  O   . ILE A 1 259 ? 8.420   31.041  69.841  1.00 63.84 ? 262  ILE A O   1 
ATOM   2069  C  CB  . ILE A 1 259 ? 10.667  28.982  68.313  1.00 63.51 ? 262  ILE A CB  1 
ATOM   2070  C  CG1 . ILE A 1 259 ? 11.988  29.062  67.548  1.00 63.30 ? 262  ILE A CG1 1 
ATOM   2071  C  CG2 . ILE A 1 259 ? 9.486   29.005  67.341  1.00 63.50 ? 262  ILE A CG2 1 
ATOM   2072  C  CD1 . ILE A 1 259 ? 12.186  27.969  66.531  1.00 62.89 ? 262  ILE A CD1 1 
ATOM   2073  N  N   . ARG A 1 260 ? 9.045   29.120  70.849  1.00 62.98 ? 263  ARG A N   1 
ATOM   2074  C  CA  . ARG A 1 260 ? 7.811   28.948  71.609  1.00 62.13 ? 263  ARG A CA  1 
ATOM   2075  C  C   . ARG A 1 260 ? 7.457   30.215  72.359  1.00 61.82 ? 263  ARG A C   1 
ATOM   2076  O  O   . ARG A 1 260 ? 6.388   30.786  72.155  1.00 61.78 ? 263  ARG A O   1 
ATOM   2077  C  CB  . ARG A 1 260 ? 7.973   27.801  72.602  1.00 61.76 ? 263  ARG A CB  1 
ATOM   2078  C  CG  . ARG A 1 260 ? 6.734   27.467  73.403  1.00 60.98 ? 263  ARG A CG  1 
ATOM   2079  C  CD  . ARG A 1 260 ? 6.991   26.229  74.223  1.00 60.73 ? 263  ARG A CD  1 
ATOM   2080  N  NE  . ARG A 1 260 ? 7.471   25.154  73.364  1.00 60.56 ? 263  ARG A NE  1 
ATOM   2081  C  CZ  . ARG A 1 260 ? 6.684   24.249  72.795  1.00 60.61 ? 263  ARG A CZ  1 
ATOM   2082  N  NH1 . ARG A 1 260 ? 5.374   24.277  73.000  1.00 60.25 ? 263  ARG A NH1 1 
ATOM   2083  N  NH2 . ARG A 1 260 ? 7.203   23.349  71.977  1.00 60.57 ? 263  ARG A NH2 1 
ATOM   2084  N  N   . ASP A 1 261 ? 8.380   30.664  73.203  1.00 61.63 ? 264  ASP A N   1 
ATOM   2085  C  CA  . ASP A 1 261 ? 8.182   31.870  73.995  1.00 61.66 ? 264  ASP A CA  1 
ATOM   2086  C  C   . ASP A 1 261 ? 7.663   33.033  73.168  1.00 61.33 ? 264  ASP A C   1 
ATOM   2087  O  O   . ASP A 1 261 ? 6.657   33.648  73.505  1.00 61.23 ? 264  ASP A O   1 
ATOM   2088  C  CB  . ASP A 1 261 ? 9.490   32.289  74.660  1.00 62.12 ? 264  ASP A CB  1 
ATOM   2089  C  CG  . ASP A 1 261 ? 9.357   33.587  75.428  1.00 62.58 ? 264  ASP A CG  1 
ATOM   2090  O  OD1 . ASP A 1 261 ? 8.939   33.541  76.606  1.00 62.87 ? 264  ASP A OD1 1 
ATOM   2091  O  OD2 . ASP A 1 261 ? 9.654   34.654  74.850  1.00 63.27 ? 264  ASP A OD2 1 
ATOM   2092  N  N   . LEU A 1 262 ? 8.376   33.351  72.100  1.00 61.22 ? 265  LEU A N   1 
ATOM   2093  C  CA  . LEU A 1 262 ? 7.981   34.451  71.247  1.00 61.11 ? 265  LEU A CA  1 
ATOM   2094  C  C   . LEU A 1 262 ? 6.604   34.248  70.637  1.00 61.16 ? 265  LEU A C   1 
ATOM   2095  O  O   . LEU A 1 262 ? 5.780   35.166  70.612  1.00 61.37 ? 265  LEU A O   1 
ATOM   2096  C  CB  . LEU A 1 262 ? 9.005   34.643  70.138  1.00 61.24 ? 265  LEU A CB  1 
ATOM   2097  C  CG  . LEU A 1 262 ? 8.656   35.776  69.176  1.00 61.14 ? 265  LEU A CG  1 
ATOM   2098  C  CD1 . LEU A 1 262 ? 8.463   37.076  69.932  1.00 61.35 ? 265  LEU A CD1 1 
ATOM   2099  C  CD2 . LEU A 1 262 ? 9.749   35.918  68.162  1.00 61.29 ? 265  LEU A CD2 1 
ATOM   2100  N  N   . PHE A 1 263 ? 6.353   33.042  70.153  1.00 61.10 ? 266  PHE A N   1 
ATOM   2101  C  CA  . PHE A 1 263 ? 5.077   32.747  69.528  1.00 61.06 ? 266  PHE A CA  1 
ATOM   2102  C  C   . PHE A 1 263 ? 3.911   32.909  70.484  1.00 60.99 ? 266  PHE A C   1 
ATOM   2103  O  O   . PHE A 1 263 ? 2.956   33.632  70.198  1.00 61.19 ? 266  PHE A O   1 
ATOM   2104  C  CB  . PHE A 1 263 ? 5.078   31.334  68.952  1.00 61.06 ? 266  PHE A CB  1 
ATOM   2105  C  CG  . PHE A 1 263 ? 3.930   31.070  68.027  1.00 61.23 ? 266  PHE A CG  1 
ATOM   2106  C  CD1 . PHE A 1 263 ? 2.711   30.626  68.521  1.00 61.39 ? 266  PHE A CD1 1 
ATOM   2107  C  CD2 . PHE A 1 263 ? 4.051   31.322  66.667  1.00 61.39 ? 266  PHE A CD2 1 
ATOM   2108  C  CE1 . PHE A 1 263 ? 1.622   30.442  67.668  1.00 61.58 ? 266  PHE A CE1 1 
ATOM   2109  C  CE2 . PHE A 1 263 ? 2.970   31.141  65.807  1.00 61.56 ? 266  PHE A CE2 1 
ATOM   2110  C  CZ  . PHE A 1 263 ? 1.752   30.702  66.307  1.00 61.45 ? 266  PHE A CZ  1 
ATOM   2111  N  N   . ASN A 1 264 ? 3.991   32.238  71.624  1.00 60.66 ? 267  ASN A N   1 
ATOM   2112  C  CA  . ASN A 1 264 ? 2.923   32.310  72.602  1.00 60.34 ? 267  ASN A CA  1 
ATOM   2113  C  C   . ASN A 1 264 ? 2.648   33.720  73.096  1.00 60.02 ? 267  ASN A C   1 
ATOM   2114  O  O   . ASN A 1 264 ? 1.491   34.106  73.258  1.00 60.39 ? 267  ASN A O   1 
ATOM   2115  C  CB  . ASN A 1 264 ? 3.216   31.373  73.767  1.00 60.59 ? 267  ASN A CB  1 
ATOM   2116  C  CG  . ASN A 1 264 ? 3.088   29.914  73.378  1.00 60.89 ? 267  ASN A CG  1 
ATOM   2117  O  OD1 . ASN A 1 264 ? 2.271   29.559  72.524  1.00 61.23 ? 267  ASN A OD1 1 
ATOM   2118  N  ND2 . ASN A 1 264 ? 3.896   29.059  73.993  1.00 61.01 ? 267  ASN A ND2 1 
ATOM   2119  N  N   . ALA A 1 265 ? 3.705   34.501  73.297  1.00 59.66 ? 268  ALA A N   1 
ATOM   2120  C  CA  . ALA A 1 265 ? 3.559   35.877  73.768  1.00 59.05 ? 268  ALA A CA  1 
ATOM   2121  C  C   . ALA A 1 265 ? 2.712   36.676  72.801  1.00 58.74 ? 268  ALA A C   1 
ATOM   2122  O  O   . ALA A 1 265 ? 1.748   37.332  73.199  1.00 58.85 ? 268  ALA A O   1 
ATOM   2123  C  CB  . ALA A 1 265 ? 4.907   36.528  73.919  1.00 59.04 ? 268  ALA A CB  1 
ATOM   2124  N  N   . ILE A 1 266 ? 3.073   36.624  71.527  1.00 58.33 ? 269  ILE A N   1 
ATOM   2125  C  CA  . ILE A 1 266 ? 2.322   37.343  70.518  1.00 58.15 ? 269  ILE A CA  1 
ATOM   2126  C  C   . ILE A 1 266 ? 0.939   36.744  70.376  1.00 58.71 ? 269  ILE A C   1 
ATOM   2127  O  O   . ILE A 1 266 ? -0.042  37.465  70.205  1.00 58.87 ? 269  ILE A O   1 
ATOM   2128  C  CB  . ILE A 1 266 ? 3.026   37.295  69.175  1.00 57.54 ? 269  ILE A CB  1 
ATOM   2129  C  CG1 . ILE A 1 266 ? 4.333   38.070  69.274  1.00 56.96 ? 269  ILE A CG1 1 
ATOM   2130  C  CG2 . ILE A 1 266 ? 2.127   37.849  68.091  1.00 57.11 ? 269  ILE A CG2 1 
ATOM   2131  C  CD1 . ILE A 1 266 ? 5.029   38.254  67.965  1.00 57.03 ? 269  ILE A CD1 1 
ATOM   2132  N  N   . ALA A 1 267 ? 0.860   35.423  70.498  1.00 59.18 ? 270  ALA A N   1 
ATOM   2133  C  CA  . ALA A 1 267 ? -0.407  34.713  70.368  1.00 59.33 ? 270  ALA A CA  1 
ATOM   2134  C  C   . ALA A 1 267 ? -1.380  35.018  71.486  1.00 59.63 ? 270  ALA A C   1 
ATOM   2135  O  O   . ALA A 1 267 ? -2.579  34.832  71.313  1.00 60.14 ? 270  ALA A O   1 
ATOM   2136  C  CB  . ALA A 1 267 ? -0.169  33.227  70.284  1.00 59.20 ? 270  ALA A CB  1 
ATOM   2137  N  N   . THR A 1 268 ? -0.876  35.463  72.635  1.00 59.88 ? 271  THR A N   1 
ATOM   2138  C  CA  . THR A 1 268 ? -1.755  35.788  73.756  1.00 60.13 ? 271  THR A CA  1 
ATOM   2139  C  C   . THR A 1 268 ? -1.862  37.281  74.010  1.00 60.59 ? 271  THR A C   1 
ATOM   2140  O  O   . THR A 1 268 ? -2.216  37.705  75.110  1.00 60.69 ? 271  THR A O   1 
ATOM   2141  C  CB  . THR A 1 268 ? -1.326  35.105  75.057  1.00 59.80 ? 271  THR A CB  1 
ATOM   2142  O  OG1 . THR A 1 268 ? -0.034  35.577  75.442  1.00 59.92 ? 271  THR A OG1 1 
ATOM   2143  C  CG2 . THR A 1 268 ? -1.292  33.611  74.874  1.00 59.69 ? 271  THR A CG2 1 
ATOM   2144  N  N   . GLY A 1 269 ? -1.529  38.081  73.005  1.00 60.89 ? 272  GLY A N   1 
ATOM   2145  C  CA  . GLY A 1 269 ? -1.639  39.518  73.157  1.00 61.61 ? 272  GLY A CA  1 
ATOM   2146  C  C   . GLY A 1 269 ? -0.507  40.228  73.868  1.00 62.17 ? 272  GLY A C   1 
ATOM   2147  O  O   . GLY A 1 269 ? -0.472  41.461  73.887  1.00 62.57 ? 272  GLY A O   1 
ATOM   2148  N  N   . LYS A 1 270 ? 0.414   39.485  74.462  1.00 62.73 ? 273  LYS A N   1 
ATOM   2149  C  CA  . LYS A 1 270 ? 1.525   40.135  75.142  1.00 63.21 ? 273  LYS A CA  1 
ATOM   2150  C  C   . LYS A 1 270 ? 2.593   40.509  74.109  1.00 62.93 ? 273  LYS A C   1 
ATOM   2151  O  O   . LYS A 1 270 ? 3.672   39.919  74.072  1.00 63.09 ? 273  LYS A O   1 
ATOM   2152  C  CB  . LYS A 1 270 ? 2.100   39.215  76.215  1.00 64.50 ? 273  LYS A CB  1 
ATOM   2153  C  CG  . LYS A 1 270 ? 1.060   38.658  77.178  1.00 66.42 ? 273  LYS A CG  1 
ATOM   2154  C  CD  . LYS A 1 270 ? 1.725   37.870  78.309  1.00 68.25 ? 273  LYS A CD  1 
ATOM   2155  C  CE  . LYS A 1 270 ? 0.714   37.047  79.114  1.00 69.33 ? 273  LYS A CE  1 
ATOM   2156  N  NZ  . LYS A 1 270 ? 0.164   35.895  78.328  1.00 70.25 ? 273  LYS A NZ  1 
ATOM   2157  N  N   . TYR A 1 271 ? 2.279   41.481  73.257  1.00 62.38 ? 274  TYR A N   1 
ATOM   2158  C  CA  . TYR A 1 271 ? 3.208   41.911  72.217  1.00 61.61 ? 274  TYR A CA  1 
ATOM   2159  C  C   . TYR A 1 271 ? 4.418   42.600  72.823  1.00 60.87 ? 274  TYR A C   1 
ATOM   2160  O  O   . TYR A 1 271 ? 4.284   43.585  73.551  1.00 60.93 ? 274  TYR A O   1 
ATOM   2161  C  CB  . TYR A 1 271 ? 2.533   42.886  71.260  1.00 62.44 ? 274  TYR A CB  1 
ATOM   2162  C  CG  . TYR A 1 271 ? 1.189   42.448  70.744  1.00 63.35 ? 274  TYR A CG  1 
ATOM   2163  C  CD1 . TYR A 1 271 ? 0.137   43.357  70.652  1.00 63.90 ? 274  TYR A CD1 1 
ATOM   2164  C  CD2 . TYR A 1 271 ? 0.959   41.135  70.343  1.00 63.78 ? 274  TYR A CD2 1 
ATOM   2165  C  CE1 . TYR A 1 271 ? -1.111  42.974  70.173  1.00 64.27 ? 274  TYR A CE1 1 
ATOM   2166  C  CE2 . TYR A 1 271 ? -0.291  40.739  69.861  1.00 64.22 ? 274  TYR A CE2 1 
ATOM   2167  C  CZ  . TYR A 1 271 ? -1.319  41.669  69.781  1.00 64.41 ? 274  TYR A CZ  1 
ATOM   2168  O  OH  . TYR A 1 271 ? -2.561  41.312  69.315  1.00 64.90 ? 274  TYR A OH  1 
ATOM   2169  N  N   . PRO A 1 272 ? 5.621   42.101  72.515  1.00 59.90 ? 275  PRO A N   1 
ATOM   2170  C  CA  . PRO A 1 272 ? 6.860   42.676  73.035  1.00 59.21 ? 275  PRO A CA  1 
ATOM   2171  C  C   . PRO A 1 272 ? 7.174   43.956  72.282  1.00 58.77 ? 275  PRO A C   1 
ATOM   2172  O  O   . PRO A 1 272 ? 6.757   44.120  71.135  1.00 58.88 ? 275  PRO A O   1 
ATOM   2173  C  CB  . PRO A 1 272 ? 7.875   41.592  72.721  1.00 59.05 ? 275  PRO A CB  1 
ATOM   2174  C  CG  . PRO A 1 272 ? 7.393   41.083  71.423  1.00 59.11 ? 275  PRO A CG  1 
ATOM   2175  C  CD  . PRO A 1 272 ? 5.907   40.961  71.631  1.00 59.68 ? 275  PRO A CD  1 
ATOM   2176  N  N   . SER A 1 273 ? 7.893   44.871  72.925  1.00 58.11 ? 276  SER A N   1 
ATOM   2177  C  CA  . SER A 1 273 ? 8.236   46.118  72.272  1.00 57.65 ? 276  SER A CA  1 
ATOM   2178  C  C   . SER A 1 273 ? 9.559   46.621  72.781  1.00 57.32 ? 276  SER A C   1 
ATOM   2179  O  O   . SER A 1 273 ? 9.997   46.242  73.866  1.00 57.56 ? 276  SER A O   1 
ATOM   2180  C  CB  . SER A 1 273 ? 7.175   47.170  72.542  1.00 57.82 ? 276  SER A CB  1 
ATOM   2181  O  OG  . SER A 1 273 ? 7.213   47.556  73.905  1.00 58.43 ? 276  SER A OG  1 
ATOM   2182  N  N   . TRP A 1 274 ? 10.191  47.473  71.985  1.00 56.97 ? 277  TRP A N   1 
ATOM   2183  C  CA  . TRP A 1 274 ? 11.473  48.060  72.333  1.00 56.68 ? 277  TRP A CA  1 
ATOM   2184  C  C   . TRP A 1 274 ? 11.415  49.545  72.067  1.00 56.45 ? 277  TRP A C   1 
ATOM   2185  O  O   . TRP A 1 274 ? 10.719  49.996  71.153  1.00 56.27 ? 277  TRP A O   1 
ATOM   2186  C  CB  . TRP A 1 274 ? 12.584  47.466  71.472  1.00 56.92 ? 277  TRP A CB  1 
ATOM   2187  C  CG  . TRP A 1 274 ? 12.977  46.066  71.829  1.00 57.50 ? 277  TRP A CG  1 
ATOM   2188  C  CD1 . TRP A 1 274 ? 14.123  45.680  72.457  1.00 57.65 ? 277  TRP A CD1 1 
ATOM   2189  C  CD2 . TRP A 1 274 ? 12.227  44.865  71.592  1.00 57.78 ? 277  TRP A CD2 1 
ATOM   2190  N  NE1 . TRP A 1 274 ? 14.133  44.316  72.636  1.00 57.74 ? 277  TRP A NE1 1 
ATOM   2191  C  CE2 . TRP A 1 274 ? 12.980  43.791  72.115  1.00 57.69 ? 277  TRP A CE2 1 
ATOM   2192  C  CE3 . TRP A 1 274 ? 10.991  44.592  70.991  1.00 58.28 ? 277  TRP A CE3 1 
ATOM   2193  C  CZ2 . TRP A 1 274 ? 12.539  42.464  72.060  1.00 57.79 ? 277  TRP A CZ2 1 
ATOM   2194  C  CZ3 . TRP A 1 274 ? 10.551  43.267  70.938  1.00 58.39 ? 277  TRP A CZ3 1 
ATOM   2195  C  CH2 . TRP A 1 274 ? 11.327  42.223  71.471  1.00 57.88 ? 277  TRP A CH2 1 
ATOM   2196  N  N   . THR A 1 275 ? 12.138  50.306  72.876  1.00 56.70 ? 278  THR A N   1 
ATOM   2197  C  CA  . THR A 1 275 ? 12.196  51.748  72.704  1.00 57.05 ? 278  THR A CA  1 
ATOM   2198  C  C   . THR A 1 275 ? 13.411  52.016  71.820  1.00 57.33 ? 278  THR A C   1 
ATOM   2199  O  O   . THR A 1 275 ? 14.522  51.583  72.138  1.00 57.57 ? 278  THR A O   1 
ATOM   2200  C  CB  . THR A 1 275 ? 12.357  52.456  74.053  1.00 57.25 ? 278  THR A CB  1 
ATOM   2201  O  OG1 . THR A 1 275 ? 11.293  52.053  74.925  1.00 57.76 ? 278  THR A OG1 1 
ATOM   2202  C  CG2 . THR A 1 275 ? 12.294  53.965  73.873  1.00 57.42 ? 278  THR A CG2 1 
ATOM   2203  N  N   . PHE A 1 276 ? 13.197  52.715  70.707  1.00 57.24 ? 279  PHE A N   1 
ATOM   2204  C  CA  . PHE A 1 276 ? 14.261  53.003  69.750  1.00 57.21 ? 279  PHE A CA  1 
ATOM   2205  C  C   . PHE A 1 276 ? 14.982  54.309  70.041  1.00 57.83 ? 279  PHE A C   1 
ATOM   2206  O  O   . PHE A 1 276 ? 14.357  55.370  70.072  1.00 57.99 ? 279  PHE A O   1 
ATOM   2207  C  CB  . PHE A 1 276 ? 13.664  53.054  68.350  1.00 56.63 ? 279  PHE A CB  1 
ATOM   2208  C  CG  . PHE A 1 276 ? 14.654  52.807  67.262  1.00 55.96 ? 279  PHE A CG  1 
ATOM   2209  C  CD1 . PHE A 1 276 ? 14.987  51.517  66.895  1.00 55.76 ? 279  PHE A CD1 1 
ATOM   2210  C  CD2 . PHE A 1 276 ? 15.247  53.860  66.597  1.00 55.52 ? 279  PHE A CD2 1 
ATOM   2211  C  CE1 . PHE A 1 276 ? 15.901  51.280  65.880  1.00 55.48 ? 279  PHE A CE1 1 
ATOM   2212  C  CE2 . PHE A 1 276 ? 16.159  53.631  65.583  1.00 55.35 ? 279  PHE A CE2 1 
ATOM   2213  C  CZ  . PHE A 1 276 ? 16.487  52.339  65.224  1.00 55.35 ? 279  PHE A CZ  1 
ATOM   2214  N  N   . TYR A 1 277 ? 16.299  54.237  70.230  1.00 58.43 ? 280  TYR A N   1 
ATOM   2215  C  CA  . TYR A 1 277 ? 17.106  55.426  70.517  1.00 58.89 ? 280  TYR A CA  1 
ATOM   2216  C  C   . TYR A 1 277 ? 18.256  55.561  69.543  1.00 59.36 ? 280  TYR A C   1 
ATOM   2217  O  O   . TYR A 1 277 ? 18.537  54.647  68.764  1.00 59.24 ? 280  TYR A O   1 
ATOM   2218  C  CB  . TYR A 1 277 ? 17.774  55.332  71.888  1.00 59.02 ? 280  TYR A CB  1 
ATOM   2219  C  CG  . TYR A 1 277 ? 16.872  55.223  73.076  1.00 59.30 ? 280  TYR A CG  1 
ATOM   2220  C  CD1 . TYR A 1 277 ? 16.343  56.357  73.674  1.00 59.48 ? 280  TYR A CD1 1 
ATOM   2221  C  CD2 . TYR A 1 277 ? 16.594  53.986  73.641  1.00 59.29 ? 280  TYR A CD2 1 
ATOM   2222  C  CE1 . TYR A 1 277 ? 15.562  56.263  74.807  1.00 59.81 ? 280  TYR A CE1 1 
ATOM   2223  C  CE2 . TYR A 1 277 ? 15.816  53.877  74.771  1.00 59.74 ? 280  TYR A CE2 1 
ATOM   2224  C  CZ  . TYR A 1 277 ? 15.303  55.018  75.353  1.00 60.00 ? 280  TYR A CZ  1 
ATOM   2225  O  OH  . TYR A 1 277 ? 14.527  54.906  76.485  1.00 60.34 ? 280  TYR A OH  1 
ATOM   2226  N  N   . ILE A 1 278 ? 18.957  56.691  69.651  1.00 59.70 ? 281  ILE A N   1 
ATOM   2227  C  CA  . ILE A 1 278 ? 20.146  56.962  68.852  1.00 60.00 ? 281  ILE A CA  1 
ATOM   2228  C  C   . ILE A 1 278 ? 21.078  57.868  69.617  1.00 60.34 ? 281  ILE A C   1 
ATOM   2229  O  O   . ILE A 1 278 ? 20.650  58.699  70.411  1.00 60.53 ? 281  ILE A O   1 
ATOM   2230  C  CB  . ILE A 1 278 ? 19.878  57.684  67.514  1.00 59.82 ? 281  ILE A CB  1 
ATOM   2231  C  CG1 . ILE A 1 278 ? 19.287  59.068  67.760  1.00 59.62 ? 281  ILE A CG1 1 
ATOM   2232  C  CG2 . ILE A 1 278 ? 19.044  56.831  66.593  1.00 59.86 ? 281  ILE A CG2 1 
ATOM   2233  C  CD1 . ILE A 1 278 ? 19.281  59.944  66.521  1.00 59.48 ? 281  ILE A CD1 1 
ATOM   2234  N  N   . GLN A 1 279 ? 22.362  57.659  69.399  1.00 60.66 ? 282  GLN A N   1 
ATOM   2235  C  CA  . GLN A 1 279 ? 23.382  58.483  69.999  1.00 61.23 ? 282  GLN A CA  1 
ATOM   2236  C  C   . GLN A 1 279 ? 23.887  59.246  68.796  1.00 61.48 ? 282  GLN A C   1 
ATOM   2237  O  O   . GLN A 1 279 ? 23.878  58.714  67.684  1.00 61.95 ? 282  GLN A O   1 
ATOM   2238  C  CB  . GLN A 1 279 ? 24.513  57.624  70.530  1.00 61.46 ? 282  GLN A CB  1 
ATOM   2239  C  CG  . GLN A 1 279 ? 24.191  56.871  71.781  1.00 62.08 ? 282  GLN A CG  1 
ATOM   2240  C  CD  . GLN A 1 279 ? 25.333  55.971  72.183  1.00 62.68 ? 282  GLN A CD  1 
ATOM   2241  O  OE1 . GLN A 1 279 ? 25.696  55.057  71.445  1.00 62.95 ? 282  GLN A OE1 1 
ATOM   2242  N  NE2 . GLN A 1 279 ? 25.924  56.234  73.344  1.00 62.72 ? 282  GLN A NE2 1 
ATOM   2243  N  N   . VAL A 1 280 ? 24.317  60.485  68.996  1.00 61.55 ? 283  VAL A N   1 
ATOM   2244  C  CA  . VAL A 1 280 ? 24.829  61.270  67.884  1.00 61.30 ? 283  VAL A CA  1 
ATOM   2245  C  C   . VAL A 1 280 ? 26.213  61.820  68.182  1.00 61.85 ? 283  VAL A C   1 
ATOM   2246  O  O   . VAL A 1 280 ? 26.535  62.177  69.319  1.00 61.84 ? 283  VAL A O   1 
ATOM   2247  C  CB  . VAL A 1 280 ? 23.883  62.426  67.514  1.00 60.94 ? 283  VAL A CB  1 
ATOM   2248  C  CG1 . VAL A 1 280 ? 24.484  63.264  66.412  1.00 60.56 ? 283  VAL A CG1 1 
ATOM   2249  C  CG2 . VAL A 1 280 ? 22.553  61.884  67.052  1.00 60.37 ? 283  VAL A CG2 1 
ATOM   2250  N  N   . MET A 1 281 ? 27.034  61.856  67.141  1.00 62.13 ? 284  MET A N   1 
ATOM   2251  C  CA  . MET A 1 281 ? 28.393  62.356  67.222  1.00 62.44 ? 284  MET A CA  1 
ATOM   2252  C  C   . MET A 1 281 ? 28.619  63.181  65.967  1.00 62.77 ? 284  MET A C   1 
ATOM   2253  O  O   . MET A 1 281 ? 28.323  62.730  64.858  1.00 62.97 ? 284  MET A O   1 
ATOM   2254  C  CB  . MET A 1 281 ? 29.374  61.187  67.256  1.00 62.46 ? 284  MET A CB  1 
ATOM   2255  C  CG  . MET A 1 281 ? 30.827  61.587  67.202  1.00 62.43 ? 284  MET A CG  1 
ATOM   2256  S  SD  . MET A 1 281 ? 31.877  60.133  67.092  1.00 63.07 ? 284  MET A SD  1 
ATOM   2257  C  CE  . MET A 1 281 ? 31.822  59.573  68.778  1.00 62.31 ? 284  MET A CE  1 
ATOM   2258  N  N   . THR A 1 282 ? 29.089  64.408  66.141  1.00 63.08 ? 285  THR A N   1 
ATOM   2259  C  CA  . THR A 1 282 ? 29.336  65.273  65.000  1.00 63.38 ? 285  THR A CA  1 
ATOM   2260  C  C   . THR A 1 282 ? 30.713  64.973  64.455  1.00 63.76 ? 285  THR A C   1 
ATOM   2261  O  O   . THR A 1 282 ? 31.569  64.436  65.165  1.00 63.82 ? 285  THR A O   1 
ATOM   2262  C  CB  . THR A 1 282 ? 29.306  66.736  65.401  1.00 63.34 ? 285  THR A CB  1 
ATOM   2263  O  OG1 . THR A 1 282 ? 30.404  66.998  66.282  1.00 63.31 ? 285  THR A OG1 1 
ATOM   2264  C  CG2 . THR A 1 282 ? 27.992  67.064  66.095  1.00 62.92 ? 285  THR A CG2 1 
ATOM   2265  N  N   . PHE A 1 283 ? 30.929  65.342  63.200  1.00 64.11 ? 286  PHE A N   1 
ATOM   2266  C  CA  . PHE A 1 283 ? 32.209  65.119  62.559  1.00 64.66 ? 286  PHE A CA  1 
ATOM   2267  C  C   . PHE A 1 283 ? 33.353  65.679  63.402  1.00 65.55 ? 286  PHE A C   1 
ATOM   2268  O  O   . PHE A 1 283 ? 34.433  65.095  63.445  1.00 65.97 ? 286  PHE A O   1 
ATOM   2269  C  CB  . PHE A 1 283 ? 32.204  65.722  61.156  1.00 64.10 ? 286  PHE A CB  1 
ATOM   2270  C  CG  . PHE A 1 283 ? 31.506  64.867  60.128  1.00 63.66 ? 286  PHE A CG  1 
ATOM   2271  C  CD1 . PHE A 1 283 ? 30.431  64.064  60.475  1.00 63.39 ? 286  PHE A CD1 1 
ATOM   2272  C  CD2 . PHE A 1 283 ? 31.954  64.844  58.811  1.00 63.57 ? 286  PHE A CD2 1 
ATOM   2273  C  CE1 . PHE A 1 283 ? 29.812  63.247  59.523  1.00 63.20 ? 286  PHE A CE1 1 
ATOM   2274  C  CE2 . PHE A 1 283 ? 31.339  64.029  57.854  1.00 63.29 ? 286  PHE A CE2 1 
ATOM   2275  C  CZ  . PHE A 1 283 ? 30.269  63.231  58.214  1.00 63.11 ? 286  PHE A CZ  1 
ATOM   2276  N  N   . ASN A 1 284 ? 33.100  66.780  64.110  1.00 66.42 ? 287  ASN A N   1 
ATOM   2277  C  CA  . ASN A 1 284 ? 34.119  67.381  64.971  1.00 67.26 ? 287  ASN A CA  1 
ATOM   2278  C  C   . ASN A 1 284 ? 34.369  66.475  66.157  1.00 67.48 ? 287  ASN A C   1 
ATOM   2279  O  O   . ASN A 1 284 ? 35.490  66.384  66.648  1.00 67.67 ? 287  ASN A O   1 
ATOM   2280  C  CB  . ASN A 1 284 ? 33.691  68.753  65.499  1.00 67.91 ? 287  ASN A CB  1 
ATOM   2281  C  CG  . ASN A 1 284 ? 33.678  69.816  64.427  1.00 68.75 ? 287  ASN A CG  1 
ATOM   2282  O  OD1 . ASN A 1 284 ? 34.378  69.713  63.413  1.00 69.40 ? 287  ASN A OD1 1 
ATOM   2283  N  ND2 . ASN A 1 284 ? 32.876  70.851  64.641  1.00 69.08 ? 287  ASN A ND2 1 
ATOM   2284  N  N   . GLN A 1 285 ? 33.308  65.841  66.643  1.00 67.63 ? 288  GLN A N   1 
ATOM   2285  C  CA  . GLN A 1 285 ? 33.434  64.941  67.775  1.00 67.83 ? 288  GLN A CA  1 
ATOM   2286  C  C   . GLN A 1 285 ? 34.159  63.691  67.344  1.00 68.21 ? 288  GLN A C   1 
ATOM   2287  O  O   . GLN A 1 285 ? 34.962  63.145  68.099  1.00 68.21 ? 288  GLN A O   1 
ATOM   2288  C  CB  . GLN A 1 285 ? 32.069  64.589  68.325  1.00 67.50 ? 288  GLN A CB  1 
ATOM   2289  C  CG  . GLN A 1 285 ? 31.384  65.762  68.958  1.00 67.42 ? 288  GLN A CG  1 
ATOM   2290  C  CD  . GLN A 1 285 ? 30.040  65.391  69.506  1.00 67.56 ? 288  GLN A CD  1 
ATOM   2291  O  OE1 . GLN A 1 285 ? 29.151  64.989  68.758  1.00 67.74 ? 288  GLN A OE1 1 
ATOM   2292  N  NE2 . GLN A 1 285 ? 29.884  65.492  70.820  1.00 67.29 ? 288  GLN A NE2 1 
ATOM   2293  N  N   . ALA A 1 286 ? 33.901  63.267  66.110  1.00 68.84 ? 289  ALA A N   1 
ATOM   2294  C  CA  . ALA A 1 286 ? 34.540  62.081  65.549  1.00 69.47 ? 289  ALA A CA  1 
ATOM   2295  C  C   . ALA A 1 286 ? 36.054  62.251  65.569  1.00 69.89 ? 289  ALA A C   1 
ATOM   2296  O  O   . ALA A 1 286 ? 36.802  61.274  65.550  1.00 70.18 ? 289  ALA A O   1 
ATOM   2297  C  CB  . ALA A 1 286 ? 34.063  61.849  64.125  1.00 69.41 ? 289  ALA A CB  1 
ATOM   2298  N  N   . GLU A 1 287 ? 36.492  63.503  65.621  1.00 70.21 ? 290  GLU A N   1 
ATOM   2299  C  CA  . GLU A 1 287 ? 37.908  63.828  65.638  1.00 70.26 ? 290  GLU A CA  1 
ATOM   2300  C  C   . GLU A 1 287 ? 38.497  63.904  67.042  1.00 69.91 ? 290  GLU A C   1 
ATOM   2301  O  O   . GLU A 1 287 ? 39.704  63.749  67.209  1.00 70.25 ? 290  GLU A O   1 
ATOM   2302  C  CB  . GLU A 1 287 ? 38.143  65.145  64.899  1.00 70.99 ? 290  GLU A CB  1 
ATOM   2303  C  CG  . GLU A 1 287 ? 37.761  65.096  63.422  1.00 72.05 ? 290  GLU A CG  1 
ATOM   2304  C  CD  . GLU A 1 287 ? 38.637  64.144  62.626  1.00 73.01 ? 290  GLU A CD  1 
ATOM   2305  O  OE1 . GLU A 1 287 ? 39.862  64.115  62.889  1.00 73.38 ? 290  GLU A OE1 1 
ATOM   2306  O  OE2 . GLU A 1 287 ? 38.104  63.431  61.739  1.00 73.21 ? 290  GLU A OE2 1 
ATOM   2307  N  N   . THR A 1 288 ? 37.657  64.150  68.047  1.00 69.14 ? 291  THR A N   1 
ATOM   2308  C  CA  . THR A 1 288 ? 38.132  64.245  69.429  1.00 68.23 ? 291  THR A CA  1 
ATOM   2309  C  C   . THR A 1 288 ? 37.920  62.948  70.192  1.00 67.51 ? 291  THR A C   1 
ATOM   2310  O  O   . THR A 1 288 ? 38.281  62.846  71.367  1.00 67.53 ? 291  THR A O   1 
ATOM   2311  C  CB  . THR A 1 288 ? 37.410  65.353  70.213  1.00 68.40 ? 291  THR A CB  1 
ATOM   2312  O  OG1 . THR A 1 288 ? 36.081  64.926  70.536  1.00 68.72 ? 291  THR A OG1 1 
ATOM   2313  C  CG2 . THR A 1 288 ? 37.338  66.624  69.385  1.00 68.45 ? 291  THR A CG2 1 
ATOM   2314  N  N   . PHE A 1 289 ? 37.307  61.968  69.537  1.00 66.54 ? 292  PHE A N   1 
ATOM   2315  C  CA  . PHE A 1 289 ? 37.045  60.691  70.176  1.00 65.37 ? 292  PHE A CA  1 
ATOM   2316  C  C   . PHE A 1 289 ? 38.351  59.975  70.487  1.00 64.85 ? 292  PHE A C   1 
ATOM   2317  O  O   . PHE A 1 289 ? 39.175  59.747  69.598  1.00 64.50 ? 292  PHE A O   1 
ATOM   2318  C  CB  . PHE A 1 289 ? 36.159  59.820  69.297  1.00 64.80 ? 292  PHE A CB  1 
ATOM   2319  C  CG  . PHE A 1 289 ? 35.521  58.693  70.038  1.00 64.53 ? 292  PHE A CG  1 
ATOM   2320  C  CD1 . PHE A 1 289 ? 35.827  57.378  69.728  1.00 64.27 ? 292  PHE A CD1 1 
ATOM   2321  C  CD2 . PHE A 1 289 ? 34.636  58.948  71.079  1.00 64.30 ? 292  PHE A CD2 1 
ATOM   2322  C  CE1 . PHE A 1 289 ? 35.264  56.330  70.447  1.00 64.28 ? 292  PHE A CE1 1 
ATOM   2323  C  CE2 . PHE A 1 289 ? 34.067  57.907  71.803  1.00 64.18 ? 292  PHE A CE2 1 
ATOM   2324  C  CZ  . PHE A 1 289 ? 34.382  56.596  71.488  1.00 64.19 ? 292  PHE A CZ  1 
ATOM   2325  N  N   . PRO A 1 290 ? 38.543  59.592  71.757  1.00 64.53 ? 293  PRO A N   1 
ATOM   2326  C  CA  . PRO A 1 290 ? 39.727  58.896  72.269  1.00 64.39 ? 293  PRO A CA  1 
ATOM   2327  C  C   . PRO A 1 290 ? 40.147  57.691  71.438  1.00 64.33 ? 293  PRO A C   1 
ATOM   2328  O  O   . PRO A 1 290 ? 41.320  57.317  71.426  1.00 64.59 ? 293  PRO A O   1 
ATOM   2329  C  CB  . PRO A 1 290 ? 39.290  58.467  73.666  1.00 64.28 ? 293  PRO A CB  1 
ATOM   2330  C  CG  . PRO A 1 290 ? 38.370  59.555  74.072  1.00 64.25 ? 293  PRO A CG  1 
ATOM   2331  C  CD  . PRO A 1 290 ? 37.542  59.754  72.827  1.00 64.45 ? 293  PRO A CD  1 
ATOM   2332  N  N   . PHE A 1 291 ? 39.187  57.057  70.777  1.00 63.98 ? 294  PHE A N   1 
ATOM   2333  C  CA  . PHE A 1 291 ? 39.494  55.892  69.957  1.00 63.53 ? 294  PHE A CA  1 
ATOM   2334  C  C   . PHE A 1 291 ? 38.960  56.116  68.550  1.00 63.44 ? 294  PHE A C   1 
ATOM   2335  O  O   . PHE A 1 291 ? 38.586  57.227  68.195  1.00 63.92 ? 294  PHE A O   1 
ATOM   2336  C  CB  . PHE A 1 291 ? 38.845  54.647  70.557  1.00 63.32 ? 294  PHE A CB  1 
ATOM   2337  C  CG  . PHE A 1 291 ? 39.078  54.480  72.036  1.00 62.86 ? 294  PHE A CG  1 
ATOM   2338  C  CD1 . PHE A 1 291 ? 40.288  53.984  72.516  1.00 62.75 ? 294  PHE A CD1 1 
ATOM   2339  C  CD2 . PHE A 1 291 ? 38.069  54.776  72.946  1.00 62.79 ? 294  PHE A CD2 1 
ATOM   2340  C  CE1 . PHE A 1 291 ? 40.487  53.779  73.891  1.00 62.39 ? 294  PHE A CE1 1 
ATOM   2341  C  CE2 . PHE A 1 291 ? 38.255  54.576  74.313  1.00 62.47 ? 294  PHE A CE2 1 
ATOM   2342  C  CZ  . PHE A 1 291 ? 39.467  54.074  74.786  1.00 62.27 ? 294  PHE A CZ  1 
ATOM   2343  N  N   . ASN A 1 292 ? 38.974  55.075  67.730  1.00 63.02 ? 295  ASN A N   1 
ATOM   2344  C  CA  . ASN A 1 292 ? 38.442  55.189  66.381  1.00 62.43 ? 295  ASN A CA  1 
ATOM   2345  C  C   . ASN A 1 292 ? 36.942  54.996  66.536  1.00 61.91 ? 295  ASN A C   1 
ATOM   2346  O  O   . ASN A 1 292 ? 36.480  53.895  66.833  1.00 62.10 ? 295  ASN A O   1 
ATOM   2347  C  CB  . ASN A 1 292 ? 39.018  54.092  65.481  1.00 62.62 ? 295  ASN A CB  1 
ATOM   2348  C  CG  . ASN A 1 292 ? 38.393  54.083  64.103  1.00 62.66 ? 295  ASN A CG  1 
ATOM   2349  O  OD1 . ASN A 1 292 ? 37.783  55.068  63.680  1.00 63.17 ? 295  ASN A OD1 1 
ATOM   2350  N  ND2 . ASN A 1 292 ? 38.533  52.964  63.396  1.00 62.17 ? 295  ASN A ND2 1 
ATOM   2351  N  N   . PRO A 1 293 ? 36.160  56.061  66.324  1.00 61.29 ? 296  PRO A N   1 
ATOM   2352  C  CA  . PRO A 1 293 ? 34.698  55.991  66.450  1.00 60.99 ? 296  PRO A CA  1 
ATOM   2353  C  C   . PRO A 1 293 ? 34.059  54.928  65.551  1.00 60.91 ? 296  PRO A C   1 
ATOM   2354  O  O   . PRO A 1 293 ? 32.930  54.495  65.781  1.00 60.87 ? 296  PRO A O   1 
ATOM   2355  C  CB  . PRO A 1 293 ? 34.259  57.405  66.065  1.00 60.75 ? 296  PRO A CB  1 
ATOM   2356  C  CG  . PRO A 1 293 ? 35.328  57.840  65.119  1.00 60.64 ? 296  PRO A CG  1 
ATOM   2357  C  CD  . PRO A 1 293 ? 36.580  57.363  65.787  1.00 60.81 ? 296  PRO A CD  1 
ATOM   2358  N  N   . PHE A 1 294 ? 34.807  54.484  64.553  1.00 60.82 ? 297  PHE A N   1 
ATOM   2359  C  CA  . PHE A 1 294 ? 34.324  53.485  63.621  1.00 60.59 ? 297  PHE A CA  1 
ATOM   2360  C  C   . PHE A 1 294 ? 34.784  52.093  64.016  1.00 60.53 ? 297  PHE A C   1 
ATOM   2361  O  O   . PHE A 1 294 ? 34.528  51.131  63.298  1.00 60.83 ? 297  PHE A O   1 
ATOM   2362  C  CB  . PHE A 1 294 ? 34.815  53.831  62.224  1.00 60.54 ? 297  PHE A CB  1 
ATOM   2363  C  CG  . PHE A 1 294 ? 34.692  55.289  61.899  1.00 60.84 ? 297  PHE A CG  1 
ATOM   2364  C  CD1 . PHE A 1 294 ? 33.456  55.924  61.959  1.00 60.99 ? 297  PHE A CD1 1 
ATOM   2365  C  CD2 . PHE A 1 294 ? 35.813  56.039  61.558  1.00 61.11 ? 297  PHE A CD2 1 
ATOM   2366  C  CE1 . PHE A 1 294 ? 33.336  57.285  61.684  1.00 60.80 ? 297  PHE A CE1 1 
ATOM   2367  C  CE2 . PHE A 1 294 ? 35.705  57.405  61.281  1.00 61.08 ? 297  PHE A CE2 1 
ATOM   2368  C  CZ  . PHE A 1 294 ? 34.464  58.026  61.345  1.00 60.92 ? 297  PHE A CZ  1 
ATOM   2369  N  N   . ASP A 1 295 ? 35.455  51.989  65.161  1.00 60.25 ? 298  ASP A N   1 
ATOM   2370  C  CA  . ASP A 1 295 ? 35.942  50.703  65.659  1.00 60.00 ? 298  ASP A CA  1 
ATOM   2371  C  C   . ASP A 1 295 ? 34.790  49.923  66.283  1.00 59.87 ? 298  ASP A C   1 
ATOM   2372  O  O   . ASP A 1 295 ? 34.272  50.294  67.341  1.00 60.39 ? 298  ASP A O   1 
ATOM   2373  C  CB  . ASP A 1 295 ? 37.060  50.913  66.692  1.00 60.07 ? 298  ASP A CB  1 
ATOM   2374  C  CG  . ASP A 1 295 ? 37.611  49.600  67.266  1.00 60.04 ? 298  ASP A CG  1 
ATOM   2375  O  OD1 . ASP A 1 295 ? 38.661  49.647  67.940  1.00 59.97 ? 298  ASP A OD1 1 
ATOM   2376  O  OD2 . ASP A 1 295 ? 37.018  48.520  67.066  1.00 60.16 ? 298  ASP A OD2 1 
ATOM   2377  N  N   . LEU A 1 296 ? 34.465  48.787  65.678  1.00 59.30 ? 299  LEU A N   1 
ATOM   2378  C  CA  . LEU A 1 296 ? 33.373  47.954  66.161  1.00 58.53 ? 299  LEU A CA  1 
ATOM   2379  C  C   . LEU A 1 296 ? 33.560  47.375  67.567  1.00 58.28 ? 299  LEU A C   1 
ATOM   2380  O  O   . LEU A 1 296 ? 32.617  46.835  68.151  1.00 58.12 ? 299  LEU A O   1 
ATOM   2381  C  CB  . LEU A 1 296 ? 33.084  46.838  65.163  1.00 58.11 ? 299  LEU A CB  1 
ATOM   2382  C  CG  . LEU A 1 296 ? 31.750  46.129  65.385  1.00 57.52 ? 299  LEU A CG  1 
ATOM   2383  C  CD1 . LEU A 1 296 ? 30.624  47.150  65.416  1.00 57.16 ? 299  LEU A CD1 1 
ATOM   2384  C  CD2 . LEU A 1 296 ? 31.521  45.106  64.291  1.00 57.43 ? 299  LEU A CD2 1 
ATOM   2385  N  N   . THR A 1 297 ? 34.762  47.479  68.118  1.00 57.84 ? 300  THR A N   1 
ATOM   2386  C  CA  . THR A 1 297 ? 34.989  46.963  69.459  1.00 57.57 ? 300  THR A CA  1 
ATOM   2387  C  C   . THR A 1 297 ? 34.835  48.080  70.470  1.00 57.36 ? 300  THR A C   1 
ATOM   2388  O  O   . THR A 1 297 ? 35.125  47.899  71.650  1.00 57.54 ? 300  THR A O   1 
ATOM   2389  C  CB  . THR A 1 297 ? 36.392  46.352  69.633  1.00 57.83 ? 300  THR A CB  1 
ATOM   2390  O  OG1 . THR A 1 297 ? 37.386  47.354  69.396  1.00 58.33 ? 300  THR A OG1 1 
ATOM   2391  C  CG2 . THR A 1 297 ? 36.597  45.189  68.675  1.00 57.59 ? 300  THR A CG2 1 
ATOM   2392  N  N   . LYS A 1 298 ? 34.366  49.235  70.018  1.00 57.04 ? 301  LYS A N   1 
ATOM   2393  C  CA  . LYS A 1 298 ? 34.196  50.365  70.914  1.00 56.85 ? 301  LYS A CA  1 
ATOM   2394  C  C   . LYS A 1 298 ? 32.766  50.855  71.020  1.00 57.47 ? 301  LYS A C   1 
ATOM   2395  O  O   . LYS A 1 298 ? 32.002  50.768  70.057  1.00 57.38 ? 301  LYS A O   1 
ATOM   2396  C  CB  . LYS A 1 298 ? 35.079  51.513  70.457  1.00 56.08 ? 301  LYS A CB  1 
ATOM   2397  C  CG  . LYS A 1 298 ? 36.544  51.171  70.452  1.00 55.50 ? 301  LYS A CG  1 
ATOM   2398  C  CD  . LYS A 1 298 ? 37.016  50.725  71.825  1.00 55.14 ? 301  LYS A CD  1 
ATOM   2399  C  CE  . LYS A 1 298 ? 38.512  50.459  71.817  1.00 55.16 ? 301  LYS A CE  1 
ATOM   2400  N  NZ  . LYS A 1 298 ? 38.896  49.452  70.781  1.00 55.33 ? 301  LYS A NZ  1 
ATOM   2401  N  N   . VAL A 1 299 ? 32.416  51.368  72.199  1.00 58.23 ? 302  VAL A N   1 
ATOM   2402  C  CA  . VAL A 1 299 ? 31.087  51.921  72.453  1.00 59.19 ? 302  VAL A CA  1 
ATOM   2403  C  C   . VAL A 1 299 ? 31.258  53.411  72.695  1.00 60.17 ? 302  VAL A C   1 
ATOM   2404  O  O   . VAL A 1 299 ? 32.378  53.885  72.874  1.00 60.51 ? 302  VAL A O   1 
ATOM   2405  C  CB  . VAL A 1 299 ? 30.438  51.344  73.730  1.00 59.05 ? 302  VAL A CB  1 
ATOM   2406  C  CG1 . VAL A 1 299 ? 30.264  49.852  73.610  1.00 59.17 ? 302  VAL A CG1 1 
ATOM   2407  C  CG2 . VAL A 1 299 ? 31.274  51.687  74.950  1.00 58.64 ? 302  VAL A CG2 1 
ATOM   2408  N  N   . TRP A 1 300 ? 30.153  54.149  72.679  1.00 61.13 ? 303  TRP A N   1 
ATOM   2409  C  CA  . TRP A 1 300 ? 30.187  55.580  72.944  1.00 61.94 ? 303  TRP A CA  1 
ATOM   2410  C  C   . TRP A 1 300 ? 29.601  55.716  74.339  1.00 62.80 ? 303  TRP A C   1 
ATOM   2411  O  O   . TRP A 1 300 ? 28.444  55.344  74.568  1.00 62.98 ? 303  TRP A O   1 
ATOM   2412  C  CB  . TRP A 1 300 ? 29.313  56.345  71.956  1.00 61.59 ? 303  TRP A CB  1 
ATOM   2413  C  CG  . TRP A 1 300 ? 29.804  56.346  70.544  1.00 61.42 ? 303  TRP A CG  1 
ATOM   2414  C  CD1 . TRP A 1 300 ? 30.962  55.805  70.073  1.00 61.51 ? 303  TRP A CD1 1 
ATOM   2415  C  CD2 . TRP A 1 300 ? 29.138  56.913  69.410  1.00 61.39 ? 303  TRP A CD2 1 
ATOM   2416  N  NE1 . TRP A 1 300 ? 31.059  55.996  68.712  1.00 61.37 ? 303  TRP A NE1 1 
ATOM   2417  C  CE2 . TRP A 1 300 ? 29.952  56.674  68.280  1.00 61.24 ? 303  TRP A CE2 1 
ATOM   2418  C  CE3 . TRP A 1 300 ? 27.927  57.601  69.239  1.00 61.29 ? 303  TRP A CE3 1 
ATOM   2419  C  CZ2 . TRP A 1 300 ? 29.596  57.095  66.999  1.00 61.17 ? 303  TRP A CZ2 1 
ATOM   2420  C  CZ3 . TRP A 1 300 ? 27.572  58.021  67.963  1.00 61.06 ? 303  TRP A CZ3 1 
ATOM   2421  C  CH2 . TRP A 1 300 ? 28.405  57.765  66.859  1.00 61.15 ? 303  TRP A CH2 1 
ATOM   2422  N  N   . PRO A 1 301 ? 30.403  56.209  75.300  1.00 63.47 ? 304  PRO A N   1 
ATOM   2423  C  CA  . PRO A 1 301 ? 29.950  56.384  76.681  1.00 64.10 ? 304  PRO A CA  1 
ATOM   2424  C  C   . PRO A 1 301 ? 28.676  57.201  76.708  1.00 64.97 ? 304  PRO A C   1 
ATOM   2425  O  O   . PRO A 1 301 ? 28.591  58.258  76.080  1.00 64.91 ? 304  PRO A O   1 
ATOM   2426  C  CB  . PRO A 1 301 ? 31.101  57.150  77.319  1.00 63.78 ? 304  PRO A CB  1 
ATOM   2427  C  CG  . PRO A 1 301 ? 32.280  56.668  76.559  1.00 63.59 ? 304  PRO A CG  1 
ATOM   2428  C  CD  . PRO A 1 301 ? 31.781  56.698  75.142  1.00 63.50 ? 304  PRO A CD  1 
ATOM   2429  N  N   . HIS A 1 302 ? 27.677  56.677  77.407  1.00 66.06 ? 305  HIS A N   1 
ATOM   2430  C  CA  . HIS A 1 302 ? 26.392  57.341  77.524  1.00 67.26 ? 305  HIS A CA  1 
ATOM   2431  C  C   . HIS A 1 302 ? 26.534  58.755  78.046  1.00 67.96 ? 305  HIS A C   1 
ATOM   2432  O  O   . HIS A 1 302 ? 25.892  59.676  77.540  1.00 68.29 ? 305  HIS A O   1 
ATOM   2433  C  CB  . HIS A 1 302 ? 25.475  56.544  78.442  1.00 67.35 ? 305  HIS A CB  1 
ATOM   2434  C  CG  . HIS A 1 302 ? 24.945  55.293  77.818  1.00 68.00 ? 305  HIS A CG  1 
ATOM   2435  N  ND1 . HIS A 1 302 ? 25.132  54.046  78.375  1.00 68.26 ? 305  HIS A ND1 1 
ATOM   2436  C  CD2 . HIS A 1 302 ? 24.223  55.100  76.689  1.00 68.25 ? 305  HIS A CD2 1 
ATOM   2437  C  CE1 . HIS A 1 302 ? 24.543  53.137  77.615  1.00 68.41 ? 305  HIS A CE1 1 
ATOM   2438  N  NE2 . HIS A 1 302 ? 23.985  53.750  76.586  1.00 68.38 ? 305  HIS A NE2 1 
ATOM   2439  N  N   . LYS A 1 303 ? 27.402  58.929  79.036  1.00 68.64 ? 306  LYS A N   1 
ATOM   2440  C  CA  . LYS A 1 303 ? 27.625  60.234  79.633  1.00 69.31 ? 306  LYS A CA  1 
ATOM   2441  C  C   . LYS A 1 303 ? 28.012  61.261  78.582  1.00 69.06 ? 306  LYS A C   1 
ATOM   2442  O  O   . LYS A 1 303 ? 27.458  62.357  78.543  1.00 69.10 ? 306  LYS A O   1 
ATOM   2443  C  CB  . LYS A 1 303 ? 28.707  60.149  80.718  1.00 70.54 ? 306  LYS A CB  1 
ATOM   2444  C  CG  . LYS A 1 303 ? 29.001  61.474  81.413  1.00 72.32 ? 306  LYS A CG  1 
ATOM   2445  C  CD  . LYS A 1 303 ? 27.718  62.093  81.974  1.00 73.78 ? 306  LYS A CD  1 
ATOM   2446  C  CE  . LYS A 1 303 ? 27.867  63.600  82.195  1.00 74.55 ? 306  LYS A CE  1 
ATOM   2447  N  NZ  . LYS A 1 303 ? 26.542  64.279  82.341  1.00 75.06 ? 306  LYS A NZ  1 
ATOM   2448  N  N   . ASP A 1 304 ? 28.918  60.870  77.693  1.00 68.96 ? 307  ASP A N   1 
ATOM   2449  C  CA  . ASP A 1 304 ? 29.406  61.759  76.646  1.00 68.55 ? 307  ASP A CA  1 
ATOM   2450  C  C   . ASP A 1 304 ? 28.477  61.860  75.444  1.00 67.89 ? 307  ASP A C   1 
ATOM   2451  O  O   . ASP A 1 304 ? 28.376  62.913  74.816  1.00 67.83 ? 307  ASP A O   1 
ATOM   2452  C  CB  . ASP A 1 304 ? 30.804  61.313  76.226  1.00 69.25 ? 307  ASP A CB  1 
ATOM   2453  C  CG  . ASP A 1 304 ? 31.724  61.125  77.418  1.00 69.88 ? 307  ASP A CG  1 
ATOM   2454  O  OD1 . ASP A 1 304 ? 32.359  60.056  77.539  1.00 70.42 ? 307  ASP A OD1 1 
ATOM   2455  O  OD2 . ASP A 1 304 ? 31.778  62.040  78.267  1.00 70.50 ? 307  ASP A OD2 1 
ATOM   2456  N  N   . TYR A 1 305 ? 27.798  60.763  75.132  1.00 66.74 ? 308  TYR A N   1 
ATOM   2457  C  CA  . TYR A 1 305 ? 26.868  60.720  74.012  1.00 65.52 ? 308  TYR A CA  1 
ATOM   2458  C  C   . TYR A 1 305 ? 25.574  60.100  74.523  1.00 65.03 ? 308  TYR A C   1 
ATOM   2459  O  O   . TYR A 1 305 ? 25.378  58.885  74.478  1.00 65.24 ? 308  TYR A O   1 
ATOM   2460  C  CB  . TYR A 1 305 ? 27.470  59.898  72.874  1.00 64.86 ? 308  TYR A CB  1 
ATOM   2461  C  CG  . TYR A 1 305 ? 28.817  60.419  72.441  1.00 64.13 ? 308  TYR A CG  1 
ATOM   2462  C  CD1 . TYR A 1 305 ? 28.917  61.460  71.522  1.00 63.92 ? 308  TYR A CD1 1 
ATOM   2463  C  CD2 . TYR A 1 305 ? 29.992  59.919  72.996  1.00 63.74 ? 308  TYR A CD2 1 
ATOM   2464  C  CE1 . TYR A 1 305 ? 30.156  61.999  71.174  1.00 63.62 ? 308  TYR A CE1 1 
ATOM   2465  C  CE2 . TYR A 1 305 ? 31.236  60.452  72.652  1.00 63.56 ? 308  TYR A CE2 1 
ATOM   2466  C  CZ  . TYR A 1 305 ? 31.307  61.490  71.742  1.00 63.47 ? 308  TYR A CZ  1 
ATOM   2467  O  OH  . TYR A 1 305 ? 32.524  62.034  71.408  1.00 63.51 ? 308  TYR A OH  1 
ATOM   2468  N  N   . PRO A 1 306 ? 24.678  60.941  75.039  1.00 64.56 ? 309  PRO A N   1 
ATOM   2469  C  CA  . PRO A 1 306 ? 23.382  60.544  75.591  1.00 64.36 ? 309  PRO A CA  1 
ATOM   2470  C  C   . PRO A 1 306 ? 22.467  59.862  74.580  1.00 64.23 ? 309  PRO A C   1 
ATOM   2471  O  O   . PRO A 1 306 ? 22.589  60.075  73.371  1.00 64.52 ? 309  PRO A O   1 
ATOM   2472  C  CB  . PRO A 1 306 ? 22.790  61.879  76.047  1.00 64.54 ? 309  PRO A CB  1 
ATOM   2473  C  CG  . PRO A 1 306 ? 24.002  62.756  76.248  1.00 64.20 ? 309  PRO A CG  1 
ATOM   2474  C  CD  . PRO A 1 306 ? 24.828  62.403  75.070  1.00 64.42 ? 309  PRO A CD  1 
ATOM   2475  N  N   . LEU A 1 307 ? 21.567  59.022  75.082  1.00 63.73 ? 310  LEU A N   1 
ATOM   2476  C  CA  . LEU A 1 307 ? 20.611  58.328  74.233  1.00 63.20 ? 310  LEU A CA  1 
ATOM   2477  C  C   . LEU A 1 307 ? 19.520  59.319  73.872  1.00 62.90 ? 310  LEU A C   1 
ATOM   2478  O  O   . LEU A 1 307 ? 19.048  60.066  74.729  1.00 63.10 ? 310  LEU A O   1 
ATOM   2479  C  CB  . LEU A 1 307 ? 19.984  57.142  74.966  1.00 63.00 ? 310  LEU A CB  1 
ATOM   2480  C  CG  . LEU A 1 307 ? 20.862  55.932  75.293  1.00 62.93 ? 310  LEU A CG  1 
ATOM   2481  C  CD1 . LEU A 1 307 ? 19.991  54.828  75.849  1.00 62.74 ? 310  LEU A CD1 1 
ATOM   2482  C  CD2 . LEU A 1 307 ? 21.575  55.439  74.055  1.00 62.82 ? 310  LEU A CD2 1 
ATOM   2483  N  N   . ILE A 1 308 ? 19.145  59.342  72.597  1.00 62.44 ? 311  ILE A N   1 
ATOM   2484  C  CA  . ILE A 1 308 ? 18.107  60.237  72.106  1.00 61.62 ? 311  ILE A CA  1 
ATOM   2485  C  C   . ILE A 1 308 ? 16.946  59.368  71.641  1.00 61.74 ? 311  ILE A C   1 
ATOM   2486  O  O   . ILE A 1 308 ? 17.099  58.530  70.747  1.00 62.20 ? 311  ILE A O   1 
ATOM   2487  C  CB  . ILE A 1 308 ? 18.628  61.086  70.944  1.00 60.95 ? 311  ILE A CB  1 
ATOM   2488  C  CG1 . ILE A 1 308 ? 19.920  61.781  71.365  1.00 60.36 ? 311  ILE A CG1 1 
ATOM   2489  C  CG2 . ILE A 1 308 ? 17.602  62.124  70.547  1.00 60.52 ? 311  ILE A CG2 1 
ATOM   2490  C  CD1 . ILE A 1 308 ? 20.602  62.515  70.258  1.00 59.88 ? 311  ILE A CD1 1 
ATOM   2491  N  N   . PRO A 1 309 ? 15.774  59.528  72.274  1.00 61.34 ? 312  PRO A N   1 
ATOM   2492  C  CA  . PRO A 1 309 ? 14.562  58.772  71.957  1.00 61.04 ? 312  PRO A CA  1 
ATOM   2493  C  C   . PRO A 1 309 ? 14.064  59.075  70.567  1.00 60.85 ? 312  PRO A C   1 
ATOM   2494  O  O   . PRO A 1 309 ? 14.015  60.231  70.160  1.00 60.60 ? 312  PRO A O   1 
ATOM   2495  C  CB  . PRO A 1 309 ? 13.577  59.277  73.002  1.00 61.03 ? 312  PRO A CB  1 
ATOM   2496  C  CG  . PRO A 1 309 ? 13.991  60.699  73.167  1.00 61.25 ? 312  PRO A CG  1 
ATOM   2497  C  CD  . PRO A 1 309 ? 15.485  60.563  73.280  1.00 61.40 ? 312  PRO A CD  1 
ATOM   2498  N  N   . VAL A 1 310 ? 13.676  58.031  69.848  1.00 61.09 ? 313  VAL A N   1 
ATOM   2499  C  CA  . VAL A 1 310 ? 13.170  58.189  68.493  1.00 61.35 ? 313  VAL A CA  1 
ATOM   2500  C  C   . VAL A 1 310 ? 11.780  57.561  68.294  1.00 61.79 ? 313  VAL A C   1 
ATOM   2501  O  O   . VAL A 1 310 ? 10.831  58.251  67.901  1.00 61.64 ? 313  VAL A O   1 
ATOM   2502  C  CB  . VAL A 1 310 ? 14.160  57.600  67.468  1.00 61.10 ? 313  VAL A CB  1 
ATOM   2503  C  CG1 . VAL A 1 310 ? 13.629  57.783  66.065  1.00 61.02 ? 313  VAL A CG1 1 
ATOM   2504  C  CG2 . VAL A 1 310 ? 15.511  58.265  67.606  1.00 60.37 ? 313  VAL A CG2 1 
ATOM   2505  N  N   . GLY A 1 311 ? 11.652  56.265  68.581  1.00 62.20 ? 314  GLY A N   1 
ATOM   2506  C  CA  . GLY A 1 311 ? 10.369  55.605  68.401  1.00 62.52 ? 314  GLY A CA  1 
ATOM   2507  C  C   . GLY A 1 311 ? 10.215  54.295  69.144  1.00 62.65 ? 314  GLY A C   1 
ATOM   2508  O  O   . GLY A 1 311 ? 10.909  54.051  70.128  1.00 62.80 ? 314  GLY A O   1 
ATOM   2509  N  N   . LYS A 1 312 ? 9.310   53.447  68.664  1.00 62.86 ? 315  LYS A N   1 
ATOM   2510  C  CA  . LYS A 1 312 ? 9.044   52.156  69.295  1.00 63.05 ? 315  LYS A CA  1 
ATOM   2511  C  C   . LYS A 1 312 ? 8.998   51.021  68.296  1.00 62.59 ? 315  LYS A C   1 
ATOM   2512  O  O   . LYS A 1 312 ? 8.519   51.185  67.172  1.00 62.62 ? 315  LYS A O   1 
ATOM   2513  C  CB  . LYS A 1 312 ? 7.689   52.182  70.004  1.00 64.20 ? 315  LYS A CB  1 
ATOM   2514  C  CG  . LYS A 1 312 ? 7.650   52.934  71.319  1.00 66.15 ? 315  LYS A CG  1 
ATOM   2515  C  CD  . LYS A 1 312 ? 7.880   51.992  72.498  1.00 67.37 ? 315  LYS A CD  1 
ATOM   2516  C  CE  . LYS A 1 312 ? 7.713   52.725  73.825  1.00 68.00 ? 315  LYS A CE  1 
ATOM   2517  N  NZ  . LYS A 1 312 ? 7.818   51.776  74.964  1.00 68.53 ? 315  LYS A NZ  1 
ATOM   2518  N  N   . LEU A 1 313 ? 9.487   49.864  68.720  1.00 61.91 ? 316  LEU A N   1 
ATOM   2519  C  CA  . LEU A 1 313 ? 9.457   48.670  67.891  1.00 61.33 ? 316  LEU A CA  1 
ATOM   2520  C  C   . LEU A 1 313 ? 8.436   47.776  68.568  1.00 61.48 ? 316  LEU A C   1 
ATOM   2521  O  O   . LEU A 1 313 ? 8.552   47.500  69.765  1.00 61.61 ? 316  LEU A O   1 
ATOM   2522  C  CB  . LEU A 1 313 ? 10.818  47.982  67.872  1.00 60.71 ? 316  LEU A CB  1 
ATOM   2523  C  CG  . LEU A 1 313 ? 11.885  48.650  67.012  1.00 60.07 ? 316  LEU A CG  1 
ATOM   2524  C  CD1 . LEU A 1 313 ? 13.187  47.883  67.111  1.00 59.45 ? 316  LEU A CD1 1 
ATOM   2525  C  CD2 . LEU A 1 313 ? 11.416  48.705  65.576  1.00 59.93 ? 316  LEU A CD2 1 
ATOM   2526  N  N   . VAL A 1 314 ? 7.425   47.350  67.819  1.00 61.22 ? 317  VAL A N   1 
ATOM   2527  C  CA  . VAL A 1 314 ? 6.370   46.504  68.369  1.00 60.96 ? 317  VAL A CA  1 
ATOM   2528  C  C   . VAL A 1 314 ? 6.157   45.285  67.497  1.00 60.73 ? 317  VAL A C   1 
ATOM   2529  O  O   . VAL A 1 314 ? 6.160   45.393  66.272  1.00 60.97 ? 317  VAL A O   1 
ATOM   2530  C  CB  . VAL A 1 314 ? 5.033   47.274  68.432  1.00 60.95 ? 317  VAL A CB  1 
ATOM   2531  C  CG1 . VAL A 1 314 ? 3.948   46.397  69.016  1.00 60.57 ? 317  VAL A CG1 1 
ATOM   2532  C  CG2 . VAL A 1 314 ? 5.191   48.550  69.250  1.00 60.97 ? 317  VAL A CG2 1 
ATOM   2533  N  N   . LEU A 1 315 ? 5.943   44.136  68.128  1.00 60.87 ? 318  LEU A N   1 
ATOM   2534  C  CA  . LEU A 1 315 ? 5.710   42.891  67.404  1.00 61.17 ? 318  LEU A CA  1 
ATOM   2535  C  C   . LEU A 1 315 ? 4.379   42.295  67.825  1.00 61.57 ? 318  LEU A C   1 
ATOM   2536  O  O   . LEU A 1 315 ? 4.198   41.879  68.972  1.00 61.46 ? 318  LEU A O   1 
ATOM   2537  C  CB  . LEU A 1 315 ? 6.844   41.908  67.666  1.00 61.19 ? 318  LEU A CB  1 
ATOM   2538  C  CG  . LEU A 1 315 ? 8.214   42.421  67.223  1.00 61.07 ? 318  LEU A CG  1 
ATOM   2539  C  CD1 . LEU A 1 315 ? 9.295   41.478  67.687  1.00 61.38 ? 318  LEU A CD1 1 
ATOM   2540  C  CD2 . LEU A 1 315 ? 8.246   42.553  65.719  1.00 61.21 ? 318  LEU A CD2 1 
ATOM   2541  N  N   . ASN A 1 316 ? 3.461   42.217  66.869  1.00 62.00 ? 319  ASN A N   1 
ATOM   2542  C  CA  . ASN A 1 316 ? 2.124   41.716  67.136  1.00 62.47 ? 319  ASN A CA  1 
ATOM   2543  C  C   . ASN A 1 316 ? 1.630   40.684  66.140  1.00 62.88 ? 319  ASN A C   1 
ATOM   2544  O  O   . ASN A 1 316 ? 0.449   40.339  66.156  1.00 62.99 ? 319  ASN A O   1 
ATOM   2545  C  CB  . ASN A 1 316 ? 1.151   42.887  67.132  1.00 62.78 ? 319  ASN A CB  1 
ATOM   2546  C  CG  . ASN A 1 316 ? 1.180   43.659  65.824  1.00 63.25 ? 319  ASN A CG  1 
ATOM   2547  O  OD1 . ASN A 1 316 ? 1.661   43.161  64.800  1.00 63.42 ? 319  ASN A OD1 1 
ATOM   2548  N  ND2 . ASN A 1 316 ? 0.672   44.887  65.851  1.00 63.54 ? 319  ASN A ND2 1 
ATOM   2549  N  N   . ARG A 1 317 ? 2.504   40.213  65.255  1.00 63.24 ? 320  ARG A N   1 
ATOM   2550  C  CA  . ARG A 1 317 ? 2.087   39.226  64.264  1.00 63.48 ? 320  ARG A CA  1 
ATOM   2551  C  C   . ARG A 1 317 ? 3.055   38.065  64.050  1.00 63.42 ? 320  ARG A C   1 
ATOM   2552  O  O   . ARG A 1 317 ? 4.197   38.260  63.623  1.00 63.46 ? 320  ARG A O   1 
ATOM   2553  C  CB  . ARG A 1 317 ? 1.792   39.898  62.921  1.00 64.10 ? 320  ARG A CB  1 
ATOM   2554  C  CG  . ARG A 1 317 ? 1.083   38.968  61.949  1.00 65.30 ? 320  ARG A CG  1 
ATOM   2555  C  CD  . ARG A 1 317 ? 0.675   39.654  60.660  1.00 65.78 ? 320  ARG A CD  1 
ATOM   2556  N  NE  . ARG A 1 317 ? 1.748   39.654  59.677  1.00 66.64 ? 320  ARG A NE  1 
ATOM   2557  C  CZ  . ARG A 1 317 ? 2.427   40.736  59.320  1.00 67.10 ? 320  ARG A CZ  1 
ATOM   2558  N  NH1 . ARG A 1 317 ? 2.144   41.909  59.873  1.00 67.05 ? 320  ARG A NH1 1 
ATOM   2559  N  NH2 . ARG A 1 317 ? 3.386   40.647  58.405  1.00 67.51 ? 320  ARG A NH2 1 
ATOM   2560  N  N   . ASN A 1 318 ? 2.572   36.856  64.334  1.00 63.05 ? 321  ASN A N   1 
ATOM   2561  C  CA  . ASN A 1 318 ? 3.344   35.625  64.173  1.00 62.59 ? 321  ASN A CA  1 
ATOM   2562  C  C   . ASN A 1 318 ? 3.374   35.218  62.716  1.00 62.23 ? 321  ASN A C   1 
ATOM   2563  O  O   . ASN A 1 318 ? 2.535   35.642  61.927  1.00 62.63 ? 321  ASN A O   1 
ATOM   2564  C  CB  . ASN A 1 318 ? 2.699   34.488  64.969  1.00 62.65 ? 321  ASN A CB  1 
ATOM   2565  C  CG  . ASN A 1 318 ? 3.042   34.541  66.431  1.00 62.66 ? 321  ASN A CG  1 
ATOM   2566  O  OD1 . ASN A 1 318 ? 4.162   34.889  66.801  1.00 62.79 ? 321  ASN A OD1 1 
ATOM   2567  N  ND2 . ASN A 1 318 ? 2.084   34.186  67.279  1.00 62.75 ? 321  ASN A ND2 1 
ATOM   2568  N  N   . PRO A 1 319 ? 4.346   34.383  62.333  1.00 61.83 ? 322  PRO A N   1 
ATOM   2569  C  CA  . PRO A 1 319 ? 4.445   33.930  60.944  1.00 61.56 ? 322  PRO A CA  1 
ATOM   2570  C  C   . PRO A 1 319 ? 3.293   32.981  60.698  1.00 61.22 ? 322  PRO A C   1 
ATOM   2571  O  O   . PRO A 1 319 ? 2.802   32.358  61.632  1.00 61.44 ? 322  PRO A O   1 
ATOM   2572  C  CB  . PRO A 1 319 ? 5.753   33.149  60.931  1.00 61.35 ? 322  PRO A CB  1 
ATOM   2573  C  CG  . PRO A 1 319 ? 6.519   33.721  62.090  1.00 61.79 ? 322  PRO A CG  1 
ATOM   2574  C  CD  . PRO A 1 319 ? 5.468   33.871  63.131  1.00 61.83 ? 322  PRO A CD  1 
ATOM   2575  N  N   . VAL A 1 320 ? 2.819   32.904  59.468  1.00 61.00 ? 323  VAL A N   1 
ATOM   2576  C  CA  . VAL A 1 320 ? 1.744   31.983  59.169  1.00 60.78 ? 323  VAL A CA  1 
ATOM   2577  C  C   . VAL A 1 320 ? 2.431   30.715  58.683  1.00 61.33 ? 323  VAL A C   1 
ATOM   2578  O  O   . VAL A 1 320 ? 2.005   29.606  59.003  1.00 61.75 ? 323  VAL A O   1 
ATOM   2579  C  CB  . VAL A 1 320 ? 0.815   32.540  58.107  1.00 60.52 ? 323  VAL A CB  1 
ATOM   2580  C  CG1 . VAL A 1 320 ? -0.291  31.553  57.810  1.00 60.18 ? 323  VAL A CG1 1 
ATOM   2581  C  CG2 . VAL A 1 320 ? 0.235   33.848  58.587  1.00 60.15 ? 323  VAL A CG2 1 
ATOM   2582  N  N   . ASN A 1 321 ? 3.507   30.889  57.916  1.00 61.19 ? 324  ASN A N   1 
ATOM   2583  C  CA  . ASN A 1 321 ? 4.295   29.764  57.417  1.00 60.83 ? 324  ASN A CA  1 
ATOM   2584  C  C   . ASN A 1 321 ? 5.753   30.098  57.689  1.00 60.65 ? 324  ASN A C   1 
ATOM   2585  O  O   . ASN A 1 321 ? 6.335   30.949  57.013  1.00 61.10 ? 324  ASN A O   1 
ATOM   2586  C  CB  . ASN A 1 321 ? 4.090   29.554  55.919  1.00 61.09 ? 324  ASN A CB  1 
ATOM   2587  C  CG  . ASN A 1 321 ? 4.920   28.400  55.383  1.00 61.24 ? 324  ASN A CG  1 
ATOM   2588  O  OD1 . ASN A 1 321 ? 6.084   28.567  55.029  1.00 61.61 ? 324  ASN A OD1 1 
ATOM   2589  N  ND2 . ASN A 1 321 ? 4.329   27.218  55.346  1.00 61.51 ? 324  ASN A ND2 1 
ATOM   2590  N  N   . TYR A 1 322 ? 6.350   29.418  58.661  1.00 59.90 ? 325  TYR A N   1 
ATOM   2591  C  CA  . TYR A 1 322 ? 7.735   29.686  59.033  1.00 59.14 ? 325  TYR A CA  1 
ATOM   2592  C  C   . TYR A 1 322 ? 8.713   29.752  57.875  1.00 59.22 ? 325  TYR A C   1 
ATOM   2593  O  O   . TYR A 1 322 ? 9.423   30.736  57.706  1.00 59.34 ? 325  TYR A O   1 
ATOM   2594  C  CB  . TYR A 1 322 ? 8.213   28.653  60.036  1.00 58.00 ? 325  TYR A CB  1 
ATOM   2595  C  CG  . TYR A 1 322 ? 9.599   28.915  60.549  1.00 56.72 ? 325  TYR A CG  1 
ATOM   2596  C  CD1 . TYR A 1 322 ? 9.794   29.552  61.763  1.00 56.28 ? 325  TYR A CD1 1 
ATOM   2597  C  CD2 . TYR A 1 322 ? 10.715  28.498  59.837  1.00 56.24 ? 325  TYR A CD2 1 
ATOM   2598  C  CE1 . TYR A 1 322 ? 11.067  29.761  62.266  1.00 56.03 ? 325  TYR A CE1 1 
ATOM   2599  C  CE2 . TYR A 1 322 ? 11.990  28.703  60.324  1.00 55.88 ? 325  TYR A CE2 1 
ATOM   2600  C  CZ  . TYR A 1 322 ? 12.161  29.335  61.542  1.00 55.91 ? 325  TYR A CZ  1 
ATOM   2601  O  OH  . TYR A 1 322 ? 13.424  29.532  62.053  1.00 55.86 ? 325  TYR A OH  1 
ATOM   2602  N  N   . PHE A 1 323 ? 8.773   28.681  57.100  1.00 59.30 ? 326  PHE A N   1 
ATOM   2603  C  CA  . PHE A 1 323 ? 9.677   28.616  55.970  1.00 59.47 ? 326  PHE A CA  1 
ATOM   2604  C  C   . PHE A 1 323 ? 9.562   29.820  55.055  1.00 59.57 ? 326  PHE A C   1 
ATOM   2605  O  O   . PHE A 1 323 ? 10.529  30.528  54.831  1.00 59.83 ? 326  PHE A O   1 
ATOM   2606  C  CB  . PHE A 1 323 ? 9.410   27.358  55.161  1.00 59.79 ? 326  PHE A CB  1 
ATOM   2607  C  CG  . PHE A 1 323 ? 10.358  27.172  54.022  1.00 60.12 ? 326  PHE A CG  1 
ATOM   2608  C  CD1 . PHE A 1 323 ? 10.029  27.614  52.745  1.00 60.42 ? 326  PHE A CD1 1 
ATOM   2609  C  CD2 . PHE A 1 323 ? 11.593  26.565  54.226  1.00 60.31 ? 326  PHE A CD2 1 
ATOM   2610  C  CE1 . PHE A 1 323 ? 10.921  27.454  51.682  1.00 60.44 ? 326  PHE A CE1 1 
ATOM   2611  C  CE2 . PHE A 1 323 ? 12.490  26.399  53.176  1.00 60.26 ? 326  PHE A CE2 1 
ATOM   2612  C  CZ  . PHE A 1 323 ? 12.155  26.845  51.900  1.00 60.37 ? 326  PHE A CZ  1 
ATOM   2613  N  N   . ALA A 1 324 ? 8.373   30.052  54.524  1.00 59.59 ? 327  ALA A N   1 
ATOM   2614  C  CA  . ALA A 1 324 ? 8.160   31.161  53.613  1.00 59.86 ? 327  ALA A CA  1 
ATOM   2615  C  C   . ALA A 1 324 ? 8.328   32.543  54.226  1.00 60.32 ? 327  ALA A C   1 
ATOM   2616  O  O   . ALA A 1 324 ? 8.655   33.496  53.520  1.00 60.62 ? 327  ALA A O   1 
ATOM   2617  C  CB  . ALA A 1 324 ? 6.795   31.050  52.988  1.00 59.66 ? 327  ALA A CB  1 
ATOM   2618  N  N   . GLU A 1 325 ? 8.094   32.669  55.526  1.00 60.53 ? 328  GLU A N   1 
ATOM   2619  C  CA  . GLU A 1 325 ? 8.199   33.970  56.163  1.00 60.64 ? 328  GLU A CA  1 
ATOM   2620  C  C   . GLU A 1 325 ? 9.434   34.188  57.003  1.00 60.46 ? 328  GLU A C   1 
ATOM   2621  O  O   . GLU A 1 325 ? 9.912   35.317  57.120  1.00 60.74 ? 328  GLU A O   1 
ATOM   2622  C  CB  . GLU A 1 325 ? 6.957   34.247  57.001  1.00 61.44 ? 328  GLU A CB  1 
ATOM   2623  C  CG  . GLU A 1 325 ? 5.702   34.421  56.172  1.00 62.38 ? 328  GLU A CG  1 
ATOM   2624  C  CD  . GLU A 1 325 ? 4.479   34.664  57.022  1.00 63.11 ? 328  GLU A CD  1 
ATOM   2625  O  OE1 . GLU A 1 325 ? 4.342   35.783  57.573  1.00 63.33 ? 328  GLU A OE1 1 
ATOM   2626  O  OE2 . GLU A 1 325 ? 3.657   33.732  57.138  1.00 63.27 ? 328  GLU A OE2 1 
ATOM   2627  N  N   . VAL A 1 326 ? 9.962   33.120  57.588  1.00 59.85 ? 329  VAL A N   1 
ATOM   2628  C  CA  . VAL A 1 326 ? 11.134  33.255  58.438  1.00 59.12 ? 329  VAL A CA  1 
ATOM   2629  C  C   . VAL A 1 326 ? 12.416  32.705  57.845  1.00 59.08 ? 329  VAL A C   1 
ATOM   2630  O  O   . VAL A 1 326 ? 13.431  33.398  57.800  1.00 59.30 ? 329  VAL A O   1 
ATOM   2631  C  CB  . VAL A 1 326 ? 10.902  32.610  59.805  1.00 58.74 ? 329  VAL A CB  1 
ATOM   2632  C  CG1 . VAL A 1 326 ? 12.054  32.926  60.733  1.00 58.17 ? 329  VAL A CG1 1 
ATOM   2633  C  CG2 . VAL A 1 326 ? 9.602   33.105  60.396  1.00 58.33 ? 329  VAL A CG2 1 
ATOM   2634  N  N   . GLU A 1 327 ? 12.387  31.454  57.414  1.00 58.86 ? 330  GLU A N   1 
ATOM   2635  C  CA  . GLU A 1 327 ? 13.579  30.840  56.846  1.00 58.61 ? 330  GLU A CA  1 
ATOM   2636  C  C   . GLU A 1 327 ? 14.064  31.568  55.598  1.00 58.38 ? 330  GLU A C   1 
ATOM   2637  O  O   . GLU A 1 327 ? 15.268  31.757  55.405  1.00 58.47 ? 330  GLU A O   1 
ATOM   2638  C  CB  . GLU A 1 327 ? 13.311  29.376  56.513  1.00 58.64 ? 330  GLU A CB  1 
ATOM   2639  C  CG  . GLU A 1 327 ? 14.566  28.594  56.178  1.00 58.99 ? 330  GLU A CG  1 
ATOM   2640  C  CD  . GLU A 1 327 ? 15.575  28.563  57.324  1.00 59.64 ? 330  GLU A CD  1 
ATOM   2641  O  OE1 . GLU A 1 327 ? 16.789  28.434  57.046  1.00 60.07 ? 330  GLU A OE1 1 
ATOM   2642  O  OE2 . GLU A 1 327 ? 15.163  28.656  58.504  1.00 59.97 ? 330  GLU A OE2 1 
ATOM   2643  N  N   . GLN A 1 328 ? 13.120  31.993  54.765  1.00 57.85 ? 331  GLN A N   1 
ATOM   2644  C  CA  . GLN A 1 328 ? 13.444  32.683  53.530  1.00 57.06 ? 331  GLN A CA  1 
ATOM   2645  C  C   . GLN A 1 328 ? 13.723  34.162  53.656  1.00 56.90 ? 331  GLN A C   1 
ATOM   2646  O  O   . GLN A 1 328 ? 14.255  34.748  52.721  1.00 56.94 ? 331  GLN A O   1 
ATOM   2647  C  CB  . GLN A 1 328 ? 12.342  32.488  52.494  1.00 57.09 ? 331  GLN A CB  1 
ATOM   2648  C  CG  . GLN A 1 328 ? 12.221  31.067  51.985  1.00 56.90 ? 331  GLN A CG  1 
ATOM   2649  C  CD  . GLN A 1 328 ? 11.493  30.980  50.656  1.00 56.79 ? 331  GLN A CD  1 
ATOM   2650  O  OE1 . GLN A 1 328 ? 12.002  30.402  49.694  1.00 57.23 ? 331  GLN A OE1 1 
ATOM   2651  N  NE2 . GLN A 1 328 ? 10.299  31.554  50.593  1.00 56.73 ? 331  GLN A NE2 1 
ATOM   2652  N  N   . ILE A 1 329 ? 13.380  34.783  54.782  1.00 56.84 ? 332  ILE A N   1 
ATOM   2653  C  CA  . ILE A 1 329 ? 13.619  36.223  54.917  1.00 56.71 ? 332  ILE A CA  1 
ATOM   2654  C  C   . ILE A 1 329 ? 15.097  36.578  54.741  1.00 57.08 ? 332  ILE A C   1 
ATOM   2655  O  O   . ILE A 1 329 ? 15.979  35.745  54.986  1.00 57.22 ? 332  ILE A O   1 
ATOM   2656  C  CB  . ILE A 1 329 ? 13.058  36.807  56.237  1.00 56.27 ? 332  ILE A CB  1 
ATOM   2657  C  CG1 . ILE A 1 329 ? 13.048  38.333  56.148  1.00 55.73 ? 332  ILE A CG1 1 
ATOM   2658  C  CG2 . ILE A 1 329 ? 13.887  36.355  57.431  1.00 55.71 ? 332  ILE A CG2 1 
ATOM   2659  C  CD1 . ILE A 1 329 ? 12.281  38.994  57.237  1.00 55.62 ? 332  ILE A CD1 1 
ATOM   2660  N  N   . ALA A 1 330 ? 15.365  37.801  54.287  1.00 57.12 ? 333  ALA A N   1 
ATOM   2661  C  CA  . ALA A 1 330 ? 16.741  38.230  54.048  1.00 57.12 ? 333  ALA A CA  1 
ATOM   2662  C  C   . ALA A 1 330 ? 16.952  39.686  54.371  1.00 57.32 ? 333  ALA A C   1 
ATOM   2663  O  O   . ALA A 1 330 ? 16.214  40.548  53.896  1.00 57.77 ? 333  ALA A O   1 
ATOM   2664  C  CB  . ALA A 1 330 ? 17.120  37.981  52.603  1.00 57.02 ? 333  ALA A CB  1 
ATOM   2665  N  N   . PHE A 1 331 ? 17.988  39.957  55.153  1.00 57.47 ? 334  PHE A N   1 
ATOM   2666  C  CA  . PHE A 1 331 ? 18.309  41.316  55.535  1.00 57.65 ? 334  PHE A CA  1 
ATOM   2667  C  C   . PHE A 1 331 ? 19.646  41.708  54.908  1.00 57.73 ? 334  PHE A C   1 
ATOM   2668  O  O   . PHE A 1 331 ? 20.617  40.950  54.968  1.00 57.58 ? 334  PHE A O   1 
ATOM   2669  C  CB  . PHE A 1 331 ? 18.403  41.421  57.059  1.00 57.83 ? 334  PHE A CB  1 
ATOM   2670  C  CG  . PHE A 1 331 ? 17.185  40.921  57.787  1.00 57.97 ? 334  PHE A CG  1 
ATOM   2671  C  CD1 . PHE A 1 331 ? 16.118  41.776  58.060  1.00 57.99 ? 334  PHE A CD1 1 
ATOM   2672  C  CD2 . PHE A 1 331 ? 17.113  39.604  58.225  1.00 58.16 ? 334  PHE A CD2 1 
ATOM   2673  C  CE1 . PHE A 1 331 ? 14.997  41.324  58.762  1.00 57.66 ? 334  PHE A CE1 1 
ATOM   2674  C  CE2 . PHE A 1 331 ? 15.995  39.142  58.929  1.00 58.07 ? 334  PHE A CE2 1 
ATOM   2675  C  CZ  . PHE A 1 331 ? 14.937  40.006  59.196  1.00 57.79 ? 334  PHE A CZ  1 
ATOM   2676  N  N   . ASP A 1 332 ? 19.691  42.884  54.293  1.00 57.70 ? 335  ASP A N   1 
ATOM   2677  C  CA  . ASP A 1 332 ? 20.917  43.374  53.686  1.00 57.78 ? 335  ASP A CA  1 
ATOM   2678  C  C   . ASP A 1 332 ? 21.258  44.724  54.310  1.00 58.04 ? 335  ASP A C   1 
ATOM   2679  O  O   . ASP A 1 332 ? 20.521  45.690  54.121  1.00 58.47 ? 335  ASP A O   1 
ATOM   2680  C  CB  . ASP A 1 332 ? 20.732  43.553  52.178  1.00 57.34 ? 335  ASP A CB  1 
ATOM   2681  C  CG  . ASP A 1 332 ? 20.440  42.255  51.471  1.00 57.13 ? 335  ASP A CG  1 
ATOM   2682  O  OD1 . ASP A 1 332 ? 19.471  42.213  50.691  1.00 57.03 ? 335  ASP A OD1 1 
ATOM   2683  O  OD2 . ASP A 1 332 ? 21.185  41.280  51.685  1.00 57.06 ? 335  ASP A OD2 1 
ATOM   2684  N  N   . PRO A 1 333 ? 22.372  44.807  55.069  1.00 57.86 ? 336  PRO A N   1 
ATOM   2685  C  CA  . PRO A 1 333 ? 22.789  46.057  55.709  1.00 57.77 ? 336  PRO A CA  1 
ATOM   2686  C  C   . PRO A 1 333 ? 22.903  47.164  54.675  1.00 57.91 ? 336  PRO A C   1 
ATOM   2687  O  O   . PRO A 1 333 ? 22.673  48.332  54.970  1.00 57.76 ? 336  PRO A O   1 
ATOM   2688  C  CB  . PRO A 1 333 ? 24.155  45.697  56.281  1.00 57.61 ? 336  PRO A CB  1 
ATOM   2689  C  CG  . PRO A 1 333 ? 23.995  44.261  56.629  1.00 57.19 ? 336  PRO A CG  1 
ATOM   2690  C  CD  . PRO A 1 333 ? 23.314  43.727  55.400  1.00 57.66 ? 336  PRO A CD  1 
ATOM   2691  N  N   . SER A 1 334 ? 23.239  46.780  53.451  1.00 58.35 ? 337  SER A N   1 
ATOM   2692  C  CA  . SER A 1 334 ? 23.370  47.731  52.366  1.00 59.10 ? 337  SER A CA  1 
ATOM   2693  C  C   . SER A 1 334 ? 22.031  48.348  51.995  1.00 59.80 ? 337  SER A C   1 
ATOM   2694  O  O   . SER A 1 334 ? 21.989  49.321  51.244  1.00 60.42 ? 337  SER A O   1 
ATOM   2695  C  CB  . SER A 1 334 ? 23.991  47.064  51.145  1.00 58.73 ? 337  SER A CB  1 
ATOM   2696  O  OG  . SER A 1 334 ? 23.291  45.884  50.818  1.00 58.56 ? 337  SER A OG  1 
ATOM   2697  N  N   . ASN A 1 335 ? 20.935  47.780  52.489  1.00 60.39 ? 338  ASN A N   1 
ATOM   2698  C  CA  . ASN A 1 335 ? 19.619  48.339  52.194  1.00 61.01 ? 338  ASN A CA  1 
ATOM   2699  C  C   . ASN A 1 335 ? 19.371  49.558  53.067  1.00 61.39 ? 338  ASN A C   1 
ATOM   2700  O  O   . ASN A 1 335 ? 18.798  49.446  54.156  1.00 61.69 ? 338  ASN A O   1 
ATOM   2701  C  CB  . ASN A 1 335 ? 18.508  47.319  52.432  1.00 61.34 ? 338  ASN A CB  1 
ATOM   2702  C  CG  . ASN A 1 335 ? 18.425  46.279  51.343  1.00 61.42 ? 338  ASN A CG  1 
ATOM   2703  O  OD1 . ASN A 1 335 ? 17.897  45.191  51.562  1.00 62.10 ? 338  ASN A OD1 1 
ATOM   2704  N  ND2 . ASN A 1 335 ? 18.930  46.605  50.159  1.00 61.30 ? 338  ASN A ND2 1 
ATOM   2705  N  N   . MET A 1 336 ? 19.812  50.718  52.593  1.00 61.66 ? 339  MET A N   1 
ATOM   2706  C  CA  . MET A 1 336 ? 19.635  51.961  53.329  1.00 61.81 ? 339  MET A CA  1 
ATOM   2707  C  C   . MET A 1 336 ? 19.036  53.025  52.435  1.00 61.74 ? 339  MET A C   1 
ATOM   2708  O  O   . MET A 1 336 ? 19.529  53.282  51.345  1.00 61.93 ? 339  MET A O   1 
ATOM   2709  C  CB  . MET A 1 336 ? 20.970  52.446  53.888  1.00 62.23 ? 339  MET A CB  1 
ATOM   2710  C  CG  . MET A 1 336 ? 21.570  51.522  54.932  1.00 62.86 ? 339  MET A CG  1 
ATOM   2711  S  SD  . MET A 1 336 ? 23.202  52.065  55.475  1.00 63.48 ? 339  MET A SD  1 
ATOM   2712  C  CE  . MET A 1 336 ? 24.197  51.435  54.153  1.00 63.35 ? 339  MET A CE  1 
ATOM   2713  N  N   . PRO A 1 337 ? 17.962  53.672  52.897  1.00 61.53 ? 340  PRO A N   1 
ATOM   2714  C  CA  . PRO A 1 337 ? 17.247  54.729  52.178  1.00 61.34 ? 340  PRO A CA  1 
ATOM   2715  C  C   . PRO A 1 337 ? 17.942  56.063  52.372  1.00 61.12 ? 340  PRO A C   1 
ATOM   2716  O  O   . PRO A 1 337 ? 18.806  56.196  53.234  1.00 61.43 ? 340  PRO A O   1 
ATOM   2717  C  CB  . PRO A 1 337 ? 15.886  54.770  52.886  1.00 61.46 ? 340  PRO A CB  1 
ATOM   2718  C  CG  . PRO A 1 337 ? 15.888  53.574  53.829  1.00 61.51 ? 340  PRO A CG  1 
ATOM   2719  C  CD  . PRO A 1 337 ? 17.318  53.397  54.186  1.00 61.44 ? 340  PRO A CD  1 
ATOM   2720  N  N   . PRO A 1 338 ? 17.564  57.075  51.583  1.00 60.73 ? 341  PRO A N   1 
ATOM   2721  C  CA  . PRO A 1 338 ? 18.181  58.396  51.718  1.00 60.58 ? 341  PRO A CA  1 
ATOM   2722  C  C   . PRO A 1 338 ? 17.984  58.870  53.152  1.00 60.49 ? 341  PRO A C   1 
ATOM   2723  O  O   . PRO A 1 338 ? 16.939  58.621  53.741  1.00 60.77 ? 341  PRO A O   1 
ATOM   2724  C  CB  . PRO A 1 338 ? 17.372  59.235  50.736  1.00 60.55 ? 341  PRO A CB  1 
ATOM   2725  C  CG  . PRO A 1 338 ? 17.066  58.248  49.650  1.00 60.33 ? 341  PRO A CG  1 
ATOM   2726  C  CD  . PRO A 1 338 ? 16.654  57.032  50.426  1.00 60.55 ? 341  PRO A CD  1 
ATOM   2727  N  N   . GLY A 1 339 ? 19.006  59.501  53.725  1.00 60.43 ? 342  GLY A N   1 
ATOM   2728  C  CA  . GLY A 1 339 ? 18.924  59.983  55.098  1.00 60.00 ? 342  GLY A CA  1 
ATOM   2729  C  C   . GLY A 1 339 ? 19.724  59.114  56.051  1.00 59.60 ? 342  GLY A C   1 
ATOM   2730  O  O   . GLY A 1 339 ? 20.054  59.514  57.169  1.00 59.55 ? 342  GLY A O   1 
ATOM   2731  N  N   . ILE A 1 340 ? 20.029  57.907  55.595  1.00 59.57 ? 343  ILE A N   1 
ATOM   2732  C  CA  . ILE A 1 340 ? 20.785  56.943  56.376  1.00 59.58 ? 343  ILE A CA  1 
ATOM   2733  C  C   . ILE A 1 340 ? 21.856  56.381  55.457  1.00 60.27 ? 343  ILE A C   1 
ATOM   2734  O  O   . ILE A 1 340 ? 21.553  55.891  54.367  1.00 60.49 ? 343  ILE A O   1 
ATOM   2735  C  CB  . ILE A 1 340 ? 19.899  55.768  56.816  1.00 58.86 ? 343  ILE A CB  1 
ATOM   2736  C  CG1 . ILE A 1 340 ? 18.642  56.276  57.518  1.00 58.31 ? 343  ILE A CG1 1 
ATOM   2737  C  CG2 . ILE A 1 340 ? 20.676  54.849  57.741  1.00 58.91 ? 343  ILE A CG2 1 
ATOM   2738  C  CD1 . ILE A 1 340 ? 17.741  55.169  58.028  1.00 57.57 ? 343  ILE A CD1 1 
ATOM   2739  N  N   . GLU A 1 341 ? 23.105  56.439  55.896  1.00 60.74 ? 344  GLU A N   1 
ATOM   2740  C  CA  . GLU A 1 341 ? 24.209  55.935  55.091  1.00 61.16 ? 344  GLU A CA  1 
ATOM   2741  C  C   . GLU A 1 341 ? 25.213  55.178  55.951  1.00 61.64 ? 344  GLU A C   1 
ATOM   2742  O  O   . GLU A 1 341 ? 25.086  55.114  57.179  1.00 62.01 ? 344  GLU A O   1 
ATOM   2743  C  CB  . GLU A 1 341 ? 24.926  57.091  54.377  1.00 61.16 ? 344  GLU A CB  1 
ATOM   2744  C  CG  . GLU A 1 341 ? 24.134  57.773  53.261  1.00 60.46 ? 344  GLU A CG  1 
ATOM   2745  C  CD  . GLU A 1 341 ? 24.859  58.991  52.699  1.00 60.35 ? 344  GLU A CD  1 
ATOM   2746  O  OE1 . GLU A 1 341 ? 24.189  59.980  52.339  1.00 60.35 ? 344  GLU A OE1 1 
ATOM   2747  O  OE2 . GLU A 1 341 ? 26.104  58.971  52.621  1.00 59.86 ? 344  GLU A OE2 1 
ATOM   2748  N  N   . ALA A 1 342 ? 26.222  54.626  55.285  1.00 61.82 ? 345  ALA A N   1 
ATOM   2749  C  CA  . ALA A 1 342 ? 27.278  53.870  55.933  1.00 61.92 ? 345  ALA A CA  1 
ATOM   2750  C  C   . ALA A 1 342 ? 28.417  54.773  56.384  1.00 62.25 ? 345  ALA A C   1 
ATOM   2751  O  O   . ALA A 1 342 ? 28.601  55.878  55.873  1.00 62.25 ? 345  ALA A O   1 
ATOM   2752  C  CB  . ALA A 1 342 ? 27.805  52.820  54.980  1.00 61.68 ? 345  ALA A CB  1 
ATOM   2753  N  N   . SER A 1 343 ? 29.170  54.295  57.364  1.00 62.74 ? 346  SER A N   1 
ATOM   2754  C  CA  . SER A 1 343 ? 30.314  55.030  57.883  1.00 63.33 ? 346  SER A CA  1 
ATOM   2755  C  C   . SER A 1 343 ? 31.539  54.235  57.458  1.00 63.75 ? 346  SER A C   1 
ATOM   2756  O  O   . SER A 1 343 ? 31.413  53.136  56.913  1.00 64.24 ? 346  SER A O   1 
ATOM   2757  C  CB  . SER A 1 343 ? 30.268  55.081  59.407  1.00 63.55 ? 346  SER A CB  1 
ATOM   2758  O  OG  . SER A 1 343 ? 30.581  53.808  59.956  1.00 63.51 ? 346  SER A OG  1 
ATOM   2759  N  N   . PRO A 1 344 ? 32.741  54.788  57.668  1.00 63.87 ? 347  PRO A N   1 
ATOM   2760  C  CA  . PRO A 1 344 ? 33.945  54.050  57.276  1.00 64.04 ? 347  PRO A CA  1 
ATOM   2761  C  C   . PRO A 1 344 ? 34.284  52.808  58.124  1.00 64.07 ? 347  PRO A C   1 
ATOM   2762  O  O   . PRO A 1 344 ? 35.393  52.266  58.019  1.00 64.51 ? 347  PRO A O   1 
ATOM   2763  C  CB  . PRO A 1 344 ? 35.035  55.123  57.335  1.00 64.07 ? 347  PRO A CB  1 
ATOM   2764  C  CG  . PRO A 1 344 ? 34.501  56.115  58.316  1.00 64.05 ? 347  PRO A CG  1 
ATOM   2765  C  CD  . PRO A 1 344 ? 33.056  56.196  57.960  1.00 63.90 ? 347  PRO A CD  1 
ATOM   2766  N  N   . ASP A 1 345 ? 33.336  52.345  58.944  1.00 63.72 ? 348  ASP A N   1 
ATOM   2767  C  CA  . ASP A 1 345 ? 33.571  51.157  59.761  1.00 63.10 ? 348  ASP A CA  1 
ATOM   2768  C  C   . ASP A 1 345 ? 33.826  49.985  58.823  1.00 62.78 ? 348  ASP A C   1 
ATOM   2769  O  O   . ASP A 1 345 ? 32.932  49.554  58.095  1.00 63.03 ? 348  ASP A O   1 
ATOM   2770  C  CB  . ASP A 1 345 ? 32.364  50.846  60.649  1.00 62.94 ? 348  ASP A CB  1 
ATOM   2771  C  CG  . ASP A 1 345 ? 32.594  49.636  61.562  1.00 63.18 ? 348  ASP A CG  1 
ATOM   2772  O  OD1 . ASP A 1 345 ? 33.529  48.838  61.320  1.00 63.32 ? 348  ASP A OD1 1 
ATOM   2773  O  OD2 . ASP A 1 345 ? 31.830  49.473  62.537  1.00 62.92 ? 348  ASP A OD2 1 
ATOM   2774  N  N   . LYS A 1 346 ? 35.037  49.445  58.888  1.00 62.07 ? 349  LYS A N   1 
ATOM   2775  C  CA  . LYS A 1 346 ? 35.431  48.326  58.045  1.00 61.34 ? 349  LYS A CA  1 
ATOM   2776  C  C   . LYS A 1 346 ? 34.448  47.168  58.107  1.00 60.88 ? 349  LYS A C   1 
ATOM   2777  O  O   . LYS A 1 346 ? 33.936  46.737  57.075  1.00 61.20 ? 349  LYS A O   1 
ATOM   2778  C  CB  . LYS A 1 346 ? 36.831  47.846  58.421  1.00 61.44 ? 349  LYS A CB  1 
ATOM   2779  C  CG  . LYS A 1 346 ? 37.905  48.893  58.216  1.00 61.00 ? 349  LYS A CG  1 
ATOM   2780  C  CD  . LYS A 1 346 ? 39.273  48.343  58.540  1.00 61.20 ? 349  LYS A CD  1 
ATOM   2781  C  CE  . LYS A 1 346 ? 40.341  49.397  58.285  1.00 61.56 ? 349  LYS A CE  1 
ATOM   2782  N  NZ  . LYS A 1 346 ? 41.726  48.867  58.481  1.00 61.86 ? 349  LYS A NZ  1 
ATOM   2783  N  N   . MET A 1 347 ? 34.160  46.692  59.316  1.00 59.98 ? 350  MET A N   1 
ATOM   2784  C  CA  . MET A 1 347 ? 33.229  45.582  59.514  1.00 59.16 ? 350  MET A CA  1 
ATOM   2785  C  C   . MET A 1 347 ? 31.970  45.803  58.708  1.00 58.60 ? 350  MET A C   1 
ATOM   2786  O  O   . MET A 1 347 ? 31.520  44.921  57.984  1.00 58.35 ? 350  MET A O   1 
ATOM   2787  C  CB  . MET A 1 347 ? 32.863  45.455  60.988  1.00 58.88 ? 350  MET A CB  1 
ATOM   2788  C  CG  . MET A 1 347 ? 33.996  44.980  61.861  1.00 58.84 ? 350  MET A CG  1 
ATOM   2789  S  SD  . MET A 1 347 ? 34.468  43.292  61.463  1.00 59.07 ? 350  MET A SD  1 
ATOM   2790  C  CE  . MET A 1 347 ? 33.135  42.438  62.237  1.00 59.01 ? 350  MET A CE  1 
ATOM   2791  N  N   . LEU A 1 348 ? 31.424  47.007  58.824  1.00 58.17 ? 351  LEU A N   1 
ATOM   2792  C  CA  . LEU A 1 348 ? 30.222  47.381  58.109  1.00 57.93 ? 351  LEU A CA  1 
ATOM   2793  C  C   . LEU A 1 348 ? 30.498  47.349  56.622  1.00 57.88 ? 351  LEU A C   1 
ATOM   2794  O  O   . LEU A 1 348 ? 29.768  46.709  55.858  1.00 57.94 ? 351  LEU A O   1 
ATOM   2795  C  CB  . LEU A 1 348 ? 29.786  48.784  58.513  1.00 58.03 ? 351  LEU A CB  1 
ATOM   2796  C  CG  . LEU A 1 348 ? 28.544  49.297  57.778  1.00 58.15 ? 351  LEU A CG  1 
ATOM   2797  C  CD1 . LEU A 1 348 ? 27.374  48.337  57.972  1.00 57.78 ? 351  LEU A CD1 1 
ATOM   2798  C  CD2 . LEU A 1 348 ? 28.184  50.692  58.276  1.00 58.51 ? 351  LEU A CD2 1 
ATOM   2799  N  N   . GLN A 1 349 ? 31.562  48.037  56.220  1.00 57.88 ? 352  GLN A N   1 
ATOM   2800  C  CA  . GLN A 1 349 ? 31.960  48.096  54.821  1.00 57.86 ? 352  GLN A CA  1 
ATOM   2801  C  C   . GLN A 1 349 ? 31.933  46.696  54.235  1.00 58.09 ? 352  GLN A C   1 
ATOM   2802  O  O   . GLN A 1 349 ? 31.415  46.484  53.141  1.00 58.22 ? 352  GLN A O   1 
ATOM   2803  C  CB  . GLN A 1 349 ? 33.358  48.699  54.700  1.00 57.53 ? 352  GLN A CB  1 
ATOM   2804  C  CG  . GLN A 1 349 ? 33.418  50.189  55.016  1.00 57.01 ? 352  GLN A CG  1 
ATOM   2805  C  CD  . GLN A 1 349 ? 32.942  51.050  53.863  1.00 56.65 ? 352  GLN A CD  1 
ATOM   2806  O  OE1 . GLN A 1 349 ? 33.506  51.004  52.771  1.00 56.55 ? 352  GLN A OE1 1 
ATOM   2807  N  NE2 . GLN A 1 349 ? 31.913  51.852  54.102  1.00 56.44 ? 352  GLN A NE2 1 
ATOM   2808  N  N   . GLY A 1 350 ? 32.422  45.733  55.010  1.00 58.33 ? 353  GLY A N   1 
ATOM   2809  C  CA  . GLY A 1 350 ? 32.430  44.348  54.571  1.00 58.39 ? 353  GLY A CA  1 
ATOM   2810  C  C   . GLY A 1 350 ? 31.037  43.753  54.458  1.00 58.78 ? 353  GLY A C   1 
ATOM   2811  O  O   . GLY A 1 350 ? 30.686  43.174  53.425  1.00 58.97 ? 353  GLY A O   1 
ATOM   2812  N  N   . ARG A 1 351 ? 30.224  43.917  55.500  1.00 58.63 ? 354  ARG A N   1 
ATOM   2813  C  CA  . ARG A 1 351 ? 28.866  43.390  55.491  1.00 58.43 ? 354  ARG A CA  1 
ATOM   2814  C  C   . ARG A 1 351 ? 28.094  43.910  54.293  1.00 58.91 ? 354  ARG A C   1 
ATOM   2815  O  O   . ARG A 1 351 ? 27.180  43.253  53.802  1.00 59.22 ? 354  ARG A O   1 
ATOM   2816  C  CB  . ARG A 1 351 ? 28.156  43.781  56.777  1.00 58.23 ? 354  ARG A CB  1 
ATOM   2817  C  CG  . ARG A 1 351 ? 28.883  43.308  58.018  1.00 57.94 ? 354  ARG A CG  1 
ATOM   2818  C  CD  . ARG A 1 351 ? 28.139  43.673  59.277  1.00 57.67 ? 354  ARG A CD  1 
ATOM   2819  N  NE  . ARG A 1 351 ? 26.873  42.962  59.377  1.00 57.96 ? 354  ARG A NE  1 
ATOM   2820  C  CZ  . ARG A 1 351 ? 25.825  43.417  60.054  1.00 58.10 ? 354  ARG A CZ  1 
ATOM   2821  N  NH1 . ARG A 1 351 ? 25.896  44.580  60.687  1.00 58.15 ? 354  ARG A NH1 1 
ATOM   2822  N  NH2 . ARG A 1 351 ? 24.712  42.702  60.110  1.00 58.41 ? 354  ARG A NH2 1 
ATOM   2823  N  N   . LEU A 1 352 ? 28.486  45.087  53.817  1.00 59.41 ? 355  LEU A N   1 
ATOM   2824  C  CA  . LEU A 1 352 ? 27.866  45.731  52.659  1.00 59.56 ? 355  LEU A CA  1 
ATOM   2825  C  C   . LEU A 1 352 ? 27.820  44.834  51.418  1.00 59.91 ? 355  LEU A C   1 
ATOM   2826  O  O   . LEU A 1 352 ? 26.888  44.916  50.616  1.00 59.99 ? 355  LEU A O   1 
ATOM   2827  C  CB  . LEU A 1 352 ? 28.617  47.022  52.335  1.00 59.10 ? 355  LEU A CB  1 
ATOM   2828  C  CG  . LEU A 1 352 ? 27.958  48.342  52.740  1.00 58.97 ? 355  LEU A CG  1 
ATOM   2829  C  CD1 . LEU A 1 352 ? 27.082  48.150  53.956  1.00 59.11 ? 355  LEU A CD1 1 
ATOM   2830  C  CD2 . LEU A 1 352 ? 29.017  49.403  52.981  1.00 58.73 ? 355  LEU A CD2 1 
ATOM   2831  N  N   . PHE A 1 353 ? 28.832  43.987  51.257  1.00 59.95 ? 356  PHE A N   1 
ATOM   2832  C  CA  . PHE A 1 353 ? 28.894  43.077  50.123  1.00 59.89 ? 356  PHE A CA  1 
ATOM   2833  C  C   . PHE A 1 353 ? 28.365  41.695  50.471  1.00 59.75 ? 356  PHE A C   1 
ATOM   2834  O  O   . PHE A 1 353 ? 27.604  41.107  49.708  1.00 60.29 ? 356  PHE A O   1 
ATOM   2835  C  CB  . PHE A 1 353 ? 30.341  42.951  49.625  1.00 60.25 ? 356  PHE A CB  1 
ATOM   2836  C  CG  . PHE A 1 353 ? 30.634  41.652  48.896  1.00 60.09 ? 356  PHE A CG  1 
ATOM   2837  C  CD1 . PHE A 1 353 ? 30.309  41.496  47.553  1.00 59.95 ? 356  PHE A CD1 1 
ATOM   2838  C  CD2 . PHE A 1 353 ? 31.232  40.584  49.558  1.00 59.93 ? 356  PHE A CD2 1 
ATOM   2839  C  CE1 . PHE A 1 353 ? 30.575  40.295  46.886  1.00 59.43 ? 356  PHE A CE1 1 
ATOM   2840  C  CE2 . PHE A 1 353 ? 31.498  39.385  48.895  1.00 59.45 ? 356  PHE A CE2 1 
ATOM   2841  C  CZ  . PHE A 1 353 ? 31.168  39.243  47.561  1.00 59.17 ? 356  PHE A CZ  1 
ATOM   2842  N  N   . ALA A 1 354 ? 28.781  41.182  51.624  1.00 59.38 ? 357  ALA A N   1 
ATOM   2843  C  CA  . ALA A 1 354 ? 28.411  39.842  52.073  1.00 59.06 ? 357  ALA A CA  1 
ATOM   2844  C  C   . ALA A 1 354 ? 26.946  39.435  51.989  1.00 58.95 ? 357  ALA A C   1 
ATOM   2845  O  O   . ALA A 1 354 ? 26.598  38.474  51.298  1.00 59.36 ? 357  ALA A O   1 
ATOM   2846  C  CB  . ALA A 1 354 ? 28.928  39.608  53.485  1.00 58.80 ? 357  ALA A CB  1 
ATOM   2847  N  N   . TYR A 1 355 ? 26.087  40.174  52.675  1.00 58.74 ? 358  TYR A N   1 
ATOM   2848  C  CA  . TYR A 1 355 ? 24.673  39.836  52.722  1.00 58.33 ? 358  TYR A CA  1 
ATOM   2849  C  C   . TYR A 1 355 ? 23.968  39.597  51.390  1.00 58.03 ? 358  TYR A C   1 
ATOM   2850  O  O   . TYR A 1 355 ? 23.509  38.484  51.133  1.00 58.05 ? 358  TYR A O   1 
ATOM   2851  C  CB  . TYR A 1 355 ? 23.929  40.804  53.646  1.00 58.35 ? 358  TYR A CB  1 
ATOM   2852  C  CG  . TYR A 1 355 ? 24.391  40.700  55.096  1.00 58.45 ? 358  TYR A CG  1 
ATOM   2853  C  CD1 . TYR A 1 355 ? 23.564  40.156  56.076  1.00 58.45 ? 358  TYR A CD1 1 
ATOM   2854  C  CD2 . TYR A 1 355 ? 25.665  41.124  55.481  1.00 58.37 ? 358  TYR A CD2 1 
ATOM   2855  C  CE1 . TYR A 1 355 ? 23.994  40.036  57.405  1.00 58.82 ? 358  TYR A CE1 1 
ATOM   2856  C  CE2 . TYR A 1 355 ? 26.100  41.006  56.805  1.00 58.71 ? 358  TYR A CE2 1 
ATOM   2857  C  CZ  . TYR A 1 355 ? 25.260  40.462  57.760  1.00 58.78 ? 358  TYR A CZ  1 
ATOM   2858  O  OH  . TYR A 1 355 ? 25.669  40.349  59.071  1.00 58.56 ? 358  TYR A OH  1 
ATOM   2859  N  N   . PRO A 1 356 ? 23.883  40.607  50.513  1.00 57.73 ? 359  PRO A N   1 
ATOM   2860  C  CA  . PRO A 1 356 ? 23.197  40.281  49.263  1.00 57.49 ? 359  PRO A CA  1 
ATOM   2861  C  C   . PRO A 1 356 ? 23.936  39.189  48.504  1.00 57.36 ? 359  PRO A C   1 
ATOM   2862  O  O   . PRO A 1 356 ? 23.322  38.399  47.792  1.00 57.46 ? 359  PRO A O   1 
ATOM   2863  C  CB  . PRO A 1 356 ? 23.196  41.609  48.518  1.00 57.30 ? 359  PRO A CB  1 
ATOM   2864  C  CG  . PRO A 1 356 ? 24.380  42.299  49.047  1.00 57.32 ? 359  PRO A CG  1 
ATOM   2865  C  CD  . PRO A 1 356 ? 24.315  42.010  50.512  1.00 57.70 ? 359  PRO A CD  1 
ATOM   2866  N  N   . ASP A 1 357 ? 25.244  39.095  48.709  1.00 57.21 ? 360  ASP A N   1 
ATOM   2867  C  CA  . ASP A 1 357 ? 26.024  38.064  48.033  1.00 56.98 ? 360  ASP A CA  1 
ATOM   2868  C  C   . ASP A 1 357 ? 25.595  36.675  48.492  1.00 56.95 ? 360  ASP A C   1 
ATOM   2869  O  O   . ASP A 1 357 ? 25.304  35.807  47.665  1.00 57.36 ? 360  ASP A O   1 
ATOM   2870  C  CB  . ASP A 1 357 ? 27.520  38.250  48.286  1.00 56.74 ? 360  ASP A CB  1 
ATOM   2871  C  CG  . ASP A 1 357 ? 28.370  37.197  47.584  1.00 56.83 ? 360  ASP A CG  1 
ATOM   2872  O  OD1 . ASP A 1 357 ? 28.230  37.028  46.355  1.00 57.01 ? 360  ASP A OD1 1 
ATOM   2873  O  OD2 . ASP A 1 357 ? 29.188  36.539  48.258  1.00 56.54 ? 360  ASP A OD2 1 
ATOM   2874  N  N   . THR A 1 358 ? 25.510  36.477  49.807  1.00 56.49 ? 361  THR A N   1 
ATOM   2875  C  CA  . THR A 1 358 ? 25.124  35.181  50.348  1.00 55.98 ? 361  THR A CA  1 
ATOM   2876  C  C   . THR A 1 358 ? 23.670  34.864  50.039  1.00 56.11 ? 361  THR A C   1 
ATOM   2877  O  O   . THR A 1 358 ? 23.283  33.698  49.975  1.00 56.60 ? 361  THR A O   1 
ATOM   2878  C  CB  . THR A 1 358 ? 25.365  35.094  51.871  1.00 55.60 ? 361  THR A CB  1 
ATOM   2879  O  OG1 . THR A 1 358 ? 25.256  33.732  52.296  1.00 55.49 ? 361  THR A OG1 1 
ATOM   2880  C  CG2 . THR A 1 358 ? 24.345  35.904  52.628  1.00 55.39 ? 361  THR A CG2 1 
ATOM   2881  N  N   . HIS A 1 359 ? 22.862  35.894  49.830  1.00 56.14 ? 362  HIS A N   1 
ATOM   2882  C  CA  . HIS A 1 359 ? 21.453  35.684  49.529  1.00 56.08 ? 362  HIS A CA  1 
ATOM   2883  C  C   . HIS A 1 359 ? 21.226  35.190  48.121  1.00 56.18 ? 362  HIS A C   1 
ATOM   2884  O  O   . HIS A 1 359 ? 20.262  34.473  47.847  1.00 56.33 ? 362  HIS A O   1 
ATOM   2885  C  CB  . HIS A 1 359 ? 20.673  36.961  49.757  1.00 56.19 ? 362  HIS A CB  1 
ATOM   2886  C  CG  . HIS A 1 359 ? 20.594  37.352  51.192  1.00 56.11 ? 362  HIS A CG  1 
ATOM   2887  N  ND1 . HIS A 1 359 ? 20.644  38.662  51.614  1.00 56.10 ? 362  HIS A ND1 1 
ATOM   2888  C  CD2 . HIS A 1 359 ? 20.500  36.593  52.308  1.00 55.86 ? 362  HIS A CD2 1 
ATOM   2889  C  CE1 . HIS A 1 359 ? 20.587  38.695  52.935  1.00 56.42 ? 362  HIS A CE1 1 
ATOM   2890  N  NE2 . HIS A 1 359 ? 20.499  37.453  53.381  1.00 56.49 ? 362  HIS A NE2 1 
ATOM   2891  N  N   . ARG A 1 360 ? 22.102  35.598  47.216  1.00 56.37 ? 363  ARG A N   1 
ATOM   2892  C  CA  . ARG A 1 360 ? 21.994  35.168  45.841  1.00 56.79 ? 363  ARG A CA  1 
ATOM   2893  C  C   . ARG A 1 360 ? 22.314  33.689  45.804  1.00 57.37 ? 363  ARG A C   1 
ATOM   2894  O  O   . ARG A 1 360 ? 21.913  32.987  44.880  1.00 57.71 ? 363  ARG A O   1 
ATOM   2895  C  CB  . ARG A 1 360 ? 22.953  35.974  44.987  1.00 56.30 ? 363  ARG A CB  1 
ATOM   2896  C  CG  . ARG A 1 360 ? 22.558  37.420  45.010  1.00 56.41 ? 363  ARG A CG  1 
ATOM   2897  C  CD  . ARG A 1 360 ? 23.581  38.338  44.402  1.00 56.95 ? 363  ARG A CD  1 
ATOM   2898  N  NE  . ARG A 1 360 ? 23.123  39.723  44.484  1.00 57.02 ? 363  ARG A NE  1 
ATOM   2899  C  CZ  . ARG A 1 360 ? 23.872  40.733  44.907  1.00 57.22 ? 363  ARG A CZ  1 
ATOM   2900  N  NH1 . ARG A 1 360 ? 25.126  40.524  45.280  1.00 57.04 ? 363  ARG A NH1 1 
ATOM   2901  N  NH2 . ARG A 1 360 ? 23.361  41.950  44.977  1.00 57.76 ? 363  ARG A NH2 1 
ATOM   2902  N  N   . HIS A 1 361 ? 22.964  33.214  46.864  1.00 58.01 ? 364  HIS A N   1 
ATOM   2903  C  CA  . HIS A 1 361 ? 23.352  31.813  47.001  1.00 58.39 ? 364  HIS A CA  1 
ATOM   2904  C  C   . HIS A 1 361 ? 22.306  30.967  47.710  1.00 58.46 ? 364  HIS A C   1 
ATOM   2905  O  O   . HIS A 1 361 ? 21.708  30.101  47.085  1.00 58.50 ? 364  HIS A O   1 
ATOM   2906  C  CB  . HIS A 1 361 ? 24.701  31.685  47.729  1.00 58.88 ? 364  HIS A CB  1 
ATOM   2907  C  CG  . HIS A 1 361 ? 25.017  30.295  48.200  1.00 59.51 ? 364  HIS A CG  1 
ATOM   2908  N  ND1 . HIS A 1 361 ? 25.537  29.324  47.372  1.00 59.74 ? 364  HIS A ND1 1 
ATOM   2909  C  CD2 . HIS A 1 361 ? 24.887  29.716  49.420  1.00 59.86 ? 364  HIS A CD2 1 
ATOM   2910  C  CE1 . HIS A 1 361 ? 25.715  28.208  48.060  1.00 60.09 ? 364  HIS A CE1 1 
ATOM   2911  N  NE2 . HIS A 1 361 ? 25.328  28.420  49.305  1.00 59.90 ? 364  HIS A NE2 1 
ATOM   2912  N  N   . ARG A 1 362 ? 22.068  31.212  49.000  1.00 58.50 ? 365  ARG A N   1 
ATOM   2913  C  CA  . ARG A 1 362 ? 21.101  30.388  49.726  1.00 58.52 ? 365  ARG A CA  1 
ATOM   2914  C  C   . ARG A 1 362 ? 19.660  30.551  49.284  1.00 58.27 ? 365  ARG A C   1 
ATOM   2915  O  O   . ARG A 1 362 ? 18.829  29.688  49.558  1.00 58.61 ? 365  ARG A O   1 
ATOM   2916  C  CB  . ARG A 1 362 ? 21.223  30.532  51.253  1.00 58.67 ? 365  ARG A CB  1 
ATOM   2917  C  CG  . ARG A 1 362 ? 20.518  31.713  51.869  1.00 58.96 ? 365  ARG A CG  1 
ATOM   2918  C  CD  . ARG A 1 362 ? 20.425  31.561  53.388  1.00 59.10 ? 365  ARG A CD  1 
ATOM   2919  N  NE  . ARG A 1 362 ? 19.878  32.763  54.026  1.00 59.50 ? 365  ARG A NE  1 
ATOM   2920  C  CZ  . ARG A 1 362 ? 18.583  32.981  54.262  1.00 59.53 ? 365  ARG A CZ  1 
ATOM   2921  N  NH1 . ARG A 1 362 ? 18.197  34.114  54.836  1.00 59.47 ? 365  ARG A NH1 1 
ATOM   2922  N  NH2 . ARG A 1 362 ? 17.671  32.061  53.954  1.00 59.11 ? 365  ARG A NH2 1 
ATOM   2923  N  N   . LEU A 1 363 ? 19.363  31.635  48.582  1.00 57.74 ? 366  LEU A N   1 
ATOM   2924  C  CA  . LEU A 1 363 ? 18.009  31.854  48.113  1.00 57.43 ? 366  LEU A CA  1 
ATOM   2925  C  C   . LEU A 1 363 ? 17.958  31.821  46.597  1.00 57.48 ? 366  LEU A C   1 
ATOM   2926  O  O   . LEU A 1 363 ? 17.265  30.987  46.006  1.00 57.82 ? 366  LEU A O   1 
ATOM   2927  C  CB  . LEU A 1 363 ? 17.484  33.181  48.635  1.00 57.07 ? 366  LEU A CB  1 
ATOM   2928  C  CG  . LEU A 1 363 ? 17.407  33.238  50.158  1.00 56.70 ? 366  LEU A CG  1 
ATOM   2929  C  CD1 . LEU A 1 363 ? 17.013  34.630  50.602  1.00 56.47 ? 366  LEU A CD1 1 
ATOM   2930  C  CD2 . LEU A 1 363 ? 16.411  32.214  50.661  1.00 56.42 ? 366  LEU A CD2 1 
ATOM   2931  N  N   . GLY A 1 364 ? 18.699  32.724  45.963  1.00 57.53 ? 367  GLY A N   1 
ATOM   2932  C  CA  . GLY A 1 364 ? 18.710  32.763  44.513  1.00 57.26 ? 367  GLY A CA  1 
ATOM   2933  C  C   . GLY A 1 364 ? 18.895  34.166  43.992  1.00 57.20 ? 367  GLY A C   1 
ATOM   2934  O  O   . GLY A 1 364 ? 18.707  35.140  44.722  1.00 57.24 ? 367  GLY A O   1 
ATOM   2935  N  N   . PRO A 1 365 ? 19.242  34.299  42.710  1.00 57.18 ? 368  PRO A N   1 
ATOM   2936  C  CA  . PRO A 1 365 ? 19.465  35.578  42.038  1.00 57.11 ? 368  PRO A CA  1 
ATOM   2937  C  C   . PRO A 1 365 ? 18.343  36.544  42.324  1.00 57.16 ? 368  PRO A C   1 
ATOM   2938  O  O   . PRO A 1 365 ? 18.583  37.681  42.708  1.00 56.90 ? 368  PRO A O   1 
ATOM   2939  C  CB  . PRO A 1 365 ? 19.476  35.182  40.572  1.00 56.88 ? 368  PRO A CB  1 
ATOM   2940  C  CG  . PRO A 1 365 ? 20.126  33.838  40.626  1.00 57.12 ? 368  PRO A CG  1 
ATOM   2941  C  CD  . PRO A 1 365 ? 19.417  33.179  41.772  1.00 57.17 ? 368  PRO A CD  1 
ATOM   2942  N  N   . ASN A 1 366 ? 17.114  36.065  42.172  1.00 57.63 ? 369  ASN A N   1 
ATOM   2943  C  CA  . ASN A 1 366 ? 15.931  36.884  42.402  1.00 58.20 ? 369  ASN A CA  1 
ATOM   2944  C  C   . ASN A 1 366 ? 15.351  36.748  43.811  1.00 58.55 ? 369  ASN A C   1 
ATOM   2945  O  O   . ASN A 1 366 ? 14.134  36.789  43.986  1.00 58.35 ? 369  ASN A O   1 
ATOM   2946  C  CB  . ASN A 1 366 ? 14.855  36.536  41.372  1.00 58.32 ? 369  ASN A CB  1 
ATOM   2947  C  CG  . ASN A 1 366 ? 15.196  37.025  39.986  1.00 58.77 ? 369  ASN A CG  1 
ATOM   2948  O  OD1 . ASN A 1 366 ? 15.106  36.272  39.011  1.00 59.31 ? 369  ASN A OD1 1 
ATOM   2949  N  ND2 . ASN A 1 366 ? 15.577  38.297  39.881  1.00 58.87 ? 369  ASN A ND2 1 
ATOM   2950  N  N   . TYR A 1 367 ? 16.209  36.650  44.823  1.00 59.03 ? 370  TYR A N   1 
ATOM   2951  C  CA  . TYR A 1 367 ? 15.717  36.495  46.184  1.00 59.46 ? 370  TYR A CA  1 
ATOM   2952  C  C   . TYR A 1 367 ? 14.824  37.635  46.653  1.00 59.97 ? 370  TYR A C   1 
ATOM   2953  O  O   . TYR A 1 367 ? 14.039  37.458  47.580  1.00 60.36 ? 370  TYR A O   1 
ATOM   2954  C  CB  . TYR A 1 367 ? 16.860  36.270  47.167  1.00 59.47 ? 370  TYR A CB  1 
ATOM   2955  C  CG  . TYR A 1 367 ? 17.665  37.497  47.497  1.00 59.97 ? 370  TYR A CG  1 
ATOM   2956  C  CD1 . TYR A 1 367 ? 17.378  38.261  48.627  1.00 60.12 ? 370  TYR A CD1 1 
ATOM   2957  C  CD2 . TYR A 1 367 ? 18.744  37.876  46.711  1.00 60.17 ? 370  TYR A CD2 1 
ATOM   2958  C  CE1 . TYR A 1 367 ? 18.156  39.372  48.964  1.00 60.34 ? 370  TYR A CE1 1 
ATOM   2959  C  CE2 . TYR A 1 367 ? 19.525  38.985  47.040  1.00 60.39 ? 370  TYR A CE2 1 
ATOM   2960  C  CZ  . TYR A 1 367 ? 19.227  39.724  48.167  1.00 60.45 ? 370  TYR A CZ  1 
ATOM   2961  O  OH  . TYR A 1 367 ? 20.005  40.815  48.489  1.00 61.15 ? 370  TYR A OH  1 
ATOM   2962  N  N   . LEU A 1 368 ? 14.913  38.792  46.007  1.00 60.48 ? 371  LEU A N   1 
ATOM   2963  C  CA  . LEU A 1 368 ? 14.073  39.926  46.395  1.00 61.08 ? 371  LEU A CA  1 
ATOM   2964  C  C   . LEU A 1 368 ? 12.635  39.788  45.905  1.00 62.10 ? 371  LEU A C   1 
ATOM   2965  O  O   . LEU A 1 368 ? 11.783  40.612  46.238  1.00 62.44 ? 371  LEU A O   1 
ATOM   2966  C  CB  . LEU A 1 368 ? 14.668  41.245  45.907  1.00 60.19 ? 371  LEU A CB  1 
ATOM   2967  C  CG  . LEU A 1 368 ? 16.000  41.604  46.559  1.00 59.84 ? 371  LEU A CG  1 
ATOM   2968  C  CD1 . LEU A 1 368 ? 16.595  42.798  45.878  1.00 59.59 ? 371  LEU A CD1 1 
ATOM   2969  C  CD2 . LEU A 1 368 ? 15.808  41.870  48.039  1.00 59.38 ? 371  LEU A CD2 1 
ATOM   2970  N  N   . HIS A 1 369 ? 12.366  38.763  45.097  1.00 62.98 ? 372  HIS A N   1 
ATOM   2971  C  CA  . HIS A 1 369 ? 11.012  38.532  44.603  1.00 63.60 ? 372  HIS A CA  1 
ATOM   2972  C  C   . HIS A 1 369 ? 10.190  37.755  45.618  1.00 63.57 ? 372  HIS A C   1 
ATOM   2973  O  O   . HIS A 1 369 ? 8.978   37.630  45.472  1.00 63.91 ? 372  HIS A O   1 
ATOM   2974  C  CB  . HIS A 1 369 ? 11.024  37.775  43.282  1.00 64.67 ? 372  HIS A CB  1 
ATOM   2975  C  CG  . HIS A 1 369 ? 11.515  38.587  42.127  1.00 65.59 ? 372  HIS A CG  1 
ATOM   2976  N  ND1 . HIS A 1 369 ? 11.429  38.146  40.822  1.00 66.12 ? 372  HIS A ND1 1 
ATOM   2977  C  CD2 . HIS A 1 369 ? 12.108  39.801  42.079  1.00 65.91 ? 372  HIS A CD2 1 
ATOM   2978  C  CE1 . HIS A 1 369 ? 11.953  39.057  40.019  1.00 66.43 ? 372  HIS A CE1 1 
ATOM   2979  N  NE2 . HIS A 1 369 ? 12.373  40.071  40.757  1.00 66.51 ? 372  HIS A NE2 1 
ATOM   2980  N  N   . ILE A 1 370 ? 10.855  37.170  46.608  1.00 63.40 ? 373  ILE A N   1 
ATOM   2981  C  CA  . ILE A 1 370 ? 10.148  36.437  47.646  1.00 62.99 ? 373  ILE A CA  1 
ATOM   2982  C  C   . ILE A 1 370 ? 9.340   37.484  48.401  1.00 63.24 ? 373  ILE A C   1 
ATOM   2983  O  O   . ILE A 1 370 ? 9.894   38.438  48.942  1.00 63.69 ? 373  ILE A O   1 
ATOM   2984  C  CB  . ILE A 1 370 ? 11.122  35.762  48.594  1.00 62.39 ? 373  ILE A CB  1 
ATOM   2985  C  CG1 . ILE A 1 370 ? 12.094  34.910  47.787  1.00 62.03 ? 373  ILE A CG1 1 
ATOM   2986  C  CG2 . ILE A 1 370 ? 10.368  34.900  49.591  1.00 62.15 ? 373  ILE A CG2 1 
ATOM   2987  C  CD1 . ILE A 1 370 ? 13.223  34.345  48.599  1.00 61.93 ? 373  ILE A CD1 1 
ATOM   2988  N  N   . PRO A 1 371 ? 8.017   37.307  48.461  1.00 63.03 ? 374  PRO A N   1 
ATOM   2989  C  CA  . PRO A 1 371 ? 7.104   38.230  49.136  1.00 62.61 ? 374  PRO A CA  1 
ATOM   2990  C  C   . PRO A 1 371 ? 7.634   38.910  50.388  1.00 62.67 ? 374  PRO A C   1 
ATOM   2991  O  O   . PRO A 1 371 ? 7.691   40.135  50.440  1.00 62.88 ? 374  PRO A O   1 
ATOM   2992  C  CB  . PRO A 1 371 ? 5.907   37.341  49.439  1.00 62.93 ? 374  PRO A CB  1 
ATOM   2993  C  CG  . PRO A 1 371 ? 5.857   36.469  48.224  1.00 62.93 ? 374  PRO A CG  1 
ATOM   2994  C  CD  . PRO A 1 371 ? 7.310   36.078  48.058  1.00 63.03 ? 374  PRO A CD  1 
ATOM   2995  N  N   . VAL A 1 372 ? 8.086   38.131  51.363  1.00 62.64 ? 375  VAL A N   1 
ATOM   2996  C  CA  . VAL A 1 372 ? 8.574   38.708  52.608  1.00 62.62 ? 375  VAL A CA  1 
ATOM   2997  C  C   . VAL A 1 372 ? 9.724   39.683  52.433  1.00 62.90 ? 375  VAL A C   1 
ATOM   2998  O  O   . VAL A 1 372 ? 9.904   40.566  53.258  1.00 63.18 ? 375  VAL A O   1 
ATOM   2999  C  CB  . VAL A 1 372 ? 8.988   37.632  53.620  1.00 62.27 ? 375  VAL A CB  1 
ATOM   3000  C  CG1 . VAL A 1 372 ? 10.321  37.033  53.233  1.00 62.08 ? 375  VAL A CG1 1 
ATOM   3001  C  CG2 . VAL A 1 372 ? 9.046   38.221  55.016  1.00 62.15 ? 375  VAL A CG2 1 
ATOM   3002  N  N   . ASN A 1 373 ? 10.504  39.530  51.372  1.00 63.09 ? 376  ASN A N   1 
ATOM   3003  C  CA  . ASN A 1 373 ? 11.626  40.435  51.135  1.00 63.39 ? 376  ASN A CA  1 
ATOM   3004  C  C   . ASN A 1 373 ? 11.282  41.556  50.162  1.00 63.94 ? 376  ASN A C   1 
ATOM   3005  O  O   . ASN A 1 373 ? 11.960  42.583  50.116  1.00 64.06 ? 376  ASN A O   1 
ATOM   3006  C  CB  . ASN A 1 373 ? 12.831  39.658  50.622  1.00 63.14 ? 376  ASN A CB  1 
ATOM   3007  C  CG  . ASN A 1 373 ? 13.240  38.559  51.559  1.00 62.60 ? 376  ASN A CG  1 
ATOM   3008  O  OD1 . ASN A 1 373 ? 13.110  38.687  52.778  1.00 62.72 ? 376  ASN A OD1 1 
ATOM   3009  N  ND2 . ASN A 1 373 ? 13.723  37.458  51.001  1.00 62.28 ? 376  ASN A ND2 1 
ATOM   3010  N  N   . CYS A 1 374 ? 10.219  41.354  49.391  1.00 64.65 ? 377  CYS A N   1 
ATOM   3011  C  CA  . CYS A 1 374 ? 9.778   42.339  48.418  1.00 65.14 ? 377  CYS A CA  1 
ATOM   3012  C  C   . CYS A 1 374 ? 9.516   43.662  49.134  1.00 64.94 ? 377  CYS A C   1 
ATOM   3013  O  O   . CYS A 1 374 ? 9.039   43.676  50.265  1.00 64.96 ? 377  CYS A O   1 
ATOM   3014  C  CB  . CYS A 1 374 ? 8.511   41.839  47.716  1.00 65.80 ? 377  CYS A CB  1 
ATOM   3015  S  SG  . CYS A 1 374 ? 7.998   42.819  46.285  1.00 68.41 ? 377  CYS A SG  1 
ATOM   3016  N  N   . PRO A 1 375 ? 9.944   44.781  48.535  1.00 64.93 ? 378  PRO A N   1 
ATOM   3017  C  CA  . PRO A 1 375 ? 9.753   46.115  49.109  1.00 65.17 ? 378  PRO A CA  1 
ATOM   3018  C  C   . PRO A 1 375 ? 8.394   46.633  48.662  1.00 65.85 ? 378  PRO A C   1 
ATOM   3019  O  O   . PRO A 1 375 ? 8.297   47.663  47.998  1.00 66.12 ? 378  PRO A O   1 
ATOM   3020  C  CB  . PRO A 1 375 ? 10.887  46.900  48.471  1.00 64.87 ? 378  PRO A CB  1 
ATOM   3021  C  CG  . PRO A 1 375 ? 10.929  46.328  47.105  1.00 64.41 ? 378  PRO A CG  1 
ATOM   3022  C  CD  . PRO A 1 375 ? 10.816  44.847  47.348  1.00 64.52 ? 378  PRO A CD  1 
ATOM   3023  N  N   . TYR A 1 376 ? 7.350   45.914  49.058  1.00 66.57 ? 379  TYR A N   1 
ATOM   3024  C  CA  . TYR A 1 376 ? 5.976   46.215  48.674  1.00 67.45 ? 379  TYR A CA  1 
ATOM   3025  C  C   . TYR A 1 376 ? 5.442   47.617  48.946  1.00 67.79 ? 379  TYR A C   1 
ATOM   3026  O  O   . TYR A 1 376 ? 4.451   48.040  48.351  1.00 67.76 ? 379  TYR A O   1 
ATOM   3027  C  CB  . TYR A 1 376 ? 5.037   45.172  49.274  1.00 68.09 ? 379  TYR A CB  1 
ATOM   3028  C  CG  . TYR A 1 376 ? 4.829   45.282  50.769  1.00 68.99 ? 379  TYR A CG  1 
ATOM   3029  C  CD1 . TYR A 1 376 ? 5.629   44.571  51.666  1.00 69.40 ? 379  TYR A CD1 1 
ATOM   3030  C  CD2 . TYR A 1 376 ? 3.792   46.059  51.286  1.00 69.34 ? 379  TYR A CD2 1 
ATOM   3031  C  CE1 . TYR A 1 376 ? 5.393   44.626  53.049  1.00 69.66 ? 379  TYR A CE1 1 
ATOM   3032  C  CE2 . TYR A 1 376 ? 3.547   46.125  52.660  1.00 69.65 ? 379  TYR A CE2 1 
ATOM   3033  C  CZ  . TYR A 1 376 ? 4.345   45.406  53.538  1.00 69.92 ? 379  TYR A CZ  1 
ATOM   3034  O  OH  . TYR A 1 376 ? 4.069   45.455  54.893  1.00 70.21 ? 379  TYR A OH  1 
ATOM   3035  N  N   . ARG A 1 377 ? 6.089   48.337  49.844  1.00 68.22 ? 380  ARG A N   1 
ATOM   3036  C  CA  . ARG A 1 377 ? 5.649   49.677  50.167  1.00 68.61 ? 380  ARG A CA  1 
ATOM   3037  C  C   . ARG A 1 377 ? 6.287   50.675  49.206  1.00 68.65 ? 380  ARG A C   1 
ATOM   3038  O  O   . ARG A 1 377 ? 6.056   51.882  49.300  1.00 68.73 ? 380  ARG A O   1 
ATOM   3039  C  CB  . ARG A 1 377 ? 6.043   49.994  51.601  1.00 69.37 ? 380  ARG A CB  1 
ATOM   3040  C  CG  . ARG A 1 377 ? 5.110   50.940  52.298  1.00 70.29 ? 380  ARG A CG  1 
ATOM   3041  C  CD  . ARG A 1 377 ? 5.569   51.164  53.725  1.00 71.46 ? 380  ARG A CD  1 
ATOM   3042  N  NE  . ARG A 1 377 ? 4.673   52.037  54.462  1.00 72.06 ? 380  ARG A NE  1 
ATOM   3043  C  CZ  . ARG A 1 377 ? 3.407   51.738  54.724  1.00 72.93 ? 380  ARG A CZ  1 
ATOM   3044  N  NH1 . ARG A 1 377 ? 2.899   50.581  54.314  1.00 72.84 ? 380  ARG A NH1 1 
ATOM   3045  N  NH2 . ARG A 1 377 ? 2.636   52.614  55.357  1.00 73.29 ? 380  ARG A NH2 1 
ATOM   3046  N  N   . ALA A 1 378 ? 7.086   50.159  48.276  1.00 68.49 ? 381  ALA A N   1 
ATOM   3047  C  CA  . ALA A 1 378 ? 7.777   50.986  47.295  1.00 68.45 ? 381  ALA A CA  1 
ATOM   3048  C  C   . ALA A 1 378 ? 7.537   50.471  45.886  1.00 68.69 ? 381  ALA A C   1 
ATOM   3049  O  O   . ALA A 1 378 ? 7.178   49.315  45.698  1.00 68.87 ? 381  ALA A O   1 
ATOM   3050  C  CB  . ALA A 1 378 ? 9.261   50.991  47.584  1.00 68.23 ? 381  ALA A CB  1 
ATOM   3051  N  N   . ARG A 1 379 ? 7.744   51.329  44.894  1.00 68.79 ? 382  ARG A N   1 
ATOM   3052  C  CA  . ARG A 1 379 ? 7.553   50.932  43.508  1.00 68.79 ? 382  ARG A CA  1 
ATOM   3053  C  C   . ARG A 1 379 ? 8.890   50.658  42.837  1.00 67.99 ? 382  ARG A C   1 
ATOM   3054  O  O   . ARG A 1 379 ? 9.588   51.588  42.422  1.00 68.02 ? 382  ARG A O   1 
ATOM   3055  C  CB  . ARG A 1 379 ? 6.803   52.014  42.738  1.00 70.33 ? 382  ARG A CB  1 
ATOM   3056  C  CG  . ARG A 1 379 ? 6.556   51.649  41.284  1.00 72.41 ? 382  ARG A CG  1 
ATOM   3057  C  CD  . ARG A 1 379 ? 5.812   52.749  40.550  1.00 73.93 ? 382  ARG A CD  1 
ATOM   3058  N  NE  . ARG A 1 379 ? 5.560   52.386  39.157  1.00 75.59 ? 382  ARG A NE  1 
ATOM   3059  C  CZ  . ARG A 1 379 ? 4.403   52.583  38.530  1.00 76.52 ? 382  ARG A CZ  1 
ATOM   3060  N  NH1 . ARG A 1 379 ? 3.379   53.147  39.172  1.00 76.67 ? 382  ARG A NH1 1 
ATOM   3061  N  NH2 . ARG A 1 379 ? 4.267   52.208  37.261  1.00 76.57 ? 382  ARG A NH2 1 
ATOM   3062  N  N   . VAL A 1 380 ? 9.238   49.379  42.732  1.00 66.97 ? 383  VAL A N   1 
ATOM   3063  C  CA  . VAL A 1 380 ? 10.497  48.966  42.115  1.00 65.65 ? 383  VAL A CA  1 
ATOM   3064  C  C   . VAL A 1 380 ? 10.476  49.168  40.608  1.00 65.14 ? 383  VAL A C   1 
ATOM   3065  O  O   . VAL A 1 380 ? 9.667   48.574  39.901  1.00 65.33 ? 383  VAL A O   1 
ATOM   3066  C  CB  . VAL A 1 380 ? 10.808  47.491  42.412  1.00 65.14 ? 383  VAL A CB  1 
ATOM   3067  C  CG1 . VAL A 1 380 ? 12.135  47.097  41.798  1.00 64.82 ? 383  VAL A CG1 1 
ATOM   3068  C  CG2 . VAL A 1 380 ? 10.839  47.269  43.896  1.00 64.51 ? 383  VAL A CG2 1 
ATOM   3069  N  N   . ALA A 1 381 ? 11.378  50.008  40.122  1.00 64.37 ? 384  ALA A N   1 
ATOM   3070  C  CA  . ALA A 1 381 ? 11.462  50.288  38.701  1.00 63.76 ? 384  ALA A CA  1 
ATOM   3071  C  C   . ALA A 1 381 ? 12.925  50.514  38.368  1.00 63.41 ? 384  ALA A C   1 
ATOM   3072  O  O   . ALA A 1 381 ? 13.583  51.361  38.984  1.00 63.98 ? 384  ALA A O   1 
ATOM   3073  C  CB  . ALA A 1 381 ? 10.644  51.524  38.365  1.00 63.61 ? 384  ALA A CB  1 
ATOM   3074  N  N   . ASN A 1 382 ? 13.446  49.732  37.429  1.00 62.52 ? 385  ASN A N   1 
ATOM   3075  C  CA  . ASN A 1 382 ? 14.840  49.861  37.031  1.00 61.33 ? 385  ASN A CA  1 
ATOM   3076  C  C   . ASN A 1 382 ? 15.163  49.177  35.715  1.00 60.64 ? 385  ASN A C   1 
ATOM   3077  O  O   . ASN A 1 382 ? 14.273  48.873  34.923  1.00 60.52 ? 385  ASN A O   1 
ATOM   3078  C  CB  . ASN A 1 382 ? 15.761  49.335  38.129  1.00 61.30 ? 385  ASN A CB  1 
ATOM   3079  C  CG  . ASN A 1 382 ? 15.431  47.926  38.539  1.00 61.50 ? 385  ASN A CG  1 
ATOM   3080  O  OD1 . ASN A 1 382 ? 15.414  47.612  39.725  1.00 62.02 ? 385  ASN A OD1 1 
ATOM   3081  N  ND2 . ASN A 1 382 ? 15.179  47.061  37.565  1.00 61.45 ? 385  ASN A ND2 1 
ATOM   3082  N  N   . TYR A 1 383 ? 16.444  48.904  35.503  1.00 59.79 ? 386  TYR A N   1 
ATOM   3083  C  CA  . TYR A 1 383 ? 16.885  48.271  34.275  1.00 59.07 ? 386  TYR A CA  1 
ATOM   3084  C  C   . TYR A 1 383 ? 17.339  46.829  34.435  1.00 58.77 ? 386  TYR A C   1 
ATOM   3085  O  O   . TYR A 1 383 ? 17.939  46.250  33.526  1.00 58.93 ? 386  TYR A O   1 
ATOM   3086  C  CB  . TYR A 1 383 ? 17.957  49.143  33.635  1.00 58.52 ? 386  TYR A CB  1 
ATOM   3087  C  CG  . TYR A 1 383 ? 17.362  50.471  33.264  1.00 58.48 ? 386  TYR A CG  1 
ATOM   3088  C  CD1 . TYR A 1 383 ? 17.333  51.526  34.174  1.00 58.38 ? 386  TYR A CD1 1 
ATOM   3089  C  CD2 . TYR A 1 383 ? 16.712  50.632  32.046  1.00 58.72 ? 386  TYR A CD2 1 
ATOM   3090  C  CE1 . TYR A 1 383 ? 16.651  52.702  33.883  1.00 58.30 ? 386  TYR A CE1 1 
ATOM   3091  C  CE2 . TYR A 1 383 ? 16.033  51.797  31.742  1.00 58.57 ? 386  TYR A CE2 1 
ATOM   3092  C  CZ  . TYR A 1 383 ? 16.004  52.822  32.662  1.00 58.61 ? 386  TYR A CZ  1 
ATOM   3093  O  OH  . TYR A 1 383 ? 15.282  53.944  32.353  1.00 59.20 ? 386  TYR A OH  1 
ATOM   3094  N  N   . GLN A 1 384 ? 17.011  46.233  35.574  1.00 58.52 ? 387  GLN A N   1 
ATOM   3095  C  CA  . GLN A 1 384 ? 17.384  44.853  35.842  1.00 58.42 ? 387  GLN A CA  1 
ATOM   3096  C  C   . GLN A 1 384 ? 16.316  43.936  35.248  1.00 58.67 ? 387  GLN A C   1 
ATOM   3097  O  O   . GLN A 1 384 ? 15.139  44.296  35.210  1.00 58.76 ? 387  GLN A O   1 
ATOM   3098  C  CB  . GLN A 1 384 ? 17.522  44.651  37.348  1.00 58.16 ? 387  GLN A CB  1 
ATOM   3099  C  CG  . GLN A 1 384 ? 18.493  45.645  37.972  1.00 57.39 ? 387  GLN A CG  1 
ATOM   3100  C  CD  . GLN A 1 384 ? 18.617  45.490  39.466  1.00 57.03 ? 387  GLN A CD  1 
ATOM   3101  O  OE1 . GLN A 1 384 ? 18.529  44.385  39.993  1.00 57.17 ? 387  GLN A OE1 1 
ATOM   3102  N  NE2 . GLN A 1 384 ? 18.842  46.599  40.162  1.00 56.68 ? 387  GLN A NE2 1 
ATOM   3103  N  N   . ARG A 1 385 ? 16.724  42.762  34.769  1.00 58.95 ? 388  ARG A N   1 
ATOM   3104  C  CA  . ARG A 1 385 ? 15.786  41.837  34.141  1.00 59.27 ? 388  ARG A CA  1 
ATOM   3105  C  C   . ARG A 1 385 ? 16.214  40.384  34.223  1.00 59.97 ? 388  ARG A C   1 
ATOM   3106  O  O   . ARG A 1 385 ? 17.360  40.076  34.530  1.00 60.21 ? 388  ARG A O   1 
ATOM   3107  C  CB  . ARG A 1 385 ? 15.645  42.172  32.654  1.00 58.64 ? 388  ARG A CB  1 
ATOM   3108  C  CG  . ARG A 1 385 ? 15.110  43.549  32.324  1.00 57.70 ? 388  ARG A CG  1 
ATOM   3109  C  CD  . ARG A 1 385 ? 13.634  43.663  32.640  1.00 57.15 ? 388  ARG A CD  1 
ATOM   3110  N  NE  . ARG A 1 385 ? 13.053  44.833  31.992  1.00 55.93 ? 388  ARG A NE  1 
ATOM   3111  C  CZ  . ARG A 1 385 ? 13.139  46.066  32.465  1.00 55.47 ? 388  ARG A CZ  1 
ATOM   3112  N  NH1 . ARG A 1 385 ? 13.776  46.302  33.603  1.00 55.25 ? 388  ARG A NH1 1 
ATOM   3113  N  NH2 . ARG A 1 385 ? 12.616  47.068  31.781  1.00 55.61 ? 388  ARG A NH2 1 
ATOM   3114  N  N   . ASP A 1 386 ? 15.275  39.498  33.906  1.00 60.82 ? 389  ASP A N   1 
ATOM   3115  C  CA  . ASP A 1 386 ? 15.508  38.061  33.878  1.00 61.61 ? 389  ASP A CA  1 
ATOM   3116  C  C   . ASP A 1 386 ? 16.024  37.453  35.178  1.00 62.23 ? 389  ASP A C   1 
ATOM   3117  O  O   . ASP A 1 386 ? 15.729  37.940  36.270  1.00 62.26 ? 389  ASP A O   1 
ATOM   3118  C  CB  . ASP A 1 386 ? 16.461  37.721  32.726  1.00 62.02 ? 389  ASP A CB  1 
ATOM   3119  C  CG  . ASP A 1 386 ? 16.004  38.304  31.388  1.00 62.57 ? 389  ASP A CG  1 
ATOM   3120  O  OD1 . ASP A 1 386 ? 14.862  38.809  31.308  1.00 63.18 ? 389  ASP A OD1 1 
ATOM   3121  O  OD2 . ASP A 1 386 ? 16.788  38.252  30.414  1.00 62.33 ? 389  ASP A OD2 1 
ATOM   3122  N  N   . GLY A 1 387 ? 16.791  36.377  35.052  1.00 62.81 ? 390  GLY A N   1 
ATOM   3123  C  CA  . GLY A 1 387 ? 17.325  35.713  36.222  1.00 63.81 ? 390  GLY A CA  1 
ATOM   3124  C  C   . GLY A 1 387 ? 16.440  34.566  36.657  1.00 64.75 ? 390  GLY A C   1 
ATOM   3125  O  O   . GLY A 1 387 ? 15.217  34.648  36.543  1.00 64.66 ? 390  GLY A O   1 
ATOM   3126  N  N   . PRO A 1 388 ? 17.032  33.491  37.192  1.00 65.73 ? 391  PRO A N   1 
ATOM   3127  C  CA  . PRO A 1 388 ? 16.296  32.313  37.652  1.00 66.55 ? 391  PRO A CA  1 
ATOM   3128  C  C   . PRO A 1 388 ? 15.126  32.699  38.526  1.00 67.06 ? 391  PRO A C   1 
ATOM   3129  O  O   . PRO A 1 388 ? 15.179  33.684  39.263  1.00 66.84 ? 391  PRO A O   1 
ATOM   3130  C  CB  . PRO A 1 388 ? 17.344  31.557  38.460  1.00 66.70 ? 391  PRO A CB  1 
ATOM   3131  C  CG  . PRO A 1 388 ? 18.614  31.871  37.724  1.00 66.47 ? 391  PRO A CG  1 
ATOM   3132  C  CD  . PRO A 1 388 ? 18.471  33.355  37.477  1.00 66.11 ? 391  PRO A CD  1 
ATOM   3133  N  N   . MET A 1 389 ? 14.064  31.913  38.414  1.00 68.02 ? 392  MET A N   1 
ATOM   3134  C  CA  . MET A 1 389 ? 12.842  32.116  39.176  1.00 69.06 ? 392  MET A CA  1 
ATOM   3135  C  C   . MET A 1 389 ? 12.344  33.557  39.172  1.00 69.78 ? 392  MET A C   1 
ATOM   3136  O  O   . MET A 1 389 ? 12.041  34.127  40.218  1.00 70.10 ? 392  MET A O   1 
ATOM   3137  C  CB  . MET A 1 389 ? 13.008  31.597  40.605  1.00 69.01 ? 392  MET A CB  1 
ATOM   3138  C  CG  . MET A 1 389 ? 13.030  30.080  40.726  1.00 68.84 ? 392  MET A CG  1 
ATOM   3139  S  SD  . MET A 1 389 ? 11.411  29.314  40.488  1.00 69.23 ? 392  MET A SD  1 
ATOM   3140  C  CE  . MET A 1 389 ? 11.748  28.337  39.087  1.00 69.22 ? 392  MET A CE  1 
ATOM   3141  N  N   . CYS A 1 390 ? 12.280  34.142  37.984  1.00 70.50 ? 393  CYS A N   1 
ATOM   3142  C  CA  . CYS A 1 390 ? 11.793  35.498  37.819  1.00 71.36 ? 393  CYS A CA  1 
ATOM   3143  C  C   . CYS A 1 390 ? 10.277  35.447  37.996  1.00 72.01 ? 393  CYS A C   1 
ATOM   3144  O  O   . CYS A 1 390 ? 9.542   35.286  37.028  1.00 71.78 ? 393  CYS A O   1 
ATOM   3145  C  CB  . CYS A 1 390 ? 12.150  35.977  36.422  1.00 71.47 ? 393  CYS A CB  1 
ATOM   3146  S  SG  . CYS A 1 390 ? 11.533  37.591  36.041  1.00 72.58 ? 393  CYS A SG  1 
ATOM   3147  N  N   . MET A 1 391 ? 9.821   35.551  39.243  1.00 73.17 ? 394  MET A N   1 
ATOM   3148  C  CA  . MET A 1 391 ? 8.394   35.479  39.566  1.00 74.42 ? 394  MET A CA  1 
ATOM   3149  C  C   . MET A 1 391 ? 7.556   36.728  39.359  1.00 75.24 ? 394  MET A C   1 
ATOM   3150  O  O   . MET A 1 391 ? 6.518   36.880  40.005  1.00 75.78 ? 394  MET A O   1 
ATOM   3151  C  CB  . MET A 1 391 ? 8.179   34.987  41.000  1.00 74.54 ? 394  MET A CB  1 
ATOM   3152  C  CG  . MET A 1 391 ? 7.697   33.565  41.076  1.00 75.08 ? 394  MET A CG  1 
ATOM   3153  S  SD  . MET A 1 391 ? 8.963   32.509  40.402  1.00 76.38 ? 394  MET A SD  1 
ATOM   3154  C  CE  . MET A 1 391 ? 8.556   30.922  41.110  1.00 76.09 ? 394  MET A CE  1 
ATOM   3155  N  N   . GLN A 1 392 ? 7.968   37.613  38.462  1.00 75.80 ? 395  GLN A N   1 
ATOM   3156  C  CA  . GLN A 1 392 ? 7.183   38.818  38.230  1.00 76.29 ? 395  GLN A CA  1 
ATOM   3157  C  C   . GLN A 1 392 ? 6.871   38.979  36.758  1.00 75.97 ? 395  GLN A C   1 
ATOM   3158  O  O   . GLN A 1 392 ? 7.070   38.053  35.972  1.00 76.17 ? 395  GLN A O   1 
ATOM   3159  C  CB  . GLN A 1 392 ? 7.936   40.036  38.747  1.00 77.44 ? 395  GLN A CB  1 
ATOM   3160  C  CG  . GLN A 1 392 ? 8.242   39.938  40.227  1.00 79.18 ? 395  GLN A CG  1 
ATOM   3161  C  CD  . GLN A 1 392 ? 8.970   41.148  40.776  1.00 80.48 ? 395  GLN A CD  1 
ATOM   3162  O  OE1 . GLN A 1 392 ? 9.227   41.232  41.980  1.00 80.98 ? 395  GLN A OE1 1 
ATOM   3163  N  NE2 . GLN A 1 392 ? 9.314   42.092  39.899  1.00 80.81 ? 395  GLN A NE2 1 
ATOM   3164  N  N   . ASP A 1 393 ? 6.321   40.132  36.395  1.00 75.07 ? 396  ASP A N   1 
ATOM   3165  C  CA  . ASP A 1 393 ? 6.020   40.416  34.998  1.00 74.12 ? 396  ASP A CA  1 
ATOM   3166  C  C   . ASP A 1 393 ? 7.329   40.840  34.319  1.00 73.10 ? 396  ASP A C   1 
ATOM   3167  O  O   . ASP A 1 393 ? 7.352   41.175  33.129  1.00 73.42 ? 396  ASP A O   1 
ATOM   3168  C  CB  . ASP A 1 393 ? 4.987   41.536  34.898  1.00 74.66 ? 396  ASP A CB  1 
ATOM   3169  C  CG  . ASP A 1 393 ? 5.496   42.855  35.454  1.00 75.27 ? 396  ASP A CG  1 
ATOM   3170  O  OD1 . ASP A 1 393 ? 6.246   42.855  36.456  1.00 75.43 ? 396  ASP A OD1 1 
ATOM   3171  O  OD2 . ASP A 1 393 ? 5.146   43.901  34.880  1.00 75.65 ? 396  ASP A OD2 1 
ATOM   3172  N  N   . ASN A 1 394 ? 8.404   40.853  35.110  1.00 71.49 ? 397  ASN A N   1 
ATOM   3173  C  CA  . ASN A 1 394 ? 9.743   41.219  34.652  1.00 69.55 ? 397  ASN A CA  1 
ATOM   3174  C  C   . ASN A 1 394 ? 9.759   42.611  34.010  1.00 68.18 ? 397  ASN A C   1 
ATOM   3175  O  O   . ASN A 1 394 ? 10.500  42.868  33.065  1.00 68.14 ? 397  ASN A O   1 
ATOM   3176  C  CB  . ASN A 1 394 ? 10.270  40.153  33.681  1.00 69.39 ? 397  ASN A CB  1 
ATOM   3177  C  CG  . ASN A 1 394 ? 11.786  40.149  33.575  1.00 69.29 ? 397  ASN A CG  1 
ATOM   3178  O  OD1 . ASN A 1 394 ? 12.349  39.606  32.624  1.00 69.82 ? 397  ASN A OD1 1 
ATOM   3179  N  ND2 . ASN A 1 394 ? 12.456  40.743  34.558  1.00 68.89 ? 397  ASN A ND2 1 
ATOM   3180  N  N   . GLN A 1 395 ? 8.948   43.508  34.562  1.00 66.53 ? 398  GLN A N   1 
ATOM   3181  C  CA  . GLN A 1 395 ? 8.827   44.878  34.081  1.00 64.95 ? 398  GLN A CA  1 
ATOM   3182  C  C   . GLN A 1 395 ? 8.345   44.986  32.637  1.00 64.18 ? 398  GLN A C   1 
ATOM   3183  O  O   . GLN A 1 395 ? 8.607   45.978  31.956  1.00 64.02 ? 398  GLN A O   1 
ATOM   3184  C  CB  . GLN A 1 395 ? 10.125  45.656  34.320  1.00 64.49 ? 398  GLN A CB  1 
ATOM   3185  C  CG  . GLN A 1 395 ? 10.371  45.900  35.804  1.00 64.05 ? 398  GLN A CG  1 
ATOM   3186  C  CD  . GLN A 1 395 ? 11.669  46.629  36.106  1.00 64.09 ? 398  GLN A CD  1 
ATOM   3187  O  OE1 . GLN A 1 395 ? 12.707  46.005  36.320  1.00 64.37 ? 398  GLN A OE1 1 
ATOM   3188  N  NE2 . GLN A 1 395 ? 11.608  47.953  36.167  1.00 64.06 ? 398  GLN A NE2 1 
ATOM   3189  N  N   . GLY A 1 396 ? 7.630   43.953  32.192  1.00 63.58 ? 399  GLY A N   1 
ATOM   3190  C  CA  . GLY A 1 396 ? 7.054   43.916  30.856  1.00 62.72 ? 399  GLY A CA  1 
ATOM   3191  C  C   . GLY A 1 396 ? 7.949   44.262  29.684  1.00 62.17 ? 399  GLY A C   1 
ATOM   3192  O  O   . GLY A 1 396 ? 9.115   43.885  29.654  1.00 62.27 ? 399  GLY A O   1 
ATOM   3193  N  N   . GLY A 1 397 ? 7.386   44.962  28.704  1.00 61.69 ? 400  GLY A N   1 
ATOM   3194  C  CA  . GLY A 1 397 ? 8.146   45.345  27.529  1.00 60.92 ? 400  GLY A CA  1 
ATOM   3195  C  C   . GLY A 1 397 ? 8.776   46.716  27.661  1.00 60.55 ? 400  GLY A C   1 
ATOM   3196  O  O   . GLY A 1 397 ? 9.002   47.401  26.663  1.00 60.79 ? 400  GLY A O   1 
ATOM   3197  N  N   . ALA A 1 398 ? 9.075   47.117  28.890  1.00 60.13 ? 401  ALA A N   1 
ATOM   3198  C  CA  . ALA A 1 398 ? 9.672   48.421  29.138  1.00 59.83 ? 401  ALA A CA  1 
ATOM   3199  C  C   . ALA A 1 398 ? 11.128  48.438  28.697  1.00 59.79 ? 401  ALA A C   1 
ATOM   3200  O  O   . ALA A 1 398 ? 11.832  47.453  28.858  1.00 60.24 ? 401  ALA A O   1 
ATOM   3201  C  CB  . ALA A 1 398 ? 9.568   48.757  30.608  1.00 59.54 ? 401  ALA A CB  1 
ATOM   3202  N  N   . PRO A 1 399 ? 11.592  49.553  28.112  1.00 59.55 ? 402  PRO A N   1 
ATOM   3203  C  CA  . PRO A 1 399 ? 12.971  49.710  27.643  1.00 59.34 ? 402  PRO A CA  1 
ATOM   3204  C  C   . PRO A 1 399 ? 13.942  49.298  28.739  1.00 59.39 ? 402  PRO A C   1 
ATOM   3205  O  O   . PRO A 1 399 ? 13.904  49.829  29.844  1.00 59.34 ? 402  PRO A O   1 
ATOM   3206  C  CB  . PRO A 1 399 ? 13.046  51.199  27.351  1.00 59.17 ? 402  PRO A CB  1 
ATOM   3207  C  CG  . PRO A 1 399 ? 11.683  51.470  26.815  1.00 59.17 ? 402  PRO A CG  1 
ATOM   3208  C  CD  . PRO A 1 399 ? 10.809  50.765  27.818  1.00 59.44 ? 402  PRO A CD  1 
ATOM   3209  N  N   . ASN A 1 400 ? 14.810  48.347  28.413  1.00 59.56 ? 403  ASN A N   1 
ATOM   3210  C  CA  . ASN A 1 400 ? 15.759  47.789  29.365  1.00 59.60 ? 403  ASN A CA  1 
ATOM   3211  C  C   . ASN A 1 400 ? 17.111  48.454  29.451  1.00 59.92 ? 403  ASN A C   1 
ATOM   3212  O  O   . ASN A 1 400 ? 18.022  47.918  30.079  1.00 60.01 ? 403  ASN A O   1 
ATOM   3213  C  CB  . ASN A 1 400 ? 15.959  46.297  29.073  1.00 59.24 ? 403  ASN A CB  1 
ATOM   3214  C  CG  . ASN A 1 400 ? 16.557  46.041  27.705  1.00 58.83 ? 403  ASN A CG  1 
ATOM   3215  O  OD1 . ASN A 1 400 ? 16.813  44.897  27.337  1.00 58.67 ? 403  ASN A OD1 1 
ATOM   3216  N  ND2 . ASN A 1 400 ? 16.789  47.106  26.947  1.00 58.87 ? 403  ASN A ND2 1 
ATOM   3217  N  N   . TYR A 1 401 ? 17.254  49.623  28.854  1.00 60.14 ? 404  TYR A N   1 
ATOM   3218  C  CA  . TYR A 1 401 ? 18.545  50.277  28.899  1.00 60.47 ? 404  TYR A CA  1 
ATOM   3219  C  C   . TYR A 1 401 ? 18.428  51.739  29.291  1.00 60.72 ? 404  TYR A C   1 
ATOM   3220  O  O   . TYR A 1 401 ? 17.460  52.409  28.943  1.00 60.94 ? 404  TYR A O   1 
ATOM   3221  C  CB  . TYR A 1 401 ? 19.225  50.146  27.548  1.00 60.93 ? 404  TYR A CB  1 
ATOM   3222  C  CG  . TYR A 1 401 ? 18.487  50.889  26.478  1.00 61.25 ? 404  TYR A CG  1 
ATOM   3223  C  CD1 . TYR A 1 401 ? 18.929  52.137  26.050  1.00 61.63 ? 404  TYR A CD1 1 
ATOM   3224  C  CD2 . TYR A 1 401 ? 17.327  50.372  25.922  1.00 61.38 ? 404  TYR A CD2 1 
ATOM   3225  C  CE1 . TYR A 1 401 ? 18.231  52.857  25.104  1.00 61.96 ? 404  TYR A CE1 1 
ATOM   3226  C  CE2 . TYR A 1 401 ? 16.620  51.084  24.974  1.00 61.81 ? 404  TYR A CE2 1 
ATOM   3227  C  CZ  . TYR A 1 401 ? 17.080  52.328  24.570  1.00 61.99 ? 404  TYR A CZ  1 
ATOM   3228  O  OH  . TYR A 1 401 ? 16.375  53.065  23.651  1.00 62.83 ? 404  TYR A OH  1 
ATOM   3229  N  N   . TYR A 1 402 ? 19.445  52.232  29.990  1.00 60.78 ? 405  TYR A N   1 
ATOM   3230  C  CA  . TYR A 1 402 ? 19.482  53.610  30.462  1.00 60.67 ? 405  TYR A CA  1 
ATOM   3231  C  C   . TYR A 1 402 ? 20.821  54.216  30.064  1.00 60.88 ? 405  TYR A C   1 
ATOM   3232  O  O   . TYR A 1 402 ? 21.867  53.617  30.301  1.00 60.61 ? 405  TYR A O   1 
ATOM   3233  C  CB  . TYR A 1 402 ? 19.342  53.604  31.981  1.00 60.55 ? 405  TYR A CB  1 
ATOM   3234  C  CG  . TYR A 1 402 ? 19.125  54.954  32.622  1.00 60.55 ? 405  TYR A CG  1 
ATOM   3235  C  CD1 . TYR A 1 402 ? 17.989  55.706  32.343  1.00 60.59 ? 405  TYR A CD1 1 
ATOM   3236  C  CD2 . TYR A 1 402 ? 20.027  55.455  33.555  1.00 60.57 ? 405  TYR A CD2 1 
ATOM   3237  C  CE1 . TYR A 1 402 ? 17.752  56.924  32.983  1.00 60.66 ? 405  TYR A CE1 1 
ATOM   3238  C  CE2 . TYR A 1 402 ? 19.803  56.668  34.198  1.00 60.59 ? 405  TYR A CE2 1 
ATOM   3239  C  CZ  . TYR A 1 402 ? 18.662  57.396  33.911  1.00 60.73 ? 405  TYR A CZ  1 
ATOM   3240  O  OH  . TYR A 1 402 ? 18.426  58.588  34.563  1.00 60.86 ? 405  TYR A OH  1 
ATOM   3241  N  N   . PRO A 1 403 ? 20.819  55.436  29.498  1.00 61.04 ? 406  PRO A N   1 
ATOM   3242  C  CA  . PRO A 1 403 ? 19.641  56.255  29.203  1.00 61.41 ? 406  PRO A CA  1 
ATOM   3243  C  C   . PRO A 1 403 ? 18.922  55.823  27.944  1.00 61.84 ? 406  PRO A C   1 
ATOM   3244  O  O   . PRO A 1 403 ? 19.461  55.082  27.121  1.00 61.89 ? 406  PRO A O   1 
ATOM   3245  C  CB  . PRO A 1 403 ? 20.250  57.639  29.021  1.00 61.22 ? 406  PRO A CB  1 
ATOM   3246  C  CG  . PRO A 1 403 ? 21.518  57.323  28.318  1.00 60.90 ? 406  PRO A CG  1 
ATOM   3247  C  CD  . PRO A 1 403 ? 22.049  56.145  29.111  1.00 60.96 ? 406  PRO A CD  1 
ATOM   3248  N  N   . ASN A 1 404 ? 17.707  56.323  27.784  1.00 62.33 ? 407  ASN A N   1 
ATOM   3249  C  CA  . ASN A 1 404 ? 16.894  56.008  26.621  1.00 62.56 ? 407  ASN A CA  1 
ATOM   3250  C  C   . ASN A 1 404 ? 15.959  57.169  26.368  1.00 62.36 ? 407  ASN A C   1 
ATOM   3251  O  O   . ASN A 1 404 ? 15.642  57.930  27.277  1.00 62.15 ? 407  ASN A O   1 
ATOM   3252  C  CB  . ASN A 1 404 ? 16.083  54.739  26.863  1.00 63.11 ? 407  ASN A CB  1 
ATOM   3253  C  CG  . ASN A 1 404 ? 15.137  54.874  28.029  1.00 63.64 ? 407  ASN A CG  1 
ATOM   3254  O  OD1 . ASN A 1 404 ? 14.040  55.427  27.894  1.00 64.34 ? 407  ASN A OD1 1 
ATOM   3255  N  ND2 . ASN A 1 404 ? 15.559  54.387  29.192  1.00 64.03 ? 407  ASN A ND2 1 
ATOM   3256  N  N   . SER A 1 405 ? 15.505  57.289  25.131  1.00 62.06 ? 408  SER A N   1 
ATOM   3257  C  CA  . SER A 1 405 ? 14.603  58.357  24.758  1.00 61.88 ? 408  SER A CA  1 
ATOM   3258  C  C   . SER A 1 405 ? 13.176  57.829  24.748  1.00 62.08 ? 408  SER A C   1 
ATOM   3259  O  O   . SER A 1 405 ? 12.322  58.379  24.054  1.00 62.47 ? 408  SER A O   1 
ATOM   3260  C  CB  . SER A 1 405 ? 14.973  58.860  23.363  1.00 61.85 ? 408  SER A CB  1 
ATOM   3261  O  OG  . SER A 1 405 ? 16.368  59.077  23.266  1.00 61.54 ? 408  SER A OG  1 
ATOM   3262  N  N   . PHE A 1 406 ? 12.899  56.787  25.532  1.00 61.97 ? 409  PHE A N   1 
ATOM   3263  C  CA  . PHE A 1 406 ? 11.559  56.207  25.535  1.00 61.65 ? 409  PHE A CA  1 
ATOM   3264  C  C   . PHE A 1 406 ? 10.713  56.213  26.815  1.00 62.08 ? 409  PHE A C   1 
ATOM   3265  O  O   . PHE A 1 406 ? 9.725   55.481  26.908  1.00 62.41 ? 409  PHE A O   1 
ATOM   3266  C  CB  . PHE A 1 406 ? 11.599  54.814  24.906  1.00 60.69 ? 409  PHE A CB  1 
ATOM   3267  C  CG  . PHE A 1 406 ? 12.018  54.823  23.459  1.00 59.96 ? 409  PHE A CG  1 
ATOM   3268  C  CD1 . PHE A 1 406 ? 13.362  54.733  23.110  1.00 59.69 ? 409  PHE A CD1 1 
ATOM   3269  C  CD2 . PHE A 1 406 ? 11.073  54.948  22.444  1.00 59.71 ? 409  PHE A CD2 1 
ATOM   3270  C  CE1 . PHE A 1 406 ? 13.760  54.772  21.769  1.00 59.05 ? 409  PHE A CE1 1 
ATOM   3271  C  CE2 . PHE A 1 406 ? 11.461  54.989  21.095  1.00 58.95 ? 409  PHE A CE2 1 
ATOM   3272  C  CZ  . PHE A 1 406 ? 12.806  54.901  20.761  1.00 58.77 ? 409  PHE A CZ  1 
ATOM   3273  N  N   . GLY A 1 407 ? 11.079  57.043  27.787  1.00 62.18 ? 410  GLY A N   1 
ATOM   3274  C  CA  . GLY A 1 407 ? 10.292  57.145  29.009  1.00 62.32 ? 410  GLY A CA  1 
ATOM   3275  C  C   . GLY A 1 407 ? 10.420  56.092  30.097  1.00 62.61 ? 410  GLY A C   1 
ATOM   3276  O  O   . GLY A 1 407 ? 9.515   55.942  30.921  1.00 62.77 ? 410  GLY A O   1 
ATOM   3277  N  N   . ALA A 1 408 ? 11.525  55.356  30.108  1.00 62.62 ? 411  ALA A N   1 
ATOM   3278  C  CA  . ALA A 1 408 ? 11.753  54.341  31.131  1.00 62.82 ? 411  ALA A CA  1 
ATOM   3279  C  C   . ALA A 1 408 ? 12.148  55.095  32.406  1.00 63.20 ? 411  ALA A C   1 
ATOM   3280  O  O   . ALA A 1 408 ? 12.438  56.285  32.347  1.00 63.40 ? 411  ALA A O   1 
ATOM   3281  C  CB  . ALA A 1 408 ? 12.854  53.405  30.685  1.00 62.79 ? 411  ALA A CB  1 
ATOM   3282  N  N   . PRO A 1 409 ? 12.185  54.417  33.568  1.00 63.70 ? 412  PRO A N   1 
ATOM   3283  C  CA  . PRO A 1 409 ? 12.539  55.045  34.850  1.00 64.08 ? 412  PRO A CA  1 
ATOM   3284  C  C   . PRO A 1 409 ? 13.742  56.004  34.849  1.00 64.55 ? 412  PRO A C   1 
ATOM   3285  O  O   . PRO A 1 409 ? 14.705  55.803  34.109  1.00 64.67 ? 412  PRO A O   1 
ATOM   3286  C  CB  . PRO A 1 409 ? 12.780  53.836  35.750  1.00 64.05 ? 412  PRO A CB  1 
ATOM   3287  C  CG  . PRO A 1 409 ? 11.798  52.861  35.236  1.00 63.80 ? 412  PRO A CG  1 
ATOM   3288  C  CD  . PRO A 1 409 ? 11.964  52.973  33.749  1.00 63.70 ? 412  PRO A CD  1 
ATOM   3289  N  N   . GLU A 1 410 ? 13.680  57.044  35.681  1.00 64.82 ? 413  GLU A N   1 
ATOM   3290  C  CA  . GLU A 1 410 ? 14.763  58.022  35.767  1.00 65.04 ? 413  GLU A CA  1 
ATOM   3291  C  C   . GLU A 1 410 ? 15.387  58.096  37.150  1.00 65.29 ? 413  GLU A C   1 
ATOM   3292  O  O   . GLU A 1 410 ? 14.738  57.823  38.160  1.00 65.22 ? 413  GLU A O   1 
ATOM   3293  C  CB  . GLU A 1 410 ? 14.270  59.422  35.383  1.00 65.15 ? 413  GLU A CB  1 
ATOM   3294  C  CG  . GLU A 1 410 ? 14.110  59.682  33.886  1.00 65.36 ? 413  GLU A CG  1 
ATOM   3295  C  CD  . GLU A 1 410 ? 15.435  59.739  33.119  1.00 65.63 ? 413  GLU A CD  1 
ATOM   3296  O  OE1 . GLU A 1 410 ? 15.423  59.475  31.895  1.00 65.38 ? 413  GLU A OE1 1 
ATOM   3297  O  OE2 . GLU A 1 410 ? 16.483  60.062  33.723  1.00 65.88 ? 413  GLU A OE2 1 
ATOM   3298  N  N   . GLN A 1 411 ? 16.655  58.484  37.180  1.00 65.73 ? 414  GLN A N   1 
ATOM   3299  C  CA  . GLN A 1 411 ? 17.380  58.625  38.426  1.00 66.17 ? 414  GLN A CA  1 
ATOM   3300  C  C   . GLN A 1 411 ? 16.904  59.886  39.121  1.00 66.89 ? 414  GLN A C   1 
ATOM   3301  O  O   . GLN A 1 411 ? 16.559  60.872  38.477  1.00 66.84 ? 414  GLN A O   1 
ATOM   3302  C  CB  . GLN A 1 411 ? 18.873  58.709  38.150  1.00 65.96 ? 414  GLN A CB  1 
ATOM   3303  C  CG  . GLN A 1 411 ? 19.261  59.847  37.231  1.00 65.45 ? 414  GLN A CG  1 
ATOM   3304  C  CD  . GLN A 1 411 ? 20.714  59.794  36.842  1.00 65.26 ? 414  GLN A CD  1 
ATOM   3305  O  OE1 . GLN A 1 411 ? 21.333  58.729  36.832  1.00 65.58 ? 414  GLN A OE1 1 
ATOM   3306  N  NE2 . GLN A 1 411 ? 21.269  60.942  36.512  1.00 65.14 ? 414  GLN A NE2 1 
ATOM   3307  N  N   . GLN A 1 412 ? 16.909  59.849  40.443  1.00 67.93 ? 415  GLN A N   1 
ATOM   3308  C  CA  . GLN A 1 412 ? 16.457  60.968  41.246  1.00 69.15 ? 415  GLN A CA  1 
ATOM   3309  C  C   . GLN A 1 412 ? 17.634  61.693  41.899  1.00 69.26 ? 415  GLN A C   1 
ATOM   3310  O  O   . GLN A 1 412 ? 18.222  61.195  42.858  1.00 69.58 ? 415  GLN A O   1 
ATOM   3311  C  CB  . GLN A 1 412 ? 15.522  60.436  42.325  1.00 70.41 ? 415  GLN A CB  1 
ATOM   3312  C  CG  . GLN A 1 412 ? 14.752  61.501  43.073  1.00 72.75 ? 415  GLN A CG  1 
ATOM   3313  C  CD  . GLN A 1 412 ? 13.424  61.811  42.416  1.00 74.06 ? 415  GLN A CD  1 
ATOM   3314  O  OE1 . GLN A 1 412 ? 12.625  60.903  42.159  1.00 74.90 ? 415  GLN A OE1 1 
ATOM   3315  N  NE2 . GLN A 1 412 ? 13.177  63.096  42.139  1.00 74.66 ? 415  GLN A NE2 1 
ATOM   3316  N  N   . PRO A 1 413 ? 17.974  62.893  41.408  1.00 69.10 ? 416  PRO A N   1 
ATOM   3317  C  CA  . PRO A 1 413 ? 19.071  63.721  41.912  1.00 68.95 ? 416  PRO A CA  1 
ATOM   3318  C  C   . PRO A 1 413 ? 19.090  63.933  43.417  1.00 68.90 ? 416  PRO A C   1 
ATOM   3319  O  O   . PRO A 1 413 ? 20.157  64.009  44.016  1.00 69.25 ? 416  PRO A O   1 
ATOM   3320  C  CB  . PRO A 1 413 ? 18.854  65.031  41.183  1.00 68.86 ? 416  PRO A CB  1 
ATOM   3321  C  CG  . PRO A 1 413 ? 18.392  64.560  39.858  1.00 69.21 ? 416  PRO A CG  1 
ATOM   3322  C  CD  . PRO A 1 413 ? 17.375  63.505  40.213  1.00 68.99 ? 416  PRO A CD  1 
ATOM   3323  N  N   . SER A 1 414 ? 17.920  64.019  44.036  1.00 68.84 ? 417  SER A N   1 
ATOM   3324  C  CA  . SER A 1 414 ? 17.853  64.235  45.480  1.00 68.74 ? 417  SER A CA  1 
ATOM   3325  C  C   . SER A 1 414 ? 18.130  62.981  46.301  1.00 68.57 ? 417  SER A C   1 
ATOM   3326  O  O   . SER A 1 414 ? 17.978  62.984  47.523  1.00 68.66 ? 417  SER A O   1 
ATOM   3327  C  CB  . SER A 1 414 ? 16.496  64.810  45.863  1.00 68.86 ? 417  SER A CB  1 
ATOM   3328  O  OG  . SER A 1 414 ? 15.463  63.922  45.490  1.00 69.25 ? 417  SER A OG  1 
ATOM   3329  N  N   . ALA A 1 415 ? 18.538  61.912  45.627  1.00 68.51 ? 418  ALA A N   1 
ATOM   3330  C  CA  . ALA A 1 415 ? 18.842  60.654  46.300  1.00 68.43 ? 418  ALA A CA  1 
ATOM   3331  C  C   . ALA A 1 415 ? 20.341  60.405  46.345  1.00 68.39 ? 418  ALA A C   1 
ATOM   3332  O  O   . ALA A 1 415 ? 20.788  59.324  46.721  1.00 68.49 ? 418  ALA A O   1 
ATOM   3333  C  CB  . ALA A 1 415 ? 18.145  59.503  45.601  1.00 68.45 ? 418  ALA A CB  1 
ATOM   3334  N  N   . LEU A 1 416 ? 21.116  61.404  45.942  1.00 68.19 ? 419  LEU A N   1 
ATOM   3335  C  CA  . LEU A 1 416 ? 22.562  61.280  45.951  1.00 67.95 ? 419  LEU A CA  1 
ATOM   3336  C  C   . LEU A 1 416 ? 23.083  61.113  47.354  1.00 67.82 ? 419  LEU A C   1 
ATOM   3337  O  O   . LEU A 1 416 ? 22.567  61.703  48.297  1.00 68.02 ? 419  LEU A O   1 
ATOM   3338  C  CB  . LEU A 1 416 ? 23.213  62.497  45.314  1.00 68.35 ? 419  LEU A CB  1 
ATOM   3339  C  CG  . LEU A 1 416 ? 23.289  62.394  43.796  1.00 68.74 ? 419  LEU A CG  1 
ATOM   3340  C  CD1 . LEU A 1 416 ? 23.911  63.661  43.207  1.00 68.94 ? 419  LEU A CD1 1 
ATOM   3341  C  CD2 . LEU A 1 416 ? 24.102  61.157  43.430  1.00 68.72 ? 419  LEU A CD2 1 
ATOM   3342  N  N   . GLU A 1 417 ? 24.119  60.300  47.479  1.00 67.48 ? 420  GLU A N   1 
ATOM   3343  C  CA  . GLU A 1 417 ? 24.731  60.035  48.764  1.00 67.13 ? 420  GLU A CA  1 
ATOM   3344  C  C   . GLU A 1 417 ? 25.563  61.233  49.230  1.00 66.95 ? 420  GLU A C   1 
ATOM   3345  O  O   . GLU A 1 417 ? 26.210  61.903  48.423  1.00 66.77 ? 420  GLU A O   1 
ATOM   3346  C  CB  . GLU A 1 417 ? 25.612  58.782  48.663  1.00 67.30 ? 420  GLU A CB  1 
ATOM   3347  C  CG  . GLU A 1 417 ? 24.896  57.513  48.148  1.00 67.44 ? 420  GLU A CG  1 
ATOM   3348  C  CD  . GLU A 1 417 ? 24.966  57.321  46.624  1.00 67.77 ? 420  GLU A CD  1 
ATOM   3349  O  OE1 . GLU A 1 417 ? 25.594  58.145  45.918  1.00 67.68 ? 420  GLU A OE1 1 
ATOM   3350  O  OE2 . GLU A 1 417 ? 24.395  56.320  46.134  1.00 67.59 ? 420  GLU A OE2 1 
ATOM   3351  N  N   . HIS A 1 418 ? 25.524  61.509  50.532  1.00 66.51 ? 421  HIS A N   1 
ATOM   3352  C  CA  . HIS A 1 418 ? 26.290  62.604  51.116  1.00 66.36 ? 421  HIS A CA  1 
ATOM   3353  C  C   . HIS A 1 418 ? 27.758  62.289  50.887  1.00 66.55 ? 421  HIS A C   1 
ATOM   3354  O  O   . HIS A 1 418 ? 28.187  61.173  51.156  1.00 66.92 ? 421  HIS A O   1 
ATOM   3355  C  CB  . HIS A 1 418 ? 26.027  62.677  52.620  1.00 65.91 ? 421  HIS A CB  1 
ATOM   3356  C  CG  . HIS A 1 418 ? 26.944  63.606  53.356  1.00 65.39 ? 421  HIS A CG  1 
ATOM   3357  N  ND1 . HIS A 1 418 ? 28.146  63.195  53.892  1.00 65.16 ? 421  HIS A ND1 1 
ATOM   3358  C  CD2 . HIS A 1 418 ? 26.837  64.927  53.639  1.00 65.32 ? 421  HIS A CD2 1 
ATOM   3359  C  CE1 . HIS A 1 418 ? 28.740  64.223  54.473  1.00 65.23 ? 421  HIS A CE1 1 
ATOM   3360  N  NE2 . HIS A 1 418 ? 27.968  65.287  54.335  1.00 65.00 ? 421  HIS A NE2 1 
ATOM   3361  N  N   . SER A 1 419 ? 28.534  63.253  50.402  1.00 66.90 ? 422  SER A N   1 
ATOM   3362  C  CA  . SER A 1 419 ? 29.950  62.988  50.163  1.00 67.21 ? 422  SER A CA  1 
ATOM   3363  C  C   . SER A 1 419 ? 30.920  63.548  51.203  1.00 67.41 ? 422  SER A C   1 
ATOM   3364  O  O   . SER A 1 419 ? 30.747  64.657  51.710  1.00 67.42 ? 422  SER A O   1 
ATOM   3365  C  CB  . SER A 1 419 ? 30.372  63.367  48.731  1.00 67.34 ? 422  SER A CB  1 
ATOM   3366  O  OG  . SER A 1 419 ? 30.082  64.709  48.401  1.00 67.50 ? 422  SER A OG  1 
ATOM   3367  N  N   . ILE A 1 420 ? 31.924  62.736  51.530  1.00 67.49 ? 423  ILE A N   1 
ATOM   3368  C  CA  . ILE A 1 420 ? 32.954  63.068  52.506  1.00 67.65 ? 423  ILE A CA  1 
ATOM   3369  C  C   . ILE A 1 420 ? 34.336  63.061  51.843  1.00 67.98 ? 423  ILE A C   1 
ATOM   3370  O  O   . ILE A 1 420 ? 34.632  62.217  50.995  1.00 67.90 ? 423  ILE A O   1 
ATOM   3371  C  CB  . ILE A 1 420 ? 32.961  62.045  53.668  1.00 67.45 ? 423  ILE A CB  1 
ATOM   3372  C  CG1 . ILE A 1 420 ? 31.610  62.035  54.383  1.00 67.21 ? 423  ILE A CG1 1 
ATOM   3373  C  CG2 . ILE A 1 420 ? 34.071  62.367  54.659  1.00 67.56 ? 423  ILE A CG2 1 
ATOM   3374  C  CD1 . ILE A 1 420 ? 31.524  61.015  55.499  1.00 66.93 ? 423  ILE A CD1 1 
ATOM   3375  N  N   . GLN A 1 421 ? 35.178  64.009  52.244  1.00 68.18 ? 424  GLN A N   1 
ATOM   3376  C  CA  . GLN A 1 421 ? 36.528  64.135  51.710  1.00 68.06 ? 424  GLN A CA  1 
ATOM   3377  C  C   . GLN A 1 421 ? 37.419  63.133  52.398  1.00 67.45 ? 424  GLN A C   1 
ATOM   3378  O  O   . GLN A 1 421 ? 37.335  62.964  53.614  1.00 67.64 ? 424  GLN A O   1 
ATOM   3379  C  CB  . GLN A 1 421 ? 37.069  65.524  52.008  1.00 68.91 ? 424  GLN A CB  1 
ATOM   3380  C  CG  . GLN A 1 421 ? 38.418  65.808  51.403  1.00 70.06 ? 424  GLN A CG  1 
ATOM   3381  C  CD  . GLN A 1 421 ? 38.329  66.827  50.288  1.00 71.17 ? 424  GLN A CD  1 
ATOM   3382  O  OE1 . GLN A 1 421 ? 38.924  66.651  49.222  1.00 71.42 ? 424  GLN A OE1 1 
ATOM   3383  N  NE2 . GLN A 1 421 ? 37.579  67.909  50.528  1.00 71.42 ? 424  GLN A NE2 1 
ATOM   3384  N  N   . TYR A 1 422 ? 38.282  62.484  51.627  1.00 66.67 ? 425  TYR A N   1 
ATOM   3385  C  CA  . TYR A 1 422 ? 39.215  61.505  52.174  1.00 66.13 ? 425  TYR A CA  1 
ATOM   3386  C  C   . TYR A 1 422 ? 40.595  61.698  51.560  1.00 66.12 ? 425  TYR A C   1 
ATOM   3387  O  O   . TYR A 1 422 ? 40.726  62.353  50.526  1.00 66.18 ? 425  TYR A O   1 
ATOM   3388  C  CB  . TYR A 1 422 ? 38.740  60.081  51.893  1.00 65.39 ? 425  TYR A CB  1 
ATOM   3389  C  CG  . TYR A 1 422 ? 37.584  59.612  52.744  1.00 64.57 ? 425  TYR A CG  1 
ATOM   3390  C  CD1 . TYR A 1 422 ? 37.772  59.245  54.074  1.00 64.29 ? 425  TYR A CD1 1 
ATOM   3391  C  CD2 . TYR A 1 422 ? 36.307  59.508  52.210  1.00 64.26 ? 425  TYR A CD2 1 
ATOM   3392  C  CE1 . TYR A 1 422 ? 36.709  58.783  54.850  1.00 64.10 ? 425  TYR A CE1 1 
ATOM   3393  C  CE2 . TYR A 1 422 ? 35.242  59.050  52.971  1.00 63.98 ? 425  TYR A CE2 1 
ATOM   3394  C  CZ  . TYR A 1 422 ? 35.446  58.691  54.287  1.00 64.05 ? 425  TYR A CZ  1 
ATOM   3395  O  OH  . TYR A 1 422 ? 34.380  58.253  55.039  1.00 64.02 ? 425  TYR A OH  1 
ATOM   3396  N  N   . SER A 1 423 ? 41.618  61.130  52.195  1.00 66.07 ? 426  SER A N   1 
ATOM   3397  C  CA  . SER A 1 423 ? 42.985  61.240  51.690  1.00 66.28 ? 426  SER A CA  1 
ATOM   3398  C  C   . SER A 1 423 ? 43.896  60.192  52.305  1.00 66.24 ? 426  SER A C   1 
ATOM   3399  O  O   . SER A 1 423 ? 43.919  60.018  53.521  1.00 66.41 ? 426  SER A O   1 
ATOM   3400  C  CB  . SER A 1 423 ? 43.563  62.626  51.962  1.00 66.21 ? 426  SER A CB  1 
ATOM   3401  O  OG  . SER A 1 423 ? 44.819  62.765  51.318  1.00 66.16 ? 426  SER A OG  1 
ATOM   3402  N  N   . GLY A 1 424 ? 44.657  59.504  51.462  1.00 66.51 ? 427  GLY A N   1 
ATOM   3403  C  CA  . GLY A 1 424 ? 45.555  58.480  51.963  1.00 66.59 ? 427  GLY A CA  1 
ATOM   3404  C  C   . GLY A 1 424 ? 45.890  57.415  50.940  1.00 66.54 ? 427  GLY A C   1 
ATOM   3405  O  O   . GLY A 1 424 ? 45.388  57.427  49.812  1.00 66.75 ? 427  GLY A O   1 
ATOM   3406  N  N   . GLU A 1 425 ? 46.767  56.501  51.331  1.00 66.51 ? 428  GLU A N   1 
ATOM   3407  C  CA  . GLU A 1 425 ? 47.176  55.428  50.450  1.00 66.69 ? 428  GLU A CA  1 
ATOM   3408  C  C   . GLU A 1 425 ? 46.152  54.324  50.403  1.00 66.63 ? 428  GLU A C   1 
ATOM   3409  O  O   . GLU A 1 425 ? 45.496  54.019  51.397  1.00 66.62 ? 428  GLU A O   1 
ATOM   3410  C  CB  . GLU A 1 425 ? 48.495  54.817  50.906  1.00 67.14 ? 428  GLU A CB  1 
ATOM   3411  C  CG  . GLU A 1 425 ? 49.710  55.686  50.690  1.00 67.91 ? 428  GLU A CG  1 
ATOM   3412  C  CD  . GLU A 1 425 ? 51.001  54.937  50.959  1.00 68.22 ? 428  GLU A CD  1 
ATOM   3413  O  OE1 . GLU A 1 425 ? 51.075  54.219  51.977  1.00 68.67 ? 428  GLU A OE1 1 
ATOM   3414  O  OE2 . GLU A 1 425 ? 51.942  55.060  50.149  1.00 68.53 ? 428  GLU A OE2 1 
ATOM   3415  N  N   . VAL A 1 426 ? 46.040  53.708  49.237  1.00 66.54 ? 429  VAL A N   1 
ATOM   3416  C  CA  . VAL A 1 426 ? 45.135  52.594  49.055  1.00 66.37 ? 429  VAL A CA  1 
ATOM   3417  C  C   . VAL A 1 426 ? 45.906  51.371  49.523  1.00 66.19 ? 429  VAL A C   1 
ATOM   3418  O  O   . VAL A 1 426 ? 46.628  50.745  48.736  1.00 66.05 ? 429  VAL A O   1 
ATOM   3419  C  CB  . VAL A 1 426 ? 44.740  52.466  47.587  1.00 66.53 ? 429  VAL A CB  1 
ATOM   3420  C  CG1 . VAL A 1 426 ? 44.151  51.099  47.305  1.00 66.95 ? 429  VAL A CG1 1 
ATOM   3421  C  CG2 . VAL A 1 426 ? 43.722  53.530  47.264  1.00 66.44 ? 429  VAL A CG2 1 
ATOM   3422  N  N   . ARG A 1 427 ? 45.792  51.067  50.818  1.00 65.95 ? 430  ARG A N   1 
ATOM   3423  C  CA  . ARG A 1 427 ? 46.508  49.928  51.391  1.00 65.65 ? 430  ARG A CA  1 
ATOM   3424  C  C   . ARG A 1 427 ? 45.820  49.235  52.568  1.00 64.99 ? 430  ARG A C   1 
ATOM   3425  O  O   . ARG A 1 427 ? 44.674  49.541  52.908  1.00 64.89 ? 430  ARG A O   1 
ATOM   3426  C  CB  . ARG A 1 427 ? 47.922  50.348  51.810  1.00 66.61 ? 430  ARG A CB  1 
ATOM   3427  C  CG  . ARG A 1 427 ? 47.963  51.455  52.848  1.00 67.16 ? 430  ARG A CG  1 
ATOM   3428  C  CD  . ARG A 1 427 ? 49.224  51.382  53.699  1.00 67.80 ? 430  ARG A CD  1 
ATOM   3429  N  NE  . ARG A 1 427 ? 50.427  51.652  52.923  1.00 68.64 ? 430  ARG A NE  1 
ATOM   3430  C  CZ  . ARG A 1 427 ? 51.473  50.835  52.856  1.00 69.49 ? 430  ARG A CZ  1 
ATOM   3431  N  NH1 . ARG A 1 427 ? 51.470  49.687  53.521  1.00 69.47 ? 430  ARG A NH1 1 
ATOM   3432  N  NH2 . ARG A 1 427 ? 52.530  51.166  52.123  1.00 69.60 ? 430  ARG A NH2 1 
ATOM   3433  N  N   . ARG A 1 428 ? 46.542  48.287  53.165  1.00 63.93 ? 431  ARG A N   1 
ATOM   3434  C  CA  . ARG A 1 428 ? 46.065  47.510  54.302  1.00 62.92 ? 431  ARG A CA  1 
ATOM   3435  C  C   . ARG A 1 428 ? 46.681  48.031  55.592  1.00 62.61 ? 431  ARG A C   1 
ATOM   3436  O  O   . ARG A 1 428 ? 47.810  47.679  55.944  1.00 62.53 ? 431  ARG A O   1 
ATOM   3437  C  CB  . ARG A 1 428 ? 46.435  46.038  54.120  1.00 62.41 ? 431  ARG A CB  1 
ATOM   3438  C  CG  . ARG A 1 428 ? 45.888  45.447  52.846  1.00 61.27 ? 431  ARG A CG  1 
ATOM   3439  C  CD  . ARG A 1 428 ? 46.228  43.986  52.707  1.00 60.57 ? 431  ARG A CD  1 
ATOM   3440  N  NE  . ARG A 1 428 ? 45.780  43.482  51.413  1.00 59.96 ? 431  ARG A NE  1 
ATOM   3441  C  CZ  . ARG A 1 428 ? 44.524  43.156  51.134  1.00 59.88 ? 431  ARG A CZ  1 
ATOM   3442  N  NH1 . ARG A 1 428 ? 43.586  43.266  52.063  1.00 59.73 ? 431  ARG A NH1 1 
ATOM   3443  N  NH2 . ARG A 1 428 ? 44.193  42.772  49.908  1.00 59.48 ? 431  ARG A NH2 1 
ATOM   3444  N  N   . PHE A 1 429 ? 45.938  48.887  56.282  1.00 62.45 ? 432  PHE A N   1 
ATOM   3445  C  CA  . PHE A 1 429 ? 46.404  49.464  57.533  1.00 62.43 ? 432  PHE A CA  1 
ATOM   3446  C  C   . PHE A 1 429 ? 46.077  48.490  58.646  1.00 62.51 ? 432  PHE A C   1 
ATOM   3447  O  O   . PHE A 1 429 ? 44.976  47.948  58.693  1.00 62.79 ? 432  PHE A O   1 
ATOM   3448  C  CB  . PHE A 1 429 ? 45.710  50.806  57.781  1.00 61.73 ? 432  PHE A CB  1 
ATOM   3449  C  CG  . PHE A 1 429 ? 45.862  51.782  56.646  1.00 61.18 ? 432  PHE A CG  1 
ATOM   3450  C  CD1 . PHE A 1 429 ? 46.961  52.636  56.585  1.00 61.11 ? 432  PHE A CD1 1 
ATOM   3451  C  CD2 . PHE A 1 429 ? 44.918  51.831  55.623  1.00 61.01 ? 432  PHE A CD2 1 
ATOM   3452  C  CE1 . PHE A 1 429 ? 47.118  53.525  55.520  1.00 60.84 ? 432  PHE A CE1 1 
ATOM   3453  C  CE2 . PHE A 1 429 ? 45.065  52.713  54.553  1.00 60.71 ? 432  PHE A CE2 1 
ATOM   3454  C  CZ  . PHE A 1 429 ? 46.167  53.560  54.502  1.00 60.73 ? 432  PHE A CZ  1 
ATOM   3455  N  N   . ASN A 1 430 ? 47.022  48.263  59.546  1.00 62.73 ? 433  ASN A N   1 
ATOM   3456  C  CA  . ASN A 1 430 ? 46.784  47.327  60.628  1.00 63.18 ? 433  ASN A CA  1 
ATOM   3457  C  C   . ASN A 1 430 ? 45.994  47.937  61.768  1.00 63.46 ? 433  ASN A C   1 
ATOM   3458  O  O   . ASN A 1 430 ? 46.272  49.055  62.178  1.00 63.68 ? 433  ASN A O   1 
ATOM   3459  C  CB  . ASN A 1 430 ? 48.103  46.794  61.155  1.00 63.52 ? 433  ASN A CB  1 
ATOM   3460  C  CG  . ASN A 1 430 ? 47.916  45.600  62.045  1.00 63.88 ? 433  ASN A CG  1 
ATOM   3461  O  OD1 . ASN A 1 430 ? 46.898  44.901  61.962  1.00 64.26 ? 433  ASN A OD1 1 
ATOM   3462  N  ND2 . ASN A 1 430 ? 48.892  45.351  62.908  1.00 63.93 ? 433  ASN A ND2 1 
ATOM   3463  N  N   . THR A 1 431 ? 45.022  47.195  62.291  1.00 64.06 ? 434  THR A N   1 
ATOM   3464  C  CA  . THR A 1 431 ? 44.196  47.680  63.403  1.00 64.61 ? 434  THR A CA  1 
ATOM   3465  C  C   . THR A 1 431 ? 44.246  46.757  64.601  1.00 65.15 ? 434  THR A C   1 
ATOM   3466  O  O   . THR A 1 431 ? 43.590  47.012  65.616  1.00 65.41 ? 434  THR A O   1 
ATOM   3467  C  CB  . THR A 1 431 ? 42.721  47.773  63.034  1.00 64.57 ? 434  THR A CB  1 
ATOM   3468  O  OG1 . THR A 1 431 ? 42.248  46.477  62.647  1.00 64.65 ? 434  THR A OG1 1 
ATOM   3469  C  CG2 . THR A 1 431 ? 42.508  48.763  61.918  1.00 64.72 ? 434  THR A CG2 1 
ATOM   3470  N  N   . ALA A 1 432 ? 44.977  45.659  64.463  1.00 65.44 ? 435  ALA A N   1 
ATOM   3471  C  CA  . ALA A 1 432 ? 45.097  44.690  65.536  1.00 65.75 ? 435  ALA A CA  1 
ATOM   3472  C  C   . ALA A 1 432 ? 45.549  45.360  66.817  1.00 66.07 ? 435  ALA A C   1 
ATOM   3473  O  O   . ALA A 1 432 ? 45.119  44.971  67.902  1.00 66.30 ? 435  ALA A O   1 
ATOM   3474  C  CB  . ALA A 1 432 ? 46.081  43.597  65.147  1.00 65.71 ? 435  ALA A CB  1 
ATOM   3475  N  N   . ASN A 1 433 ? 46.354  46.412  66.693  1.00 66.33 ? 436  ASN A N   1 
ATOM   3476  C  CA  . ASN A 1 433 ? 46.865  47.069  67.880  1.00 66.68 ? 436  ASN A CA  1 
ATOM   3477  C  C   . ASN A 1 433 ? 46.244  48.326  68.406  1.00 66.46 ? 436  ASN A C   1 
ATOM   3478  O  O   . ASN A 1 433 ? 46.878  49.082  69.137  1.00 66.54 ? 436  ASN A O   1 
ATOM   3479  C  CB  . ASN A 1 433 ? 48.368  47.202  67.809  1.00 67.51 ? 436  ASN A CB  1 
ATOM   3480  C  CG  . ASN A 1 433 ? 49.048  45.873  67.971  1.00 68.26 ? 436  ASN A CG  1 
ATOM   3481  O  OD1 . ASN A 1 433 ? 48.802  45.149  68.946  1.00 68.44 ? 436  ASN A OD1 1 
ATOM   3482  N  ND2 . ASN A 1 433 ? 49.866  45.507  66.992  1.00 69.04 ? 436  ASN A ND2 1 
ATOM   3483  N  N   . ASP A 1 434 ? 44.986  48.542  68.074  1.00 66.38 ? 437  ASP A N   1 
ATOM   3484  C  CA  . ASP A 1 434 ? 44.294  49.689  68.621  1.00 66.39 ? 437  ASP A CA  1 
ATOM   3485  C  C   . ASP A 1 434 ? 44.067  49.288  70.075  1.00 65.96 ? 437  ASP A C   1 
ATOM   3486  O  O   . ASP A 1 434 ? 44.461  48.191  70.489  1.00 66.00 ? 437  ASP A O   1 
ATOM   3487  C  CB  . ASP A 1 434 ? 42.964  49.884  67.905  1.00 66.95 ? 437  ASP A CB  1 
ATOM   3488  C  CG  . ASP A 1 434 ? 43.142  50.359  66.486  1.00 67.77 ? 437  ASP A CG  1 
ATOM   3489  O  OD1 . ASP A 1 434 ? 42.224  51.032  65.972  1.00 68.19 ? 437  ASP A OD1 1 
ATOM   3490  O  OD2 . ASP A 1 434 ? 44.206  50.075  65.885  1.00 68.40 ? 437  ASP A OD2 1 
ATOM   3491  N  N   . ASP A 1 435 ? 43.464  50.164  70.863  1.00 65.32 ? 438  ASP A N   1 
ATOM   3492  C  CA  . ASP A 1 435 ? 43.214  49.823  72.251  1.00 64.87 ? 438  ASP A CA  1 
ATOM   3493  C  C   . ASP A 1 435 ? 42.275  48.622  72.321  1.00 64.77 ? 438  ASP A C   1 
ATOM   3494  O  O   . ASP A 1 435 ? 41.187  48.638  71.747  1.00 64.98 ? 438  ASP A O   1 
ATOM   3495  C  CB  . ASP A 1 435 ? 42.591  50.995  72.981  1.00 64.84 ? 438  ASP A CB  1 
ATOM   3496  C  CG  . ASP A 1 435 ? 42.452  50.737  74.445  1.00 64.80 ? 438  ASP A CG  1 
ATOM   3497  O  OD1 . ASP A 1 435 ? 43.206  51.365  75.206  1.00 65.12 ? 438  ASP A OD1 1 
ATOM   3498  O  OD2 . ASP A 1 435 ? 41.614  49.899  74.838  1.00 64.49 ? 438  ASP A OD2 1 
ATOM   3499  N  N   . ASN A 1 436 ? 42.701  47.581  73.026  1.00 64.44 ? 439  ASN A N   1 
ATOM   3500  C  CA  . ASN A 1 436 ? 41.900  46.372  73.169  1.00 63.84 ? 439  ASN A CA  1 
ATOM   3501  C  C   . ASN A 1 436 ? 41.479  46.160  74.613  1.00 63.88 ? 439  ASN A C   1 
ATOM   3502  O  O   . ASN A 1 436 ? 40.802  45.175  74.915  1.00 63.87 ? 439  ASN A O   1 
ATOM   3503  C  CB  . ASN A 1 436 ? 42.702  45.146  72.717  1.00 63.17 ? 439  ASN A CB  1 
ATOM   3504  C  CG  . ASN A 1 436 ? 43.095  45.210  71.260  1.00 62.75 ? 439  ASN A CG  1 
ATOM   3505  O  OD1 . ASN A 1 436 ? 42.251  45.397  70.387  1.00 62.68 ? 439  ASN A OD1 1 
ATOM   3506  N  ND2 . ASN A 1 436 ? 44.384  45.058  70.988  1.00 62.32 ? 439  ASN A ND2 1 
ATOM   3507  N  N   . VAL A 1 437 ? 41.801  47.110  75.492  1.00 63.60 ? 440  VAL A N   1 
ATOM   3508  C  CA  . VAL A 1 437 ? 41.489  46.926  76.908  1.00 63.37 ? 440  VAL A CA  1 
ATOM   3509  C  C   . VAL A 1 437 ? 40.755  47.990  77.716  1.00 63.15 ? 440  VAL A C   1 
ATOM   3510  O  O   . VAL A 1 437 ? 39.959  47.647  78.589  1.00 63.01 ? 440  VAL A O   1 
ATOM   3511  C  CB  . VAL A 1 437 ? 42.774  46.592  77.696  1.00 63.45 ? 440  VAL A CB  1 
ATOM   3512  C  CG1 . VAL A 1 437 ? 43.370  45.263  77.220  1.00 63.05 ? 440  VAL A CG1 1 
ATOM   3513  C  CG2 . VAL A 1 437 ? 43.783  47.718  77.535  1.00 62.96 ? 440  VAL A CG2 1 
ATOM   3514  N  N   . THR A 1 438 ? 41.045  49.264  77.474  1.00 62.91 ? 441  THR A N   1 
ATOM   3515  C  CA  . THR A 1 438 ? 40.426  50.330  78.253  1.00 62.59 ? 441  THR A CA  1 
ATOM   3516  C  C   . THR A 1 438 ? 38.932  50.208  78.477  1.00 62.78 ? 441  THR A C   1 
ATOM   3517  O  O   . THR A 1 438 ? 38.491  50.116  79.617  1.00 62.86 ? 441  THR A O   1 
ATOM   3518  C  CB  . THR A 1 438 ? 40.738  51.706  77.687  1.00 62.45 ? 441  THR A CB  1 
ATOM   3519  O  OG1 . THR A 1 438 ? 42.155  51.868  77.610  1.00 62.23 ? 441  THR A OG1 1 
ATOM   3520  C  CG2 . THR A 1 438 ? 40.184  52.783  78.597  1.00 62.07 ? 441  THR A CG2 1 
ATOM   3521  N  N   . GLN A 1 439 ? 38.153  50.210  77.400  1.00 63.00 ? 442  GLN A N   1 
ATOM   3522  C  CA  . GLN A 1 439 ? 36.704  50.102  77.527  1.00 63.25 ? 442  GLN A CA  1 
ATOM   3523  C  C   . GLN A 1 439 ? 36.285  48.788  78.144  1.00 63.78 ? 442  GLN A C   1 
ATOM   3524  O  O   . GLN A 1 439 ? 35.170  48.661  78.649  1.00 64.30 ? 442  GLN A O   1 
ATOM   3525  C  CB  . GLN A 1 439 ? 36.019  50.252  76.181  1.00 62.67 ? 442  GLN A CB  1 
ATOM   3526  C  CG  . GLN A 1 439 ? 36.053  51.646  75.648  1.00 62.15 ? 442  GLN A CG  1 
ATOM   3527  C  CD  . GLN A 1 439 ? 34.939  51.898  74.661  1.00 62.31 ? 442  GLN A CD  1 
ATOM   3528  O  OE1 . GLN A 1 439 ? 34.263  50.970  74.204  1.00 62.09 ? 442  GLN A OE1 1 
ATOM   3529  N  NE2 . GLN A 1 439 ? 34.724  53.168  74.335  1.00 61.95 ? 442  GLN A NE2 1 
ATOM   3530  N  N   . VAL A 1 440 ? 37.167  47.799  78.068  1.00 64.04 ? 443  VAL A N   1 
ATOM   3531  C  CA  . VAL A 1 440 ? 36.881  46.494  78.633  1.00 64.28 ? 443  VAL A CA  1 
ATOM   3532  C  C   . VAL A 1 440 ? 37.026  46.596  80.149  1.00 64.83 ? 443  VAL A C   1 
ATOM   3533  O  O   . VAL A 1 440 ? 36.207  46.068  80.904  1.00 64.92 ? 443  VAL A O   1 
ATOM   3534  C  CB  . VAL A 1 440 ? 37.853  45.446  78.095  1.00 64.10 ? 443  VAL A CB  1 
ATOM   3535  C  CG1 . VAL A 1 440 ? 37.405  44.061  78.499  1.00 64.01 ? 443  VAL A CG1 1 
ATOM   3536  C  CG2 . VAL A 1 440 ? 37.953  45.557  76.581  1.00 64.12 ? 443  VAL A CG2 1 
ATOM   3537  N  N   . ARG A 1 441 ? 38.056  47.317  80.586  1.00 65.53 ? 444  ARG A N   1 
ATOM   3538  C  CA  . ARG A 1 441 ? 38.325  47.519  82.008  1.00 65.77 ? 444  ARG A CA  1 
ATOM   3539  C  C   . ARG A 1 441 ? 37.159  48.252  82.663  1.00 65.90 ? 444  ARG A C   1 
ATOM   3540  O  O   . ARG A 1 441 ? 36.733  47.902  83.767  1.00 66.11 ? 444  ARG A O   1 
ATOM   3541  C  CB  . ARG A 1 441 ? 39.611  48.326  82.178  1.00 65.83 ? 444  ARG A CB  1 
ATOM   3542  C  CG  . ARG A 1 441 ? 39.995  48.608  83.615  1.00 65.69 ? 444  ARG A CG  1 
ATOM   3543  C  CD  . ARG A 1 441 ? 41.295  49.380  83.675  1.00 65.61 ? 444  ARG A CD  1 
ATOM   3544  N  NE  . ARG A 1 441 ? 42.353  48.661  82.980  1.00 65.75 ? 444  ARG A NE  1 
ATOM   3545  C  CZ  . ARG A 1 441 ? 43.169  49.212  82.091  1.00 65.86 ? 444  ARG A CZ  1 
ATOM   3546  N  NH1 . ARG A 1 441 ? 44.100  48.472  81.499  1.00 65.89 ? 444  ARG A NH1 1 
ATOM   3547  N  NH2 . ARG A 1 441 ? 43.057  50.501  81.796  1.00 65.63 ? 444  ARG A NH2 1 
ATOM   3548  N  N   . ALA A 1 442 ? 36.636  49.261  81.972  1.00 65.79 ? 445  ALA A N   1 
ATOM   3549  C  CA  . ALA A 1 442 ? 35.514  50.031  82.492  1.00 65.85 ? 445  ALA A CA  1 
ATOM   3550  C  C   . ALA A 1 442 ? 34.331  49.105  82.778  1.00 65.74 ? 445  ALA A C   1 
ATOM   3551  O  O   . ALA A 1 442 ? 33.727  49.152  83.851  1.00 66.06 ? 445  ALA A O   1 
ATOM   3552  C  CB  . ALA A 1 442 ? 35.120  51.123  81.497  1.00 65.73 ? 445  ALA A CB  1 
ATOM   3553  N  N   . PHE A 1 443 ? 34.029  48.237  81.822  1.00 65.69 ? 446  PHE A N   1 
ATOM   3554  C  CA  . PHE A 1 443 ? 32.930  47.300  81.975  1.00 65.67 ? 446  PHE A CA  1 
ATOM   3555  C  C   . PHE A 1 443 ? 33.135  46.446  83.217  1.00 65.62 ? 446  PHE A C   1 
ATOM   3556  O  O   . PHE A 1 443 ? 32.260  46.372  84.080  1.00 66.04 ? 446  PHE A O   1 
ATOM   3557  C  CB  . PHE A 1 443 ? 32.818  46.411  80.734  1.00 65.42 ? 446  PHE A CB  1 
ATOM   3558  C  CG  . PHE A 1 443 ? 31.832  45.286  80.878  1.00 65.34 ? 446  PHE A CG  1 
ATOM   3559  C  CD1 . PHE A 1 443 ? 30.481  45.545  81.057  1.00 65.62 ? 446  PHE A CD1 1 
ATOM   3560  C  CD2 . PHE A 1 443 ? 32.259  43.967  80.846  1.00 65.15 ? 446  PHE A CD2 1 
ATOM   3561  C  CE1 . PHE A 1 443 ? 29.566  44.499  81.204  1.00 65.74 ? 446  PHE A CE1 1 
ATOM   3562  C  CE2 . PHE A 1 443 ? 31.354  42.915  80.991  1.00 65.19 ? 446  PHE A CE2 1 
ATOM   3563  C  CZ  . PHE A 1 443 ? 30.006  43.182  81.170  1.00 65.41 ? 446  PHE A CZ  1 
ATOM   3564  N  N   . TYR A 1 444 ? 34.308  45.839  83.325  1.00 65.44 ? 447  TYR A N   1 
ATOM   3565  C  CA  . TYR A 1 444 ? 34.615  44.979  84.458  1.00 65.31 ? 447  TYR A CA  1 
ATOM   3566  C  C   . TYR A 1 444 ? 34.580  45.731  85.787  1.00 65.38 ? 447  TYR A C   1 
ATOM   3567  O  O   . TYR A 1 444 ? 33.924  45.301  86.739  1.00 65.48 ? 447  TYR A O   1 
ATOM   3568  C  CB  . TYR A 1 444 ? 35.983  44.313  84.248  1.00 64.77 ? 447  TYR A CB  1 
ATOM   3569  C  CG  . TYR A 1 444 ? 36.381  43.317  85.317  1.00 64.59 ? 447  TYR A CG  1 
ATOM   3570  C  CD1 . TYR A 1 444 ? 37.120  43.720  86.427  1.00 64.68 ? 447  TYR A CD1 1 
ATOM   3571  C  CD2 . TYR A 1 444 ? 36.027  41.974  85.218  1.00 64.53 ? 447  TYR A CD2 1 
ATOM   3572  C  CE1 . TYR A 1 444 ? 37.499  42.812  87.413  1.00 64.35 ? 447  TYR A CE1 1 
ATOM   3573  C  CE2 . TYR A 1 444 ? 36.402  41.055  86.204  1.00 64.37 ? 447  TYR A CE2 1 
ATOM   3574  C  CZ  . TYR A 1 444 ? 37.137  41.487  87.298  1.00 64.47 ? 447  TYR A CZ  1 
ATOM   3575  O  OH  . TYR A 1 444 ? 37.513  40.604  88.285  1.00 64.41 ? 447  TYR A OH  1 
ATOM   3576  N  N   . VAL A 1 445 ? 35.222  46.889  85.830  1.00 65.55 ? 448  VAL A N   1 
ATOM   3577  C  CA  . VAL A 1 445 ? 35.292  47.657  87.065  1.00 65.72 ? 448  VAL A CA  1 
ATOM   3578  C  C   . VAL A 1 445 ? 34.071  48.472  87.447  1.00 66.04 ? 448  VAL A C   1 
ATOM   3579  O  O   . VAL A 1 445 ? 33.632  48.440  88.595  1.00 66.07 ? 448  VAL A O   1 
ATOM   3580  C  CB  . VAL A 1 445 ? 36.511  48.602  87.069  1.00 65.77 ? 448  VAL A CB  1 
ATOM   3581  C  CG1 . VAL A 1 445 ? 36.591  49.357  88.391  1.00 65.53 ? 448  VAL A CG1 1 
ATOM   3582  C  CG2 . VAL A 1 445 ? 37.787  47.814  86.844  1.00 65.55 ? 448  VAL A CG2 1 
ATOM   3583  N  N   . ASN A 1 446 ? 33.544  49.232  86.501  1.00 66.10 ? 449  ASN A N   1 
ATOM   3584  C  CA  . ASN A 1 446 ? 32.417  50.091  86.802  1.00 66.18 ? 449  ASN A CA  1 
ATOM   3585  C  C   . ASN A 1 446 ? 31.045  49.562  86.469  1.00 66.12 ? 449  ASN A C   1 
ATOM   3586  O  O   . ASN A 1 446 ? 30.073  49.915  87.130  1.00 66.44 ? 449  ASN A O   1 
ATOM   3587  C  CB  . ASN A 1 446 ? 32.628  51.453  86.158  1.00 66.46 ? 449  ASN A CB  1 
ATOM   3588  C  CG  . ASN A 1 446 ? 33.934  52.086  86.577  1.00 66.67 ? 449  ASN A CG  1 
ATOM   3589  O  OD1 . ASN A 1 446 ? 34.723  52.511  85.739  1.00 66.84 ? 449  ASN A OD1 1 
ATOM   3590  N  ND2 . ASN A 1 446 ? 34.185  52.121  87.882  1.00 66.83 ? 449  ASN A ND2 1 
ATOM   3591  N  N   . VAL A 1 447 ? 30.929  48.737  85.445  1.00 65.97 ? 450  VAL A N   1 
ATOM   3592  C  CA  . VAL A 1 447 ? 29.611  48.232  85.128  1.00 65.98 ? 450  VAL A CA  1 
ATOM   3593  C  C   . VAL A 1 447 ? 29.228  47.033  85.989  1.00 66.72 ? 450  VAL A C   1 
ATOM   3594  O  O   . VAL A 1 447 ? 28.172  47.042  86.616  1.00 66.94 ? 450  VAL A O   1 
ATOM   3595  C  CB  . VAL A 1 447 ? 29.461  47.940  83.630  1.00 65.36 ? 450  VAL A CB  1 
ATOM   3596  C  CG1 . VAL A 1 447 ? 28.148  47.245  83.352  1.00 64.71 ? 450  VAL A CG1 1 
ATOM   3597  C  CG2 . VAL A 1 447 ? 29.513  49.246  82.854  1.00 64.76 ? 450  VAL A CG2 1 
ATOM   3598  N  N   . LEU A 1 448 ? 30.113  46.046  86.098  1.00 67.08 ? 451  LEU A N   1 
ATOM   3599  C  CA  . LEU A 1 448 ? 29.823  44.841  86.881  1.00 67.39 ? 451  LEU A CA  1 
ATOM   3600  C  C   . LEU A 1 448 ? 30.097  44.937  88.376  1.00 68.39 ? 451  LEU A C   1 
ATOM   3601  O  O   . LEU A 1 448 ? 31.013  45.643  88.799  1.00 68.71 ? 451  LEU A O   1 
ATOM   3602  C  CB  . LEU A 1 448 ? 30.613  43.665  86.325  1.00 66.11 ? 451  LEU A CB  1 
ATOM   3603  C  CG  . LEU A 1 448 ? 30.434  43.396  84.841  1.00 65.05 ? 451  LEU A CG  1 
ATOM   3604  C  CD1 . LEU A 1 448 ? 31.221  42.155  84.483  1.00 64.61 ? 451  LEU A CD1 1 
ATOM   3605  C  CD2 . LEU A 1 448 ? 28.964  43.212  84.526  1.00 64.17 ? 451  LEU A CD2 1 
ATOM   3606  N  N   . ASN A 1 449 ? 29.310  44.216  89.173  1.00 69.57 ? 452  ASN A N   1 
ATOM   3607  C  CA  . ASN A 1 449 ? 29.522  44.204  90.618  1.00 70.62 ? 452  ASN A CA  1 
ATOM   3608  C  C   . ASN A 1 449 ? 30.339  42.961  90.959  1.00 71.67 ? 452  ASN A C   1 
ATOM   3609  O  O   . ASN A 1 449 ? 30.676  42.174  90.068  1.00 71.87 ? 452  ASN A O   1 
ATOM   3610  C  CB  . ASN A 1 449 ? 28.197  44.237  91.395  1.00 70.10 ? 452  ASN A CB  1 
ATOM   3611  C  CG  . ASN A 1 449 ? 27.404  42.950  91.286  1.00 69.81 ? 452  ASN A CG  1 
ATOM   3612  O  OD1 . ASN A 1 449 ? 27.956  41.849  91.265  1.00 70.05 ? 452  ASN A OD1 1 
ATOM   3613  N  ND2 . ASN A 1 449 ? 26.091  43.086  91.252  1.00 69.52 ? 452  ASN A ND2 1 
ATOM   3614  N  N   . GLU A 1 450 ? 30.599  42.737  92.240  1.00 72.67 ? 453  GLU A N   1 
ATOM   3615  C  CA  . GLU A 1 450 ? 31.397  41.590  92.614  1.00 73.77 ? 453  GLU A CA  1 
ATOM   3616  C  C   . GLU A 1 450 ? 30.886  40.252  92.120  1.00 73.56 ? 453  GLU A C   1 
ATOM   3617  O  O   . GLU A 1 450 ? 31.572  39.584  91.348  1.00 73.93 ? 453  GLU A O   1 
ATOM   3618  C  CB  . GLU A 1 450 ? 31.625  41.513  94.114  1.00 75.53 ? 453  GLU A CB  1 
ATOM   3619  C  CG  . GLU A 1 450 ? 32.601  40.382  94.451  1.00 78.34 ? 453  GLU A CG  1 
ATOM   3620  C  CD  . GLU A 1 450 ? 32.847  40.185  95.943  1.00 80.12 ? 453  GLU A CD  1 
ATOM   3621  O  OE1 . GLU A 1 450 ? 32.267  40.933  96.771  1.00 80.89 ? 453  GLU A OE1 1 
ATOM   3622  O  OE2 . GLU A 1 450 ? 33.630  39.267  96.286  1.00 80.98 ? 453  GLU A OE2 1 
ATOM   3623  N  N   . GLU A 1 451 ? 29.694  39.849  92.548  1.00 73.46 ? 454  GLU A N   1 
ATOM   3624  C  CA  . GLU A 1 451 ? 29.178  38.551  92.126  1.00 73.07 ? 454  GLU A CA  1 
ATOM   3625  C  C   . GLU A 1 451 ? 29.083  38.405  90.610  1.00 72.23 ? 454  GLU A C   1 
ATOM   3626  O  O   . GLU A 1 451 ? 29.247  37.306  90.077  1.00 72.40 ? 454  GLU A O   1 
ATOM   3627  C  CB  . GLU A 1 451 ? 27.841  38.230  92.790  1.00 73.83 ? 454  GLU A CB  1 
ATOM   3628  C  CG  . GLU A 1 451 ? 26.703  39.126  92.385  1.00 75.11 ? 454  GLU A CG  1 
ATOM   3629  C  CD  . GLU A 1 451 ? 25.392  38.670  92.984  1.00 76.12 ? 454  GLU A CD  1 
ATOM   3630  O  OE1 . GLU A 1 451 ? 24.976  39.242  94.017  1.00 76.60 ? 454  GLU A OE1 1 
ATOM   3631  O  OE2 . GLU A 1 451 ? 24.784  37.728  92.429  1.00 76.35 ? 454  GLU A OE2 1 
ATOM   3632  N  N   . GLN A 1 452 ? 28.857  39.511  89.911  1.00 70.93 ? 455  GLN A N   1 
ATOM   3633  C  CA  . GLN A 1 452 ? 28.774  39.460  88.458  1.00 69.76 ? 455  GLN A CA  1 
ATOM   3634  C  C   . GLN A 1 452 ? 30.147  39.137  87.881  1.00 69.35 ? 455  GLN A C   1 
ATOM   3635  O  O   . GLN A 1 452 ? 30.272  38.293  86.991  1.00 69.32 ? 455  GLN A O   1 
ATOM   3636  C  CB  . GLN A 1 452 ? 28.221  40.770  87.910  1.00 69.20 ? 455  GLN A CB  1 
ATOM   3637  C  CG  . GLN A 1 452 ? 26.761  40.972  88.287  1.00 68.03 ? 455  GLN A CG  1 
ATOM   3638  C  CD  . GLN A 1 452 ? 26.231  42.342  87.922  1.00 67.75 ? 455  GLN A CD  1 
ATOM   3639  O  OE1 . GLN A 1 452 ? 26.984  43.311  87.836  1.00 67.65 ? 455  GLN A OE1 1 
ATOM   3640  N  NE2 . GLN A 1 452 ? 24.921  42.433  87.725  1.00 67.17 ? 455  GLN A NE2 1 
ATOM   3641  N  N   . ARG A 1 453 ? 31.182  39.767  88.427  1.00 68.74 ? 456  ARG A N   1 
ATOM   3642  C  CA  . ARG A 1 453 ? 32.537  39.504  87.973  1.00 68.13 ? 456  ARG A CA  1 
ATOM   3643  C  C   . ARG A 1 453 ? 32.814  38.041  88.245  1.00 68.03 ? 456  ARG A C   1 
ATOM   3644  O  O   . ARG A 1 453 ? 33.302  37.328  87.378  1.00 68.28 ? 456  ARG A O   1 
ATOM   3645  C  CB  . ARG A 1 453 ? 33.541  40.353  88.740  1.00 67.75 ? 456  ARG A CB  1 
ATOM   3646  C  CG  . ARG A 1 453 ? 33.387  41.834  88.530  1.00 67.33 ? 456  ARG A CG  1 
ATOM   3647  C  CD  . ARG A 1 453 ? 34.401  42.599  89.349  1.00 67.08 ? 456  ARG A CD  1 
ATOM   3648  N  NE  . ARG A 1 453 ? 34.191  44.037  89.235  1.00 67.22 ? 456  ARG A NE  1 
ATOM   3649  C  CZ  . ARG A 1 453 ? 33.642  44.793  90.181  1.00 67.20 ? 456  ARG A CZ  1 
ATOM   3650  N  NH1 . ARG A 1 453 ? 33.243  44.251  91.327  1.00 67.14 ? 456  ARG A NH1 1 
ATOM   3651  N  NH2 . ARG A 1 453 ? 33.488  46.093  89.977  1.00 67.27 ? 456  ARG A NH2 1 
ATOM   3652  N  N   . LYS A 1 454 ? 32.448  37.586  89.439  1.00 68.04 ? 457  LYS A N   1 
ATOM   3653  C  CA  . LYS A 1 454 ? 32.658  36.195  89.820  1.00 68.05 ? 457  LYS A CA  1 
ATOM   3654  C  C   . LYS A 1 454 ? 32.083  35.262  88.766  1.00 67.57 ? 457  LYS A C   1 
ATOM   3655  O  O   . LYS A 1 454 ? 32.797  34.428  88.220  1.00 67.79 ? 457  LYS A O   1 
ATOM   3656  C  CB  . LYS A 1 454 ? 32.020  35.891  91.181  1.00 68.84 ? 457  LYS A CB  1 
ATOM   3657  C  CG  . LYS A 1 454 ? 32.170  34.427  91.631  1.00 69.86 ? 457  LYS A CG  1 
ATOM   3658  C  CD  . LYS A 1 454 ? 31.430  34.112  92.941  1.00 71.08 ? 457  LYS A CD  1 
ATOM   3659  C  CE  . LYS A 1 454 ? 29.898  34.308  92.833  1.00 72.00 ? 457  LYS A CE  1 
ATOM   3660  N  NZ  . LYS A 1 454 ? 29.188  33.316  91.954  1.00 72.45 ? 457  LYS A NZ  1 
ATOM   3661  N  N   . ARG A 1 455 ? 30.801  35.422  88.455  1.00 66.79 ? 458  ARG A N   1 
ATOM   3662  C  CA  . ARG A 1 455 ? 30.164  34.571  87.459  1.00 65.99 ? 458  ARG A CA  1 
ATOM   3663  C  C   . ARG A 1 455 ? 30.874  34.654  86.118  1.00 65.49 ? 458  ARG A C   1 
ATOM   3664  O  O   . ARG A 1 455 ? 31.181  33.634  85.502  1.00 65.40 ? 458  ARG A O   1 
ATOM   3665  C  CB  . ARG A 1 455 ? 28.687  34.928  87.306  1.00 65.88 ? 458  ARG A CB  1 
ATOM   3666  C  CG  . ARG A 1 455 ? 27.809  34.395  88.436  1.00 65.74 ? 458  ARG A CG  1 
ATOM   3667  C  CD  . ARG A 1 455 ? 26.329  34.531  88.112  1.00 65.40 ? 458  ARG A CD  1 
ATOM   3668  N  NE  . ARG A 1 455 ? 25.905  35.925  88.076  1.00 65.57 ? 458  ARG A NE  1 
ATOM   3669  C  CZ  . ARG A 1 455 ? 25.580  36.624  89.159  1.00 65.70 ? 458  ARG A CZ  1 
ATOM   3670  N  NH1 . ARG A 1 455 ? 25.633  36.051  90.356  1.00 65.79 ? 458  ARG A NH1 1 
ATOM   3671  N  NH2 . ARG A 1 455 ? 25.203  37.889  89.046  1.00 65.26 ? 458  ARG A NH2 1 
ATOM   3672  N  N   . LEU A 1 456 ? 31.177  35.873  85.696  1.00 65.07 ? 459  LEU A N   1 
ATOM   3673  C  CA  . LEU A 1 456 ? 31.861  36.083  84.436  1.00 64.57 ? 459  LEU A CA  1 
ATOM   3674  C  C   . LEU A 1 456 ? 33.065  35.171  84.349  1.00 64.57 ? 459  LEU A C   1 
ATOM   3675  O  O   . LEU A 1 456 ? 33.181  34.379  83.424  1.00 64.81 ? 459  LEU A O   1 
ATOM   3676  C  CB  . LEU A 1 456 ? 32.320  37.530  84.320  1.00 64.15 ? 459  LEU A CB  1 
ATOM   3677  C  CG  . LEU A 1 456 ? 33.182  37.878  83.105  1.00 63.71 ? 459  LEU A CG  1 
ATOM   3678  C  CD1 . LEU A 1 456 ? 32.509  37.464  81.813  1.00 63.54 ? 459  LEU A CD1 1 
ATOM   3679  C  CD2 . LEU A 1 456 ? 33.439  39.365  83.100  1.00 63.38 ? 459  LEU A CD2 1 
ATOM   3680  N  N   . CYS A 1 457 ? 33.928  35.246  85.352  1.00 64.55 ? 460  CYS A N   1 
ATOM   3681  C  CA  . CYS A 1 457 ? 35.138  34.436  85.377  1.00 64.76 ? 460  CYS A CA  1 
ATOM   3682  C  C   . CYS A 1 457 ? 34.856  32.946  85.379  1.00 64.82 ? 460  CYS A C   1 
ATOM   3683  O  O   . CYS A 1 457 ? 35.537  32.176  84.701  1.00 65.12 ? 460  CYS A O   1 
ATOM   3684  C  CB  . CYS A 1 457 ? 35.997  34.793  86.586  1.00 64.75 ? 460  CYS A CB  1 
ATOM   3685  S  SG  . CYS A 1 457 ? 36.489  36.532  86.662  1.00 65.77 ? 460  CYS A SG  1 
ATOM   3686  N  N   . GLU A 1 458 ? 33.838  32.540  86.123  1.00 64.78 ? 461  GLU A N   1 
ATOM   3687  C  CA  . GLU A 1 458 ? 33.498  31.135  86.204  1.00 64.68 ? 461  GLU A CA  1 
ATOM   3688  C  C   . GLU A 1 458 ? 33.086  30.595  84.858  1.00 64.27 ? 461  GLU A C   1 
ATOM   3689  O  O   . GLU A 1 458 ? 33.439  29.472  84.504  1.00 64.63 ? 461  GLU A O   1 
ATOM   3690  C  CB  . GLU A 1 458 ? 32.395  30.932  87.221  1.00 65.07 ? 461  GLU A CB  1 
ATOM   3691  C  CG  . GLU A 1 458 ? 32.836  31.323  88.603  1.00 65.83 ? 461  GLU A CG  1 
ATOM   3692  C  CD  . GLU A 1 458 ? 31.690  31.429  89.572  1.00 66.75 ? 461  GLU A CD  1 
ATOM   3693  O  OE1 . GLU A 1 458 ? 31.942  31.298  90.788  1.00 67.43 ? 461  GLU A OE1 1 
ATOM   3694  O  OE2 . GLU A 1 458 ? 30.541  31.654  89.128  1.00 67.06 ? 461  GLU A OE2 1 
ATOM   3695  N  N   . ASN A 1 459 ? 32.366  31.410  84.094  1.00 63.93 ? 462  ASN A N   1 
ATOM   3696  C  CA  . ASN A 1 459 ? 31.911  31.007  82.768  1.00 63.26 ? 462  ASN A CA  1 
ATOM   3697  C  C   . ASN A 1 459 ? 33.086  30.898  81.803  1.00 62.72 ? 462  ASN A C   1 
ATOM   3698  O  O   . ASN A 1 459 ? 33.137  30.003  80.967  1.00 62.56 ? 462  ASN A O   1 
ATOM   3699  C  CB  . ASN A 1 459 ? 30.886  32.007  82.224  1.00 63.34 ? 462  ASN A CB  1 
ATOM   3700  C  CG  . ASN A 1 459 ? 29.607  32.036  83.036  1.00 63.29 ? 462  ASN A CG  1 
ATOM   3701  O  OD1 . ASN A 1 459 ? 29.235  31.049  83.679  1.00 63.27 ? 462  ASN A OD1 1 
ATOM   3702  N  ND2 . ASN A 1 459 ? 28.913  33.167  82.995  1.00 63.20 ? 462  ASN A ND2 1 
ATOM   3703  N  N   . ILE A 1 460 ? 34.024  31.825  81.907  1.00 62.07 ? 463  ILE A N   1 
ATOM   3704  C  CA  . ILE A 1 460 ? 35.180  31.796  81.035  1.00 61.44 ? 463  ILE A CA  1 
ATOM   3705  C  C   . ILE A 1 460 ? 36.011  30.562  81.341  1.00 61.56 ? 463  ILE A C   1 
ATOM   3706  O  O   . ILE A 1 460 ? 36.274  29.746  80.453  1.00 61.71 ? 463  ILE A O   1 
ATOM   3707  C  CB  . ILE A 1 460 ? 36.020  33.064  81.203  1.00 61.02 ? 463  ILE A CB  1 
ATOM   3708  C  CG1 . ILE A 1 460 ? 35.243  34.255  80.643  1.00 60.45 ? 463  ILE A CG1 1 
ATOM   3709  C  CG2 . ILE A 1 460 ? 37.361  32.911  80.508  1.00 60.71 ? 463  ILE A CG2 1 
ATOM   3710  C  CD1 . ILE A 1 460 ? 35.956  35.571  80.745  1.00 60.14 ? 463  ILE A CD1 1 
ATOM   3711  N  N   . ALA A 1 461 ? 36.370  30.402  82.612  1.00 61.67 ? 464  ALA A N   1 
ATOM   3712  C  CA  . ALA A 1 461 ? 37.173  29.264  83.053  1.00 61.74 ? 464  ALA A CA  1 
ATOM   3713  C  C   . ALA A 1 461 ? 36.490  27.945  82.733  1.00 61.89 ? 464  ALA A C   1 
ATOM   3714  O  O   . ALA A 1 461 ? 37.145  26.987  82.324  1.00 61.94 ? 464  ALA A O   1 
ATOM   3715  C  CB  . ALA A 1 461 ? 37.447  29.360  84.547  1.00 61.61 ? 464  ALA A CB  1 
ATOM   3716  N  N   . GLY A 1 462 ? 35.170  27.914  82.903  1.00 62.15 ? 465  GLY A N   1 
ATOM   3717  C  CA  . GLY A 1 462 ? 34.402  26.709  82.641  1.00 62.66 ? 465  GLY A CA  1 
ATOM   3718  C  C   . GLY A 1 462 ? 34.548  26.155  81.235  1.00 63.11 ? 465  GLY A C   1 
ATOM   3719  O  O   . GLY A 1 462 ? 34.435  24.942  81.024  1.00 63.12 ? 465  GLY A O   1 
ATOM   3720  N  N   . HIS A 1 463 ? 34.801  27.039  80.273  1.00 63.29 ? 466  HIS A N   1 
ATOM   3721  C  CA  . HIS A 1 463 ? 34.966  26.625  78.889  1.00 63.42 ? 466  HIS A CA  1 
ATOM   3722  C  C   . HIS A 1 463 ? 36.440  26.484  78.567  1.00 63.49 ? 466  HIS A C   1 
ATOM   3723  O  O   . HIS A 1 463 ? 36.879  25.442  78.088  1.00 63.73 ? 466  HIS A O   1 
ATOM   3724  C  CB  . HIS A 1 463 ? 34.342  27.654  77.947  1.00 63.75 ? 466  HIS A CB  1 
ATOM   3725  C  CG  . HIS A 1 463 ? 34.376  27.259  76.501  1.00 64.00 ? 466  HIS A CG  1 
ATOM   3726  N  ND1 . HIS A 1 463 ? 35.152  27.913  75.568  1.00 64.17 ? 466  HIS A ND1 1 
ATOM   3727  C  CD2 . HIS A 1 463 ? 33.712  26.291  75.825  1.00 64.16 ? 466  HIS A CD2 1 
ATOM   3728  C  CE1 . HIS A 1 463 ? 34.961  27.368  74.380  1.00 64.27 ? 466  HIS A CE1 1 
ATOM   3729  N  NE2 . HIS A 1 463 ? 34.092  26.382  74.509  1.00 64.19 ? 466  HIS A NE2 1 
ATOM   3730  N  N   . LEU A 1 464 ? 37.194  27.537  78.855  1.00 63.37 ? 467  LEU A N   1 
ATOM   3731  C  CA  . LEU A 1 464 ? 38.625  27.582  78.595  1.00 63.43 ? 467  LEU A CA  1 
ATOM   3732  C  C   . LEU A 1 464 ? 39.417  26.398  79.159  1.00 63.99 ? 467  LEU A C   1 
ATOM   3733  O  O   . LEU A 1 464 ? 40.422  25.993  78.580  1.00 64.29 ? 467  LEU A O   1 
ATOM   3734  C  CB  . LEU A 1 464 ? 39.191  28.899  79.129  1.00 62.84 ? 467  LEU A CB  1 
ATOM   3735  C  CG  . LEU A 1 464 ? 40.676  29.229  78.948  1.00 62.61 ? 467  LEU A CG  1 
ATOM   3736  C  CD1 . LEU A 1 464 ? 41.064  29.234  77.487  1.00 62.41 ? 467  LEU A CD1 1 
ATOM   3737  C  CD2 . LEU A 1 464 ? 40.969  30.583  79.557  1.00 62.26 ? 467  LEU A CD2 1 
ATOM   3738  N  N   . LYS A 1 465 ? 38.957  25.826  80.267  1.00 64.41 ? 468  LYS A N   1 
ATOM   3739  C  CA  . LYS A 1 465 ? 39.657  24.706  80.894  1.00 64.78 ? 468  LYS A CA  1 
ATOM   3740  C  C   . LYS A 1 465 ? 39.990  23.563  79.954  1.00 65.36 ? 468  LYS A C   1 
ATOM   3741  O  O   . LYS A 1 465 ? 40.932  22.818  80.206  1.00 65.53 ? 468  LYS A O   1 
ATOM   3742  C  CB  . LYS A 1 465 ? 38.850  24.139  82.063  1.00 64.64 ? 468  LYS A CB  1 
ATOM   3743  C  CG  . LYS A 1 465 ? 37.505  23.555  81.654  1.00 64.74 ? 468  LYS A CG  1 
ATOM   3744  C  CD  . LYS A 1 465 ? 36.936  22.652  82.726  1.00 64.57 ? 468  LYS A CD  1 
ATOM   3745  C  CE  . LYS A 1 465 ? 35.453  22.378  82.491  1.00 64.52 ? 468  LYS A CE  1 
ATOM   3746  N  NZ  . LYS A 1 465 ? 35.186  21.681  81.212  1.00 64.46 ? 468  LYS A NZ  1 
ATOM   3747  N  N   . ASP A 1 466 ? 39.202  23.395  78.897  1.00 66.02 ? 469  ASP A N   1 
ATOM   3748  C  CA  . ASP A 1 466 ? 39.436  22.304  77.954  1.00 66.79 ? 469  ASP A CA  1 
ATOM   3749  C  C   . ASP A 1 466 ? 40.407  22.624  76.820  1.00 67.30 ? 469  ASP A C   1 
ATOM   3750  O  O   . ASP A 1 466 ? 40.625  21.793  75.934  1.00 67.49 ? 469  ASP A O   1 
ATOM   3751  C  CB  . ASP A 1 466 ? 38.114  21.790  77.383  1.00 66.86 ? 469  ASP A CB  1 
ATOM   3752  C  CG  . ASP A 1 466 ? 37.170  21.300  78.456  1.00 67.03 ? 469  ASP A CG  1 
ATOM   3753  O  OD1 . ASP A 1 466 ? 36.047  21.837  78.539  1.00 67.60 ? 469  ASP A OD1 1 
ATOM   3754  O  OD2 . ASP A 1 466 ? 37.549  20.386  79.216  1.00 66.93 ? 469  ASP A OD2 1 
ATOM   3755  N  N   . ALA A 1 467 ? 40.979  23.825  76.835  1.00 67.58 ? 470  ALA A N   1 
ATOM   3756  C  CA  . ALA A 1 467 ? 41.945  24.218  75.810  1.00 67.81 ? 470  ALA A CA  1 
ATOM   3757  C  C   . ALA A 1 467 ? 43.343  23.816  76.265  1.00 68.00 ? 470  ALA A C   1 
ATOM   3758  O  O   . ALA A 1 467 ? 43.538  23.443  77.426  1.00 68.41 ? 470  ALA A O   1 
ATOM   3759  C  CB  . ALA A 1 467 ? 41.891  25.715  75.575  1.00 67.64 ? 470  ALA A CB  1 
ATOM   3760  N  N   . GLN A 1 468 ? 44.308  23.860  75.350  1.00 67.92 ? 471  GLN A N   1 
ATOM   3761  C  CA  . GLN A 1 468 ? 45.675  23.516  75.709  1.00 67.69 ? 471  GLN A CA  1 
ATOM   3762  C  C   . GLN A 1 468 ? 46.225  24.583  76.635  1.00 67.46 ? 471  GLN A C   1 
ATOM   3763  O  O   . GLN A 1 468 ? 45.976  25.780  76.446  1.00 67.61 ? 471  GLN A O   1 
ATOM   3764  C  CB  . GLN A 1 468 ? 46.559  23.377  74.474  1.00 67.89 ? 471  GLN A CB  1 
ATOM   3765  C  CG  . GLN A 1 468 ? 46.402  22.049  73.774  1.00 68.04 ? 471  GLN A CG  1 
ATOM   3766  C  CD  . GLN A 1 468 ? 47.491  21.799  72.756  1.00 68.14 ? 471  GLN A CD  1 
ATOM   3767  O  OE1 . GLN A 1 468 ? 48.681  21.768  73.091  1.00 68.38 ? 471  GLN A OE1 1 
ATOM   3768  N  NE2 . GLN A 1 468 ? 47.093  21.614  71.503  1.00 68.19 ? 471  GLN A NE2 1 
ATOM   3769  N  N   . ILE A 1 469 ? 46.964  24.130  77.639  1.00 67.01 ? 472  ILE A N   1 
ATOM   3770  C  CA  . ILE A 1 469 ? 47.548  25.007  78.641  1.00 66.65 ? 472  ILE A CA  1 
ATOM   3771  C  C   . ILE A 1 469 ? 48.155  26.284  78.076  1.00 66.17 ? 472  ILE A C   1 
ATOM   3772  O  O   . ILE A 1 469 ? 47.908  27.373  78.605  1.00 66.15 ? 472  ILE A O   1 
ATOM   3773  C  CB  . ILE A 1 469 ? 48.616  24.257  79.469  1.00 67.14 ? 472  ILE A CB  1 
ATOM   3774  C  CG1 . ILE A 1 469 ? 47.996  23.037  80.164  1.00 67.32 ? 472  ILE A CG1 1 
ATOM   3775  C  CG2 . ILE A 1 469 ? 49.228  25.180  80.510  1.00 67.30 ? 472  ILE A CG2 1 
ATOM   3776  C  CD1 . ILE A 1 469 ? 46.954  23.381  81.213  1.00 67.36 ? 472  ILE A CD1 1 
ATOM   3777  N  N   . PHE A 1 470 ? 48.908  26.162  76.984  1.00 65.47 ? 473  PHE A N   1 
ATOM   3778  C  CA  . PHE A 1 470 ? 49.546  27.331  76.397  1.00 64.90 ? 473  PHE A CA  1 
ATOM   3779  C  C   . PHE A 1 470 ? 48.531  28.359  75.949  1.00 64.62 ? 473  PHE A C   1 
ATOM   3780  O  O   . PHE A 1 470 ? 48.752  29.566  76.076  1.00 64.29 ? 473  PHE A O   1 
ATOM   3781  C  CB  . PHE A 1 470 ? 50.511  26.948  75.266  1.00 64.66 ? 473  PHE A CB  1 
ATOM   3782  C  CG  . PHE A 1 470 ? 49.851  26.595  73.960  1.00 64.70 ? 473  PHE A CG  1 
ATOM   3783  C  CD1 . PHE A 1 470 ? 49.643  27.569  72.989  1.00 64.54 ? 473  PHE A CD1 1 
ATOM   3784  C  CD2 . PHE A 1 470 ? 49.517  25.277  73.661  1.00 64.92 ? 473  PHE A CD2 1 
ATOM   3785  C  CE1 . PHE A 1 470 ? 49.119  27.233  71.741  1.00 64.51 ? 473  PHE A CE1 1 
ATOM   3786  C  CE2 . PHE A 1 470 ? 48.991  24.931  72.408  1.00 64.75 ? 473  PHE A CE2 1 
ATOM   3787  C  CZ  . PHE A 1 470 ? 48.794  25.909  71.451  1.00 64.54 ? 473  PHE A CZ  1 
ATOM   3788  N  N   . ILE A 1 471 ? 47.392  27.878  75.472  1.00 64.29 ? 474  ILE A N   1 
ATOM   3789  C  CA  . ILE A 1 471 ? 46.335  28.768  75.032  1.00 64.01 ? 474  ILE A CA  1 
ATOM   3790  C  C   . ILE A 1 471 ? 45.794  29.472  76.259  1.00 64.10 ? 474  ILE A C   1 
ATOM   3791  O  O   . ILE A 1 471 ? 45.585  30.687  76.254  1.00 64.10 ? 474  ILE A O   1 
ATOM   3792  C  CB  . ILE A 1 471 ? 45.215  27.988  74.355  1.00 63.77 ? 474  ILE A CB  1 
ATOM   3793  C  CG1 . ILE A 1 471 ? 45.783  27.239  73.150  1.00 63.68 ? 474  ILE A CG1 1 
ATOM   3794  C  CG2 . ILE A 1 471 ? 44.117  28.930  73.926  1.00 63.62 ? 474  ILE A CG2 1 
ATOM   3795  C  CD1 . ILE A 1 471 ? 44.784  26.382  72.415  1.00 63.94 ? 474  ILE A CD1 1 
ATOM   3796  N  N   . GLN A 1 472 ? 45.620  28.702  77.327  1.00 64.27 ? 475  GLN A N   1 
ATOM   3797  C  CA  . GLN A 1 472 ? 45.117  29.235  78.585  1.00 64.47 ? 475  GLN A CA  1 
ATOM   3798  C  C   . GLN A 1 472 ? 45.996  30.376  79.049  1.00 64.96 ? 475  GLN A C   1 
ATOM   3799  O  O   . GLN A 1 472 ? 45.501  31.434  79.424  1.00 64.97 ? 475  GLN A O   1 
ATOM   3800  C  CB  . GLN A 1 472 ? 45.104  28.152  79.658  1.00 63.98 ? 475  GLN A CB  1 
ATOM   3801  C  CG  . GLN A 1 472 ? 44.281  26.938  79.293  1.00 63.24 ? 475  GLN A CG  1 
ATOM   3802  C  CD  . GLN A 1 472 ? 44.035  26.034  80.478  1.00 62.88 ? 475  GLN A CD  1 
ATOM   3803  O  OE1 . GLN A 1 472 ? 44.348  26.381  81.620  1.00 63.00 ? 475  GLN A OE1 1 
ATOM   3804  N  NE2 . GLN A 1 472 ? 43.455  24.872  80.219  1.00 62.55 ? 475  GLN A NE2 1 
ATOM   3805  N  N   . LYS A 1 473 ? 47.306  30.167  78.985  1.00 65.50 ? 476  LYS A N   1 
ATOM   3806  C  CA  . LYS A 1 473 ? 48.256  31.180  79.406  1.00 66.18 ? 476  LYS A CA  1 
ATOM   3807  C  C   . LYS A 1 473 ? 48.123  32.460  78.612  1.00 66.16 ? 476  LYS A C   1 
ATOM   3808  O  O   . LYS A 1 473 ? 48.028  33.544  79.187  1.00 66.53 ? 476  LYS A O   1 
ATOM   3809  C  CB  . LYS A 1 473 ? 49.671  30.651  79.292  1.00 66.77 ? 476  LYS A CB  1 
ATOM   3810  C  CG  . LYS A 1 473 ? 49.950  29.506  80.229  1.00 68.15 ? 476  LYS A CG  1 
ATOM   3811  C  CD  . LYS A 1 473 ? 49.765  29.929  81.676  1.00 69.08 ? 476  LYS A CD  1 
ATOM   3812  C  CE  . LYS A 1 473 ? 50.124  28.788  82.621  1.00 69.85 ? 476  LYS A CE  1 
ATOM   3813  N  NZ  . LYS A 1 473 ? 51.470  28.210  82.302  1.00 70.23 ? 476  LYS A NZ  1 
ATOM   3814  N  N   . LYS A 1 474 ? 48.092  32.348  77.291  1.00 66.31 ? 477  LYS A N   1 
ATOM   3815  C  CA  . LYS A 1 474 ? 47.968  33.546  76.487  1.00 66.34 ? 477  LYS A CA  1 
ATOM   3816  C  C   . LYS A 1 474 ? 46.673  34.259  76.797  1.00 66.07 ? 477  LYS A C   1 
ATOM   3817  O  O   . LYS A 1 474 ? 46.656  35.474  76.981  1.00 66.16 ? 477  LYS A O   1 
ATOM   3818  C  CB  . LYS A 1 474 ? 48.033  33.228  75.005  1.00 67.12 ? 477  LYS A CB  1 
ATOM   3819  C  CG  . LYS A 1 474 ? 48.128  34.478  74.159  1.00 67.97 ? 477  LYS A CG  1 
ATOM   3820  C  CD  . LYS A 1 474 ? 49.131  34.295  73.039  1.00 68.72 ? 477  LYS A CD  1 
ATOM   3821  C  CE  . LYS A 1 474 ? 49.522  35.636  72.452  1.00 69.41 ? 477  LYS A CE  1 
ATOM   3822  N  NZ  . LYS A 1 474 ? 50.082  36.544  73.503  1.00 69.87 ? 477  LYS A NZ  1 
ATOM   3823  N  N   . ALA A 1 475 ? 45.591  33.500  76.870  1.00 65.74 ? 478  ALA A N   1 
ATOM   3824  C  CA  . ALA A 1 475 ? 44.295  34.085  77.166  1.00 65.79 ? 478  ALA A CA  1 
ATOM   3825  C  C   . ALA A 1 475 ? 44.342  34.857  78.483  1.00 65.81 ? 478  ALA A C   1 
ATOM   3826  O  O   . ALA A 1 475 ? 43.959  36.030  78.544  1.00 65.66 ? 478  ALA A O   1 
ATOM   3827  C  CB  . ALA A 1 475 ? 43.250  33.002  77.233  1.00 65.69 ? 478  ALA A CB  1 
ATOM   3828  N  N   . VAL A 1 476 ? 44.848  34.203  79.526  1.00 65.76 ? 479  VAL A N   1 
ATOM   3829  C  CA  . VAL A 1 476 ? 44.938  34.813  80.845  1.00 65.56 ? 479  VAL A CA  1 
ATOM   3830  C  C   . VAL A 1 476 ? 45.752  36.081  80.795  1.00 65.97 ? 479  VAL A C   1 
ATOM   3831  O  O   . VAL A 1 476 ? 45.363  37.096  81.370  1.00 66.27 ? 479  VAL A O   1 
ATOM   3832  C  CB  . VAL A 1 476 ? 45.559  33.855  81.873  1.00 65.17 ? 479  VAL A CB  1 
ATOM   3833  C  CG1 . VAL A 1 476 ? 45.801  34.576  83.189  1.00 64.84 ? 479  VAL A CG1 1 
ATOM   3834  C  CG2 . VAL A 1 476 ? 44.635  32.680  82.107  1.00 64.78 ? 479  VAL A CG2 1 
ATOM   3835  N  N   . LYS A 1 477 ? 46.879  36.029  80.098  1.00 66.61 ? 480  LYS A N   1 
ATOM   3836  C  CA  . LYS A 1 477 ? 47.725  37.202  79.979  1.00 67.37 ? 480  LYS A CA  1 
ATOM   3837  C  C   . LYS A 1 477 ? 46.870  38.343  79.450  1.00 67.12 ? 480  LYS A C   1 
ATOM   3838  O  O   . LYS A 1 477 ? 46.891  39.447  79.995  1.00 67.16 ? 480  LYS A O   1 
ATOM   3839  C  CB  . LYS A 1 477 ? 48.896  36.939  79.033  1.00 68.63 ? 480  LYS A CB  1 
ATOM   3840  C  CG  . LYS A 1 477 ? 49.898  38.098  78.955  1.00 70.51 ? 480  LYS A CG  1 
ATOM   3841  C  CD  . LYS A 1 477 ? 51.119  37.770  78.088  1.00 71.64 ? 480  LYS A CD  1 
ATOM   3842  C  CE  . LYS A 1 477 ? 50.717  37.448  76.656  1.00 72.60 ? 480  LYS A CE  1 
ATOM   3843  N  NZ  . LYS A 1 477 ? 49.872  38.527  76.054  1.00 73.47 ? 480  LYS A NZ  1 
ATOM   3844  N  N   . ASN A 1 478 ? 46.067  38.048  78.432  1.00 66.67 ? 481  ASN A N   1 
ATOM   3845  C  CA  . ASN A 1 478 ? 45.195  39.053  77.847  1.00 66.42 ? 481  ASN A CA  1 
ATOM   3846  C  C   . ASN A 1 478 ? 44.273  39.638  78.896  1.00 66.31 ? 481  ASN A C   1 
ATOM   3847  O  O   . ASN A 1 478 ? 44.251  40.850  79.097  1.00 66.25 ? 481  ASN A O   1 
ATOM   3848  C  CB  . ASN A 1 478 ? 44.390  38.461  76.697  1.00 66.14 ? 481  ASN A CB  1 
ATOM   3849  C  CG  . ASN A 1 478 ? 45.242  38.199  75.478  1.00 65.88 ? 481  ASN A CG  1 
ATOM   3850  O  OD1 . ASN A 1 478 ? 46.421  38.547  75.452  1.00 65.83 ? 481  ASN A OD1 1 
ATOM   3851  N  ND2 . ASN A 1 478 ? 44.654  37.585  74.457  1.00 65.97 ? 481  ASN A ND2 1 
ATOM   3852  N  N   . PHE A 1 479 ? 43.565  38.770  79.611  1.00 66.56 ? 482  PHE A N   1 
ATOM   3853  C  CA  . PHE A 1 479 ? 42.645  39.214  80.657  1.00 66.71 ? 482  PHE A CA  1 
ATOM   3854  C  C   . PHE A 1 479 ? 43.334  39.996  81.762  1.00 66.79 ? 482  PHE A C   1 
ATOM   3855  O  O   . PHE A 1 479 ? 42.740  40.874  82.385  1.00 66.51 ? 482  PHE A O   1 
ATOM   3856  C  CB  . PHE A 1 479 ? 41.929  38.019  81.268  1.00 66.83 ? 482  PHE A CB  1 
ATOM   3857  C  CG  . PHE A 1 479 ? 40.956  37.373  80.344  1.00 67.06 ? 482  PHE A CG  1 
ATOM   3858  C  CD1 . PHE A 1 479 ? 39.918  38.114  79.788  1.00 66.92 ? 482  PHE A CD1 1 
ATOM   3859  C  CD2 . PHE A 1 479 ? 41.086  36.032  80.002  1.00 67.01 ? 482  PHE A CD2 1 
ATOM   3860  C  CE1 . PHE A 1 479 ? 39.022  37.529  78.902  1.00 67.06 ? 482  PHE A CE1 1 
ATOM   3861  C  CE2 . PHE A 1 479 ? 40.194  35.432  79.113  1.00 67.07 ? 482  PHE A CE2 1 
ATOM   3862  C  CZ  . PHE A 1 479 ? 39.159  36.183  78.561  1.00 67.13 ? 482  PHE A CZ  1 
ATOM   3863  N  N   . THR A 1 480 ? 44.583  39.653  82.026  1.00 67.17 ? 483  THR A N   1 
ATOM   3864  C  CA  . THR A 1 480 ? 45.324  40.340  83.057  1.00 67.75 ? 483  THR A CA  1 
ATOM   3865  C  C   . THR A 1 480 ? 45.553  41.791  82.652  1.00 68.70 ? 483  THR A C   1 
ATOM   3866  O  O   . THR A 1 480 ? 45.437  42.694  83.487  1.00 68.98 ? 483  THR A O   1 
ATOM   3867  C  CB  . THR A 1 480 ? 46.651  39.653  83.309  1.00 67.39 ? 483  THR A CB  1 
ATOM   3868  O  OG1 . THR A 1 480 ? 46.410  38.264  83.554  1.00 66.98 ? 483  THR A OG1 1 
ATOM   3869  C  CG2 . THR A 1 480 ? 47.338  40.260  84.516  1.00 67.15 ? 483  THR A CG2 1 
ATOM   3870  N  N   . GLU A 1 481 ? 45.836  42.017  81.367  1.00 69.29 ? 484  GLU A N   1 
ATOM   3871  C  CA  . GLU A 1 481 ? 46.080  43.368  80.856  1.00 69.80 ? 484  GLU A CA  1 
ATOM   3872  C  C   . GLU A 1 481 ? 44.878  44.264  81.072  1.00 69.42 ? 484  GLU A C   1 
ATOM   3873  O  O   . GLU A 1 481 ? 45.012  45.479  81.175  1.00 69.50 ? 484  GLU A O   1 
ATOM   3874  C  CB  . GLU A 1 481 ? 46.446  43.339  79.371  1.00 71.06 ? 484  GLU A CB  1 
ATOM   3875  C  CG  . GLU A 1 481 ? 47.848  42.790  79.081  1.00 72.81 ? 484  GLU A CG  1 
ATOM   3876  C  CD  . GLU A 1 481 ? 48.205  42.790  77.590  1.00 74.01 ? 484  GLU A CD  1 
ATOM   3877  O  OE1 . GLU A 1 481 ? 49.037  41.943  77.177  1.00 74.42 ? 484  GLU A OE1 1 
ATOM   3878  O  OE2 . GLU A 1 481 ? 47.667  43.635  76.832  1.00 74.44 ? 484  GLU A OE2 1 
ATOM   3879  N  N   . VAL A 1 482 ? 43.700  43.655  81.129  1.00 69.21 ? 485  VAL A N   1 
ATOM   3880  C  CA  . VAL A 1 482 ? 42.471  44.400  81.359  1.00 69.01 ? 485  VAL A CA  1 
ATOM   3881  C  C   . VAL A 1 482 ? 42.449  44.807  82.813  1.00 69.03 ? 485  VAL A C   1 
ATOM   3882  O  O   . VAL A 1 482 ? 42.133  45.945  83.149  1.00 69.14 ? 485  VAL A O   1 
ATOM   3883  C  CB  . VAL A 1 482 ? 41.232  43.534  81.109  1.00 68.82 ? 485  VAL A CB  1 
ATOM   3884  C  CG1 . VAL A 1 482 ? 39.971  44.287  81.511  1.00 68.42 ? 485  VAL A CG1 1 
ATOM   3885  C  CG2 . VAL A 1 482 ? 41.172  43.121  79.652  1.00 68.70 ? 485  VAL A CG2 1 
ATOM   3886  N  N   . HIS A 1 483 ? 42.751  43.841  83.671  1.00 68.76 ? 486  HIS A N   1 
ATOM   3887  C  CA  . HIS A 1 483 ? 42.784  44.053  85.099  1.00 68.63 ? 486  HIS A CA  1 
ATOM   3888  C  C   . HIS A 1 483 ? 43.364  42.801  85.717  1.00 68.64 ? 486  HIS A C   1 
ATOM   3889  O  O   . HIS A 1 483 ? 43.079  41.689  85.268  1.00 68.51 ? 486  HIS A O   1 
ATOM   3890  C  CB  . HIS A 1 483 ? 41.377  44.297  85.642  1.00 68.90 ? 486  HIS A CB  1 
ATOM   3891  C  CG  . HIS A 1 483 ? 41.346  44.653  87.096  1.00 69.34 ? 486  HIS A CG  1 
ATOM   3892  N  ND1 . HIS A 1 483 ? 41.170  45.943  87.549  1.00 69.73 ? 486  HIS A ND1 1 
ATOM   3893  C  CD2 . HIS A 1 483 ? 41.492  43.886  88.203  1.00 69.51 ? 486  HIS A CD2 1 
ATOM   3894  C  CE1 . HIS A 1 483 ? 41.210  45.958  88.869  1.00 69.50 ? 486  HIS A CE1 1 
ATOM   3895  N  NE2 . HIS A 1 483 ? 41.404  44.720  89.291  1.00 69.96 ? 486  HIS A NE2 1 
ATOM   3896  N  N   . PRO A 1 484 ? 44.219  42.969  86.733  1.00 68.63 ? 487  PRO A N   1 
ATOM   3897  C  CA  . PRO A 1 484 ? 44.873  41.874  87.446  1.00 68.57 ? 487  PRO A CA  1 
ATOM   3898  C  C   . PRO A 1 484 ? 43.875  40.907  88.058  1.00 68.63 ? 487  PRO A C   1 
ATOM   3899  O  O   . PRO A 1 484 ? 44.055  39.697  87.958  1.00 68.74 ? 487  PRO A O   1 
ATOM   3900  C  CB  . PRO A 1 484 ? 45.661  42.603  88.526  1.00 68.58 ? 487  PRO A CB  1 
ATOM   3901  C  CG  . PRO A 1 484 ? 46.022  43.886  87.862  1.00 68.43 ? 487  PRO A CG  1 
ATOM   3902  C  CD  . PRO A 1 484 ? 44.716  44.267  87.222  1.00 68.56 ? 487  PRO A CD  1 
ATOM   3903  N  N   . ASP A 1 485 ? 42.834  41.438  88.695  1.00 68.50 ? 488  ASP A N   1 
ATOM   3904  C  CA  . ASP A 1 485 ? 41.815  40.597  89.318  1.00 68.42 ? 488  ASP A CA  1 
ATOM   3905  C  C   . ASP A 1 485 ? 41.125  39.722  88.286  1.00 68.12 ? 488  ASP A C   1 
ATOM   3906  O  O   . ASP A 1 485 ? 40.767  38.579  88.580  1.00 68.24 ? 488  ASP A O   1 
ATOM   3907  C  CB  . ASP A 1 485 ? 40.769  41.433  90.062  1.00 68.48 ? 488  ASP A CB  1 
ATOM   3908  C  CG  . ASP A 1 485 ? 41.335  42.147  91.281  1.00 68.79 ? 488  ASP A CG  1 
ATOM   3909  O  OD1 . ASP A 1 485 ? 42.548  42.009  91.562  1.00 68.72 ? 488  ASP A OD1 1 
ATOM   3910  O  OD2 . ASP A 1 485 ? 40.556  42.858  91.957  1.00 68.87 ? 488  ASP A OD2 1 
ATOM   3911  N  N   . TYR A 1 486 ? 40.962  40.247  87.074  1.00 67.88 ? 489  TYR A N   1 
ATOM   3912  C  CA  . TYR A 1 486 ? 40.316  39.494  86.002  1.00 67.50 ? 489  TYR A CA  1 
ATOM   3913  C  C   . TYR A 1 486 ? 41.122  38.221  85.733  1.00 67.51 ? 489  TYR A C   1 
ATOM   3914  O  O   . TYR A 1 486 ? 40.658  37.115  86.010  1.00 67.44 ? 489  TYR A O   1 
ATOM   3915  C  CB  . TYR A 1 486 ? 40.221  40.348  84.732  1.00 66.90 ? 489  TYR A CB  1 
ATOM   3916  C  CG  . TYR A 1 486 ? 39.122  39.948  83.754  1.00 66.03 ? 489  TYR A CG  1 
ATOM   3917  C  CD1 . TYR A 1 486 ? 38.669  40.849  82.787  1.00 65.79 ? 489  TYR A CD1 1 
ATOM   3918  C  CD2 . TYR A 1 486 ? 38.555  38.672  83.777  1.00 65.73 ? 489  TYR A CD2 1 
ATOM   3919  C  CE1 . TYR A 1 486 ? 37.683  40.490  81.864  1.00 65.48 ? 489  TYR A CE1 1 
ATOM   3920  C  CE2 . TYR A 1 486 ? 37.568  38.301  82.860  1.00 65.51 ? 489  TYR A CE2 1 
ATOM   3921  C  CZ  . TYR A 1 486 ? 37.137  39.214  81.905  1.00 65.57 ? 489  TYR A CZ  1 
ATOM   3922  O  OH  . TYR A 1 486 ? 36.170  38.855  80.982  1.00 65.46 ? 489  TYR A OH  1 
ATOM   3923  N  N   . GLY A 1 487 ? 42.349  38.391  85.249  1.00 67.66 ? 490  GLY A N   1 
ATOM   3924  C  CA  . GLY A 1 487 ? 43.198  37.248  84.962  1.00 67.75 ? 490  GLY A CA  1 
ATOM   3925  C  C   . GLY A 1 487 ? 43.465  36.343  86.155  1.00 67.84 ? 490  GLY A C   1 
ATOM   3926  O  O   . GLY A 1 487 ? 43.370  35.117  86.043  1.00 67.76 ? 490  GLY A O   1 
ATOM   3927  N  N   . SER A 1 488 ? 43.786  36.937  87.301  1.00 67.95 ? 491  SER A N   1 
ATOM   3928  C  CA  . SER A 1 488 ? 44.080  36.162  88.499  1.00 68.17 ? 491  SER A CA  1 
ATOM   3929  C  C   . SER A 1 488 ? 42.917  35.260  88.860  1.00 68.21 ? 491  SER A C   1 
ATOM   3930  O  O   . SER A 1 488 ? 43.102  34.063  89.089  1.00 68.34 ? 491  SER A O   1 
ATOM   3931  C  CB  . SER A 1 488 ? 44.408  37.080  89.677  1.00 68.39 ? 491  SER A CB  1 
ATOM   3932  O  OG  . SER A 1 488 ? 43.296  37.883  90.029  1.00 69.21 ? 491  SER A OG  1 
ATOM   3933  N  N   . HIS A 1 489 ? 41.712  35.822  88.859  1.00 68.23 ? 492  HIS A N   1 
ATOM   3934  C  CA  . HIS A 1 489 ? 40.530  35.045  89.205  1.00 68.23 ? 492  HIS A CA  1 
ATOM   3935  C  C   . HIS A 1 489 ? 40.372  33.853  88.277  1.00 67.95 ? 492  HIS A C   1 
ATOM   3936  O  O   . HIS A 1 489 ? 40.188  32.730  88.733  1.00 67.92 ? 492  HIS A O   1 
ATOM   3937  C  CB  . HIS A 1 489 ? 39.273  35.907  89.154  1.00 68.75 ? 492  HIS A CB  1 
ATOM   3938  C  CG  . HIS A 1 489 ? 38.125  35.335  89.923  1.00 69.27 ? 492  HIS A CG  1 
ATOM   3939  N  ND1 . HIS A 1 489 ? 38.098  34.022  90.353  1.00 69.41 ? 492  HIS A ND1 1 
ATOM   3940  C  CD2 . HIS A 1 489 ? 36.971  35.895  90.357  1.00 69.52 ? 492  HIS A CD2 1 
ATOM   3941  C  CE1 . HIS A 1 489 ? 36.979  33.802  91.018  1.00 69.68 ? 492  HIS A CE1 1 
ATOM   3942  N  NE2 . HIS A 1 489 ? 36.276  34.923  91.035  1.00 69.85 ? 492  HIS A NE2 1 
ATOM   3943  N  N   . ILE A 1 490 ? 40.461  34.104  86.975  1.00 67.55 ? 493  ILE A N   1 
ATOM   3944  C  CA  . ILE A 1 490 ? 40.342  33.052  85.974  1.00 67.17 ? 493  ILE A CA  1 
ATOM   3945  C  C   . ILE A 1 490 ? 41.437  32.012  86.142  1.00 67.22 ? 493  ILE A C   1 
ATOM   3946  O  O   . ILE A 1 490 ? 41.168  30.812  86.091  1.00 67.58 ? 493  ILE A O   1 
ATOM   3947  C  CB  . ILE A 1 490 ? 40.425  33.622  84.555  1.00 66.85 ? 493  ILE A CB  1 
ATOM   3948  C  CG1 . ILE A 1 490 ? 39.197  34.481  84.268  1.00 66.46 ? 493  ILE A CG1 1 
ATOM   3949  C  CG2 . ILE A 1 490 ? 40.533  32.502  83.538  1.00 66.68 ? 493  ILE A CG2 1 
ATOM   3950  C  CD1 . ILE A 1 490 ? 39.258  35.179  82.942  1.00 66.13 ? 493  ILE A CD1 1 
ATOM   3951  N  N   . GLN A 1 491 ? 42.673  32.464  86.330  1.00 67.13 ? 494  GLN A N   1 
ATOM   3952  C  CA  . GLN A 1 491 ? 43.774  31.530  86.510  1.00 66.91 ? 494  GLN A CA  1 
ATOM   3953  C  C   . GLN A 1 491 ? 43.507  30.663  87.731  1.00 66.89 ? 494  GLN A C   1 
ATOM   3954  O  O   . GLN A 1 491 ? 43.651  29.440  87.675  1.00 67.05 ? 494  GLN A O   1 
ATOM   3955  C  CB  . GLN A 1 491 ? 45.097  32.262  86.686  1.00 66.97 ? 494  GLN A CB  1 
ATOM   3956  C  CG  . GLN A 1 491 ? 46.293  31.322  86.676  1.00 67.17 ? 494  GLN A CG  1 
ATOM   3957  C  CD  . GLN A 1 491 ? 46.409  30.554  85.371  1.00 67.37 ? 494  GLN A CD  1 
ATOM   3958  O  OE1 . GLN A 1 491 ? 47.016  31.027  84.404  1.00 67.55 ? 494  GLN A OE1 1 
ATOM   3959  N  NE2 . GLN A 1 491 ? 45.812  29.368  85.330  1.00 67.40 ? 494  GLN A NE2 1 
ATOM   3960  N  N   . ALA A 1 492 ? 43.086  31.300  88.820  1.00 66.61 ? 495  ALA A N   1 
ATOM   3961  C  CA  . ALA A 1 492 ? 42.776  30.598  90.057  1.00 66.62 ? 495  ALA A CA  1 
ATOM   3962  C  C   . ALA A 1 492 ? 41.844  29.429  89.772  1.00 66.84 ? 495  ALA A C   1 
ATOM   3963  O  O   . ALA A 1 492 ? 42.090  28.308  90.216  1.00 66.98 ? 495  ALA A O   1 
ATOM   3964  C  CB  . ALA A 1 492 ? 42.126  31.547  91.036  1.00 66.39 ? 495  ALA A CB  1 
ATOM   3965  N  N   . LEU A 1 493 ? 40.794  29.700  88.999  1.00 67.08 ? 496  LEU A N   1 
ATOM   3966  C  CA  . LEU A 1 493 ? 39.805  28.692  88.625  1.00 67.20 ? 496  LEU A CA  1 
ATOM   3967  C  C   . LEU A 1 493 ? 40.394  27.626  87.711  1.00 67.90 ? 496  LEU A C   1 
ATOM   3968  O  O   . LEU A 1 493 ? 40.123  26.436  87.882  1.00 67.80 ? 496  LEU A O   1 
ATOM   3969  C  CB  . LEU A 1 493 ? 38.602  29.361  87.958  1.00 66.37 ? 496  LEU A CB  1 
ATOM   3970  C  CG  . LEU A 1 493 ? 37.710  30.178  88.900  1.00 65.78 ? 496  LEU A CG  1 
ATOM   3971  C  CD1 . LEU A 1 493 ? 36.763  31.083  88.137  1.00 65.41 ? 496  LEU A CD1 1 
ATOM   3972  C  CD2 . LEU A 1 493 ? 36.934  29.238  89.797  1.00 65.49 ? 496  LEU A CD2 1 
ATOM   3973  N  N   . LEU A 1 494 ? 41.210  28.050  86.753  1.00 68.79 ? 497  LEU A N   1 
ATOM   3974  C  CA  . LEU A 1 494 ? 41.839  27.114  85.837  1.00 70.02 ? 497  LEU A CA  1 
ATOM   3975  C  C   . LEU A 1 494 ? 42.669  26.115  86.621  1.00 71.22 ? 497  LEU A C   1 
ATOM   3976  O  O   . LEU A 1 494 ? 42.618  24.916  86.352  1.00 71.66 ? 497  LEU A O   1 
ATOM   3977  C  CB  . LEU A 1 494 ? 42.728  27.847  84.838  1.00 69.54 ? 497  LEU A CB  1 
ATOM   3978  C  CG  . LEU A 1 494 ? 41.984  28.657  83.779  1.00 69.27 ? 497  LEU A CG  1 
ATOM   3979  C  CD1 . LEU A 1 494 ? 42.966  29.276  82.805  1.00 69.08 ? 497  LEU A CD1 1 
ATOM   3980  C  CD2 . LEU A 1 494 ? 41.017  27.753  83.044  1.00 68.93 ? 497  LEU A CD2 1 
ATOM   3981  N  N   . ASP A 1 495 ? 43.395  26.613  87.618  1.00 72.52 ? 498  ASP A N   1 
ATOM   3982  C  CA  . ASP A 1 495 ? 44.241  25.775  88.460  1.00 74.07 ? 498  ASP A CA  1 
ATOM   3983  C  C   . ASP A 1 495 ? 43.459  24.663  89.153  1.00 75.14 ? 498  ASP A C   1 
ATOM   3984  O  O   . ASP A 1 495 ? 43.990  23.578  89.397  1.00 75.27 ? 498  ASP A O   1 
ATOM   3985  C  CB  . ASP A 1 495 ? 44.948  26.632  89.511  1.00 74.49 ? 498  ASP A CB  1 
ATOM   3986  C  CG  . ASP A 1 495 ? 45.860  27.686  88.896  1.00 75.02 ? 498  ASP A CG  1 
ATOM   3987  O  OD1 . ASP A 1 495 ? 46.279  27.513  87.731  1.00 75.19 ? 498  ASP A OD1 1 
ATOM   3988  O  OD2 . ASP A 1 495 ? 46.164  28.691  89.581  1.00 75.18 ? 498  ASP A OD2 1 
ATOM   3989  N  N   . LYS A 1 496 ? 42.203  24.938  89.483  1.00 76.31 ? 499  LYS A N   1 
ATOM   3990  C  CA  . LYS A 1 496 ? 41.376  23.943  90.141  1.00 77.63 ? 499  LYS A CA  1 
ATOM   3991  C  C   . LYS A 1 496 ? 40.878  22.897  89.151  1.00 78.19 ? 499  LYS A C   1 
ATOM   3992  O  O   . LYS A 1 496 ? 40.973  21.693  89.419  1.00 78.27 ? 499  LYS A O   1 
ATOM   3993  C  CB  . LYS A 1 496 ? 40.196  24.604  90.846  1.00 78.34 ? 499  LYS A CB  1 
ATOM   3994  C  CG  . LYS A 1 496 ? 39.328  23.615  91.607  1.00 79.71 ? 499  LYS A CG  1 
ATOM   3995  C  CD  . LYS A 1 496 ? 38.221  24.316  92.382  1.00 80.90 ? 499  LYS A CD  1 
ATOM   3996  C  CE  . LYS A 1 496 ? 37.359  23.317  93.151  1.00 81.50 ? 499  LYS A CE  1 
ATOM   3997  N  NZ  . LYS A 1 496 ? 36.333  24.009  93.986  1.00 82.25 ? 499  LYS A NZ  1 
ATOM   3998  N  N   . TYR A 1 497 ? 40.349  23.357  88.014  1.00 78.86 ? 500  TYR A N   1 
ATOM   3999  C  CA  . TYR A 1 497 ? 39.839  22.459  86.972  1.00 79.46 ? 500  TYR A CA  1 
ATOM   4000  C  C   . TYR A 1 497 ? 40.935  21.522  86.489  1.00 79.83 ? 500  TYR A C   1 
ATOM   4001  O  O   . TYR A 1 497 ? 40.676  20.370  86.141  1.00 80.08 ? 500  TYR A O   1 
ATOM   4002  C  CB  . TYR A 1 497 ? 39.285  23.245  85.782  1.00 79.57 ? 500  TYR A CB  1 
ATOM   4003  C  CG  . TYR A 1 497 ? 38.017  24.024  86.073  1.00 79.86 ? 500  TYR A CG  1 
ATOM   4004  C  CD1 . TYR A 1 497 ? 36.839  23.378  86.458  1.00 79.86 ? 500  TYR A CD1 1 
ATOM   4005  C  CD2 . TYR A 1 497 ? 37.994  25.413  85.963  1.00 80.07 ? 500  TYR A CD2 1 
ATOM   4006  C  CE1 . TYR A 1 497 ? 35.669  24.103  86.727  1.00 79.74 ? 500  TYR A CE1 1 
ATOM   4007  C  CE2 . TYR A 1 497 ? 36.835  26.143  86.228  1.00 79.97 ? 500  TYR A CE2 1 
ATOM   4008  C  CZ  . TYR A 1 497 ? 35.681  25.487  86.609  1.00 79.86 ? 500  TYR A CZ  1 
ATOM   4009  O  OH  . TYR A 1 497 ? 34.555  26.233  86.879  1.00 79.86 ? 500  TYR A OH  1 
ATOM   4010  N  N   . ASN A 1 498 ? 42.166  22.016  86.477  1.00 80.06 ? 501  ASN A N   1 
ATOM   4011  C  CA  . ASN A 1 498 ? 43.291  21.202  86.055  1.00 80.34 ? 501  ASN A CA  1 
ATOM   4012  C  C   . ASN A 1 498 ? 43.792  20.304  87.191  1.00 80.47 ? 501  ASN A C   1 
ATOM   4013  O  O   . ASN A 1 498 ? 44.585  19.394  86.891  1.00 80.70 ? 501  ASN A O   1 
ATOM   4014  C  CB  . ASN A 1 498 ? 44.415  22.092  85.516  1.00 80.58 ? 501  ASN A CB  1 
ATOM   4015  C  CG  . ASN A 1 498 ? 43.987  22.893  84.291  1.00 80.90 ? 501  ASN A CG  1 
ATOM   4016  O  OD1 . ASN A 1 498 ? 43.040  22.525  83.593  1.00 80.97 ? 501  ASN A OD1 1 
ATOM   4017  N  ND2 . ASN A 1 498 ? 44.676  23.998  84.032  1.00 80.98 ? 501  ASN A ND2 1 
ATOM   4018  O  OXT . ASN A 1 498 ? 43.375  20.493  88.358  1.00 80.58 ? 501  ASN A OXT 1 
ATOM   4019  N  N   . SER B 1 1   ? 41.368  12.393  5.140   1.00 81.77 ? 4    SER B N   1 
ATOM   4020  C  CA  . SER B 1 1   ? 40.431  12.249  3.988   1.00 81.56 ? 4    SER B CA  1 
ATOM   4021  C  C   . SER B 1 1   ? 39.755  13.603  3.715   1.00 80.96 ? 4    SER B C   1 
ATOM   4022  O  O   . SER B 1 1   ? 39.785  14.106  2.582   1.00 81.29 ? 4    SER B O   1 
ATOM   4023  C  CB  . SER B 1 1   ? 39.389  11.164  4.296   1.00 82.08 ? 4    SER B CB  1 
ATOM   4024  O  OG  . SER B 1 1   ? 39.127  10.355  3.159   1.00 82.80 ? 4    SER B OG  1 
ATOM   4025  N  N   . ARG B 1 2   ? 39.141  14.172  4.757   1.00 79.61 ? 5    ARG B N   1 
ATOM   4026  C  CA  . ARG B 1 2   ? 38.477  15.479  4.686   1.00 77.80 ? 5    ARG B CA  1 
ATOM   4027  C  C   . ARG B 1 2   ? 39.255  16.375  5.638   1.00 77.40 ? 5    ARG B C   1 
ATOM   4028  O  O   . ARG B 1 2   ? 40.389  16.056  6.012   1.00 77.48 ? 5    ARG B O   1 
ATOM   4029  C  CB  . ARG B 1 2   ? 37.023  15.392  5.166   1.00 76.55 ? 5    ARG B CB  1 
ATOM   4030  C  CG  . ARG B 1 2   ? 36.200  14.293  4.513   1.00 74.67 ? 5    ARG B CG  1 
ATOM   4031  C  CD  . ARG B 1 2   ? 35.879  13.167  5.492   1.00 72.70 ? 5    ARG B CD  1 
ATOM   4032  N  NE  . ARG B 1 2   ? 34.533  13.282  6.056   1.00 71.23 ? 5    ARG B NE  1 
ATOM   4033  C  CZ  . ARG B 1 2   ? 34.125  12.688  7.176   1.00 70.14 ? 5    ARG B CZ  1 
ATOM   4034  N  NH1 . ARG B 1 2   ? 34.958  11.930  7.878   1.00 69.51 ? 5    ARG B NH1 1 
ATOM   4035  N  NH2 . ARG B 1 2   ? 32.873  12.842  7.586   1.00 69.69 ? 5    ARG B NH2 1 
ATOM   4036  N  N   . ASP B 1 3   ? 38.654  17.486  6.051   1.00 76.63 ? 6    ASP B N   1 
ATOM   4037  C  CA  . ASP B 1 3   ? 39.342  18.370  6.978   1.00 75.69 ? 6    ASP B CA  1 
ATOM   4038  C  C   . ASP B 1 3   ? 39.464  17.632  8.300   1.00 74.77 ? 6    ASP B C   1 
ATOM   4039  O  O   . ASP B 1 3   ? 38.572  16.875  8.686   1.00 74.64 ? 6    ASP B O   1 
ATOM   4040  C  CB  . ASP B 1 3   ? 38.612  19.711  7.146   1.00 76.09 ? 6    ASP B CB  1 
ATOM   4041  C  CG  . ASP B 1 3   ? 37.218  19.556  7.698   1.00 76.41 ? 6    ASP B CG  1 
ATOM   4042  O  OD1 . ASP B 1 3   ? 36.373  18.939  7.023   1.00 77.23 ? 6    ASP B OD1 1 
ATOM   4043  O  OD2 . ASP B 1 3   ? 36.957  20.074  8.800   1.00 76.34 ? 6    ASP B OD2 1 
ATOM   4044  N  N   . PRO B 1 4   ? 40.595  17.815  8.988   1.00 73.85 ? 7    PRO B N   1 
ATOM   4045  C  CA  . PRO B 1 4   ? 40.908  17.193  10.275  1.00 73.07 ? 7    PRO B CA  1 
ATOM   4046  C  C   . PRO B 1 4   ? 39.745  17.240  11.248  1.00 72.20 ? 7    PRO B C   1 
ATOM   4047  O  O   . PRO B 1 4   ? 39.486  16.269  11.955  1.00 72.48 ? 7    PRO B O   1 
ATOM   4048  C  CB  . PRO B 1 4   ? 42.078  18.029  10.773  1.00 73.34 ? 7    PRO B CB  1 
ATOM   4049  C  CG  . PRO B 1 4   ? 42.788  18.373  9.499   1.00 73.46 ? 7    PRO B CG  1 
ATOM   4050  C  CD  . PRO B 1 4   ? 41.651  18.766  8.596   1.00 73.71 ? 7    PRO B CD  1 
ATOM   4051  N  N   . ALA B 1 5   ? 39.029  18.359  11.260  1.00 71.08 ? 8    ALA B N   1 
ATOM   4052  C  CA  . ALA B 1 5   ? 37.890  18.519  12.150  1.00 69.86 ? 8    ALA B CA  1 
ATOM   4053  C  C   . ALA B 1 5   ? 36.802  17.496  11.862  1.00 69.12 ? 8    ALA B C   1 
ATOM   4054  O  O   . ALA B 1 5   ? 36.342  16.800  12.765  1.00 69.03 ? 8    ALA B O   1 
ATOM   4055  C  CB  . ALA B 1 5   ? 37.337  19.917  12.039  1.00 69.78 ? 8    ALA B CB  1 
ATOM   4056  N  N   . SER B 1 6   ? 36.419  17.376  10.596  1.00 68.28 ? 9    SER B N   1 
ATOM   4057  C  CA  . SER B 1 6   ? 35.377  16.432  10.217  1.00 67.84 ? 9    SER B CA  1 
ATOM   4058  C  C   . SER B 1 6   ? 35.761  14.972  10.471  1.00 67.51 ? 9    SER B C   1 
ATOM   4059  O  O   . SER B 1 6   ? 34.891  14.120  10.654  1.00 67.38 ? 9    SER B O   1 
ATOM   4060  C  CB  . SER B 1 6   ? 34.988  16.633  8.751   1.00 68.00 ? 9    SER B CB  1 
ATOM   4061  O  OG  . SER B 1 6   ? 36.109  16.480  7.903   1.00 68.51 ? 9    SER B OG  1 
ATOM   4062  N  N   . ASP B 1 7   ? 37.061  14.690  10.485  1.00 67.25 ? 10   ASP B N   1 
ATOM   4063  C  CA  . ASP B 1 7   ? 37.563  13.336  10.715  1.00 66.81 ? 10   ASP B CA  1 
ATOM   4064  C  C   . ASP B 1 7   ? 37.765  13.004  12.183  1.00 66.66 ? 10   ASP B C   1 
ATOM   4065  O  O   . ASP B 1 7   ? 38.362  11.975  12.510  1.00 66.79 ? 10   ASP B O   1 
ATOM   4066  C  CB  . ASP B 1 7   ? 38.894  13.138  9.994   1.00 66.93 ? 10   ASP B CB  1 
ATOM   4067  C  CG  . ASP B 1 7   ? 38.745  13.124  8.499   1.00 67.23 ? 10   ASP B CG  1 
ATOM   4068  O  OD1 . ASP B 1 7   ? 37.687  12.660  8.017   1.00 67.11 ? 10   ASP B OD1 1 
ATOM   4069  O  OD2 . ASP B 1 7   ? 39.693  13.568  7.808   1.00 67.88 ? 10   ASP B OD2 1 
ATOM   4070  N  N   . GLN B 1 8   ? 37.261  13.863  13.062  1.00 66.60 ? 11   GLN B N   1 
ATOM   4071  C  CA  . GLN B 1 8   ? 37.404  13.670  14.503  1.00 66.50 ? 11   GLN B CA  1 
ATOM   4072  C  C   . GLN B 1 8   ? 37.172  12.228  14.989  1.00 66.58 ? 11   GLN B C   1 
ATOM   4073  O  O   . GLN B 1 8   ? 38.108  11.571  15.452  1.00 66.87 ? 11   GLN B O   1 
ATOM   4074  C  CB  . GLN B 1 8   ? 36.504  14.666  15.250  1.00 66.36 ? 11   GLN B CB  1 
ATOM   4075  C  CG  . GLN B 1 8   ? 36.771  14.792  16.752  1.00 65.90 ? 11   GLN B CG  1 
ATOM   4076  C  CD  . GLN B 1 8   ? 36.166  13.655  17.558  1.00 66.11 ? 11   GLN B CD  1 
ATOM   4077  O  OE1 . GLN B 1 8   ? 35.107  13.124  17.215  1.00 65.86 ? 11   GLN B OE1 1 
ATOM   4078  N  NE2 . GLN B 1 8   ? 36.839  13.275  18.638  1.00 65.81 ? 11   GLN B NE2 1 
ATOM   4079  N  N   . MET B 1 9   ? 35.950  11.724  14.856  1.00 66.28 ? 12   MET B N   1 
ATOM   4080  C  CA  . MET B 1 9   ? 35.651  10.370  15.307  1.00 66.29 ? 12   MET B CA  1 
ATOM   4081  C  C   . MET B 1 9   ? 36.510  9.301   14.656  1.00 66.94 ? 12   MET B C   1 
ATOM   4082  O  O   . MET B 1 9   ? 36.919  8.335   15.303  1.00 67.37 ? 12   MET B O   1 
ATOM   4083  C  CB  . MET B 1 9   ? 34.182  10.042  15.079  1.00 65.24 ? 12   MET B CB  1 
ATOM   4084  C  CG  . MET B 1 9   ? 33.249  10.754  16.027  1.00 64.36 ? 12   MET B CG  1 
ATOM   4085  S  SD  . MET B 1 9   ? 31.586  10.131  15.878  1.00 63.51 ? 12   MET B SD  1 
ATOM   4086  C  CE  . MET B 1 9   ? 31.243  10.596  14.206  1.00 63.23 ? 12   MET B CE  1 
ATOM   4087  N  N   . GLN B 1 10  ? 36.783  9.477   13.372  1.00 67.66 ? 13   GLN B N   1 
ATOM   4088  C  CA  . GLN B 1 10  ? 37.579  8.511   12.643  1.00 68.20 ? 13   GLN B CA  1 
ATOM   4089  C  C   . GLN B 1 10  ? 38.920  8.292   13.319  1.00 68.72 ? 13   GLN B C   1 
ATOM   4090  O  O   . GLN B 1 10  ? 39.309  7.155   13.572  1.00 68.56 ? 13   GLN B O   1 
ATOM   4091  C  CB  . GLN B 1 10  ? 37.772  8.965   11.197  1.00 68.49 ? 13   GLN B CB  1 
ATOM   4092  C  CG  . GLN B 1 10  ? 38.387  7.897   10.304  1.00 69.12 ? 13   GLN B CG  1 
ATOM   4093  C  CD  . GLN B 1 10  ? 37.684  6.551   10.426  1.00 69.43 ? 13   GLN B CD  1 
ATOM   4094  O  OE1 . GLN B 1 10  ? 38.327  5.505   10.478  1.00 69.64 ? 13   GLN B OE1 1 
ATOM   4095  N  NE2 . GLN B 1 10  ? 36.356  6.577   10.482  1.00 69.85 ? 13   GLN B NE2 1 
ATOM   4096  N  N   . HIS B 1 11  ? 39.600  9.383   13.657  1.00 69.44 ? 14   HIS B N   1 
ATOM   4097  C  CA  . HIS B 1 11  ? 40.903  9.293   14.304  1.00 70.33 ? 14   HIS B CA  1 
ATOM   4098  C  C   . HIS B 1 11  ? 40.802  8.607   15.645  1.00 70.21 ? 14   HIS B C   1 
ATOM   4099  O  O   . HIS B 1 11  ? 41.563  7.676   15.933  1.00 70.23 ? 14   HIS B O   1 
ATOM   4100  C  CB  . HIS B 1 11  ? 41.521  10.679  14.470  1.00 71.81 ? 14   HIS B CB  1 
ATOM   4101  C  CG  . HIS B 1 11  ? 41.850  11.343  13.171  1.00 73.76 ? 14   HIS B CG  1 
ATOM   4102  N  ND1 . HIS B 1 11  ? 42.138  10.630  12.027  1.00 74.73 ? 14   HIS B ND1 1 
ATOM   4103  C  CD2 . HIS B 1 11  ? 41.914  12.652  12.825  1.00 74.58 ? 14   HIS B CD2 1 
ATOM   4104  C  CE1 . HIS B 1 11  ? 42.362  11.468  11.030  1.00 75.01 ? 14   HIS B CE1 1 
ATOM   4105  N  NE2 . HIS B 1 11  ? 42.232  12.700  11.487  1.00 75.26 ? 14   HIS B NE2 1 
ATOM   4106  N  N   . TRP B 1 12  ? 39.833  9.046   16.443  1.00 69.88 ? 15   TRP B N   1 
ATOM   4107  C  CA  . TRP B 1 12  ? 39.610  8.482   17.763  1.00 69.84 ? 15   TRP B CA  1 
ATOM   4108  C  C   . TRP B 1 12  ? 39.556  6.965   17.647  1.00 70.49 ? 15   TRP B C   1 
ATOM   4109  O  O   . TRP B 1 12  ? 40.250  6.252   18.375  1.00 70.76 ? 15   TRP B O   1 
ATOM   4110  C  CB  . TRP B 1 12  ? 38.301  9.009   18.344  1.00 68.71 ? 15   TRP B CB  1 
ATOM   4111  C  CG  . TRP B 1 12  ? 38.090  8.653   19.784  1.00 67.88 ? 15   TRP B CG  1 
ATOM   4112  C  CD1 . TRP B 1 12  ? 38.464  9.387   20.869  1.00 67.62 ? 15   TRP B CD1 1 
ATOM   4113  C  CD2 . TRP B 1 12  ? 37.476  7.462   20.299  1.00 67.40 ? 15   TRP B CD2 1 
ATOM   4114  N  NE1 . TRP B 1 12  ? 38.127  8.730   22.030  1.00 67.29 ? 15   TRP B NE1 1 
ATOM   4115  C  CE2 . TRP B 1 12  ? 37.520  7.545   21.708  1.00 67.12 ? 15   TRP B CE2 1 
ATOM   4116  C  CE3 . TRP B 1 12  ? 36.898  6.331   19.707  1.00 67.18 ? 15   TRP B CE3 1 
ATOM   4117  C  CZ2 . TRP B 1 12  ? 37.010  6.541   22.537  1.00 66.88 ? 15   TRP B CZ2 1 
ATOM   4118  C  CZ3 . TRP B 1 12  ? 36.389  5.328   20.535  1.00 66.91 ? 15   TRP B CZ3 1 
ATOM   4119  C  CH2 . TRP B 1 12  ? 36.451  5.442   21.934  1.00 66.86 ? 15   TRP B CH2 1 
ATOM   4120  N  N   . LYS B 1 13  ? 38.778  6.486   16.680  1.00 71.53 ? 16   LYS B N   1 
ATOM   4121  C  CA  . LYS B 1 13  ? 38.621  5.051   16.448  1.00 72.39 ? 16   LYS B CA  1 
ATOM   4122  C  C   . LYS B 1 13  ? 39.945  4.388   16.088  1.00 73.07 ? 16   LYS B C   1 
ATOM   4123  O  O   . LYS B 1 13  ? 40.289  3.320   16.616  1.00 73.09 ? 16   LYS B O   1 
ATOM   4124  C  CB  . LYS B 1 13  ? 37.612  4.802   15.324  1.00 72.09 ? 16   LYS B CB  1 
ATOM   4125  C  CG  . LYS B 1 13  ? 37.397  3.325   15.004  1.00 71.77 ? 16   LYS B CG  1 
ATOM   4126  C  CD  . LYS B 1 13  ? 36.507  3.146   13.785  1.00 71.43 ? 16   LYS B CD  1 
ATOM   4127  C  CE  . LYS B 1 13  ? 36.254  1.678   13.494  1.00 71.23 ? 16   LYS B CE  1 
ATOM   4128  N  NZ  . LYS B 1 13  ? 35.358  1.515   12.317  1.00 71.01 ? 16   LYS B NZ  1 
ATOM   4129  N  N   . GLU B 1 14  ? 40.680  5.029   15.187  1.00 73.71 ? 17   GLU B N   1 
ATOM   4130  C  CA  . GLU B 1 14  ? 41.955  4.507   14.738  1.00 74.62 ? 17   GLU B CA  1 
ATOM   4131  C  C   . GLU B 1 14  ? 42.960  4.420   15.870  1.00 75.37 ? 17   GLU B C   1 
ATOM   4132  O  O   . GLU B 1 14  ? 43.642  3.406   16.017  1.00 75.77 ? 17   GLU B O   1 
ATOM   4133  C  CB  . GLU B 1 14  ? 42.486  5.354   13.590  1.00 74.56 ? 17   GLU B CB  1 
ATOM   4134  C  CG  . GLU B 1 14  ? 41.618  5.237   12.345  1.00 74.73 ? 17   GLU B CG  1 
ATOM   4135  C  CD  . GLU B 1 14  ? 41.955  6.252   11.267  1.00 74.96 ? 17   GLU B CD  1 
ATOM   4136  O  OE1 . GLU B 1 14  ? 41.538  6.029   10.108  1.00 74.97 ? 17   GLU B OE1 1 
ATOM   4137  O  OE2 . GLU B 1 14  ? 42.615  7.273   11.571  1.00 75.07 ? 17   GLU B OE2 1 
ATOM   4138  N  N   . GLN B 1 15  ? 43.015  5.450   16.706  1.00 76.10 ? 18   GLN B N   1 
ATOM   4139  C  CA  . GLN B 1 15  ? 43.942  5.451   17.830  1.00 76.82 ? 18   GLN B CA  1 
ATOM   4140  C  C   . GLN B 1 15  ? 43.717  4.280   18.771  1.00 77.03 ? 18   GLN B C   1 
ATOM   4141  O  O   . GLN B 1 15  ? 44.618  3.898   19.514  1.00 77.12 ? 18   GLN B O   1 
ATOM   4142  C  CB  . GLN B 1 15  ? 43.806  6.741   18.615  1.00 77.54 ? 18   GLN B CB  1 
ATOM   4143  C  CG  . GLN B 1 15  ? 44.266  7.960   17.857  1.00 78.96 ? 18   GLN B CG  1 
ATOM   4144  C  CD  . GLN B 1 15  ? 44.106  9.223   18.675  1.00 79.96 ? 18   GLN B CD  1 
ATOM   4145  O  OE1 . GLN B 1 15  ? 44.588  9.312   19.813  1.00 80.03 ? 18   GLN B OE1 1 
ATOM   4146  N  NE2 . GLN B 1 15  ? 43.409  10.208  18.110  1.00 80.40 ? 18   GLN B NE2 1 
ATOM   4147  N  N   . ARG B 1 16  ? 42.515  3.711   18.730  1.00 77.13 ? 19   ARG B N   1 
ATOM   4148  C  CA  . ARG B 1 16  ? 42.156  2.593   19.592  1.00 77.22 ? 19   ARG B CA  1 
ATOM   4149  C  C   . ARG B 1 16  ? 41.925  1.307   18.837  1.00 77.58 ? 19   ARG B C   1 
ATOM   4150  O  O   . ARG B 1 16  ? 41.287  0.387   19.347  1.00 77.68 ? 19   ARG B O   1 
ATOM   4151  C  CB  . ARG B 1 16  ? 40.901  2.944   20.376  1.00 76.98 ? 19   ARG B CB  1 
ATOM   4152  C  CG  . ARG B 1 16  ? 41.147  4.046   21.355  1.00 77.08 ? 19   ARG B CG  1 
ATOM   4153  C  CD  . ARG B 1 16  ? 39.870  4.569   21.946  1.00 76.60 ? 19   ARG B CD  1 
ATOM   4154  N  NE  . ARG B 1 16  ? 40.138  5.647   22.896  1.00 76.65 ? 19   ARG B NE  1 
ATOM   4155  C  CZ  . ARG B 1 16  ? 40.787  6.773   22.602  1.00 76.55 ? 19   ARG B CZ  1 
ATOM   4156  N  NH1 . ARG B 1 16  ? 41.246  6.997   21.372  1.00 76.38 ? 19   ARG B NH1 1 
ATOM   4157  N  NH2 . ARG B 1 16  ? 40.997  7.673   23.554  1.00 76.40 ? 19   ARG B NH2 1 
ATOM   4158  N  N   . ALA B 1 17  ? 42.479  1.233   17.636  1.00 77.82 ? 20   ALA B N   1 
ATOM   4159  C  CA  . ALA B 1 17  ? 42.324  0.064   16.781  1.00 78.02 ? 20   ALA B CA  1 
ATOM   4160  C  C   . ALA B 1 17  ? 42.514  -1.282  17.486  1.00 78.12 ? 20   ALA B C   1 
ATOM   4161  O  O   . ALA B 1 17  ? 41.567  -2.053  17.650  1.00 77.97 ? 20   ALA B O   1 
ATOM   4162  C  CB  . ALA B 1 17  ? 43.273  0.174   15.580  1.00 78.26 ? 20   ALA B CB  1 
ATOM   4163  N  N   . ALA B 1 18  ? 43.725  -1.521  17.967  1.00 78.40 ? 21   ALA B N   1 
ATOM   4164  C  CA  . ALA B 1 18  ? 44.058  -2.782  18.611  1.00 78.71 ? 21   ALA B CA  1 
ATOM   4165  C  C   . ALA B 1 18  ? 43.419  -3.100  19.956  1.00 78.81 ? 21   ALA B C   1 
ATOM   4166  O  O   . ALA B 1 18  ? 43.686  -4.162  20.521  1.00 79.12 ? 21   ALA B O   1 
ATOM   4167  C  CB  . ALA B 1 18  ? 45.569  -2.925  18.711  1.00 78.98 ? 21   ALA B CB  1 
ATOM   4168  N  N   . GLN B 1 19  ? 42.582  -2.216  20.484  1.00 78.50 ? 22   GLN B N   1 
ATOM   4169  C  CA  . GLN B 1 19  ? 41.982  -2.520  21.774  1.00 78.10 ? 22   GLN B CA  1 
ATOM   4170  C  C   . GLN B 1 19  ? 40.494  -2.801  21.741  1.00 77.51 ? 22   GLN B C   1 
ATOM   4171  O  O   . GLN B 1 19  ? 39.801  -2.462  20.781  1.00 77.64 ? 22   GLN B O   1 
ATOM   4172  C  CB  . GLN B 1 19  ? 42.307  -1.439  22.802  1.00 78.53 ? 22   GLN B CB  1 
ATOM   4173  C  CG  . GLN B 1 19  ? 41.757  -0.065  22.488  1.00 79.36 ? 22   GLN B CG  1 
ATOM   4174  C  CD  . GLN B 1 19  ? 42.336  0.998   23.405  1.00 79.86 ? 22   GLN B CD  1 
ATOM   4175  O  OE1 . GLN B 1 19  ? 43.509  0.935   23.773  1.00 79.95 ? 22   GLN B OE1 1 
ATOM   4176  N  NE2 . GLN B 1 19  ? 41.519  1.980   23.776  1.00 79.87 ? 22   GLN B NE2 1 
ATOM   4177  N  N   . LYS B 1 20  ? 40.026  -3.456  22.795  1.00 76.73 ? 23   LYS B N   1 
ATOM   4178  C  CA  . LYS B 1 20  ? 38.629  -3.813  22.930  1.00 75.89 ? 23   LYS B CA  1 
ATOM   4179  C  C   . LYS B 1 20  ? 37.850  -2.627  23.463  1.00 74.83 ? 23   LYS B C   1 
ATOM   4180  O  O   . LYS B 1 20  ? 38.356  -1.860  24.282  1.00 74.90 ? 23   LYS B O   1 
ATOM   4181  C  CB  . LYS B 1 20  ? 38.490  -5.006  23.869  1.00 76.57 ? 23   LYS B CB  1 
ATOM   4182  C  CG  . LYS B 1 20  ? 37.135  -5.672  23.798  1.00 77.93 ? 23   LYS B CG  1 
ATOM   4183  C  CD  . LYS B 1 20  ? 37.169  -7.051  24.425  1.00 78.97 ? 23   LYS B CD  1 
ATOM   4184  C  CE  . LYS B 1 20  ? 35.845  -7.777  24.225  1.00 79.66 ? 23   LYS B CE  1 
ATOM   4185  N  NZ  . LYS B 1 20  ? 35.875  -9.141  24.831  1.00 80.52 ? 23   LYS B NZ  1 
ATOM   4186  N  N   . ALA B 1 21  ? 36.619  -2.479  22.988  1.00 73.55 ? 24   ALA B N   1 
ATOM   4187  C  CA  . ALA B 1 21  ? 35.758  -1.382  23.409  1.00 72.34 ? 24   ALA B CA  1 
ATOM   4188  C  C   . ALA B 1 21  ? 35.480  -1.499  24.888  1.00 71.28 ? 24   ALA B C   1 
ATOM   4189  O  O   . ALA B 1 21  ? 35.428  -2.604  25.420  1.00 71.40 ? 24   ALA B O   1 
ATOM   4190  C  CB  . ALA B 1 21  ? 34.452  -1.422  22.643  1.00 72.52 ? 24   ALA B CB  1 
ATOM   4191  N  N   . ASP B 1 22  ? 35.323  -0.362  25.552  1.00 69.95 ? 25   ASP B N   1 
ATOM   4192  C  CA  . ASP B 1 22  ? 35.031  -0.362  26.974  1.00 68.79 ? 25   ASP B CA  1 
ATOM   4193  C  C   . ASP B 1 22  ? 33.631  -0.880  27.258  1.00 67.83 ? 25   ASP B C   1 
ATOM   4194  O  O   . ASP B 1 22  ? 32.784  -0.946  26.362  1.00 68.10 ? 25   ASP B O   1 
ATOM   4195  C  CB  . ASP B 1 22  ? 35.166  1.040   27.544  1.00 69.10 ? 25   ASP B CB  1 
ATOM   4196  C  CG  . ASP B 1 22  ? 36.594  1.419   27.801  1.00 69.63 ? 25   ASP B CG  1 
ATOM   4197  O  OD1 . ASP B 1 22  ? 36.996  2.519   27.381  1.00 70.16 ? 25   ASP B OD1 1 
ATOM   4198  O  OD2 . ASP B 1 22  ? 37.317  0.620   28.425  1.00 69.68 ? 25   ASP B OD2 1 
ATOM   4199  N  N   . VAL B 1 23  ? 33.399  -1.267  28.509  1.00 66.44 ? 26   VAL B N   1 
ATOM   4200  C  CA  . VAL B 1 23  ? 32.100  -1.771  28.929  1.00 64.87 ? 26   VAL B CA  1 
ATOM   4201  C  C   . VAL B 1 23  ? 31.208  -0.581  29.258  1.00 64.22 ? 26   VAL B C   1 
ATOM   4202  O  O   . VAL B 1 23  ? 31.599  0.311   30.014  1.00 64.23 ? 26   VAL B O   1 
ATOM   4203  C  CB  . VAL B 1 23  ? 32.227  -2.651  30.177  1.00 64.52 ? 26   VAL B CB  1 
ATOM   4204  C  CG1 . VAL B 1 23  ? 30.858  -3.097  30.649  1.00 64.15 ? 26   VAL B CG1 1 
ATOM   4205  C  CG2 . VAL B 1 23  ? 33.090  -3.848  29.874  1.00 64.16 ? 26   VAL B CG2 1 
ATOM   4206  N  N   . LEU B 1 24  ? 30.019  -0.560  28.668  1.00 62.99 ? 27   LEU B N   1 
ATOM   4207  C  CA  . LEU B 1 24  ? 29.072  0.519   28.902  1.00 61.72 ? 27   LEU B CA  1 
ATOM   4208  C  C   . LEU B 1 24  ? 28.525  0.397   30.318  1.00 61.23 ? 27   LEU B C   1 
ATOM   4209  O  O   . LEU B 1 24  ? 28.015  -0.651  30.707  1.00 61.30 ? 27   LEU B O   1 
ATOM   4210  C  CB  . LEU B 1 24  ? 27.950  0.441   27.872  1.00 61.35 ? 27   LEU B CB  1 
ATOM   4211  C  CG  . LEU B 1 24  ? 26.901  1.546   27.859  1.00 61.00 ? 27   LEU B CG  1 
ATOM   4212  C  CD1 . LEU B 1 24  ? 27.538  2.879   28.122  1.00 61.06 ? 27   LEU B CD1 1 
ATOM   4213  C  CD2 . LEU B 1 24  ? 26.203  1.553   26.512  1.00 60.94 ? 27   LEU B CD2 1 
ATOM   4214  N  N   . THR B 1 25  ? 28.640  1.464   31.096  1.00 60.41 ? 28   THR B N   1 
ATOM   4215  C  CA  . THR B 1 25  ? 28.167  1.424   32.472  1.00 59.67 ? 28   THR B CA  1 
ATOM   4216  C  C   . THR B 1 25  ? 27.300  2.608   32.815  1.00 59.27 ? 28   THR B C   1 
ATOM   4217  O  O   . THR B 1 25  ? 27.276  3.605   32.094  1.00 59.26 ? 28   THR B O   1 
ATOM   4218  C  CB  . THR B 1 25  ? 29.333  1.467   33.458  1.00 59.72 ? 28   THR B CB  1 
ATOM   4219  O  OG1 . THR B 1 25  ? 29.936  2.767   33.412  1.00 59.89 ? 28   THR B OG1 1 
ATOM   4220  C  CG2 . THR B 1 25  ? 30.373  0.420   33.109  1.00 59.45 ? 28   THR B CG2 1 
ATOM   4221  N  N   . THR B 1 26  ? 26.618  2.506   33.949  1.00 58.69 ? 29   THR B N   1 
ATOM   4222  C  CA  . THR B 1 26  ? 25.786  3.596   34.418  1.00 58.12 ? 29   THR B CA  1 
ATOM   4223  C  C   . THR B 1 26  ? 26.767  4.571   35.024  1.00 58.08 ? 29   THR B C   1 
ATOM   4224  O  O   . THR B 1 26  ? 27.977  4.377   34.935  1.00 58.07 ? 29   THR B O   1 
ATOM   4225  C  CB  . THR B 1 26  ? 24.853  3.157   35.535  1.00 57.94 ? 29   THR B CB  1 
ATOM   4226  O  OG1 . THR B 1 26  ? 25.635  2.752   36.662  1.00 57.88 ? 29   THR B OG1 1 
ATOM   4227  C  CG2 . THR B 1 26  ? 23.981  2.012   35.079  1.00 57.37 ? 29   THR B CG2 1 
ATOM   4228  N  N   . GLY B 1 27  ? 26.243  5.587   35.688  1.00 58.15 ? 30   GLY B N   1 
ATOM   4229  C  CA  . GLY B 1 27  ? 27.108  6.570   36.306  1.00 58.26 ? 30   GLY B CA  1 
ATOM   4230  C  C   . GLY B 1 27  ? 27.842  5.996   37.498  1.00 58.38 ? 30   GLY B C   1 
ATOM   4231  O  O   . GLY B 1 27  ? 28.982  6.354   37.759  1.00 58.48 ? 30   GLY B O   1 
ATOM   4232  N  N   . ALA B 1 28  ? 27.192  5.095   38.225  1.00 58.32 ? 31   ALA B N   1 
ATOM   4233  C  CA  . ALA B 1 28  ? 27.807  4.487   39.392  1.00 58.02 ? 31   ALA B CA  1 
ATOM   4234  C  C   . ALA B 1 28  ? 28.743  3.352   38.988  1.00 58.07 ? 31   ALA B C   1 
ATOM   4235  O  O   . ALA B 1 28  ? 29.186  2.571   39.830  1.00 58.07 ? 31   ALA B O   1 
ATOM   4236  C  CB  . ALA B 1 28  ? 26.733  3.987   40.346  1.00 58.09 ? 31   ALA B CB  1 
ATOM   4237  N  N   . GLY B 1 29  ? 29.031  3.254   37.695  1.00 58.14 ? 32   GLY B N   1 
ATOM   4238  C  CA  . GLY B 1 29  ? 29.933  2.222   37.213  1.00 58.60 ? 32   GLY B CA  1 
ATOM   4239  C  C   . GLY B 1 29  ? 29.361  0.825   37.069  1.00 59.27 ? 32   GLY B C   1 
ATOM   4240  O  O   . GLY B 1 29  ? 30.112  -0.144  36.926  1.00 59.20 ? 32   GLY B O   1 
ATOM   4241  N  N   . ASN B 1 30  ? 28.040  0.700   37.116  1.00 59.78 ? 33   ASN B N   1 
ATOM   4242  C  CA  . ASN B 1 30  ? 27.418  -0.608  36.970  1.00 60.36 ? 33   ASN B CA  1 
ATOM   4243  C  C   . ASN B 1 30  ? 27.312  -0.969  35.498  1.00 61.13 ? 33   ASN B C   1 
ATOM   4244  O  O   . ASN B 1 30  ? 26.855  -0.166  34.679  1.00 61.18 ? 33   ASN B O   1 
ATOM   4245  C  CB  . ASN B 1 30  ? 26.029  -0.608  37.592  1.00 60.16 ? 33   ASN B CB  1 
ATOM   4246  C  CG  . ASN B 1 30  ? 26.042  -0.164  39.029  1.00 60.18 ? 33   ASN B CG  1 
ATOM   4247  O  OD1 . ASN B 1 30  ? 25.276  0.714   39.423  1.00 60.51 ? 33   ASN B OD1 1 
ATOM   4248  N  ND2 . ASN B 1 30  ? 26.928  -0.753  39.823  1.00 60.00 ? 33   ASN B ND2 1 
ATOM   4249  N  N   . PRO B 1 31  ? 27.767  -2.174  35.130  1.00 61.65 ? 34   PRO B N   1 
ATOM   4250  C  CA  . PRO B 1 31  ? 27.713  -2.634  33.740  1.00 62.24 ? 34   PRO B CA  1 
ATOM   4251  C  C   . PRO B 1 31  ? 26.269  -2.635  33.241  1.00 62.65 ? 34   PRO B C   1 
ATOM   4252  O  O   . PRO B 1 31  ? 25.342  -2.892  34.015  1.00 62.94 ? 34   PRO B O   1 
ATOM   4253  C  CB  . PRO B 1 31  ? 28.261  -4.061  33.836  1.00 62.17 ? 34   PRO B CB  1 
ATOM   4254  C  CG  . PRO B 1 31  ? 29.221  -3.983  34.998  1.00 61.91 ? 34   PRO B CG  1 
ATOM   4255  C  CD  . PRO B 1 31  ? 28.431  -3.167  35.995  1.00 61.86 ? 34   PRO B CD  1 
ATOM   4256  N  N   . VAL B 1 32  ? 26.076  -2.328  31.961  1.00 62.93 ? 35   VAL B N   1 
ATOM   4257  C  CA  . VAL B 1 32  ? 24.735  -2.310  31.374  1.00 63.13 ? 35   VAL B CA  1 
ATOM   4258  C  C   . VAL B 1 32  ? 24.535  -3.461  30.374  1.00 63.47 ? 35   VAL B C   1 
ATOM   4259  O  O   . VAL B 1 32  ? 25.336  -3.646  29.451  1.00 63.60 ? 35   VAL B O   1 
ATOM   4260  C  CB  . VAL B 1 32  ? 24.447  -0.954  30.694  1.00 62.75 ? 35   VAL B CB  1 
ATOM   4261  C  CG1 . VAL B 1 32  ? 23.076  -0.961  30.059  1.00 62.82 ? 35   VAL B CG1 1 
ATOM   4262  C  CG2 . VAL B 1 32  ? 24.542  0.161   31.714  1.00 62.37 ? 35   VAL B CG2 1 
ATOM   4263  N  N   . GLY B 1 33  ? 23.466  -4.235  30.571  1.00 63.65 ? 36   GLY B N   1 
ATOM   4264  C  CA  . GLY B 1 33  ? 23.179  -5.360  29.691  1.00 63.85 ? 36   GLY B CA  1 
ATOM   4265  C  C   . GLY B 1 33  ? 22.582  -4.973  28.350  1.00 63.81 ? 36   GLY B C   1 
ATOM   4266  O  O   . GLY B 1 33  ? 22.888  -5.593  27.331  1.00 64.15 ? 36   GLY B O   1 
ATOM   4267  N  N   . ASP B 1 34  ? 21.738  -3.942  28.349  1.00 63.74 ? 37   ASP B N   1 
ATOM   4268  C  CA  . ASP B 1 34  ? 21.084  -3.460  27.133  1.00 63.35 ? 37   ASP B CA  1 
ATOM   4269  C  C   . ASP B 1 34  ? 20.679  -1.994  27.299  1.00 62.59 ? 37   ASP B C   1 
ATOM   4270  O  O   . ASP B 1 34  ? 19.781  -1.683  28.079  1.00 62.91 ? 37   ASP B O   1 
ATOM   4271  C  CB  . ASP B 1 34  ? 19.842  -4.318  26.841  1.00 63.74 ? 37   ASP B CB  1 
ATOM   4272  C  CG  . ASP B 1 34  ? 19.077  -3.867  25.595  1.00 64.31 ? 37   ASP B CG  1 
ATOM   4273  O  OD1 . ASP B 1 34  ? 19.621  -3.098  24.771  1.00 65.06 ? 37   ASP B OD1 1 
ATOM   4274  O  OD2 . ASP B 1 34  ? 17.916  -4.304  25.432  1.00 64.39 ? 37   ASP B OD2 1 
ATOM   4275  N  N   . LYS B 1 35  ? 21.358  -1.088  26.601  1.00 61.37 ? 38   LYS B N   1 
ATOM   4276  C  CA  . LYS B 1 35  ? 20.999  0.320   26.698  1.00 60.46 ? 38   LYS B CA  1 
ATOM   4277  C  C   . LYS B 1 35  ? 20.276  0.740   25.426  1.00 60.46 ? 38   LYS B C   1 
ATOM   4278  O  O   . LYS B 1 35  ? 20.398  1.889   24.977  1.00 60.57 ? 38   LYS B O   1 
ATOM   4279  C  CB  . LYS B 1 35  ? 22.226  1.209   26.916  1.00 59.40 ? 38   LYS B CB  1 
ATOM   4280  C  CG  . LYS B 1 35  ? 21.895  2.483   27.693  1.00 58.21 ? 38   LYS B CG  1 
ATOM   4281  C  CD  . LYS B 1 35  ? 22.848  3.625   27.396  1.00 56.83 ? 38   LYS B CD  1 
ATOM   4282  C  CE  . LYS B 1 35  ? 22.617  4.148   26.005  1.00 56.48 ? 38   LYS B CE  1 
ATOM   4283  N  NZ  . LYS B 1 35  ? 21.176  4.464   25.806  1.00 56.45 ? 38   LYS B NZ  1 
ATOM   4284  N  N   . LEU B 1 36  ? 19.509  -0.192  24.861  1.00 60.11 ? 39   LEU B N   1 
ATOM   4285  C  CA  . LEU B 1 36  ? 18.755  0.058   23.632  1.00 59.83 ? 39   LEU B CA  1 
ATOM   4286  C  C   . LEU B 1 36  ? 17.267  -0.264  23.744  1.00 59.79 ? 39   LEU B C   1 
ATOM   4287  O  O   . LEU B 1 36  ? 16.517  -0.104  22.779  1.00 59.71 ? 39   LEU B O   1 
ATOM   4288  C  CB  . LEU B 1 36  ? 19.351  -0.736  22.474  1.00 59.80 ? 39   LEU B CB  1 
ATOM   4289  C  CG  . LEU B 1 36  ? 20.741  -0.296  22.027  1.00 59.73 ? 39   LEU B CG  1 
ATOM   4290  C  CD1 . LEU B 1 36  ? 21.246  -1.197  20.911  1.00 59.61 ? 39   LEU B CD1 1 
ATOM   4291  C  CD2 . LEU B 1 36  ? 20.680  1.141   21.565  1.00 59.64 ? 39   LEU B CD2 1 
ATOM   4292  N  N   . ASN B 1 37  ? 16.849  -0.746  24.909  1.00 59.62 ? 40   ASN B N   1 
ATOM   4293  C  CA  . ASN B 1 37  ? 15.452  -1.082  25.141  1.00 59.19 ? 40   ASN B CA  1 
ATOM   4294  C  C   . ASN B 1 37  ? 15.147  -0.879  26.615  1.00 59.05 ? 40   ASN B C   1 
ATOM   4295  O  O   . ASN B 1 37  ? 15.916  -1.307  27.474  1.00 59.06 ? 40   ASN B O   1 
ATOM   4296  C  CB  . ASN B 1 37  ? 15.173  -2.542  24.762  1.00 59.06 ? 40   ASN B CB  1 
ATOM   4297  C  CG  . ASN B 1 37  ? 15.410  -2.827  23.291  1.00 58.90 ? 40   ASN B CG  1 
ATOM   4298  O  OD1 . ASN B 1 37  ? 16.387  -3.484  22.923  1.00 59.10 ? 40   ASN B OD1 1 
ATOM   4299  N  ND2 . ASN B 1 37  ? 14.516  -2.343  22.442  1.00 58.67 ? 40   ASN B ND2 1 
ATOM   4300  N  N   . VAL B 1 38  ? 14.043  -0.202  26.910  1.00 58.76 ? 41   VAL B N   1 
ATOM   4301  C  CA  . VAL B 1 38  ? 13.656  0.019   28.292  1.00 58.43 ? 41   VAL B CA  1 
ATOM   4302  C  C   . VAL B 1 38  ? 12.852  -1.165  28.808  1.00 58.74 ? 41   VAL B C   1 
ATOM   4303  O  O   . VAL B 1 38  ? 12.389  -2.003  28.040  1.00 58.56 ? 41   VAL B O   1 
ATOM   4304  C  CB  . VAL B 1 38  ? 12.828  1.283   28.445  1.00 57.82 ? 41   VAL B CB  1 
ATOM   4305  C  CG1 . VAL B 1 38  ? 13.654  2.487   28.075  1.00 57.16 ? 41   VAL B CG1 1 
ATOM   4306  C  CG2 . VAL B 1 38  ? 11.600  1.195   27.576  1.00 57.20 ? 41   VAL B CG2 1 
ATOM   4307  N  N   . ILE B 1 39  ? 12.676  -1.209  30.120  1.00 59.29 ? 42   ILE B N   1 
ATOM   4308  C  CA  . ILE B 1 39  ? 11.945  -2.285  30.772  1.00 59.91 ? 42   ILE B CA  1 
ATOM   4309  C  C   . ILE B 1 39  ? 10.438  -2.016  30.808  1.00 60.74 ? 42   ILE B C   1 
ATOM   4310  O  O   . ILE B 1 39  ? 10.002  -0.965  31.288  1.00 61.12 ? 42   ILE B O   1 
ATOM   4311  C  CB  . ILE B 1 39  ? 12.437  -2.463  32.220  1.00 59.44 ? 42   ILE B CB  1 
ATOM   4312  C  CG1 . ILE B 1 39  ? 13.956  -2.616  32.251  1.00 58.85 ? 42   ILE B CG1 1 
ATOM   4313  C  CG2 . ILE B 1 39  ? 11.787  -3.674  32.848  1.00 59.64 ? 42   ILE B CG2 1 
ATOM   4314  C  CD1 . ILE B 1 39  ? 14.532  -2.620  33.645  1.00 58.01 ? 42   ILE B CD1 1 
ATOM   4315  N  N   . THR B 1 40  ? 9.645   -2.978  30.334  1.00 61.19 ? 43   THR B N   1 
ATOM   4316  C  CA  . THR B 1 40  ? 8.184   -2.853  30.319  1.00 61.17 ? 43   THR B CA  1 
ATOM   4317  C  C   . THR B 1 40  ? 7.547   -4.171  30.721  1.00 61.61 ? 43   THR B C   1 
ATOM   4318  O  O   . THR B 1 40  ? 8.224   -5.198  30.779  1.00 61.61 ? 43   THR B O   1 
ATOM   4319  C  CB  . THR B 1 40  ? 7.637   -2.498  28.904  1.00 61.11 ? 43   THR B CB  1 
ATOM   4320  O  OG1 . THR B 1 40  ? 7.973   -3.536  27.971  1.00 60.14 ? 43   THR B OG1 1 
ATOM   4321  C  CG2 . THR B 1 40  ? 8.201   -1.173  28.417  1.00 60.52 ? 43   THR B CG2 1 
ATOM   4322  N  N   . VAL B 1 41  ? 6.259   -4.129  31.055  1.00 62.16 ? 44   VAL B N   1 
ATOM   4323  C  CA  . VAL B 1 41  ? 5.518   -5.341  31.403  1.00 62.72 ? 44   VAL B CA  1 
ATOM   4324  C  C   . VAL B 1 41  ? 4.928   -5.815  30.092  1.00 63.02 ? 44   VAL B C   1 
ATOM   4325  O  O   . VAL B 1 41  ? 3.973   -5.224  29.587  1.00 63.39 ? 44   VAL B O   1 
ATOM   4326  C  CB  . VAL B 1 41  ? 4.367   -5.082  32.403  1.00 62.51 ? 44   VAL B CB  1 
ATOM   4327  C  CG1 . VAL B 1 41  ? 4.910   -4.981  33.798  1.00 62.76 ? 44   VAL B CG1 1 
ATOM   4328  C  CG2 . VAL B 1 41  ? 3.635   -3.816  32.055  1.00 62.38 ? 44   VAL B CG2 1 
ATOM   4329  N  N   . GLY B 1 42  ? 5.516   -6.862  29.523  1.00 63.18 ? 45   GLY B N   1 
ATOM   4330  C  CA  . GLY B 1 42  ? 5.031   -7.345  28.248  1.00 63.19 ? 45   GLY B CA  1 
ATOM   4331  C  C   . GLY B 1 42  ? 5.495   -6.391  27.153  1.00 63.18 ? 45   GLY B C   1 
ATOM   4332  O  O   . GLY B 1 42  ? 5.820   -5.225  27.423  1.00 63.25 ? 45   GLY B O   1 
ATOM   4333  N  N   . PRO B 1 43  ? 5.499   -6.847  25.897  1.00 62.89 ? 46   PRO B N   1 
ATOM   4334  C  CA  . PRO B 1 43  ? 5.919   -6.078  24.722  1.00 62.65 ? 46   PRO B CA  1 
ATOM   4335  C  C   . PRO B 1 43  ? 5.274   -4.702  24.618  1.00 62.50 ? 46   PRO B C   1 
ATOM   4336  O  O   . PRO B 1 43  ? 5.949   -3.718  24.324  1.00 62.56 ? 46   PRO B O   1 
ATOM   4337  C  CB  . PRO B 1 43  ? 5.475   -6.966  23.563  1.00 62.71 ? 46   PRO B CB  1 
ATOM   4338  C  CG  . PRO B 1 43  ? 5.528   -8.338  24.137  1.00 62.73 ? 46   PRO B CG  1 
ATOM   4339  C  CD  . PRO B 1 43  ? 4.933   -8.147  25.494  1.00 62.79 ? 46   PRO B CD  1 
ATOM   4340  N  N   . ARG B 1 44  ? 3.967   -4.641  24.846  1.00 62.18 ? 47   ARG B N   1 
ATOM   4341  C  CA  . ARG B 1 44  ? 3.235   -3.388  24.748  1.00 61.80 ? 47   ARG B CA  1 
ATOM   4342  C  C   . ARG B 1 44  ? 2.690   -2.915  26.099  1.00 61.49 ? 47   ARG B C   1 
ATOM   4343  O  O   . ARG B 1 44  ? 1.563   -2.428  26.190  1.00 61.47 ? 47   ARG B O   1 
ATOM   4344  C  CB  . ARG B 1 44  ? 2.113   -3.525  23.710  1.00 61.94 ? 47   ARG B CB  1 
ATOM   4345  C  CG  . ARG B 1 44  ? 2.631   -3.792  22.296  1.00 62.32 ? 47   ARG B CG  1 
ATOM   4346  C  CD  . ARG B 1 44  ? 1.518   -4.113  21.292  1.00 62.77 ? 47   ARG B CD  1 
ATOM   4347  N  NE  . ARG B 1 44  ? 2.066   -4.509  19.986  1.00 63.40 ? 47   ARG B NE  1 
ATOM   4348  C  CZ  . ARG B 1 44  ? 1.340   -4.901  18.936  1.00 63.65 ? 47   ARG B CZ  1 
ATOM   4349  N  NH1 . ARG B 1 44  ? 1.939   -5.242  17.801  1.00 63.36 ? 47   ARG B NH1 1 
ATOM   4350  N  NH2 . ARG B 1 44  ? 0.015   -4.938  19.006  1.00 64.25 ? 47   ARG B NH2 1 
ATOM   4351  N  N   . GLY B 1 45  ? 3.510   -3.042  27.141  1.00 61.10 ? 48   GLY B N   1 
ATOM   4352  C  CA  . GLY B 1 45  ? 3.104   -2.611  28.469  1.00 60.49 ? 48   GLY B CA  1 
ATOM   4353  C  C   . GLY B 1 45  ? 3.832   -1.363  28.934  1.00 60.27 ? 48   GLY B C   1 
ATOM   4354  O  O   . GLY B 1 45  ? 4.784   -0.935  28.289  1.00 60.35 ? 48   GLY B O   1 
ATOM   4355  N  N   . PRO B 1 46  ? 3.414   -0.752  30.053  1.00 59.95 ? 49   PRO B N   1 
ATOM   4356  C  CA  . PRO B 1 46  ? 4.049   0.457   30.582  1.00 59.75 ? 49   PRO B CA  1 
ATOM   4357  C  C   . PRO B 1 46  ? 5.480   0.307   31.046  1.00 59.50 ? 49   PRO B C   1 
ATOM   4358  O  O   . PRO B 1 46  ? 6.013   -0.797  31.166  1.00 59.27 ? 49   PRO B O   1 
ATOM   4359  C  CB  . PRO B 1 46  ? 3.126   0.857   31.734  1.00 59.83 ? 49   PRO B CB  1 
ATOM   4360  C  CG  . PRO B 1 46  ? 2.531   -0.430  32.158  1.00 59.72 ? 49   PRO B CG  1 
ATOM   4361  C  CD  . PRO B 1 46  ? 2.213   -1.070  30.836  1.00 59.86 ? 49   PRO B CD  1 
ATOM   4362  N  N   . LEU B 1 47  ? 6.076   1.458   31.330  1.00 59.49 ? 50   LEU B N   1 
ATOM   4363  C  CA  . LEU B 1 47  ? 7.458   1.564   31.765  1.00 59.49 ? 50   LEU B CA  1 
ATOM   4364  C  C   . LEU B 1 47  ? 7.619   1.418   33.272  1.00 59.60 ? 50   LEU B C   1 
ATOM   4365  O  O   . LEU B 1 47  ? 6.797   1.916   34.052  1.00 59.84 ? 50   LEU B O   1 
ATOM   4366  C  CB  . LEU B 1 47  ? 8.009   2.913   31.303  1.00 59.40 ? 50   LEU B CB  1 
ATOM   4367  C  CG  . LEU B 1 47  ? 9.475   3.268   31.537  1.00 59.06 ? 50   LEU B CG  1 
ATOM   4368  C  CD1 . LEU B 1 47  ? 10.386  2.208   30.939  1.00 59.39 ? 50   LEU B CD1 1 
ATOM   4369  C  CD2 . LEU B 1 47  ? 9.743   4.615   30.907  1.00 58.67 ? 50   LEU B CD2 1 
ATOM   4370  N  N   . LEU B 1 48  ? 8.718   0.782   33.670  1.00 59.51 ? 51   LEU B N   1 
ATOM   4371  C  CA  . LEU B 1 48  ? 9.011   0.545   35.074  1.00 59.48 ? 51   LEU B CA  1 
ATOM   4372  C  C   . LEU B 1 48  ? 9.993   1.513   35.705  1.00 59.65 ? 51   LEU B C   1 
ATOM   4373  O  O   . LEU B 1 48  ? 10.984  1.911   35.098  1.00 59.48 ? 51   LEU B O   1 
ATOM   4374  C  CB  . LEU B 1 48  ? 9.549   -0.870  35.269  1.00 59.42 ? 51   LEU B CB  1 
ATOM   4375  C  CG  . LEU B 1 48  ? 8.542   -2.004  35.153  1.00 59.19 ? 51   LEU B CG  1 
ATOM   4376  C  CD1 . LEU B 1 48  ? 7.411   -1.733  36.109  1.00 59.48 ? 51   LEU B CD1 1 
ATOM   4377  C  CD2 . LEU B 1 48  ? 8.017   -2.102  33.746  1.00 59.49 ? 51   LEU B CD2 1 
ATOM   4378  N  N   . VAL B 1 49  ? 9.732   1.847   36.960  1.00 59.96 ? 52   VAL B N   1 
ATOM   4379  C  CA  . VAL B 1 49  ? 10.613  2.728   37.699  1.00 60.26 ? 52   VAL B CA  1 
ATOM   4380  C  C   . VAL B 1 49  ? 11.921  1.972   37.919  1.00 60.68 ? 52   VAL B C   1 
ATOM   4381  O  O   . VAL B 1 49  ? 12.990  2.575   37.976  1.00 61.01 ? 52   VAL B O   1 
ATOM   4382  C  CB  . VAL B 1 49  ? 9.977   3.112   39.037  1.00 60.16 ? 52   VAL B CB  1 
ATOM   4383  C  CG1 . VAL B 1 49  ? 10.996  3.740   39.966  1.00 60.01 ? 52   VAL B CG1 1 
ATOM   4384  C  CG2 . VAL B 1 49  ? 8.838   4.074   38.784  1.00 59.98 ? 52   VAL B CG2 1 
ATOM   4385  N  N   . GLN B 1 50  ? 11.827  0.645   37.982  1.00 60.90 ? 53   GLN B N   1 
ATOM   4386  C  CA  . GLN B 1 50  ? 12.982  -0.234  38.172  1.00 61.11 ? 53   GLN B CA  1 
ATOM   4387  C  C   . GLN B 1 50  ? 14.078  -0.023  37.149  1.00 61.01 ? 53   GLN B C   1 
ATOM   4388  O  O   . GLN B 1 50  ? 15.227  -0.389  37.387  1.00 61.12 ? 53   GLN B O   1 
ATOM   4389  C  CB  . GLN B 1 50  ? 12.571  -1.692  38.055  1.00 61.75 ? 53   GLN B CB  1 
ATOM   4390  C  CG  . GLN B 1 50  ? 11.753  -2.220  39.189  1.00 62.72 ? 53   GLN B CG  1 
ATOM   4391  C  CD  . GLN B 1 50  ? 11.535  -3.704  39.058  1.00 63.02 ? 53   GLN B CD  1 
ATOM   4392  O  OE1 . GLN B 1 50  ? 11.801  -4.287  38.004  1.00 63.05 ? 53   GLN B OE1 1 
ATOM   4393  N  NE2 . GLN B 1 50  ? 11.060  -4.332  40.127  1.00 63.75 ? 53   GLN B NE2 1 
ATOM   4394  N  N   . ASP B 1 51  ? 13.703  0.460   35.969  1.00 60.58 ? 54   ASP B N   1 
ATOM   4395  C  CA  . ASP B 1 51  ? 14.674  0.691   34.923  1.00 60.07 ? 54   ASP B CA  1 
ATOM   4396  C  C   . ASP B 1 51  ? 15.466  1.925   35.278  1.00 59.81 ? 54   ASP B C   1 
ATOM   4397  O  O   . ASP B 1 51  ? 15.224  3.001   34.748  1.00 60.02 ? 54   ASP B O   1 
ATOM   4398  C  CB  . ASP B 1 51  ? 13.985  0.886   33.585  1.00 60.36 ? 54   ASP B CB  1 
ATOM   4399  C  CG  . ASP B 1 51  ? 14.953  0.851   32.432  1.00 60.87 ? 54   ASP B CG  1 
ATOM   4400  O  OD1 . ASP B 1 51  ? 14.497  0.666   31.288  1.00 61.13 ? 54   ASP B OD1 1 
ATOM   4401  O  OD2 . ASP B 1 51  ? 16.173  1.003   32.658  1.00 61.55 ? 54   ASP B OD2 1 
ATOM   4402  N  N   . VAL B 1 52  ? 16.419  1.759   36.181  1.00 59.38 ? 55   VAL B N   1 
ATOM   4403  C  CA  . VAL B 1 52  ? 17.249  2.867   36.621  1.00 58.82 ? 55   VAL B CA  1 
ATOM   4404  C  C   . VAL B 1 52  ? 18.273  3.226   35.568  1.00 58.61 ? 55   VAL B C   1 
ATOM   4405  O  O   . VAL B 1 52  ? 18.742  4.357   35.512  1.00 58.69 ? 55   VAL B O   1 
ATOM   4406  C  CB  . VAL B 1 52  ? 17.961  2.535   37.941  1.00 58.74 ? 55   VAL B CB  1 
ATOM   4407  C  CG1 . VAL B 1 52  ? 16.936  2.393   39.050  1.00 58.58 ? 55   VAL B CG1 1 
ATOM   4408  C  CG2 . VAL B 1 52  ? 18.744  1.242   37.808  1.00 58.84 ? 55   VAL B CG2 1 
ATOM   4409  N  N   . VAL B 1 53  ? 18.636  2.257   34.739  1.00 58.27 ? 56   VAL B N   1 
ATOM   4410  C  CA  . VAL B 1 53  ? 19.610  2.512   33.688  1.00 57.91 ? 56   VAL B CA  1 
ATOM   4411  C  C   . VAL B 1 53  ? 19.034  3.618   32.849  1.00 57.74 ? 56   VAL B C   1 
ATOM   4412  O  O   . VAL B 1 53  ? 19.724  4.564   32.482  1.00 57.78 ? 56   VAL B O   1 
ATOM   4413  C  CB  . VAL B 1 53  ? 19.800  1.295   32.782  1.00 57.93 ? 56   VAL B CB  1 
ATOM   4414  C  CG1 . VAL B 1 53  ? 20.596  1.683   31.546  1.00 57.49 ? 56   VAL B CG1 1 
ATOM   4415  C  CG2 . VAL B 1 53  ? 20.495  0.179   33.543  1.00 57.61 ? 56   VAL B CG2 1 
ATOM   4416  N  N   . PHE B 1 54  ? 17.750  3.491   32.559  1.00 57.72 ? 57   PHE B N   1 
ATOM   4417  C  CA  . PHE B 1 54  ? 17.076  4.489   31.773  1.00 57.81 ? 57   PHE B CA  1 
ATOM   4418  C  C   . PHE B 1 54  ? 17.107  5.826   32.498  1.00 58.10 ? 57   PHE B C   1 
ATOM   4419  O  O   . PHE B 1 54  ? 17.670  6.802   31.995  1.00 58.48 ? 57   PHE B O   1 
ATOM   4420  C  CB  . PHE B 1 54  ? 15.636  4.087   31.518  1.00 57.45 ? 57   PHE B CB  1 
ATOM   4421  C  CG  . PHE B 1 54  ? 14.833  5.175   30.903  1.00 57.14 ? 57   PHE B CG  1 
ATOM   4422  C  CD1 . PHE B 1 54  ? 15.102  5.593   29.607  1.00 57.08 ? 57   PHE B CD1 1 
ATOM   4423  C  CD2 . PHE B 1 54  ? 13.872  5.845   31.639  1.00 56.89 ? 57   PHE B CD2 1 
ATOM   4424  C  CE1 . PHE B 1 54  ? 14.432  6.668   29.054  1.00 57.08 ? 57   PHE B CE1 1 
ATOM   4425  C  CE2 . PHE B 1 54  ? 13.196  6.923   31.092  1.00 57.10 ? 57   PHE B CE2 1 
ATOM   4426  C  CZ  . PHE B 1 54  ? 13.478  7.337   29.795  1.00 57.02 ? 57   PHE B CZ  1 
ATOM   4427  N  N   . THR B 1 55  ? 16.514  5.856   33.688  1.00 58.16 ? 58   THR B N   1 
ATOM   4428  C  CA  . THR B 1 55  ? 16.449  7.065   34.500  1.00 57.89 ? 58   THR B CA  1 
ATOM   4429  C  C   . THR B 1 55  ? 17.811  7.724   34.673  1.00 57.98 ? 58   THR B C   1 
ATOM   4430  O  O   . THR B 1 55  ? 17.949  8.935   34.500  1.00 57.82 ? 58   THR B O   1 
ATOM   4431  C  CB  . THR B 1 55  ? 15.890  6.757   35.884  1.00 57.93 ? 58   THR B CB  1 
ATOM   4432  O  OG1 . THR B 1 55  ? 14.613  6.132   35.751  1.00 57.75 ? 58   THR B OG1 1 
ATOM   4433  C  CG2 . THR B 1 55  ? 15.744  8.031   36.688  1.00 57.84 ? 58   THR B CG2 1 
ATOM   4434  N  N   . ASP B 1 56  ? 18.816  6.918   35.003  1.00 58.08 ? 59   ASP B N   1 
ATOM   4435  C  CA  . ASP B 1 56  ? 20.170  7.418   35.211  1.00 57.92 ? 59   ASP B CA  1 
ATOM   4436  C  C   . ASP B 1 56  ? 20.678  8.195   34.004  1.00 57.80 ? 59   ASP B C   1 
ATOM   4437  O  O   . ASP B 1 56  ? 21.163  9.307   34.155  1.00 57.85 ? 59   ASP B O   1 
ATOM   4438  C  CB  . ASP B 1 56  ? 21.125  6.265   35.531  1.00 58.20 ? 59   ASP B CB  1 
ATOM   4439  C  CG  . ASP B 1 56  ? 22.546  6.735   35.784  1.00 58.44 ? 59   ASP B CG  1 
ATOM   4440  O  OD1 . ASP B 1 56  ? 23.468  6.320   35.043  1.00 58.90 ? 59   ASP B OD1 1 
ATOM   4441  O  OD2 . ASP B 1 56  ? 22.744  7.520   36.733  1.00 58.70 ? 59   ASP B OD2 1 
ATOM   4442  N  N   . GLU B 1 57  ? 20.553  7.623   32.808  1.00 57.70 ? 60   GLU B N   1 
ATOM   4443  C  CA  . GLU B 1 57  ? 21.017  8.306   31.601  1.00 57.51 ? 60   GLU B CA  1 
ATOM   4444  C  C   . GLU B 1 57  ? 20.181  9.538   31.296  1.00 57.40 ? 60   GLU B C   1 
ATOM   4445  O  O   . GLU B 1 57  ? 20.721  10.621  31.085  1.00 57.69 ? 60   GLU B O   1 
ATOM   4446  C  CB  . GLU B 1 57  ? 21.013  7.374   30.389  1.00 57.50 ? 60   GLU B CB  1 
ATOM   4447  C  CG  . GLU B 1 57  ? 21.691  7.996   29.167  1.00 57.66 ? 60   GLU B CG  1 
ATOM   4448  C  CD  . GLU B 1 57  ? 21.657  7.110   27.933  1.00 58.06 ? 60   GLU B CD  1 
ATOM   4449  O  OE1 . GLU B 1 57  ? 22.574  7.222   27.093  1.00 58.02 ? 60   GLU B OE1 1 
ATOM   4450  O  OE2 . GLU B 1 57  ? 20.706  6.311   27.787  1.00 58.56 ? 60   GLU B OE2 1 
ATOM   4451  N  N   . MET B 1 58  ? 18.862  9.380   31.291  1.00 57.24 ? 61   MET B N   1 
ATOM   4452  C  CA  . MET B 1 58  ? 17.968  10.493  31.002  1.00 57.25 ? 61   MET B CA  1 
ATOM   4453  C  C   . MET B 1 58  ? 18.187  11.657  31.954  1.00 57.21 ? 61   MET B C   1 
ATOM   4454  O  O   . MET B 1 58  ? 18.359  12.796  31.520  1.00 57.67 ? 61   MET B O   1 
ATOM   4455  C  CB  . MET B 1 58  ? 16.516  10.042  31.093  1.00 57.23 ? 61   MET B CB  1 
ATOM   4456  C  CG  . MET B 1 58  ? 15.538  11.037  30.521  1.00 57.06 ? 61   MET B CG  1 
ATOM   4457  S  SD  . MET B 1 58  ? 16.004  11.447  28.842  1.00 57.48 ? 61   MET B SD  1 
ATOM   4458  C  CE  . MET B 1 58  ? 15.404  10.027  27.977  1.00 56.94 ? 61   MET B CE  1 
ATOM   4459  N  N   . ALA B 1 59  ? 18.189  11.364  33.252  1.00 57.08 ? 62   ALA B N   1 
ATOM   4460  C  CA  . ALA B 1 59  ? 18.376  12.385  34.276  1.00 56.80 ? 62   ALA B CA  1 
ATOM   4461  C  C   . ALA B 1 59  ? 19.581  13.256  33.983  1.00 56.83 ? 62   ALA B C   1 
ATOM   4462  O  O   . ALA B 1 59  ? 19.535  14.472  34.153  1.00 57.05 ? 62   ALA B O   1 
ATOM   4463  C  CB  . ALA B 1 59  ? 18.528  11.740  35.628  1.00 56.59 ? 62   ALA B CB  1 
ATOM   4464  N  N   . HIS B 1 60  ? 20.666  12.635  33.541  1.00 56.89 ? 63   HIS B N   1 
ATOM   4465  C  CA  . HIS B 1 60  ? 21.865  13.392  33.225  1.00 56.82 ? 63   HIS B CA  1 
ATOM   4466  C  C   . HIS B 1 60  ? 21.637  14.180  31.954  1.00 56.73 ? 63   HIS B C   1 
ATOM   4467  O  O   . HIS B 1 60  ? 22.043  15.333  31.846  1.00 57.19 ? 63   HIS B O   1 
ATOM   4468  C  CB  . HIS B 1 60  ? 23.072  12.479  33.044  1.00 57.21 ? 63   HIS B CB  1 
ATOM   4469  C  CG  . HIS B 1 60  ? 24.371  13.218  32.991  1.00 57.65 ? 63   HIS B CG  1 
ATOM   4470  N  ND1 . HIS B 1 60  ? 25.205  13.327  34.082  1.00 57.83 ? 63   HIS B ND1 1 
ATOM   4471  C  CD2 . HIS B 1 60  ? 24.949  13.935  32.002  1.00 57.99 ? 63   HIS B CD2 1 
ATOM   4472  C  CE1 . HIS B 1 60  ? 26.241  14.084  33.766  1.00 58.09 ? 63   HIS B CE1 1 
ATOM   4473  N  NE2 . HIS B 1 60  ? 26.110  14.467  32.509  1.00 58.11 ? 63   HIS B NE2 1 
ATOM   4474  N  N   . PHE B 1 61  ? 21.003  13.553  30.977  1.00 56.32 ? 64   PHE B N   1 
ATOM   4475  C  CA  . PHE B 1 61  ? 20.728  14.228  29.731  1.00 56.01 ? 64   PHE B CA  1 
ATOM   4476  C  C   . PHE B 1 61  ? 19.936  15.486  30.033  1.00 56.56 ? 64   PHE B C   1 
ATOM   4477  O  O   . PHE B 1 61  ? 20.238  16.569  29.524  1.00 56.80 ? 64   PHE B O   1 
ATOM   4478  C  CB  . PHE B 1 61  ? 19.907  13.331  28.834  1.00 55.41 ? 64   PHE B CB  1 
ATOM   4479  C  CG  . PHE B 1 61  ? 19.480  13.992  27.578  1.00 54.84 ? 64   PHE B CG  1 
ATOM   4480  C  CD1 . PHE B 1 61  ? 20.389  14.207  26.552  1.00 54.46 ? 64   PHE B CD1 1 
ATOM   4481  C  CD2 . PHE B 1 61  ? 18.180  14.444  27.430  1.00 54.64 ? 64   PHE B CD2 1 
ATOM   4482  C  CE1 . PHE B 1 61  ? 20.014  14.865  25.392  1.00 53.93 ? 64   PHE B CE1 1 
ATOM   4483  C  CE2 . PHE B 1 61  ? 17.793  15.105  26.272  1.00 54.14 ? 64   PHE B CE2 1 
ATOM   4484  C  CZ  . PHE B 1 61  ? 18.716  15.316  25.252  1.00 53.94 ? 64   PHE B CZ  1 
ATOM   4485  N  N   . ASP B 1 62  ? 18.947  15.335  30.908  1.00 56.99 ? 65   ASP B N   1 
ATOM   4486  C  CA  . ASP B 1 62  ? 18.077  16.437  31.313  1.00 57.09 ? 65   ASP B CA  1 
ATOM   4487  C  C   . ASP B 1 62  ? 18.835  17.588  31.964  1.00 57.22 ? 65   ASP B C   1 
ATOM   4488  O  O   . ASP B 1 62  ? 18.301  18.696  32.084  1.00 57.34 ? 65   ASP B O   1 
ATOM   4489  C  CB  . ASP B 1 62  ? 17.002  15.933  32.291  1.00 57.14 ? 65   ASP B CB  1 
ATOM   4490  C  CG  . ASP B 1 62  ? 16.045  14.922  31.661  1.00 57.41 ? 65   ASP B CG  1 
ATOM   4491  O  OD1 . ASP B 1 62  ? 15.335  14.211  32.413  1.00 57.28 ? 65   ASP B OD1 1 
ATOM   4492  O  OD2 . ASP B 1 62  ? 15.994  14.835  30.413  1.00 57.85 ? 65   ASP B OD2 1 
ATOM   4493  N  N   . ARG B 1 63  ? 20.081  17.329  32.363  1.00 57.40 ? 66   ARG B N   1 
ATOM   4494  C  CA  . ARG B 1 63  ? 20.911  18.325  33.038  1.00 57.54 ? 66   ARG B CA  1 
ATOM   4495  C  C   . ARG B 1 63  ? 22.205  18.729  32.340  1.00 57.54 ? 66   ARG B C   1 
ATOM   4496  O  O   . ARG B 1 63  ? 23.107  19.281  32.972  1.00 57.91 ? 66   ARG B O   1 
ATOM   4497  C  CB  . ARG B 1 63  ? 21.244  17.823  34.441  1.00 57.36 ? 66   ARG B CB  1 
ATOM   4498  C  CG  . ARG B 1 63  ? 20.030  17.695  35.292  1.00 57.45 ? 66   ARG B CG  1 
ATOM   4499  C  CD  . ARG B 1 63  ? 20.326  17.144  36.649  1.00 57.51 ? 66   ARG B CD  1 
ATOM   4500  N  NE  . ARG B 1 63  ? 19.107  17.204  37.441  1.00 57.98 ? 66   ARG B NE  1 
ATOM   4501  C  CZ  . ARG B 1 63  ? 18.030  16.461  37.211  1.00 58.12 ? 66   ARG B CZ  1 
ATOM   4502  N  NH1 . ARG B 1 63  ? 18.017  15.573  36.222  1.00 58.18 ? 66   ARG B NH1 1 
ATOM   4503  N  NH2 . ARG B 1 63  ? 16.927  16.675  37.910  1.00 58.48 ? 66   ARG B NH2 1 
ATOM   4504  N  N   . GLU B 1 64  ? 22.300  18.496  31.041  1.00 57.47 ? 67   GLU B N   1 
ATOM   4505  C  CA  . GLU B 1 64  ? 23.520  18.839  30.331  1.00 57.57 ? 67   GLU B CA  1 
ATOM   4506  C  C   . GLU B 1 64  ? 23.843  20.313  30.265  1.00 57.31 ? 67   GLU B C   1 
ATOM   4507  O  O   . GLU B 1 64  ? 24.994  20.698  30.412  1.00 57.35 ? 67   GLU B O   1 
ATOM   4508  C  CB  . GLU B 1 64  ? 23.471  18.300  28.914  1.00 58.24 ? 67   GLU B CB  1 
ATOM   4509  C  CG  . GLU B 1 64  ? 23.584  16.801  28.833  1.00 59.12 ? 67   GLU B CG  1 
ATOM   4510  C  CD  . GLU B 1 64  ? 23.654  16.307  27.406  1.00 59.74 ? 67   GLU B CD  1 
ATOM   4511  O  OE1 . GLU B 1 64  ? 23.745  17.140  26.475  1.00 59.71 ? 67   GLU B OE1 1 
ATOM   4512  O  OE2 . GLU B 1 64  ? 23.620  15.075  27.215  1.00 60.35 ? 67   GLU B OE2 1 
ATOM   4513  N  N   . ARG B 1 65  ? 22.826  21.133  30.037  1.00 57.33 ? 68   ARG B N   1 
ATOM   4514  C  CA  . ARG B 1 65  ? 23.001  22.572  29.886  1.00 57.20 ? 68   ARG B CA  1 
ATOM   4515  C  C   . ARG B 1 65  ? 23.268  23.412  31.123  1.00 57.59 ? 68   ARG B C   1 
ATOM   4516  O  O   . ARG B 1 65  ? 22.653  23.212  32.174  1.00 57.85 ? 68   ARG B O   1 
ATOM   4517  C  CB  . ARG B 1 65  ? 21.787  23.164  29.176  1.00 56.76 ? 68   ARG B CB  1 
ATOM   4518  C  CG  . ARG B 1 65  ? 21.438  22.501  27.872  1.00 56.09 ? 68   ARG B CG  1 
ATOM   4519  C  CD  . ARG B 1 65  ? 22.552  22.639  26.866  1.00 55.88 ? 68   ARG B CD  1 
ATOM   4520  N  NE  . ARG B 1 65  ? 22.160  21.998  25.619  1.00 56.05 ? 68   ARG B NE  1 
ATOM   4521  C  CZ  . ARG B 1 65  ? 22.456  20.743  25.302  1.00 56.49 ? 68   ARG B CZ  1 
ATOM   4522  N  NH1 . ARG B 1 65  ? 23.170  19.988  26.135  1.00 55.90 ? 68   ARG B NH1 1 
ATOM   4523  N  NH2 . ARG B 1 65  ? 21.964  20.217  24.186  1.00 56.86 ? 68   ARG B NH2 1 
ATOM   4524  N  N   . ILE B 1 66  ? 24.168  24.383  30.968  1.00 57.73 ? 69   ILE B N   1 
ATOM   4525  C  CA  . ILE B 1 66  ? 24.499  25.334  32.024  1.00 57.99 ? 69   ILE B CA  1 
ATOM   4526  C  C   . ILE B 1 66  ? 24.317  26.712  31.382  1.00 58.17 ? 69   ILE B C   1 
ATOM   4527  O  O   . ILE B 1 66  ? 24.333  26.843  30.157  1.00 58.53 ? 69   ILE B O   1 
ATOM   4528  C  CB  . ILE B 1 66  ? 25.949  25.172  32.564  1.00 58.15 ? 69   ILE B CB  1 
ATOM   4529  C  CG1 . ILE B 1 66  ? 26.976  25.542  31.501  1.00 58.30 ? 69   ILE B CG1 1 
ATOM   4530  C  CG2 . ILE B 1 66  ? 26.185  23.746  33.032  1.00 58.18 ? 69   ILE B CG2 1 
ATOM   4531  C  CD1 . ILE B 1 66  ? 28.409  25.473  32.005  1.00 58.57 ? 69   ILE B CD1 1 
ATOM   4532  N  N   . PRO B 1 67  ? 24.128  27.753  32.193  1.00 58.04 ? 70   PRO B N   1 
ATOM   4533  C  CA  . PRO B 1 67  ? 23.940  29.095  31.645  1.00 58.02 ? 70   PRO B CA  1 
ATOM   4534  C  C   . PRO B 1 67  ? 25.081  29.505  30.751  1.00 58.19 ? 70   PRO B C   1 
ATOM   4535  O  O   . PRO B 1 67  ? 26.241  29.380  31.134  1.00 58.43 ? 70   PRO B O   1 
ATOM   4536  C  CB  . PRO B 1 67  ? 23.921  29.964  32.893  1.00 57.84 ? 70   PRO B CB  1 
ATOM   4537  C  CG  . PRO B 1 67  ? 23.363  29.054  33.928  1.00 57.81 ? 70   PRO B CG  1 
ATOM   4538  C  CD  . PRO B 1 67  ? 24.107  27.784  33.663  1.00 57.96 ? 70   PRO B CD  1 
ATOM   4539  N  N   . GLU B 1 68  ? 24.763  29.962  29.546  1.00 58.41 ? 71   GLU B N   1 
ATOM   4540  C  CA  . GLU B 1 68  ? 25.808  30.416  28.644  1.00 58.60 ? 71   GLU B CA  1 
ATOM   4541  C  C   . GLU B 1 68  ? 26.317  31.738  29.216  1.00 58.30 ? 71   GLU B C   1 
ATOM   4542  O  O   . GLU B 1 68  ? 25.651  32.350  30.052  1.00 58.25 ? 71   GLU B O   1 
ATOM   4543  C  CB  . GLU B 1 68  ? 25.268  30.623  27.226  1.00 59.31 ? 71   GLU B CB  1 
ATOM   4544  C  CG  . GLU B 1 68  ? 24.302  31.793  27.079  1.00 60.29 ? 71   GLU B CG  1 
ATOM   4545  C  CD  . GLU B 1 68  ? 23.889  32.049  25.636  1.00 60.73 ? 71   GLU B CD  1 
ATOM   4546  O  OE1 . GLU B 1 68  ? 23.830  31.085  24.843  1.00 61.01 ? 71   GLU B OE1 1 
ATOM   4547  O  OE2 . GLU B 1 68  ? 23.620  33.219  25.296  1.00 60.84 ? 71   GLU B OE2 1 
ATOM   4548  N  N   . ARG B 1 69  ? 27.508  32.156  28.794  1.00 57.84 ? 72   ARG B N   1 
ATOM   4549  C  CA  . ARG B 1 69  ? 28.092  33.407  29.267  1.00 57.33 ? 72   ARG B CA  1 
ATOM   4550  C  C   . ARG B 1 69  ? 27.086  34.507  28.995  1.00 57.37 ? 72   ARG B C   1 
ATOM   4551  O  O   . ARG B 1 69  ? 26.376  34.465  27.988  1.00 57.39 ? 72   ARG B O   1 
ATOM   4552  C  CB  . ARG B 1 69  ? 29.410  33.681  28.545  1.00 56.83 ? 72   ARG B CB  1 
ATOM   4553  C  CG  . ARG B 1 69  ? 30.487  32.646  28.864  1.00 56.11 ? 72   ARG B CG  1 
ATOM   4554  C  CD  . ARG B 1 69  ? 31.662  32.717  27.899  1.00 55.69 ? 72   ARG B CD  1 
ATOM   4555  N  NE  . ARG B 1 69  ? 32.779  31.868  28.321  1.00 55.62 ? 72   ARG B NE  1 
ATOM   4556  C  CZ  . ARG B 1 69  ? 32.811  30.541  28.214  1.00 55.77 ? 72   ARG B CZ  1 
ATOM   4557  N  NH1 . ARG B 1 69  ? 31.784  29.880  27.692  1.00 55.75 ? 72   ARG B NH1 1 
ATOM   4558  N  NH2 . ARG B 1 69  ? 33.875  29.867  28.633  1.00 55.30 ? 72   ARG B NH2 1 
ATOM   4559  N  N   . VAL B 1 70  ? 26.959  35.441  29.931  1.00 57.45 ? 73   VAL B N   1 
ATOM   4560  C  CA  . VAL B 1 70  ? 26.005  36.536  29.781  1.00 57.36 ? 73   VAL B CA  1 
ATOM   4561  C  C   . VAL B 1 70  ? 26.335  37.408  28.572  1.00 57.53 ? 73   VAL B C   1 
ATOM   4562  O  O   . VAL B 1 70  ? 25.466  38.106  28.036  1.00 57.58 ? 73   VAL B O   1 
ATOM   4563  C  CB  . VAL B 1 70  ? 25.903  37.360  31.073  1.00 57.16 ? 73   VAL B CB  1 
ATOM   4564  C  CG1 . VAL B 1 70  ? 27.243  37.922  31.444  1.00 57.01 ? 73   VAL B CG1 1 
ATOM   4565  C  CG2 . VAL B 1 70  ? 24.864  38.454  30.928  1.00 56.95 ? 73   VAL B CG2 1 
ATOM   4566  N  N   . VAL B 1 71  ? 27.596  37.336  28.142  1.00 57.58 ? 74   VAL B N   1 
ATOM   4567  C  CA  . VAL B 1 71  ? 28.108  38.049  26.968  1.00 57.36 ? 74   VAL B CA  1 
ATOM   4568  C  C   . VAL B 1 71  ? 29.264  37.207  26.469  1.00 57.32 ? 74   VAL B C   1 
ATOM   4569  O  O   . VAL B 1 71  ? 29.825  36.427  27.241  1.00 57.32 ? 74   VAL B O   1 
ATOM   4570  C  CB  . VAL B 1 71  ? 28.633  39.459  27.298  1.00 57.48 ? 74   VAL B CB  1 
ATOM   4571  C  CG1 . VAL B 1 71  ? 27.487  40.378  27.677  1.00 57.30 ? 74   VAL B CG1 1 
ATOM   4572  C  CG2 . VAL B 1 71  ? 29.661  39.395  28.405  1.00 57.47 ? 74   VAL B CG2 1 
ATOM   4573  N  N   . HIS B 1 72  ? 29.633  37.369  25.201  1.00 57.07 ? 75   HIS B N   1 
ATOM   4574  C  CA  . HIS B 1 72  ? 30.717  36.578  24.621  1.00 57.28 ? 75   HIS B CA  1 
ATOM   4575  C  C   . HIS B 1 72  ? 30.332  35.105  24.701  1.00 57.59 ? 75   HIS B C   1 
ATOM   4576  O  O   . HIS B 1 72  ? 31.185  34.229  24.890  1.00 58.00 ? 75   HIS B O   1 
ATOM   4577  C  CB  . HIS B 1 72  ? 32.024  36.786  25.387  1.00 56.93 ? 75   HIS B CB  1 
ATOM   4578  C  CG  . HIS B 1 72  ? 32.614  38.150  25.240  1.00 56.54 ? 75   HIS B CG  1 
ATOM   4579  N  ND1 . HIS B 1 72  ? 33.603  38.435  24.326  1.00 56.53 ? 75   HIS B ND1 1 
ATOM   4580  C  CD2 . HIS B 1 72  ? 32.402  39.293  25.934  1.00 56.32 ? 75   HIS B CD2 1 
ATOM   4581  C  CE1 . HIS B 1 72  ? 33.983  39.693  24.466  1.00 56.28 ? 75   HIS B CE1 1 
ATOM   4582  N  NE2 . HIS B 1 72  ? 33.269  40.236  25.437  1.00 56.18 ? 75   HIS B NE2 1 
ATOM   4583  N  N   . ALA B 1 73  ? 29.035  34.844  24.576  1.00 57.92 ? 76   ALA B N   1 
ATOM   4584  C  CA  . ALA B 1 73  ? 28.497  33.489  24.649  1.00 57.87 ? 76   ALA B CA  1 
ATOM   4585  C  C   . ALA B 1 73  ? 29.103  32.542  23.642  1.00 58.06 ? 76   ALA B C   1 
ATOM   4586  O  O   . ALA B 1 73  ? 29.425  31.416  23.987  1.00 58.37 ? 76   ALA B O   1 
ATOM   4587  C  CB  . ALA B 1 73  ? 26.992  33.511  24.484  1.00 57.89 ? 76   ALA B CB  1 
ATOM   4588  N  N   . LYS B 1 74  ? 29.248  32.979  22.395  1.00 58.51 ? 77   LYS B N   1 
ATOM   4589  C  CA  . LYS B 1 74  ? 29.811  32.099  21.382  1.00 59.03 ? 77   LYS B CA  1 
ATOM   4590  C  C   . LYS B 1 74  ? 31.284  32.291  21.148  1.00 59.19 ? 77   LYS B C   1 
ATOM   4591  O  O   . LYS B 1 74  ? 31.706  33.358  20.713  1.00 59.62 ? 77   LYS B O   1 
ATOM   4592  C  CB  . LYS B 1 74  ? 29.100  32.237  20.047  1.00 58.84 ? 77   LYS B CB  1 
ATOM   4593  C  CG  . LYS B 1 74  ? 29.239  30.953  19.279  1.00 58.91 ? 77   LYS B CG  1 
ATOM   4594  C  CD  . LYS B 1 74  ? 28.978  31.105  17.832  1.00 59.10 ? 77   LYS B CD  1 
ATOM   4595  C  CE  . LYS B 1 74  ? 29.191  29.772  17.173  1.00 59.05 ? 77   LYS B CE  1 
ATOM   4596  N  NZ  . LYS B 1 74  ? 29.166  29.931  15.703  1.00 59.94 ? 77   LYS B NZ  1 
ATOM   4597  N  N   . GLY B 1 75  ? 32.059  31.233  21.352  1.00 59.19 ? 78   GLY B N   1 
ATOM   4598  C  CA  . GLY B 1 75  ? 33.483  31.354  21.147  1.00 59.28 ? 78   GLY B CA  1 
ATOM   4599  C  C   . GLY B 1 75  ? 34.196  30.064  20.834  1.00 59.10 ? 78   GLY B C   1 
ATOM   4600  O  O   . GLY B 1 75  ? 33.571  29.012  20.688  1.00 59.12 ? 78   GLY B O   1 
ATOM   4601  N  N   . ALA B 1 76  ? 35.516  30.159  20.709  1.00 59.25 ? 79   ALA B N   1 
ATOM   4602  C  CA  . ALA B 1 76  ? 36.350  29.006  20.414  1.00 59.30 ? 79   ALA B CA  1 
ATOM   4603  C  C   . ALA B 1 76  ? 37.478  28.964  21.422  1.00 59.45 ? 79   ALA B C   1 
ATOM   4604  O  O   . ALA B 1 76  ? 37.845  29.999  21.981  1.00 59.54 ? 79   ALA B O   1 
ATOM   4605  C  CB  . ALA B 1 76  ? 36.913  29.110  19.018  1.00 59.44 ? 79   ALA B CB  1 
ATOM   4606  N  N   . GLY B 1 77  ? 38.032  27.774  21.639  1.00 59.63 ? 80   GLY B N   1 
ATOM   4607  C  CA  . GLY B 1 77  ? 39.115  27.627  22.594  1.00 59.75 ? 80   GLY B CA  1 
ATOM   4608  C  C   . GLY B 1 77  ? 40.308  26.869  22.050  1.00 59.98 ? 80   GLY B C   1 
ATOM   4609  O  O   . GLY B 1 77  ? 40.188  26.123  21.077  1.00 59.73 ? 80   GLY B O   1 
ATOM   4610  N  N   . ALA B 1 78  ? 41.465  27.079  22.678  1.00 60.27 ? 81   ALA B N   1 
ATOM   4611  C  CA  . ALA B 1 78  ? 42.716  26.422  22.289  1.00 60.63 ? 81   ALA B CA  1 
ATOM   4612  C  C   . ALA B 1 78  ? 43.762  26.582  23.399  1.00 60.82 ? 81   ALA B C   1 
ATOM   4613  O  O   . ALA B 1 78  ? 43.551  27.352  24.343  1.00 61.12 ? 81   ALA B O   1 
ATOM   4614  C  CB  . ALA B 1 78  ? 43.234  27.003  20.977  1.00 60.69 ? 81   ALA B CB  1 
ATOM   4615  N  N   . PHE B 1 79  ? 44.873  25.851  23.297  1.00 61.00 ? 82   PHE B N   1 
ATOM   4616  C  CA  . PHE B 1 79  ? 45.934  25.915  24.308  1.00 60.94 ? 82   PHE B CA  1 
ATOM   4617  C  C   . PHE B 1 79  ? 47.338  25.983  23.743  1.00 60.82 ? 82   PHE B C   1 
ATOM   4618  O  O   . PHE B 1 79  ? 47.593  25.603  22.601  1.00 61.02 ? 82   PHE B O   1 
ATOM   4619  C  CB  . PHE B 1 79  ? 45.858  24.711  25.227  1.00 60.78 ? 82   PHE B CB  1 
ATOM   4620  C  CG  . PHE B 1 79  ? 44.528  24.530  25.847  1.00 61.13 ? 82   PHE B CG  1 
ATOM   4621  C  CD1 . PHE B 1 79  ? 43.484  23.984  25.117  1.00 61.19 ? 82   PHE B CD1 1 
ATOM   4622  C  CD2 . PHE B 1 79  ? 44.301  24.931  27.151  1.00 61.32 ? 82   PHE B CD2 1 
ATOM   4623  C  CE1 . PHE B 1 79  ? 42.224  23.842  25.676  1.00 61.50 ? 82   PHE B CE1 1 
ATOM   4624  C  CE2 . PHE B 1 79  ? 43.044  24.794  27.723  1.00 61.72 ? 82   PHE B CE2 1 
ATOM   4625  C  CZ  . PHE B 1 79  ? 42.001  24.248  26.982  1.00 61.71 ? 82   PHE B CZ  1 
ATOM   4626  N  N   . GLY B 1 80  ? 48.264  26.419  24.580  1.00 60.63 ? 83   GLY B N   1 
ATOM   4627  C  CA  . GLY B 1 80  ? 49.633  26.518  24.141  1.00 60.39 ? 83   GLY B CA  1 
ATOM   4628  C  C   . GLY B 1 80  ? 50.471  27.103  25.241  1.00 60.21 ? 83   GLY B C   1 
ATOM   4629  O  O   . GLY B 1 80  ? 50.317  26.737  26.404  1.00 60.25 ? 83   GLY B O   1 
ATOM   4630  N  N   . TYR B 1 81  ? 51.290  28.083  24.892  1.00 60.02 ? 84   TYR B N   1 
ATOM   4631  C  CA  . TYR B 1 81  ? 52.159  28.691  25.875  1.00 59.83 ? 84   TYR B CA  1 
ATOM   4632  C  C   . TYR B 1 81  ? 52.577  30.098  25.527  1.00 59.81 ? 84   TYR B C   1 
ATOM   4633  O  O   . TYR B 1 81  ? 52.394  30.574  24.407  1.00 59.80 ? 84   TYR B O   1 
ATOM   4634  C  CB  . TYR B 1 81  ? 53.421  27.852  26.030  1.00 59.78 ? 84   TYR B CB  1 
ATOM   4635  C  CG  . TYR B 1 81  ? 54.246  27.786  24.766  1.00 59.88 ? 84   TYR B CG  1 
ATOM   4636  C  CD1 . TYR B 1 81  ? 55.227  28.730  24.506  1.00 59.73 ? 84   TYR B CD1 1 
ATOM   4637  C  CD2 . TYR B 1 81  ? 54.041  26.783  23.827  1.00 59.84 ? 84   TYR B CD2 1 
ATOM   4638  C  CE1 . TYR B 1 81  ? 55.983  28.681  23.343  1.00 59.70 ? 84   TYR B CE1 1 
ATOM   4639  C  CE2 . TYR B 1 81  ? 54.797  26.728  22.657  1.00 59.79 ? 84   TYR B CE2 1 
ATOM   4640  C  CZ  . TYR B 1 81  ? 55.766  27.682  22.427  1.00 59.61 ? 84   TYR B CZ  1 
ATOM   4641  O  OH  . TYR B 1 81  ? 56.526  27.638  21.284  1.00 59.57 ? 84   TYR B OH  1 
ATOM   4642  N  N   . PHE B 1 82  ? 53.200  30.730  26.507  1.00 59.82 ? 85   PHE B N   1 
ATOM   4643  C  CA  . PHE B 1 82  ? 53.712  32.070  26.371  1.00 60.11 ? 85   PHE B CA  1 
ATOM   4644  C  C   . PHE B 1 82  ? 55.201  31.978  26.672  1.00 60.67 ? 85   PHE B C   1 
ATOM   4645  O  O   . PHE B 1 82  ? 55.591  31.373  27.675  1.00 60.98 ? 85   PHE B O   1 
ATOM   4646  C  CB  . PHE B 1 82  ? 53.039  32.980  27.375  1.00 59.77 ? 85   PHE B CB  1 
ATOM   4647  C  CG  . PHE B 1 82  ? 53.735  34.277  27.552  1.00 59.70 ? 85   PHE B CG  1 
ATOM   4648  C  CD1 . PHE B 1 82  ? 53.642  35.263  26.579  1.00 59.56 ? 85   PHE B CD1 1 
ATOM   4649  C  CD2 . PHE B 1 82  ? 54.515  34.508  28.677  1.00 59.64 ? 85   PHE B CD2 1 
ATOM   4650  C  CE1 . PHE B 1 82  ? 54.322  36.469  26.719  1.00 59.64 ? 85   PHE B CE1 1 
ATOM   4651  C  CE2 . PHE B 1 82  ? 55.202  35.709  28.835  1.00 59.61 ? 85   PHE B CE2 1 
ATOM   4652  C  CZ  . PHE B 1 82  ? 55.106  36.694  27.851  1.00 59.61 ? 85   PHE B CZ  1 
ATOM   4653  N  N   . GLU B 1 83  ? 56.027  32.556  25.798  1.00 60.85 ? 86   GLU B N   1 
ATOM   4654  C  CA  . GLU B 1 83  ? 57.485  32.536  25.953  1.00 60.81 ? 86   GLU B CA  1 
ATOM   4655  C  C   . GLU B 1 83  ? 58.053  33.948  26.029  1.00 61.06 ? 86   GLU B C   1 
ATOM   4656  O  O   . GLU B 1 83  ? 57.751  34.789  25.180  1.00 61.16 ? 86   GLU B O   1 
ATOM   4657  C  CB  . GLU B 1 83  ? 58.122  31.801  24.776  1.00 60.55 ? 86   GLU B CB  1 
ATOM   4658  C  CG  . GLU B 1 83  ? 59.639  31.784  24.786  1.00 60.51 ? 86   GLU B CG  1 
ATOM   4659  C  CD  . GLU B 1 83  ? 60.232  30.973  23.639  1.00 60.73 ? 86   GLU B CD  1 
ATOM   4660  O  OE1 . GLU B 1 83  ? 61.452  31.091  23.392  1.00 61.17 ? 86   GLU B OE1 1 
ATOM   4661  O  OE2 . GLU B 1 83  ? 59.488  30.210  22.984  1.00 60.45 ? 86   GLU B OE2 1 
ATOM   4662  N  N   . VAL B 1 84  ? 58.897  34.199  27.027  1.00 61.36 ? 87   VAL B N   1 
ATOM   4663  C  CA  . VAL B 1 84  ? 59.502  35.520  27.209  1.00 61.63 ? 87   VAL B CA  1 
ATOM   4664  C  C   . VAL B 1 84  ? 60.655  35.718  26.235  1.00 62.04 ? 87   VAL B C   1 
ATOM   4665  O  O   . VAL B 1 84  ? 61.587  34.918  26.212  1.00 62.55 ? 87   VAL B O   1 
ATOM   4666  C  CB  . VAL B 1 84  ? 60.054  35.690  28.633  1.00 61.46 ? 87   VAL B CB  1 
ATOM   4667  C  CG1 . VAL B 1 84  ? 60.528  37.105  28.835  1.00 61.23 ? 87   VAL B CG1 1 
ATOM   4668  C  CG2 . VAL B 1 84  ? 59.001  35.326  29.658  1.00 61.15 ? 87   VAL B CG2 1 
ATOM   4669  N  N   . THR B 1 85  ? 60.606  36.779  25.439  1.00 62.33 ? 88   THR B N   1 
ATOM   4670  C  CA  . THR B 1 85  ? 61.671  37.034  24.478  1.00 62.69 ? 88   THR B CA  1 
ATOM   4671  C  C   . THR B 1 85  ? 62.536  38.211  24.891  1.00 63.41 ? 88   THR B C   1 
ATOM   4672  O  O   . THR B 1 85  ? 63.679  38.337  24.451  1.00 63.42 ? 88   THR B O   1 
ATOM   4673  C  CB  . THR B 1 85  ? 61.120  37.336  23.074  1.00 62.64 ? 88   THR B CB  1 
ATOM   4674  O  OG1 . THR B 1 85  ? 60.312  38.522  23.113  1.00 62.72 ? 88   THR B OG1 1 
ATOM   4675  C  CG2 . THR B 1 85  ? 60.299  36.177  22.568  1.00 62.40 ? 88   THR B CG2 1 
ATOM   4676  N  N   . HIS B 1 86  ? 61.976  39.093  25.711  1.00 63.83 ? 89   HIS B N   1 
ATOM   4677  C  CA  . HIS B 1 86  ? 62.705  40.271  26.157  1.00 64.35 ? 89   HIS B CA  1 
ATOM   4678  C  C   . HIS B 1 86  ? 62.618  40.497  27.656  1.00 64.83 ? 89   HIS B C   1 
ATOM   4679  O  O   . HIS B 1 86  ? 61.678  40.051  28.304  1.00 65.15 ? 89   HIS B O   1 
ATOM   4680  C  CB  . HIS B 1 86  ? 62.206  41.508  25.412  1.00 64.32 ? 89   HIS B CB  1 
ATOM   4681  C  CG  . HIS B 1 86  ? 62.479  41.478  23.942  1.00 64.52 ? 89   HIS B CG  1 
ATOM   4682  N  ND1 . HIS B 1 86  ? 61.893  40.562  23.095  1.00 64.57 ? 89   HIS B ND1 1 
ATOM   4683  C  CD2 . HIS B 1 86  ? 63.280  42.247  23.168  1.00 64.45 ? 89   HIS B CD2 1 
ATOM   4684  C  CE1 . HIS B 1 86  ? 62.321  40.768  21.862  1.00 64.44 ? 89   HIS B CE1 1 
ATOM   4685  N  NE2 . HIS B 1 86  ? 63.163  41.786  21.879  1.00 64.37 ? 89   HIS B NE2 1 
ATOM   4686  N  N   . ASP B 1 87  ? 63.597  41.220  28.190  1.00 65.16 ? 90   ASP B N   1 
ATOM   4687  C  CA  . ASP B 1 87  ? 63.671  41.527  29.611  1.00 65.19 ? 90   ASP B CA  1 
ATOM   4688  C  C   . ASP B 1 87  ? 62.943  42.820  29.969  1.00 65.25 ? 90   ASP B C   1 
ATOM   4689  O  O   . ASP B 1 87  ? 63.352  43.908  29.558  1.00 65.31 ? 90   ASP B O   1 
ATOM   4690  C  CB  . ASP B 1 87  ? 65.137  41.650  30.015  1.00 65.20 ? 90   ASP B CB  1 
ATOM   4691  C  CG  . ASP B 1 87  ? 65.318  41.902  31.487  1.00 65.28 ? 90   ASP B CG  1 
ATOM   4692  O  OD1 . ASP B 1 87  ? 64.892  42.965  31.990  1.00 65.81 ? 90   ASP B OD1 1 
ATOM   4693  O  OD2 . ASP B 1 87  ? 65.910  41.028  32.144  1.00 65.20 ? 90   ASP B OD2 1 
ATOM   4694  N  N   . ILE B 1 88  ? 61.885  42.697  30.763  1.00 65.21 ? 91   ILE B N   1 
ATOM   4695  C  CA  . ILE B 1 88  ? 61.110  43.849  31.224  1.00 65.13 ? 91   ILE B CA  1 
ATOM   4696  C  C   . ILE B 1 88  ? 61.035  43.793  32.749  1.00 65.28 ? 91   ILE B C   1 
ATOM   4697  O  O   . ILE B 1 88  ? 60.140  44.383  33.367  1.00 65.43 ? 91   ILE B O   1 
ATOM   4698  C  CB  . ILE B 1 88  ? 59.667  43.878  30.651  1.00 64.59 ? 91   ILE B CB  1 
ATOM   4699  C  CG1 . ILE B 1 88  ? 58.911  42.602  31.028  1.00 64.00 ? 91   ILE B CG1 1 
ATOM   4700  C  CG2 . ILE B 1 88  ? 59.700  44.091  29.152  1.00 64.21 ? 91   ILE B CG2 1 
ATOM   4701  C  CD1 . ILE B 1 88  ? 57.418  42.706  30.840  1.00 63.50 ? 91   ILE B CD1 1 
ATOM   4702  N  N   . THR B 1 89  ? 61.986  43.079  33.346  1.00 65.26 ? 92   THR B N   1 
ATOM   4703  C  CA  . THR B 1 89  ? 62.051  42.932  34.791  1.00 65.07 ? 92   THR B CA  1 
ATOM   4704  C  C   . THR B 1 89  ? 62.229  44.285  35.473  1.00 65.30 ? 92   THR B C   1 
ATOM   4705  O  O   . THR B 1 89  ? 61.982  44.423  36.667  1.00 65.22 ? 92   THR B O   1 
ATOM   4706  C  CB  . THR B 1 89  ? 63.210  42.025  35.191  1.00 65.17 ? 92   THR B CB  1 
ATOM   4707  O  OG1 . THR B 1 89  ? 64.437  42.622  34.764  1.00 65.82 ? 92   THR B OG1 1 
ATOM   4708  C  CG2 . THR B 1 89  ? 63.074  40.671  34.535  1.00 64.73 ? 92   THR B CG2 1 
ATOM   4709  N  N   . LYS B 1 90  ? 62.680  45.277  34.712  1.00 65.70 ? 93   LYS B N   1 
ATOM   4710  C  CA  . LYS B 1 90  ? 62.877  46.630  35.232  1.00 66.20 ? 93   LYS B CA  1 
ATOM   4711  C  C   . LYS B 1 90  ? 61.534  47.329  35.407  1.00 66.22 ? 93   LYS B C   1 
ATOM   4712  O  O   . LYS B 1 90  ? 61.464  48.431  35.950  1.00 66.26 ? 93   LYS B O   1 
ATOM   4713  C  CB  . LYS B 1 90  ? 63.740  47.441  34.270  1.00 66.77 ? 93   LYS B CB  1 
ATOM   4714  C  CG  . LYS B 1 90  ? 63.189  47.455  32.858  1.00 67.76 ? 93   LYS B CG  1 
ATOM   4715  C  CD  . LYS B 1 90  ? 64.102  48.184  31.884  1.00 68.84 ? 93   LYS B CD  1 
ATOM   4716  C  CE  . LYS B 1 90  ? 64.106  49.684  32.134  1.00 69.66 ? 93   LYS B CE  1 
ATOM   4717  N  NZ  . LYS B 1 90  ? 64.945  50.405  31.127  1.00 70.49 ? 93   LYS B NZ  1 
ATOM   4718  N  N   . TYR B 1 91  ? 60.476  46.696  34.910  1.00 66.12 ? 94   TYR B N   1 
ATOM   4719  C  CA  . TYR B 1 91  ? 59.131  47.250  35.005  1.00 66.04 ? 94   TYR B CA  1 
ATOM   4720  C  C   . TYR B 1 91  ? 58.211  46.386  35.857  1.00 65.48 ? 94   TYR B C   1 
ATOM   4721  O  O   . TYR B 1 91  ? 57.379  46.909  36.600  1.00 65.34 ? 94   TYR B O   1 
ATOM   4722  C  CB  . TYR B 1 91  ? 58.523  47.379  33.617  1.00 66.57 ? 94   TYR B CB  1 
ATOM   4723  C  CG  . TYR B 1 91  ? 59.218  48.362  32.709  1.00 67.24 ? 94   TYR B CG  1 
ATOM   4724  C  CD1 . TYR B 1 91  ? 59.765  47.946  31.499  1.00 67.48 ? 94   TYR B CD1 1 
ATOM   4725  C  CD2 . TYR B 1 91  ? 59.278  49.717  33.026  1.00 67.40 ? 94   TYR B CD2 1 
ATOM   4726  C  CE1 . TYR B 1 91  ? 60.354  48.858  30.613  1.00 67.89 ? 94   TYR B CE1 1 
ATOM   4727  C  CE2 . TYR B 1 91  ? 59.865  50.641  32.147  1.00 67.77 ? 94   TYR B CE2 1 
ATOM   4728  C  CZ  . TYR B 1 91  ? 60.400  50.202  30.939  1.00 67.96 ? 94   TYR B CZ  1 
ATOM   4729  O  OH  . TYR B 1 91  ? 60.965  51.096  30.048  1.00 67.95 ? 94   TYR B OH  1 
ATOM   4730  N  N   . SER B 1 92  ? 58.342  45.067  35.714  1.00 65.23 ? 95   SER B N   1 
ATOM   4731  C  CA  . SER B 1 92  ? 57.516  44.112  36.453  1.00 64.92 ? 95   SER B CA  1 
ATOM   4732  C  C   . SER B 1 92  ? 58.332  42.965  37.039  1.00 64.97 ? 95   SER B C   1 
ATOM   4733  O  O   . SER B 1 92  ? 59.296  42.501  36.422  1.00 65.37 ? 95   SER B O   1 
ATOM   4734  C  CB  . SER B 1 92  ? 56.435  43.534  35.543  1.00 64.40 ? 95   SER B CB  1 
ATOM   4735  O  OG  . SER B 1 92  ? 55.697  42.527  36.215  1.00 63.79 ? 95   SER B OG  1 
ATOM   4736  N  N   . LYS B 1 93  ? 57.915  42.488  38.211  1.00 64.88 ? 96   LYS B N   1 
ATOM   4737  C  CA  . LYS B 1 93  ? 58.597  41.389  38.893  1.00 64.80 ? 96   LYS B CA  1 
ATOM   4738  C  C   . LYS B 1 93  ? 57.819  40.071  38.792  1.00 64.78 ? 96   LYS B C   1 
ATOM   4739  O  O   . LYS B 1 93  ? 58.231  39.056  39.355  1.00 64.48 ? 96   LYS B O   1 
ATOM   4740  C  CB  . LYS B 1 93  ? 58.800  41.739  40.372  1.00 65.15 ? 96   LYS B CB  1 
ATOM   4741  C  CG  . LYS B 1 93  ? 57.503  41.750  41.186  1.00 64.93 ? 96   LYS B CG  1 
ATOM   4742  C  CD  . LYS B 1 93  ? 57.736  42.114  42.647  1.00 64.82 ? 96   LYS B CD  1 
ATOM   4743  C  CE  . LYS B 1 93  ? 56.434  42.036  43.442  1.00 64.86 ? 96   LYS B CE  1 
ATOM   4744  N  NZ  . LYS B 1 93  ? 56.584  42.514  44.849  1.00 64.75 ? 96   LYS B NZ  1 
ATOM   4745  N  N   . ALA B 1 94  ? 56.685  40.095  38.098  1.00 64.64 ? 97   ALA B N   1 
ATOM   4746  C  CA  . ALA B 1 94  ? 55.855  38.907  37.951  1.00 64.41 ? 97   ALA B CA  1 
ATOM   4747  C  C   . ALA B 1 94  ? 56.682  37.761  37.420  1.00 64.58 ? 97   ALA B C   1 
ATOM   4748  O  O   . ALA B 1 94  ? 57.446  37.920  36.475  1.00 64.51 ? 97   ALA B O   1 
ATOM   4749  C  CB  . ALA B 1 94  ? 54.701  39.192  37.025  1.00 64.50 ? 97   ALA B CB  1 
ATOM   4750  N  N   . LYS B 1 95  ? 56.543  36.598  38.035  1.00 64.79 ? 98   LYS B N   1 
ATOM   4751  C  CA  . LYS B 1 95  ? 57.312  35.454  37.586  1.00 65.42 ? 98   LYS B CA  1 
ATOM   4752  C  C   . LYS B 1 95  ? 57.126  35.141  36.109  1.00 65.55 ? 98   LYS B C   1 
ATOM   4753  O  O   . LYS B 1 95  ? 58.034  34.608  35.470  1.00 65.68 ? 98   LYS B O   1 
ATOM   4754  C  CB  . LYS B 1 95  ? 57.005  34.224  38.434  1.00 66.00 ? 98   LYS B CB  1 
ATOM   4755  C  CG  . LYS B 1 95  ? 57.718  34.223  39.778  1.00 67.43 ? 98   LYS B CG  1 
ATOM   4756  C  CD  . LYS B 1 95  ? 57.898  32.803  40.322  1.00 68.55 ? 98   LYS B CD  1 
ATOM   4757  C  CE  . LYS B 1 95  ? 58.741  32.801  41.596  1.00 69.23 ? 98   LYS B CE  1 
ATOM   4758  N  NZ  . LYS B 1 95  ? 58.097  33.612  42.671  1.00 70.07 ? 98   LYS B NZ  1 
ATOM   4759  N  N   . VAL B 1 96  ? 55.988  35.543  35.550  1.00 65.70 ? 99   VAL B N   1 
ATOM   4760  C  CA  . VAL B 1 96  ? 55.700  35.282  34.141  1.00 65.97 ? 99   VAL B CA  1 
ATOM   4761  C  C   . VAL B 1 96  ? 56.804  35.780  33.232  1.00 65.95 ? 99   VAL B C   1 
ATOM   4762  O  O   . VAL B 1 96  ? 56.989  35.274  32.126  1.00 65.92 ? 99   VAL B O   1 
ATOM   4763  C  CB  . VAL B 1 96  ? 54.437  35.991  33.661  1.00 66.14 ? 99   VAL B CB  1 
ATOM   4764  C  CG1 . VAL B 1 96  ? 53.838  35.226  32.503  1.00 66.26 ? 99   VAL B CG1 1 
ATOM   4765  C  CG2 . VAL B 1 96  ? 53.451  36.159  34.780  1.00 66.60 ? 99   VAL B CG2 1 
ATOM   4766  N  N   . PHE B 1 97  ? 57.515  36.798  33.692  1.00 66.07 ? 100  PHE B N   1 
ATOM   4767  C  CA  . PHE B 1 97  ? 58.573  37.376  32.895  1.00 66.30 ? 100  PHE B CA  1 
ATOM   4768  C  C   . PHE B 1 97  ? 59.942  37.207  33.517  1.00 66.48 ? 100  PHE B C   1 
ATOM   4769  O  O   . PHE B 1 97  ? 60.914  37.732  32.974  1.00 66.68 ? 100  PHE B O   1 
ATOM   4770  C  CB  . PHE B 1 97  ? 58.340  38.878  32.729  1.00 66.07 ? 100  PHE B CB  1 
ATOM   4771  C  CG  . PHE B 1 97  ? 56.917  39.257  32.452  1.00 66.15 ? 100  PHE B CG  1 
ATOM   4772  C  CD1 . PHE B 1 97  ? 56.317  38.928  31.246  1.00 66.20 ? 100  PHE B CD1 1 
ATOM   4773  C  CD2 . PHE B 1 97  ? 56.187  39.978  33.387  1.00 66.19 ? 100  PHE B CD2 1 
ATOM   4774  C  CE1 . PHE B 1 97  ? 55.016  39.313  30.973  1.00 66.12 ? 100  PHE B CE1 1 
ATOM   4775  C  CE2 . PHE B 1 97  ? 54.886  40.368  33.126  1.00 66.20 ? 100  PHE B CE2 1 
ATOM   4776  C  CZ  . PHE B 1 97  ? 54.298  40.035  31.913  1.00 66.29 ? 100  PHE B CZ  1 
ATOM   4777  N  N   . GLU B 1 98  ? 60.052  36.456  34.610  1.00 66.90 ? 101  GLU B N   1 
ATOM   4778  C  CA  . GLU B 1 98  ? 61.349  36.346  35.279  1.00 67.29 ? 101  GLU B CA  1 
ATOM   4779  C  C   . GLU B 1 98  ? 62.616  36.102  34.465  1.00 67.08 ? 101  GLU B C   1 
ATOM   4780  O  O   . GLU B 1 98  ? 63.701  36.416  34.946  1.00 67.07 ? 101  GLU B O   1 
ATOM   4781  C  CB  . GLU B 1 98  ? 61.297  35.464  36.526  1.00 68.05 ? 101  GLU B CB  1 
ATOM   4782  C  CG  . GLU B 1 98  ? 61.101  33.991  36.295  1.00 69.30 ? 101  GLU B CG  1 
ATOM   4783  C  CD  . GLU B 1 98  ? 61.094  33.209  37.600  1.00 70.11 ? 101  GLU B CD  1 
ATOM   4784  O  OE1 . GLU B 1 98  ? 61.398  31.996  37.565  1.00 70.65 ? 101  GLU B OE1 1 
ATOM   4785  O  OE2 . GLU B 1 98  ? 60.781  33.799  38.661  1.00 70.54 ? 101  GLU B OE2 1 
ATOM   4786  N  N   . HIS B 1 99  ? 62.502  35.571  33.249  1.00 66.64 ? 102  HIS B N   1 
ATOM   4787  C  CA  . HIS B 1 99  ? 63.687  35.379  32.409  1.00 66.39 ? 102  HIS B CA  1 
ATOM   4788  C  C   . HIS B 1 99  ? 63.386  34.979  30.974  1.00 66.02 ? 102  HIS B C   1 
ATOM   4789  O  O   . HIS B 1 99  ? 62.406  34.288  30.698  1.00 66.26 ? 102  HIS B O   1 
ATOM   4790  C  CB  . HIS B 1 99  ? 64.684  34.409  33.042  1.00 66.67 ? 102  HIS B CB  1 
ATOM   4791  C  CG  . HIS B 1 99  ? 64.295  32.972  32.931  1.00 66.87 ? 102  HIS B CG  1 
ATOM   4792  N  ND1 . HIS B 1 99  ? 64.271  32.298  31.728  1.00 67.15 ? 102  HIS B ND1 1 
ATOM   4793  C  CD2 . HIS B 1 99  ? 63.951  32.067  33.878  1.00 66.88 ? 102  HIS B CD2 1 
ATOM   4794  C  CE1 . HIS B 1 99  ? 63.931  31.039  31.939  1.00 67.03 ? 102  HIS B CE1 1 
ATOM   4795  N  NE2 . HIS B 1 99  ? 63.731  30.873  33.235  1.00 67.10 ? 102  HIS B NE2 1 
ATOM   4796  N  N   . ILE B 1 100 ? 64.246  35.415  30.062  1.00 65.61 ? 103  ILE B N   1 
ATOM   4797  C  CA  . ILE B 1 100 ? 64.071  35.120  28.651  1.00 64.97 ? 103  ILE B CA  1 
ATOM   4798  C  C   . ILE B 1 100 ? 64.109  33.633  28.412  1.00 64.97 ? 103  ILE B C   1 
ATOM   4799  O  O   . ILE B 1 100 ? 64.928  32.926  28.990  1.00 65.01 ? 103  ILE B O   1 
ATOM   4800  C  CB  . ILE B 1 100 ? 65.131  35.824  27.804  1.00 64.57 ? 103  ILE B CB  1 
ATOM   4801  C  CG1 . ILE B 1 100 ? 64.967  37.337  27.979  1.00 64.32 ? 103  ILE B CG1 1 
ATOM   4802  C  CG2 . ILE B 1 100 ? 64.997  35.418  26.335  1.00 64.41 ? 103  ILE B CG2 1 
ATOM   4803  C  CD1 . ILE B 1 100 ? 65.926  38.167  27.177  1.00 64.27 ? 103  ILE B CD1 1 
ATOM   4804  N  N   . GLY B 1 101 ? 63.172  33.159  27.599  1.00 64.92 ? 104  GLY B N   1 
ATOM   4805  C  CA  . GLY B 1 101 ? 63.094  31.745  27.295  1.00 65.00 ? 104  GLY B CA  1 
ATOM   4806  C  C   . GLY B 1 101 ? 62.131  30.975  28.181  1.00 65.01 ? 104  GLY B C   1 
ATOM   4807  O  O   . GLY B 1 101 ? 61.842  29.808  27.907  1.00 65.17 ? 104  GLY B O   1 
ATOM   4808  N  N   . LYS B 1 102 ? 61.633  31.605  29.243  1.00 65.03 ? 105  LYS B N   1 
ATOM   4809  C  CA  . LYS B 1 102 ? 60.702  30.925  30.140  1.00 64.88 ? 105  LYS B CA  1 
ATOM   4810  C  C   . LYS B 1 102 ? 59.342  30.712  29.506  1.00 64.56 ? 105  LYS B C   1 
ATOM   4811  O  O   . LYS B 1 102 ? 58.750  31.646  28.960  1.00 64.84 ? 105  LYS B O   1 
ATOM   4812  C  CB  . LYS B 1 102 ? 60.513  31.699  31.431  1.00 65.01 ? 105  LYS B CB  1 
ATOM   4813  C  CG  . LYS B 1 102 ? 59.507  31.041  32.341  1.00 65.10 ? 105  LYS B CG  1 
ATOM   4814  C  CD  . LYS B 1 102 ? 59.472  31.709  33.687  1.00 65.59 ? 105  LYS B CD  1 
ATOM   4815  C  CE  . LYS B 1 102 ? 58.721  30.857  34.683  1.00 65.79 ? 105  LYS B CE  1 
ATOM   4816  N  NZ  . LYS B 1 102 ? 58.845  31.445  36.037  1.00 66.27 ? 105  LYS B NZ  1 
ATOM   4817  N  N   . LYS B 1 103 ? 58.828  29.494  29.638  1.00 64.33 ? 106  LYS B N   1 
ATOM   4818  C  CA  . LYS B 1 103 ? 57.528  29.146  29.077  1.00 64.04 ? 106  LYS B CA  1 
ATOM   4819  C  C   . LYS B 1 103 ? 56.459  28.891  30.128  1.00 63.59 ? 106  LYS B C   1 
ATOM   4820  O  O   . LYS B 1 103 ? 56.667  28.129  31.072  1.00 63.55 ? 106  LYS B O   1 
ATOM   4821  C  CB  . LYS B 1 103 ? 57.658  27.914  28.182  1.00 64.33 ? 106  LYS B CB  1 
ATOM   4822  C  CG  . LYS B 1 103 ? 58.395  28.186  26.890  1.00 64.42 ? 106  LYS B CG  1 
ATOM   4823  C  CD  . LYS B 1 103 ? 58.627  26.919  26.094  1.00 64.17 ? 106  LYS B CD  1 
ATOM   4824  C  CE  . LYS B 1 103 ? 59.318  27.252  24.790  1.00 64.37 ? 106  LYS B CE  1 
ATOM   4825  N  NZ  . LYS B 1 103 ? 60.014  26.073  24.226  1.00 64.35 ? 106  LYS B NZ  1 
ATOM   4826  N  N   . THR B 1 104 ? 55.304  29.521  29.943  1.00 63.00 ? 107  THR B N   1 
ATOM   4827  C  CA  . THR B 1 104 ? 54.188  29.345  30.858  1.00 62.44 ? 107  THR B CA  1 
ATOM   4828  C  C   . THR B 1 104 ? 53.024  28.831  30.039  1.00 62.04 ? 107  THR B C   1 
ATOM   4829  O  O   . THR B 1 104 ? 52.738  29.357  28.968  1.00 62.27 ? 107  THR B O   1 
ATOM   4830  C  CB  . THR B 1 104 ? 53.769  30.667  31.492  1.00 62.26 ? 107  THR B CB  1 
ATOM   4831  O  OG1 . THR B 1 104 ? 54.917  31.311  32.049  1.00 61.98 ? 107  THR B OG1 1 
ATOM   4832  C  CG2 . THR B 1 104 ? 52.759  30.422  32.596  1.00 62.00 ? 107  THR B CG2 1 
ATOM   4833  N  N   . PRO B 1 105 ? 52.361  27.769  30.511  1.00 61.62 ? 108  PRO B N   1 
ATOM   4834  C  CA  . PRO B 1 105 ? 51.213  27.179  29.813  1.00 61.56 ? 108  PRO B CA  1 
ATOM   4835  C  C   . PRO B 1 105 ? 50.067  28.175  29.717  1.00 61.22 ? 108  PRO B C   1 
ATOM   4836  O  O   . PRO B 1 105 ? 49.799  28.913  30.666  1.00 61.42 ? 108  PRO B O   1 
ATOM   4837  C  CB  . PRO B 1 105 ? 50.826  26.016  30.722  1.00 61.27 ? 108  PRO B CB  1 
ATOM   4838  C  CG  . PRO B 1 105 ? 52.118  25.648  31.368  1.00 61.50 ? 108  PRO B CG  1 
ATOM   4839  C  CD  . PRO B 1 105 ? 52.718  26.978  31.697  1.00 61.54 ? 108  PRO B CD  1 
ATOM   4840  N  N   . ILE B 1 106 ? 49.401  28.220  28.571  1.00 60.94 ? 109  ILE B N   1 
ATOM   4841  C  CA  . ILE B 1 106 ? 48.292  29.139  28.432  1.00 60.70 ? 109  ILE B CA  1 
ATOM   4842  C  C   . ILE B 1 106 ? 47.051  28.486  27.893  1.00 60.67 ? 109  ILE B C   1 
ATOM   4843  O  O   . ILE B 1 106 ? 47.093  27.463  27.203  1.00 60.60 ? 109  ILE B O   1 
ATOM   4844  C  CB  . ILE B 1 106 ? 48.593  30.307  27.505  1.00 60.70 ? 109  ILE B CB  1 
ATOM   4845  C  CG1 . ILE B 1 106 ? 48.815  29.797  26.081  1.00 60.39 ? 109  ILE B CG1 1 
ATOM   4846  C  CG2 . ILE B 1 106 ? 49.744  31.129  28.042  1.00 60.81 ? 109  ILE B CG2 1 
ATOM   4847  C  CD1 . ILE B 1 106 ? 48.846  30.891  25.048  1.00 60.21 ? 109  ILE B CD1 1 
ATOM   4848  N  N   . ALA B 1 107 ? 45.943  29.144  28.197  1.00 60.78 ? 110  ALA B N   1 
ATOM   4849  C  CA  . ALA B 1 107 ? 44.617  28.739  27.774  1.00 60.64 ? 110  ALA B CA  1 
ATOM   4850  C  C   . ALA B 1 107 ? 44.040  30.001  27.160  1.00 60.46 ? 110  ALA B C   1 
ATOM   4851  O  O   . ALA B 1 107 ? 44.232  31.098  27.694  1.00 60.63 ? 110  ALA B O   1 
ATOM   4852  C  CB  . ALA B 1 107 ? 43.797  28.320  28.973  1.00 61.16 ? 110  ALA B CB  1 
ATOM   4853  N  N   . VAL B 1 108 ? 43.338  29.853  26.043  1.00 59.93 ? 111  VAL B N   1 
ATOM   4854  C  CA  . VAL B 1 108 ? 42.767  31.005  25.360  1.00 59.53 ? 111  VAL B CA  1 
ATOM   4855  C  C   . VAL B 1 108 ? 41.376  30.723  24.810  1.00 59.45 ? 111  VAL B C   1 
ATOM   4856  O  O   . VAL B 1 108 ? 41.103  29.618  24.344  1.00 59.66 ? 111  VAL B O   1 
ATOM   4857  C  CB  . VAL B 1 108 ? 43.672  31.419  24.181  1.00 59.42 ? 111  VAL B CB  1 
ATOM   4858  C  CG1 . VAL B 1 108 ? 43.040  32.529  23.389  1.00 59.11 ? 111  VAL B CG1 1 
ATOM   4859  C  CG2 . VAL B 1 108 ? 45.031  31.850  24.688  1.00 59.34 ? 111  VAL B CG2 1 
ATOM   4860  N  N   . ARG B 1 109 ? 40.495  31.715  24.881  1.00 59.13 ? 112  ARG B N   1 
ATOM   4861  C  CA  . ARG B 1 109 ? 39.152  31.566  24.341  1.00 58.96 ? 112  ARG B CA  1 
ATOM   4862  C  C   . ARG B 1 109 ? 38.779  32.809  23.560  1.00 59.10 ? 112  ARG B C   1 
ATOM   4863  O  O   . ARG B 1 109 ? 38.876  33.929  24.075  1.00 59.07 ? 112  ARG B O   1 
ATOM   4864  C  CB  . ARG B 1 109 ? 38.114  31.321  25.435  1.00 58.57 ? 112  ARG B CB  1 
ATOM   4865  C  CG  . ARG B 1 109 ? 36.699  31.208  24.871  1.00 57.71 ? 112  ARG B CG  1 
ATOM   4866  C  CD  . ARG B 1 109 ? 35.696  30.734  25.903  1.00 57.36 ? 112  ARG B CD  1 
ATOM   4867  N  NE  . ARG B 1 109 ? 34.363  30.606  25.317  1.00 57.30 ? 112  ARG B NE  1 
ATOM   4868  C  CZ  . ARG B 1 109 ? 33.513  31.617  25.153  1.00 57.35 ? 112  ARG B CZ  1 
ATOM   4869  N  NH1 . ARG B 1 109 ? 33.846  32.841  25.535  1.00 57.56 ? 112  ARG B NH1 1 
ATOM   4870  N  NH2 . ARG B 1 109 ? 32.329  31.411  24.591  1.00 56.90 ? 112  ARG B NH2 1 
ATOM   4871  N  N   . PHE B 1 110 ? 38.407  32.605  22.299  1.00 59.33 ? 113  PHE B N   1 
ATOM   4872  C  CA  . PHE B 1 110 ? 37.996  33.695  21.416  1.00 59.48 ? 113  PHE B CA  1 
ATOM   4873  C  C   . PHE B 1 110 ? 36.482  33.741  21.383  1.00 59.54 ? 113  PHE B C   1 
ATOM   4874  O  O   . PHE B 1 110 ? 35.834  32.706  21.536  1.00 59.43 ? 113  PHE B O   1 
ATOM   4875  C  CB  . PHE B 1 110 ? 38.481  33.448  20.002  1.00 59.02 ? 113  PHE B CB  1 
ATOM   4876  C  CG  . PHE B 1 110 ? 39.951  33.315  19.889  1.00 58.23 ? 113  PHE B CG  1 
ATOM   4877  C  CD1 . PHE B 1 110 ? 40.537  32.065  19.773  1.00 57.72 ? 113  PHE B CD1 1 
ATOM   4878  C  CD2 . PHE B 1 110 ? 40.751  34.444  19.837  1.00 57.75 ? 113  PHE B CD2 1 
ATOM   4879  C  CE1 . PHE B 1 110 ? 41.903  31.939  19.599  1.00 57.73 ? 113  PHE B CE1 1 
ATOM   4880  C  CE2 . PHE B 1 110 ? 42.119  34.331  19.663  1.00 57.67 ? 113  PHE B CE2 1 
ATOM   4881  C  CZ  . PHE B 1 110 ? 42.697  33.075  19.541  1.00 57.64 ? 113  PHE B CZ  1 
ATOM   4882  N  N   . SER B 1 111 ? 35.921  34.911  21.097  1.00 59.60 ? 114  SER B N   1 
ATOM   4883  C  CA  . SER B 1 111 ? 34.475  35.020  21.075  1.00 59.87 ? 114  SER B CA  1 
ATOM   4884  C  C   . SER B 1 111 ? 33.918  36.304  20.474  1.00 60.06 ? 114  SER B C   1 
ATOM   4885  O  O   . SER B 1 111 ? 34.640  37.278  20.256  1.00 60.37 ? 114  SER B O   1 
ATOM   4886  C  CB  . SER B 1 111 ? 33.967  34.933  22.507  1.00 59.72 ? 114  SER B CB  1 
ATOM   4887  O  OG  . SER B 1 111 ? 34.441  36.045  23.246  1.00 59.83 ? 114  SER B OG  1 
ATOM   4888  N  N   . THR B 1 112 ? 32.622  36.272  20.173  1.00 60.06 ? 115  THR B N   1 
ATOM   4889  C  CA  . THR B 1 112 ? 31.922  37.445  19.687  1.00 60.04 ? 115  THR B CA  1 
ATOM   4890  C  C   . THR B 1 112 ? 31.382  38.040  20.991  1.00 60.35 ? 115  THR B C   1 
ATOM   4891  O  O   . THR B 1 112 ? 31.881  37.702  22.077  1.00 60.42 ? 115  THR B O   1 
ATOM   4892  C  CB  . THR B 1 112 ? 30.772  37.095  18.735  1.00 59.92 ? 115  THR B CB  1 
ATOM   4893  O  OG1 . THR B 1 112 ? 30.006  36.022  19.288  1.00 59.70 ? 115  THR B OG1 1 
ATOM   4894  C  CG2 . THR B 1 112 ? 31.308  36.693  17.377  1.00 59.83 ? 115  THR B CG2 1 
ATOM   4895  N  N   . VAL B 1 113 ? 30.345  38.868  20.918  1.00 60.54 ? 116  VAL B N   1 
ATOM   4896  C  CA  . VAL B 1 113 ? 29.828  39.494  22.130  1.00 60.55 ? 116  VAL B CA  1 
ATOM   4897  C  C   . VAL B 1 113 ? 28.336  39.351  22.390  1.00 60.77 ? 116  VAL B C   1 
ATOM   4898  O  O   . VAL B 1 113 ? 27.937  38.802  23.421  1.00 60.77 ? 116  VAL B O   1 
ATOM   4899  C  CB  . VAL B 1 113 ? 30.198  40.996  22.163  1.00 60.62 ? 116  VAL B CB  1 
ATOM   4900  C  CG1 . VAL B 1 113 ? 29.611  41.674  23.392  1.00 60.81 ? 116  VAL B CG1 1 
ATOM   4901  C  CG2 . VAL B 1 113 ? 31.706  41.158  22.147  1.00 60.77 ? 116  VAL B CG2 1 
ATOM   4902  N  N   . ALA B 1 114 ? 27.522  39.846  21.462  1.00 60.75 ? 117  ALA B N   1 
ATOM   4903  C  CA  . ALA B 1 114 ? 26.066  39.829  21.602  1.00 61.18 ? 117  ALA B CA  1 
ATOM   4904  C  C   . ALA B 1 114 ? 25.348  38.505  21.427  1.00 61.55 ? 117  ALA B C   1 
ATOM   4905  O  O   . ALA B 1 114 ? 24.476  38.152  22.223  1.00 61.67 ? 117  ALA B O   1 
ATOM   4906  C  CB  . ALA B 1 114 ? 25.448  40.854  20.665  1.00 60.91 ? 117  ALA B CB  1 
ATOM   4907  N  N   . GLY B 1 115 ? 25.670  37.815  20.339  1.00 61.99 ? 118  GLY B N   1 
ATOM   4908  C  CA  . GLY B 1 115 ? 25.033  36.546  20.022  1.00 62.60 ? 118  GLY B CA  1 
ATOM   4909  C  C   . GLY B 1 115 ? 25.088  35.460  21.076  1.00 62.95 ? 118  GLY B C   1 
ATOM   4910  O  O   . GLY B 1 115 ? 26.015  35.407  21.890  1.00 63.22 ? 118  GLY B O   1 
ATOM   4911  N  N   . GLU B 1 116 ? 24.075  34.597  21.063  1.00 62.89 ? 119  GLU B N   1 
ATOM   4912  C  CA  . GLU B 1 116 ? 23.979  33.492  22.008  1.00 62.19 ? 119  GLU B CA  1 
ATOM   4913  C  C   . GLU B 1 116 ? 24.711  32.290  21.428  1.00 61.74 ? 119  GLU B C   1 
ATOM   4914  O  O   . GLU B 1 116 ? 25.311  32.381  20.341  1.00 61.61 ? 119  GLU B O   1 
ATOM   4915  C  CB  . GLU B 1 116 ? 22.532  33.119  22.262  1.00 62.56 ? 119  GLU B CB  1 
ATOM   4916  C  CG  . GLU B 1 116 ? 21.700  34.242  22.872  1.00 63.32 ? 119  GLU B CG  1 
ATOM   4917  C  CD  . GLU B 1 116 ? 21.254  35.279  21.854  1.00 63.91 ? 119  GLU B CD  1 
ATOM   4918  O  OE1 . GLU B 1 116 ? 21.376  35.025  20.632  1.00 64.14 ? 119  GLU B OE1 1 
ATOM   4919  O  OE2 . GLU B 1 116 ? 20.764  36.345  22.281  1.00 63.87 ? 119  GLU B OE2 1 
ATOM   4920  N  N   A SER B 1 117 ? 24.686  31.180  22.141  0.50 61.11 ? 120  SER B N   1 
ATOM   4921  N  N   B SER B 1 117 ? 24.637  31.184  22.139  0.50 61.32 ? 120  SER B N   1 
ATOM   4922  C  CA  A SER B 1 117 ? 25.388  29.966  21.726  0.50 60.38 ? 120  SER B CA  1 
ATOM   4923  C  CA  B SER B 1 117 ? 25.289  29.939  21.680  0.50 60.64 ? 120  SER B CA  1 
ATOM   4924  C  C   A SER B 1 117 ? 25.254  29.510  20.273  0.50 60.56 ? 120  SER B C   1 
ATOM   4925  C  C   B SER B 1 117 ? 24.387  29.438  20.546  0.50 60.59 ? 120  SER B C   1 
ATOM   4926  O  O   A SER B 1 117 ? 26.239  29.087  19.683  0.50 60.38 ? 120  SER B O   1 
ATOM   4927  O  O   B SER B 1 117 ? 23.210  29.134  20.746  0.50 60.29 ? 120  SER B O   1 
ATOM   4928  C  CB  A SER B 1 117 ? 25.014  28.817  22.663  0.50 59.87 ? 120  SER B CB  1 
ATOM   4929  C  CB  B SER B 1 117 ? 25.287  28.913  22.810  0.50 60.53 ? 120  SER B CB  1 
ATOM   4930  O  OG  A SER B 1 117 ? 25.399  29.144  23.993  0.50 58.94 ? 120  SER B OG  1 
ATOM   4931  O  OG  B SER B 1 117 ? 25.936  29.431  23.971  0.50 60.19 ? 120  SER B OG  1 
ATOM   4932  N  N   A GLY B 1 118 ? 24.056  29.588  19.697  0.50 60.49 ? 121  GLY B N   1 
ATOM   4933  N  N   B GLY B 1 118 ? 24.922  29.449  19.344  0.50 60.70 ? 121  GLY B N   1 
ATOM   4934  C  CA  A GLY B 1 118 ? 23.887  29.135  18.323  0.50 60.86 ? 121  GLY B CA  1 
ATOM   4935  C  CA  B GLY B 1 118 ? 24.092  29.050  18.235  0.50 60.52 ? 121  GLY B CA  1 
ATOM   4936  C  C   A GLY B 1 118 ? 24.027  30.174  17.214  0.50 61.07 ? 121  GLY B C   1 
ATOM   4937  C  C   B GLY B 1 118 ? 24.254  30.107  17.162  0.50 60.71 ? 121  GLY B C   1 
ATOM   4938  O  O   A GLY B 1 118 ? 23.649  29.933  16.075  0.50 61.10 ? 121  GLY B O   1 
ATOM   4939  O  O   B GLY B 1 118 ? 24.047  29.810  15.979  0.50 60.95 ? 121  GLY B O   1 
ATOM   4940  N  N   . SER B 1 119 ? 24.592  31.322  17.561  1.00 61.56 ? 122  SER B N   1 
ATOM   4941  C  CA  . SER B 1 119 ? 24.789  32.420  16.622  1.00 60.78 ? 122  SER B CA  1 
ATOM   4942  C  C   . SER B 1 119 ? 25.988  32.183  15.718  1.00 60.88 ? 122  SER B C   1 
ATOM   4943  O  O   . SER B 1 119 ? 26.792  31.297  15.973  1.00 60.97 ? 122  SER B O   1 
ATOM   4944  C  CB  . SER B 1 119 ? 24.957  33.737  17.365  1.00 61.07 ? 122  SER B CB  1 
ATOM   4945  O  OG  . SER B 1 119 ? 26.126  33.701  18.158  1.00 61.76 ? 122  SER B OG  1 
ATOM   4946  N  N   . ALA B 1 120 ? 26.125  33.003  14.682  1.00 60.99 ? 123  ALA B N   1 
ATOM   4947  C  CA  . ALA B 1 120 ? 27.221  32.860  13.739  1.00 61.12 ? 123  ALA B CA  1 
ATOM   4948  C  C   . ALA B 1 120 ? 28.493  33.571  14.187  1.00 61.33 ? 123  ALA B C   1 
ATOM   4949  O  O   . ALA B 1 120 ? 28.440  34.552  14.932  1.00 61.75 ? 123  ALA B O   1 
ATOM   4950  C  CB  . ALA B 1 120 ? 26.793  33.372  12.379  1.00 61.25 ? 123  ALA B CB  1 
ATOM   4951  N  N   . ASP B 1 121 ? 29.636  33.086  13.710  1.00 61.71 ? 124  ASP B N   1 
ATOM   4952  C  CA  . ASP B 1 121 ? 30.922  33.686  14.052  1.00 61.73 ? 124  ASP B CA  1 
ATOM   4953  C  C   . ASP B 1 121 ? 31.233  34.928  13.214  1.00 62.01 ? 124  ASP B C   1 
ATOM   4954  O  O   . ASP B 1 121 ? 31.785  35.904  13.721  1.00 62.30 ? 124  ASP B O   1 
ATOM   4955  C  CB  . ASP B 1 121 ? 32.063  32.678  13.850  1.00 62.35 ? 124  ASP B CB  1 
ATOM   4956  C  CG  . ASP B 1 121 ? 32.083  31.575  14.895  1.00 62.58 ? 124  ASP B CG  1 
ATOM   4957  O  OD1 . ASP B 1 121 ? 31.422  31.721  15.942  1.00 63.13 ? 124  ASP B OD1 1 
ATOM   4958  O  OD2 . ASP B 1 121 ? 32.786  30.559  14.676  1.00 62.66 ? 124  ASP B OD2 1 
ATOM   4959  N  N   . THR B 1 122 ? 30.897  34.884  11.929  1.00 61.99 ? 125  THR B N   1 
ATOM   4960  C  CA  . THR B 1 122 ? 31.192  35.986  11.017  1.00 62.04 ? 125  THR B CA  1 
ATOM   4961  C  C   . THR B 1 122 ? 30.201  37.121  11.035  1.00 62.05 ? 125  THR B C   1 
ATOM   4962  O  O   . THR B 1 122 ? 29.516  37.357  10.043  1.00 61.87 ? 125  THR B O   1 
ATOM   4963  C  CB  . THR B 1 122 ? 31.283  35.496  9.575   1.00 62.18 ? 125  THR B CB  1 
ATOM   4964  O  OG1 . THR B 1 122 ? 30.031  34.914  9.193   1.00 62.67 ? 125  THR B OG1 1 
ATOM   4965  C  CG2 . THR B 1 122 ? 32.375  34.466  9.440   1.00 62.53 ? 125  THR B CG2 1 
ATOM   4966  N  N   . VAL B 1 123 ? 30.133  37.837  12.149  1.00 61.74 ? 126  VAL B N   1 
ATOM   4967  C  CA  . VAL B 1 123 ? 29.221  38.960  12.259  1.00 61.64 ? 126  VAL B CA  1 
ATOM   4968  C  C   . VAL B 1 123 ? 29.952  40.146  12.850  1.00 61.86 ? 126  VAL B C   1 
ATOM   4969  O  O   . VAL B 1 123 ? 30.865  39.980  13.664  1.00 62.06 ? 126  VAL B O   1 
ATOM   4970  C  CB  . VAL B 1 123 ? 28.023  38.626  13.147  1.00 61.33 ? 126  VAL B CB  1 
ATOM   4971  C  CG1 . VAL B 1 123 ? 27.213  37.502  12.531  1.00 60.96 ? 126  VAL B CG1 1 
ATOM   4972  C  CG2 . VAL B 1 123 ? 28.492  38.253  14.538  1.00 60.91 ? 126  VAL B CG2 1 
ATOM   4973  N  N   . ARG B 1 124 ? 29.574  41.345  12.421  1.00 62.32 ? 127  ARG B N   1 
ATOM   4974  C  CA  . ARG B 1 124 ? 30.200  42.553  12.935  1.00 62.58 ? 127  ARG B CA  1 
ATOM   4975  C  C   . ARG B 1 124 ? 30.005  42.547  14.432  1.00 62.65 ? 127  ARG B C   1 
ATOM   4976  O  O   . ARG B 1 124 ? 28.874  42.457  14.917  1.00 62.79 ? 127  ARG B O   1 
ATOM   4977  C  CB  . ARG B 1 124 ? 29.570  43.808  12.324  1.00 63.04 ? 127  ARG B CB  1 
ATOM   4978  C  CG  . ARG B 1 124 ? 30.068  45.113  12.950  1.00 63.25 ? 127  ARG B CG  1 
ATOM   4979  C  CD  . ARG B 1 124 ? 29.809  46.317  12.053  1.00 63.41 ? 127  ARG B CD  1 
ATOM   4980  N  NE  . ARG B 1 124 ? 30.751  46.370  10.935  1.00 63.56 ? 127  ARG B NE  1 
ATOM   4981  C  CZ  . ARG B 1 124 ? 30.454  46.022  9.687   1.00 63.77 ? 127  ARG B CZ  1 
ATOM   4982  N  NH1 . ARG B 1 124 ? 31.378  46.100  8.746   1.00 62.90 ? 127  ARG B NH1 1 
ATOM   4983  N  NH2 . ARG B 1 124 ? 29.232  45.602  9.373   1.00 64.13 ? 127  ARG B NH2 1 
ATOM   4984  N  N   . ASP B 1 125 ? 31.114  42.601  15.156  1.00 62.56 ? 128  ASP B N   1 
ATOM   4985  C  CA  . ASP B 1 125 ? 31.073  42.574  16.606  1.00 62.42 ? 128  ASP B CA  1 
ATOM   4986  C  C   . ASP B 1 125 ? 32.505  42.544  17.084  1.00 62.19 ? 128  ASP B C   1 
ATOM   4987  O  O   . ASP B 1 125 ? 33.385  42.057  16.377  1.00 62.32 ? 128  ASP B O   1 
ATOM   4988  C  CB  . ASP B 1 125 ? 30.387  41.283  17.067  1.00 62.54 ? 128  ASP B CB  1 
ATOM   4989  C  CG  . ASP B 1 125 ? 29.532  41.477  18.299  1.00 62.55 ? 128  ASP B CG  1 
ATOM   4990  O  OD1 . ASP B 1 125 ? 29.225  40.465  18.968  1.00 62.52 ? 128  ASP B OD1 1 
ATOM   4991  O  OD2 . ASP B 1 125 ? 29.141  42.629  18.586  1.00 62.65 ? 128  ASP B OD2 1 
ATOM   4992  N  N   . PRO B 1 126 ? 32.776  43.117  18.263  1.00 61.80 ? 129  PRO B N   1 
ATOM   4993  C  CA  . PRO B 1 126 ? 34.168  43.055  18.706  1.00 61.55 ? 129  PRO B CA  1 
ATOM   4994  C  C   . PRO B 1 126 ? 34.484  41.580  18.965  1.00 61.27 ? 129  PRO B C   1 
ATOM   4995  O  O   . PRO B 1 126 ? 33.595  40.727  18.847  1.00 61.36 ? 129  PRO B O   1 
ATOM   4996  C  CB  . PRO B 1 126 ? 34.155  43.891  19.989  1.00 61.66 ? 129  PRO B CB  1 
ATOM   4997  C  CG  . PRO B 1 126 ? 32.722  43.837  20.444  1.00 61.54 ? 129  PRO B CG  1 
ATOM   4998  C  CD  . PRO B 1 126 ? 31.962  43.940  19.168  1.00 61.74 ? 129  PRO B CD  1 
ATOM   4999  N  N   . ARG B 1 127 ? 35.738  41.255  19.256  1.00 60.82 ? 130  ARG B N   1 
ATOM   5000  C  CA  . ARG B 1 127 ? 36.080  39.861  19.503  1.00 60.32 ? 130  ARG B CA  1 
ATOM   5001  C  C   . ARG B 1 127 ? 36.806  39.660  20.819  1.00 60.58 ? 130  ARG B C   1 
ATOM   5002  O  O   . ARG B 1 127 ? 37.710  40.424  21.163  1.00 60.73 ? 130  ARG B O   1 
ATOM   5003  C  CB  . ARG B 1 127 ? 36.935  39.315  18.368  1.00 59.48 ? 130  ARG B CB  1 
ATOM   5004  C  CG  . ARG B 1 127 ? 36.257  39.314  17.006  1.00 58.74 ? 130  ARG B CG  1 
ATOM   5005  C  CD  . ARG B 1 127 ? 35.075  38.369  16.960  1.00 57.91 ? 130  ARG B CD  1 
ATOM   5006  N  NE  . ARG B 1 127 ? 34.695  38.079  15.581  1.00 57.46 ? 130  ARG B NE  1 
ATOM   5007  C  CZ  . ARG B 1 127 ? 33.741  38.716  14.910  1.00 57.29 ? 130  ARG B CZ  1 
ATOM   5008  N  NH1 . ARG B 1 127 ? 33.048  39.688  15.488  1.00 57.37 ? 130  ARG B NH1 1 
ATOM   5009  N  NH2 . ARG B 1 127 ? 33.500  38.399  13.647  1.00 57.13 ? 130  ARG B NH2 1 
ATOM   5010  N  N   . GLY B 1 128 ? 36.394  38.637  21.559  1.00 60.85 ? 131  GLY B N   1 
ATOM   5011  C  CA  . GLY B 1 128 ? 37.033  38.341  22.821  1.00 61.25 ? 131  GLY B CA  1 
ATOM   5012  C  C   . GLY B 1 128 ? 38.326  37.595  22.563  1.00 61.64 ? 131  GLY B C   1 
ATOM   5013  O  O   . GLY B 1 128 ? 38.391  36.742  21.680  1.00 61.95 ? 131  GLY B O   1 
ATOM   5014  N  N   . PHE B 1 129 ? 39.352  37.910  23.342  1.00 61.88 ? 132  PHE B N   1 
ATOM   5015  C  CA  . PHE B 1 129 ? 40.658  37.279  23.205  1.00 61.94 ? 132  PHE B CA  1 
ATOM   5016  C  C   . PHE B 1 129 ? 41.188  37.134  24.632  1.00 61.80 ? 132  PHE B C   1 
ATOM   5017  O  O   . PHE B 1 129 ? 42.021  37.923  25.087  1.00 62.08 ? 132  PHE B O   1 
ATOM   5018  C  CB  . PHE B 1 129 ? 41.569  38.199  22.380  1.00 62.51 ? 132  PHE B CB  1 
ATOM   5019  C  CG  . PHE B 1 129 ? 42.809  37.532  21.826  1.00 62.87 ? 132  PHE B CG  1 
ATOM   5020  C  CD1 . PHE B 1 129 ? 43.365  36.416  22.436  1.00 63.06 ? 132  PHE B CD1 1 
ATOM   5021  C  CD2 . PHE B 1 129 ? 43.434  38.049  20.691  1.00 63.17 ? 132  PHE B CD2 1 
ATOM   5022  C  CE1 . PHE B 1 129 ? 44.522  35.827  21.924  1.00 62.95 ? 132  PHE B CE1 1 
ATOM   5023  C  CE2 . PHE B 1 129 ? 44.586  37.468  20.175  1.00 63.04 ? 132  PHE B CE2 1 
ATOM   5024  C  CZ  . PHE B 1 129 ? 45.132  36.357  20.791  1.00 62.99 ? 132  PHE B CZ  1 
ATOM   5025  N  N   . ALA B 1 130 ? 40.690  36.131  25.344  1.00 61.40 ? 133  ALA B N   1 
ATOM   5026  C  CA  . ALA B 1 130 ? 41.100  35.924  26.724  1.00 61.16 ? 133  ALA B CA  1 
ATOM   5027  C  C   . ALA B 1 130 ? 42.233  34.930  26.867  1.00 61.11 ? 133  ALA B C   1 
ATOM   5028  O  O   . ALA B 1 130 ? 42.227  33.875  26.224  1.00 61.24 ? 133  ALA B O   1 
ATOM   5029  C  CB  . ALA B 1 130 ? 39.916  35.482  27.557  1.00 61.07 ? 133  ALA B CB  1 
ATOM   5030  N  N   . VAL B 1 131 ? 43.200  35.270  27.722  1.00 60.91 ? 134  VAL B N   1 
ATOM   5031  C  CA  . VAL B 1 131 ? 44.342  34.397  27.971  1.00 60.49 ? 134  VAL B CA  1 
ATOM   5032  C  C   . VAL B 1 131 ? 44.517  34.092  29.445  1.00 60.34 ? 134  VAL B C   1 
ATOM   5033  O  O   . VAL B 1 131 ? 44.463  34.984  30.295  1.00 59.90 ? 134  VAL B O   1 
ATOM   5034  C  CB  . VAL B 1 131 ? 45.660  34.991  27.485  1.00 60.52 ? 134  VAL B CB  1 
ATOM   5035  C  CG1 . VAL B 1 131 ? 46.678  33.876  27.312  1.00 60.14 ? 134  VAL B CG1 1 
ATOM   5036  C  CG2 . VAL B 1 131 ? 45.464  35.757  26.191  1.00 60.24 ? 134  VAL B CG2 1 
ATOM   5037  N  N   . LYS B 1 132 ? 44.741  32.816  29.728  1.00 60.28 ? 135  LYS B N   1 
ATOM   5038  C  CA  . LYS B 1 132 ? 44.946  32.344  31.084  1.00 60.43 ? 135  LYS B CA  1 
ATOM   5039  C  C   . LYS B 1 132 ? 46.362  31.814  31.212  1.00 60.91 ? 135  LYS B C   1 
ATOM   5040  O  O   . LYS B 1 132 ? 46.730  30.833  30.550  1.00 61.40 ? 135  LYS B O   1 
ATOM   5041  C  CB  . LYS B 1 132 ? 43.967  31.220  31.422  1.00 59.91 ? 135  LYS B CB  1 
ATOM   5042  C  CG  . LYS B 1 132 ? 44.173  30.648  32.818  1.00 59.11 ? 135  LYS B CG  1 
ATOM   5043  C  CD  . LYS B 1 132 ? 43.196  29.531  33.144  1.00 58.54 ? 135  LYS B CD  1 
ATOM   5044  C  CE  . LYS B 1 132 ? 41.766  30.036  33.278  1.00 58.23 ? 135  LYS B CE  1 
ATOM   5045  N  NZ  . LYS B 1 132 ? 41.601  31.085  34.332  1.00 58.15 ? 135  LYS B NZ  1 
ATOM   5046  N  N   . PHE B 1 133 ? 47.155  32.461  32.058  1.00 61.03 ? 136  PHE B N   1 
ATOM   5047  C  CA  . PHE B 1 133 ? 48.525  32.029  32.277  1.00 61.08 ? 136  PHE B CA  1 
ATOM   5048  C  C   . PHE B 1 133 ? 48.603  31.221  33.574  1.00 61.40 ? 136  PHE B C   1 
ATOM   5049  O  O   . PHE B 1 133 ? 48.226  31.706  34.640  1.00 61.33 ? 136  PHE B O   1 
ATOM   5050  C  CB  . PHE B 1 133 ? 49.447  33.232  32.392  1.00 61.17 ? 136  PHE B CB  1 
ATOM   5051  C  CG  . PHE B 1 133 ? 49.458  34.117  31.187  1.00 60.99 ? 136  PHE B CG  1 
ATOM   5052  C  CD1 . PHE B 1 133 ? 48.430  35.017  30.961  1.00 60.89 ? 136  PHE B CD1 1 
ATOM   5053  C  CD2 . PHE B 1 133 ? 50.540  34.104  30.316  1.00 60.94 ? 136  PHE B CD2 1 
ATOM   5054  C  CE1 . PHE B 1 133 ? 48.483  35.900  29.887  1.00 60.86 ? 136  PHE B CE1 1 
ATOM   5055  C  CE2 . PHE B 1 133 ? 50.603  34.983  29.239  1.00 60.75 ? 136  PHE B CE2 1 
ATOM   5056  C  CZ  . PHE B 1 133 ? 49.575  35.882  29.026  1.00 60.86 ? 136  PHE B CZ  1 
ATOM   5057  N  N   . TYR B 1 134 ? 49.085  29.989  33.482  1.00 61.42 ? 137  TYR B N   1 
ATOM   5058  C  CA  . TYR B 1 134 ? 49.211  29.147  34.655  1.00 61.65 ? 137  TYR B CA  1 
ATOM   5059  C  C   . TYR B 1 134 ? 50.566  29.380  35.293  1.00 62.13 ? 137  TYR B C   1 
ATOM   5060  O  O   . TYR B 1 134 ? 51.514  28.626  35.073  1.00 62.32 ? 137  TYR B O   1 
ATOM   5061  C  CB  . TYR B 1 134 ? 49.046  27.701  34.254  1.00 61.47 ? 137  TYR B CB  1 
ATOM   5062  C  CG  . TYR B 1 134 ? 47.703  27.436  33.650  1.00 61.41 ? 137  TYR B CG  1 
ATOM   5063  C  CD1 . TYR B 1 134 ? 46.631  27.066  34.447  1.00 61.38 ? 137  TYR B CD1 1 
ATOM   5064  C  CD2 . TYR B 1 134 ? 47.502  27.540  32.278  1.00 61.48 ? 137  TYR B CD2 1 
ATOM   5065  C  CE1 . TYR B 1 134 ? 45.391  26.802  33.899  1.00 61.26 ? 137  TYR B CE1 1 
ATOM   5066  C  CE2 . TYR B 1 134 ? 46.260  27.279  31.716  1.00 61.35 ? 137  TYR B CE2 1 
ATOM   5067  C  CZ  . TYR B 1 134 ? 45.211  26.907  32.536  1.00 61.38 ? 137  TYR B CZ  1 
ATOM   5068  O  OH  . TYR B 1 134 ? 43.976  26.639  31.999  1.00 61.41 ? 137  TYR B OH  1 
ATOM   5069  N  N   . THR B 1 135 ? 50.635  30.445  36.083  1.00 62.63 ? 138  THR B N   1 
ATOM   5070  C  CA  . THR B 1 135 ? 51.842  30.883  36.775  1.00 62.98 ? 138  THR B CA  1 
ATOM   5071  C  C   . THR B 1 135 ? 52.092  30.182  38.104  1.00 63.35 ? 138  THR B C   1 
ATOM   5072  O  O   . THR B 1 135 ? 51.197  29.557  38.669  1.00 63.46 ? 138  THR B O   1 
ATOM   5073  C  CB  . THR B 1 135 ? 51.740  32.400  37.013  1.00 62.86 ? 138  THR B CB  1 
ATOM   5074  O  OG1 . THR B 1 135 ? 51.893  33.075  35.764  1.00 63.28 ? 138  THR B OG1 1 
ATOM   5075  C  CG2 . THR B 1 135 ? 52.763  32.904  37.986  1.00 62.66 ? 138  THR B CG2 1 
ATOM   5076  N  N   . GLU B 1 136 ? 53.332  30.262  38.574  1.00 63.65 ? 139  GLU B N   1 
ATOM   5077  C  CA  . GLU B 1 136 ? 53.719  29.685  39.852  1.00 64.20 ? 139  GLU B CA  1 
ATOM   5078  C  C   . GLU B 1 136 ? 53.050  30.495  40.944  1.00 63.84 ? 139  GLU B C   1 
ATOM   5079  O  O   . GLU B 1 136 ? 52.834  30.000  42.046  1.00 64.06 ? 139  GLU B O   1 
ATOM   5080  C  CB  . GLU B 1 136 ? 55.229  29.760  40.049  1.00 65.41 ? 139  GLU B CB  1 
ATOM   5081  C  CG  . GLU B 1 136 ? 56.025  28.913  39.089  1.00 67.25 ? 139  GLU B CG  1 
ATOM   5082  C  CD  . GLU B 1 136 ? 56.361  29.622  37.794  1.00 68.49 ? 139  GLU B CD  1 
ATOM   5083  O  OE1 . GLU B 1 136 ? 55.634  30.562  37.395  1.00 69.24 ? 139  GLU B OE1 1 
ATOM   5084  O  OE2 . GLU B 1 136 ? 57.370  29.231  37.170  1.00 69.27 ? 139  GLU B OE2 1 
ATOM   5085  N  N   . ASP B 1 137 ? 52.798  31.767  40.655  1.00 63.15 ? 140  ASP B N   1 
ATOM   5086  C  CA  . ASP B 1 137 ? 52.130  32.643  41.602  1.00 62.46 ? 140  ASP B CA  1 
ATOM   5087  C  C   . ASP B 1 137 ? 50.636  32.626  41.343  1.00 61.90 ? 140  ASP B C   1 
ATOM   5088  O  O   . ASP B 1 137 ? 49.959  33.642  41.490  1.00 62.21 ? 140  ASP B O   1 
ATOM   5089  C  CB  . ASP B 1 137 ? 52.664  34.074  41.505  1.00 62.70 ? 140  ASP B CB  1 
ATOM   5090  C  CG  . ASP B 1 137 ? 53.912  34.295  42.348  1.00 63.09 ? 140  ASP B CG  1 
ATOM   5091  O  OD1 . ASP B 1 137 ? 54.557  35.357  42.190  1.00 63.24 ? 140  ASP B OD1 1 
ATOM   5092  O  OD2 . ASP B 1 137 ? 54.248  33.420  43.180  1.00 63.35 ? 140  ASP B OD2 1 
ATOM   5093  N  N   . GLY B 1 138 ? 50.120  31.462  40.972  1.00 61.06 ? 141  GLY B N   1 
ATOM   5094  C  CA  . GLY B 1 138 ? 48.702  31.348  40.701  1.00 59.98 ? 141  GLY B CA  1 
ATOM   5095  C  C   . GLY B 1 138 ? 48.400  31.771  39.282  1.00 59.40 ? 141  GLY B C   1 
ATOM   5096  O  O   . GLY B 1 138 ? 49.309  32.115  38.528  1.00 59.12 ? 141  GLY B O   1 
ATOM   5097  N  N   . ASN B 1 139 ? 47.123  31.762  38.919  1.00 58.90 ? 142  ASN B N   1 
ATOM   5098  C  CA  . ASN B 1 139 ? 46.727  32.130  37.570  1.00 58.51 ? 142  ASN B CA  1 
ATOM   5099  C  C   . ASN B 1 139 ? 46.623  33.618  37.312  1.00 58.39 ? 142  ASN B C   1 
ATOM   5100  O  O   . ASN B 1 139 ? 46.223  34.390  38.180  1.00 58.22 ? 142  ASN B O   1 
ATOM   5101  C  CB  . ASN B 1 139 ? 45.393  31.480  37.201  1.00 58.46 ? 142  ASN B CB  1 
ATOM   5102  C  CG  . ASN B 1 139 ? 45.510  29.990  36.992  1.00 58.53 ? 142  ASN B CG  1 
ATOM   5103  O  OD1 . ASN B 1 139 ? 46.613  29.445  36.944  1.00 59.47 ? 142  ASN B OD1 1 
ATOM   5104  N  ND2 . ASN B 1 139 ? 44.372  29.317  36.871  1.00 58.14 ? 142  ASN B ND2 1 
ATOM   5105  N  N   . TRP B 1 140 ? 46.982  33.999  36.091  1.00 58.45 ? 143  TRP B N   1 
ATOM   5106  C  CA  . TRP B 1 140 ? 46.903  35.377  35.640  1.00 58.24 ? 143  TRP B CA  1 
ATOM   5107  C  C   . TRP B 1 140 ? 46.000  35.391  34.414  1.00 58.10 ? 143  TRP B C   1 
ATOM   5108  O  O   . TRP B 1 140 ? 46.346  34.824  33.369  1.00 58.10 ? 143  TRP B O   1 
ATOM   5109  C  CB  . TRP B 1 140 ? 48.278  35.909  35.251  1.00 58.20 ? 143  TRP B CB  1 
ATOM   5110  C  CG  . TRP B 1 140 ? 48.202  37.247  34.586  1.00 58.45 ? 143  TRP B CG  1 
ATOM   5111  C  CD1 . TRP B 1 140 ? 47.267  38.224  34.803  1.00 58.49 ? 143  TRP B CD1 1 
ATOM   5112  C  CD2 . TRP B 1 140 ? 49.073  37.747  33.572  1.00 58.41 ? 143  TRP B CD2 1 
ATOM   5113  N  NE1 . TRP B 1 140 ? 47.503  39.299  33.982  1.00 58.40 ? 143  TRP B NE1 1 
ATOM   5114  C  CE2 . TRP B 1 140 ? 48.607  39.034  33.216  1.00 58.44 ? 143  TRP B CE2 1 
ATOM   5115  C  CE3 . TRP B 1 140 ? 50.204  37.233  32.925  1.00 58.49 ? 143  TRP B CE3 1 
ATOM   5116  C  CZ2 . TRP B 1 140 ? 49.236  39.813  32.244  1.00 58.68 ? 143  TRP B CZ2 1 
ATOM   5117  C  CZ3 . TRP B 1 140 ? 50.830  38.008  31.955  1.00 58.42 ? 143  TRP B CZ3 1 
ATOM   5118  C  CH2 . TRP B 1 140 ? 50.344  39.283  31.625  1.00 58.63 ? 143  TRP B CH2 1 
ATOM   5119  N  N   . ASP B 1 141 ? 44.835  36.013  34.552  1.00 57.97 ? 144  ASP B N   1 
ATOM   5120  C  CA  . ASP B 1 141 ? 43.900  36.090  33.445  1.00 57.75 ? 144  ASP B CA  1 
ATOM   5121  C  C   . ASP B 1 141 ? 43.978  37.460  32.814  1.00 58.10 ? 144  ASP B C   1 
ATOM   5122  O  O   . ASP B 1 141 ? 43.768  38.472  33.488  1.00 58.22 ? 144  ASP B O   1 
ATOM   5123  C  CB  . ASP B 1 141 ? 42.470  35.830  33.920  1.00 57.13 ? 144  ASP B CB  1 
ATOM   5124  C  CG  . ASP B 1 141 ? 42.245  34.394  34.358  1.00 56.37 ? 144  ASP B CG  1 
ATOM   5125  O  OD1 . ASP B 1 141 ? 41.486  34.180  35.326  1.00 56.23 ? 144  ASP B OD1 1 
ATOM   5126  O  OD2 . ASP B 1 141 ? 42.808  33.476  33.733  1.00 55.94 ? 144  ASP B OD2 1 
ATOM   5127  N  N   . LEU B 1 142 ? 44.353  37.495  31.540  1.00 58.22 ? 145  LEU B N   1 
ATOM   5128  C  CA  . LEU B 1 142 ? 44.427  38.751  30.808  1.00 58.28 ? 145  LEU B CA  1 
ATOM   5129  C  C   . LEU B 1 142 ? 43.235  38.708  29.874  1.00 58.68 ? 145  LEU B C   1 
ATOM   5130  O  O   . LEU B 1 142 ? 43.327  38.235  28.739  1.00 58.94 ? 145  LEU B O   1 
ATOM   5131  C  CB  . LEU B 1 142 ? 45.723  38.852  30.005  1.00 57.66 ? 145  LEU B CB  1 
ATOM   5132  C  CG  . LEU B 1 142 ? 45.867  40.185  29.274  1.00 56.82 ? 145  LEU B CG  1 
ATOM   5133  C  CD1 . LEU B 1 142 ? 46.012  41.284  30.285  1.00 56.41 ? 145  LEU B CD1 1 
ATOM   5134  C  CD2 . LEU B 1 142 ? 47.056  40.168  28.341  1.00 56.51 ? 145  LEU B CD2 1 
ATOM   5135  N  N   . VAL B 1 143 ? 42.093  39.142  30.389  1.00 59.01 ? 146  VAL B N   1 
ATOM   5136  C  CA  . VAL B 1 143 ? 40.848  39.129  29.638  1.00 59.11 ? 146  VAL B CA  1 
ATOM   5137  C  C   . VAL B 1 143 ? 40.767  40.309  28.677  1.00 59.61 ? 146  VAL B C   1 
ATOM   5138  O  O   . VAL B 1 143 ? 40.335  41.402  29.060  1.00 59.80 ? 146  VAL B O   1 
ATOM   5139  C  CB  . VAL B 1 143 ? 39.672  39.162  30.612  1.00 58.59 ? 146  VAL B CB  1 
ATOM   5140  C  CG1 . VAL B 1 143 ? 38.395  38.821  29.901  1.00 58.62 ? 146  VAL B CG1 1 
ATOM   5141  C  CG2 . VAL B 1 143 ? 39.925  38.188  31.748  1.00 58.00 ? 146  VAL B CG2 1 
ATOM   5142  N  N   . GLY B 1 144 ? 41.159  40.084  27.424  1.00 59.95 ? 147  GLY B N   1 
ATOM   5143  C  CA  . GLY B 1 144 ? 41.139  41.168  26.455  1.00 60.53 ? 147  GLY B CA  1 
ATOM   5144  C  C   . GLY B 1 144 ? 40.255  41.028  25.227  1.00 60.96 ? 147  GLY B C   1 
ATOM   5145  O  O   . GLY B 1 144 ? 39.632  39.987  25.000  1.00 61.27 ? 147  GLY B O   1 
ATOM   5146  N  N   . ASN B 1 145 ? 40.195  42.106  24.444  1.00 61.04 ? 148  ASN B N   1 
ATOM   5147  C  CA  . ASN B 1 145 ? 39.414  42.174  23.208  1.00 61.10 ? 148  ASN B CA  1 
ATOM   5148  C  C   . ASN B 1 145 ? 40.341  42.473  22.047  1.00 60.97 ? 148  ASN B C   1 
ATOM   5149  O  O   . ASN B 1 145 ? 41.530  42.753  22.242  1.00 61.45 ? 148  ASN B O   1 
ATOM   5150  C  CB  . ASN B 1 145 ? 38.378  43.297  23.277  1.00 60.99 ? 148  ASN B CB  1 
ATOM   5151  C  CG  . ASN B 1 145 ? 37.080  42.859  23.910  1.00 61.09 ? 148  ASN B CG  1 
ATOM   5152  O  OD1 . ASN B 1 145 ? 36.717  41.683  23.861  1.00 61.42 ? 148  ASN B OD1 1 
ATOM   5153  N  ND2 . ASN B 1 145 ? 36.358  43.810  24.495  1.00 61.03 ? 148  ASN B ND2 1 
ATOM   5154  N  N   . ASN B 1 146 ? 39.783  42.466  20.840  1.00 60.73 ? 149  ASN B N   1 
ATOM   5155  C  CA  . ASN B 1 146 ? 40.569  42.749  19.649  1.00 60.25 ? 149  ASN B CA  1 
ATOM   5156  C  C   . ASN B 1 146 ? 40.585  44.247  19.382  1.00 60.09 ? 149  ASN B C   1 
ATOM   5157  O  O   . ASN B 1 146 ? 40.844  44.684  18.266  1.00 60.46 ? 149  ASN B O   1 
ATOM   5158  C  CB  . ASN B 1 146 ? 40.002  42.008  18.442  1.00 59.99 ? 149  ASN B CB  1 
ATOM   5159  C  CG  . ASN B 1 146 ? 38.593  42.429  18.121  1.00 59.85 ? 149  ASN B CG  1 
ATOM   5160  O  OD1 . ASN B 1 146 ? 37.843  42.851  19.005  1.00 60.06 ? 149  ASN B OD1 1 
ATOM   5161  N  ND2 . ASN B 1 146 ? 38.217  42.321  16.852  1.00 59.52 ? 149  ASN B ND2 1 
ATOM   5162  N  N   . THR B 1 147 ? 40.299  45.036  20.408  1.00 59.48 ? 150  THR B N   1 
ATOM   5163  C  CA  . THR B 1 147 ? 40.298  46.480  20.266  1.00 58.73 ? 150  THR B CA  1 
ATOM   5164  C  C   . THR B 1 147 ? 40.938  47.073  21.504  1.00 58.74 ? 150  THR B C   1 
ATOM   5165  O  O   . THR B 1 147 ? 40.791  46.530  22.595  1.00 58.72 ? 150  THR B O   1 
ATOM   5166  C  CB  . THR B 1 147 ? 38.888  47.027  20.120  1.00 58.49 ? 150  THR B CB  1 
ATOM   5167  O  OG1 . THR B 1 147 ? 38.911  48.433  20.369  1.00 58.25 ? 150  THR B OG1 1 
ATOM   5168  C  CG2 . THR B 1 147 ? 37.953  46.365  21.106  1.00 58.26 ? 150  THR B CG2 1 
ATOM   5169  N  N   . PRO B 1 148 ? 41.688  48.176  21.345  1.00 58.50 ? 151  PRO B N   1 
ATOM   5170  C  CA  . PRO B 1 148 ? 42.360  48.837  22.467  1.00 58.33 ? 151  PRO B CA  1 
ATOM   5171  C  C   . PRO B 1 148 ? 41.422  49.651  23.341  1.00 58.59 ? 151  PRO B C   1 
ATOM   5172  O  O   . PRO B 1 148 ? 41.779  50.030  24.457  1.00 58.46 ? 151  PRO B O   1 
ATOM   5173  C  CB  . PRO B 1 148 ? 43.353  49.747  21.761  1.00 58.28 ? 151  PRO B CB  1 
ATOM   5174  C  CG  . PRO B 1 148 ? 42.598  50.152  20.545  1.00 58.12 ? 151  PRO B CG  1 
ATOM   5175  C  CD  . PRO B 1 148 ? 42.030  48.842  20.077  1.00 58.37 ? 151  PRO B CD  1 
ATOM   5176  N  N   . ILE B 1 149 ? 40.206  49.867  22.856  1.00 58.61 ? 152  ILE B N   1 
ATOM   5177  C  CA  . ILE B 1 149 ? 39.223  50.672  23.571  1.00 58.63 ? 152  ILE B CA  1 
ATOM   5178  C  C   . ILE B 1 149 ? 37.850  50.008  23.660  1.00 58.99 ? 152  ILE B C   1 
ATOM   5179  O  O   . ILE B 1 149 ? 37.646  48.907  23.143  1.00 59.23 ? 152  ILE B O   1 
ATOM   5180  C  CB  . ILE B 1 149 ? 39.044  51.996  22.841  1.00 58.38 ? 152  ILE B CB  1 
ATOM   5181  C  CG1 . ILE B 1 149 ? 38.547  51.723  21.423  1.00 58.31 ? 152  ILE B CG1 1 
ATOM   5182  C  CG2 . ILE B 1 149 ? 40.366  52.709  22.738  1.00 58.29 ? 152  ILE B CG2 1 
ATOM   5183  C  CD1 . ILE B 1 149 ? 38.390  52.948  20.585  1.00 58.28 ? 152  ILE B CD1 1 
ATOM   5184  N  N   . PHE B 1 150 ? 36.896  50.711  24.268  1.00 59.08 ? 153  PHE B N   1 
ATOM   5185  C  CA  . PHE B 1 150 ? 35.534  50.199  24.412  1.00 59.24 ? 153  PHE B CA  1 
ATOM   5186  C  C   . PHE B 1 150 ? 34.531  51.341  24.226  1.00 59.07 ? 153  PHE B C   1 
ATOM   5187  O  O   . PHE B 1 150 ? 34.919  52.510  24.125  1.00 59.08 ? 153  PHE B O   1 
ATOM   5188  C  CB  . PHE B 1 150 ? 35.364  49.539  25.781  1.00 60.03 ? 153  PHE B CB  1 
ATOM   5189  C  CG  . PHE B 1 150 ? 34.279  48.492  25.836  1.00 60.64 ? 153  PHE B CG  1 
ATOM   5190  C  CD1 . PHE B 1 150 ? 33.167  48.666  26.658  1.00 60.68 ? 153  PHE B CD1 1 
ATOM   5191  C  CD2 . PHE B 1 150 ? 34.386  47.315  25.092  1.00 60.82 ? 153  PHE B CD2 1 
ATOM   5192  C  CE1 . PHE B 1 150 ? 32.180  47.685  26.741  1.00 60.93 ? 153  PHE B CE1 1 
ATOM   5193  C  CE2 . PHE B 1 150 ? 33.401  46.323  25.167  1.00 61.00 ? 153  PHE B CE2 1 
ATOM   5194  C  CZ  . PHE B 1 150 ? 32.296  46.509  25.994  1.00 60.99 ? 153  PHE B CZ  1 
ATOM   5195  N  N   . PHE B 1 151 ? 33.244  50.998  24.211  1.00 58.76 ? 154  PHE B N   1 
ATOM   5196  C  CA  . PHE B 1 151 ? 32.167  51.965  23.986  1.00 58.22 ? 154  PHE B CA  1 
ATOM   5197  C  C   . PHE B 1 151 ? 31.850  52.936  25.116  1.00 58.63 ? 154  PHE B C   1 
ATOM   5198  O  O   . PHE B 1 151 ? 31.344  54.038  24.871  1.00 58.68 ? 154  PHE B O   1 
ATOM   5199  C  CB  . PHE B 1 151 ? 30.882  51.230  23.618  1.00 57.16 ? 154  PHE B CB  1 
ATOM   5200  C  CG  . PHE B 1 151 ? 31.042  50.248  22.503  1.00 56.26 ? 154  PHE B CG  1 
ATOM   5201  C  CD1 . PHE B 1 151 ? 31.514  48.968  22.753  1.00 55.80 ? 154  PHE B CD1 1 
ATOM   5202  C  CD2 . PHE B 1 151 ? 30.695  50.593  21.208  1.00 55.73 ? 154  PHE B CD2 1 
ATOM   5203  C  CE1 . PHE B 1 151 ? 31.636  48.042  21.731  1.00 55.49 ? 154  PHE B CE1 1 
ATOM   5204  C  CE2 . PHE B 1 151 ? 30.814  49.676  20.181  1.00 55.47 ? 154  PHE B CE2 1 
ATOM   5205  C  CZ  . PHE B 1 151 ? 31.286  48.394  20.444  1.00 55.28 ? 154  PHE B CZ  1 
ATOM   5206  N  N   . ILE B 1 152 ? 32.102  52.523  26.351  1.00 58.69 ? 155  ILE B N   1 
ATOM   5207  C  CA  . ILE B 1 152 ? 31.806  53.370  27.499  1.00 58.98 ? 155  ILE B CA  1 
ATOM   5208  C  C   . ILE B 1 152 ? 32.980  53.447  28.466  1.00 58.99 ? 155  ILE B C   1 
ATOM   5209  O  O   . ILE B 1 152 ? 33.901  52.633  28.395  1.00 59.04 ? 155  ILE B O   1 
ATOM   5210  C  CB  . ILE B 1 152 ? 30.575  52.851  28.244  1.00 59.07 ? 155  ILE B CB  1 
ATOM   5211  C  CG1 . ILE B 1 152 ? 30.748  51.359  28.550  1.00 59.45 ? 155  ILE B CG1 1 
ATOM   5212  C  CG2 . ILE B 1 152 ? 29.335  53.099  27.417  1.00 59.29 ? 155  ILE B CG2 1 
ATOM   5213  C  CD1 . ILE B 1 152 ? 29.569  50.710  29.236  1.00 59.66 ? 155  ILE B CD1 1 
ATOM   5214  N  N   . ARG B 1 153 ? 32.931  54.411  29.382  1.00 58.91 ? 156  ARG B N   1 
ATOM   5215  C  CA  . ARG B 1 153 ? 34.006  54.596  30.346  1.00 58.72 ? 156  ARG B CA  1 
ATOM   5216  C  C   . ARG B 1 153 ? 33.612  54.372  31.804  1.00 58.81 ? 156  ARG B C   1 
ATOM   5217  O  O   . ARG B 1 153 ? 34.426  54.584  32.702  1.00 59.11 ? 156  ARG B O   1 
ATOM   5218  C  CB  . ARG B 1 153 ? 34.644  55.985  30.172  1.00 58.37 ? 156  ARG B CB  1 
ATOM   5219  C  CG  . ARG B 1 153 ? 33.673  57.144  30.260  1.00 57.80 ? 156  ARG B CG  1 
ATOM   5220  C  CD  . ARG B 1 153 ? 34.388  58.466  30.090  1.00 57.36 ? 156  ARG B CD  1 
ATOM   5221  N  NE  . ARG B 1 153 ? 34.937  58.628  28.747  1.00 57.35 ? 156  ARG B NE  1 
ATOM   5222  C  CZ  . ARG B 1 153 ? 34.486  59.506  27.855  1.00 57.33 ? 156  ARG B CZ  1 
ATOM   5223  N  NH1 . ARG B 1 153 ? 33.472  60.309  28.156  1.00 56.90 ? 156  ARG B NH1 1 
ATOM   5224  N  NH2 . ARG B 1 153 ? 35.067  59.599  26.665  1.00 57.37 ? 156  ARG B NH2 1 
ATOM   5225  N  N   . ASP B 1 154 ? 32.382  53.935  32.048  1.00 58.72 ? 157  ASP B N   1 
ATOM   5226  C  CA  . ASP B 1 154 ? 31.934  53.690  33.415  1.00 58.75 ? 157  ASP B CA  1 
ATOM   5227  C  C   . ASP B 1 154 ? 31.201  52.358  33.437  1.00 58.68 ? 157  ASP B C   1 
ATOM   5228  O  O   . ASP B 1 154 ? 30.257  52.153  32.681  1.00 58.90 ? 157  ASP B O   1 
ATOM   5229  C  CB  . ASP B 1 154 ? 31.025  54.819  33.898  1.00 59.18 ? 157  ASP B CB  1 
ATOM   5230  C  CG  . ASP B 1 154 ? 30.763  54.755  35.390  1.00 59.69 ? 157  ASP B CG  1 
ATOM   5231  O  OD1 . ASP B 1 154 ? 31.118  55.721  36.102  1.00 59.65 ? 157  ASP B OD1 1 
ATOM   5232  O  OD2 . ASP B 1 154 ? 30.202  53.738  35.855  1.00 60.50 ? 157  ASP B OD2 1 
ATOM   5233  N  N   . PRO B 1 155 ? 31.586  51.463  34.354  1.00 58.39 ? 158  PRO B N   1 
ATOM   5234  C  CA  . PRO B 1 155 ? 30.988  50.138  34.490  1.00 58.42 ? 158  PRO B CA  1 
ATOM   5235  C  C   . PRO B 1 155 ? 29.486  50.149  34.651  1.00 58.66 ? 158  PRO B C   1 
ATOM   5236  O  O   . PRO B 1 155 ? 28.792  49.299  34.096  1.00 59.25 ? 158  PRO B O   1 
ATOM   5237  C  CB  . PRO B 1 155 ? 31.635  49.600  35.762  1.00 58.14 ? 158  PRO B CB  1 
ATOM   5238  C  CG  . PRO B 1 155 ? 32.896  50.324  35.853  1.00 57.95 ? 158  PRO B CG  1 
ATOM   5239  C  CD  . PRO B 1 155 ? 32.522  51.711  35.460  1.00 58.06 ? 158  PRO B CD  1 
ATOM   5240  N  N   . ILE B 1 156 ? 28.976  51.125  35.391  1.00 58.68 ? 159  ILE B N   1 
ATOM   5241  C  CA  . ILE B 1 156 ? 27.546  51.187  35.646  1.00 58.54 ? 159  ILE B CA  1 
ATOM   5242  C  C   . ILE B 1 156 ? 26.672  51.270  34.390  1.00 58.79 ? 159  ILE B C   1 
ATOM   5243  O  O   . ILE B 1 156 ? 25.462  51.052  34.452  1.00 58.93 ? 159  ILE B O   1 
ATOM   5244  C  CB  . ILE B 1 156 ? 27.209  52.296  36.662  1.00 57.86 ? 159  ILE B CB  1 
ATOM   5245  C  CG1 . ILE B 1 156 ? 25.991  51.888  37.485  1.00 57.31 ? 159  ILE B CG1 1 
ATOM   5246  C  CG2 . ILE B 1 156 ? 26.952  53.615  35.960  1.00 57.91 ? 159  ILE B CG2 1 
ATOM   5247  C  CD1 . ILE B 1 156 ? 25.780  52.743  38.711  1.00 56.64 ? 159  ILE B CD1 1 
ATOM   5248  N  N   . LEU B 1 157 ? 27.282  51.560  33.248  1.00 58.84 ? 160  LEU B N   1 
ATOM   5249  C  CA  . LEU B 1 157 ? 26.524  51.631  32.009  1.00 59.20 ? 160  LEU B CA  1 
ATOM   5250  C  C   . LEU B 1 157 ? 26.591  50.335  31.219  1.00 59.79 ? 160  LEU B C   1 
ATOM   5251  O  O   . LEU B 1 157 ? 25.800  50.121  30.293  1.00 60.52 ? 160  LEU B O   1 
ATOM   5252  C  CB  . LEU B 1 157 ? 27.024  52.763  31.126  1.00 58.68 ? 160  LEU B CB  1 
ATOM   5253  C  CG  . LEU B 1 157 ? 26.464  54.138  31.464  1.00 58.58 ? 160  LEU B CG  1 
ATOM   5254  C  CD1 . LEU B 1 157 ? 27.399  54.830  32.433  1.00 58.59 ? 160  LEU B CD1 1 
ATOM   5255  C  CD2 . LEU B 1 157 ? 26.326  54.959  30.198  1.00 57.83 ? 160  LEU B CD2 1 
ATOM   5256  N  N   . PHE B 1 158 ? 27.526  49.465  31.590  1.00 59.65 ? 161  PHE B N   1 
ATOM   5257  C  CA  . PHE B 1 158 ? 27.719  48.202  30.895  1.00 59.04 ? 161  PHE B CA  1 
ATOM   5258  C  C   . PHE B 1 158 ? 26.453  47.368  30.696  1.00 58.99 ? 161  PHE B C   1 
ATOM   5259  O  O   . PHE B 1 158 ? 26.129  46.987  29.562  1.00 59.41 ? 161  PHE B O   1 
ATOM   5260  C  CB  . PHE B 1 158 ? 28.792  47.378  31.592  1.00 59.13 ? 161  PHE B CB  1 
ATOM   5261  C  CG  . PHE B 1 158 ? 29.255  46.205  30.790  1.00 59.26 ? 161  PHE B CG  1 
ATOM   5262  C  CD1 . PHE B 1 158 ? 28.891  44.910  31.145  1.00 59.51 ? 161  PHE B CD1 1 
ATOM   5263  C  CD2 . PHE B 1 158 ? 30.045  46.396  29.662  1.00 59.27 ? 161  PHE B CD2 1 
ATOM   5264  C  CE1 . PHE B 1 158 ? 29.307  43.819  30.384  1.00 59.40 ? 161  PHE B CE1 1 
ATOM   5265  C  CE2 . PHE B 1 158 ? 30.468  45.319  28.892  1.00 59.04 ? 161  PHE B CE2 1 
ATOM   5266  C  CZ  . PHE B 1 158 ? 30.100  44.027  29.252  1.00 59.39 ? 161  PHE B CZ  1 
ATOM   5267  N  N   . PRO B 1 159 ? 25.711  47.080  31.782  1.00 58.44 ? 162  PRO B N   1 
ATOM   5268  C  CA  . PRO B 1 159 ? 24.487  46.285  31.648  1.00 58.17 ? 162  PRO B CA  1 
ATOM   5269  C  C   . PRO B 1 159 ? 23.577  46.881  30.593  1.00 58.01 ? 162  PRO B C   1 
ATOM   5270  O  O   . PRO B 1 159 ? 23.152  46.199  29.658  1.00 58.63 ? 162  PRO B O   1 
ATOM   5271  C  CB  . PRO B 1 159 ? 23.864  46.395  33.035  1.00 57.90 ? 162  PRO B CB  1 
ATOM   5272  C  CG  . PRO B 1 159 ? 25.061  46.458  33.920  1.00 57.63 ? 162  PRO B CG  1 
ATOM   5273  C  CD  . PRO B 1 159 ? 25.928  47.452  33.193  1.00 58.23 ? 162  PRO B CD  1 
ATOM   5274  N  N   . SER B 1 160 ? 23.353  48.182  30.706  1.00 57.82 ? 163  SER B N   1 
ATOM   5275  C  CA  . SER B 1 160 ? 22.499  48.882  29.770  1.00 57.53 ? 163  SER B CA  1 
ATOM   5276  C  C   . SER B 1 160 ? 23.008  48.703  28.346  1.00 57.26 ? 163  SER B C   1 
ATOM   5277  O  O   . SER B 1 160 ? 22.264  48.297  27.444  1.00 57.19 ? 163  SER B O   1 
ATOM   5278  C  CB  . SER B 1 160 ? 22.459  50.365  30.125  1.00 57.76 ? 163  SER B CB  1 
ATOM   5279  O  OG  . SER B 1 160 ? 21.846  50.578  31.384  1.00 58.18 ? 163  SER B OG  1 
ATOM   5280  N  N   . PHE B 1 161 ? 24.292  48.982  28.157  1.00 57.06 ? 164  PHE B N   1 
ATOM   5281  C  CA  . PHE B 1 161 ? 24.895  48.863  26.846  1.00 57.05 ? 164  PHE B CA  1 
ATOM   5282  C  C   . PHE B 1 161 ? 24.628  47.490  26.295  1.00 57.34 ? 164  PHE B C   1 
ATOM   5283  O  O   . PHE B 1 161 ? 24.120  47.331  25.188  1.00 57.55 ? 164  PHE B O   1 
ATOM   5284  C  CB  . PHE B 1 161 ? 26.398  49.074  26.921  1.00 56.56 ? 164  PHE B CB  1 
ATOM   5285  C  CG  . PHE B 1 161 ? 27.097  48.761  25.641  1.00 55.87 ? 164  PHE B CG  1 
ATOM   5286  C  CD1 . PHE B 1 161 ? 28.162  47.877  25.614  1.00 55.63 ? 164  PHE B CD1 1 
ATOM   5287  C  CD2 . PHE B 1 161 ? 26.648  49.308  24.449  1.00 55.66 ? 164  PHE B CD2 1 
ATOM   5288  C  CE1 . PHE B 1 161 ? 28.769  47.535  24.411  1.00 55.47 ? 164  PHE B CE1 1 
ATOM   5289  C  CE2 . PHE B 1 161 ? 27.243  48.978  23.246  1.00 55.66 ? 164  PHE B CE2 1 
ATOM   5290  C  CZ  . PHE B 1 161 ? 28.307  48.087  23.226  1.00 55.59 ? 164  PHE B CZ  1 
ATOM   5291  N  N   . ILE B 1 162 ? 24.957  46.487  27.086  1.00 57.55 ? 165  ILE B N   1 
ATOM   5292  C  CA  . ILE B 1 162 ? 24.748  45.127  26.648  1.00 57.75 ? 165  ILE B CA  1 
ATOM   5293  C  C   . ILE B 1 162 ? 23.295  44.876  26.265  1.00 58.32 ? 165  ILE B C   1 
ATOM   5294  O  O   . ILE B 1 162 ? 23.022  44.300  25.206  1.00 58.77 ? 165  ILE B O   1 
ATOM   5295  C  CB  . ILE B 1 162 ? 25.221  44.141  27.708  1.00 57.19 ? 165  ILE B CB  1 
ATOM   5296  C  CG1 . ILE B 1 162 ? 26.736  44.260  27.852  1.00 56.63 ? 165  ILE B CG1 1 
ATOM   5297  C  CG2 . ILE B 1 162 ? 24.839  42.716  27.327  1.00 57.37 ? 165  ILE B CG2 1 
ATOM   5298  C  CD1 . ILE B 1 162 ? 27.494  44.008  26.557  1.00 55.72 ? 165  ILE B CD1 1 
ATOM   5299  N  N   . HIS B 1 163 ? 22.367  45.347  27.097  1.00 58.55 ? 166  HIS B N   1 
ATOM   5300  C  CA  . HIS B 1 163 ? 20.946  45.174  26.820  1.00 58.54 ? 166  HIS B CA  1 
ATOM   5301  C  C   . HIS B 1 163 ? 20.594  45.785  25.481  1.00 58.81 ? 166  HIS B C   1 
ATOM   5302  O  O   . HIS B 1 163 ? 19.904  45.166  24.676  1.00 59.32 ? 166  HIS B O   1 
ATOM   5303  C  CB  . HIS B 1 163 ? 20.097  45.830  27.899  1.00 58.39 ? 166  HIS B CB  1 
ATOM   5304  C  CG  . HIS B 1 163 ? 20.026  45.051  29.169  1.00 57.80 ? 166  HIS B CG  1 
ATOM   5305  N  ND1 . HIS B 1 163 ? 19.310  45.479  30.265  1.00 57.42 ? 166  HIS B ND1 1 
ATOM   5306  C  CD2 . HIS B 1 163 ? 20.580  43.864  29.521  1.00 57.79 ? 166  HIS B CD2 1 
ATOM   5307  C  CE1 . HIS B 1 163 ? 19.425  44.594  31.238  1.00 57.53 ? 166  HIS B CE1 1 
ATOM   5308  N  NE2 . HIS B 1 163 ? 20.190  43.603  30.811  1.00 57.48 ? 166  HIS B NE2 1 
ATOM   5309  N  N   . SER B 1 164 ? 21.094  46.990  25.230  1.00 58.73 ? 167  SER B N   1 
ATOM   5310  C  CA  . SER B 1 164 ? 20.811  47.669  23.973  1.00 58.52 ? 167  SER B CA  1 
ATOM   5311  C  C   . SER B 1 164 ? 21.387  46.890  22.807  1.00 58.56 ? 167  SER B C   1 
ATOM   5312  O  O   . SER B 1 164 ? 20.933  47.027  21.678  1.00 58.57 ? 167  SER B O   1 
ATOM   5313  C  CB  . SER B 1 164 ? 21.408  49.070  23.976  1.00 58.48 ? 167  SER B CB  1 
ATOM   5314  O  OG  . SER B 1 164 ? 22.812  49.010  23.807  1.00 58.95 ? 167  SER B OG  1 
ATOM   5315  N  N   . GLN B 1 165 ? 22.407  46.089  23.079  1.00 58.73 ? 168  GLN B N   1 
ATOM   5316  C  CA  . GLN B 1 165 ? 23.046  45.304  22.038  1.00 58.80 ? 168  GLN B CA  1 
ATOM   5317  C  C   . GLN B 1 165 ? 22.420  43.932  21.838  1.00 58.74 ? 168  GLN B C   1 
ATOM   5318  O  O   . GLN B 1 165 ? 22.716  43.239  20.861  1.00 58.83 ? 168  GLN B O   1 
ATOM   5319  C  CB  . GLN B 1 165 ? 24.524  45.161  22.355  1.00 59.13 ? 168  GLN B CB  1 
ATOM   5320  C  CG  . GLN B 1 165 ? 25.292  46.463  22.250  1.00 59.58 ? 168  GLN B CG  1 
ATOM   5321  C  CD  . GLN B 1 165 ? 25.569  46.871  20.811  1.00 59.86 ? 168  GLN B CD  1 
ATOM   5322  O  OE1 . GLN B 1 165 ? 25.213  47.974  20.387  1.00 60.80 ? 168  GLN B OE1 1 
ATOM   5323  N  NE2 . GLN B 1 165 ? 26.230  45.992  20.062  1.00 59.07 ? 168  GLN B NE2 1 
ATOM   5324  N  N   . LYS B 1 166 ? 21.560  43.522  22.759  1.00 58.78 ? 169  LYS B N   1 
ATOM   5325  C  CA  . LYS B 1 166 ? 20.930  42.223  22.612  1.00 58.83 ? 169  LYS B CA  1 
ATOM   5326  C  C   . LYS B 1 166 ? 19.501  42.269  22.067  1.00 59.01 ? 169  LYS B C   1 
ATOM   5327  O  O   . LYS B 1 166 ? 19.215  43.061  21.174  1.00 59.33 ? 169  LYS B O   1 
ATOM   5328  C  CB  . LYS B 1 166 ? 21.066  41.425  23.900  1.00 58.76 ? 169  LYS B CB  1 
ATOM   5329  C  CG  . LYS B 1 166 ? 22.466  40.841  24.043  1.00 58.63 ? 169  LYS B CG  1 
ATOM   5330  C  CD  . LYS B 1 166 ? 22.760  40.404  25.456  1.00 58.47 ? 169  LYS B CD  1 
ATOM   5331  C  CE  . LYS B 1 166 ? 24.092  39.684  25.533  1.00 58.30 ? 169  LYS B CE  1 
ATOM   5332  N  NZ  . LYS B 1 166 ? 24.025  38.348  24.872  1.00 58.36 ? 169  LYS B NZ  1 
ATOM   5333  N  N   . ARG B 1 167 ? 18.608  41.425  22.569  1.00 58.79 ? 170  ARG B N   1 
ATOM   5334  C  CA  . ARG B 1 167 ? 17.249  41.402  22.044  1.00 58.49 ? 170  ARG B CA  1 
ATOM   5335  C  C   . ARG B 1 167 ? 16.276  42.305  22.761  1.00 58.86 ? 170  ARG B C   1 
ATOM   5336  O  O   . ARG B 1 167 ? 16.445  42.605  23.938  1.00 59.09 ? 170  ARG B O   1 
ATOM   5337  C  CB  . ARG B 1 167 ? 16.717  39.977  22.051  1.00 58.10 ? 170  ARG B CB  1 
ATOM   5338  C  CG  . ARG B 1 167 ? 17.544  39.021  21.214  1.00 57.61 ? 170  ARG B CG  1 
ATOM   5339  C  CD  . ARG B 1 167 ? 17.241  37.574  21.559  1.00 56.68 ? 170  ARG B CD  1 
ATOM   5340  N  NE  . ARG B 1 167 ? 18.145  36.666  20.867  1.00 56.33 ? 170  ARG B NE  1 
ATOM   5341  C  CZ  . ARG B 1 167 ? 17.957  36.233  19.623  1.00 56.01 ? 170  ARG B CZ  1 
ATOM   5342  N  NH1 . ARG B 1 167 ? 16.884  36.618  18.941  1.00 55.67 ? 170  ARG B NH1 1 
ATOM   5343  N  NH2 . ARG B 1 167 ? 18.870  35.463  19.041  1.00 55.65 ? 170  ARG B NH2 1 
ATOM   5344  N  N   . ASN B 1 168 ? 15.253  42.741  22.034  1.00 59.17 ? 171  ASN B N   1 
ATOM   5345  C  CA  . ASN B 1 168 ? 14.210  43.599  22.586  1.00 59.28 ? 171  ASN B CA  1 
ATOM   5346  C  C   . ASN B 1 168 ? 13.520  42.753  23.636  1.00 59.34 ? 171  ASN B C   1 
ATOM   5347  O  O   . ASN B 1 168 ? 13.223  41.590  23.396  1.00 59.69 ? 171  ASN B O   1 
ATOM   5348  C  CB  . ASN B 1 168 ? 13.221  43.982  21.480  1.00 59.48 ? 171  ASN B CB  1 
ATOM   5349  C  CG  . ASN B 1 168 ? 12.031  44.765  21.991  1.00 59.73 ? 171  ASN B CG  1 
ATOM   5350  O  OD1 . ASN B 1 168 ? 11.109  44.202  22.584  1.00 60.30 ? 171  ASN B OD1 1 
ATOM   5351  N  ND2 . ASN B 1 168 ? 12.024  46.066  21.732  1.00 59.58 ? 171  ASN B ND2 1 
ATOM   5352  N  N   . PRO B 1 169 ? 13.250  43.323  24.808  1.00 59.39 ? 172  PRO B N   1 
ATOM   5353  C  CA  . PRO B 1 169 ? 12.589  42.580  25.884  1.00 59.84 ? 172  PRO B CA  1 
ATOM   5354  C  C   . PRO B 1 169 ? 11.238  41.940  25.543  1.00 60.54 ? 172  PRO B C   1 
ATOM   5355  O  O   . PRO B 1 169 ? 10.885  40.902  26.103  1.00 60.91 ? 172  PRO B O   1 
ATOM   5356  C  CB  . PRO B 1 169 ? 12.471  43.626  26.995  1.00 59.58 ? 172  PRO B CB  1 
ATOM   5357  C  CG  . PRO B 1 169 ? 12.454  44.933  26.245  1.00 59.11 ? 172  PRO B CG  1 
ATOM   5358  C  CD  . PRO B 1 169 ? 13.510  44.712  25.213  1.00 59.23 ? 172  PRO B CD  1 
ATOM   5359  N  N   . GLN B 1 170 ? 10.486  42.525  24.617  1.00 61.19 ? 173  GLN B N   1 
ATOM   5360  C  CA  . GLN B 1 170 ? 9.190   41.953  24.280  1.00 61.58 ? 173  GLN B CA  1 
ATOM   5361  C  C   . GLN B 1 170 ? 9.165   41.118  23.012  1.00 61.83 ? 173  GLN B C   1 
ATOM   5362  O  O   . GLN B 1 170 ? 8.636   40.004  23.012  1.00 62.23 ? 173  GLN B O   1 
ATOM   5363  C  CB  . GLN B 1 170 ? 8.121   43.031  24.191  1.00 61.55 ? 173  GLN B CB  1 
ATOM   5364  C  CG  . GLN B 1 170 ? 6.761   42.457  23.853  1.00 61.46 ? 173  GLN B CG  1 
ATOM   5365  C  CD  . GLN B 1 170 ? 5.642   43.453  24.010  1.00 61.49 ? 173  GLN B CD  1 
ATOM   5366  O  OE1 . GLN B 1 170 ? 5.862   44.617  24.358  1.00 61.40 ? 173  GLN B OE1 1 
ATOM   5367  N  NE2 . GLN B 1 170 ? 4.420   42.999  23.761  1.00 61.19 ? 173  GLN B NE2 1 
ATOM   5368  N  N   . THR B 1 171 ? 9.714   41.665  21.930  1.00 61.75 ? 174  THR B N   1 
ATOM   5369  C  CA  . THR B 1 171 ? 9.742   40.976  20.640  1.00 61.47 ? 174  THR B CA  1 
ATOM   5370  C  C   . THR B 1 171 ? 10.846  39.937  20.536  1.00 61.96 ? 174  THR B C   1 
ATOM   5371  O  O   . THR B 1 171 ? 10.809  39.063  19.667  1.00 62.26 ? 174  THR B O   1 
ATOM   5372  C  CB  . THR B 1 171 ? 9.970   41.955  19.518  1.00 61.02 ? 174  THR B CB  1 
ATOM   5373  O  OG1 . THR B 1 171 ? 11.274  42.530  19.668  1.00 60.51 ? 174  THR B OG1 1 
ATOM   5374  C  CG2 . THR B 1 171 ? 8.921   43.039  19.556  1.00 60.26 ? 174  THR B CG2 1 
ATOM   5375  N  N   . HIS B 1 172 ? 11.863  40.091  21.376  1.00 62.08 ? 175  HIS B N   1 
ATOM   5376  C  CA  . HIS B 1 172 ? 13.000  39.183  21.404  1.00 62.06 ? 175  HIS B CA  1 
ATOM   5377  C  C   . HIS B 1 172 ? 13.786  39.265  20.112  1.00 61.81 ? 175  HIS B C   1 
ATOM   5378  O  O   . HIS B 1 172 ? 14.490  38.331  19.736  1.00 61.89 ? 175  HIS B O   1 
ATOM   5379  C  CB  . HIS B 1 172 ? 12.537  37.753  21.633  1.00 62.50 ? 175  HIS B CB  1 
ATOM   5380  C  CG  . HIS B 1 172 ? 13.605  36.860  22.174  1.00 63.23 ? 175  HIS B CG  1 
ATOM   5381  N  ND1 . HIS B 1 172 ? 14.160  37.041  23.422  1.00 63.43 ? 175  HIS B ND1 1 
ATOM   5382  C  CD2 . HIS B 1 172 ? 14.220  35.779  21.641  1.00 63.59 ? 175  HIS B CD2 1 
ATOM   5383  C  CE1 . HIS B 1 172 ? 15.072  36.109  23.636  1.00 63.74 ? 175  HIS B CE1 1 
ATOM   5384  N  NE2 . HIS B 1 172 ? 15.129  35.330  22.570  1.00 63.68 ? 175  HIS B NE2 1 
ATOM   5385  N  N   . LEU B 1 173 ? 13.649  40.392  19.429  1.00 61.42 ? 176  LEU B N   1 
ATOM   5386  C  CA  . LEU B 1 173 ? 14.354  40.612  18.185  1.00 61.10 ? 176  LEU B CA  1 
ATOM   5387  C  C   . LEU B 1 173 ? 15.449  41.629  18.440  1.00 61.38 ? 176  LEU B C   1 
ATOM   5388  O  O   . LEU B 1 173 ? 15.385  42.381  19.410  1.00 61.55 ? 176  LEU B O   1 
ATOM   5389  C  CB  . LEU B 1 173 ? 13.385  41.155  17.141  1.00 60.38 ? 176  LEU B CB  1 
ATOM   5390  C  CG  . LEU B 1 173 ? 12.221  40.233  16.798  1.00 59.68 ? 176  LEU B CG  1 
ATOM   5391  C  CD1 . LEU B 1 173 ? 11.235  40.942  15.909  1.00 59.35 ? 176  LEU B CD1 1 
ATOM   5392  C  CD2 . LEU B 1 173 ? 12.743  39.003  16.107  1.00 59.38 ? 176  LEU B CD2 1 
ATOM   5393  N  N   . LYS B 1 174 ? 16.482  41.620  17.607  1.00 61.62 ? 177  LYS B N   1 
ATOM   5394  C  CA  . LYS B 1 174 ? 17.554  42.595  17.739  1.00 61.83 ? 177  LYS B CA  1 
ATOM   5395  C  C   . LYS B 1 174 ? 16.875  43.938  17.492  1.00 62.11 ? 177  LYS B C   1 
ATOM   5396  O  O   . LYS B 1 174 ? 15.887  44.004  16.769  1.00 61.87 ? 177  LYS B O   1 
ATOM   5397  C  CB  . LYS B 1 174 ? 18.630  42.343  16.689  1.00 62.05 ? 177  LYS B CB  1 
ATOM   5398  C  CG  . LYS B 1 174 ? 19.427  41.081  16.926  1.00 62.05 ? 177  LYS B CG  1 
ATOM   5399  C  CD  . LYS B 1 174 ? 20.056  41.115  18.304  1.00 62.43 ? 177  LYS B CD  1 
ATOM   5400  C  CE  . LYS B 1 174 ? 21.348  40.333  18.324  1.00 62.74 ? 177  LYS B CE  1 
ATOM   5401  N  NZ  . LYS B 1 174 ? 21.116  38.943  17.870  1.00 62.97 ? 177  LYS B NZ  1 
ATOM   5402  N  N   . ASP B 1 175 ? 17.385  45.013  18.077  1.00 62.54 ? 178  ASP B N   1 
ATOM   5403  C  CA  . ASP B 1 175 ? 16.719  46.290  17.898  1.00 62.93 ? 178  ASP B CA  1 
ATOM   5404  C  C   . ASP B 1 175 ? 17.603  47.485  17.615  1.00 62.94 ? 178  ASP B C   1 
ATOM   5405  O  O   . ASP B 1 175 ? 18.161  48.098  18.526  1.00 63.30 ? 178  ASP B O   1 
ATOM   5406  C  CB  . ASP B 1 175 ? 15.851  46.585  19.114  1.00 63.14 ? 178  ASP B CB  1 
ATOM   5407  C  CG  . ASP B 1 175 ? 14.730  47.530  18.799  1.00 63.74 ? 178  ASP B CG  1 
ATOM   5408  O  OD1 . ASP B 1 175 ? 14.849  48.288  17.811  1.00 64.18 ? 178  ASP B OD1 1 
ATOM   5409  O  OD2 . ASP B 1 175 ? 13.715  47.497  19.527  1.00 64.11 ? 178  ASP B OD2 1 
ATOM   5410  N  N   . PRO B 1 176 ? 17.673  47.886  16.342  1.00 62.94 ? 179  PRO B N   1 
ATOM   5411  C  CA  . PRO B 1 176 ? 18.484  49.029  15.917  1.00 62.76 ? 179  PRO B CA  1 
ATOM   5412  C  C   . PRO B 1 176 ? 18.117  50.333  16.628  1.00 62.53 ? 179  PRO B C   1 
ATOM   5413  O  O   . PRO B 1 176 ? 18.938  51.243  16.728  1.00 62.52 ? 179  PRO B O   1 
ATOM   5414  C  CB  . PRO B 1 176 ? 18.236  49.084  14.404  1.00 62.85 ? 179  PRO B CB  1 
ATOM   5415  C  CG  . PRO B 1 176 ? 16.937  48.345  14.215  1.00 63.16 ? 179  PRO B CG  1 
ATOM   5416  C  CD  . PRO B 1 176 ? 17.050  47.220  15.187  1.00 62.95 ? 179  PRO B CD  1 
ATOM   5417  N  N   . ASP B 1 177 ? 16.891  50.419  17.130  1.00 62.19 ? 180  ASP B N   1 
ATOM   5418  C  CA  . ASP B 1 177 ? 16.464  51.608  17.856  1.00 61.89 ? 180  ASP B CA  1 
ATOM   5419  C  C   . ASP B 1 177 ? 17.192  51.626  19.195  1.00 61.64 ? 180  ASP B C   1 
ATOM   5420  O  O   . ASP B 1 177 ? 17.699  52.654  19.635  1.00 61.57 ? 180  ASP B O   1 
ATOM   5421  C  CB  . ASP B 1 177 ? 14.954  51.576  18.108  1.00 62.44 ? 180  ASP B CB  1 
ATOM   5422  C  CG  . ASP B 1 177 ? 14.168  52.454  17.141  1.00 62.73 ? 180  ASP B CG  1 
ATOM   5423  O  OD1 . ASP B 1 177 ? 13.011  52.814  17.464  1.00 62.82 ? 180  ASP B OD1 1 
ATOM   5424  O  OD2 . ASP B 1 177 ? 14.697  52.785  16.059  1.00 63.28 ? 180  ASP B OD2 1 
ATOM   5425  N  N   . MET B 1 178 ? 17.219  50.473  19.847  1.00 61.09 ? 181  MET B N   1 
ATOM   5426  C  CA  . MET B 1 178 ? 17.885  50.333  21.125  1.00 60.67 ? 181  MET B CA  1 
ATOM   5427  C  C   . MET B 1 178 ? 19.370  50.614  20.968  1.00 60.65 ? 181  MET B C   1 
ATOM   5428  O  O   . MET B 1 178 ? 19.933  51.440  21.685  1.00 60.73 ? 181  MET B O   1 
ATOM   5429  C  CB  . MET B 1 178 ? 17.680  48.917  21.651  1.00 60.70 ? 181  MET B CB  1 
ATOM   5430  C  CG  . MET B 1 178 ? 16.241  48.609  22.008  1.00 60.56 ? 181  MET B CG  1 
ATOM   5431  S  SD  . MET B 1 178 ? 15.994  46.901  22.461  1.00 61.07 ? 181  MET B SD  1 
ATOM   5432  C  CE  . MET B 1 178 ? 16.971  46.830  23.955  1.00 60.77 ? 181  MET B CE  1 
ATOM   5433  N  N   . VAL B 1 179 ? 19.993  49.939  20.010  1.00 60.70 ? 182  VAL B N   1 
ATOM   5434  C  CA  . VAL B 1 179 ? 21.421  50.101  19.745  1.00 60.75 ? 182  VAL B CA  1 
ATOM   5435  C  C   . VAL B 1 179 ? 21.832  51.553  19.535  1.00 61.02 ? 182  VAL B C   1 
ATOM   5436  O  O   . VAL B 1 179 ? 22.733  52.064  20.207  1.00 60.89 ? 182  VAL B O   1 
ATOM   5437  C  CB  . VAL B 1 179 ? 21.847  49.300  18.490  1.00 60.68 ? 182  VAL B CB  1 
ATOM   5438  C  CG1 . VAL B 1 179 ? 23.295  49.591  18.136  1.00 60.02 ? 182  VAL B CG1 1 
ATOM   5439  C  CG2 . VAL B 1 179 ? 21.655  47.814  18.726  1.00 60.62 ? 182  VAL B CG2 1 
ATOM   5440  N  N   . TRP B 1 180 ? 21.150  52.218  18.612  1.00 61.23 ? 183  TRP B N   1 
ATOM   5441  C  CA  . TRP B 1 180 ? 21.465  53.593  18.285  1.00 61.46 ? 183  TRP B CA  1 
ATOM   5442  C  C   . TRP B 1 180 ? 20.972  54.644  19.238  1.00 61.34 ? 183  TRP B C   1 
ATOM   5443  O  O   . TRP B 1 180 ? 21.553  55.725  19.316  1.00 61.58 ? 183  TRP B O   1 
ATOM   5444  C  CB  . TRP B 1 180 ? 21.042  53.896  16.858  1.00 61.89 ? 183  TRP B CB  1 
ATOM   5445  C  CG  . TRP B 1 180 ? 21.955  53.223  15.928  1.00 62.23 ? 183  TRP B CG  1 
ATOM   5446  C  CD1 . TRP B 1 180 ? 21.732  52.059  15.252  1.00 62.34 ? 183  TRP B CD1 1 
ATOM   5447  C  CD2 . TRP B 1 180 ? 23.307  53.589  15.666  1.00 62.49 ? 183  TRP B CD2 1 
ATOM   5448  N  NE1 . TRP B 1 180 ? 22.873  51.665  14.599  1.00 62.41 ? 183  TRP B NE1 1 
ATOM   5449  C  CE2 . TRP B 1 180 ? 23.857  52.590  14.837  1.00 62.58 ? 183  TRP B CE2 1 
ATOM   5450  C  CE3 . TRP B 1 180 ? 24.117  54.664  16.064  1.00 62.66 ? 183  TRP B CE3 1 
ATOM   5451  C  CZ2 . TRP B 1 180 ? 25.185  52.628  14.397  1.00 62.66 ? 183  TRP B CZ2 1 
ATOM   5452  C  CZ3 . TRP B 1 180 ? 25.440  54.705  15.626  1.00 62.52 ? 183  TRP B CZ3 1 
ATOM   5453  C  CH2 . TRP B 1 180 ? 25.959  53.690  14.800  1.00 62.51 ? 183  TRP B CH2 1 
ATOM   5454  N  N   . ASP B 1 181 ? 19.903  54.352  19.966  1.00 61.05 ? 184  ASP B N   1 
ATOM   5455  C  CA  . ASP B 1 181 ? 19.411  55.330  20.919  1.00 60.79 ? 184  ASP B CA  1 
ATOM   5456  C  C   . ASP B 1 181 ? 20.484  55.474  21.987  1.00 60.59 ? 184  ASP B C   1 
ATOM   5457  O  O   . ASP B 1 181 ? 20.866  56.583  22.350  1.00 61.03 ? 184  ASP B O   1 
ATOM   5458  C  CB  . ASP B 1 181 ? 18.099  54.883  21.556  1.00 60.91 ? 184  ASP B CB  1 
ATOM   5459  C  CG  . ASP B 1 181 ? 17.465  55.974  22.394  1.00 60.99 ? 184  ASP B CG  1 
ATOM   5460  O  OD1 . ASP B 1 181 ? 17.536  57.150  21.981  1.00 61.45 ? 184  ASP B OD1 1 
ATOM   5461  O  OD2 . ASP B 1 181 ? 16.906  55.667  23.466  1.00 60.63 ? 184  ASP B OD2 1 
ATOM   5462  N  N   . PHE B 1 182 ? 21.011  54.345  22.447  1.00 59.94 ? 185  PHE B N   1 
ATOM   5463  C  CA  . PHE B 1 182 ? 22.054  54.352  23.464  1.00 59.19 ? 185  PHE B CA  1 
ATOM   5464  C  C   . PHE B 1 182 ? 23.291  55.079  22.955  1.00 59.27 ? 185  PHE B C   1 
ATOM   5465  O  O   . PHE B 1 182 ? 23.764  56.037  23.568  1.00 59.14 ? 185  PHE B O   1 
ATOM   5466  C  CB  . PHE B 1 182 ? 22.431  52.922  23.828  1.00 58.66 ? 185  PHE B CB  1 
ATOM   5467  C  CG  . PHE B 1 182 ? 23.426  52.826  24.944  1.00 57.79 ? 185  PHE B CG  1 
ATOM   5468  C  CD1 . PHE B 1 182 ? 24.754  52.518  24.684  1.00 57.69 ? 185  PHE B CD1 1 
ATOM   5469  C  CD2 . PHE B 1 182 ? 23.035  53.042  26.260  1.00 57.23 ? 185  PHE B CD2 1 
ATOM   5470  C  CE1 . PHE B 1 182 ? 25.675  52.425  25.719  1.00 57.21 ? 185  PHE B CE1 1 
ATOM   5471  C  CE2 . PHE B 1 182 ? 23.949  52.950  27.296  1.00 56.72 ? 185  PHE B CE2 1 
ATOM   5472  C  CZ  . PHE B 1 182 ? 25.272  52.641  27.025  1.00 56.77 ? 185  PHE B CZ  1 
ATOM   5473  N  N   . TRP B 1 183 ? 23.815  54.603  21.834  1.00 59.36 ? 186  TRP B N   1 
ATOM   5474  C  CA  . TRP B 1 183 ? 24.990  55.205  21.239  1.00 59.48 ? 186  TRP B CA  1 
ATOM   5475  C  C   . TRP B 1 183 ? 24.815  56.704  21.043  1.00 59.57 ? 186  TRP B C   1 
ATOM   5476  O  O   . TRP B 1 183 ? 25.619  57.487  21.537  1.00 59.94 ? 186  TRP B O   1 
ATOM   5477  C  CB  . TRP B 1 183 ? 25.344  54.500  19.928  1.00 59.33 ? 186  TRP B CB  1 
ATOM   5478  C  CG  . TRP B 1 183 ? 26.076  53.207  20.168  1.00 59.65 ? 186  TRP B CG  1 
ATOM   5479  C  CD1 . TRP B 1 183 ? 26.631  52.794  21.345  1.00 59.67 ? 186  TRP B CD1 1 
ATOM   5480  C  CD2 . TRP B 1 183 ? 26.350  52.172  19.216  1.00 59.85 ? 186  TRP B CD2 1 
ATOM   5481  N  NE1 . TRP B 1 183 ? 27.231  51.571  21.187  1.00 59.81 ? 186  TRP B NE1 1 
ATOM   5482  C  CE2 . TRP B 1 183 ? 27.074  51.165  19.892  1.00 59.85 ? 186  TRP B CE2 1 
ATOM   5483  C  CE3 . TRP B 1 183 ? 26.056  51.996  17.859  1.00 60.07 ? 186  TRP B CE3 1 
ATOM   5484  C  CZ2 . TRP B 1 183 ? 27.505  50.001  19.259  1.00 60.09 ? 186  TRP B CZ2 1 
ATOM   5485  C  CZ3 . TRP B 1 183 ? 26.486  50.837  17.228  1.00 60.04 ? 186  TRP B CZ3 1 
ATOM   5486  C  CH2 . TRP B 1 183 ? 27.203  49.853  17.930  1.00 60.11 ? 186  TRP B CH2 1 
ATOM   5487  N  N   . SER B 1 184 ? 23.722  57.111  20.408  1.00 59.64 ? 187  SER B N   1 
ATOM   5488  C  CA  . SER B 1 184 ? 23.480  58.530  20.170  1.00 59.79 ? 187  SER B CA  1 
ATOM   5489  C  C   . SER B 1 184 ? 23.398  59.318  21.467  1.00 59.72 ? 187  SER B C   1 
ATOM   5490  O  O   . SER B 1 184 ? 23.836  60.464  21.533  1.00 59.93 ? 187  SER B O   1 
ATOM   5491  C  CB  . SER B 1 184 ? 22.199  58.732  19.367  1.00 60.12 ? 187  SER B CB  1 
ATOM   5492  O  OG  . SER B 1 184 ? 21.067  58.351  20.124  1.00 60.65 ? 187  SER B OG  1 
ATOM   5493  N  N   . LEU B 1 185 ? 22.831  58.704  22.498  1.00 59.79 ? 188  LEU B N   1 
ATOM   5494  C  CA  . LEU B 1 185 ? 22.714  59.372  23.788  1.00 59.77 ? 188  LEU B CA  1 
ATOM   5495  C  C   . LEU B 1 185 ? 24.039  59.350  24.522  1.00 59.74 ? 188  LEU B C   1 
ATOM   5496  O  O   . LEU B 1 185 ? 24.348  60.271  25.276  1.00 59.95 ? 188  LEU B O   1 
ATOM   5497  C  CB  . LEU B 1 185 ? 21.642  58.713  24.647  1.00 59.68 ? 188  LEU B CB  1 
ATOM   5498  C  CG  . LEU B 1 185 ? 20.202  59.008  24.235  1.00 59.49 ? 188  LEU B CG  1 
ATOM   5499  C  CD1 . LEU B 1 185 ? 19.276  58.142  25.052  1.00 59.50 ? 188  LEU B CD1 1 
ATOM   5500  C  CD2 . LEU B 1 185 ? 19.875  60.488  24.419  1.00 59.58 ? 188  LEU B CD2 1 
ATOM   5501  N  N   . ARG B 1 186 ? 24.829  58.307  24.282  1.00 59.45 ? 189  ARG B N   1 
ATOM   5502  C  CA  . ARG B 1 186 ? 26.128  58.167  24.926  1.00 58.99 ? 189  ARG B CA  1 
ATOM   5503  C  C   . ARG B 1 186 ? 27.283  58.236  23.917  1.00 58.71 ? 189  ARG B C   1 
ATOM   5504  O  O   . ARG B 1 186 ? 27.875  57.219  23.555  1.00 58.57 ? 189  ARG B O   1 
ATOM   5505  C  CB  . ARG B 1 186 ? 26.170  56.859  25.712  1.00 58.97 ? 189  ARG B CB  1 
ATOM   5506  C  CG  . ARG B 1 186 ? 25.122  56.775  26.812  1.00 58.51 ? 189  ARG B CG  1 
ATOM   5507  C  CD  . ARG B 1 186 ? 25.277  57.914  27.804  1.00 58.58 ? 189  ARG B CD  1 
ATOM   5508  N  NE  . ARG B 1 186 ? 26.629  57.979  28.365  1.00 58.53 ? 189  ARG B NE  1 
ATOM   5509  C  CZ  . ARG B 1 186 ? 26.924  58.505  29.550  1.00 58.51 ? 189  ARG B CZ  1 
ATOM   5510  N  NH1 . ARG B 1 186 ? 25.963  59.015  30.310  1.00 58.28 ? 189  ARG B NH1 1 
ATOM   5511  N  NH2 . ARG B 1 186 ? 28.179  58.529  29.973  1.00 58.07 ? 189  ARG B NH2 1 
ATOM   5512  N  N   . PRO B 1 187 ? 27.663  59.457  23.508  1.00 58.55 ? 190  PRO B N   1 
ATOM   5513  C  CA  . PRO B 1 187 ? 28.740  59.697  22.545  1.00 58.62 ? 190  PRO B CA  1 
ATOM   5514  C  C   . PRO B 1 187 ? 30.168  59.253  22.871  1.00 59.11 ? 190  PRO B C   1 
ATOM   5515  O  O   . PRO B 1 187 ? 31.056  59.390  22.027  1.00 59.04 ? 190  PRO B O   1 
ATOM   5516  C  CB  . PRO B 1 187 ? 28.641  61.202  22.295  1.00 58.45 ? 190  PRO B CB  1 
ATOM   5517  C  CG  . PRO B 1 187 ? 28.040  61.728  23.557  1.00 58.16 ? 190  PRO B CG  1 
ATOM   5518  C  CD  . PRO B 1 187 ? 26.991  60.721  23.857  1.00 58.46 ? 190  PRO B CD  1 
ATOM   5519  N  N   . GLU B 1 188 ? 30.406  58.717  24.066  1.00 59.55 ? 191  GLU B N   1 
ATOM   5520  C  CA  . GLU B 1 188 ? 31.756  58.260  24.407  1.00 60.03 ? 191  GLU B CA  1 
ATOM   5521  C  C   . GLU B 1 188 ? 32.071  57.083  23.497  1.00 60.33 ? 191  GLU B C   1 
ATOM   5522  O  O   . GLU B 1 188 ? 33.229  56.766  23.228  1.00 60.79 ? 191  GLU B O   1 
ATOM   5523  C  CB  . GLU B 1 188 ? 31.834  57.750  25.846  1.00 60.11 ? 191  GLU B CB  1 
ATOM   5524  C  CG  . GLU B 1 188 ? 31.031  58.514  26.865  1.00 60.05 ? 191  GLU B CG  1 
ATOM   5525  C  CD  . GLU B 1 188 ? 29.595  58.052  26.926  1.00 59.84 ? 191  GLU B CD  1 
ATOM   5526  O  OE1 . GLU B 1 188 ? 29.314  57.024  27.577  1.00 58.97 ? 191  GLU B OE1 1 
ATOM   5527  O  OE2 . GLU B 1 188 ? 28.745  58.728  26.322  1.00 60.17 ? 191  GLU B OE2 1 
ATOM   5528  N  N   . SER B 1 189 ? 31.005  56.427  23.061  1.00 60.43 ? 192  SER B N   1 
ATOM   5529  C  CA  . SER B 1 189 ? 31.062  55.263  22.201  1.00 60.58 ? 192  SER B CA  1 
ATOM   5530  C  C   . SER B 1 189 ? 31.597  55.539  20.809  1.00 60.91 ? 192  SER B C   1 
ATOM   5531  O  O   . SER B 1 189 ? 32.029  54.616  20.114  1.00 61.26 ? 192  SER B O   1 
ATOM   5532  C  CB  . SER B 1 189 ? 29.662  54.689  22.077  1.00 60.25 ? 192  SER B CB  1 
ATOM   5533  O  OG  . SER B 1 189 ? 28.772  55.700  21.633  1.00 59.77 ? 192  SER B OG  1 
ATOM   5534  N  N   . LEU B 1 190 ? 31.540  56.793  20.386  1.00 61.21 ? 193  LEU B N   1 
ATOM   5535  C  CA  . LEU B 1 190 ? 32.010  57.162  19.058  1.00 61.66 ? 193  LEU B CA  1 
ATOM   5536  C  C   . LEU B 1 190 ? 33.302  56.468  18.650  1.00 62.14 ? 193  LEU B C   1 
ATOM   5537  O  O   . LEU B 1 190 ? 33.369  55.818  17.599  1.00 62.59 ? 193  LEU B O   1 
ATOM   5538  C  CB  . LEU B 1 190 ? 32.188  58.672  18.967  1.00 61.44 ? 193  LEU B CB  1 
ATOM   5539  C  CG  . LEU B 1 190 ? 30.875  59.451  18.912  1.00 61.17 ? 193  LEU B CG  1 
ATOM   5540  C  CD1 . LEU B 1 190 ? 31.148  60.913  19.152  1.00 61.20 ? 193  LEU B CD1 1 
ATOM   5541  C  CD2 . LEU B 1 190 ? 30.181  59.242  17.576  1.00 60.87 ? 193  LEU B CD2 1 
ATOM   5542  N  N   . HIS B 1 191 ? 34.305  56.537  19.516  1.00 62.10 ? 194  HIS B N   1 
ATOM   5543  C  CA  . HIS B 1 191 ? 35.584  55.928  19.207  1.00 61.90 ? 194  HIS B CA  1 
ATOM   5544  C  C   . HIS B 1 191 ? 35.465  54.462  18.820  1.00 61.99 ? 194  HIS B C   1 
ATOM   5545  O  O   . HIS B 1 191 ? 35.722  54.102  17.676  1.00 62.01 ? 194  HIS B O   1 
ATOM   5546  C  CB  . HIS B 1 191 ? 36.552  56.088  20.368  1.00 61.91 ? 194  HIS B CB  1 
ATOM   5547  C  CG  . HIS B 1 191 ? 37.983  56.080  19.946  1.00 61.95 ? 194  HIS B CG  1 
ATOM   5548  N  ND1 . HIS B 1 191 ? 39.029  56.164  20.838  1.00 61.97 ? 194  HIS B ND1 1 
ATOM   5549  C  CD2 . HIS B 1 191 ? 38.544  56.012  18.714  1.00 62.14 ? 194  HIS B CD2 1 
ATOM   5550  C  CE1 . HIS B 1 191 ? 40.173  56.149  20.176  1.00 62.15 ? 194  HIS B CE1 1 
ATOM   5551  N  NE2 . HIS B 1 191 ? 39.907  56.057  18.884  1.00 62.04 ? 194  HIS B NE2 1 
ATOM   5552  N  N   . GLN B 1 192 ? 35.046  53.620  19.757  1.00 61.91 ? 195  GLN B N   1 
ATOM   5553  C  CA  . GLN B 1 192 ? 34.913  52.198  19.472  1.00 61.68 ? 195  GLN B CA  1 
ATOM   5554  C  C   . GLN B 1 192 ? 33.935  51.913  18.344  1.00 61.68 ? 195  GLN B C   1 
ATOM   5555  O  O   . GLN B 1 192 ? 34.187  51.045  17.512  1.00 61.93 ? 195  GLN B O   1 
ATOM   5556  C  CB  . GLN B 1 192 ? 34.509  51.421  20.725  1.00 61.77 ? 195  GLN B CB  1 
ATOM   5557  C  CG  . GLN B 1 192 ? 34.295  49.920  20.494  1.00 62.00 ? 195  GLN B CG  1 
ATOM   5558  C  CD  . GLN B 1 192 ? 35.503  49.217  19.887  1.00 62.11 ? 195  GLN B CD  1 
ATOM   5559  O  OE1 . GLN B 1 192 ? 36.630  49.679  20.024  1.00 62.46 ? 195  GLN B OE1 1 
ATOM   5560  N  NE2 . GLN B 1 192 ? 35.266  48.095  19.212  1.00 61.91 ? 195  GLN B NE2 1 
ATOM   5561  N  N   . VAL B 1 193 ? 32.826  52.642  18.308  1.00 61.51 ? 196  VAL B N   1 
ATOM   5562  C  CA  . VAL B 1 193 ? 31.833  52.441  17.259  1.00 61.45 ? 196  VAL B CA  1 
ATOM   5563  C  C   . VAL B 1 193 ? 32.495  52.566  15.904  1.00 61.38 ? 196  VAL B C   1 
ATOM   5564  O  O   . VAL B 1 193 ? 32.284  51.748  15.006  1.00 60.93 ? 196  VAL B O   1 
ATOM   5565  C  CB  . VAL B 1 193 ? 30.722  53.488  17.354  1.00 61.79 ? 196  VAL B CB  1 
ATOM   5566  C  CG1 . VAL B 1 193 ? 29.923  53.536  16.059  1.00 61.50 ? 196  VAL B CG1 1 
ATOM   5567  C  CG2 . VAL B 1 193 ? 29.815  53.168  18.527  1.00 61.61 ? 196  VAL B CG2 1 
ATOM   5568  N  N   . SER B 1 194 ? 33.314  53.600  15.781  1.00 61.60 ? 197  SER B N   1 
ATOM   5569  C  CA  . SER B 1 194 ? 34.031  53.873  14.553  1.00 62.36 ? 197  SER B CA  1 
ATOM   5570  C  C   . SER B 1 194 ? 34.944  52.707  14.224  1.00 62.89 ? 197  SER B C   1 
ATOM   5571  O  O   . SER B 1 194 ? 35.004  52.261  13.079  1.00 63.46 ? 197  SER B O   1 
ATOM   5572  C  CB  . SER B 1 194 ? 34.831  55.164  14.700  1.00 62.20 ? 197  SER B CB  1 
ATOM   5573  O  OG  . SER B 1 194 ? 33.964  56.250  14.984  1.00 61.97 ? 197  SER B OG  1 
ATOM   5574  N  N   . PHE B 1 195 ? 35.631  52.189  15.235  1.00 63.37 ? 198  PHE B N   1 
ATOM   5575  C  CA  . PHE B 1 195 ? 36.521  51.060  15.023  1.00 63.56 ? 198  PHE B CA  1 
ATOM   5576  C  C   . PHE B 1 195 ? 35.712  49.833  14.621  1.00 63.45 ? 198  PHE B C   1 
ATOM   5577  O  O   . PHE B 1 195 ? 36.088  49.110  13.702  1.00 63.33 ? 198  PHE B O   1 
ATOM   5578  C  CB  . PHE B 1 195 ? 37.320  50.752  16.288  1.00 64.36 ? 198  PHE B CB  1 
ATOM   5579  C  CG  . PHE B 1 195 ? 38.238  49.570  16.146  1.00 65.56 ? 198  PHE B CG  1 
ATOM   5580  C  CD1 . PHE B 1 195 ? 37.852  48.309  16.604  1.00 66.05 ? 198  PHE B CD1 1 
ATOM   5581  C  CD2 . PHE B 1 195 ? 39.483  49.708  15.536  1.00 66.10 ? 198  PHE B CD2 1 
ATOM   5582  C  CE1 . PHE B 1 195 ? 38.699  47.200  16.453  1.00 66.28 ? 198  PHE B CE1 1 
ATOM   5583  C  CE2 . PHE B 1 195 ? 40.340  48.608  15.379  1.00 66.26 ? 198  PHE B CE2 1 
ATOM   5584  C  CZ  . PHE B 1 195 ? 39.946  47.353  15.839  1.00 66.21 ? 198  PHE B CZ  1 
ATOM   5585  N  N   . LEU B 1 196 ? 34.597  49.609  15.311  1.00 63.24 ? 199  LEU B N   1 
ATOM   5586  C  CA  . LEU B 1 196 ? 33.739  48.460  15.034  1.00 63.00 ? 199  LEU B CA  1 
ATOM   5587  C  C   . LEU B 1 196 ? 33.198  48.467  13.610  1.00 63.30 ? 199  LEU B C   1 
ATOM   5588  O  O   . LEU B 1 196 ? 33.203  47.432  12.930  1.00 63.44 ? 199  LEU B O   1 
ATOM   5589  C  CB  . LEU B 1 196 ? 32.575  48.400  16.030  1.00 62.34 ? 199  LEU B CB  1 
ATOM   5590  C  CG  . LEU B 1 196 ? 31.532  47.283  15.848  1.00 61.70 ? 199  LEU B CG  1 
ATOM   5591  C  CD1 . LEU B 1 196 ? 32.139  45.899  16.029  1.00 61.35 ? 199  LEU B CD1 1 
ATOM   5592  C  CD2 . LEU B 1 196 ? 30.406  47.476  16.835  1.00 61.47 ? 199  LEU B CD2 1 
ATOM   5593  N  N   . PHE B 1 197 ? 32.749  49.632  13.149  1.00 63.39 ? 200  PHE B N   1 
ATOM   5594  C  CA  . PHE B 1 197 ? 32.196  49.720  11.808  1.00 63.27 ? 200  PHE B CA  1 
ATOM   5595  C  C   . PHE B 1 197 ? 33.194  49.809  10.669  1.00 63.37 ? 200  PHE B C   1 
ATOM   5596  O  O   . PHE B 1 197 ? 32.801  49.948  9.511   1.00 63.42 ? 200  PHE B O   1 
ATOM   5597  C  CB  . PHE B 1 197 ? 31.156  50.825  11.720  1.00 63.11 ? 200  PHE B CB  1 
ATOM   5598  C  CG  . PHE B 1 197 ? 29.819  50.420  12.251  1.00 62.97 ? 200  PHE B CG  1 
ATOM   5599  C  CD1 . PHE B 1 197 ? 29.524  50.571  13.602  1.00 62.93 ? 200  PHE B CD1 1 
ATOM   5600  C  CD2 . PHE B 1 197 ? 28.863  49.861  11.406  1.00 62.87 ? 200  PHE B CD2 1 
ATOM   5601  C  CE1 . PHE B 1 197 ? 28.294  50.167  14.106  1.00 62.83 ? 200  PHE B CE1 1 
ATOM   5602  C  CE2 . PHE B 1 197 ? 27.632  49.454  11.896  1.00 62.65 ? 200  PHE B CE2 1 
ATOM   5603  C  CZ  . PHE B 1 197 ? 27.345  49.605  13.250  1.00 62.77 ? 200  PHE B CZ  1 
ATOM   5604  N  N   . SER B 1 198 ? 34.482  49.740  10.994  1.00 63.56 ? 201  SER B N   1 
ATOM   5605  C  CA  . SER B 1 198 ? 35.519  49.767  9.967   1.00 63.79 ? 201  SER B CA  1 
ATOM   5606  C  C   . SER B 1 198 ? 35.748  48.321  9.523   1.00 64.21 ? 201  SER B C   1 
ATOM   5607  O  O   . SER B 1 198 ? 35.068  47.409  10.000  1.00 64.55 ? 201  SER B O   1 
ATOM   5608  C  CB  . SER B 1 198 ? 36.810  50.349  10.528  1.00 63.46 ? 201  SER B CB  1 
ATOM   5609  O  OG  . SER B 1 198 ? 37.306  49.543  11.579  1.00 63.30 ? 201  SER B OG  1 
ATOM   5610  N  N   . ASP B 1 199 ? 36.720  48.103  8.642   1.00 64.58 ? 202  ASP B N   1 
ATOM   5611  C  CA  . ASP B 1 199 ? 37.017  46.757  8.145   1.00 64.86 ? 202  ASP B CA  1 
ATOM   5612  C  C   . ASP B 1 199 ? 37.390  45.757  9.244   1.00 65.03 ? 202  ASP B C   1 
ATOM   5613  O  O   . ASP B 1 199 ? 37.289  44.553  9.050   1.00 64.87 ? 202  ASP B O   1 
ATOM   5614  C  CB  . ASP B 1 199 ? 38.148  46.812  7.115   1.00 64.87 ? 202  ASP B CB  1 
ATOM   5615  C  CG  . ASP B 1 199 ? 37.869  47.782  5.978   1.00 64.67 ? 202  ASP B CG  1 
ATOM   5616  O  OD1 . ASP B 1 199 ? 36.694  48.140  5.742   1.00 64.93 ? 202  ASP B OD1 1 
ATOM   5617  O  OD2 . ASP B 1 199 ? 38.841  48.179  5.311   1.00 64.67 ? 202  ASP B OD2 1 
ATOM   5618  N  N   . ARG B 1 200 ? 37.826  46.264  10.392  1.00 65.55 ? 203  ARG B N   1 
ATOM   5619  C  CA  . ARG B 1 200 ? 38.231  45.429  11.525  1.00 65.76 ? 203  ARG B CA  1 
ATOM   5620  C  C   . ARG B 1 200 ? 37.061  44.817  12.285  1.00 65.12 ? 203  ARG B C   1 
ATOM   5621  O  O   . ARG B 1 200 ? 37.259  43.997  13.179  1.00 65.07 ? 203  ARG B O   1 
ATOM   5622  C  CB  . ARG B 1 200 ? 39.067  46.257  12.500  1.00 66.99 ? 203  ARG B CB  1 
ATOM   5623  C  CG  . ARG B 1 200 ? 40.369  46.800  11.929  1.00 68.72 ? 203  ARG B CG  1 
ATOM   5624  C  CD  . ARG B 1 200 ? 41.393  45.695  11.739  1.00 70.31 ? 203  ARG B CD  1 
ATOM   5625  N  NE  . ARG B 1 200 ? 42.637  46.206  11.165  1.00 72.53 ? 203  ARG B NE  1 
ATOM   5626  C  CZ  . ARG B 1 200 ? 43.642  46.720  11.871  1.00 73.46 ? 203  ARG B CZ  1 
ATOM   5627  N  NH1 . ARG B 1 200 ? 44.734  47.161  11.252  1.00 73.68 ? 203  ARG B NH1 1 
ATOM   5628  N  NH2 . ARG B 1 200 ? 43.573  46.777  13.196  1.00 74.01 ? 203  ARG B NH2 1 
ATOM   5629  N  N   . GLY B 1 201 ? 35.846  45.242  11.957  1.00 64.48 ? 204  GLY B N   1 
ATOM   5630  C  CA  . GLY B 1 201 ? 34.673  44.720  12.634  1.00 63.63 ? 204  GLY B CA  1 
ATOM   5631  C  C   . GLY B 1 201 ? 34.395  43.247  12.380  1.00 63.06 ? 204  GLY B C   1 
ATOM   5632  O  O   . GLY B 1 201 ? 33.674  42.608  13.148  1.00 63.07 ? 204  GLY B O   1 
ATOM   5633  N  N   . ILE B 1 202 ? 34.960  42.703  11.306  1.00 62.46 ? 205  ILE B N   1 
ATOM   5634  C  CA  . ILE B 1 202 ? 34.749  41.299  10.964  1.00 61.79 ? 205  ILE B CA  1 
ATOM   5635  C  C   . ILE B 1 202 ? 36.068  40.640  10.568  1.00 61.50 ? 205  ILE B C   1 
ATOM   5636  O  O   . ILE B 1 202 ? 36.393  40.508  9.388   1.00 61.64 ? 205  ILE B O   1 
ATOM   5637  C  CB  . ILE B 1 202 ? 33.734  41.142  9.801   1.00 61.51 ? 205  ILE B CB  1 
ATOM   5638  C  CG1 . ILE B 1 202 ? 32.497  42.013  10.046  1.00 61.14 ? 205  ILE B CG1 1 
ATOM   5639  C  CG2 . ILE B 1 202 ? 33.314  39.679  9.660   1.00 61.44 ? 205  ILE B CG2 1 
ATOM   5640  C  CD1 . ILE B 1 202 ? 31.513  42.023  8.894   1.00 60.70 ? 205  ILE B CD1 1 
ATOM   5641  N  N   . PRO B 1 203 ? 36.845  40.211  11.563  1.00 61.03 ? 206  PRO B N   1 
ATOM   5642  C  CA  . PRO B 1 203 ? 38.138  39.562  11.347  1.00 60.81 ? 206  PRO B CA  1 
ATOM   5643  C  C   . PRO B 1 203 ? 37.949  38.259  10.603  1.00 61.00 ? 206  PRO B C   1 
ATOM   5644  O  O   . PRO B 1 203 ? 36.949  37.571  10.796  1.00 60.86 ? 206  PRO B O   1 
ATOM   5645  C  CB  . PRO B 1 203 ? 38.609  39.284  12.765  1.00 60.68 ? 206  PRO B CB  1 
ATOM   5646  C  CG  . PRO B 1 203 ? 37.906  40.343  13.581  1.00 60.88 ? 206  PRO B CG  1 
ATOM   5647  C  CD  . PRO B 1 203 ? 36.549  40.344  12.996  1.00 60.80 ? 206  PRO B CD  1 
ATOM   5648  N  N   . ASP B 1 204 ? 38.891  37.928  9.729   1.00 61.39 ? 207  ASP B N   1 
ATOM   5649  C  CA  . ASP B 1 204 ? 38.799  36.675  9.001   1.00 61.66 ? 207  ASP B CA  1 
ATOM   5650  C  C   . ASP B 1 204 ? 39.304  35.610  9.960   1.00 61.69 ? 207  ASP B C   1 
ATOM   5651  O  O   . ASP B 1 204 ? 40.479  35.251  9.938   1.00 61.85 ? 207  ASP B O   1 
ATOM   5652  C  CB  . ASP B 1 204 ? 39.663  36.699  7.736   1.00 62.00 ? 207  ASP B CB  1 
ATOM   5653  C  CG  . ASP B 1 204 ? 39.463  35.459  6.857   1.00 62.66 ? 207  ASP B CG  1 
ATOM   5654  O  OD1 . ASP B 1 204 ? 39.803  35.515  5.653   1.00 63.16 ? 207  ASP B OD1 1 
ATOM   5655  O  OD2 . ASP B 1 204 ? 38.968  34.424  7.356   1.00 62.78 ? 207  ASP B OD2 1 
ATOM   5656  N  N   . GLY B 1 205 ? 38.415  35.119  10.813  1.00 61.66 ? 208  GLY B N   1 
ATOM   5657  C  CA  . GLY B 1 205 ? 38.809  34.105  11.773  1.00 61.78 ? 208  GLY B CA  1 
ATOM   5658  C  C   . GLY B 1 205 ? 39.449  34.759  12.970  1.00 61.94 ? 208  GLY B C   1 
ATOM   5659  O  O   . GLY B 1 205 ? 39.550  35.980  13.005  1.00 62.18 ? 208  GLY B O   1 
ATOM   5660  N  N   . HIS B 1 206 ? 39.896  33.960  13.936  1.00 61.90 ? 209  HIS B N   1 
ATOM   5661  C  CA  . HIS B 1 206 ? 40.517  34.482  15.150  1.00 62.03 ? 209  HIS B CA  1 
ATOM   5662  C  C   . HIS B 1 206 ? 42.013  34.664  15.041  1.00 62.13 ? 209  HIS B C   1 
ATOM   5663  O  O   . HIS B 1 206 ? 42.631  35.307  15.888  1.00 62.16 ? 209  HIS B O   1 
ATOM   5664  C  CB  . HIS B 1 206 ? 40.245  33.549  16.311  1.00 61.54 ? 209  HIS B CB  1 
ATOM   5665  C  CG  . HIS B 1 206 ? 38.803  33.230  16.491  1.00 61.40 ? 209  HIS B CG  1 
ATOM   5666  N  ND1 . HIS B 1 206 ? 37.863  34.193  16.773  1.00 61.23 ? 209  HIS B ND1 1 
ATOM   5667  C  CD2 . HIS B 1 206 ? 38.135  32.055  16.426  1.00 61.19 ? 209  HIS B CD2 1 
ATOM   5668  C  CE1 . HIS B 1 206 ? 36.673  33.625  16.875  1.00 61.40 ? 209  HIS B CE1 1 
ATOM   5669  N  NE2 . HIS B 1 206 ? 36.812  32.327  16.669  1.00 61.37 ? 209  HIS B NE2 1 
ATOM   5670  N  N   . ARG B 1 207 ? 42.602  34.076  14.012  1.00 62.53 ? 210  ARG B N   1 
ATOM   5671  C  CA  . ARG B 1 207 ? 44.038  34.165  13.822  1.00 62.65 ? 210  ARG B CA  1 
ATOM   5672  C  C   . ARG B 1 207 ? 44.511  35.469  13.178  1.00 63.00 ? 210  ARG B C   1 
ATOM   5673  O  O   . ARG B 1 207 ? 45.678  35.838  13.323  1.00 63.25 ? 210  ARG B O   1 
ATOM   5674  C  CB  . ARG B 1 207 ? 44.522  32.960  13.015  1.00 62.50 ? 210  ARG B CB  1 
ATOM   5675  C  CG  . ARG B 1 207 ? 44.233  31.621  13.679  1.00 62.30 ? 210  ARG B CG  1 
ATOM   5676  C  CD  . ARG B 1 207 ? 44.620  30.452  12.798  1.00 62.34 ? 210  ARG B CD  1 
ATOM   5677  N  NE  . ARG B 1 207 ? 43.854  30.445  11.556  1.00 62.87 ? 210  ARG B NE  1 
ATOM   5678  C  CZ  . ARG B 1 207 ? 44.394  30.489  10.340  1.00 63.20 ? 210  ARG B CZ  1 
ATOM   5679  N  NH1 . ARG B 1 207 ? 45.712  30.539  10.193  1.00 63.24 ? 210  ARG B NH1 1 
ATOM   5680  N  NH2 . ARG B 1 207 ? 43.618  30.510  9.268   1.00 63.34 ? 210  ARG B NH2 1 
ATOM   5681  N  N   . HIS B 1 208 ? 43.611  36.190  12.511  1.00 63.23 ? 211  HIS B N   1 
ATOM   5682  C  CA  . HIS B 1 208 ? 43.994  37.436  11.843  1.00 63.60 ? 211  HIS B CA  1 
ATOM   5683  C  C   . HIS B 1 208 ? 43.544  38.747  12.486  1.00 63.57 ? 211  HIS B C   1 
ATOM   5684  O  O   . HIS B 1 208 ? 43.202  39.713  11.788  1.00 63.39 ? 211  HIS B O   1 
ATOM   5685  C  CB  . HIS B 1 208 ? 43.549  37.402  10.391  1.00 64.40 ? 211  HIS B CB  1 
ATOM   5686  C  CG  . HIS B 1 208 ? 44.191  36.318  9.591   1.00 64.92 ? 211  HIS B CG  1 
ATOM   5687  N  ND1 . HIS B 1 208 ? 43.602  35.087  9.401   1.00 65.23 ? 211  HIS B ND1 1 
ATOM   5688  C  CD2 . HIS B 1 208 ? 45.360  36.285  8.909   1.00 65.06 ? 211  HIS B CD2 1 
ATOM   5689  C  CE1 . HIS B 1 208 ? 44.378  34.343  8.633   1.00 65.35 ? 211  HIS B CE1 1 
ATOM   5690  N  NE2 . HIS B 1 208 ? 45.451  35.046  8.321   1.00 65.54 ? 211  HIS B NE2 1 
ATOM   5691  N  N   . MET B 1 209 ? 43.600  38.790  13.812  1.00 63.39 ? 212  MET B N   1 
ATOM   5692  C  CA  . MET B 1 209 ? 43.216  39.972  14.569  1.00 63.16 ? 212  MET B CA  1 
ATOM   5693  C  C   . MET B 1 209 ? 44.202  40.143  15.706  1.00 62.99 ? 212  MET B C   1 
ATOM   5694  O  O   . MET B 1 209 ? 44.901  39.203  16.076  1.00 62.93 ? 212  MET B O   1 
ATOM   5695  C  CB  . MET B 1 209 ? 41.809  39.808  15.137  1.00 63.21 ? 212  MET B CB  1 
ATOM   5696  C  CG  . MET B 1 209 ? 41.654  38.610  16.050  1.00 63.12 ? 212  MET B CG  1 
ATOM   5697  S  SD  . MET B 1 209 ? 39.949  38.359  16.569  1.00 63.41 ? 212  MET B SD  1 
ATOM   5698  C  CE  . MET B 1 209 ? 40.194  37.501  18.109  1.00 62.79 ? 212  MET B CE  1 
ATOM   5699  N  N   . ASN B 1 210 ? 44.269  41.350  16.248  1.00 62.97 ? 213  ASN B N   1 
ATOM   5700  C  CA  . ASN B 1 210 ? 45.171  41.628  17.348  1.00 62.68 ? 213  ASN B CA  1 
ATOM   5701  C  C   . ASN B 1 210 ? 44.449  41.417  18.663  1.00 62.38 ? 213  ASN B C   1 
ATOM   5702  O  O   . ASN B 1 210 ? 43.247  41.162  18.697  1.00 62.18 ? 213  ASN B O   1 
ATOM   5703  C  CB  . ASN B 1 210 ? 45.692  43.066  17.261  1.00 62.94 ? 213  ASN B CB  1 
ATOM   5704  C  CG  . ASN B 1 210 ? 46.559  43.303  16.038  1.00 63.06 ? 213  ASN B CG  1 
ATOM   5705  O  OD1 . ASN B 1 210 ? 47.166  42.368  15.502  1.00 63.48 ? 213  ASN B OD1 1 
ATOM   5706  N  ND2 . ASN B 1 210 ? 46.632  44.558  15.593  1.00 63.21 ? 213  ASN B ND2 1 
ATOM   5707  N  N   . GLY B 1 211 ? 45.204  41.507  19.746  1.00 61.97 ? 214  GLY B N   1 
ATOM   5708  C  CA  . GLY B 1 211 ? 44.633  41.352  21.063  1.00 61.87 ? 214  GLY B CA  1 
ATOM   5709  C  C   . GLY B 1 211 ? 45.105  42.527  21.883  1.00 61.68 ? 214  GLY B C   1 
ATOM   5710  O  O   . GLY B 1 211 ? 46.225  43.004  21.699  1.00 61.78 ? 214  GLY B O   1 
ATOM   5711  N  N   . TYR B 1 212 ? 44.260  43.003  22.784  1.00 61.52 ? 215  TYR B N   1 
ATOM   5712  C  CA  . TYR B 1 212 ? 44.623  44.138  23.607  1.00 61.29 ? 215  TYR B CA  1 
ATOM   5713  C  C   . TYR B 1 212 ? 44.107  43.938  25.011  1.00 61.16 ? 215  TYR B C   1 
ATOM   5714  O  O   . TYR B 1 212 ? 43.129  43.227  25.211  1.00 61.69 ? 215  TYR B O   1 
ATOM   5715  C  CB  . TYR B 1 212 ? 43.997  45.398  23.032  1.00 61.28 ? 215  TYR B CB  1 
ATOM   5716  C  CG  . TYR B 1 212 ? 44.357  45.654  21.592  1.00 61.54 ? 215  TYR B CG  1 
ATOM   5717  C  CD1 . TYR B 1 212 ? 45.556  46.277  21.254  1.00 61.78 ? 215  TYR B CD1 1 
ATOM   5718  C  CD2 . TYR B 1 212 ? 43.481  45.317  20.566  1.00 61.79 ? 215  TYR B CD2 1 
ATOM   5719  C  CE1 . TYR B 1 212 ? 45.872  46.566  19.931  1.00 61.71 ? 215  TYR B CE1 1 
ATOM   5720  C  CE2 . TYR B 1 212 ? 43.786  45.603  19.240  1.00 61.78 ? 215  TYR B CE2 1 
ATOM   5721  C  CZ  . TYR B 1 212 ? 44.985  46.232  18.932  1.00 61.79 ? 215  TYR B CZ  1 
ATOM   5722  O  OH  . TYR B 1 212 ? 45.302  46.552  17.631  1.00 62.18 ? 215  TYR B OH  1 
ATOM   5723  N  N   . GLY B 1 213 ? 44.801  44.512  25.986  1.00 60.92 ? 216  GLY B N   1 
ATOM   5724  C  CA  . GLY B 1 213 ? 44.344  44.413  27.358  1.00 60.61 ? 216  GLY B CA  1 
ATOM   5725  C  C   . GLY B 1 213 ? 43.324  45.520  27.548  1.00 60.69 ? 216  GLY B C   1 
ATOM   5726  O  O   . GLY B 1 213 ? 42.505  45.485  28.468  1.00 60.71 ? 216  GLY B O   1 
ATOM   5727  N  N   . SER B 1 214 ? 43.379  46.497  26.639  1.00 60.65 ? 217  SER B N   1 
ATOM   5728  C  CA  . SER B 1 214 ? 42.500  47.664  26.619  1.00 60.58 ? 217  SER B CA  1 
ATOM   5729  C  C   . SER B 1 214 ? 42.723  48.612  27.771  1.00 60.76 ? 217  SER B C   1 
ATOM   5730  O  O   . SER B 1 214 ? 43.060  49.773  27.569  1.00 60.87 ? 217  SER B O   1 
ATOM   5731  C  CB  . SER B 1 214 ? 41.037  47.250  26.577  1.00 60.49 ? 217  SER B CB  1 
ATOM   5732  O  OG  . SER B 1 214 ? 40.752  46.587  25.363  1.00 60.58 ? 217  SER B OG  1 
ATOM   5733  N  N   . HIS B 1 215 ? 42.495  48.122  28.980  1.00 60.98 ? 218  HIS B N   1 
ATOM   5734  C  CA  . HIS B 1 215 ? 42.675  48.941  30.163  1.00 61.08 ? 218  HIS B CA  1 
ATOM   5735  C  C   . HIS B 1 215 ? 44.145  49.250  30.383  1.00 61.00 ? 218  HIS B C   1 
ATOM   5736  O  O   . HIS B 1 215 ? 45.035  48.638  29.783  1.00 61.03 ? 218  HIS B O   1 
ATOM   5737  C  CB  . HIS B 1 215 ? 42.194  48.206  31.415  1.00 61.41 ? 218  HIS B CB  1 
ATOM   5738  C  CG  . HIS B 1 215 ? 40.797  47.689  31.333  1.00 61.51 ? 218  HIS B CG  1 
ATOM   5739  N  ND1 . HIS B 1 215 ? 39.697  48.476  31.600  1.00 61.42 ? 218  HIS B ND1 1 
ATOM   5740  C  CD2 . HIS B 1 215 ? 40.322  46.451  31.065  1.00 61.28 ? 218  HIS B CD2 1 
ATOM   5741  C  CE1 . HIS B 1 215 ? 38.602  47.741  31.502  1.00 61.76 ? 218  HIS B CE1 1 
ATOM   5742  N  NE2 . HIS B 1 215 ? 38.954  46.508  31.179  1.00 61.59 ? 218  HIS B NE2 1 
ATOM   5743  N  N   . THR B 1 216 ? 44.374  50.212  31.268  1.00 60.81 ? 219  THR B N   1 
ATOM   5744  C  CA  . THR B 1 216 ? 45.703  50.612  31.672  1.00 60.40 ? 219  THR B CA  1 
ATOM   5745  C  C   . THR B 1 216 ? 45.922  49.806  32.939  1.00 60.43 ? 219  THR B C   1 
ATOM   5746  O  O   . THR B 1 216 ? 45.074  49.810  33.832  1.00 60.41 ? 219  THR B O   1 
ATOM   5747  C  CB  . THR B 1 216 ? 45.745  52.098  32.063  1.00 60.22 ? 219  THR B CB  1 
ATOM   5748  O  OG1 . THR B 1 216 ? 45.547  52.910  30.900  1.00 59.79 ? 219  THR B OG1 1 
ATOM   5749  C  CG2 . THR B 1 216 ? 47.073  52.443  32.708  1.00 59.62 ? 219  THR B CG2 1 
ATOM   5750  N  N   . PHE B 1 217 ? 47.000  49.041  32.988  1.00 60.21 ? 220  PHE B N   1 
ATOM   5751  C  CA  . PHE B 1 217 ? 47.279  48.270  34.183  1.00 60.05 ? 220  PHE B CA  1 
ATOM   5752  C  C   . PHE B 1 217 ? 48.460  48.882  34.883  1.00 60.20 ? 220  PHE B C   1 
ATOM   5753  O  O   . PHE B 1 217 ? 48.965  49.923  34.465  1.00 60.54 ? 220  PHE B O   1 
ATOM   5754  C  CB  . PHE B 1 217 ? 47.569  46.820  33.839  1.00 59.88 ? 220  PHE B CB  1 
ATOM   5755  C  CG  . PHE B 1 217 ? 46.354  46.051  33.441  1.00 59.66 ? 220  PHE B CG  1 
ATOM   5756  C  CD1 . PHE B 1 217 ? 45.684  45.264  34.371  1.00 59.54 ? 220  PHE B CD1 1 
ATOM   5757  C  CD2 . PHE B 1 217 ? 45.868  46.121  32.138  1.00 59.67 ? 220  PHE B CD2 1 
ATOM   5758  C  CE1 . PHE B 1 217 ? 44.542  44.554  34.016  1.00 59.43 ? 220  PHE B CE1 1 
ATOM   5759  C  CE2 . PHE B 1 217 ? 44.728  45.418  31.765  1.00 59.44 ? 220  PHE B CE2 1 
ATOM   5760  C  CZ  . PHE B 1 217 ? 44.061  44.631  32.708  1.00 59.52 ? 220  PHE B CZ  1 
ATOM   5761  N  N   . LYS B 1 218 ? 48.891  48.246  35.962  1.00 60.17 ? 221  LYS B N   1 
ATOM   5762  C  CA  . LYS B 1 218 ? 50.026  48.742  36.712  1.00 60.20 ? 221  LYS B CA  1 
ATOM   5763  C  C   . LYS B 1 218 ? 51.019  47.618  36.931  1.00 60.35 ? 221  LYS B C   1 
ATOM   5764  O  O   . LYS B 1 218 ? 50.633  46.520  37.330  1.00 60.47 ? 221  LYS B O   1 
ATOM   5765  C  CB  . LYS B 1 218 ? 49.562  49.302  38.053  1.00 59.94 ? 221  LYS B CB  1 
ATOM   5766  C  CG  . LYS B 1 218 ? 50.701  49.798  38.924  1.00 59.45 ? 221  LYS B CG  1 
ATOM   5767  C  CD  . LYS B 1 218 ? 50.205  50.422  40.222  1.00 58.99 ? 221  LYS B CD  1 
ATOM   5768  C  CE  . LYS B 1 218 ? 49.667  49.397  41.194  1.00 58.47 ? 221  LYS B CE  1 
ATOM   5769  N  NZ  . LYS B 1 218 ? 49.347  50.027  42.508  1.00 58.26 ? 221  LYS B NZ  1 
ATOM   5770  N  N   . LEU B 1 219 ? 52.284  47.882  36.620  1.00 60.32 ? 222  LEU B N   1 
ATOM   5771  C  CA  . LEU B 1 219 ? 53.347  46.898  36.797  1.00 60.36 ? 222  LEU B CA  1 
ATOM   5772  C  C   . LEU B 1 219 ? 54.212  47.318  37.968  1.00 60.60 ? 222  LEU B C   1 
ATOM   5773  O  O   . LEU B 1 219 ? 54.445  48.511  38.174  1.00 61.07 ? 222  LEU B O   1 
ATOM   5774  C  CB  . LEU B 1 219 ? 54.216  46.816  35.546  1.00 59.98 ? 222  LEU B CB  1 
ATOM   5775  C  CG  . LEU B 1 219 ? 53.466  46.466  34.269  1.00 59.73 ? 222  LEU B CG  1 
ATOM   5776  C  CD1 . LEU B 1 219 ? 54.417  46.501  33.102  1.00 59.56 ? 222  LEU B CD1 1 
ATOM   5777  C  CD2 . LEU B 1 219 ? 52.850  45.095  34.410  1.00 59.70 ? 222  LEU B CD2 1 
ATOM   5778  N  N   . VAL B 1 220 ? 54.707  46.341  38.720  1.00 60.81 ? 223  VAL B N   1 
ATOM   5779  C  CA  . VAL B 1 220 ? 55.545  46.622  39.882  1.00 60.89 ? 223  VAL B CA  1 
ATOM   5780  C  C   . VAL B 1 220 ? 56.815  45.774  39.837  1.00 61.25 ? 223  VAL B C   1 
ATOM   5781  O  O   . VAL B 1 220 ? 56.746  44.558  39.643  1.00 61.28 ? 223  VAL B O   1 
ATOM   5782  C  CB  . VAL B 1 220 ? 54.787  46.305  41.181  1.00 60.66 ? 223  VAL B CB  1 
ATOM   5783  C  CG1 . VAL B 1 220 ? 55.576  46.775  42.380  1.00 60.41 ? 223  VAL B CG1 1 
ATOM   5784  C  CG2 . VAL B 1 220 ? 53.426  46.956  41.168  1.00 60.48 ? 223  VAL B CG2 1 
ATOM   5785  N  N   . ASN B 1 221 ? 57.973  46.415  40.001  1.00 61.59 ? 224  ASN B N   1 
ATOM   5786  C  CA  . ASN B 1 221 ? 59.241  45.690  39.980  1.00 61.78 ? 224  ASN B CA  1 
ATOM   5787  C  C   . ASN B 1 221 ? 59.722  45.268  41.364  1.00 62.18 ? 224  ASN B C   1 
ATOM   5788  O  O   . ASN B 1 221 ? 59.098  45.574  42.378  1.00 62.55 ? 224  ASN B O   1 
ATOM   5789  C  CB  . ASN B 1 221 ? 60.332  46.490  39.259  1.00 61.72 ? 224  ASN B CB  1 
ATOM   5790  C  CG  . ASN B 1 221 ? 60.770  47.725  40.023  1.00 61.64 ? 224  ASN B CG  1 
ATOM   5791  O  OD1 . ASN B 1 221 ? 60.679  47.791  41.254  1.00 61.55 ? 224  ASN B OD1 1 
ATOM   5792  N  ND2 . ASN B 1 221 ? 61.275  48.709  39.290  1.00 61.74 ? 224  ASN B ND2 1 
ATOM   5793  N  N   . ALA B 1 222 ? 60.882  44.629  41.402  1.00 62.51 ? 225  ALA B N   1 
ATOM   5794  C  CA  . ALA B 1 222 ? 61.454  44.147  42.650  1.00 63.13 ? 225  ALA B CA  1 
ATOM   5795  C  C   . ALA B 1 222 ? 61.829  45.235  43.656  1.00 63.59 ? 225  ALA B C   1 
ATOM   5796  O  O   . ALA B 1 222 ? 62.002  44.947  44.840  1.00 63.65 ? 225  ALA B O   1 
ATOM   5797  C  CB  . ALA B 1 222 ? 62.651  43.273  42.358  1.00 63.26 ? 225  ALA B CB  1 
ATOM   5798  N  N   . ASN B 1 223 ? 61.975  46.473  43.193  1.00 63.81 ? 226  ASN B N   1 
ATOM   5799  C  CA  . ASN B 1 223 ? 62.331  47.569  44.089  1.00 63.91 ? 226  ASN B CA  1 
ATOM   5800  C  C   . ASN B 1 223 ? 61.107  48.226  44.696  1.00 64.02 ? 226  ASN B C   1 
ATOM   5801  O  O   . ASN B 1 223 ? 61.214  48.994  45.652  1.00 63.96 ? 226  ASN B O   1 
ATOM   5802  C  CB  . ASN B 1 223 ? 63.163  48.620  43.358  1.00 64.43 ? 226  ASN B CB  1 
ATOM   5803  C  CG  . ASN B 1 223 ? 64.581  48.158  43.082  1.00 64.51 ? 226  ASN B CG  1 
ATOM   5804  O  OD1 . ASN B 1 223 ? 65.240  48.658  42.165  1.00 65.03 ? 226  ASN B OD1 1 
ATOM   5805  N  ND2 . ASN B 1 223 ? 65.062  47.203  43.875  1.00 64.36 ? 226  ASN B ND2 1 
ATOM   5806  N  N   . GLY B 1 224 ? 59.941  47.904  44.155  1.00 64.09 ? 227  GLY B N   1 
ATOM   5807  C  CA  . GLY B 1 224 ? 58.723  48.492  44.669  1.00 64.28 ? 227  GLY B CA  1 
ATOM   5808  C  C   . GLY B 1 224 ? 58.272  49.648  43.802  1.00 64.39 ? 227  GLY B C   1 
ATOM   5809  O  O   . GLY B 1 224 ? 57.263  50.290  44.092  1.00 64.35 ? 227  GLY B O   1 
ATOM   5810  N  N   . GLU B 1 225 ? 59.036  49.934  42.753  1.00 64.71 ? 228  GLU B N   1 
ATOM   5811  C  CA  . GLU B 1 225 ? 58.691  51.009  41.831  1.00 65.31 ? 228  GLU B CA  1 
ATOM   5812  C  C   . GLU B 1 225 ? 57.610  50.517  40.868  1.00 65.16 ? 228  GLU B C   1 
ATOM   5813  O  O   . GLU B 1 225 ? 57.639  49.368  40.405  1.00 65.11 ? 228  GLU B O   1 
ATOM   5814  C  CB  . GLU B 1 225 ? 59.925  51.461  41.053  1.00 66.19 ? 228  GLU B CB  1 
ATOM   5815  C  CG  . GLU B 1 225 ? 61.006  52.095  41.911  1.00 67.31 ? 228  GLU B CG  1 
ATOM   5816  C  CD  . GLU B 1 225 ? 62.415  51.716  41.464  1.00 68.43 ? 228  GLU B CD  1 
ATOM   5817  O  OE1 . GLU B 1 225 ? 62.581  51.118  40.374  1.00 68.52 ? 228  GLU B OE1 1 
ATOM   5818  O  OE2 . GLU B 1 225 ? 63.367  52.002  42.222  1.00 69.23 ? 228  GLU B OE2 1 
ATOM   5819  N  N   . ALA B 1 226 ? 56.670  51.401  40.545  1.00 64.74 ? 229  ALA B N   1 
ATOM   5820  C  CA  . ALA B 1 226 ? 55.578  51.037  39.661  1.00 63.89 ? 229  ALA B CA  1 
ATOM   5821  C  C   . ALA B 1 226 ? 55.395  51.969  38.489  1.00 63.43 ? 229  ALA B C   1 
ATOM   5822  O  O   . ALA B 1 226 ? 55.837  53.115  38.503  1.00 63.61 ? 229  ALA B O   1 
ATOM   5823  C  CB  . ALA B 1 226 ? 54.293  50.959  40.444  1.00 64.29 ? 229  ALA B CB  1 
ATOM   5824  N  N   . VAL B 1 227 ? 54.721  51.454  37.472  1.00 62.99 ? 230  VAL B N   1 
ATOM   5825  C  CA  . VAL B 1 227 ? 54.415  52.212  36.274  1.00 62.48 ? 230  VAL B CA  1 
ATOM   5826  C  C   . VAL B 1 227 ? 53.104  51.690  35.707  1.00 62.38 ? 230  VAL B C   1 
ATOM   5827  O  O   . VAL B 1 227 ? 52.639  50.609  36.078  1.00 62.37 ? 230  VAL B O   1 
ATOM   5828  C  CB  . VAL B 1 227 ? 55.512  52.069  35.206  1.00 62.26 ? 230  VAL B CB  1 
ATOM   5829  C  CG1 . VAL B 1 227 ? 56.794  52.714  35.681  1.00 61.90 ? 230  VAL B CG1 1 
ATOM   5830  C  CG2 . VAL B 1 227 ? 55.746  50.605  34.884  1.00 62.01 ? 230  VAL B CG2 1 
ATOM   5831  N  N   . TYR B 1 228 ? 52.478  52.482  34.856  1.00 61.90 ? 231  TYR B N   1 
ATOM   5832  C  CA  . TYR B 1 228 ? 51.243  52.059  34.244  1.00 61.90 ? 231  TYR B CA  1 
ATOM   5833  C  C   . TYR B 1 228 ? 51.597  51.478  32.898  1.00 61.57 ? 231  TYR B C   1 
ATOM   5834  O  O   . TYR B 1 228 ? 52.622  51.841  32.317  1.00 61.78 ? 231  TYR B O   1 
ATOM   5835  C  CB  . TYR B 1 228 ? 50.322  53.241  34.059  1.00 62.82 ? 231  TYR B CB  1 
ATOM   5836  C  CG  . TYR B 1 228 ? 49.862  53.868  35.345  1.00 63.77 ? 231  TYR B CG  1 
ATOM   5837  C  CD1 . TYR B 1 228 ? 49.172  53.122  36.297  1.00 64.22 ? 231  TYR B CD1 1 
ATOM   5838  C  CD2 . TYR B 1 228 ? 50.058  55.230  35.582  1.00 64.20 ? 231  TYR B CD2 1 
ATOM   5839  C  CE1 . TYR B 1 228 ? 48.681  53.720  37.450  1.00 64.55 ? 231  TYR B CE1 1 
ATOM   5840  C  CE2 . TYR B 1 228 ? 49.572  55.835  36.725  1.00 64.55 ? 231  TYR B CE2 1 
ATOM   5841  C  CZ  . TYR B 1 228 ? 48.884  55.077  37.652  1.00 64.79 ? 231  TYR B CZ  1 
ATOM   5842  O  OH  . TYR B 1 228 ? 48.380  55.689  38.772  1.00 65.52 ? 231  TYR B OH  1 
ATOM   5843  N  N   . CYS B 1 229 ? 50.736  50.613  32.373  1.00 61.33 ? 232  CYS B N   1 
ATOM   5844  C  CA  . CYS B 1 229 ? 51.019  49.999  31.087  1.00 60.80 ? 232  CYS B CA  1 
ATOM   5845  C  C   . CYS B 1 229 ? 49.788  49.495  30.364  1.00 60.47 ? 232  CYS B C   1 
ATOM   5846  O  O   . CYS B 1 229 ? 48.693  49.428  30.923  1.00 60.48 ? 232  CYS B O   1 
ATOM   5847  C  CB  . CYS B 1 229 ? 51.953  48.813  31.278  1.00 60.91 ? 232  CYS B CB  1 
ATOM   5848  S  SG  . CYS B 1 229 ? 51.072  47.348  31.854  1.00 61.25 ? 232  CYS B SG  1 
ATOM   5849  N  N   . LYS B 1 230 ? 50.016  49.100  29.118  1.00 60.00 ? 233  LYS B N   1 
ATOM   5850  C  CA  . LYS B 1 230 ? 48.996  48.548  28.250  1.00 59.64 ? 233  LYS B CA  1 
ATOM   5851  C  C   . LYS B 1 230 ? 49.591  47.260  27.718  1.00 59.67 ? 233  LYS B C   1 
ATOM   5852  O  O   . LYS B 1 230 ? 50.814  47.128  27.635  1.00 60.02 ? 233  LYS B O   1 
ATOM   5853  C  CB  . LYS B 1 230 ? 48.758  49.467  27.068  1.00 59.75 ? 233  LYS B CB  1 
ATOM   5854  C  CG  . LYS B 1 230 ? 48.197  50.817  27.417  1.00 59.69 ? 233  LYS B CG  1 
ATOM   5855  C  CD  . LYS B 1 230 ? 46.728  50.731  27.748  1.00 59.73 ? 233  LYS B CD  1 
ATOM   5856  C  CE  . LYS B 1 230 ? 46.108  52.118  27.721  1.00 59.48 ? 233  LYS B CE  1 
ATOM   5857  N  NZ  . LYS B 1 230 ? 44.672  52.060  28.105  1.00 59.83 ? 233  LYS B NZ  1 
ATOM   5858  N  N   . PHE B 1 231 ? 48.733  46.313  27.357  1.00 59.18 ? 234  PHE B N   1 
ATOM   5859  C  CA  . PHE B 1 231 ? 49.192  45.050  26.813  1.00 58.28 ? 234  PHE B CA  1 
ATOM   5860  C  C   . PHE B 1 231 ? 48.693  44.922  25.405  1.00 58.32 ? 234  PHE B C   1 
ATOM   5861  O  O   . PHE B 1 231 ? 47.556  45.287  25.112  1.00 58.39 ? 234  PHE B O   1 
ATOM   5862  C  CB  . PHE B 1 231 ? 48.645  43.909  27.622  1.00 57.80 ? 234  PHE B CB  1 
ATOM   5863  C  CG  . PHE B 1 231 ? 49.168  43.871  29.001  1.00 57.33 ? 234  PHE B CG  1 
ATOM   5864  C  CD1 . PHE B 1 231 ? 50.431  43.367  29.253  1.00 57.16 ? 234  PHE B CD1 1 
ATOM   5865  C  CD2 . PHE B 1 231 ? 48.397  44.322  30.058  1.00 57.16 ? 234  PHE B CD2 1 
ATOM   5866  C  CE1 . PHE B 1 231 ? 50.923  43.307  30.543  1.00 57.03 ? 234  PHE B CE1 1 
ATOM   5867  C  CE2 . PHE B 1 231 ? 48.878  44.268  31.354  1.00 57.12 ? 234  PHE B CE2 1 
ATOM   5868  C  CZ  . PHE B 1 231 ? 50.144  43.758  31.599  1.00 57.17 ? 234  PHE B CZ  1 
ATOM   5869  N  N   . HIS B 1 232 ? 49.548  44.417  24.526  1.00 58.08 ? 235  HIS B N   1 
ATOM   5870  C  CA  . HIS B 1 232 ? 49.178  44.249  23.133  1.00 58.01 ? 235  HIS B CA  1 
ATOM   5871  C  C   . HIS B 1 232 ? 49.772  42.965  22.630  1.00 58.03 ? 235  HIS B C   1 
ATOM   5872  O  O   . HIS B 1 232 ? 50.934  42.670  22.902  1.00 58.01 ? 235  HIS B O   1 
ATOM   5873  C  CB  . HIS B 1 232 ? 49.788  45.347  22.266  1.00 58.29 ? 235  HIS B CB  1 
ATOM   5874  C  CG  . HIS B 1 232 ? 49.326  46.730  22.585  1.00 58.47 ? 235  HIS B CG  1 
ATOM   5875  N  ND1 . HIS B 1 232 ? 48.745  47.547  21.640  1.00 58.60 ? 235  HIS B ND1 1 
ATOM   5876  C  CD2 . HIS B 1 232 ? 49.428  47.470  23.714  1.00 58.52 ? 235  HIS B CD2 1 
ATOM   5877  C  CE1 . HIS B 1 232 ? 48.511  48.734  22.171  1.00 58.81 ? 235  HIS B CE1 1 
ATOM   5878  N  NE2 . HIS B 1 232 ? 48.917  48.713  23.430  1.00 58.90 ? 235  HIS B NE2 1 
ATOM   5879  N  N   . TYR B 1 233 ? 48.982  42.195  21.899  1.00 58.24 ? 236  TYR B N   1 
ATOM   5880  C  CA  . TYR B 1 233 ? 49.492  40.975  21.301  1.00 58.78 ? 236  TYR B CA  1 
ATOM   5881  C  C   . TYR B 1 233 ? 49.085  40.997  19.838  1.00 59.22 ? 236  TYR B C   1 
ATOM   5882  O  O   . TYR B 1 233 ? 47.923  40.780  19.490  1.00 59.43 ? 236  TYR B O   1 
ATOM   5883  C  CB  . TYR B 1 233 ? 49.033  39.701  22.022  1.00 58.22 ? 236  TYR B CB  1 
ATOM   5884  C  CG  . TYR B 1 233 ? 47.781  39.779  22.864  1.00 57.99 ? 236  TYR B CG  1 
ATOM   5885  C  CD1 . TYR B 1 233 ? 46.769  38.839  22.712  1.00 57.94 ? 236  TYR B CD1 1 
ATOM   5886  C  CD2 . TYR B 1 233 ? 47.646  40.721  23.872  1.00 57.98 ? 236  TYR B CD2 1 
ATOM   5887  C  CE1 . TYR B 1 233 ? 45.660  38.828  23.548  1.00 58.10 ? 236  TYR B CE1 1 
ATOM   5888  C  CE2 . TYR B 1 233 ? 46.537  40.721  24.716  1.00 58.12 ? 236  TYR B CE2 1 
ATOM   5889  C  CZ  . TYR B 1 233 ? 45.551  39.769  24.550  1.00 58.24 ? 236  TYR B CZ  1 
ATOM   5890  O  OH  . TYR B 1 233 ? 44.462  39.746  25.395  1.00 58.66 ? 236  TYR B OH  1 
ATOM   5891  N  N   . LYS B 1 234 ? 50.044  41.375  19.000  1.00 59.95 ? 237  LYS B N   1 
ATOM   5892  C  CA  . LYS B 1 234 ? 49.836  41.492  17.564  1.00 60.66 ? 237  LYS B CA  1 
ATOM   5893  C  C   . LYS B 1 234 ? 49.888  40.159  16.850  1.00 60.48 ? 237  LYS B C   1 
ATOM   5894  O  O   . LYS B 1 234 ? 50.772  39.347  17.114  1.00 60.87 ? 237  LYS B O   1 
ATOM   5895  C  CB  . LYS B 1 234 ? 50.893  42.414  16.967  1.00 61.70 ? 237  LYS B CB  1 
ATOM   5896  C  CG  . LYS B 1 234 ? 50.931  43.828  17.555  1.00 62.75 ? 237  LYS B CG  1 
ATOM   5897  C  CD  . LYS B 1 234 ? 49.651  44.606  17.268  1.00 63.38 ? 237  LYS B CD  1 
ATOM   5898  C  CE  . LYS B 1 234 ? 49.859  46.109  17.399  1.00 63.55 ? 237  LYS B CE  1 
ATOM   5899  N  NZ  . LYS B 1 234 ? 50.551  46.713  16.229  1.00 63.86 ? 237  LYS B NZ  1 
ATOM   5900  N  N   . THR B 1 235 ? 48.967  39.953  15.915  1.00 60.29 ? 238  THR B N   1 
ATOM   5901  C  CA  . THR B 1 235 ? 48.932  38.702  15.179  1.00 60.08 ? 238  THR B CA  1 
ATOM   5902  C  C   . THR B 1 235 ? 50.115  38.565  14.259  1.00 60.40 ? 238  THR B C   1 
ATOM   5903  O  O   . THR B 1 235 ? 50.432  39.464  13.486  1.00 60.39 ? 238  THR B O   1 
ATOM   5904  C  CB  . THR B 1 235 ? 47.675  38.541  14.327  1.00 59.92 ? 238  THR B CB  1 
ATOM   5905  O  OG1 . THR B 1 235 ? 47.876  37.458  13.408  1.00 59.55 ? 238  THR B OG1 1 
ATOM   5906  C  CG2 . THR B 1 235 ? 47.390  39.809  13.546  1.00 59.50 ? 238  THR B CG2 1 
ATOM   5907  N  N   . ASP B 1 236 ? 50.752  37.410  14.332  1.00 60.51 ? 239  ASP B N   1 
ATOM   5908  C  CA  . ASP B 1 236 ? 51.895  37.151  13.493  1.00 60.37 ? 239  ASP B CA  1 
ATOM   5909  C  C   . ASP B 1 236 ? 51.431  36.543  12.185  1.00 60.66 ? 239  ASP B C   1 
ATOM   5910  O  O   . ASP B 1 236 ? 52.242  36.232  11.319  1.00 60.83 ? 239  ASP B O   1 
ATOM   5911  C  CB  . ASP B 1 236 ? 52.886  36.247  14.218  1.00 59.83 ? 239  ASP B CB  1 
ATOM   5912  C  CG  . ASP B 1 236 ? 53.446  36.893  15.474  1.00 59.45 ? 239  ASP B CG  1 
ATOM   5913  O  OD1 . ASP B 1 236 ? 53.757  36.158  16.431  1.00 59.69 ? 239  ASP B OD1 1 
ATOM   5914  O  OD2 . ASP B 1 236 ? 53.570  38.136  15.513  1.00 58.91 ? 239  ASP B OD2 1 
ATOM   5915  N  N   . GLN B 1 237 ? 50.125  36.338  12.052  1.00 60.72 ? 240  GLN B N   1 
ATOM   5916  C  CA  . GLN B 1 237 ? 49.593  35.793  10.815  1.00 60.80 ? 240  GLN B CA  1 
ATOM   5917  C  C   . GLN B 1 237 ? 49.094  36.964  9.989   1.00 60.91 ? 240  GLN B C   1 
ATOM   5918  O  O   . GLN B 1 237 ? 48.591  36.789  8.883   1.00 61.17 ? 240  GLN B O   1 
ATOM   5919  C  CB  . GLN B 1 237 ? 48.476  34.775  11.069  1.00 61.01 ? 240  GLN B CB  1 
ATOM   5920  C  CG  . GLN B 1 237 ? 48.947  33.450  11.692  1.00 61.34 ? 240  GLN B CG  1 
ATOM   5921  C  CD  . GLN B 1 237 ? 49.391  33.609  13.137  1.00 61.74 ? 240  GLN B CD  1 
ATOM   5922  O  OE1 . GLN B 1 237 ? 50.333  32.956  13.596  1.00 61.83 ? 240  GLN B OE1 1 
ATOM   5923  N  NE2 . GLN B 1 237 ? 48.720  34.496  13.860  1.00 61.93 ? 240  GLN B NE2 1 
ATOM   5924  N  N   . GLY B 1 238 ? 49.260  38.167  10.525  1.00 60.82 ? 241  GLY B N   1 
ATOM   5925  C  CA  . GLY B 1 238 ? 48.842  39.352  9.804   1.00 60.98 ? 241  GLY B CA  1 
ATOM   5926  C  C   . GLY B 1 238 ? 47.360  39.635  9.867   1.00 61.31 ? 241  GLY B C   1 
ATOM   5927  O  O   . GLY B 1 238 ? 46.536  38.721  9.887   1.00 60.87 ? 241  GLY B O   1 
ATOM   5928  N  N   . ILE B 1 239 ? 47.027  40.921  9.898   1.00 61.90 ? 242  ILE B N   1 
ATOM   5929  C  CA  . ILE B 1 239 ? 45.644  41.353  9.955   1.00 62.49 ? 242  ILE B CA  1 
ATOM   5930  C  C   . ILE B 1 239 ? 44.932  40.963  8.686   1.00 63.26 ? 242  ILE B C   1 
ATOM   5931  O  O   . ILE B 1 239 ? 45.446  41.172  7.591   1.00 63.33 ? 242  ILE B O   1 
ATOM   5932  C  CB  . ILE B 1 239 ? 45.544  42.866  10.105  1.00 62.05 ? 242  ILE B CB  1 
ATOM   5933  C  CG1 . ILE B 1 239 ? 45.934  43.267  11.521  1.00 62.20 ? 242  ILE B CG1 1 
ATOM   5934  C  CG2 . ILE B 1 239 ? 44.129  43.329  9.823   1.00 62.04 ? 242  ILE B CG2 1 
ATOM   5935  C  CD1 . ILE B 1 239 ? 44.990  42.723  12.582  1.00 62.45 ? 242  ILE B CD1 1 
ATOM   5936  N  N   . LYS B 1 240 ? 43.739  40.406  8.843   1.00 64.24 ? 243  LYS B N   1 
ATOM   5937  C  CA  . LYS B 1 240 ? 42.928  39.997  7.709   1.00 65.07 ? 243  LYS B CA  1 
ATOM   5938  C  C   . LYS B 1 240 ? 41.453  40.031  8.123   1.00 64.94 ? 243  LYS B C   1 
ATOM   5939  O  O   . LYS B 1 240 ? 41.083  39.564  9.207   1.00 65.26 ? 243  LYS B O   1 
ATOM   5940  C  CB  . LYS B 1 240 ? 43.367  38.609  7.219   1.00 66.21 ? 243  LYS B CB  1 
ATOM   5941  C  CG  . LYS B 1 240 ? 42.488  37.995  6.139   1.00 67.81 ? 243  LYS B CG  1 
ATOM   5942  C  CD  . LYS B 1 240 ? 43.299  37.260  5.076   1.00 68.76 ? 243  LYS B CD  1 
ATOM   5943  C  CE  . LYS B 1 240 ? 42.369  36.590  4.066   1.00 69.58 ? 243  LYS B CE  1 
ATOM   5944  N  NZ  . LYS B 1 240 ? 43.056  36.227  2.792   1.00 70.05 ? 243  LYS B NZ  1 
ATOM   5945  N  N   . ASN B 1 241 ? 40.631  40.647  7.275   1.00 64.74 ? 244  ASN B N   1 
ATOM   5946  C  CA  . ASN B 1 241 ? 39.201  40.788  7.529   1.00 64.39 ? 244  ASN B CA  1 
ATOM   5947  C  C   . ASN B 1 241 ? 38.343  40.175  6.430   1.00 64.20 ? 244  ASN B C   1 
ATOM   5948  O  O   . ASN B 1 241 ? 38.841  39.807  5.364   1.00 64.43 ? 244  ASN B O   1 
ATOM   5949  C  CB  . ASN B 1 241 ? 38.845  42.268  7.637   1.00 64.15 ? 244  ASN B CB  1 
ATOM   5950  C  CG  . ASN B 1 241 ? 39.663  42.988  8.678   1.00 64.00 ? 244  ASN B CG  1 
ATOM   5951  O  OD1 . ASN B 1 241 ? 39.690  42.597  9.845   1.00 63.99 ? 244  ASN B OD1 1 
ATOM   5952  N  ND2 . ASN B 1 241 ? 40.321  44.064  8.268   1.00 63.80 ? 244  ASN B ND2 1 
ATOM   5953  N  N   . LEU B 1 242 ? 37.044  40.084  6.697   1.00 63.69 ? 245  LEU B N   1 
ATOM   5954  C  CA  . LEU B 1 242 ? 36.095  39.548  5.735   1.00 63.24 ? 245  LEU B CA  1 
ATOM   5955  C  C   . LEU B 1 242 ? 35.249  40.697  5.234   1.00 63.58 ? 245  LEU B C   1 
ATOM   5956  O  O   . LEU B 1 242 ? 34.936  41.611  5.988   1.00 63.55 ? 245  LEU B O   1 
ATOM   5957  C  CB  . LEU B 1 242 ? 35.187  38.520  6.400   1.00 62.43 ? 245  LEU B CB  1 
ATOM   5958  C  CG  . LEU B 1 242 ? 35.855  37.226  6.844   1.00 61.72 ? 245  LEU B CG  1 
ATOM   5959  C  CD1 . LEU B 1 242 ? 34.928  36.449  7.745   1.00 61.38 ? 245  LEU B CD1 1 
ATOM   5960  C  CD2 . LEU B 1 242 ? 36.232  36.417  5.629   1.00 61.37 ? 245  LEU B CD2 1 
ATOM   5961  N  N   . SER B 1 243 ? 34.886  40.661  3.959   1.00 64.11 ? 246  SER B N   1 
ATOM   5962  C  CA  . SER B 1 243 ? 34.052  41.709  3.388   1.00 64.71 ? 246  SER B CA  1 
ATOM   5963  C  C   . SER B 1 243 ? 32.662  41.498  3.947   1.00 65.43 ? 246  SER B C   1 
ATOM   5964  O  O   . SER B 1 243 ? 32.312  40.384  4.348   1.00 65.66 ? 246  SER B O   1 
ATOM   5965  C  CB  . SER B 1 243 ? 33.986  41.583  1.870   1.00 64.71 ? 246  SER B CB  1 
ATOM   5966  O  OG  . SER B 1 243 ? 33.206  40.460  1.498   1.00 64.96 ? 246  SER B OG  1 
ATOM   5967  N  N   . VAL B 1 244 ? 31.863  42.558  3.938   1.00 66.26 ? 247  VAL B N   1 
ATOM   5968  C  CA  . VAL B 1 244 ? 30.499  42.488  4.439   1.00 67.17 ? 247  VAL B CA  1 
ATOM   5969  C  C   . VAL B 1 244 ? 29.797  41.309  3.783   1.00 67.63 ? 247  VAL B C   1 
ATOM   5970  O  O   . VAL B 1 244 ? 29.200  40.474  4.455   1.00 67.79 ? 247  VAL B O   1 
ATOM   5971  C  CB  . VAL B 1 244 ? 29.720  43.781  4.114   1.00 67.33 ? 247  VAL B CB  1 
ATOM   5972  C  CG1 . VAL B 1 244 ? 28.261  43.630  4.511   1.00 67.68 ? 247  VAL B CG1 1 
ATOM   5973  C  CG2 . VAL B 1 244 ? 30.332  44.962  4.842   1.00 67.48 ? 247  VAL B CG2 1 
ATOM   5974  N  N   . GLU B 1 245 ? 29.945  41.205  2.471   1.00 68.21 ? 248  GLU B N   1 
ATOM   5975  C  CA  . GLU B 1 245 ? 29.315  40.132  1.724   1.00 68.80 ? 248  GLU B CA  1 
ATOM   5976  C  C   . GLU B 1 245 ? 29.785  38.731  2.136   1.00 67.98 ? 248  GLU B C   1 
ATOM   5977  O  O   . GLU B 1 245 ? 28.968  37.856  2.426   1.00 68.11 ? 248  GLU B O   1 
ATOM   5978  C  CB  . GLU B 1 245 ? 29.536  40.351  0.233   1.00 70.65 ? 248  GLU B CB  1 
ATOM   5979  C  CG  . GLU B 1 245 ? 28.704  39.442  -0.645  1.00 73.58 ? 248  GLU B CG  1 
ATOM   5980  C  CD  . GLU B 1 245 ? 29.086  39.557  -2.104  1.00 75.41 ? 248  GLU B CD  1 
ATOM   5981  O  OE1 . GLU B 1 245 ? 30.291  39.363  -2.409  1.00 76.32 ? 248  GLU B OE1 1 
ATOM   5982  O  OE2 . GLU B 1 245 ? 28.189  39.839  -2.938  1.00 76.21 ? 248  GLU B OE2 1 
ATOM   5983  N  N   . ASP B 1 246 ? 31.094  38.515  2.173   1.00 67.14 ? 249  ASP B N   1 
ATOM   5984  C  CA  . ASP B 1 246 ? 31.610  37.211  2.550   1.00 66.29 ? 249  ASP B CA  1 
ATOM   5985  C  C   . ASP B 1 246 ? 31.154  36.782  3.934   1.00 65.76 ? 249  ASP B C   1 
ATOM   5986  O  O   . ASP B 1 246 ? 30.753  35.638  4.138   1.00 65.80 ? 249  ASP B O   1 
ATOM   5987  C  CB  . ASP B 1 246 ? 33.131  37.197  2.471   1.00 66.64 ? 249  ASP B CB  1 
ATOM   5988  C  CG  . ASP B 1 246 ? 33.639  37.167  1.043   1.00 67.18 ? 249  ASP B CG  1 
ATOM   5989  O  OD1 . ASP B 1 246 ? 34.874  37.081  0.849   1.00 67.19 ? 249  ASP B OD1 1 
ATOM   5990  O  OD2 . ASP B 1 246 ? 32.806  37.213  0.109   1.00 67.74 ? 249  ASP B OD2 1 
ATOM   5991  N  N   . ALA B 1 247 ? 31.199  37.708  4.881   1.00 65.03 ? 250  ALA B N   1 
ATOM   5992  C  CA  . ALA B 1 247 ? 30.792  37.405  6.245   1.00 64.56 ? 250  ALA B CA  1 
ATOM   5993  C  C   . ALA B 1 247 ? 29.337  36.974  6.272   1.00 64.21 ? 250  ALA B C   1 
ATOM   5994  O  O   . ALA B 1 247 ? 28.966  36.031  6.971   1.00 64.23 ? 250  ALA B O   1 
ATOM   5995  C  CB  . ALA B 1 247 ? 30.997  38.616  7.131   1.00 64.69 ? 250  ALA B CB  1 
ATOM   5996  N  N   . ALA B 1 248 ? 28.518  37.675  5.498   1.00 63.82 ? 251  ALA B N   1 
ATOM   5997  C  CA  . ALA B 1 248 ? 27.098  37.375  5.416   1.00 63.51 ? 251  ALA B CA  1 
ATOM   5998  C  C   . ALA B 1 248 ? 26.922  35.991  4.827   1.00 63.56 ? 251  ALA B C   1 
ATOM   5999  O  O   . ALA B 1 248 ? 26.091  35.212  5.286   1.00 63.67 ? 251  ALA B O   1 
ATOM   6000  C  CB  . ALA B 1 248 ? 26.394  38.401  4.544   1.00 63.62 ? 251  ALA B CB  1 
ATOM   6001  N  N   . ARG B 1 249 ? 27.712  35.688  3.806   1.00 63.66 ? 252  ARG B N   1 
ATOM   6002  C  CA  . ARG B 1 249 ? 27.633  34.391  3.162   1.00 63.92 ? 252  ARG B CA  1 
ATOM   6003  C  C   . ARG B 1 249 ? 28.051  33.319  4.155   1.00 63.76 ? 252  ARG B C   1 
ATOM   6004  O  O   . ARG B 1 249 ? 27.331  32.357  4.400   1.00 63.60 ? 252  ARG B O   1 
ATOM   6005  C  CB  . ARG B 1 249 ? 28.552  34.350  1.947   1.00 64.51 ? 252  ARG B CB  1 
ATOM   6006  C  CG  . ARG B 1 249 ? 28.179  33.275  0.958   1.00 65.64 ? 252  ARG B CG  1 
ATOM   6007  C  CD  . ARG B 1 249 ? 29.220  33.132  -0.121  1.00 67.08 ? 252  ARG B CD  1 
ATOM   6008  N  NE  . ARG B 1 249 ? 30.426  32.501  0.404   1.00 68.87 ? 252  ARG B NE  1 
ATOM   6009  C  CZ  . ARG B 1 249 ? 31.598  33.115  0.535   1.00 69.83 ? 252  ARG B CZ  1 
ATOM   6010  N  NH1 . ARG B 1 249 ? 31.732  34.392  0.175   1.00 70.26 ? 252  ARG B NH1 1 
ATOM   6011  N  NH2 . ARG B 1 249 ? 32.636  32.449  1.028   1.00 70.03 ? 252  ARG B NH2 1 
ATOM   6012  N  N   . LEU B 1 250 ? 29.202  33.527  4.772   1.00 63.72 ? 253  LEU B N   1 
ATOM   6013  C  CA  . LEU B 1 250 ? 29.723  32.575  5.727   1.00 64.03 ? 253  LEU B CA  1 
ATOM   6014  C  C   . LEU B 1 250 ? 28.794  32.308  6.897   1.00 64.57 ? 253  LEU B C   1 
ATOM   6015  O  O   . LEU B 1 250 ? 28.622  31.160  7.304   1.00 64.91 ? 253  LEU B O   1 
ATOM   6016  C  CB  . LEU B 1 250 ? 31.089  33.033  6.215   1.00 63.64 ? 253  LEU B CB  1 
ATOM   6017  C  CG  . LEU B 1 250 ? 32.176  32.931  5.141   1.00 63.15 ? 253  LEU B CG  1 
ATOM   6018  C  CD1 . LEU B 1 250 ? 33.436  33.625  5.609   1.00 63.04 ? 253  LEU B CD1 1 
ATOM   6019  C  CD2 . LEU B 1 250 ? 32.458  31.463  4.803   1.00 62.66 ? 253  LEU B CD2 1 
ATOM   6020  N  N   . SER B 1 251 ? 28.172  33.353  7.423   1.00 65.21 ? 254  SER B N   1 
ATOM   6021  C  CA  . SER B 1 251 ? 27.262  33.187  8.552   1.00 65.92 ? 254  SER B CA  1 
ATOM   6022  C  C   . SER B 1 251 ? 26.194  32.153  8.221   1.00 66.35 ? 254  SER B C   1 
ATOM   6023  O  O   . SER B 1 251 ? 25.705  31.446  9.099   1.00 66.60 ? 254  SER B O   1 
ATOM   6024  C  CB  . SER B 1 251 ? 26.585  34.513  8.891   1.00 66.20 ? 254  SER B CB  1 
ATOM   6025  O  OG  . SER B 1 251 ? 25.667  34.880  7.874   1.00 66.77 ? 254  SER B OG  1 
ATOM   6026  N  N   . GLN B 1 252 ? 25.824  32.077  6.949   1.00 66.64 ? 255  GLN B N   1 
ATOM   6027  C  CA  . GLN B 1 252 ? 24.813  31.125  6.524   1.00 66.89 ? 255  GLN B CA  1 
ATOM   6028  C  C   . GLN B 1 252 ? 25.416  29.754  6.237   1.00 66.59 ? 255  GLN B C   1 
ATOM   6029  O  O   . GLN B 1 252 ? 24.918  28.735  6.712   1.00 66.56 ? 255  GLN B O   1 
ATOM   6030  C  CB  . GLN B 1 252 ? 24.069  31.669  5.300   1.00 67.86 ? 255  GLN B CB  1 
ATOM   6031  C  CG  . GLN B 1 252 ? 23.092  30.703  4.653   1.00 69.08 ? 255  GLN B CG  1 
ATOM   6032  C  CD  . GLN B 1 252 ? 23.773  29.778  3.661   1.00 70.19 ? 255  GLN B CD  1 
ATOM   6033  O  OE1 . GLN B 1 252 ? 23.838  28.564  3.871   1.00 70.93 ? 255  GLN B OE1 1 
ATOM   6034  N  NE2 . GLN B 1 252 ? 24.307  30.351  2.581   1.00 70.41 ? 255  GLN B NE2 1 
ATOM   6035  N  N   . GLU B 1 253 ? 26.505  29.736  5.479   1.00 66.26 ? 256  GLU B N   1 
ATOM   6036  C  CA  . GLU B 1 253 ? 27.160  28.488  5.119   1.00 65.93 ? 256  GLU B CA  1 
ATOM   6037  C  C   . GLU B 1 253 ? 27.850  27.773  6.265   1.00 65.34 ? 256  GLU B C   1 
ATOM   6038  O  O   . GLU B 1 253 ? 27.809  26.551  6.350   1.00 65.34 ? 256  GLU B O   1 
ATOM   6039  C  CB  . GLU B 1 253 ? 28.145  28.725  3.981   1.00 66.35 ? 256  GLU B CB  1 
ATOM   6040  C  CG  . GLU B 1 253 ? 27.456  29.182  2.710   1.00 67.22 ? 256  GLU B CG  1 
ATOM   6041  C  CD  . GLU B 1 253 ? 28.404  29.365  1.546   1.00 67.98 ? 256  GLU B CD  1 
ATOM   6042  O  OE1 . GLU B 1 253 ? 29.631  29.210  1.731   1.00 68.14 ? 256  GLU B OE1 1 
ATOM   6043  O  OE2 . GLU B 1 253 ? 27.915  29.668  0.438   1.00 68.45 ? 256  GLU B OE2 1 
ATOM   6044  N  N   . ASP B 1 254 ? 28.465  28.530  7.165   1.00 64.88 ? 257  ASP B N   1 
ATOM   6045  C  CA  . ASP B 1 254 ? 29.169  27.922  8.285   1.00 64.22 ? 257  ASP B CA  1 
ATOM   6046  C  C   . ASP B 1 254 ? 29.230  28.876  9.474   1.00 63.75 ? 257  ASP B C   1 
ATOM   6047  O  O   . ASP B 1 254 ? 30.232  29.562  9.696   1.00 63.96 ? 257  ASP B O   1 
ATOM   6048  C  CB  . ASP B 1 254 ? 30.572  27.494  7.837   1.00 64.28 ? 257  ASP B CB  1 
ATOM   6049  C  CG  . ASP B 1 254 ? 31.364  26.818  8.932   1.00 64.38 ? 257  ASP B CG  1 
ATOM   6050  O  OD1 . ASP B 1 254 ? 30.771  26.389  9.944   1.00 64.59 ? 257  ASP B OD1 1 
ATOM   6051  O  OD2 . ASP B 1 254 ? 32.597  26.717  8.773   1.00 64.64 ? 257  ASP B OD2 1 
ATOM   6052  N  N   . PRO B 1 255 ? 28.164  28.885  10.285  1.00 63.20 ? 258  PRO B N   1 
ATOM   6053  C  CA  . PRO B 1 255 ? 28.021  29.728  11.476  1.00 62.74 ? 258  PRO B CA  1 
ATOM   6054  C  C   . PRO B 1 255 ? 29.200  29.581  12.428  1.00 62.63 ? 258  PRO B C   1 
ATOM   6055  O  O   . PRO B 1 255 ? 29.483  30.487  13.218  1.00 62.17 ? 258  PRO B O   1 
ATOM   6056  C  CB  . PRO B 1 255 ? 26.744  29.186  12.119  1.00 62.73 ? 258  PRO B CB  1 
ATOM   6057  C  CG  . PRO B 1 255 ? 25.964  28.664  10.947  1.00 62.63 ? 258  PRO B CG  1 
ATOM   6058  C  CD  . PRO B 1 255 ? 27.018  27.969  10.147  1.00 62.78 ? 258  PRO B CD  1 
ATOM   6059  N  N   . ASP B 1 256 ? 29.897  28.451  12.315  1.00 62.58 ? 259  ASP B N   1 
ATOM   6060  C  CA  . ASP B 1 256 ? 31.029  28.139  13.176  1.00 62.33 ? 259  ASP B CA  1 
ATOM   6061  C  C   . ASP B 1 256 ? 32.400  28.259  12.518  1.00 62.39 ? 259  ASP B C   1 
ATOM   6062  O  O   . ASP B 1 256 ? 33.378  27.674  12.984  1.00 62.46 ? 259  ASP B O   1 
ATOM   6063  C  CB  . ASP B 1 256 ? 30.843  26.741  13.750  1.00 62.05 ? 259  ASP B CB  1 
ATOM   6064  C  CG  . ASP B 1 256 ? 29.517  26.582  14.461  1.00 61.86 ? 259  ASP B CG  1 
ATOM   6065  O  OD1 . ASP B 1 256 ? 29.324  27.220  15.512  1.00 61.97 ? 259  ASP B OD1 1 
ATOM   6066  O  OD2 . ASP B 1 256 ? 28.660  25.822  13.970  1.00 62.22 ? 259  ASP B OD2 1 
ATOM   6067  N  N   . TYR B 1 257 ? 32.469  29.062  11.464  1.00 62.45 ? 260  TYR B N   1 
ATOM   6068  C  CA  . TYR B 1 257 ? 33.697  29.301  10.709  1.00 62.43 ? 260  TYR B CA  1 
ATOM   6069  C  C   . TYR B 1 257 ? 34.949  29.473  11.569  1.00 62.24 ? 260  TYR B C   1 
ATOM   6070  O  O   . TYR B 1 257 ? 35.969  28.813  11.336  1.00 62.21 ? 260  TYR B O   1 
ATOM   6071  C  CB  . TYR B 1 257 ? 33.503  30.540  9.853   1.00 62.64 ? 260  TYR B CB  1 
ATOM   6072  C  CG  . TYR B 1 257 ? 34.661  30.876  8.959   1.00 62.99 ? 260  TYR B CG  1 
ATOM   6073  C  CD1 . TYR B 1 257 ? 35.449  31.992  9.211   1.00 63.12 ? 260  TYR B CD1 1 
ATOM   6074  C  CD2 . TYR B 1 257 ? 34.923  30.130  7.817   1.00 63.26 ? 260  TYR B CD2 1 
ATOM   6075  C  CE1 . TYR B 1 257 ? 36.469  32.367  8.343   1.00 63.56 ? 260  TYR B CE1 1 
ATOM   6076  C  CE2 . TYR B 1 257 ? 35.944  30.496  6.939   1.00 63.71 ? 260  TYR B CE2 1 
ATOM   6077  C  CZ  . TYR B 1 257 ? 36.708  31.620  7.209   1.00 63.68 ? 260  TYR B CZ  1 
ATOM   6078  O  OH  . TYR B 1 257 ? 37.688  32.020  6.331   1.00 64.10 ? 260  TYR B OH  1 
ATOM   6079  N  N   . GLY B 1 258 ? 34.860  30.363  12.556  1.00 61.95 ? 261  GLY B N   1 
ATOM   6080  C  CA  . GLY B 1 258 ? 35.981  30.626  13.448  1.00 61.72 ? 261  GLY B CA  1 
ATOM   6081  C  C   . GLY B 1 258 ? 36.477  29.388  14.167  1.00 61.61 ? 261  GLY B C   1 
ATOM   6082  O  O   . GLY B 1 258 ? 37.681  29.139  14.257  1.00 61.58 ? 261  GLY B O   1 
ATOM   6083  N  N   . ILE B 1 259 ? 35.542  28.605  14.684  1.00 61.43 ? 262  ILE B N   1 
ATOM   6084  C  CA  . ILE B 1 259 ? 35.884  27.379  15.383  1.00 61.04 ? 262  ILE B CA  1 
ATOM   6085  C  C   . ILE B 1 259 ? 36.610  26.440  14.429  1.00 61.10 ? 262  ILE B C   1 
ATOM   6086  O  O   . ILE B 1 259 ? 37.726  26.001  14.703  1.00 61.44 ? 262  ILE B O   1 
ATOM   6087  C  CB  . ILE B 1 259 ? 34.623  26.694  15.904  1.00 60.83 ? 262  ILE B CB  1 
ATOM   6088  C  CG1 . ILE B 1 259 ? 33.982  27.568  16.980  1.00 60.81 ? 262  ILE B CG1 1 
ATOM   6089  C  CG2 . ILE B 1 259 ? 34.945  25.306  16.434  1.00 60.63 ? 262  ILE B CG2 1 
ATOM   6090  C  CD1 . ILE B 1 259 ? 32.692  27.009  17.535  1.00 61.03 ? 262  ILE B CD1 1 
ATOM   6091  N  N   . ARG B 1 260 ? 35.991  26.171  13.286  1.00 60.88 ? 263  ARG B N   1 
ATOM   6092  C  CA  . ARG B 1 260 ? 36.586  25.284  12.302  1.00 60.58 ? 263  ARG B CA  1 
ATOM   6093  C  C   . ARG B 1 260 ? 37.990  25.743  11.938  1.00 60.42 ? 263  ARG B C   1 
ATOM   6094  O  O   . ARG B 1 260 ? 38.962  24.996  12.094  1.00 60.46 ? 263  ARG B O   1 
ATOM   6095  C  CB  . ARG B 1 260 ? 35.720  25.239  11.049  1.00 60.47 ? 263  ARG B CB  1 
ATOM   6096  C  CG  . ARG B 1 260 ? 36.113  24.150  10.071  1.00 60.44 ? 263  ARG B CG  1 
ATOM   6097  C  CD  . ARG B 1 260 ? 35.266  24.199  8.817   1.00 60.06 ? 263  ARG B CD  1 
ATOM   6098  N  NE  . ARG B 1 260 ? 33.842  24.278  9.132   1.00 60.29 ? 263  ARG B NE  1 
ATOM   6099  C  CZ  . ARG B 1 260 ? 33.086  23.239  9.475   1.00 60.13 ? 263  ARG B CZ  1 
ATOM   6100  N  NH1 . ARG B 1 260 ? 33.615  22.019  9.550   1.00 60.08 ? 263  ARG B NH1 1 
ATOM   6101  N  NH2 . ARG B 1 260 ? 31.794  23.423  9.737   1.00 59.40 ? 263  ARG B NH2 1 
ATOM   6102  N  N   . ASP B 1 261 ? 38.096  26.988  11.493  1.00 60.30 ? 264  ASP B N   1 
ATOM   6103  C  CA  . ASP B 1 261 ? 39.380  27.541  11.098  1.00 60.26 ? 264  ASP B CA  1 
ATOM   6104  C  C   . ASP B 1 261 ? 40.465  27.255  12.124  1.00 60.16 ? 264  ASP B C   1 
ATOM   6105  O  O   . ASP B 1 261 ? 41.472  26.620  11.815  1.00 60.16 ? 264  ASP B O   1 
ATOM   6106  C  CB  . ASP B 1 261 ? 39.265  29.045  10.885  1.00 60.48 ? 264  ASP B CB  1 
ATOM   6107  C  CG  . ASP B 1 261 ? 40.593  29.681  10.536  1.00 60.72 ? 264  ASP B CG  1 
ATOM   6108  O  OD1 . ASP B 1 261 ? 41.023  29.538  9.373   1.00 61.37 ? 264  ASP B OD1 1 
ATOM   6109  O  OD2 . ASP B 1 261 ? 41.210  30.307  11.422  1.00 60.74 ? 264  ASP B OD2 1 
ATOM   6110  N  N   . LEU B 1 262 ? 40.234  27.697  13.353  1.00 60.25 ? 265  LEU B N   1 
ATOM   6111  C  CA  . LEU B 1 262 ? 41.194  27.503  14.427  1.00 60.35 ? 265  LEU B CA  1 
ATOM   6112  C  C   . LEU B 1 262 ? 41.546  26.052  14.684  1.00 60.88 ? 265  LEU B C   1 
ATOM   6113  O  O   . LEU B 1 262 ? 42.722  25.699  14.754  1.00 60.87 ? 265  LEU B O   1 
ATOM   6114  C  CB  . LEU B 1 262 ? 40.681  28.125  15.715  1.00 59.63 ? 265  LEU B CB  1 
ATOM   6115  C  CG  . LEU B 1 262 ? 41.624  27.920  16.895  1.00 59.19 ? 265  LEU B CG  1 
ATOM   6116  C  CD1 . LEU B 1 262 ? 42.981  28.527  16.594  1.00 58.73 ? 265  LEU B CD1 1 
ATOM   6117  C  CD2 . LEU B 1 262 ? 41.019  28.538  18.131  1.00 59.02 ? 265  LEU B CD2 1 
ATOM   6118  N  N   . PHE B 1 263 ? 40.535  25.210  14.837  1.00 61.34 ? 266  PHE B N   1 
ATOM   6119  C  CA  . PHE B 1 263 ? 40.791  23.809  15.104  1.00 62.03 ? 266  PHE B CA  1 
ATOM   6120  C  C   . PHE B 1 263 ? 41.672  23.202  14.039  1.00 62.57 ? 266  PHE B C   1 
ATOM   6121  O  O   . PHE B 1 263 ? 42.701  22.604  14.346  1.00 63.12 ? 266  PHE B O   1 
ATOM   6122  C  CB  . PHE B 1 263 ? 39.501  23.015  15.181  1.00 62.02 ? 266  PHE B CB  1 
ATOM   6123  C  CG  . PHE B 1 263 ? 39.705  21.594  15.609  1.00 62.24 ? 266  PHE B CG  1 
ATOM   6124  C  CD1 . PHE B 1 263 ? 40.000  20.606  14.677  1.00 62.06 ? 266  PHE B CD1 1 
ATOM   6125  C  CD2 . PHE B 1 263 ? 39.624  21.246  16.955  1.00 62.36 ? 266  PHE B CD2 1 
ATOM   6126  C  CE1 . PHE B 1 263 ? 40.213  19.296  15.075  1.00 62.08 ? 266  PHE B CE1 1 
ATOM   6127  C  CE2 . PHE B 1 263 ? 39.835  19.938  17.366  1.00 62.31 ? 266  PHE B CE2 1 
ATOM   6128  C  CZ  . PHE B 1 263 ? 40.131  18.960  16.423  1.00 62.28 ? 266  PHE B CZ  1 
ATOM   6129  N  N   . ASN B 1 264 ? 41.259  23.345  12.784  1.00 62.92 ? 267  ASN B N   1 
ATOM   6130  C  CA  . ASN B 1 264 ? 42.025  22.795  11.671  1.00 63.07 ? 267  ASN B CA  1 
ATOM   6131  C  C   . ASN B 1 264 ? 43.449  23.332  11.619  1.00 62.93 ? 267  ASN B C   1 
ATOM   6132  O  O   . ASN B 1 264 ? 44.405  22.565  11.505  1.00 62.91 ? 267  ASN B O   1 
ATOM   6133  C  CB  . ASN B 1 264 ? 41.312  23.060  10.347  1.00 63.20 ? 267  ASN B CB  1 
ATOM   6134  C  CG  . ASN B 1 264 ? 40.288  21.997  10.019  1.00 63.46 ? 267  ASN B CG  1 
ATOM   6135  O  OD1 . ASN B 1 264 ? 40.336  20.879  10.543  1.00 63.51 ? 267  ASN B OD1 1 
ATOM   6136  N  ND2 . ASN B 1 264 ? 39.359  22.330  9.134   1.00 63.74 ? 267  ASN B ND2 1 
ATOM   6137  N  N   . ALA B 1 265 ? 43.581  24.650  11.721  1.00 62.67 ? 268  ALA B N   1 
ATOM   6138  C  CA  . ALA B 1 265 ? 44.884  25.289  11.688  1.00 62.32 ? 268  ALA B CA  1 
ATOM   6139  C  C   . ALA B 1 265 ? 45.829  24.525  12.598  1.00 62.41 ? 268  ALA B C   1 
ATOM   6140  O  O   . ALA B 1 265 ? 46.836  23.982  12.154  1.00 62.72 ? 268  ALA B O   1 
ATOM   6141  C  CB  . ALA B 1 265 ? 44.765  26.732  12.144  1.00 62.08 ? 268  ALA B CB  1 
ATOM   6142  N  N   . ILE B 1 266 ? 45.446  24.412  13.861  1.00 62.56 ? 269  ILE B N   1 
ATOM   6143  C  CA  . ILE B 1 266 ? 46.255  23.709  14.845  1.00 62.75 ? 269  ILE B CA  1 
ATOM   6144  C  C   . ILE B 1 266 ? 46.431  22.242  14.486  1.00 62.94 ? 269  ILE B C   1 
ATOM   6145  O  O   . ILE B 1 266 ? 47.528  21.689  14.591  1.00 62.85 ? 269  ILE B O   1 
ATOM   6146  C  CB  . ILE B 1 266 ? 45.612  23.817  16.232  1.00 62.83 ? 269  ILE B CB  1 
ATOM   6147  C  CG1 . ILE B 1 266 ? 45.615  25.280  16.673  1.00 62.89 ? 269  ILE B CG1 1 
ATOM   6148  C  CG2 . ILE B 1 266 ? 46.334  22.921  17.235  1.00 62.66 ? 269  ILE B CG2 1 
ATOM   6149  C  CD1 . ILE B 1 266 ? 44.966  25.521  18.016  1.00 63.45 ? 269  ILE B CD1 1 
ATOM   6150  N  N   . ALA B 1 267 ? 45.346  21.619  14.044  1.00 63.10 ? 270  ALA B N   1 
ATOM   6151  C  CA  . ALA B 1 267 ? 45.376  20.210  13.686  1.00 63.42 ? 270  ALA B CA  1 
ATOM   6152  C  C   . ALA B 1 267 ? 46.378  19.921  12.580  1.00 63.77 ? 270  ALA B C   1 
ATOM   6153  O  O   . ALA B 1 267 ? 46.944  18.835  12.527  1.00 64.09 ? 270  ALA B O   1 
ATOM   6154  C  CB  . ALA B 1 267 ? 43.990  19.750  13.268  1.00 63.30 ? 270  ALA B CB  1 
ATOM   6155  N  N   . THR B 1 268 ? 46.600  20.898  11.708  1.00 64.27 ? 271  THR B N   1 
ATOM   6156  C  CA  . THR B 1 268 ? 47.527  20.725  10.595  1.00 64.65 ? 271  THR B CA  1 
ATOM   6157  C  C   . THR B 1 268 ? 48.920  21.256  10.862  1.00 65.06 ? 271  THR B C   1 
ATOM   6158  O  O   . THR B 1 268 ? 49.775  21.221  9.977   1.00 65.16 ? 271  THR B O   1 
ATOM   6159  C  CB  . THR B 1 268 ? 47.003  21.377  9.308   1.00 64.61 ? 271  THR B CB  1 
ATOM   6160  O  OG1 . THR B 1 268 ? 46.667  22.746  9.565   1.00 64.91 ? 271  THR B OG1 1 
ATOM   6161  C  CG2 . THR B 1 268 ? 45.780  20.644  8.808   1.00 64.12 ? 271  THR B CG2 1 
ATOM   6162  N  N   . GLY B 1 269 ? 49.142  21.780  12.063  1.00 65.52 ? 272  GLY B N   1 
ATOM   6163  C  CA  . GLY B 1 269 ? 50.460  22.291  12.404  1.00 65.89 ? 272  GLY B CA  1 
ATOM   6164  C  C   . GLY B 1 269 ? 50.715  23.780  12.239  1.00 66.14 ? 272  GLY B C   1 
ATOM   6165  O  O   . GLY B 1 269 ? 51.733  24.278  12.715  1.00 66.30 ? 272  GLY B O   1 
ATOM   6166  N  N   . LYS B 1 270 ? 49.818  24.499  11.577  1.00 66.19 ? 273  LYS B N   1 
ATOM   6167  C  CA  . LYS B 1 270 ? 50.008  25.929  11.391  1.00 66.37 ? 273  LYS B CA  1 
ATOM   6168  C  C   . LYS B 1 270 ? 49.621  26.675  12.650  1.00 65.89 ? 273  LYS B C   1 
ATOM   6169  O  O   . LYS B 1 270 ? 48.682  27.463  12.644  1.00 65.92 ? 273  LYS B O   1 
ATOM   6170  C  CB  . LYS B 1 270 ? 49.170  26.425  10.222  1.00 67.38 ? 273  LYS B CB  1 
ATOM   6171  C  CG  . LYS B 1 270 ? 49.356  25.592  8.983   1.00 69.06 ? 273  LYS B CG  1 
ATOM   6172  C  CD  . LYS B 1 270 ? 48.578  26.164  7.817   1.00 70.31 ? 273  LYS B CD  1 
ATOM   6173  C  CE  . LYS B 1 270 ? 48.484  25.143  6.690   1.00 71.12 ? 273  LYS B CE  1 
ATOM   6174  N  NZ  . LYS B 1 270 ? 47.733  23.930  7.134   1.00 71.88 ? 273  LYS B NZ  1 
ATOM   6175  N  N   . TYR B 1 271 ? 50.351  26.425  13.729  1.00 65.55 ? 274  TYR B N   1 
ATOM   6176  C  CA  . TYR B 1 271 ? 50.078  27.076  15.007  1.00 65.23 ? 274  TYR B CA  1 
ATOM   6177  C  C   . TYR B 1 271 ? 50.153  28.596  14.899  1.00 65.20 ? 274  TYR B C   1 
ATOM   6178  O  O   . TYR B 1 271 ? 51.137  29.148  14.408  1.00 65.40 ? 274  TYR B O   1 
ATOM   6179  C  CB  . TYR B 1 271 ? 51.065  26.601  16.077  1.00 64.57 ? 274  TYR B CB  1 
ATOM   6180  C  CG  . TYR B 1 271 ? 51.202  25.106  16.165  1.00 64.11 ? 274  TYR B CG  1 
ATOM   6181  C  CD1 . TYR B 1 271 ? 52.451  24.517  16.324  1.00 63.85 ? 274  TYR B CD1 1 
ATOM   6182  C  CD2 . TYR B 1 271 ? 50.089  24.277  16.067  1.00 63.86 ? 274  TYR B CD2 1 
ATOM   6183  C  CE1 . TYR B 1 271 ? 52.593  23.138  16.379  1.00 63.81 ? 274  TYR B CE1 1 
ATOM   6184  C  CE2 . TYR B 1 271 ? 50.217  22.894  16.121  1.00 63.95 ? 274  TYR B CE2 1 
ATOM   6185  C  CZ  . TYR B 1 271 ? 51.474  22.332  16.276  1.00 63.99 ? 274  TYR B CZ  1 
ATOM   6186  O  OH  . TYR B 1 271 ? 51.622  20.964  16.309  1.00 64.28 ? 274  TYR B OH  1 
ATOM   6187  N  N   . PRO B 1 272 ? 49.089  29.291  15.323  1.00 64.99 ? 275  PRO B N   1 
ATOM   6188  C  CA  . PRO B 1 272 ? 49.044  30.751  15.277  1.00 64.65 ? 275  PRO B CA  1 
ATOM   6189  C  C   . PRO B 1 272 ? 49.821  31.357  16.447  1.00 64.27 ? 275  PRO B C   1 
ATOM   6190  O  O   . PRO B 1 272 ? 49.847  30.796  17.544  1.00 64.36 ? 275  PRO B O   1 
ATOM   6191  C  CB  . PRO B 1 272 ? 47.551  31.030  15.386  1.00 64.98 ? 275  PRO B CB  1 
ATOM   6192  C  CG  . PRO B 1 272 ? 47.088  29.944  16.314  1.00 64.68 ? 275  PRO B CG  1 
ATOM   6193  C  CD  . PRO B 1 272 ? 47.795  28.736  15.760  1.00 64.95 ? 275  PRO B CD  1 
ATOM   6194  N  N   . SER B 1 273 ? 50.452  32.498  16.217  1.00 63.83 ? 276  SER B N   1 
ATOM   6195  C  CA  . SER B 1 273 ? 51.221  33.140  17.271  1.00 63.46 ? 276  SER B CA  1 
ATOM   6196  C  C   . SER B 1 273 ? 51.032  34.642  17.237  1.00 63.50 ? 276  SER B C   1 
ATOM   6197  O  O   . SER B 1 273 ? 50.660  35.212  16.208  1.00 63.66 ? 276  SER B O   1 
ATOM   6198  C  CB  . SER B 1 273 ? 52.704  32.802  17.130  1.00 63.28 ? 276  SER B CB  1 
ATOM   6199  O  OG  . SER B 1 273 ? 53.200  33.244  15.877  1.00 63.01 ? 276  SER B OG  1 
ATOM   6200  N  N   . TRP B 1 274 ? 51.272  35.277  18.376  1.00 63.09 ? 277  TRP B N   1 
ATOM   6201  C  CA  . TRP B 1 274 ? 51.131  36.719  18.495  1.00 62.70 ? 277  TRP B CA  1 
ATOM   6202  C  C   . TRP B 1 274 ? 52.335  37.261  19.218  1.00 62.57 ? 277  TRP B C   1 
ATOM   6203  O  O   . TRP B 1 274 ? 52.864  36.601  20.112  1.00 62.98 ? 277  TRP B O   1 
ATOM   6204  C  CB  . TRP B 1 274 ? 49.899  37.069  19.321  1.00 62.31 ? 277  TRP B CB  1 
ATOM   6205  C  CG  . TRP B 1 274 ? 48.603  36.840  18.636  1.00 62.09 ? 277  TRP B CG  1 
ATOM   6206  C  CD1 . TRP B 1 274 ? 47.776  37.791  18.131  1.00 62.14 ? 277  TRP B CD1 1 
ATOM   6207  C  CD2 . TRP B 1 274 ? 47.952  35.587  18.423  1.00 61.81 ? 277  TRP B CD2 1 
ATOM   6208  N  NE1 . TRP B 1 274 ? 46.644  37.212  17.617  1.00 62.03 ? 277  TRP B NE1 1 
ATOM   6209  C  CE2 . TRP B 1 274 ? 46.727  35.857  17.786  1.00 61.71 ? 277  TRP B CE2 1 
ATOM   6210  C  CE3 . TRP B 1 274 ? 48.282  34.259  18.714  1.00 61.72 ? 277  TRP B CE3 1 
ATOM   6211  C  CZ2 . TRP B 1 274 ? 45.829  34.854  17.434  1.00 61.64 ? 277  TRP B CZ2 1 
ATOM   6212  C  CZ3 . TRP B 1 274 ? 47.389  33.258  18.364  1.00 61.52 ? 277  TRP B CZ3 1 
ATOM   6213  C  CH2 . TRP B 1 274 ? 46.176  33.561  17.732  1.00 61.61 ? 277  TRP B CH2 1 
ATOM   6214  N  N   . THR B 1 275 ? 52.779  38.450  18.827  1.00 62.49 ? 278  THR B N   1 
ATOM   6215  C  CA  . THR B 1 275 ? 53.912  39.069  19.495  1.00 62.29 ? 278  THR B CA  1 
ATOM   6216  C  C   . THR B 1 275 ? 53.338  39.929  20.604  1.00 62.34 ? 278  THR B C   1 
ATOM   6217  O  O   . THR B 1 275 ? 52.502  40.799  20.362  1.00 62.29 ? 278  THR B O   1 
ATOM   6218  C  CB  . THR B 1 275 ? 54.737  39.924  18.546  1.00 62.12 ? 278  THR B CB  1 
ATOM   6219  O  OG1 . THR B 1 275 ? 55.113  39.132  17.415  1.00 62.51 ? 278  THR B OG1 1 
ATOM   6220  C  CG2 . THR B 1 275 ? 55.995  40.398  19.233  1.00 61.79 ? 278  THR B CG2 1 
ATOM   6221  N  N   . PHE B 1 276 ? 53.760  39.634  21.827  1.00 62.12 ? 279  PHE B N   1 
ATOM   6222  C  CA  . PHE B 1 276 ? 53.298  40.327  23.016  1.00 62.13 ? 279  PHE B CA  1 
ATOM   6223  C  C   . PHE B 1 276 ? 54.138  41.576  23.257  1.00 62.50 ? 279  PHE B C   1 
ATOM   6224  O  O   . PHE B 1 276 ? 55.364  41.500  23.284  1.00 62.73 ? 279  PHE B O   1 
ATOM   6225  C  CB  . PHE B 1 276 ? 53.431  39.373  24.199  1.00 61.67 ? 279  PHE B CB  1 
ATOM   6226  C  CG  . PHE B 1 276 ? 52.535  39.699  25.352  1.00 61.48 ? 279  PHE B CG  1 
ATOM   6227  C  CD1 . PHE B 1 276 ? 51.214  39.266  25.364  1.00 61.19 ? 279  PHE B CD1 1 
ATOM   6228  C  CD2 . PHE B 1 276 ? 53.010  40.424  26.437  1.00 61.16 ? 279  PHE B CD2 1 
ATOM   6229  C  CE1 . PHE B 1 276 ? 50.380  39.552  26.444  1.00 61.02 ? 279  PHE B CE1 1 
ATOM   6230  C  CE2 . PHE B 1 276 ? 52.183  40.714  27.520  1.00 60.90 ? 279  PHE B CE2 1 
ATOM   6231  C  CZ  . PHE B 1 276 ? 50.865  40.276  27.524  1.00 60.84 ? 279  PHE B CZ  1 
ATOM   6232  N  N   . TYR B 1 277 ? 53.478  42.727  23.393  1.00 62.87 ? 280  TYR B N   1 
ATOM   6233  C  CA  . TYR B 1 277 ? 54.158  44.002  23.651  1.00 63.17 ? 280  TYR B CA  1 
ATOM   6234  C  C   . TYR B 1 277 ? 53.471  44.724  24.795  1.00 63.36 ? 280  TYR B C   1 
ATOM   6235  O  O   . TYR B 1 277 ? 52.338  44.393  25.167  1.00 63.45 ? 280  TYR B O   1 
ATOM   6236  C  CB  . TYR B 1 277 ? 54.060  44.959  22.460  1.00 63.40 ? 280  TYR B CB  1 
ATOM   6237  C  CG  . TYR B 1 277 ? 54.657  44.497  21.163  1.00 63.95 ? 280  TYR B CG  1 
ATOM   6238  C  CD1 . TYR B 1 277 ? 55.960  44.834  20.818  1.00 64.11 ? 280  TYR B CD1 1 
ATOM   6239  C  CD2 . TYR B 1 277 ? 53.898  43.777  20.246  1.00 64.12 ? 280  TYR B CD2 1 
ATOM   6240  C  CE1 . TYR B 1 277 ? 56.490  44.469  19.586  1.00 64.17 ? 280  TYR B CE1 1 
ATOM   6241  C  CE2 . TYR B 1 277 ? 54.418  43.409  19.012  1.00 64.26 ? 280  TYR B CE2 1 
ATOM   6242  C  CZ  . TYR B 1 277 ? 55.714  43.759  18.688  1.00 64.28 ? 280  TYR B CZ  1 
ATOM   6243  O  OH  . TYR B 1 277 ? 56.232  43.399  17.465  1.00 64.31 ? 280  TYR B OH  1 
ATOM   6244  N  N   . ILE B 1 278 ? 54.133  45.762  25.296  1.00 63.41 ? 281  ILE B N   1 
ATOM   6245  C  CA  . ILE B 1 278 ? 53.577  46.586  26.358  1.00 63.58 ? 281  ILE B CA  1 
ATOM   6246  C  C   . ILE B 1 278 ? 53.943  48.022  26.088  1.00 64.00 ? 281  ILE B C   1 
ATOM   6247  O  O   . ILE B 1 278 ? 54.901  48.303  25.373  1.00 64.33 ? 281  ILE B O   1 
ATOM   6248  C  CB  . ILE B 1 278 ? 54.153  46.266  27.739  1.00 63.28 ? 281  ILE B CB  1 
ATOM   6249  C  CG1 . ILE B 1 278 ? 55.671  46.399  27.721  1.00 63.05 ? 281  ILE B CG1 1 
ATOM   6250  C  CG2 . ILE B 1 278 ? 53.706  44.904  28.201  1.00 63.29 ? 281  ILE B CG2 1 
ATOM   6251  C  CD1 . ILE B 1 278 ? 56.283  46.360  29.088  1.00 62.61 ? 281  ILE B CD1 1 
ATOM   6252  N  N   . GLN B 1 279 ? 53.133  48.929  26.608  1.00 64.29 ? 282  GLN B N   1 
ATOM   6253  C  CA  . GLN B 1 279 ? 53.403  50.345  26.479  1.00 64.69 ? 282  GLN B CA  1 
ATOM   6254  C  C   . GLN B 1 279 ? 53.643  50.741  27.909  1.00 64.86 ? 282  GLN B C   1 
ATOM   6255  O  O   . GLN B 1 279 ? 53.144  50.087  28.822  1.00 64.96 ? 282  GLN B O   1 
ATOM   6256  C  CB  . GLN B 1 279 ? 52.202  51.096  25.911  1.00 64.83 ? 282  GLN B CB  1 
ATOM   6257  C  CG  . GLN B 1 279 ? 52.053  50.934  24.412  1.00 65.24 ? 282  GLN B CG  1 
ATOM   6258  C  CD  . GLN B 1 279 ? 50.899  51.732  23.841  1.00 65.40 ? 282  GLN B CD  1 
ATOM   6259  O  OE1 . GLN B 1 279 ? 49.736  51.357  23.987  1.00 65.80 ? 282  GLN B OE1 1 
ATOM   6260  N  NE2 . GLN B 1 279 ? 51.216  52.836  23.173  1.00 65.46 ? 282  GLN B NE2 1 
ATOM   6261  N  N   . VAL B 1 280 ? 54.433  51.780  28.124  1.00 65.12 ? 283  VAL B N   1 
ATOM   6262  C  CA  . VAL B 1 280 ? 54.708  52.188  29.484  1.00 65.34 ? 283  VAL B CA  1 
ATOM   6263  C  C   . VAL B 1 280 ? 54.610  53.679  29.710  1.00 65.84 ? 283  VAL B C   1 
ATOM   6264  O  O   . VAL B 1 280 ? 55.232  54.476  29.009  1.00 66.12 ? 283  VAL B O   1 
ATOM   6265  C  CB  . VAL B 1 280 ? 56.093  51.697  29.941  1.00 65.00 ? 283  VAL B CB  1 
ATOM   6266  C  CG1 . VAL B 1 280 ? 56.409  52.226  31.328  1.00 64.79 ? 283  VAL B CG1 1 
ATOM   6267  C  CG2 . VAL B 1 280 ? 56.138  50.183  29.944  1.00 64.57 ? 283  VAL B CG2 1 
ATOM   6268  N  N   . MET B 1 281 ? 53.824  54.043  30.713  1.00 66.22 ? 284  MET B N   1 
ATOM   6269  C  CA  . MET B 1 281 ? 53.646  55.429  31.079  1.00 66.70 ? 284  MET B CA  1 
ATOM   6270  C  C   . MET B 1 281 ? 54.003  55.560  32.552  1.00 66.97 ? 284  MET B C   1 
ATOM   6271  O  O   . MET B 1 281 ? 53.441  54.864  33.398  1.00 67.44 ? 284  MET B O   1 
ATOM   6272  C  CB  . MET B 1 281 ? 52.199  55.846  30.869  1.00 66.73 ? 284  MET B CB  1 
ATOM   6273  C  CG  . MET B 1 281 ? 51.914  57.267  31.303  1.00 67.39 ? 284  MET B CG  1 
ATOM   6274  S  SD  . MET B 1 281 ? 50.153  57.623  31.328  1.00 68.03 ? 284  MET B SD  1 
ATOM   6275  C  CE  . MET B 1 281 ? 49.864  57.763  29.583  1.00 67.61 ? 284  MET B CE  1 
ATOM   6276  N  N   . THR B 1 282 ? 54.966  56.422  32.854  1.00 67.07 ? 285  THR B N   1 
ATOM   6277  C  CA  . THR B 1 282 ? 55.378  56.635  34.233  1.00 66.93 ? 285  THR B CA  1 
ATOM   6278  C  C   . THR B 1 282 ? 54.315  57.487  34.882  1.00 66.90 ? 285  THR B C   1 
ATOM   6279  O  O   . THR B 1 282 ? 53.504  58.111  34.199  1.00 66.96 ? 285  THR B O   1 
ATOM   6280  C  CB  . THR B 1 282 ? 56.678  57.419  34.305  1.00 67.12 ? 285  THR B CB  1 
ATOM   6281  O  OG1 . THR B 1 282 ? 56.473  58.709  33.715  1.00 67.42 ? 285  THR B OG1 1 
ATOM   6282  C  CG2 . THR B 1 282 ? 57.786  56.695  33.564  1.00 66.83 ? 285  THR B CG2 1 
ATOM   6283  N  N   . PHE B 1 283 ? 54.357  57.563  36.201  1.00 66.96 ? 286  PHE B N   1 
ATOM   6284  C  CA  . PHE B 1 283 ? 53.389  58.361  36.925  1.00 67.20 ? 286  PHE B CA  1 
ATOM   6285  C  C   . PHE B 1 283 ? 53.500  59.824  36.572  1.00 67.59 ? 286  PHE B C   1 
ATOM   6286  O  O   . PHE B 1 283 ? 52.518  60.552  36.652  1.00 67.68 ? 286  PHE B O   1 
ATOM   6287  C  CB  . PHE B 1 283 ? 53.531  58.134  38.418  1.00 66.80 ? 286  PHE B CB  1 
ATOM   6288  C  CG  . PHE B 1 283 ? 53.103  56.767  38.839  1.00 66.77 ? 286  PHE B CG  1 
ATOM   6289  C  CD1 . PHE B 1 283 ? 53.182  55.703  37.948  1.00 66.68 ? 286  PHE B CD1 1 
ATOM   6290  C  CD2 . PHE B 1 283 ? 52.590  56.541  40.101  1.00 66.76 ? 286  PHE B CD2 1 
ATOM   6291  C  CE1 . PHE B 1 283 ? 52.758  54.444  38.307  1.00 66.66 ? 286  PHE B CE1 1 
ATOM   6292  C  CE2 . PHE B 1 283 ? 52.160  55.275  40.472  1.00 66.79 ? 286  PHE B CE2 1 
ATOM   6293  C  CZ  . PHE B 1 283 ? 52.245  54.227  39.571  1.00 66.82 ? 286  PHE B CZ  1 
ATOM   6294  N  N   . ASN B 1 284 ? 54.688  60.239  36.138  1.00 68.09 ? 287  ASN B N   1 
ATOM   6295  C  CA  . ASN B 1 284 ? 54.913  61.621  35.734  1.00 68.55 ? 287  ASN B CA  1 
ATOM   6296  C  C   . ASN B 1 284 ? 54.209  61.898  34.417  1.00 68.61 ? 287  ASN B C   1 
ATOM   6297  O  O   . ASN B 1 284 ? 53.581  62.941  34.250  1.00 68.81 ? 287  ASN B O   1 
ATOM   6298  C  CB  . ASN B 1 284 ? 56.404  61.909  35.579  1.00 69.05 ? 287  ASN B CB  1 
ATOM   6299  C  CG  . ASN B 1 284 ? 57.076  62.230  36.896  1.00 69.89 ? 287  ASN B CG  1 
ATOM   6300  O  OD1 . ASN B 1 284 ? 58.303  62.283  36.979  1.00 70.43 ? 287  ASN B OD1 1 
ATOM   6301  N  ND2 . ASN B 1 284 ? 56.278  62.461  37.934  1.00 70.28 ? 287  ASN B ND2 1 
ATOM   6302  N  N   . GLN B 1 285 ? 54.326  60.966  33.480  1.00 68.46 ? 288  GLN B N   1 
ATOM   6303  C  CA  . GLN B 1 285 ? 53.692  61.124  32.184  1.00 68.32 ? 288  GLN B CA  1 
ATOM   6304  C  C   . GLN B 1 285 ? 52.188  61.134  32.358  1.00 69.03 ? 288  GLN B C   1 
ATOM   6305  O  O   . GLN B 1 285 ? 51.487  61.918  31.721  1.00 69.34 ? 288  GLN B O   1 
ATOM   6306  C  CB  . GLN B 1 285 ? 54.103  59.991  31.256  1.00 67.64 ? 288  GLN B CB  1 
ATOM   6307  C  CG  . GLN B 1 285 ? 55.599  59.884  31.063  1.00 66.69 ? 288  GLN B CG  1 
ATOM   6308  C  CD  . GLN B 1 285 ? 55.992  58.769  30.118  1.00 66.27 ? 288  GLN B CD  1 
ATOM   6309  O  OE1 . GLN B 1 285 ? 56.120  57.613  30.520  1.00 65.92 ? 288  GLN B OE1 1 
ATOM   6310  N  NE2 . GLN B 1 285 ? 56.197  59.111  28.852  1.00 65.88 ? 288  GLN B NE2 1 
ATOM   6311  N  N   . ALA B 1 286 ? 51.699  60.290  33.260  1.00 69.65 ? 289  ALA B N   1 
ATOM   6312  C  CA  . ALA B 1 286 ? 50.271  60.200  33.523  1.00 70.57 ? 289  ALA B CA  1 
ATOM   6313  C  C   . ALA B 1 286 ? 49.688  61.572  33.849  1.00 71.48 ? 289  ALA B C   1 
ATOM   6314  O  O   . ALA B 1 286 ? 48.558  61.891  33.480  1.00 71.78 ? 289  ALA B O   1 
ATOM   6315  C  CB  . ALA B 1 286 ? 50.017  59.240  34.661  1.00 70.22 ? 289  ALA B CB  1 
ATOM   6316  N  N   . GLU B 1 287 ? 50.488  62.394  34.509  1.00 72.33 ? 290  GLU B N   1 
ATOM   6317  C  CA  . GLU B 1 287 ? 50.080  63.736  34.899  1.00 73.05 ? 290  GLU B CA  1 
ATOM   6318  C  C   . GLU B 1 287 ? 49.936  64.670  33.715  1.00 72.90 ? 290  GLU B C   1 
ATOM   6319  O  O   . GLU B 1 287 ? 49.110  65.580  33.728  1.00 73.09 ? 290  GLU B O   1 
ATOM   6320  C  CB  . GLU B 1 287 ? 51.118  64.325  35.850  1.00 74.19 ? 290  GLU B CB  1 
ATOM   6321  C  CG  . GLU B 1 287 ? 51.210  63.622  37.188  1.00 76.19 ? 290  GLU B CG  1 
ATOM   6322  C  CD  . GLU B 1 287 ? 50.245  64.197  38.198  1.00 77.52 ? 290  GLU B CD  1 
ATOM   6323  O  OE1 . GLU B 1 287 ? 50.419  65.390  38.540  1.00 78.41 ? 290  GLU B OE1 1 
ATOM   6324  O  OE2 . GLU B 1 287 ? 49.323  63.470  38.646  1.00 77.95 ? 290  GLU B OE2 1 
ATOM   6325  N  N   . THR B 1 288 ? 50.773  64.469  32.707  1.00 72.65 ? 291  THR B N   1 
ATOM   6326  C  CA  . THR B 1 288 ? 50.748  65.328  31.535  1.00 72.40 ? 291  THR B CA  1 
ATOM   6327  C  C   . THR B 1 288 ? 49.921  64.781  30.393  1.00 71.98 ? 291  THR B C   1 
ATOM   6328  O  O   . THR B 1 288 ? 49.843  65.406  29.340  1.00 72.12 ? 291  THR B O   1 
ATOM   6329  C  CB  . THR B 1 288 ? 52.168  65.599  31.006  1.00 72.69 ? 291  THR B CB  1 
ATOM   6330  O  OG1 . THR B 1 288 ? 52.737  64.380  30.505  1.00 72.88 ? 291  THR B OG1 1 
ATOM   6331  C  CG2 . THR B 1 288 ? 53.047  66.159  32.115  1.00 72.64 ? 291  THR B CG2 1 
ATOM   6332  N  N   . PHE B 1 289 ? 49.319  63.613  30.573  1.00 71.32 ? 292  PHE B N   1 
ATOM   6333  C  CA  . PHE B 1 289 ? 48.516  63.060  29.497  1.00 70.59 ? 292  PHE B CA  1 
ATOM   6334  C  C   . PHE B 1 289 ? 47.313  63.958  29.221  1.00 70.16 ? 292  PHE B C   1 
ATOM   6335  O  O   . PHE B 1 289 ? 46.501  64.219  30.114  1.00 70.33 ? 292  PHE B O   1 
ATOM   6336  C  CB  . PHE B 1 289 ? 48.050  61.654  29.826  1.00 70.60 ? 292  PHE B CB  1 
ATOM   6337  C  CG  . PHE B 1 289 ? 47.537  60.901  28.636  1.00 70.53 ? 292  PHE B CG  1 
ATOM   6338  C  CD1 . PHE B 1 289 ? 46.211  60.484  28.575  1.00 70.64 ? 292  PHE B CD1 1 
ATOM   6339  C  CD2 . PHE B 1 289 ? 48.386  60.594  27.574  1.00 70.54 ? 292  PHE B CD2 1 
ATOM   6340  C  CE1 . PHE B 1 289 ? 45.738  59.767  27.473  1.00 70.45 ? 292  PHE B CE1 1 
ATOM   6341  C  CE2 . PHE B 1 289 ? 47.921  59.878  26.467  1.00 70.38 ? 292  PHE B CE2 1 
ATOM   6342  C  CZ  . PHE B 1 289 ? 46.597  59.464  26.417  1.00 70.26 ? 292  PHE B CZ  1 
ATOM   6343  N  N   . PRO B 1 290 ? 47.175  64.417  27.967  1.00 69.49 ? 293  PRO B N   1 
ATOM   6344  C  CA  . PRO B 1 290 ? 46.109  65.295  27.474  1.00 68.79 ? 293  PRO B CA  1 
ATOM   6345  C  C   . PRO B 1 290 ? 44.719  64.866  27.886  1.00 68.20 ? 293  PRO B C   1 
ATOM   6346  O  O   . PRO B 1 290 ? 43.796  65.665  27.873  1.00 68.33 ? 293  PRO B O   1 
ATOM   6347  C  CB  . PRO B 1 290 ? 46.269  65.201  25.963  1.00 68.92 ? 293  PRO B CB  1 
ATOM   6348  C  CG  . PRO B 1 290 ? 47.726  65.030  25.798  1.00 69.25 ? 293  PRO B CG  1 
ATOM   6349  C  CD  . PRO B 1 290 ? 48.043  64.002  26.852  1.00 69.42 ? 293  PRO B CD  1 
ATOM   6350  N  N   . PHE B 1 291 ? 44.556  63.593  28.204  1.00 67.49 ? 294  PHE B N   1 
ATOM   6351  C  CA  . PHE B 1 291 ? 43.254  63.105  28.611  1.00 66.82 ? 294  PHE B CA  1 
ATOM   6352  C  C   . PHE B 1 291 ? 43.424  62.325  29.889  1.00 66.21 ? 294  PHE B C   1 
ATOM   6353  O  O   . PHE B 1 291 ? 44.439  62.452  30.574  1.00 66.32 ? 294  PHE B O   1 
ATOM   6354  C  CB  . PHE B 1 291 ? 42.662  62.182  27.547  1.00 67.16 ? 294  PHE B CB  1 
ATOM   6355  C  CG  . PHE B 1 291 ? 42.597  62.785  26.169  1.00 67.38 ? 294  PHE B CG  1 
ATOM   6356  C  CD1 . PHE B 1 291 ? 41.602  63.698  25.836  1.00 67.39 ? 294  PHE B CD1 1 
ATOM   6357  C  CD2 . PHE B 1 291 ? 43.509  62.399  25.186  1.00 67.40 ? 294  PHE B CD2 1 
ATOM   6358  C  CE1 . PHE B 1 291 ? 41.516  64.213  24.542  1.00 67.26 ? 294  PHE B CE1 1 
ATOM   6359  C  CE2 . PHE B 1 291 ? 43.430  62.909  23.888  1.00 67.03 ? 294  PHE B CE2 1 
ATOM   6360  C  CZ  . PHE B 1 291 ? 42.433  63.815  23.567  1.00 67.07 ? 294  PHE B CZ  1 
ATOM   6361  N  N   . ASN B 1 292 ? 42.400  61.546  30.223  1.00 65.33 ? 295  ASN B N   1 
ATOM   6362  C  CA  . ASN B 1 292 ? 42.428  60.708  31.404  1.00 64.43 ? 295  ASN B CA  1 
ATOM   6363  C  C   . ASN B 1 292 ? 43.048  59.417  30.918  1.00 63.93 ? 295  ASN B C   1 
ATOM   6364  O  O   . ASN B 1 292 ? 42.460  58.715  30.108  1.00 64.04 ? 295  ASN B O   1 
ATOM   6365  C  CB  . ASN B 1 292 ? 41.014  60.442  31.902  1.00 64.07 ? 295  ASN B CB  1 
ATOM   6366  C  CG  . ASN B 1 292 ? 40.978  59.439  33.030  1.00 64.09 ? 295  ASN B CG  1 
ATOM   6367  O  OD1 . ASN B 1 292 ? 42.017  58.929  33.461  1.00 64.17 ? 295  ASN B OD1 1 
ATOM   6368  N  ND2 . ASN B 1 292 ? 39.776  59.140  33.514  1.00 64.06 ? 295  ASN B ND2 1 
ATOM   6369  N  N   . PRO B 1 293 ? 44.249  59.091  31.401  1.00 63.48 ? 296  PRO B N   1 
ATOM   6370  C  CA  . PRO B 1 293 ? 44.952  57.867  31.003  1.00 63.31 ? 296  PRO B CA  1 
ATOM   6371  C  C   . PRO B 1 293 ? 44.213  56.580  31.363  1.00 63.36 ? 296  PRO B C   1 
ATOM   6372  O  O   . PRO B 1 293 ? 44.532  55.502  30.847  1.00 63.11 ? 296  PRO B O   1 
ATOM   6373  C  CB  . PRO B 1 293 ? 46.277  57.986  31.753  1.00 63.03 ? 296  PRO B CB  1 
ATOM   6374  C  CG  . PRO B 1 293 ? 45.898  58.762  32.975  1.00 62.92 ? 296  PRO B CG  1 
ATOM   6375  C  CD  . PRO B 1 293 ? 45.018  59.833  32.413  1.00 63.06 ? 296  PRO B CD  1 
ATOM   6376  N  N   . PHE B 1 294 ? 43.222  56.711  32.242  1.00 63.16 ? 297  PHE B N   1 
ATOM   6377  C  CA  . PHE B 1 294 ? 42.420  55.581  32.705  1.00 62.66 ? 297  PHE B CA  1 
ATOM   6378  C  C   . PHE B 1 294 ? 41.059  55.538  32.019  1.00 62.06 ? 297  PHE B C   1 
ATOM   6379  O  O   . PHE B 1 294 ? 40.169  54.788  32.427  1.00 62.22 ? 297  PHE B O   1 
ATOM   6380  C  CB  . PHE B 1 294 ? 42.231  55.682  34.216  1.00 62.81 ? 297  PHE B CB  1 
ATOM   6381  C  CG  . PHE B 1 294 ? 43.501  55.958  34.956  1.00 63.19 ? 297  PHE B CG  1 
ATOM   6382  C  CD1 . PHE B 1 294 ? 44.566  55.069  34.887  1.00 63.16 ? 297  PHE B CD1 1 
ATOM   6383  C  CD2 . PHE B 1 294 ? 43.641  57.115  35.713  1.00 63.34 ? 297  PHE B CD2 1 
ATOM   6384  C  CE1 . PHE B 1 294 ? 45.758  55.327  35.564  1.00 63.34 ? 297  PHE B CE1 1 
ATOM   6385  C  CE2 . PHE B 1 294 ? 44.831  57.384  36.396  1.00 63.37 ? 297  PHE B CE2 1 
ATOM   6386  C  CZ  . PHE B 1 294 ? 45.890  56.488  36.321  1.00 63.35 ? 297  PHE B CZ  1 
ATOM   6387  N  N   . ASP B 1 295 ? 40.907  56.353  30.981  1.00 61.54 ? 298  ASP B N   1 
ATOM   6388  C  CA  . ASP B 1 295 ? 39.665  56.436  30.228  1.00 61.05 ? 298  ASP B CA  1 
ATOM   6389  C  C   . ASP B 1 295 ? 39.682  55.388  29.132  1.00 60.70 ? 298  ASP B C   1 
ATOM   6390  O  O   . ASP B 1 295 ? 40.316  55.582  28.100  1.00 61.15 ? 298  ASP B O   1 
ATOM   6391  C  CB  . ASP B 1 295 ? 39.528  57.838  29.631  1.00 61.03 ? 298  ASP B CB  1 
ATOM   6392  C  CG  . ASP B 1 295 ? 38.246  58.031  28.857  1.00 61.05 ? 298  ASP B CG  1 
ATOM   6393  O  OD1 . ASP B 1 295 ? 38.015  59.165  28.402  1.00 61.05 ? 298  ASP B OD1 1 
ATOM   6394  O  OD2 . ASP B 1 295 ? 37.468  57.070  28.695  1.00 61.29 ? 298  ASP B OD2 1 
ATOM   6395  N  N   . LEU B 1 296 ? 38.920  54.315  29.325  1.00 60.18 ? 299  LEU B N   1 
ATOM   6396  C  CA  . LEU B 1 296 ? 38.872  53.222  28.359  1.00 59.61 ? 299  LEU B CA  1 
ATOM   6397  C  C   . LEU B 1 296 ? 38.491  53.614  26.934  1.00 59.52 ? 299  LEU B C   1 
ATOM   6398  O  O   . LEU B 1 296 ? 38.504  52.768  26.033  1.00 59.22 ? 299  LEU B O   1 
ATOM   6399  C  CB  . LEU B 1 296 ? 37.960  52.108  28.860  1.00 59.21 ? 299  LEU B CB  1 
ATOM   6400  C  CG  . LEU B 1 296 ? 38.122  50.745  28.182  1.00 58.77 ? 299  LEU B CG  1 
ATOM   6401  C  CD1 . LEU B 1 296 ? 39.582  50.295  28.184  1.00 58.54 ? 299  LEU B CD1 1 
ATOM   6402  C  CD2 . LEU B 1 296 ? 37.251  49.735  28.903  1.00 58.72 ? 299  LEU B CD2 1 
ATOM   6403  N  N   . THR B 1 297 ? 38.147  54.882  26.724  1.00 59.72 ? 300  THR B N   1 
ATOM   6404  C  CA  . THR B 1 297 ? 37.799  55.343  25.387  1.00 59.79 ? 300  THR B CA  1 
ATOM   6405  C  C   . THR B 1 297 ? 38.987  56.038  24.753  1.00 60.33 ? 300  THR B C   1 
ATOM   6406  O  O   . THR B 1 297 ? 38.863  56.600  23.670  1.00 60.56 ? 300  THR B O   1 
ATOM   6407  C  CB  . THR B 1 297 ? 36.637  56.350  25.385  1.00 59.48 ? 300  THR B CB  1 
ATOM   6408  O  OG1 . THR B 1 297 ? 36.992  57.492  26.174  1.00 59.21 ? 300  THR B OG1 1 
ATOM   6409  C  CG2 . THR B 1 297 ? 35.362  55.715  25.909  1.00 58.70 ? 300  THR B CG2 1 
ATOM   6410  N  N   . LYS B 1 298 ? 40.136  56.005  25.421  1.00 60.62 ? 301  LYS B N   1 
ATOM   6411  C  CA  . LYS B 1 298 ? 41.336  56.665  24.907  1.00 61.14 ? 301  LYS B CA  1 
ATOM   6412  C  C   . LYS B 1 298 ? 42.496  55.693  24.688  1.00 61.74 ? 301  LYS B C   1 
ATOM   6413  O  O   . LYS B 1 298 ? 42.591  54.666  25.359  1.00 62.10 ? 301  LYS B O   1 
ATOM   6414  C  CB  . LYS B 1 298 ? 41.784  57.757  25.883  1.00 60.98 ? 301  LYS B CB  1 
ATOM   6415  C  CG  . LYS B 1 298 ? 40.716  58.780  26.250  1.00 60.91 ? 301  LYS B CG  1 
ATOM   6416  C  CD  . LYS B 1 298 ? 40.392  59.718  25.098  1.00 60.52 ? 301  LYS B CD  1 
ATOM   6417  C  CE  . LYS B 1 298 ? 39.326  60.728  25.497  1.00 59.75 ? 301  LYS B CE  1 
ATOM   6418  N  NZ  . LYS B 1 298 ? 38.069  60.036  25.891  1.00 59.44 ? 301  LYS B NZ  1 
ATOM   6419  N  N   . VAL B 1 299 ? 43.386  56.030  23.758  1.00 62.22 ? 302  VAL B N   1 
ATOM   6420  C  CA  . VAL B 1 299 ? 44.551  55.198  23.476  1.00 62.53 ? 302  VAL B CA  1 
ATOM   6421  C  C   . VAL B 1 299 ? 45.794  56.004  23.780  1.00 63.43 ? 302  VAL B C   1 
ATOM   6422  O  O   . VAL B 1 299 ? 45.716  57.212  23.981  1.00 63.39 ? 302  VAL B O   1 
ATOM   6423  C  CB  . VAL B 1 299 ? 44.643  54.803  21.992  1.00 62.18 ? 302  VAL B CB  1 
ATOM   6424  C  CG1 . VAL B 1 299 ? 43.554  53.824  21.633  1.00 61.62 ? 302  VAL B CG1 1 
ATOM   6425  C  CG2 . VAL B 1 299 ? 44.558  56.040  21.119  1.00 61.38 ? 302  VAL B CG2 1 
ATOM   6426  N  N   . TRP B 1 300 ? 46.931  55.320  23.857  1.00 64.57 ? 303  TRP B N   1 
ATOM   6427  C  CA  . TRP B 1 300 ? 48.220  55.961  24.090  1.00 65.80 ? 303  TRP B CA  1 
ATOM   6428  C  C   . TRP B 1 300 ? 48.883  55.950  22.723  1.00 67.00 ? 303  TRP B C   1 
ATOM   6429  O  O   . TRP B 1 300 ? 49.314  54.895  22.260  1.00 67.15 ? 303  TRP B O   1 
ATOM   6430  C  CB  . TRP B 1 300 ? 49.070  55.137  25.051  1.00 65.29 ? 303  TRP B CB  1 
ATOM   6431  C  CG  . TRP B 1 300 ? 48.569  55.093  26.445  1.00 65.33 ? 303  TRP B CG  1 
ATOM   6432  C  CD1 . TRP B 1 300 ? 47.468  55.720  26.945  1.00 65.16 ? 303  TRP B CD1 1 
ATOM   6433  C  CD2 . TRP B 1 300 ? 49.164  54.392  27.539  1.00 65.36 ? 303  TRP B CD2 1 
ATOM   6434  N  NE1 . TRP B 1 300 ? 47.340  55.454  28.287  1.00 65.22 ? 303  TRP B NE1 1 
ATOM   6435  C  CE2 . TRP B 1 300 ? 48.369  54.637  28.676  1.00 65.33 ? 303  TRP B CE2 1 
ATOM   6436  C  CE3 . TRP B 1 300 ? 50.298  53.577  27.668  1.00 65.45 ? 303  TRP B CE3 1 
ATOM   6437  C  CZ2 . TRP B 1 300 ? 48.668  54.097  29.932  1.00 65.59 ? 303  TRP B CZ2 1 
ATOM   6438  C  CZ3 . TRP B 1 300 ? 50.599  53.037  28.921  1.00 65.66 ? 303  TRP B CZ3 1 
ATOM   6439  C  CH2 . TRP B 1 300 ? 49.786  53.301  30.034  1.00 65.71 ? 303  TRP B CH2 1 
ATOM   6440  N  N   . PRO B 1 301 ? 48.951  57.110  22.044  1.00 68.27 ? 304  PRO B N   1 
ATOM   6441  C  CA  . PRO B 1 301 ? 49.560  57.212  20.716  1.00 69.53 ? 304  PRO B CA  1 
ATOM   6442  C  C   . PRO B 1 301 ? 50.907  56.515  20.626  1.00 70.88 ? 304  PRO B C   1 
ATOM   6443  O  O   . PRO B 1 301 ? 51.837  56.840  21.369  1.00 71.26 ? 304  PRO B O   1 
ATOM   6444  C  CB  . PRO B 1 301 ? 49.683  58.717  20.522  1.00 69.31 ? 304  PRO B CB  1 
ATOM   6445  C  CG  . PRO B 1 301 ? 48.467  59.223  21.213  1.00 68.50 ? 304  PRO B CG  1 
ATOM   6446  C  CD  . PRO B 1 301 ? 48.503  58.437  22.503  1.00 68.60 ? 304  PRO B CD  1 
ATOM   6447  N  N   . HIS B 1 302 ? 50.992  55.542  19.721  1.00 72.33 ? 305  HIS B N   1 
ATOM   6448  C  CA  . HIS B 1 302 ? 52.216  54.778  19.519  1.00 73.75 ? 305  HIS B CA  1 
ATOM   6449  C  C   . HIS B 1 302 ? 53.407  55.704  19.403  1.00 73.94 ? 305  HIS B C   1 
ATOM   6450  O  O   . HIS B 1 302 ? 54.505  55.379  19.855  1.00 74.17 ? 305  HIS B O   1 
ATOM   6451  C  CB  . HIS B 1 302 ? 52.110  53.908  18.266  1.00 75.29 ? 305  HIS B CB  1 
ATOM   6452  C  CG  . HIS B 1 302 ? 51.238  52.701  18.442  1.00 77.31 ? 305  HIS B CG  1 
ATOM   6453  N  ND1 . HIS B 1 302 ? 50.677  52.024  17.377  1.00 78.37 ? 305  HIS B ND1 1 
ATOM   6454  C  CD2 . HIS B 1 302 ? 50.832  52.049  19.558  1.00 78.12 ? 305  HIS B CD2 1 
ATOM   6455  C  CE1 . HIS B 1 302 ? 49.962  51.008  17.832  1.00 78.49 ? 305  HIS B CE1 1 
ATOM   6456  N  NE2 . HIS B 1 302 ? 50.038  50.999  19.151  1.00 78.60 ? 305  HIS B NE2 1 
ATOM   6457  N  N   . LYS B 1 303 ? 53.169  56.884  18.842  1.00 73.72 ? 306  LYS B N   1 
ATOM   6458  C  CA  . LYS B 1 303 ? 54.226  57.854  18.673  1.00 73.36 ? 306  LYS B CA  1 
ATOM   6459  C  C   . LYS B 1 303 ? 54.932  58.215  19.972  1.00 72.78 ? 306  LYS B C   1 
ATOM   6460  O  O   . LYS B 1 303 ? 56.155  58.214  20.034  1.00 72.77 ? 306  LYS B O   1 
ATOM   6461  C  CB  . LYS B 1 303 ? 53.691  59.131  18.047  1.00 74.13 ? 306  LYS B CB  1 
ATOM   6462  C  CG  . LYS B 1 303 ? 54.794  60.147  17.864  1.00 75.08 ? 306  LYS B CG  1 
ATOM   6463  C  CD  . LYS B 1 303 ? 54.277  61.525  17.575  1.00 75.99 ? 306  LYS B CD  1 
ATOM   6464  C  CE  . LYS B 1 303 ? 55.443  62.486  17.444  1.00 76.47 ? 306  LYS B CE  1 
ATOM   6465  N  NZ  . LYS B 1 303 ? 54.966  63.858  17.145  1.00 77.00 ? 306  LYS B NZ  1 
ATOM   6466  N  N   . ASP B 1 304 ? 54.161  58.506  21.012  1.00 72.10 ? 307  ASP B N   1 
ATOM   6467  C  CA  . ASP B 1 304 ? 54.744  58.913  22.286  1.00 71.23 ? 307  ASP B CA  1 
ATOM   6468  C  C   . ASP B 1 304 ? 54.977  57.809  23.299  1.00 70.42 ? 307  ASP B C   1 
ATOM   6469  O  O   . ASP B 1 304 ? 55.683  58.004  24.291  1.00 70.18 ? 307  ASP B O   1 
ATOM   6470  C  CB  . ASP B 1 304 ? 53.891  60.007  22.897  1.00 72.05 ? 307  ASP B CB  1 
ATOM   6471  C  CG  . ASP B 1 304 ? 53.542  61.073  21.897  1.00 72.74 ? 307  ASP B CG  1 
ATOM   6472  O  OD1 . ASP B 1 304 ? 52.389  61.077  21.421  1.00 73.24 ? 307  ASP B OD1 1 
ATOM   6473  O  OD2 . ASP B 1 304 ? 54.436  61.875  21.550  1.00 73.44 ? 307  ASP B OD2 1 
ATOM   6474  N  N   . TYR B 1 305 ? 54.349  56.664  23.076  1.00 69.13 ? 308  TYR B N   1 
ATOM   6475  C  CA  . TYR B 1 305 ? 54.511  55.530  23.972  1.00 67.92 ? 308  TYR B CA  1 
ATOM   6476  C  C   . TYR B 1 305 ? 54.720  54.322  23.094  1.00 67.36 ? 308  TYR B C   1 
ATOM   6477  O  O   . TYR B 1 305 ? 53.802  53.543  22.847  1.00 67.50 ? 308  TYR B O   1 
ATOM   6478  C  CB  . TYR B 1 305 ? 53.279  55.368  24.846  1.00 67.27 ? 308  TYR B CB  1 
ATOM   6479  C  CG  . TYR B 1 305 ? 53.027  56.583  25.679  1.00 66.70 ? 308  TYR B CG  1 
ATOM   6480  C  CD1 . TYR B 1 305 ? 53.558  56.690  26.957  1.00 66.59 ? 308  TYR B CD1 1 
ATOM   6481  C  CD2 . TYR B 1 305 ? 52.290  57.649  25.173  1.00 66.68 ? 308  TYR B CD2 1 
ATOM   6482  C  CE1 . TYR B 1 305 ? 53.364  57.832  27.715  1.00 66.57 ? 308  TYR B CE1 1 
ATOM   6483  C  CE2 . TYR B 1 305 ? 52.089  58.798  25.917  1.00 66.60 ? 308  TYR B CE2 1 
ATOM   6484  C  CZ  . TYR B 1 305 ? 52.629  58.887  27.189  1.00 66.79 ? 308  TYR B CZ  1 
ATOM   6485  O  OH  . TYR B 1 305 ? 52.437  60.036  27.932  1.00 66.84 ? 308  TYR B OH  1 
ATOM   6486  N  N   . PRO B 1 306 ? 55.952  54.151  22.613  1.00 66.71 ? 309  PRO B N   1 
ATOM   6487  C  CA  . PRO B 1 306 ? 56.394  53.064  21.735  1.00 66.18 ? 309  PRO B CA  1 
ATOM   6488  C  C   . PRO B 1 306 ? 56.098  51.693  22.308  1.00 65.60 ? 309  PRO B C   1 
ATOM   6489  O  O   . PRO B 1 306 ? 56.077  51.518  23.523  1.00 65.74 ? 309  PRO B O   1 
ATOM   6490  C  CB  . PRO B 1 306 ? 57.896  53.304  21.636  1.00 66.29 ? 309  PRO B CB  1 
ATOM   6491  C  CG  . PRO B 1 306 ? 58.022  54.799  21.880  1.00 66.44 ? 309  PRO B CG  1 
ATOM   6492  C  CD  . PRO B 1 306 ? 57.092  54.989  23.020  1.00 66.43 ? 309  PRO B CD  1 
ATOM   6493  N  N   . LEU B 1 307 ? 55.846  50.725  21.433  1.00 65.06 ? 310  LEU B N   1 
ATOM   6494  C  CA  . LEU B 1 307 ? 55.562  49.372  21.883  1.00 64.42 ? 310  LEU B CA  1 
ATOM   6495  C  C   . LEU B 1 307 ? 56.848  48.675  22.277  1.00 63.98 ? 310  LEU B C   1 
ATOM   6496  O  O   . LEU B 1 307 ? 57.822  48.687  21.528  1.00 64.32 ? 310  LEU B O   1 
ATOM   6497  C  CB  . LEU B 1 307 ? 54.855  48.567  20.794  1.00 64.30 ? 310  LEU B CB  1 
ATOM   6498  C  CG  . LEU B 1 307 ? 53.378  48.873  20.535  1.00 64.20 ? 310  LEU B CG  1 
ATOM   6499  C  CD1 . LEU B 1 307 ? 52.849  47.946  19.456  1.00 64.41 ? 310  LEU B CD1 1 
ATOM   6500  C  CD2 . LEU B 1 307 ? 52.583  48.680  21.798  1.00 64.09 ? 310  LEU B CD2 1 
ATOM   6501  N  N   . ILE B 1 308 ? 56.840  48.070  23.458  1.00 63.45 ? 311  ILE B N   1 
ATOM   6502  C  CA  . ILE B 1 308 ? 57.995  47.357  23.974  1.00 62.95 ? 311  ILE B CA  1 
ATOM   6503  C  C   . ILE B 1 308 ? 57.755  45.862  23.865  1.00 62.96 ? 311  ILE B C   1 
ATOM   6504  O  O   . ILE B 1 308 ? 56.813  45.338  24.460  1.00 63.59 ? 311  ILE B O   1 
ATOM   6505  C  CB  . ILE B 1 308 ? 58.216  47.695  25.455  1.00 62.65 ? 311  ILE B CB  1 
ATOM   6506  C  CG1 . ILE B 1 308 ? 58.500  49.187  25.608  1.00 62.17 ? 311  ILE B CG1 1 
ATOM   6507  C  CG2 . ILE B 1 308 ? 59.336  46.845  26.036  1.00 62.15 ? 311  ILE B CG2 1 
ATOM   6508  C  CD1 . ILE B 1 308 ? 58.475  49.663  27.035  1.00 61.82 ? 311  ILE B CD1 1 
ATOM   6509  N  N   . PRO B 1 309 ? 58.581  45.160  23.074  1.00 62.67 ? 312  PRO B N   1 
ATOM   6510  C  CA  . PRO B 1 309 ? 58.465  43.712  22.886  1.00 62.61 ? 312  PRO B CA  1 
ATOM   6511  C  C   . PRO B 1 309 ? 58.749  42.974  24.183  1.00 62.60 ? 312  PRO B C   1 
ATOM   6512  O  O   . PRO B 1 309 ? 59.658  43.336  24.923  1.00 62.40 ? 312  PRO B O   1 
ATOM   6513  C  CB  . PRO B 1 309 ? 59.528  43.418  21.831  1.00 62.51 ? 312  PRO B CB  1 
ATOM   6514  C  CG  . PRO B 1 309 ? 60.532  44.502  22.048  1.00 62.66 ? 312  PRO B CG  1 
ATOM   6515  C  CD  . PRO B 1 309 ? 59.656  45.705  22.235  1.00 62.58 ? 312  PRO B CD  1 
ATOM   6516  N  N   . VAL B 1 310 ? 57.956  41.942  24.451  1.00 62.81 ? 313  VAL B N   1 
ATOM   6517  C  CA  . VAL B 1 310 ? 58.086  41.149  25.669  1.00 63.11 ? 313  VAL B CA  1 
ATOM   6518  C  C   . VAL B 1 310 ? 58.211  39.665  25.365  1.00 63.21 ? 313  VAL B C   1 
ATOM   6519  O  O   . VAL B 1 310 ? 59.134  38.999  25.851  1.00 63.46 ? 313  VAL B O   1 
ATOM   6520  C  CB  . VAL B 1 310 ? 56.853  41.343  26.587  1.00 63.10 ? 313  VAL B CB  1 
ATOM   6521  C  CG1 . VAL B 1 310 ? 56.918  40.403  27.782  1.00 62.98 ? 313  VAL B CG1 1 
ATOM   6522  C  CG2 . VAL B 1 310 ? 56.751  42.794  27.042  1.00 62.95 ? 313  VAL B CG2 1 
ATOM   6523  N  N   . GLY B 1 311 ? 57.268  39.147  24.581  1.00 63.28 ? 314  GLY B N   1 
ATOM   6524  C  CA  . GLY B 1 311 ? 57.295  37.737  24.253  1.00 63.23 ? 314  GLY B CA  1 
ATOM   6525  C  C   . GLY B 1 311 ? 56.359  37.315  23.144  1.00 63.32 ? 314  GLY B C   1 
ATOM   6526  O  O   . GLY B 1 311 ? 55.939  38.125  22.317  1.00 63.23 ? 314  GLY B O   1 
ATOM   6527  N  N   . LYS B 1 312 ? 56.021  36.029  23.150  1.00 63.56 ? 315  LYS B N   1 
ATOM   6528  C  CA  . LYS B 1 312 ? 55.154  35.440  22.140  1.00 63.96 ? 315  LYS B CA  1 
ATOM   6529  C  C   . LYS B 1 312 ? 54.057  34.574  22.743  1.00 63.99 ? 315  LYS B C   1 
ATOM   6530  O  O   . LYS B 1 312 ? 54.247  33.944  23.788  1.00 64.27 ? 315  LYS B O   1 
ATOM   6531  C  CB  . LYS B 1 312 ? 55.976  34.545  21.209  1.00 64.58 ? 315  LYS B CB  1 
ATOM   6532  C  CG  . LYS B 1 312 ? 56.941  35.263  20.287  1.00 65.30 ? 315  LYS B CG  1 
ATOM   6533  C  CD  . LYS B 1 312 ? 56.229  35.782  19.054  1.00 65.86 ? 315  LYS B CD  1 
ATOM   6534  C  CE  . LYS B 1 312 ? 57.216  36.393  18.081  1.00 66.36 ? 315  LYS B CE  1 
ATOM   6535  N  NZ  . LYS B 1 312 ? 56.518  36.867  16.859  1.00 66.90 ? 315  LYS B NZ  1 
ATOM   6536  N  N   . LEU B 1 313 ? 52.914  34.536  22.066  1.00 63.65 ? 316  LEU B N   1 
ATOM   6537  C  CA  . LEU B 1 313 ? 51.788  33.711  22.491  1.00 63.18 ? 316  LEU B CA  1 
ATOM   6538  C  C   . LEU B 1 313 ? 51.642  32.642  21.421  1.00 62.84 ? 316  LEU B C   1 
ATOM   6539  O  O   . LEU B 1 313 ? 51.647  32.945  20.217  1.00 62.72 ? 316  LEU B O   1 
ATOM   6540  C  CB  . LEU B 1 313 ? 50.506  34.538  22.595  1.00 63.03 ? 316  LEU B CB  1 
ATOM   6541  C  CG  . LEU B 1 313 ? 50.405  35.457  23.814  1.00 63.17 ? 316  LEU B CG  1 
ATOM   6542  C  CD1 . LEU B 1 313 ? 49.211  36.374  23.678  1.00 62.91 ? 316  LEU B CD1 1 
ATOM   6543  C  CD2 . LEU B 1 313 ? 50.306  34.625  25.091  1.00 63.22 ? 316  LEU B CD2 1 
ATOM   6544  N  N   . VAL B 1 314 ? 51.543  31.391  21.854  1.00 62.15 ? 317  VAL B N   1 
ATOM   6545  C  CA  . VAL B 1 314 ? 51.431  30.290  20.917  1.00 61.19 ? 317  VAL B CA  1 
ATOM   6546  C  C   . VAL B 1 314 ? 50.360  29.290  21.275  1.00 60.49 ? 317  VAL B C   1 
ATOM   6547  O  O   . VAL B 1 314 ? 50.321  28.779  22.389  1.00 60.40 ? 317  VAL B O   1 
ATOM   6548  C  CB  . VAL B 1 314 ? 52.747  29.522  20.828  1.00 61.44 ? 317  VAL B CB  1 
ATOM   6549  C  CG1 . VAL B 1 314 ? 52.639  28.432  19.786  1.00 61.38 ? 317  VAL B CG1 1 
ATOM   6550  C  CG2 . VAL B 1 314 ? 53.883  30.461  20.489  1.00 61.58 ? 317  VAL B CG2 1 
ATOM   6551  N  N   . LEU B 1 315 ? 49.496  29.011  20.311  1.00 60.05 ? 318  LEU B N   1 
ATOM   6552  C  CA  . LEU B 1 315 ? 48.438  28.035  20.491  1.00 59.74 ? 318  LEU B CA  1 
ATOM   6553  C  C   . LEU B 1 315 ? 48.808  26.832  19.641  1.00 59.98 ? 318  LEU B C   1 
ATOM   6554  O  O   . LEU B 1 315 ? 48.788  26.899  18.410  1.00 60.13 ? 318  LEU B O   1 
ATOM   6555  C  CB  . LEU B 1 315 ? 47.104  28.600  20.029  1.00 59.15 ? 318  LEU B CB  1 
ATOM   6556  C  CG  . LEU B 1 315 ? 46.650  29.795  20.849  1.00 58.50 ? 318  LEU B CG  1 
ATOM   6557  C  CD1 . LEU B 1 315 ? 45.303  30.236  20.348  1.00 58.38 ? 318  LEU B CD1 1 
ATOM   6558  C  CD2 . LEU B 1 315 ? 46.591  29.417  22.325  1.00 58.34 ? 318  LEU B CD2 1 
ATOM   6559  N  N   . ASN B 1 316 ? 49.167  25.738  20.297  1.00 59.94 ? 319  ASN B N   1 
ATOM   6560  C  CA  . ASN B 1 316 ? 49.556  24.535  19.587  1.00 59.91 ? 319  ASN B CA  1 
ATOM   6561  C  C   . ASN B 1 316 ? 48.692  23.342  19.956  1.00 60.11 ? 319  ASN B C   1 
ATOM   6562  O  O   . ASN B 1 316 ? 48.975  22.229  19.522  1.00 60.39 ? 319  ASN B O   1 
ATOM   6563  C  CB  . ASN B 1 316 ? 51.008  24.215  19.903  1.00 59.82 ? 319  ASN B CB  1 
ATOM   6564  C  CG  . ASN B 1 316 ? 51.254  24.065  21.386  1.00 59.89 ? 319  ASN B CG  1 
ATOM   6565  O  OD1 . ASN B 1 316 ? 50.336  24.176  22.197  1.00 60.56 ? 319  ASN B OD1 1 
ATOM   6566  N  ND2 . ASN B 1 316 ? 52.497  23.815  21.753  1.00 59.83 ? 319  ASN B ND2 1 
ATOM   6567  N  N   . ARG B 1 317 ? 47.628  23.566  20.725  1.00 60.44 ? 320  ARG B N   1 
ATOM   6568  C  CA  . ARG B 1 317 ? 46.778  22.455  21.139  1.00 60.52 ? 320  ARG B CA  1 
ATOM   6569  C  C   . ARG B 1 317 ? 45.279  22.686  21.087  1.00 60.03 ? 320  ARG B C   1 
ATOM   6570  O  O   . ARG B 1 317 ? 44.767  23.660  21.628  1.00 59.69 ? 320  ARG B O   1 
ATOM   6571  C  CB  . ARG B 1 317 ? 47.156  22.013  22.550  1.00 61.74 ? 320  ARG B CB  1 
ATOM   6572  C  CG  . ARG B 1 317 ? 46.764  20.593  22.864  1.00 63.41 ? 320  ARG B CG  1 
ATOM   6573  C  CD  . ARG B 1 317 ? 47.219  20.205  24.253  1.00 65.28 ? 320  ARG B CD  1 
ATOM   6574  N  NE  . ARG B 1 317 ? 46.310  20.689  25.290  1.00 67.25 ? 320  ARG B NE  1 
ATOM   6575  C  CZ  . ARG B 1 317 ? 46.632  21.586  26.220  1.00 68.10 ? 320  ARG B CZ  1 
ATOM   6576  N  NH1 . ARG B 1 317 ? 47.847  22.117  26.250  1.00 68.55 ? 320  ARG B NH1 1 
ATOM   6577  N  NH2 . ARG B 1 317 ? 45.742  21.935  27.141  1.00 68.63 ? 320  ARG B NH2 1 
ATOM   6578  N  N   . ASN B 1 318 ? 44.588  21.761  20.429  1.00 59.34 ? 321  ASN B N   1 
ATOM   6579  C  CA  . ASN B 1 318 ? 43.139  21.789  20.313  1.00 58.67 ? 321  ASN B CA  1 
ATOM   6580  C  C   . ASN B 1 318 ? 42.590  21.141  21.574  1.00 58.32 ? 321  ASN B C   1 
ATOM   6581  O  O   . ASN B 1 318 ? 43.219  20.256  22.153  1.00 58.36 ? 321  ASN B O   1 
ATOM   6582  C  CB  . ASN B 1 318 ? 42.676  20.982  19.094  1.00 58.08 ? 321  ASN B CB  1 
ATOM   6583  C  CG  . ASN B 1 318 ? 42.723  21.779  17.818  1.00 57.54 ? 321  ASN B CG  1 
ATOM   6584  O  OD1 . ASN B 1 318 ? 42.461  22.976  17.815  1.00 57.81 ? 321  ASN B OD1 1 
ATOM   6585  N  ND2 . ASN B 1 318 ? 43.027  21.114  16.718  1.00 57.15 ? 321  ASN B ND2 1 
ATOM   6586  N  N   . PRO B 1 319 ? 41.404  21.565  22.010  1.00 58.06 ? 322  PRO B N   1 
ATOM   6587  C  CA  . PRO B 1 319 ? 40.779  21.013  23.208  1.00 57.89 ? 322  PRO B CA  1 
ATOM   6588  C  C   . PRO B 1 319 ? 40.417  19.582  22.906  1.00 57.92 ? 322  PRO B C   1 
ATOM   6589  O  O   . PRO B 1 319 ? 40.313  19.214  21.740  1.00 58.00 ? 322  PRO B O   1 
ATOM   6590  C  CB  . PRO B 1 319 ? 39.498  21.835  23.329  1.00 57.88 ? 322  PRO B CB  1 
ATOM   6591  C  CG  . PRO B 1 319 ? 39.779  23.077  22.531  1.00 57.71 ? 322  PRO B CG  1 
ATOM   6592  C  CD  . PRO B 1 319 ? 40.521  22.549  21.370  1.00 57.89 ? 322  PRO B CD  1 
ATOM   6593  N  N   . VAL B 1 320 ? 40.242  18.768  23.938  1.00 58.00 ? 323  VAL B N   1 
ATOM   6594  C  CA  . VAL B 1 320 ? 39.847  17.390  23.717  1.00 58.07 ? 323  VAL B CA  1 
ATOM   6595  C  C   . VAL B 1 320 ? 38.333  17.292  23.909  1.00 58.49 ? 323  VAL B C   1 
ATOM   6596  O  O   . VAL B 1 320 ? 37.656  16.559  23.188  1.00 58.80 ? 323  VAL B O   1 
ATOM   6597  C  CB  . VAL B 1 320 ? 40.585  16.429  24.647  1.00 58.08 ? 323  VAL B CB  1 
ATOM   6598  C  CG1 . VAL B 1 320 ? 40.220  14.992  24.320  1.00 57.55 ? 323  VAL B CG1 1 
ATOM   6599  C  CG2 . VAL B 1 320 ? 42.074  16.625  24.489  1.00 58.02 ? 323  VAL B CG2 1 
ATOM   6600  N  N   . ASN B 1 321 ? 37.801  18.032  24.878  1.00 58.59 ? 324  ASN B N   1 
ATOM   6601  C  CA  . ASN B 1 321 ? 36.361  18.052  25.111  1.00 58.56 ? 324  ASN B CA  1 
ATOM   6602  C  C   . ASN B 1 321 ? 35.965  19.505  25.262  1.00 58.52 ? 324  ASN B C   1 
ATOM   6603  O  O   . ASN B 1 321 ? 36.251  20.135  26.280  1.00 58.97 ? 324  ASN B O   1 
ATOM   6604  C  CB  . ASN B 1 321 ? 35.972  17.272  26.363  1.00 58.87 ? 324  ASN B CB  1 
ATOM   6605  C  CG  . ASN B 1 321 ? 34.468  17.273  26.597  1.00 59.16 ? 324  ASN B CG  1 
ATOM   6606  O  OD1 . ASN B 1 321 ? 33.920  18.214  27.177  1.00 59.84 ? 324  ASN B OD1 1 
ATOM   6607  N  ND2 . ASN B 1 321 ? 33.792  16.224  26.133  1.00 58.84 ? 324  ASN B ND2 1 
ATOM   6608  N  N   . TYR B 1 322 ? 35.290  20.027  24.247  1.00 58.15 ? 325  TYR B N   1 
ATOM   6609  C  CA  . TYR B 1 322 ? 34.870  21.419  24.229  1.00 57.67 ? 325  TYR B CA  1 
ATOM   6610  C  C   . TYR B 1 322 ? 34.183  21.909  25.489  1.00 57.33 ? 325  TYR B C   1 
ATOM   6611  O  O   . TYR B 1 322 ? 34.614  22.888  26.089  1.00 57.53 ? 325  TYR B O   1 
ATOM   6612  C  CB  . TYR B 1 322 ? 33.974  21.671  23.031  1.00 57.70 ? 325  TYR B CB  1 
ATOM   6613  C  CG  . TYR B 1 322 ? 33.624  23.117  22.855  1.00 57.81 ? 325  TYR B CG  1 
ATOM   6614  C  CD1 . TYR B 1 322 ? 34.429  23.959  22.093  1.00 58.06 ? 325  TYR B CD1 1 
ATOM   6615  C  CD2 . TYR B 1 322 ? 32.484  23.650  23.449  1.00 58.11 ? 325  TYR B CD2 1 
ATOM   6616  C  CE1 . TYR B 1 322 ? 34.103  25.303  21.921  1.00 58.01 ? 325  TYR B CE1 1 
ATOM   6617  C  CE2 . TYR B 1 322 ? 32.149  24.987  23.287  1.00 57.98 ? 325  TYR B CE2 1 
ATOM   6618  C  CZ  . TYR B 1 322 ? 32.962  25.808  22.524  1.00 58.17 ? 325  TYR B CZ  1 
ATOM   6619  O  OH  . TYR B 1 322 ? 32.630  27.134  22.369  1.00 58.40 ? 325  TYR B OH  1 
ATOM   6620  N  N   . PHE B 1 323 ? 33.105  21.247  25.884  1.00 56.84 ? 326  PHE B N   1 
ATOM   6621  C  CA  . PHE B 1 323 ? 32.371  21.664  27.069  1.00 56.54 ? 326  PHE B CA  1 
ATOM   6622  C  C   . PHE B 1 323 ? 33.274  21.847  28.274  1.00 56.76 ? 326  PHE B C   1 
ATOM   6623  O  O   . PHE B 1 323 ? 33.323  22.924  28.864  1.00 57.45 ? 326  PHE B O   1 
ATOM   6624  C  CB  . PHE B 1 323 ? 31.278  20.654  27.415  1.00 55.70 ? 326  PHE B CB  1 
ATOM   6625  C  CG  . PHE B 1 323 ? 30.443  21.047  28.610  1.00 54.66 ? 326  PHE B CG  1 
ATOM   6626  C  CD1 . PHE B 1 323 ? 30.759  20.585  29.884  1.00 54.14 ? 326  PHE B CD1 1 
ATOM   6627  C  CD2 . PHE B 1 323 ? 29.349  21.888  28.463  1.00 54.09 ? 326  PHE B CD2 1 
ATOM   6628  C  CE1 . PHE B 1 323 ? 29.994  20.957  30.998  1.00 53.78 ? 326  PHE B CE1 1 
ATOM   6629  C  CE2 . PHE B 1 323 ? 28.577  22.268  29.570  1.00 53.75 ? 326  PHE B CE2 1 
ATOM   6630  C  CZ  . PHE B 1 323 ? 28.901  21.802  30.839  1.00 53.55 ? 326  PHE B CZ  1 
ATOM   6631  N  N   . ALA B 1 324 ? 34.019  20.804  28.610  1.00 56.90 ? 327  ALA B N   1 
ATOM   6632  C  CA  . ALA B 1 324 ? 34.892  20.829  29.770  1.00 57.14 ? 327  ALA B CA  1 
ATOM   6633  C  C   . ALA B 1 324 ? 36.065  21.794  29.719  1.00 57.63 ? 327  ALA B C   1 
ATOM   6634  O  O   . ALA B 1 324 ? 36.467  22.328  30.753  1.00 57.83 ? 327  ALA B O   1 
ATOM   6635  C  CB  . ALA B 1 324 ? 35.391  19.436  30.060  1.00 57.21 ? 327  ALA B CB  1 
ATOM   6636  N  N   . GLU B 1 325 ? 36.615  22.030  28.531  1.00 58.16 ? 328  GLU B N   1 
ATOM   6637  C  CA  . GLU B 1 325 ? 37.781  22.907  28.406  1.00 58.52 ? 328  GLU B CA  1 
ATOM   6638  C  C   . GLU B 1 325 ? 37.515  24.310  27.909  1.00 58.22 ? 328  GLU B C   1 
ATOM   6639  O  O   . GLU B 1 325 ? 38.284  25.224  28.186  1.00 58.05 ? 328  GLU B O   1 
ATOM   6640  C  CB  . GLU B 1 325 ? 38.834  22.259  27.504  1.00 59.49 ? 328  GLU B CB  1 
ATOM   6641  C  CG  . GLU B 1 325 ? 39.361  20.941  28.032  1.00 60.95 ? 328  GLU B CG  1 
ATOM   6642  C  CD  . GLU B 1 325 ? 40.258  20.231  27.039  1.00 62.06 ? 328  GLU B CD  1 
ATOM   6643  O  OE1 . GLU B 1 325 ? 41.224  20.855  26.547  1.00 63.17 ? 328  GLU B OE1 1 
ATOM   6644  O  OE2 . GLU B 1 325 ? 40.001  19.041  26.752  1.00 62.52 ? 328  GLU B OE2 1 
ATOM   6645  N  N   . VAL B 1 326 ? 36.437  24.486  27.163  1.00 57.89 ? 329  VAL B N   1 
ATOM   6646  C  CA  . VAL B 1 326 ? 36.133  25.794  26.623  1.00 57.56 ? 329  VAL B CA  1 
ATOM   6647  C  C   . VAL B 1 326 ? 34.900  26.402  27.235  1.00 57.62 ? 329  VAL B C   1 
ATOM   6648  O  O   . VAL B 1 326 ? 34.931  27.509  27.760  1.00 57.96 ? 329  VAL B O   1 
ATOM   6649  C  CB  . VAL B 1 326 ? 35.927  25.722  25.113  1.00 57.39 ? 329  VAL B CB  1 
ATOM   6650  C  CG1 . VAL B 1 326 ? 35.783  27.110  24.545  1.00 57.24 ? 329  VAL B CG1 1 
ATOM   6651  C  CG2 . VAL B 1 326 ? 37.087  25.000  24.466  1.00 57.13 ? 329  VAL B CG2 1 
ATOM   6652  N  N   . GLU B 1 327 ? 33.799  25.682  27.156  1.00 57.52 ? 330  GLU B N   1 
ATOM   6653  C  CA  . GLU B 1 327 ? 32.567  26.201  27.691  1.00 57.65 ? 330  GLU B CA  1 
ATOM   6654  C  C   . GLU B 1 327 ? 32.685  26.504  29.165  1.00 57.71 ? 330  GLU B C   1 
ATOM   6655  O  O   . GLU B 1 327 ? 32.213  27.540  29.624  1.00 58.09 ? 330  GLU B O   1 
ATOM   6656  C  CB  . GLU B 1 327 ? 31.431  25.220  27.441  1.00 57.96 ? 330  GLU B CB  1 
ATOM   6657  C  CG  . GLU B 1 327 ? 30.064  25.766  27.802  1.00 58.36 ? 330  GLU B CG  1 
ATOM   6658  C  CD  . GLU B 1 327 ? 29.735  27.061  27.088  1.00 58.78 ? 330  GLU B CD  1 
ATOM   6659  O  OE1 . GLU B 1 327 ? 28.920  27.837  27.627  1.00 59.02 ? 330  GLU B OE1 1 
ATOM   6660  O  OE2 . GLU B 1 327 ? 30.275  27.309  25.988  1.00 59.07 ? 330  GLU B OE2 1 
ATOM   6661  N  N   . GLN B 1 328 ? 33.340  25.618  29.902  1.00 57.57 ? 331  GLN B N   1 
ATOM   6662  C  CA  . GLN B 1 328 ? 33.488  25.802  31.339  1.00 57.24 ? 331  GLN B CA  1 
ATOM   6663  C  C   . GLN B 1 328 ? 34.625  26.705  31.769  1.00 57.10 ? 331  GLN B C   1 
ATOM   6664  O  O   . GLN B 1 328 ? 34.693  27.080  32.934  1.00 57.55 ? 331  GLN B O   1 
ATOM   6665  C  CB  . GLN B 1 328 ? 33.636  24.453  32.049  1.00 57.44 ? 331  GLN B CB  1 
ATOM   6666  C  CG  . GLN B 1 328 ? 32.351  23.651  32.163  1.00 57.77 ? 331  GLN B CG  1 
ATOM   6667  C  CD  . GLN B 1 328 ? 32.487  22.455  33.082  1.00 58.02 ? 331  GLN B CD  1 
ATOM   6668  O  OE1 . GLN B 1 328 ? 31.681  22.265  33.997  1.00 58.36 ? 331  GLN B OE1 1 
ATOM   6669  N  NE2 . GLN B 1 328 ? 33.501  21.633  32.838  1.00 58.10 ? 331  GLN B NE2 1 
ATOM   6670  N  N   . ILE B 1 329 ? 35.517  27.067  30.853  1.00 56.82 ? 332  ILE B N   1 
ATOM   6671  C  CA  . ILE B 1 329 ? 36.643  27.912  31.235  1.00 56.23 ? 332  ILE B CA  1 
ATOM   6672  C  C   . ILE B 1 329 ? 36.201  29.293  31.732  1.00 56.22 ? 332  ILE B C   1 
ATOM   6673  O  O   . ILE B 1 329 ? 35.280  29.904  31.186  1.00 56.13 ? 332  ILE B O   1 
ATOM   6674  C  CB  . ILE B 1 329 ? 37.694  28.009  30.107  1.00 56.05 ? 332  ILE B CB  1 
ATOM   6675  C  CG1 . ILE B 1 329 ? 39.022  28.494  30.681  1.00 55.69 ? 332  ILE B CG1 1 
ATOM   6676  C  CG2 . ILE B 1 329 ? 37.227  28.933  29.002  1.00 56.08 ? 332  ILE B CG2 1 
ATOM   6677  C  CD1 . ILE B 1 329 ? 40.146  28.531  29.678  1.00 55.48 ? 332  ILE B CD1 1 
ATOM   6678  N  N   . ALA B 1 330 ? 36.839  29.759  32.802  1.00 56.08 ? 333  ALA B N   1 
ATOM   6679  C  CA  . ALA B 1 330 ? 36.494  31.040  33.399  1.00 56.11 ? 333  ALA B CA  1 
ATOM   6680  C  C   . ALA B 1 330 ? 37.686  31.958  33.554  1.00 56.36 ? 333  ALA B C   1 
ATOM   6681  O  O   . ALA B 1 330 ? 38.693  31.567  34.142  1.00 56.70 ? 333  ALA B O   1 
ATOM   6682  C  CB  . ALA B 1 330 ? 35.864  30.814  34.746  1.00 56.06 ? 333  ALA B CB  1 
ATOM   6683  N  N   . PHE B 1 331 ? 37.555  33.188  33.054  1.00 56.80 ? 334  PHE B N   1 
ATOM   6684  C  CA  . PHE B 1 331 ? 38.624  34.181  33.152  1.00 57.10 ? 334  PHE B CA  1 
ATOM   6685  C  C   . PHE B 1 331 ? 38.195  35.300  34.096  1.00 56.95 ? 334  PHE B C   1 
ATOM   6686  O  O   . PHE B 1 331 ? 37.100  35.852  33.965  1.00 56.96 ? 334  PHE B O   1 
ATOM   6687  C  CB  . PHE B 1 331 ? 38.945  34.788  31.782  1.00 57.51 ? 334  PHE B CB  1 
ATOM   6688  C  CG  . PHE B 1 331 ? 39.400  33.787  30.752  1.00 57.67 ? 334  PHE B CG  1 
ATOM   6689  C  CD1 . PHE B 1 331 ? 40.747  33.489  30.598  1.00 57.51 ? 334  PHE B CD1 1 
ATOM   6690  C  CD2 . PHE B 1 331 ? 38.481  33.186  29.893  1.00 57.79 ? 334  PHE B CD2 1 
ATOM   6691  C  CE1 . PHE B 1 331 ? 41.173  32.610  29.597  1.00 57.61 ? 334  PHE B CE1 1 
ATOM   6692  C  CE2 . PHE B 1 331 ? 38.899  32.306  28.888  1.00 57.65 ? 334  PHE B CE2 1 
ATOM   6693  C  CZ  . PHE B 1 331 ? 40.245  32.020  28.741  1.00 57.56 ? 334  PHE B CZ  1 
ATOM   6694  N  N   . ASP B 1 332 ? 39.055  35.626  35.052  1.00 56.79 ? 335  ASP B N   1 
ATOM   6695  C  CA  . ASP B 1 332 ? 38.764  36.682  36.002  1.00 56.74 ? 335  ASP B CA  1 
ATOM   6696  C  C   . ASP B 1 332 ? 39.868  37.695  35.885  1.00 56.76 ? 335  ASP B C   1 
ATOM   6697  O  O   . ASP B 1 332 ? 41.030  37.373  36.110  1.00 56.89 ? 335  ASP B O   1 
ATOM   6698  C  CB  . ASP B 1 332 ? 38.753  36.137  37.428  1.00 56.93 ? 335  ASP B CB  1 
ATOM   6699  C  CG  . ASP B 1 332 ? 37.643  35.144  37.662  1.00 57.08 ? 335  ASP B CG  1 
ATOM   6700  O  OD1 . ASP B 1 332 ? 37.934  34.013  38.101  1.00 57.00 ? 335  ASP B OD1 1 
ATOM   6701  O  OD2 . ASP B 1 332 ? 36.475  35.498  37.419  1.00 57.87 ? 335  ASP B OD2 1 
ATOM   6702  N  N   . PRO B 1 333 ? 39.530  38.931  35.507  1.00 56.69 ? 336  PRO B N   1 
ATOM   6703  C  CA  . PRO B 1 333 ? 40.540  39.980  35.372  1.00 56.76 ? 336  PRO B CA  1 
ATOM   6704  C  C   . PRO B 1 333 ? 41.186  40.256  36.715  1.00 57.15 ? 336  PRO B C   1 
ATOM   6705  O  O   . PRO B 1 333 ? 42.297  40.779  36.778  1.00 57.25 ? 336  PRO B O   1 
ATOM   6706  C  CB  . PRO B 1 333 ? 39.725  41.173  34.904  1.00 56.42 ? 336  PRO B CB  1 
ATOM   6707  C  CG  . PRO B 1 333 ? 38.601  40.545  34.165  1.00 56.27 ? 336  PRO B CG  1 
ATOM   6708  C  CD  . PRO B 1 333 ? 38.218  39.418  35.070  1.00 56.54 ? 336  PRO B CD  1 
ATOM   6709  N  N   . SER B 1 334 ? 40.488  39.896  37.789  1.00 57.49 ? 337  SER B N   1 
ATOM   6710  C  CA  . SER B 1 334 ? 41.000  40.094  39.141  1.00 57.96 ? 337  SER B CA  1 
ATOM   6711  C  C   . SER B 1 334 ? 42.164  39.153  39.428  1.00 58.51 ? 337  SER B C   1 
ATOM   6712  O  O   . SER B 1 334 ? 42.872  39.312  40.422  1.00 58.91 ? 337  SER B O   1 
ATOM   6713  C  CB  . SER B 1 334 ? 39.896  39.866  40.169  1.00 57.82 ? 337  SER B CB  1 
ATOM   6714  O  OG  . SER B 1 334 ? 39.355  38.565  40.045  1.00 58.06 ? 337  SER B OG  1 
ATOM   6715  N  N   . ASN B 1 335 ? 42.341  38.148  38.579  1.00 59.09 ? 338  ASN B N   1 
ATOM   6716  C  CA  . ASN B 1 335 ? 43.431  37.207  38.765  1.00 59.65 ? 338  ASN B CA  1 
ATOM   6717  C  C   . ASN B 1 335 ? 44.707  37.808  38.213  1.00 60.47 ? 338  ASN B C   1 
ATOM   6718  O  O   . ASN B 1 335 ? 44.956  37.774  37.005  1.00 60.69 ? 338  ASN B O   1 
ATOM   6719  C  CB  . ASN B 1 335 ? 43.132  35.877  38.070  1.00 59.66 ? 338  ASN B CB  1 
ATOM   6720  C  CG  . ASN B 1 335 ? 42.084  35.057  38.801  1.00 59.28 ? 338  ASN B CG  1 
ATOM   6721  O  OD1 . ASN B 1 335 ? 41.453  34.173  38.217  1.00 58.67 ? 338  ASN B OD1 1 
ATOM   6722  N  ND2 . ASN B 1 335 ? 41.896  35.342  40.087  1.00 59.51 ? 338  ASN B ND2 1 
ATOM   6723  N  N   . MET B 1 336 ? 45.494  38.392  39.110  1.00 61.17 ? 339  MET B N   1 
ATOM   6724  C  CA  . MET B 1 336 ? 46.768  39.018  38.758  1.00 61.65 ? 339  MET B CA  1 
ATOM   6725  C  C   . MET B 1 336 ? 47.759  38.647  39.853  1.00 61.91 ? 339  MET B C   1 
ATOM   6726  O  O   . MET B 1 336 ? 47.474  38.811  41.039  1.00 62.19 ? 339  MET B O   1 
ATOM   6727  C  CB  . MET B 1 336 ? 46.624  40.544  38.711  1.00 61.91 ? 339  MET B CB  1 
ATOM   6728  C  CG  . MET B 1 336 ? 45.615  41.057  37.701  1.00 62.41 ? 339  MET B CG  1 
ATOM   6729  S  SD  . MET B 1 336 ? 45.378  42.840  37.779  1.00 62.94 ? 339  MET B SD  1 
ATOM   6730  C  CE  . MET B 1 336 ? 43.766  42.937  38.546  1.00 62.77 ? 339  MET B CE  1 
ATOM   6731  N  N   . PRO B 1 337 ? 48.925  38.107  39.476  1.00 61.89 ? 340  PRO B N   1 
ATOM   6732  C  CA  . PRO B 1 337 ? 49.931  37.724  40.466  1.00 61.74 ? 340  PRO B CA  1 
ATOM   6733  C  C   . PRO B 1 337 ? 50.803  38.930  40.786  1.00 61.98 ? 340  PRO B C   1 
ATOM   6734  O  O   . PRO B 1 337 ? 50.745  39.948  40.088  1.00 62.10 ? 340  PRO B O   1 
ATOM   6735  C  CB  . PRO B 1 337 ? 50.719  36.662  39.722  1.00 61.71 ? 340  PRO B CB  1 
ATOM   6736  C  CG  . PRO B 1 337 ? 50.789  37.259  38.350  1.00 61.73 ? 340  PRO B CG  1 
ATOM   6737  C  CD  . PRO B 1 337 ? 49.375  37.770  38.114  1.00 61.76 ? 340  PRO B CD  1 
ATOM   6738  N  N   . PRO B 1 338 ? 51.617  38.838  41.850  1.00 62.03 ? 341  PRO B N   1 
ATOM   6739  C  CA  . PRO B 1 338 ? 52.505  39.927  42.256  1.00 61.84 ? 341  PRO B CA  1 
ATOM   6740  C  C   . PRO B 1 338 ? 53.303  40.432  41.068  1.00 61.84 ? 341  PRO B C   1 
ATOM   6741  O  O   . PRO B 1 338 ? 53.830  39.650  40.282  1.00 61.84 ? 341  PRO B O   1 
ATOM   6742  C  CB  . PRO B 1 338 ? 53.403  39.252  43.281  1.00 61.79 ? 341  PRO B CB  1 
ATOM   6743  C  CG  . PRO B 1 338 ? 52.461  38.313  43.946  1.00 61.95 ? 341  PRO B CG  1 
ATOM   6744  C  CD  . PRO B 1 338 ? 51.747  37.695  42.768  1.00 61.94 ? 341  PRO B CD  1 
ATOM   6745  N  N   . GLY B 1 339 ? 53.359  41.745  40.917  1.00 61.97 ? 342  GLY B N   1 
ATOM   6746  C  CA  . GLY B 1 339 ? 54.083  42.312  39.801  1.00 62.21 ? 342  GLY B CA  1 
ATOM   6747  C  C   . GLY B 1 339 ? 53.125  42.893  38.778  1.00 62.36 ? 342  GLY B C   1 
ATOM   6748  O  O   . GLY B 1 339 ? 53.545  43.624  37.873  1.00 62.66 ? 342  GLY B O   1 
ATOM   6749  N  N   . ILE B 1 340 ? 51.845  42.536  38.891  1.00 61.99 ? 343  ILE B N   1 
ATOM   6750  C  CA  . ILE B 1 340 ? 50.824  43.059  37.986  1.00 61.40 ? 343  ILE B CA  1 
ATOM   6751  C  C   . ILE B 1 340 ? 49.620  43.468  38.821  1.00 61.29 ? 343  ILE B C   1 
ATOM   6752  O  O   . ILE B 1 340 ? 49.154  42.698  39.657  1.00 61.47 ? 343  ILE B O   1 
ATOM   6753  C  CB  . ILE B 1 340 ? 50.378  42.019  36.942  1.00 61.11 ? 343  ILE B CB  1 
ATOM   6754  C  CG1 . ILE B 1 340 ? 51.592  41.446  36.217  1.00 60.68 ? 343  ILE B CG1 1 
ATOM   6755  C  CG2 . ILE B 1 340 ? 49.460  42.671  35.914  1.00 60.74 ? 343  ILE B CG2 1 
ATOM   6756  C  CD1 . ILE B 1 340 ? 51.236  40.465  35.141  1.00 60.58 ? 343  ILE B CD1 1 
ATOM   6757  N  N   . GLU B 1 341 ? 49.130  44.685  38.615  1.00 61.04 ? 344  GLU B N   1 
ATOM   6758  C  CA  . GLU B 1 341 ? 47.987  45.167  39.372  1.00 60.89 ? 344  GLU B CA  1 
ATOM   6759  C  C   . GLU B 1 341 ? 47.072  46.033  38.535  1.00 60.70 ? 344  GLU B C   1 
ATOM   6760  O  O   . GLU B 1 341 ? 47.454  46.524  37.474  1.00 60.78 ? 344  GLU B O   1 
ATOM   6761  C  CB  . GLU B 1 341 ? 48.453  45.959  40.586  1.00 61.20 ? 344  GLU B CB  1 
ATOM   6762  C  CG  . GLU B 1 341 ? 49.261  45.164  41.585  1.00 61.51 ? 344  GLU B CG  1 
ATOM   6763  C  CD  . GLU B 1 341 ? 49.716  46.013  42.754  1.00 62.05 ? 344  GLU B CD  1 
ATOM   6764  O  OE1 . GLU B 1 341 ? 50.841  45.792  43.253  1.00 62.13 ? 344  GLU B OE1 1 
ATOM   6765  O  OE2 . GLU B 1 341 ? 48.949  46.907  43.177  1.00 62.50 ? 344  GLU B OE2 1 
ATOM   6766  N  N   . ALA B 1 342 ? 45.867  46.244  39.047  1.00 60.36 ? 345  ALA B N   1 
ATOM   6767  C  CA  . ALA B 1 342 ? 44.870  47.054  38.364  1.00 60.22 ? 345  ALA B CA  1 
ATOM   6768  C  C   . ALA B 1 342 ? 45.206  48.534  38.438  1.00 60.03 ? 345  ALA B C   1 
ATOM   6769  O  O   . ALA B 1 342 ? 46.148  48.919  39.121  1.00 60.26 ? 345  ALA B O   1 
ATOM   6770  C  CB  . ALA B 1 342 ? 43.510  46.808  38.982  1.00 60.33 ? 345  ALA B CB  1 
ATOM   6771  N  N   . SER B 1 343 ? 44.456  49.349  37.697  1.00 59.79 ? 346  SER B N   1 
ATOM   6772  C  CA  . SER B 1 343 ? 44.621  50.807  37.702  1.00 59.33 ? 346  SER B CA  1 
ATOM   6773  C  C   . SER B 1 343 ? 43.251  51.351  38.106  1.00 59.25 ? 346  SER B C   1 
ATOM   6774  O  O   . SER B 1 343 ? 42.301  50.582  38.244  1.00 59.34 ? 346  SER B O   1 
ATOM   6775  C  CB  . SER B 1 343 ? 44.989  51.319  36.318  1.00 59.13 ? 346  SER B CB  1 
ATOM   6776  O  OG  . SER B 1 343 ? 43.844  51.372  35.493  1.00 59.53 ? 346  SER B OG  1 
ATOM   6777  N  N   . PRO B 1 344 ? 43.122  52.665  38.325  1.00 59.13 ? 347  PRO B N   1 
ATOM   6778  C  CA  . PRO B 1 344 ? 41.798  53.153  38.713  1.00 59.06 ? 347  PRO B CA  1 
ATOM   6779  C  C   . PRO B 1 344 ? 40.798  53.265  37.570  1.00 59.10 ? 347  PRO B C   1 
ATOM   6780  O  O   . PRO B 1 344 ? 39.766  53.926  37.723  1.00 59.26 ? 347  PRO B O   1 
ATOM   6781  C  CB  . PRO B 1 344 ? 42.103  54.511  39.335  1.00 58.94 ? 347  PRO B CB  1 
ATOM   6782  C  CG  . PRO B 1 344 ? 43.260  54.972  38.547  1.00 59.02 ? 347  PRO B CG  1 
ATOM   6783  C  CD  . PRO B 1 344 ? 44.128  53.731  38.464  1.00 59.22 ? 347  PRO B CD  1 
ATOM   6784  N  N   . ASP B 1 345 ? 41.094  52.635  36.429  1.00 59.03 ? 348  ASP B N   1 
ATOM   6785  C  CA  . ASP B 1 345 ? 40.169  52.670  35.293  1.00 58.72 ? 348  ASP B CA  1 
ATOM   6786  C  C   . ASP B 1 345 ? 38.853  52.133  35.830  1.00 58.80 ? 348  ASP B C   1 
ATOM   6787  O  O   . ASP B 1 345 ? 38.727  50.946  36.145  1.00 59.23 ? 348  ASP B O   1 
ATOM   6788  C  CB  . ASP B 1 345 ? 40.675  51.795  34.135  1.00 58.37 ? 348  ASP B CB  1 
ATOM   6789  C  CG  . ASP B 1 345 ? 39.704  51.747  32.946  1.00 58.07 ? 348  ASP B CG  1 
ATOM   6790  O  OD1 . ASP B 1 345 ? 38.484  51.956  33.125  1.00 58.21 ? 348  ASP B OD1 1 
ATOM   6791  O  OD2 . ASP B 1 345 ? 40.165  51.467  31.819  1.00 57.72 ? 348  ASP B OD2 1 
ATOM   6792  N  N   . LYS B 1 346 ? 37.879  53.022  35.937  1.00 58.80 ? 349  LYS B N   1 
ATOM   6793  C  CA  . LYS B 1 346 ? 36.575  52.657  36.462  1.00 59.05 ? 349  LYS B CA  1 
ATOM   6794  C  C   . LYS B 1 346 ? 36.065  51.346  35.872  1.00 59.33 ? 349  LYS B C   1 
ATOM   6795  O  O   . LYS B 1 346 ? 35.643  50.448  36.605  1.00 59.22 ? 349  LYS B O   1 
ATOM   6796  C  CB  . LYS B 1 346 ? 35.578  53.795  36.222  1.00 58.94 ? 349  LYS B CB  1 
ATOM   6797  C  CG  . LYS B 1 346 ? 35.985  55.135  36.858  1.00 58.67 ? 349  LYS B CG  1 
ATOM   6798  C  CD  . LYS B 1 346 ? 34.880  56.182  36.733  1.00 58.24 ? 349  LYS B CD  1 
ATOM   6799  C  CE  . LYS B 1 346 ? 35.266  57.465  37.447  1.00 58.16 ? 349  LYS B CE  1 
ATOM   6800  N  NZ  . LYS B 1 346 ? 34.146  58.453  37.433  1.00 57.88 ? 349  LYS B NZ  1 
ATOM   6801  N  N   . MET B 1 347 ? 36.188  51.207  34.556  1.00 59.55 ? 350  MET B N   1 
ATOM   6802  C  CA  . MET B 1 347 ? 35.733  50.001  33.868  1.00 59.80 ? 350  MET B CA  1 
ATOM   6803  C  C   . MET B 1 347 ? 36.408  48.773  34.442  1.00 59.50 ? 350  MET B C   1 
ATOM   6804  O  O   . MET B 1 347 ? 35.747  47.808  34.831  1.00 59.59 ? 350  MET B O   1 
ATOM   6805  C  CB  . MET B 1 347 ? 36.023  50.101  32.367  1.00 60.35 ? 350  MET B CB  1 
ATOM   6806  C  CG  . MET B 1 347 ? 35.181  51.144  31.624  1.00 60.63 ? 350  MET B CG  1 
ATOM   6807  S  SD  . MET B 1 347 ? 33.428  50.715  31.479  1.00 61.32 ? 350  MET B SD  1 
ATOM   6808  C  CE  . MET B 1 347 ? 33.529  49.594  30.068  1.00 60.99 ? 350  MET B CE  1 
ATOM   6809  N  N   . LEU B 1 348 ? 37.732  48.810  34.490  1.00 59.22 ? 351  LEU B N   1 
ATOM   6810  C  CA  . LEU B 1 348 ? 38.481  47.694  35.032  1.00 59.01 ? 351  LEU B CA  1 
ATOM   6811  C  C   . LEU B 1 348 ? 38.039  47.453  36.462  1.00 59.08 ? 351  LEU B C   1 
ATOM   6812  O  O   . LEU B 1 348 ? 37.716  46.324  36.827  1.00 59.34 ? 351  LEU B O   1 
ATOM   6813  C  CB  . LEU B 1 348 ? 39.978  47.977  34.982  1.00 58.85 ? 351  LEU B CB  1 
ATOM   6814  C  CG  . LEU B 1 348 ? 40.896  46.938  35.634  1.00 58.64 ? 351  LEU B CG  1 
ATOM   6815  C  CD1 . LEU B 1 348 ? 40.627  45.547  35.094  1.00 58.02 ? 351  LEU B CD1 1 
ATOM   6816  C  CD2 . LEU B 1 348 ? 42.344  47.343  35.395  1.00 58.80 ? 351  LEU B CD2 1 
ATOM   6817  N  N   . GLN B 1 349 ? 37.981  48.517  37.255  1.00 58.93 ? 352  GLN B N   1 
ATOM   6818  C  CA  . GLN B 1 349 ? 37.561  48.390  38.645  1.00 58.91 ? 352  GLN B CA  1 
ATOM   6819  C  C   . GLN B 1 349 ? 36.298  47.537  38.715  1.00 59.25 ? 352  GLN B C   1 
ATOM   6820  O  O   . GLN B 1 349 ? 36.254  46.527  39.420  1.00 59.88 ? 352  GLN B O   1 
ATOM   6821  C  CB  . GLN B 1 349 ? 37.292  49.764  39.249  1.00 58.34 ? 352  GLN B CB  1 
ATOM   6822  C  CG  . GLN B 1 349 ? 38.540  50.575  39.548  1.00 57.46 ? 352  GLN B CG  1 
ATOM   6823  C  CD  . GLN B 1 349 ? 39.273  50.096  40.787  1.00 56.75 ? 352  GLN B CD  1 
ATOM   6824  O  OE1 . GLN B 1 349 ? 38.722  50.094  41.889  1.00 56.90 ? 352  GLN B OE1 1 
ATOM   6825  N  NE2 . GLN B 1 349 ? 40.528  49.713  40.619  1.00 56.15 ? 352  GLN B NE2 1 
ATOM   6826  N  N   . GLY B 1 350 ? 35.305  47.897  37.911  1.00 59.48 ? 353  GLY B N   1 
ATOM   6827  C  CA  . GLY B 1 350 ? 34.066  47.144  37.902  1.00 59.08 ? 353  GLY B CA  1 
ATOM   6828  C  C   . GLY B 1 350 ? 34.267  45.694  37.518  1.00 58.83 ? 353  GLY B C   1 
ATOM   6829  O  O   . GLY B 1 350 ? 33.651  44.799  38.095  1.00 58.96 ? 353  GLY B O   1 
ATOM   6830  N  N   . ARG B 1 351 ? 35.156  45.448  36.565  1.00 58.56 ? 354  ARG B N   1 
ATOM   6831  C  CA  . ARG B 1 351 ? 35.396  44.085  36.134  1.00 58.41 ? 354  ARG B CA  1 
ATOM   6832  C  C   . ARG B 1 351 ? 36.007  43.235  37.240  1.00 58.68 ? 354  ARG B C   1 
ATOM   6833  O  O   . ARG B 1 351 ? 35.784  42.018  37.297  1.00 58.74 ? 354  ARG B O   1 
ATOM   6834  C  CB  . ARG B 1 351 ? 36.256  44.071  34.872  1.00 58.42 ? 354  ARG B CB  1 
ATOM   6835  C  CG  . ARG B 1 351 ? 35.553  44.703  33.680  1.00 58.21 ? 354  ARG B CG  1 
ATOM   6836  C  CD  . ARG B 1 351 ? 36.414  44.710  32.442  1.00 58.49 ? 354  ARG B CD  1 
ATOM   6837  N  NE  . ARG B 1 351 ? 36.591  43.372  31.889  1.00 59.15 ? 354  ARG B NE  1 
ATOM   6838  C  CZ  . ARG B 1 351 ? 37.628  43.013  31.138  1.00 59.39 ? 354  ARG B CZ  1 
ATOM   6839  N  NH1 . ARG B 1 351 ? 38.584  43.890  30.859  1.00 59.53 ? 354  ARG B NH1 1 
ATOM   6840  N  NH2 . ARG B 1 351 ? 37.684  41.792  30.626  1.00 59.66 ? 354  ARG B NH2 1 
ATOM   6841  N  N   . LEU B 1 352 ? 36.716  43.883  38.159  1.00 58.74 ? 355  LEU B N   1 
ATOM   6842  C  CA  . LEU B 1 352 ? 37.341  43.166  39.263  1.00 58.81 ? 355  LEU B CA  1 
ATOM   6843  C  C   . LEU B 1 352 ? 36.305  42.373  40.032  1.00 58.91 ? 355  LEU B C   1 
ATOM   6844  O  O   . LEU B 1 352 ? 36.597  41.304  40.560  1.00 59.19 ? 355  LEU B O   1 
ATOM   6845  C  CB  . LEU B 1 352 ? 38.038  44.134  40.214  1.00 58.75 ? 355  LEU B CB  1 
ATOM   6846  C  CG  . LEU B 1 352 ? 39.275  44.861  39.690  1.00 58.95 ? 355  LEU B CG  1 
ATOM   6847  C  CD1 . LEU B 1 352 ? 39.810  45.782  40.767  1.00 59.07 ? 355  LEU B CD1 1 
ATOM   6848  C  CD2 . LEU B 1 352 ? 40.341  43.864  39.287  1.00 58.83 ? 355  LEU B CD2 1 
ATOM   6849  N  N   . PHE B 1 353 ? 35.084  42.891  40.067  1.00 58.99 ? 356  PHE B N   1 
ATOM   6850  C  CA  . PHE B 1 353 ? 34.002  42.236  40.781  1.00 59.11 ? 356  PHE B CA  1 
ATOM   6851  C  C   . PHE B 1 353 ? 33.167  41.289  39.929  1.00 58.92 ? 356  PHE B C   1 
ATOM   6852  O  O   . PHE B 1 353 ? 32.943  40.131  40.287  1.00 59.23 ? 356  PHE B O   1 
ATOM   6853  C  CB  . PHE B 1 353 ? 33.079  43.289  41.387  1.00 59.48 ? 356  PHE B CB  1 
ATOM   6854  C  CG  . PHE B 1 353 ? 31.714  42.763  41.735  1.00 60.28 ? 356  PHE B CG  1 
ATOM   6855  C  CD1 . PHE B 1 353 ? 31.496  42.089  42.932  1.00 60.75 ? 356  PHE B CD1 1 
ATOM   6856  C  CD2 . PHE B 1 353 ? 30.652  42.900  40.843  1.00 60.59 ? 356  PHE B CD2 1 
ATOM   6857  C  CE1 . PHE B 1 353 ? 30.239  41.551  43.234  1.00 60.83 ? 356  PHE B CE1 1 
ATOM   6858  C  CE2 . PHE B 1 353 ? 29.396  42.367  41.134  1.00 60.73 ? 356  PHE B CE2 1 
ATOM   6859  C  CZ  . PHE B 1 353 ? 29.190  41.691  42.332  1.00 60.82 ? 356  PHE B CZ  1 
ATOM   6860  N  N   . ALA B 1 354 ? 32.662  41.824  38.828  1.00 58.69 ? 357  ALA B N   1 
ATOM   6861  C  CA  . ALA B 1 354 ? 31.784  41.103  37.918  1.00 58.43 ? 357  ALA B CA  1 
ATOM   6862  C  C   . ALA B 1 354 ? 32.093  39.651  37.572  1.00 58.31 ? 357  ALA B C   1 
ATOM   6863  O  O   . ALA B 1 354 ? 31.263  38.758  37.789  1.00 58.60 ? 357  ALA B O   1 
ATOM   6864  C  CB  . ALA B 1 354 ? 31.609  41.908  36.645  1.00 58.74 ? 357  ALA B CB  1 
ATOM   6865  N  N   . TYR B 1 355 ? 33.282  39.410  37.036  1.00 57.99 ? 358  TYR B N   1 
ATOM   6866  C  CA  . TYR B 1 355 ? 33.643  38.068  36.614  1.00 57.57 ? 358  TYR B CA  1 
ATOM   6867  C  C   . TYR B 1 355 ? 33.554  36.960  37.658  1.00 57.62 ? 358  TYR B C   1 
ATOM   6868  O  O   . TYR B 1 355 ? 32.731  36.053  37.519  1.00 57.84 ? 358  TYR B O   1 
ATOM   6869  C  CB  . TYR B 1 355 ? 34.984  38.080  35.884  1.00 57.33 ? 358  TYR B CB  1 
ATOM   6870  C  CG  . TYR B 1 355 ? 34.956  38.894  34.603  1.00 56.81 ? 358  TYR B CG  1 
ATOM   6871  C  CD1 . TYR B 1 355 ? 35.164  38.289  33.368  1.00 56.67 ? 358  TYR B CD1 1 
ATOM   6872  C  CD2 . TYR B 1 355 ? 34.751  40.277  34.627  1.00 56.57 ? 358  TYR B CD2 1 
ATOM   6873  C  CE1 . TYR B 1 355 ? 35.177  39.042  32.184  1.00 56.62 ? 358  TYR B CE1 1 
ATOM   6874  C  CE2 . TYR B 1 355 ? 34.763  41.037  33.445  1.00 56.70 ? 358  TYR B CE2 1 
ATOM   6875  C  CZ  . TYR B 1 355 ? 34.980  40.410  32.230  1.00 56.63 ? 358  TYR B CZ  1 
ATOM   6876  O  OH  . TYR B 1 355 ? 35.032  41.142  31.065  1.00 56.58 ? 358  TYR B OH  1 
ATOM   6877  N  N   . PRO B 1 356 ? 34.365  37.015  38.728  1.00 57.39 ? 359  PRO B N   1 
ATOM   6878  C  CA  . PRO B 1 356 ? 34.242  35.929  39.706  1.00 57.20 ? 359  PRO B CA  1 
ATOM   6879  C  C   . PRO B 1 356 ? 32.811  35.805  40.214  1.00 57.31 ? 359  PRO B C   1 
ATOM   6880  O  O   . PRO B 1 356 ? 32.314  34.704  40.460  1.00 57.65 ? 359  PRO B O   1 
ATOM   6881  C  CB  . PRO B 1 356 ? 35.231  36.333  40.796  1.00 56.90 ? 359  PRO B CB  1 
ATOM   6882  C  CG  . PRO B 1 356 ? 35.376  37.803  40.624  1.00 57.05 ? 359  PRO B CG  1 
ATOM   6883  C  CD  . PRO B 1 356 ? 35.380  37.991  39.154  1.00 57.00 ? 359  PRO B CD  1 
ATOM   6884  N  N   . ASP B 1 357 ? 32.115  36.933  40.261  1.00 57.52 ? 360  ASP B N   1 
ATOM   6885  C  CA  . ASP B 1 357 ? 30.728  36.946  40.704  1.00 57.50 ? 360  ASP B CA  1 
ATOM   6886  C  C   . ASP B 1 357 ? 29.865  36.128  39.752  1.00 57.35 ? 360  ASP B C   1 
ATOM   6887  O  O   . ASP B 1 357 ? 29.210  35.170  40.158  1.00 57.23 ? 360  ASP B O   1 
ATOM   6888  C  CB  . ASP B 1 357 ? 30.208  38.381  40.764  1.00 57.59 ? 360  ASP B CB  1 
ATOM   6889  C  CG  . ASP B 1 357 ? 28.744  38.450  41.140  1.00 58.12 ? 360  ASP B CG  1 
ATOM   6890  O  OD1 . ASP B 1 357 ? 28.392  38.053  42.269  1.00 58.34 ? 360  ASP B OD1 1 
ATOM   6891  O  OD2 . ASP B 1 357 ? 27.937  38.890  40.302  1.00 58.65 ? 360  ASP B OD2 1 
ATOM   6892  N  N   . THR B 1 358 ? 29.904  36.483  38.473  1.00 57.44 ? 361  THR B N   1 
ATOM   6893  C  CA  . THR B 1 358 ? 29.110  35.784  37.477  1.00 57.75 ? 361  THR B CA  1 
ATOM   6894  C  C   . THR B 1 358 ? 29.530  34.327  37.336  1.00 58.14 ? 361  THR B C   1 
ATOM   6895  O  O   . THR B 1 358 ? 28.725  33.475  36.960  1.00 58.58 ? 361  THR B O   1 
ATOM   6896  C  CB  . THR B 1 358 ? 29.189  36.484  36.109  1.00 57.67 ? 361  THR B CB  1 
ATOM   6897  O  OG1 . THR B 1 358 ? 28.086  36.067  35.297  1.00 57.54 ? 361  THR B OG1 1 
ATOM   6898  C  CG2 . THR B 1 358 ? 30.467  36.135  35.392  1.00 57.62 ? 361  THR B CG2 1 
ATOM   6899  N  N   . HIS B 1 359 ? 30.787  34.033  37.643  1.00 58.48 ? 362  HIS B N   1 
ATOM   6900  C  CA  . HIS B 1 359 ? 31.269  32.665  37.531  1.00 58.48 ? 362  HIS B CA  1 
ATOM   6901  C  C   . HIS B 1 359 ? 30.690  31.794  38.617  1.00 58.51 ? 362  HIS B C   1 
ATOM   6902  O  O   . HIS B 1 359 ? 30.382  30.623  38.388  1.00 58.68 ? 362  HIS B O   1 
ATOM   6903  C  CB  . HIS B 1 359 ? 32.787  32.621  37.579  1.00 59.26 ? 362  HIS B CB  1 
ATOM   6904  C  CG  . HIS B 1 359 ? 33.429  33.086  36.317  1.00 59.83 ? 362  HIS B CG  1 
ATOM   6905  N  ND1 . HIS B 1 359 ? 34.515  33.935  36.301  1.00 60.36 ? 362  HIS B ND1 1 
ATOM   6906  C  CD2 . HIS B 1 359 ? 33.109  32.858  35.022  1.00 60.22 ? 362  HIS B CD2 1 
ATOM   6907  C  CE1 . HIS B 1 359 ? 34.834  34.215  35.048  1.00 60.64 ? 362  HIS B CE1 1 
ATOM   6908  N  NE2 . HIS B 1 359 ? 33.995  33.573  34.252  1.00 60.63 ? 362  HIS B NE2 1 
ATOM   6909  N  N   . ARG B 1 360 ? 30.543  32.363  39.806  1.00 58.16 ? 363  ARG B N   1 
ATOM   6910  C  CA  . ARG B 1 360 ? 29.976  31.621  40.913  1.00 57.83 ? 363  ARG B CA  1 
ATOM   6911  C  C   . ARG B 1 360 ? 28.544  31.255  40.558  1.00 57.97 ? 363  ARG B C   1 
ATOM   6912  O  O   . ARG B 1 360 ? 27.982  30.309  41.107  1.00 58.02 ? 363  ARG B O   1 
ATOM   6913  C  CB  . ARG B 1 360 ? 30.028  32.470  42.171  1.00 57.64 ? 363  ARG B CB  1 
ATOM   6914  C  CG  . ARG B 1 360 ? 31.449  32.765  42.572  1.00 57.23 ? 363  ARG B CG  1 
ATOM   6915  C  CD  . ARG B 1 360 ? 31.568  33.735  43.725  1.00 56.81 ? 363  ARG B CD  1 
ATOM   6916  N  NE  . ARG B 1 360 ? 32.978  33.968  44.022  1.00 56.32 ? 363  ARG B NE  1 
ATOM   6917  C  CZ  . ARG B 1 360 ? 33.566  35.156  43.974  1.00 56.11 ? 363  ARG B CZ  1 
ATOM   6918  N  NH1 . ARG B 1 360 ? 32.865  36.235  43.654  1.00 55.77 ? 363  ARG B NH1 1 
ATOM   6919  N  NH2 . ARG B 1 360 ? 34.863  35.259  44.212  1.00 55.92 ? 363  ARG B NH2 1 
ATOM   6920  N  N   . HIS B 1 361 ? 27.991  31.977  39.584  1.00 57.83 ? 364  HIS B N   1 
ATOM   6921  C  CA  . HIS B 1 361 ? 26.633  31.755  39.113  1.00 57.64 ? 364  HIS B CA  1 
ATOM   6922  C  C   . HIS B 1 361 ? 26.520  30.726  37.998  1.00 57.30 ? 364  HIS B C   1 
ATOM   6923  O  O   . HIS B 1 361 ? 25.880  29.699  38.194  1.00 57.44 ? 364  HIS B O   1 
ATOM   6924  C  CB  . HIS B 1 361 ? 25.992  33.066  38.654  1.00 58.05 ? 364  HIS B CB  1 
ATOM   6925  C  CG  . HIS B 1 361 ? 24.733  32.883  37.859  1.00 58.84 ? 364  HIS B CG  1 
ATOM   6926  N  ND1 . HIS B 1 361 ? 23.569  32.385  38.405  1.00 59.04 ? 364  HIS B ND1 1 
ATOM   6927  C  CD2 . HIS B 1 361 ? 24.461  33.123  36.553  1.00 58.99 ? 364  HIS B CD2 1 
ATOM   6928  C  CE1 . HIS B 1 361 ? 22.635  32.325  37.472  1.00 59.25 ? 364  HIS B CE1 1 
ATOM   6929  N  NE2 . HIS B 1 361 ? 23.149  32.767  36.337  1.00 59.25 ? 364  HIS B NE2 1 
ATOM   6930  N  N   . ARG B 1 362 ? 27.127  30.982  36.836  1.00 56.87 ? 365  ARG B N   1 
ATOM   6931  C  CA  . ARG B 1 362 ? 26.994  30.037  35.723  1.00 56.39 ? 365  ARG B CA  1 
ATOM   6932  C  C   . ARG B 1 362 ? 27.775  28.742  35.865  1.00 56.33 ? 365  ARG B C   1 
ATOM   6933  O  O   . ARG B 1 362 ? 27.397  27.712  35.299  1.00 56.45 ? 365  ARG B O   1 
ATOM   6934  C  CB  . ARG B 1 362 ? 27.280  30.698  34.375  1.00 55.85 ? 365  ARG B CB  1 
ATOM   6935  C  CG  . ARG B 1 362 ? 28.710  30.702  33.960  1.00 55.54 ? 365  ARG B CG  1 
ATOM   6936  C  CD  . ARG B 1 362 ? 28.818  31.111  32.507  1.00 55.62 ? 365  ARG B CD  1 
ATOM   6937  N  NE  . ARG B 1 362 ? 30.204  31.379  32.143  1.00 55.59 ? 365  ARG B NE  1 
ATOM   6938  C  CZ  . ARG B 1 362 ? 31.074  30.444  31.787  1.00 55.77 ? 365  ARG B CZ  1 
ATOM   6939  N  NH1 . ARG B 1 362 ? 32.320  30.781  31.483  1.00 55.74 ? 365  ARG B NH1 1 
ATOM   6940  N  NH2 . ARG B 1 362 ? 30.696  29.174  31.719  1.00 55.82 ? 365  ARG B NH2 1 
ATOM   6941  N  N   . LEU B 1 363 ? 28.864  28.788  36.616  1.00 56.39 ? 366  LEU B N   1 
ATOM   6942  C  CA  . LEU B 1 363 ? 29.656  27.594  36.825  1.00 56.56 ? 366  LEU B CA  1 
ATOM   6943  C  C   . LEU B 1 363 ? 29.365  27.057  38.209  1.00 57.16 ? 366  LEU B C   1 
ATOM   6944  O  O   . LEU B 1 363 ? 28.989  25.897  38.359  1.00 57.85 ? 366  LEU B O   1 
ATOM   6945  C  CB  . LEU B 1 363 ? 31.139  27.889  36.649  1.00 55.63 ? 366  LEU B CB  1 
ATOM   6946  C  CG  . LEU B 1 363 ? 31.513  28.263  35.215  1.00 54.78 ? 366  LEU B CG  1 
ATOM   6947  C  CD1 . LEU B 1 363 ? 32.995  28.519  35.126  1.00 54.04 ? 366  LEU B CD1 1 
ATOM   6948  C  CD2 . LEU B 1 363 ? 31.101  27.156  34.261  1.00 54.18 ? 366  LEU B CD2 1 
ATOM   6949  N  N   . GLY B 1 364 ? 29.506  27.897  39.225  1.00 57.61 ? 367  GLY B N   1 
ATOM   6950  C  CA  . GLY B 1 364 ? 29.232  27.432  40.569  1.00 57.51 ? 367  GLY B CA  1 
ATOM   6951  C  C   . GLY B 1 364 ? 30.200  27.960  41.602  1.00 57.51 ? 367  GLY B C   1 
ATOM   6952  O  O   . GLY B 1 364 ? 31.274  28.450  41.259  1.00 57.86 ? 367  GLY B O   1 
ATOM   6953  N  N   . PRO B 1 365 ? 29.850  27.860  42.888  1.00 57.42 ? 368  PRO B N   1 
ATOM   6954  C  CA  . PRO B 1 365 ? 30.690  28.330  43.985  1.00 57.49 ? 368  PRO B CA  1 
ATOM   6955  C  C   . PRO B 1 365 ? 32.148  27.903  43.873  1.00 57.84 ? 368  PRO B C   1 
ATOM   6956  O  O   . PRO B 1 365 ? 33.043  28.728  43.970  1.00 57.81 ? 368  PRO B O   1 
ATOM   6957  C  CB  . PRO B 1 365 ? 30.007  27.725  45.201  1.00 57.34 ? 368  PRO B CB  1 
ATOM   6958  C  CG  . PRO B 1 365 ? 28.558  27.823  44.817  1.00 57.08 ? 368  PRO B CG  1 
ATOM   6959  C  CD  . PRO B 1 365 ? 28.584  27.305  43.404  1.00 57.37 ? 368  PRO B CD  1 
ATOM   6960  N  N   . ASN B 1 366 ? 32.392  26.627  43.636  1.00 58.54 ? 369  ASN B N   1 
ATOM   6961  C  CA  . ASN B 1 366 ? 33.758  26.152  43.521  1.00 59.42 ? 369  ASN B CA  1 
ATOM   6962  C  C   . ASN B 1 366 ? 34.227  26.020  42.083  1.00 60.04 ? 369  ASN B C   1 
ATOM   6963  O  O   . ASN B 1 366 ? 34.946  25.079  41.748  1.00 60.59 ? 369  ASN B O   1 
ATOM   6964  C  CB  . ASN B 1 366 ? 33.910  24.819  44.246  1.00 59.27 ? 369  ASN B CB  1 
ATOM   6965  C  CG  . ASN B 1 366 ? 33.925  24.981  45.741  1.00 59.50 ? 369  ASN B CG  1 
ATOM   6966  O  OD1 . ASN B 1 366 ? 33.142  24.350  46.455  1.00 60.05 ? 369  ASN B OD1 1 
ATOM   6967  N  ND2 . ASN B 1 366 ? 34.815  25.839  46.231  1.00 58.97 ? 369  ASN B ND2 1 
ATOM   6968  N  N   . TYR B 1 367 ? 33.874  26.986  41.242  1.00 60.61 ? 370  TYR B N   1 
ATOM   6969  C  CA  . TYR B 1 367 ? 34.265  26.931  39.834  1.00 60.88 ? 370  TYR B CA  1 
ATOM   6970  C  C   . TYR B 1 367 ? 35.766  26.766  39.591  1.00 61.18 ? 370  TYR B C   1 
ATOM   6971  O  O   . TYR B 1 367 ? 36.173  26.223  38.562  1.00 61.17 ? 370  TYR B O   1 
ATOM   6972  C  CB  . TYR B 1 367 ? 33.735  28.146  39.067  1.00 60.50 ? 370  TYR B CB  1 
ATOM   6973  C  CG  . TYR B 1 367 ? 34.416  29.469  39.370  1.00 60.31 ? 370  TYR B CG  1 
ATOM   6974  C  CD1 . TYR B 1 367 ? 35.466  29.935  38.571  1.00 60.02 ? 370  TYR B CD1 1 
ATOM   6975  C  CD2 . TYR B 1 367 ? 33.978  30.283  40.416  1.00 59.92 ? 370  TYR B CD2 1 
ATOM   6976  C  CE1 . TYR B 1 367 ? 36.059  31.172  38.801  1.00 59.69 ? 370  TYR B CE1 1 
ATOM   6977  C  CE2 . TYR B 1 367 ? 34.568  31.524  40.652  1.00 59.55 ? 370  TYR B CE2 1 
ATOM   6978  C  CZ  . TYR B 1 367 ? 35.607  31.958  39.838  1.00 59.57 ? 370  TYR B CZ  1 
ATOM   6979  O  OH  . TYR B 1 367 ? 36.204  33.178  40.054  1.00 59.62 ? 370  TYR B OH  1 
ATOM   6980  N  N   . LEU B 1 368 ? 36.579  27.197  40.551  1.00 61.33 ? 371  LEU B N   1 
ATOM   6981  C  CA  . LEU B 1 368 ? 38.028  27.099  40.420  1.00 61.41 ? 371  LEU B CA  1 
ATOM   6982  C  C   . LEU B 1 368 ? 38.559  25.675  40.526  1.00 61.51 ? 371  LEU B C   1 
ATOM   6983  O  O   . LEU B 1 368 ? 39.716  25.409  40.189  1.00 61.62 ? 371  LEU B O   1 
ATOM   6984  C  CB  . LEU B 1 368 ? 38.711  28.005  41.441  1.00 61.20 ? 371  LEU B CB  1 
ATOM   6985  C  CG  . LEU B 1 368 ? 38.489  29.502  41.190  1.00 60.85 ? 371  LEU B CG  1 
ATOM   6986  C  CD1 . LEU B 1 368 ? 39.028  30.308  42.351  1.00 61.20 ? 371  LEU B CD1 1 
ATOM   6987  C  CD2 . LEU B 1 368 ? 39.151  29.927  39.889  1.00 60.30 ? 371  LEU B CD2 1 
ATOM   6988  N  N   . HIS B 1 369 ? 37.721  24.762  41.003  1.00 61.75 ? 372  HIS B N   1 
ATOM   6989  C  CA  . HIS B 1 369 ? 38.123  23.371  41.124  1.00 62.04 ? 372  HIS B CA  1 
ATOM   6990  C  C   . HIS B 1 369 ? 38.183  22.712  39.761  1.00 61.42 ? 372  HIS B C   1 
ATOM   6991  O  O   . HIS B 1 369 ? 38.966  21.788  39.549  1.00 61.19 ? 372  HIS B O   1 
ATOM   6992  C  CB  . HIS B 1 369 ? 37.150  22.601  42.008  1.00 63.46 ? 372  HIS B CB  1 
ATOM   6993  C  CG  . HIS B 1 369 ? 37.257  22.940  43.458  1.00 65.20 ? 372  HIS B CG  1 
ATOM   6994  N  ND1 . HIS B 1 369 ? 38.089  23.937  43.926  1.00 65.83 ? 372  HIS B ND1 1 
ATOM   6995  C  CD2 . HIS B 1 369 ? 36.637  22.422  44.547  1.00 65.89 ? 372  HIS B CD2 1 
ATOM   6996  C  CE1 . HIS B 1 369 ? 37.973  24.019  45.240  1.00 66.61 ? 372  HIS B CE1 1 
ATOM   6997  N  NE2 . HIS B 1 369 ? 37.099  23.111  45.641  1.00 66.64 ? 372  HIS B NE2 1 
ATOM   6998  N  N   . ILE B 1 370 ? 37.335  23.176  38.846  1.00 60.85 ? 373  ILE B N   1 
ATOM   6999  C  CA  . ILE B 1 370 ? 37.295  22.626  37.501  1.00 60.58 ? 373  ILE B CA  1 
ATOM   7000  C  C   . ILE B 1 370 ? 38.703  22.632  36.935  1.00 60.12 ? 373  ILE B C   1 
ATOM   7001  O  O   . ILE B 1 370 ? 39.384  23.656  36.936  1.00 60.23 ? 373  ILE B O   1 
ATOM   7002  C  CB  . ILE B 1 370 ? 36.361  23.424  36.585  1.00 60.60 ? 373  ILE B CB  1 
ATOM   7003  C  CG1 . ILE B 1 370 ? 34.958  23.480  37.187  1.00 60.56 ? 373  ILE B CG1 1 
ATOM   7004  C  CG2 . ILE B 1 370 ? 36.296  22.774  35.210  1.00 60.68 ? 373  ILE B CG2 1 
ATOM   7005  C  CD1 . ILE B 1 370 ? 33.937  24.136  36.280  1.00 61.03 ? 373  ILE B CD1 1 
ATOM   7006  N  N   . PRO B 1 371 ? 39.158  21.475  36.453  1.00 59.85 ? 374  PRO B N   1 
ATOM   7007  C  CA  . PRO B 1 371 ? 40.491  21.297  35.882  1.00 60.01 ? 374  PRO B CA  1 
ATOM   7008  C  C   . PRO B 1 371 ? 41.003  22.448  35.036  1.00 59.88 ? 374  PRO B C   1 
ATOM   7009  O  O   . PRO B 1 371 ? 42.028  23.047  35.359  1.00 59.98 ? 374  PRO B O   1 
ATOM   7010  C  CB  . PRO B 1 371 ? 40.338  20.010  35.089  1.00 59.83 ? 374  PRO B CB  1 
ATOM   7011  C  CG  . PRO B 1 371 ? 39.439  19.219  35.991  1.00 59.69 ? 374  PRO B CG  1 
ATOM   7012  C  CD  . PRO B 1 371 ? 38.378  20.231  36.339  1.00 59.76 ? 374  PRO B CD  1 
ATOM   7013  N  N   . VAL B 1 372 ? 40.265  22.813  34.001  1.00 59.94 ? 375  VAL B N   1 
ATOM   7014  C  CA  . VAL B 1 372 ? 40.719  23.889  33.140  1.00 60.13 ? 375  VAL B CA  1 
ATOM   7015  C  C   . VAL B 1 372 ? 40.910  25.201  33.891  1.00 60.68 ? 375  VAL B C   1 
ATOM   7016  O  O   . VAL B 1 372 ? 41.759  26.015  33.523  1.00 60.75 ? 375  VAL B O   1 
ATOM   7017  C  CB  . VAL B 1 372 ? 39.762  24.101  31.958  1.00 59.71 ? 375  VAL B CB  1 
ATOM   7018  C  CG1 . VAL B 1 372 ? 38.438  24.668  32.436  1.00 59.64 ? 375  VAL B CG1 1 
ATOM   7019  C  CG2 . VAL B 1 372 ? 40.390  25.009  30.938  1.00 59.13 ? 375  VAL B CG2 1 
ATOM   7020  N  N   . ASN B 1 373 ? 40.160  25.387  34.972  1.00 61.28 ? 376  ASN B N   1 
ATOM   7021  C  CA  . ASN B 1 373 ? 40.247  26.621  35.744  1.00 61.91 ? 376  ASN B CA  1 
ATOM   7022  C  C   . ASN B 1 373 ? 41.210  26.580  36.920  1.00 62.72 ? 376  ASN B C   1 
ATOM   7023  O  O   . ASN B 1 373 ? 41.561  27.620  37.472  1.00 62.75 ? 376  ASN B O   1 
ATOM   7024  C  CB  . ASN B 1 373 ? 38.859  27.030  36.237  1.00 61.66 ? 376  ASN B CB  1 
ATOM   7025  C  CG  . ASN B 1 373 ? 37.924  27.395  35.107  1.00 61.02 ? 376  ASN B CG  1 
ATOM   7026  O  OD1 . ASN B 1 373 ? 38.355  27.903  34.072  1.00 61.25 ? 376  ASN B OD1 1 
ATOM   7027  N  ND2 . ASN B 1 373 ? 36.634  27.136  35.297  1.00 60.93 ? 376  ASN B ND2 1 
ATOM   7028  N  N   . CYS B 1 374 ? 41.642  25.384  37.299  1.00 63.64 ? 377  CYS B N   1 
ATOM   7029  C  CA  . CYS B 1 374 ? 42.552  25.216  38.430  1.00 64.46 ? 377  CYS B CA  1 
ATOM   7030  C  C   . CYS B 1 374 ? 43.954  25.781  38.151  1.00 64.50 ? 377  CYS B C   1 
ATOM   7031  O  O   . CYS B 1 374 ? 44.490  25.630  37.050  1.00 64.51 ? 377  CYS B O   1 
ATOM   7032  C  CB  . CYS B 1 374 ? 42.635  23.727  38.785  1.00 65.05 ? 377  CYS B CB  1 
ATOM   7033  S  SG  . CYS B 1 374 ? 43.292  23.327  40.420  1.00 67.48 ? 377  CYS B SG  1 
ATOM   7034  N  N   . PRO B 1 375 ? 44.542  26.493  39.132  1.00 64.46 ? 378  PRO B N   1 
ATOM   7035  C  CA  . PRO B 1 375 ? 45.882  27.071  38.980  1.00 64.68 ? 378  PRO B CA  1 
ATOM   7036  C  C   . PRO B 1 375 ? 46.876  25.959  39.294  1.00 65.15 ? 378  PRO B C   1 
ATOM   7037  O  O   . PRO B 1 375 ? 47.631  26.028  40.259  1.00 65.32 ? 378  PRO B O   1 
ATOM   7038  C  CB  . PRO B 1 375 ? 45.889  28.155  40.051  1.00 64.44 ? 378  PRO B CB  1 
ATOM   7039  C  CG  . PRO B 1 375 ? 45.118  27.516  41.151  1.00 64.11 ? 378  PRO B CG  1 
ATOM   7040  C  CD  . PRO B 1 375 ? 43.955  26.865  40.433  1.00 64.36 ? 378  PRO B CD  1 
ATOM   7041  N  N   . TYR B 1 376 ? 46.857  24.930  38.457  1.00 66.06 ? 379  TYR B N   1 
ATOM   7042  C  CA  . TYR B 1 376 ? 47.688  23.752  38.639  1.00 66.81 ? 379  TYR B CA  1 
ATOM   7043  C  C   . TYR B 1 376 ? 49.188  23.931  38.805  1.00 66.85 ? 379  TYR B C   1 
ATOM   7044  O  O   . TYR B 1 376 ? 49.879  22.991  39.192  1.00 66.94 ? 379  TYR B O   1 
ATOM   7045  C  CB  . TYR B 1 376 ? 47.395  22.718  37.544  1.00 67.57 ? 379  TYR B CB  1 
ATOM   7046  C  CG  . TYR B 1 376 ? 48.027  22.965  36.187  1.00 68.47 ? 379  TYR B CG  1 
ATOM   7047  C  CD1 . TYR B 1 376 ? 47.435  23.823  35.260  1.00 68.91 ? 379  TYR B CD1 1 
ATOM   7048  C  CD2 . TYR B 1 376 ? 49.177  22.274  35.796  1.00 68.84 ? 379  TYR B CD2 1 
ATOM   7049  C  CE1 . TYR B 1 376 ? 47.971  23.981  33.968  1.00 69.32 ? 379  TYR B CE1 1 
ATOM   7050  C  CE2 . TYR B 1 376 ? 49.720  22.426  34.511  1.00 69.20 ? 379  TYR B CE2 1 
ATOM   7051  C  CZ  . TYR B 1 376 ? 49.113  23.278  33.604  1.00 69.29 ? 379  TYR B CZ  1 
ATOM   7052  O  OH  . TYR B 1 376 ? 49.642  23.415  32.336  1.00 69.33 ? 379  TYR B OH  1 
ATOM   7053  N  N   . ARG B 1 377 ? 49.702  25.123  38.540  1.00 66.70 ? 380  ARG B N   1 
ATOM   7054  C  CA  . ARG B 1 377 ? 51.136  25.335  38.671  1.00 66.49 ? 380  ARG B CA  1 
ATOM   7055  C  C   . ARG B 1 377 ? 51.493  25.996  39.980  1.00 66.24 ? 380  ARG B C   1 
ATOM   7056  O  O   . ARG B 1 377 ? 52.615  26.454  40.178  1.00 66.20 ? 380  ARG B O   1 
ATOM   7057  C  CB  . ARG B 1 377 ? 51.653  26.136  37.487  1.00 66.75 ? 380  ARG B CB  1 
ATOM   7058  C  CG  . ARG B 1 377 ? 51.387  25.436  36.171  1.00 66.90 ? 380  ARG B CG  1 
ATOM   7059  C  CD  . ARG B 1 377 ? 52.657  25.271  35.398  1.00 67.34 ? 380  ARG B CD  1 
ATOM   7060  N  NE  . ARG B 1 377 ? 53.299  26.565  35.227  1.00 68.45 ? 380  ARG B NE  1 
ATOM   7061  C  CZ  . ARG B 1 377 ? 54.586  26.727  34.954  1.00 68.83 ? 380  ARG B CZ  1 
ATOM   7062  N  NH1 . ARG B 1 377 ? 55.370  25.664  34.818  1.00 68.87 ? 380  ARG B NH1 1 
ATOM   7063  N  NH2 . ARG B 1 377 ? 55.089  27.950  34.839  1.00 69.08 ? 380  ARG B NH2 1 
ATOM   7064  N  N   . ALA B 1 378 ? 50.534  25.997  40.890  1.00 66.14 ? 381  ALA B N   1 
ATOM   7065  C  CA  . ALA B 1 378 ? 50.716  26.588  42.199  1.00 66.16 ? 381  ALA B CA  1 
ATOM   7066  C  C   . ALA B 1 378 ? 49.919  25.764  43.191  1.00 66.21 ? 381  ALA B C   1 
ATOM   7067  O  O   . ALA B 1 378 ? 48.959  25.093  42.818  1.00 66.42 ? 381  ALA B O   1 
ATOM   7068  C  CB  . ALA B 1 378 ? 50.217  28.024  42.194  1.00 65.97 ? 381  ALA B CB  1 
ATOM   7069  N  N   . ARG B 1 379 ? 50.347  25.763  44.445  1.00 66.20 ? 382  ARG B N   1 
ATOM   7070  C  CA  . ARG B 1 379 ? 49.618  25.029  45.457  1.00 66.04 ? 382  ARG B CA  1 
ATOM   7071  C  C   . ARG B 1 379 ? 48.679  26.021  46.120  1.00 65.07 ? 382  ARG B C   1 
ATOM   7072  O  O   . ARG B 1 379 ? 49.119  27.062  46.613  1.00 65.11 ? 382  ARG B O   1 
ATOM   7073  C  CB  . ARG B 1 379 ? 50.563  24.411  46.484  1.00 67.39 ? 382  ARG B CB  1 
ATOM   7074  C  CG  . ARG B 1 379 ? 49.841  23.465  47.437  1.00 69.76 ? 382  ARG B CG  1 
ATOM   7075  C  CD  . ARG B 1 379 ? 50.792  22.632  48.252  1.00 71.39 ? 382  ARG B CD  1 
ATOM   7076  N  NE  . ARG B 1 379 ? 51.720  23.488  48.976  1.00 73.35 ? 382  ARG B NE  1 
ATOM   7077  C  CZ  . ARG B 1 379 ? 53.033  23.292  49.011  1.00 74.55 ? 382  ARG B CZ  1 
ATOM   7078  N  NH1 . ARG B 1 379 ? 53.570  22.259  48.364  1.00 74.94 ? 382  ARG B NH1 1 
ATOM   7079  N  NH2 . ARG B 1 379 ? 53.814  24.146  49.669  1.00 75.09 ? 382  ARG B NH2 1 
ATOM   7080  N  N   . VAL B 1 380 ? 47.381  25.738  46.050  1.00 63.90 ? 383  VAL B N   1 
ATOM   7081  C  CA  . VAL B 1 380 ? 46.375  26.610  46.646  1.00 62.77 ? 383  VAL B CA  1 
ATOM   7082  C  C   . VAL B 1 380 ? 46.172  26.223  48.107  1.00 62.35 ? 383  VAL B C   1 
ATOM   7083  O  O   . VAL B 1 380 ? 45.679  25.137  48.406  1.00 62.46 ? 383  VAL B O   1 
ATOM   7084  C  CB  . VAL B 1 380 ? 45.021  26.494  45.914  1.00 62.57 ? 383  VAL B CB  1 
ATOM   7085  C  CG1 . VAL B 1 380 ? 44.069  27.570  46.402  1.00 62.19 ? 383  VAL B CG1 1 
ATOM   7086  C  CG2 . VAL B 1 380 ? 45.215  26.591  44.416  1.00 62.16 ? 383  VAL B CG2 1 
ATOM   7087  N  N   . ALA B 1 381 ? 46.521  27.123  49.017  1.00 61.87 ? 384  ALA B N   1 
ATOM   7088  C  CA  . ALA B 1 381 ? 46.377  26.847  50.441  1.00 61.14 ? 384  ALA B CA  1 
ATOM   7089  C  C   . ALA B 1 381 ? 45.873  28.076  51.165  1.00 60.86 ? 384  ALA B C   1 
ATOM   7090  O  O   . ALA B 1 381 ? 46.499  29.140  51.127  1.00 61.00 ? 384  ALA B O   1 
ATOM   7091  C  CB  . ALA B 1 381 ? 47.702  26.403  51.024  1.00 61.38 ? 384  ALA B CB  1 
ATOM   7092  N  N   . ASN B 1 382 ? 44.753  27.910  51.854  1.00 60.37 ? 385  ASN B N   1 
ATOM   7093  C  CA  . ASN B 1 382 ? 44.142  29.007  52.575  1.00 59.70 ? 385  ASN B CA  1 
ATOM   7094  C  C   . ASN B 1 382 ? 43.142  28.496  53.596  1.00 59.71 ? 385  ASN B C   1 
ATOM   7095  O  O   . ASN B 1 382 ? 43.170  27.321  53.971  1.00 59.80 ? 385  ASN B O   1 
ATOM   7096  C  CB  . ASN B 1 382 ? 43.448  29.926  51.583  1.00 59.04 ? 385  ASN B CB  1 
ATOM   7097  C  CG  . ASN B 1 382 ? 42.611  29.165  50.595  1.00 58.55 ? 385  ASN B CG  1 
ATOM   7098  O  OD1 . ASN B 1 382 ? 41.781  28.339  50.974  1.00 58.66 ? 385  ASN B OD1 1 
ATOM   7099  N  ND2 . ASN B 1 382 ? 42.832  29.423  49.314  1.00 58.22 ? 385  ASN B ND2 1 
ATOM   7100  N  N   . TYR B 1 383 ? 42.236  29.374  54.014  1.00 59.69 ? 386  TYR B N   1 
ATOM   7101  C  CA  . TYR B 1 383 ? 41.229  29.027  55.008  1.00 59.60 ? 386  TYR B CA  1 
ATOM   7102  C  C   . TYR B 1 383 ? 39.814  28.982  54.443  1.00 59.40 ? 386  TYR B C   1 
ATOM   7103  O  O   . TYR B 1 383 ? 38.827  29.189  55.159  1.00 59.29 ? 386  TYR B O   1 
ATOM   7104  C  CB  . TYR B 1 383 ? 41.332  30.003  56.176  1.00 59.79 ? 386  TYR B CB  1 
ATOM   7105  C  CG  . TYR B 1 383 ? 42.713  29.993  56.764  1.00 59.90 ? 386  TYR B CG  1 
ATOM   7106  C  CD1 . TYR B 1 383 ? 43.707  30.835  56.268  1.00 60.07 ? 386  TYR B CD1 1 
ATOM   7107  C  CD2 . TYR B 1 383 ? 43.050  29.089  57.760  1.00 60.04 ? 386  TYR B CD2 1 
ATOM   7108  C  CE1 . TYR B 1 383 ? 45.010  30.767  56.748  1.00 60.42 ? 386  TYR B CE1 1 
ATOM   7109  C  CE2 . TYR B 1 383 ? 44.343  29.011  58.250  1.00 60.50 ? 386  TYR B CE2 1 
ATOM   7110  C  CZ  . TYR B 1 383 ? 45.322  29.851  57.742  1.00 60.66 ? 386  TYR B CZ  1 
ATOM   7111  O  OH  . TYR B 1 383 ? 46.608  29.763  58.233  1.00 60.84 ? 386  TYR B OH  1 
ATOM   7112  N  N   . GLN B 1 384 ? 39.724  28.710  53.147  1.00 59.24 ? 387  GLN B N   1 
ATOM   7113  C  CA  . GLN B 1 384 ? 38.442  28.625  52.469  1.00 59.09 ? 387  GLN B CA  1 
ATOM   7114  C  C   . GLN B 1 384 ? 38.061  27.160  52.519  1.00 59.10 ? 387  GLN B C   1 
ATOM   7115  O  O   . GLN B 1 384 ? 38.916  26.304  52.311  1.00 59.39 ? 387  GLN B O   1 
ATOM   7116  C  CB  . GLN B 1 384 ? 38.586  29.107  51.021  1.00 59.08 ? 387  GLN B CB  1 
ATOM   7117  C  CG  . GLN B 1 384 ? 39.088  30.558  50.910  1.00 58.70 ? 387  GLN B CG  1 
ATOM   7118  C  CD  . GLN B 1 384 ? 39.054  31.118  49.493  1.00 58.30 ? 387  GLN B CD  1 
ATOM   7119  O  OE1 . GLN B 1 384 ? 38.252  30.692  48.659  1.00 58.79 ? 387  GLN B OE1 1 
ATOM   7120  N  NE2 . GLN B 1 384 ? 39.912  32.100  49.225  1.00 57.56 ? 387  GLN B NE2 1 
ATOM   7121  N  N   . ARG B 1 385 ? 36.799  26.862  52.820  1.00 58.99 ? 388  ARG B N   1 
ATOM   7122  C  CA  . ARG B 1 385 ? 36.359  25.473  52.909  1.00 58.89 ? 388  ARG B CA  1 
ATOM   7123  C  C   . ARG B 1 385 ? 34.940  25.235  52.432  1.00 59.31 ? 388  ARG B C   1 
ATOM   7124  O  O   . ARG B 1 385 ? 34.122  26.152  52.348  1.00 59.16 ? 388  ARG B O   1 
ATOM   7125  C  CB  . ARG B 1 385 ? 36.426  24.988  54.355  1.00 58.50 ? 388  ARG B CB  1 
ATOM   7126  C  CG  . ARG B 1 385 ? 37.788  25.061  55.005  1.00 58.33 ? 388  ARG B CG  1 
ATOM   7127  C  CD  . ARG B 1 385 ? 38.747  24.031  54.446  1.00 58.14 ? 388  ARG B CD  1 
ATOM   7128  N  NE  . ARG B 1 385 ? 39.944  23.940  55.275  1.00 58.10 ? 388  ARG B NE  1 
ATOM   7129  C  CZ  . ARG B 1 385 ? 41.024  24.704  55.131  1.00 58.06 ? 388  ARG B CZ  1 
ATOM   7130  N  NH1 . ARG B 1 385 ? 41.078  25.623  54.173  1.00 58.08 ? 388  ARG B NH1 1 
ATOM   7131  N  NH2 . ARG B 1 385 ? 42.036  24.578  55.978  1.00 58.09 ? 388  ARG B NH2 1 
ATOM   7132  N  N   . ASP B 1 386 ? 34.658  23.970  52.148  1.00 59.67 ? 389  ASP B N   1 
ATOM   7133  C  CA  . ASP B 1 386 ? 33.334  23.540  51.742  1.00 60.15 ? 389  ASP B CA  1 
ATOM   7134  C  C   . ASP B 1 386 ? 32.808  24.137  50.453  1.00 60.55 ? 389  ASP B C   1 
ATOM   7135  O  O   . ASP B 1 386 ? 33.566  24.461  49.540  1.00 60.64 ? 389  ASP B O   1 
ATOM   7136  C  CB  . ASP B 1 386 ? 32.336  23.808  52.876  1.00 60.21 ? 389  ASP B CB  1 
ATOM   7137  C  CG  . ASP B 1 386 ? 32.811  23.279  54.222  1.00 60.24 ? 389  ASP B CG  1 
ATOM   7138  O  OD1 . ASP B 1 386 ? 33.855  22.586  54.271  1.00 60.51 ? 389  ASP B OD1 1 
ATOM   7139  O  OD2 . ASP B 1 386 ? 32.132  23.557  55.236  1.00 59.80 ? 389  ASP B OD2 1 
ATOM   7140  N  N   . GLY B 1 387 ? 31.490  24.285  50.400  1.00 61.14 ? 390  GLY B N   1 
ATOM   7141  C  CA  . GLY B 1 387 ? 30.848  24.805  49.214  1.00 62.03 ? 390  GLY B CA  1 
ATOM   7142  C  C   . GLY B 1 387 ? 30.383  23.655  48.338  1.00 62.79 ? 390  GLY B C   1 
ATOM   7143  O  O   . GLY B 1 387 ? 30.971  22.573  48.355  1.00 62.89 ? 390  GLY B O   1 
ATOM   7144  N  N   . PRO B 1 388 ? 29.312  23.859  47.562  1.00 63.54 ? 391  PRO B N   1 
ATOM   7145  C  CA  . PRO B 1 388 ? 28.744  22.851  46.663  1.00 64.20 ? 391  PRO B CA  1 
ATOM   7146  C  C   . PRO B 1 388 ? 29.806  22.267  45.766  1.00 64.92 ? 391  PRO B C   1 
ATOM   7147  O  O   . PRO B 1 388 ? 30.741  22.965  45.377  1.00 65.05 ? 391  PRO B O   1 
ATOM   7148  C  CB  . PRO B 1 388 ? 27.761  23.659  45.827  1.00 64.08 ? 391  PRO B CB  1 
ATOM   7149  C  CG  . PRO B 1 388 ? 27.299  24.719  46.775  1.00 63.95 ? 391  PRO B CG  1 
ATOM   7150  C  CD  . PRO B 1 388 ? 28.577  25.132  47.460  1.00 63.72 ? 391  PRO B CD  1 
ATOM   7151  N  N   . MET B 1 389 ? 29.673  20.984  45.461  1.00 65.88 ? 392  MET B N   1 
ATOM   7152  C  CA  . MET B 1 389 ? 30.609  20.315  44.577  1.00 67.00 ? 392  MET B CA  1 
ATOM   7153  C  C   . MET B 1 389 ? 32.076  20.563  44.932  1.00 68.15 ? 392  MET B C   1 
ATOM   7154  O  O   . MET B 1 389 ? 32.877  20.941  44.074  1.00 68.14 ? 392  MET B O   1 
ATOM   7155  C  CB  . MET B 1 389 ? 30.344  20.764  43.141  1.00 66.62 ? 392  MET B CB  1 
ATOM   7156  C  CG  . MET B 1 389 ? 29.005  20.339  42.588  1.00 66.19 ? 392  MET B CG  1 
ATOM   7157  S  SD  . MET B 1 389 ? 29.021  18.618  42.084  1.00 66.00 ? 392  MET B SD  1 
ATOM   7158  C  CE  . MET B 1 389 ? 27.984  17.955  43.309  1.00 66.45 ? 392  MET B CE  1 
ATOM   7159  N  N   . CYS B 1 390 ? 32.424  20.374  46.197  1.00 69.82 ? 393  CYS B N   1 
ATOM   7160  C  CA  . CYS B 1 390 ? 33.797  20.571  46.641  1.00 71.58 ? 393  CYS B CA  1 
ATOM   7161  C  C   . CYS B 1 390 ? 34.619  19.371  46.196  1.00 73.16 ? 393  CYS B C   1 
ATOM   7162  O  O   . CYS B 1 390 ? 34.812  18.441  46.972  1.00 73.60 ? 393  CYS B O   1 
ATOM   7163  C  CB  . CYS B 1 390 ? 33.833  20.689  48.162  1.00 71.28 ? 393  CYS B CB  1 
ATOM   7164  S  SG  . CYS B 1 390 ? 35.476  20.852  48.836  1.00 71.30 ? 393  CYS B SG  1 
ATOM   7165  N  N   . MET B 1 391 ? 35.094  19.391  44.948  1.00 74.85 ? 394  MET B N   1 
ATOM   7166  C  CA  . MET B 1 391 ? 35.877  18.277  44.388  1.00 76.31 ? 394  MET B CA  1 
ATOM   7167  C  C   . MET B 1 391 ? 37.362  18.297  44.679  1.00 76.56 ? 394  MET B C   1 
ATOM   7168  O  O   . MET B 1 391 ? 38.174  18.572  43.800  1.00 77.20 ? 394  MET B O   1 
ATOM   7169  C  CB  . MET B 1 391 ? 35.681  18.148  42.872  1.00 77.37 ? 394  MET B CB  1 
ATOM   7170  C  CG  . MET B 1 391 ? 34.494  17.306  42.470  1.00 79.33 ? 394  MET B CG  1 
ATOM   7171  S  SD  . MET B 1 391 ? 32.958  18.210  42.704  1.00 81.42 ? 394  MET B SD  1 
ATOM   7172  C  CE  . MET B 1 391 ? 31.848  17.396  41.497  1.00 80.80 ? 394  MET B CE  1 
ATOM   7173  N  N   . GLN B 1 392 ? 37.726  17.926  45.891  1.00 76.25 ? 395  GLN B N   1 
ATOM   7174  C  CA  . GLN B 1 392 ? 39.122  17.907  46.264  1.00 75.80 ? 395  GLN B CA  1 
ATOM   7175  C  C   . GLN B 1 392 ? 39.138  17.307  47.647  1.00 74.80 ? 395  GLN B C   1 
ATOM   7176  O  O   . GLN B 1 392 ? 38.213  16.597  48.022  1.00 75.04 ? 395  GLN B O   1 
ATOM   7177  C  CB  . GLN B 1 392 ? 39.655  19.343  46.286  1.00 76.95 ? 395  GLN B CB  1 
ATOM   7178  C  CG  . GLN B 1 392 ? 41.171  19.464  46.240  1.00 78.51 ? 395  GLN B CG  1 
ATOM   7179  C  CD  . GLN B 1 392 ? 41.799  18.582  45.172  1.00 79.10 ? 395  GLN B CD  1 
ATOM   7180  O  OE1 . GLN B 1 392 ? 42.295  17.496  45.468  1.00 79.24 ? 395  GLN B OE1 1 
ATOM   7181  N  NE2 . GLN B 1 392 ? 41.778  19.045  43.928  1.00 79.20 ? 395  GLN B NE2 1 
ATOM   7182  N  N   . ASP B 1 393 ? 40.203  17.550  48.392  1.00 73.56 ? 396  ASP B N   1 
ATOM   7183  C  CA  . ASP B 1 393 ? 40.284  17.050  49.754  1.00 72.05 ? 396  ASP B CA  1 
ATOM   7184  C  C   . ASP B 1 393 ? 39.830  18.157  50.714  1.00 70.47 ? 396  ASP B C   1 
ATOM   7185  O  O   . ASP B 1 393 ? 39.891  17.999  51.934  1.00 70.08 ? 396  ASP B O   1 
ATOM   7186  C  CB  . ASP B 1 393 ? 41.710  16.581  50.072  1.00 72.97 ? 396  ASP B CB  1 
ATOM   7187  C  CG  . ASP B 1 393 ? 42.754  17.690  49.931  1.00 73.83 ? 396  ASP B CG  1 
ATOM   7188  O  OD1 . ASP B 1 393 ? 42.515  18.688  49.211  1.00 74.55 ? 396  ASP B OD1 1 
ATOM   7189  O  OD2 . ASP B 1 393 ? 43.831  17.551  50.552  1.00 74.20 ? 396  ASP B OD2 1 
ATOM   7190  N  N   . ASN B 1 394 ? 39.392  19.283  50.143  1.00 68.68 ? 397  ASN B N   1 
ATOM   7191  C  CA  . ASN B 1 394 ? 38.917  20.430  50.912  1.00 66.99 ? 397  ASN B CA  1 
ATOM   7192  C  C   . ASN B 1 394 ? 39.999  20.814  51.916  1.00 66.14 ? 397  ASN B C   1 
ATOM   7193  O  O   . ASN B 1 394 ? 39.720  21.341  52.994  1.00 65.98 ? 397  ASN B O   1 
ATOM   7194  C  CB  . ASN B 1 394 ? 37.597  20.083  51.626  1.00 66.55 ? 397  ASN B CB  1 
ATOM   7195  C  CG  . ASN B 1 394 ? 36.750  21.312  51.956  1.00 65.81 ? 397  ASN B CG  1 
ATOM   7196  O  OD1 . ASN B 1 394 ? 35.847  21.242  52.785  1.00 65.91 ? 397  ASN B OD1 1 
ATOM   7197  N  ND2 . ASN B 1 394 ? 37.023  22.429  51.294  1.00 65.85 ? 397  ASN B ND2 1 
ATOM   7198  N  N   . GLN B 1 395 ? 41.241  20.525  51.541  1.00 65.19 ? 398  GLN B N   1 
ATOM   7199  C  CA  . GLN B 1 395 ? 42.409  20.807  52.363  1.00 64.24 ? 398  GLN B CA  1 
ATOM   7200  C  C   . GLN B 1 395 ? 42.482  19.982  53.654  1.00 63.88 ? 398  GLN B C   1 
ATOM   7201  O  O   . GLN B 1 395 ? 43.130  20.371  54.628  1.00 63.86 ? 398  GLN B O   1 
ATOM   7202  C  CB  . GLN B 1 395 ? 42.523  22.308  52.627  1.00 63.95 ? 398  GLN B CB  1 
ATOM   7203  C  CG  . GLN B 1 395 ? 42.827  23.099  51.364  1.00 63.09 ? 398  GLN B CG  1 
ATOM   7204  C  CD  . GLN B 1 395 ? 42.899  24.589  51.609  1.00 62.79 ? 398  GLN B CD  1 
ATOM   7205  O  OE1 . GLN B 1 395 ? 43.753  25.067  52.354  1.00 62.90 ? 398  GLN B OE1 1 
ATOM   7206  N  NE2 . GLN B 1 395 ? 41.999  25.335  50.980  1.00 62.77 ? 398  GLN B NE2 1 
ATOM   7207  N  N   . GLY B 1 396 ? 41.815  18.831  53.635  1.00 63.43 ? 399  GLY B N   1 
ATOM   7208  C  CA  . GLY B 1 396 ? 41.824  17.911  54.759  1.00 62.95 ? 399  GLY B CA  1 
ATOM   7209  C  C   . GLY B 1 396 ? 41.512  18.389  56.165  1.00 62.87 ? 399  GLY B C   1 
ATOM   7210  O  O   . GLY B 1 396 ? 40.506  19.056  56.406  1.00 63.03 ? 399  GLY B O   1 
ATOM   7211  N  N   . GLY B 1 397 ? 42.358  17.978  57.107  1.00 62.59 ? 400  GLY B N   1 
ATOM   7212  C  CA  . GLY B 1 397 ? 42.178  18.341  58.499  1.00 62.31 ? 400  GLY B CA  1 
ATOM   7213  C  C   . GLY B 1 397 ? 42.970  19.553  58.945  1.00 62.31 ? 400  GLY B C   1 
ATOM   7214  O  O   . GLY B 1 397 ? 43.140  19.775  60.145  1.00 62.66 ? 400  GLY B O   1 
ATOM   7215  N  N   . ALA B 1 398 ? 43.450  20.344  57.992  1.00 61.97 ? 401  ALA B N   1 
ATOM   7216  C  CA  . ALA B 1 398 ? 44.225  21.538  58.304  1.00 61.61 ? 401  ALA B CA  1 
ATOM   7217  C  C   . ALA B 1 398 ? 43.387  22.569  59.053  1.00 61.52 ? 401  ALA B C   1 
ATOM   7218  O  O   . ALA B 1 398 ? 42.188  22.683  58.825  1.00 61.76 ? 401  ALA B O   1 
ATOM   7219  C  CB  . ALA B 1 398 ? 44.753  22.144  57.020  1.00 61.62 ? 401  ALA B CB  1 
ATOM   7220  N  N   . PRO B 1 399 ? 44.004  23.309  59.986  1.00 61.38 ? 402  PRO B N   1 
ATOM   7221  C  CA  . PRO B 1 399 ? 43.337  24.346  60.783  1.00 61.19 ? 402  PRO B CA  1 
ATOM   7222  C  C   . PRO B 1 399 ? 42.655  25.322  59.839  1.00 61.10 ? 402  PRO B C   1 
ATOM   7223  O  O   . PRO B 1 399 ? 43.278  25.811  58.901  1.00 61.04 ? 402  PRO B O   1 
ATOM   7224  C  CB  . PRO B 1 399 ? 44.507  25.013  61.496  1.00 61.14 ? 402  PRO B CB  1 
ATOM   7225  C  CG  . PRO B 1 399 ? 45.423  23.862  61.734  1.00 60.96 ? 402  PRO B CG  1 
ATOM   7226  C  CD  . PRO B 1 399 ? 45.404  23.148  60.410  1.00 61.32 ? 402  PRO B CD  1 
ATOM   7227  N  N   . ASN B 1 400 ? 41.388  25.621  60.096  1.00 60.94 ? 403  ASN B N   1 
ATOM   7228  C  CA  . ASN B 1 400 ? 40.633  26.507  59.221  1.00 60.56 ? 403  ASN B CA  1 
ATOM   7229  C  C   . ASN B 1 400 ? 40.492  27.969  59.636  1.00 60.59 ? 403  ASN B C   1 
ATOM   7230  O  O   . ASN B 1 400 ? 39.626  28.672  59.114  1.00 60.85 ? 403  ASN B O   1 
ATOM   7231  C  CB  . ASN B 1 400 ? 39.245  25.918  58.949  1.00 60.22 ? 403  ASN B CB  1 
ATOM   7232  C  CG  . ASN B 1 400 ? 38.364  25.875  60.187  1.00 60.07 ? 403  ASN B CG  1 
ATOM   7233  O  OD1 . ASN B 1 400 ? 37.190  25.534  60.099  1.00 60.31 ? 403  ASN B OD1 1 
ATOM   7234  N  ND2 . ASN B 1 400 ? 38.920  26.226  61.340  1.00 59.96 ? 403  ASN B ND2 1 
ATOM   7235  N  N   . TYR B 1 401 ? 41.320  28.442  60.560  1.00 60.33 ? 404  TYR B N   1 
ATOM   7236  C  CA  . TYR B 1 401 ? 41.221  29.838  60.971  1.00 60.01 ? 404  TYR B CA  1 
ATOM   7237  C  C   . TYR B 1 401 ? 42.588  30.489  61.000  1.00 60.03 ? 404  TYR B C   1 
ATOM   7238  O  O   . TYR B 1 401 ? 43.591  29.838  61.283  1.00 60.01 ? 404  TYR B O   1 
ATOM   7239  C  CB  . TYR B 1 401 ? 40.543  29.961  62.335  1.00 59.90 ? 404  TYR B CB  1 
ATOM   7240  C  CG  . TYR B 1 401 ? 41.285  29.253  63.430  1.00 59.98 ? 404  TYR B CG  1 
ATOM   7241  C  CD1 . TYR B 1 401 ? 42.113  29.951  64.302  1.00 60.05 ? 404  TYR B CD1 1 
ATOM   7242  C  CD2 . TYR B 1 401 ? 41.200  27.871  63.568  1.00 60.10 ? 404  TYR B CD2 1 
ATOM   7243  C  CE1 . TYR B 1 401 ? 42.847  29.283  65.286  1.00 60.02 ? 404  TYR B CE1 1 
ATOM   7244  C  CE2 . TYR B 1 401 ? 41.929  27.193  64.547  1.00 60.03 ? 404  TYR B CE2 1 
ATOM   7245  C  CZ  . TYR B 1 401 ? 42.749  27.902  65.399  1.00 60.00 ? 404  TYR B CZ  1 
ATOM   7246  O  OH  . TYR B 1 401 ? 43.480  27.227  66.352  1.00 60.20 ? 404  TYR B OH  1 
ATOM   7247  N  N   . TYR B 1 402 ? 42.617  31.780  60.703  1.00 59.99 ? 405  TYR B N   1 
ATOM   7248  C  CA  . TYR B 1 402 ? 43.858  32.542  60.676  1.00 59.89 ? 405  TYR B CA  1 
ATOM   7249  C  C   . TYR B 1 402 ? 43.656  33.775  61.542  1.00 59.96 ? 405  TYR B C   1 
ATOM   7250  O  O   . TYR B 1 402 ? 42.684  34.506  61.375  1.00 59.94 ? 405  TYR B O   1 
ATOM   7251  C  CB  . TYR B 1 402 ? 44.159  32.946  59.235  1.00 60.03 ? 405  TYR B CB  1 
ATOM   7252  C  CG  . TYR B 1 402 ? 45.559  33.441  58.979  1.00 60.10 ? 405  TYR B CG  1 
ATOM   7253  C  CD1 . TYR B 1 402 ? 46.660  32.655  59.277  1.00 60.24 ? 405  TYR B CD1 1 
ATOM   7254  C  CD2 . TYR B 1 402 ? 45.777  34.683  58.399  1.00 60.31 ? 405  TYR B CD2 1 
ATOM   7255  C  CE1 . TYR B 1 402 ? 47.950  33.093  59.001  1.00 60.55 ? 405  TYR B CE1 1 
ATOM   7256  C  CE2 . TYR B 1 402 ? 47.057  35.133  58.120  1.00 60.58 ? 405  TYR B CE2 1 
ATOM   7257  C  CZ  . TYR B 1 402 ? 48.137  34.334  58.422  1.00 60.75 ? 405  TYR B CZ  1 
ATOM   7258  O  OH  . TYR B 1 402 ? 49.401  34.792  58.142  1.00 61.05 ? 405  TYR B OH  1 
ATOM   7259  N  N   . PRO B 1 403 ? 44.586  34.042  62.467  1.00 60.00 ? 406  PRO B N   1 
ATOM   7260  C  CA  . PRO B 1 403 ? 45.800  33.278  62.749  1.00 60.22 ? 406  PRO B CA  1 
ATOM   7261  C  C   . PRO B 1 403 ? 45.492  31.993  63.486  1.00 60.60 ? 406  PRO B C   1 
ATOM   7262  O  O   . PRO B 1 403 ? 44.365  31.772  63.928  1.00 60.74 ? 406  PRO B O   1 
ATOM   7263  C  CB  . PRO B 1 403 ? 46.588  34.215  63.666  1.00 60.11 ? 406  PRO B CB  1 
ATOM   7264  C  CG  . PRO B 1 403 ? 45.814  35.523  63.661  1.00 60.08 ? 406  PRO B CG  1 
ATOM   7265  C  CD  . PRO B 1 403 ? 44.413  35.096  63.467  1.00 60.01 ? 406  PRO B CD  1 
ATOM   7266  N  N   . ASN B 1 404 ? 46.521  31.167  63.641  1.00 60.91 ? 407  ASN B N   1 
ATOM   7267  C  CA  . ASN B 1 404 ? 46.416  29.895  64.342  1.00 61.25 ? 407  ASN B CA  1 
ATOM   7268  C  C   . ASN B 1 404 ? 47.820  29.478  64.750  1.00 61.38 ? 407  ASN B C   1 
ATOM   7269  O  O   . ASN B 1 404 ? 48.791  29.886  64.122  1.00 61.82 ? 407  ASN B O   1 
ATOM   7270  C  CB  . ASN B 1 404 ? 45.802  28.834  63.438  1.00 61.10 ? 407  ASN B CB  1 
ATOM   7271  C  CG  . ASN B 1 404 ? 46.679  28.501  62.266  1.00 61.12 ? 407  ASN B CG  1 
ATOM   7272  O  OD1 . ASN B 1 404 ? 47.633  27.725  62.387  1.00 61.23 ? 407  ASN B OD1 1 
ATOM   7273  N  ND2 . ASN B 1 404 ? 46.372  29.092  61.117  1.00 61.00 ? 407  ASN B ND2 1 
ATOM   7274  N  N   . SER B 1 405 ? 47.927  28.631  65.766  1.00 61.42 ? 408  SER B N   1 
ATOM   7275  C  CA  . SER B 1 405 ? 49.230  28.182  66.257  1.00 61.41 ? 408  SER B CA  1 
ATOM   7276  C  C   . SER B 1 405 ? 49.510  26.734  65.911  1.00 61.21 ? 408  SER B C   1 
ATOM   7277  O  O   . SER B 1 405 ? 50.295  26.067  66.595  1.00 60.98 ? 408  SER B O   1 
ATOM   7278  C  CB  . SER B 1 405 ? 49.276  28.329  67.774  1.00 61.86 ? 408  SER B CB  1 
ATOM   7279  O  OG  . SER B 1 405 ? 48.704  29.562  68.171  1.00 62.98 ? 408  SER B OG  1 
ATOM   7280  N  N   . PHE B 1 406 ? 48.882  26.247  64.848  1.00 61.11 ? 409  PHE B N   1 
ATOM   7281  C  CA  . PHE B 1 406 ? 49.065  24.860  64.474  1.00 61.04 ? 409  PHE B CA  1 
ATOM   7282  C  C   . PHE B 1 406 ? 49.642  24.594  63.091  1.00 60.76 ? 409  PHE B C   1 
ATOM   7283  O  O   . PHE B 1 406 ? 49.382  23.555  62.496  1.00 60.66 ? 409  PHE B O   1 
ATOM   7284  C  CB  . PHE B 1 406 ? 47.766  24.087  64.707  1.00 61.49 ? 409  PHE B CB  1 
ATOM   7285  C  CG  . PHE B 1 406 ? 47.260  24.169  66.134  1.00 61.92 ? 409  PHE B CG  1 
ATOM   7286  C  CD1 . PHE B 1 406 ? 46.596  25.311  66.591  1.00 61.99 ? 409  PHE B CD1 1 
ATOM   7287  C  CD2 . PHE B 1 406 ? 47.460  23.114  67.022  1.00 62.03 ? 409  PHE B CD2 1 
ATOM   7288  C  CE1 . PHE B 1 406 ? 46.142  25.402  67.911  1.00 61.97 ? 409  PHE B CE1 1 
ATOM   7289  C  CE2 . PHE B 1 406 ? 47.010  23.195  68.344  1.00 61.95 ? 409  PHE B CE2 1 
ATOM   7290  C  CZ  . PHE B 1 406 ? 46.349  24.342  68.789  1.00 61.90 ? 409  PHE B CZ  1 
ATOM   7291  N  N   . GLY B 1 407 ? 50.428  25.537  62.588  1.00 60.50 ? 410  GLY B N   1 
ATOM   7292  C  CA  . GLY B 1 407 ? 51.089  25.357  61.308  1.00 60.44 ? 410  GLY B CA  1 
ATOM   7293  C  C   . GLY B 1 407 ? 50.374  25.590  59.995  1.00 60.47 ? 410  GLY B C   1 
ATOM   7294  O  O   . GLY B 1 407 ? 50.939  25.280  58.952  1.00 60.54 ? 410  GLY B O   1 
ATOM   7295  N  N   . ALA B 1 408 ? 49.172  26.157  60.019  1.00 60.74 ? 411  ALA B N   1 
ATOM   7296  C  CA  . ALA B 1 408 ? 48.425  26.420  58.786  1.00 60.94 ? 411  ALA B CA  1 
ATOM   7297  C  C   . ALA B 1 408 ? 49.149  27.457  57.909  1.00 61.22 ? 411  ALA B C   1 
ATOM   7298  O  O   . ALA B 1 408 ? 50.093  28.099  58.364  1.00 61.29 ? 411  ALA B O   1 
ATOM   7299  C  CB  . ALA B 1 408 ? 47.026  26.878  59.124  1.00 61.05 ? 411  ALA B CB  1 
ATOM   7300  N  N   . PRO B 1 409 ? 48.724  27.624  56.642  1.00 61.53 ? 412  PRO B N   1 
ATOM   7301  C  CA  . PRO B 1 409 ? 49.324  28.571  55.690  1.00 61.91 ? 412  PRO B CA  1 
ATOM   7302  C  C   . PRO B 1 409 ? 49.515  29.985  56.211  1.00 62.63 ? 412  PRO B C   1 
ATOM   7303  O  O   . PRO B 1 409 ? 48.674  30.503  56.937  1.00 62.68 ? 412  PRO B O   1 
ATOM   7304  C  CB  . PRO B 1 409 ? 48.347  28.539  54.527  1.00 61.77 ? 412  PRO B CB  1 
ATOM   7305  C  CG  . PRO B 1 409 ? 47.901  27.127  54.540  1.00 61.45 ? 412  PRO B CG  1 
ATOM   7306  C  CD  . PRO B 1 409 ? 47.628  26.884  55.993  1.00 61.37 ? 412  PRO B CD  1 
ATOM   7307  N  N   . GLU B 1 410 ? 50.605  30.621  55.789  1.00 63.39 ? 413  GLU B N   1 
ATOM   7308  C  CA  . GLU B 1 410 ? 50.932  31.974  56.231  1.00 64.13 ? 413  GLU B CA  1 
ATOM   7309  C  C   . GLU B 1 410 ? 51.020  33.023  55.127  1.00 64.48 ? 413  GLU B C   1 
ATOM   7310  O  O   . GLU B 1 410 ? 51.443  32.735  54.002  1.00 64.73 ? 413  GLU B O   1 
ATOM   7311  C  CB  . GLU B 1 410 ? 52.261  31.959  56.989  1.00 64.48 ? 413  GLU B CB  1 
ATOM   7312  C  CG  . GLU B 1 410 ? 52.213  31.284  58.351  1.00 64.84 ? 413  GLU B CG  1 
ATOM   7313  C  CD  . GLU B 1 410 ? 51.440  32.091  59.378  1.00 65.19 ? 413  GLU B CD  1 
ATOM   7314  O  OE1 . GLU B 1 410 ? 50.783  31.471  60.242  1.00 65.51 ? 413  GLU B OE1 1 
ATOM   7315  O  OE2 . GLU B 1 410 ? 51.490  33.343  59.332  1.00 65.72 ? 413  GLU B OE2 1 
ATOM   7316  N  N   . GLN B 1 411 ? 50.637  34.253  55.470  1.00 64.83 ? 414  GLN B N   1 
ATOM   7317  C  CA  . GLN B 1 411 ? 50.700  35.362  54.533  1.00 65.06 ? 414  GLN B CA  1 
ATOM   7318  C  C   . GLN B 1 411 ? 52.169  35.626  54.256  1.00 65.86 ? 414  GLN B C   1 
ATOM   7319  O  O   . GLN B 1 411 ? 53.027  35.371  55.100  1.00 65.55 ? 414  GLN B O   1 
ATOM   7320  C  CB  . GLN B 1 411 ? 49.995  36.606  55.096  1.00 64.45 ? 414  GLN B CB  1 
ATOM   7321  C  CG  . GLN B 1 411 ? 50.486  37.085  56.454  1.00 63.17 ? 414  GLN B CG  1 
ATOM   7322  C  CD  . GLN B 1 411 ? 49.601  38.165  57.049  1.00 62.03 ? 414  GLN B CD  1 
ATOM   7323  O  OE1 . GLN B 1 411 ? 48.403  38.226  56.789  1.00 61.55 ? 414  GLN B OE1 1 
ATOM   7324  N  NE2 . GLN B 1 411 ? 50.192  39.016  57.866  1.00 61.92 ? 414  GLN B NE2 1 
ATOM   7325  N  N   . GLN B 1 412 ? 52.448  36.086  53.046  1.00 66.98 ? 415  GLN B N   1 
ATOM   7326  C  CA  . GLN B 1 412 ? 53.807  36.355  52.607  1.00 68.11 ? 415  GLN B CA  1 
ATOM   7327  C  C   . GLN B 1 412 ? 53.960  37.834  52.250  1.00 68.24 ? 415  GLN B C   1 
ATOM   7328  O  O   . GLN B 1 412 ? 53.498  38.277  51.198  1.00 68.37 ? 415  GLN B O   1 
ATOM   7329  C  CB  . GLN B 1 412 ? 54.096  35.468  51.400  1.00 69.32 ? 415  GLN B CB  1 
ATOM   7330  C  CG  . GLN B 1 412 ? 55.543  35.370  50.986  1.00 71.40 ? 415  GLN B CG  1 
ATOM   7331  C  CD  . GLN B 1 412 ? 55.723  34.354  49.875  1.00 72.77 ? 415  GLN B CD  1 
ATOM   7332  O  OE1 . GLN B 1 412 ? 55.478  34.645  48.700  1.00 73.49 ? 415  GLN B OE1 1 
ATOM   7333  N  NE2 . GLN B 1 412 ? 56.119  33.139  50.244  1.00 73.63 ? 415  GLN B NE2 1 
ATOM   7334  N  N   . PRO B 1 413 ? 54.665  38.598  53.098  1.00 68.23 ? 416  PRO B N   1 
ATOM   7335  C  CA  . PRO B 1 413 ? 54.923  40.036  52.950  1.00 68.07 ? 416  PRO B CA  1 
ATOM   7336  C  C   . PRO B 1 413 ? 55.320  40.468  51.549  1.00 67.93 ? 416  PRO B C   1 
ATOM   7337  O  O   . PRO B 1 413 ? 54.790  41.442  51.016  1.00 67.95 ? 416  PRO B O   1 
ATOM   7338  C  CB  . PRO B 1 413 ? 56.057  40.271  53.939  1.00 68.18 ? 416  PRO B CB  1 
ATOM   7339  C  CG  . PRO B 1 413 ? 55.745  39.311  55.023  1.00 68.20 ? 416  PRO B CG  1 
ATOM   7340  C  CD  . PRO B 1 413 ? 55.418  38.063  54.244  1.00 68.51 ? 416  PRO B CD  1 
ATOM   7341  N  N   . SER B 1 414 ? 56.243  39.725  50.951  1.00 67.86 ? 417  SER B N   1 
ATOM   7342  C  CA  . SER B 1 414 ? 56.726  40.032  49.615  1.00 67.89 ? 417  SER B CA  1 
ATOM   7343  C  C   . SER B 1 414 ? 55.605  40.208  48.606  1.00 67.65 ? 417  SER B C   1 
ATOM   7344  O  O   . SER B 1 414 ? 55.759  40.928  47.620  1.00 67.74 ? 417  SER B O   1 
ATOM   7345  C  CB  . SER B 1 414 ? 57.640  38.916  49.131  1.00 68.34 ? 417  SER B CB  1 
ATOM   7346  O  OG  . SER B 1 414 ? 56.932  37.690  49.063  1.00 69.24 ? 417  SER B OG  1 
ATOM   7347  N  N   . ALA B 1 415 ? 54.478  39.549  48.856  1.00 67.23 ? 418  ALA B N   1 
ATOM   7348  C  CA  . ALA B 1 415 ? 53.331  39.602  47.952  1.00 66.80 ? 418  ALA B CA  1 
ATOM   7349  C  C   . ALA B 1 415 ? 52.377  40.769  48.183  1.00 66.83 ? 418  ALA B C   1 
ATOM   7350  O  O   . ALA B 1 415 ? 51.322  40.848  47.550  1.00 66.78 ? 418  ALA B O   1 
ATOM   7351  C  CB  . ALA B 1 415 ? 52.569  38.294  48.013  1.00 66.47 ? 418  ALA B CB  1 
ATOM   7352  N  N   . LEU B 1 416 ? 52.759  41.687  49.061  1.00 66.83 ? 419  LEU B N   1 
ATOM   7353  C  CA  . LEU B 1 416 ? 51.914  42.829  49.372  1.00 66.96 ? 419  LEU B CA  1 
ATOM   7354  C  C   . LEU B 1 416 ? 51.739  43.723  48.156  1.00 67.26 ? 419  LEU B C   1 
ATOM   7355  O  O   . LEU B 1 416 ? 52.689  43.942  47.417  1.00 67.60 ? 419  LEU B O   1 
ATOM   7356  C  CB  . LEU B 1 416 ? 52.531  43.612  50.523  1.00 67.12 ? 419  LEU B CB  1 
ATOM   7357  C  CG  . LEU B 1 416 ? 51.589  44.496  51.341  1.00 67.35 ? 419  LEU B CG  1 
ATOM   7358  C  CD1 . LEU B 1 416 ? 50.328  43.724  51.726  1.00 67.05 ? 419  LEU B CD1 1 
ATOM   7359  C  CD2 . LEU B 1 416 ? 52.323  44.996  52.589  1.00 67.52 ? 419  LEU B CD2 1 
ATOM   7360  N  N   . GLU B 1 417 ? 50.528  44.234  47.946  1.00 67.39 ? 420  GLU B N   1 
ATOM   7361  C  CA  . GLU B 1 417 ? 50.249  45.099  46.800  1.00 67.67 ? 420  GLU B CA  1 
ATOM   7362  C  C   . GLU B 1 417 ? 50.903  46.456  46.915  1.00 67.33 ? 420  GLU B C   1 
ATOM   7363  O  O   . GLU B 1 417 ? 51.125  46.963  48.013  1.00 67.46 ? 420  GLU B O   1 
ATOM   7364  C  CB  . GLU B 1 417 ? 48.751  45.347  46.618  1.00 68.65 ? 420  GLU B CB  1 
ATOM   7365  C  CG  . GLU B 1 417 ? 47.891  44.111  46.541  1.00 70.71 ? 420  GLU B CG  1 
ATOM   7366  C  CD  . GLU B 1 417 ? 47.352  43.684  47.897  1.00 72.27 ? 420  GLU B CD  1 
ATOM   7367  O  OE1 . GLU B 1 417 ? 47.877  44.153  48.939  1.00 72.92 ? 420  GLU B OE1 1 
ATOM   7368  O  OE2 . GLU B 1 417 ? 46.393  42.882  47.919  1.00 72.75 ? 420  GLU B OE2 1 
ATOM   7369  N  N   . HIS B 1 418 ? 51.168  47.055  45.758  1.00 66.93 ? 421  HIS B N   1 
ATOM   7370  C  CA  . HIS B 1 418 ? 51.754  48.380  45.688  1.00 66.40 ? 421  HIS B CA  1 
ATOM   7371  C  C   . HIS B 1 418 ? 50.643  49.334  46.086  1.00 66.06 ? 421  HIS B C   1 
ATOM   7372  O  O   . HIS B 1 418 ? 49.470  49.054  45.858  1.00 66.12 ? 421  HIS B O   1 
ATOM   7373  C  CB  . HIS B 1 418 ? 52.199  48.679  44.259  1.00 66.36 ? 421  HIS B CB  1 
ATOM   7374  C  CG  . HIS B 1 418 ? 52.622  50.099  44.042  1.00 66.49 ? 421  HIS B CG  1 
ATOM   7375  N  ND1 . HIS B 1 418 ? 53.916  50.531  44.246  1.00 66.49 ? 421  HIS B ND1 1 
ATOM   7376  C  CD2 . HIS B 1 418 ? 51.921  51.186  43.642  1.00 66.43 ? 421  HIS B CD2 1 
ATOM   7377  C  CE1 . HIS B 1 418 ? 53.993  51.823  43.980  1.00 66.43 ? 421  HIS B CE1 1 
ATOM   7378  N  NE2 . HIS B 1 418 ? 52.796  52.246  43.612  1.00 66.55 ? 421  HIS B NE2 1 
ATOM   7379  N  N   . SER B 1 419 ? 51.004  50.457  46.685  1.00 65.87 ? 422  SER B N   1 
ATOM   7380  C  CA  . SER B 1 419 ? 49.992  51.414  47.100  1.00 65.91 ? 422  SER B CA  1 
ATOM   7381  C  C   . SER B 1 419 ? 50.218  52.820  46.565  1.00 65.25 ? 422  SER B C   1 
ATOM   7382  O  O   . SER B 1 419 ? 51.335  53.336  46.577  1.00 65.17 ? 422  SER B O   1 
ATOM   7383  C  CB  . SER B 1 419 ? 49.863  51.432  48.627  1.00 66.60 ? 422  SER B CB  1 
ATOM   7384  O  OG  . SER B 1 419 ? 51.125  51.578  49.254  1.00 67.83 ? 422  SER B OG  1 
ATOM   7385  N  N   . ILE B 1 420 ? 49.138  53.419  46.077  1.00 64.56 ? 423  ILE B N   1 
ATOM   7386  C  CA  . ILE B 1 420 ? 49.175  54.761  45.530  1.00 63.74 ? 423  ILE B CA  1 
ATOM   7387  C  C   . ILE B 1 420 ? 48.361  55.660  46.445  1.00 63.66 ? 423  ILE B C   1 
ATOM   7388  O  O   . ILE B 1 420 ? 47.394  55.215  47.060  1.00 63.74 ? 423  ILE B O   1 
ATOM   7389  C  CB  . ILE B 1 420 ? 48.551  54.792  44.124  1.00 63.49 ? 423  ILE B CB  1 
ATOM   7390  C  CG1 . ILE B 1 420 ? 49.356  53.911  43.173  1.00 63.19 ? 423  ILE B CG1 1 
ATOM   7391  C  CG2 . ILE B 1 420 ? 48.488  56.213  43.592  1.00 63.15 ? 423  ILE B CG2 1 
ATOM   7392  C  CD1 . ILE B 1 420 ? 48.739  53.796  41.799  1.00 63.35 ? 423  ILE B CD1 1 
ATOM   7393  N  N   . GLN B 1 421 ? 48.785  56.912  46.567  1.00 63.58 ? 424  GLN B N   1 
ATOM   7394  C  CA  . GLN B 1 421 ? 48.082  57.885  47.386  1.00 63.44 ? 424  GLN B CA  1 
ATOM   7395  C  C   . GLN B 1 421 ? 46.932  58.456  46.576  1.00 63.70 ? 424  GLN B C   1 
ATOM   7396  O  O   . GLN B 1 421 ? 47.043  58.642  45.359  1.00 63.26 ? 424  GLN B O   1 
ATOM   7397  C  CB  . GLN B 1 421 ? 49.032  59.012  47.797  1.00 63.17 ? 424  GLN B CB  1 
ATOM   7398  C  CG  . GLN B 1 421 ? 48.361  60.348  48.119  1.00 63.00 ? 424  GLN B CG  1 
ATOM   7399  C  CD  . GLN B 1 421 ? 47.645  60.356  49.448  1.00 63.26 ? 424  GLN B CD  1 
ATOM   7400  O  OE1 . GLN B 1 421 ? 48.039  59.658  50.381  1.00 63.76 ? 424  GLN B OE1 1 
ATOM   7401  N  NE2 . GLN B 1 421 ? 46.598  61.163  49.551  1.00 63.56 ? 424  GLN B NE2 1 
ATOM   7402  N  N   . TYR B 1 422 ? 45.824  58.717  47.261  1.00 64.08 ? 425  TYR B N   1 
ATOM   7403  C  CA  . TYR B 1 422 ? 44.635  59.290  46.642  1.00 64.51 ? 425  TYR B CA  1 
ATOM   7404  C  C   . TYR B 1 422 ? 43.928  60.199  47.642  1.00 64.93 ? 425  TYR B C   1 
ATOM   7405  O  O   . TYR B 1 422 ? 43.828  59.868  48.824  1.00 64.88 ? 425  TYR B O   1 
ATOM   7406  C  CB  . TYR B 1 422 ? 43.657  58.199  46.208  1.00 64.34 ? 425  TYR B CB  1 
ATOM   7407  C  CG  . TYR B 1 422 ? 44.119  57.283  45.090  1.00 64.36 ? 425  TYR B CG  1 
ATOM   7408  C  CD1 . TYR B 1 422 ? 44.038  57.677  43.750  1.00 64.30 ? 425  TYR B CD1 1 
ATOM   7409  C  CD2 . TYR B 1 422 ? 44.559  55.986  45.366  1.00 64.25 ? 425  TYR B CD2 1 
ATOM   7410  C  CE1 . TYR B 1 422 ? 44.375  56.794  42.719  1.00 64.33 ? 425  TYR B CE1 1 
ATOM   7411  C  CE2 . TYR B 1 422 ? 44.894  55.101  44.347  1.00 64.33 ? 425  TYR B CE2 1 
ATOM   7412  C  CZ  . TYR B 1 422 ? 44.800  55.508  43.029  1.00 64.42 ? 425  TYR B CZ  1 
ATOM   7413  O  OH  . TYR B 1 422 ? 45.122  54.618  42.028  1.00 64.49 ? 425  TYR B OH  1 
ATOM   7414  N  N   . SER B 1 423 ? 43.460  61.350  47.168  1.00 65.60 ? 426  SER B N   1 
ATOM   7415  C  CA  . SER B 1 423 ? 42.735  62.291  48.016  1.00 66.29 ? 426  SER B CA  1 
ATOM   7416  C  C   . SER B 1 423 ? 41.573  62.879  47.225  1.00 66.57 ? 426  SER B C   1 
ATOM   7417  O  O   . SER B 1 423 ? 41.609  62.924  45.997  1.00 66.63 ? 426  SER B O   1 
ATOM   7418  C  CB  . SER B 1 423 ? 43.648  63.416  48.510  1.00 66.35 ? 426  SER B CB  1 
ATOM   7419  O  OG  . SER B 1 423 ? 43.879  64.370  47.493  1.00 66.69 ? 426  SER B OG  1 
ATOM   7420  N  N   . GLY B 1 424 ? 40.534  63.306  47.931  1.00 67.00 ? 427  GLY B N   1 
ATOM   7421  C  CA  . GLY B 1 424 ? 39.386  63.883  47.264  1.00 67.39 ? 427  GLY B CA  1 
ATOM   7422  C  C   . GLY B 1 424 ? 38.078  63.485  47.913  1.00 67.75 ? 427  GLY B C   1 
ATOM   7423  O  O   . GLY B 1 424 ? 38.041  62.996  49.048  1.00 67.64 ? 427  GLY B O   1 
ATOM   7424  N  N   . GLU B 1 425 ? 36.993  63.761  47.203  1.00 68.05 ? 428  GLU B N   1 
ATOM   7425  C  CA  . GLU B 1 425 ? 35.663  63.427  47.682  1.00 68.39 ? 428  GLU B CA  1 
ATOM   7426  C  C   . GLU B 1 425 ? 35.320  62.028  47.210  1.00 68.34 ? 428  GLU B C   1 
ATOM   7427  O  O   . GLU B 1 425 ? 35.754  61.601  46.129  1.00 68.41 ? 428  GLU B O   1 
ATOM   7428  C  CB  . GLU B 1 425 ? 34.613  64.368  47.089  1.00 68.87 ? 428  GLU B CB  1 
ATOM   7429  C  CG  . GLU B 1 425 ? 34.602  65.787  47.601  1.00 69.41 ? 428  GLU B CG  1 
ATOM   7430  C  CD  . GLU B 1 425 ? 33.494  66.595  46.948  1.00 69.75 ? 428  GLU B CD  1 
ATOM   7431  O  OE1 . GLU B 1 425 ? 32.396  66.696  47.538  1.00 69.95 ? 428  GLU B OE1 1 
ATOM   7432  O  OE2 . GLU B 1 425 ? 33.716  67.106  45.830  1.00 69.87 ? 428  GLU B OE2 1 
ATOM   7433  N  N   . VAL B 1 426 ? 34.543  61.317  48.019  1.00 68.12 ? 429  VAL B N   1 
ATOM   7434  C  CA  . VAL B 1 426 ? 34.095  59.983  47.653  1.00 67.46 ? 429  VAL B CA  1 
ATOM   7435  C  C   . VAL B 1 426 ? 32.678  60.203  47.152  1.00 67.06 ? 429  VAL B C   1 
ATOM   7436  O  O   . VAL B 1 426 ? 31.755  60.451  47.932  1.00 66.57 ? 429  VAL B O   1 
ATOM   7437  C  CB  . VAL B 1 426 ? 34.133  58.997  48.852  1.00 67.73 ? 429  VAL B CB  1 
ATOM   7438  C  CG1 . VAL B 1 426 ? 33.264  57.779  48.577  1.00 67.70 ? 429  VAL B CG1 1 
ATOM   7439  C  CG2 . VAL B 1 426 ? 35.564  58.535  49.091  1.00 67.23 ? 429  VAL B CG2 1 
ATOM   7440  N  N   . ARG B 1 427 ? 32.539  60.218  45.833  1.00 66.65 ? 430  ARG B N   1 
ATOM   7441  C  CA  . ARG B 1 427 ? 31.247  60.434  45.220  1.00 66.38 ? 430  ARG B CA  1 
ATOM   7442  C  C   . ARG B 1 427 ? 31.248  60.005  43.775  1.00 65.92 ? 430  ARG B C   1 
ATOM   7443  O  O   . ARG B 1 427 ? 32.220  59.424  43.286  1.00 65.75 ? 430  ARG B O   1 
ATOM   7444  C  CB  . ARG B 1 427 ? 30.844  61.906  45.323  1.00 67.06 ? 430  ARG B CB  1 
ATOM   7445  C  CG  . ARG B 1 427 ? 31.887  62.875  44.831  1.00 67.78 ? 430  ARG B CG  1 
ATOM   7446  C  CD  . ARG B 1 427 ? 31.275  64.221  44.570  1.00 69.04 ? 430  ARG B CD  1 
ATOM   7447  N  NE  . ARG B 1 427 ? 31.586  64.617  43.208  1.00 70.69 ? 430  ARG B NE  1 
ATOM   7448  C  CZ  . ARG B 1 427 ? 31.883  65.853  42.839  1.00 71.74 ? 430  ARG B CZ  1 
ATOM   7449  N  NH1 . ARG B 1 427 ? 31.898  66.830  43.733  1.00 72.73 ? 430  ARG B NH1 1 
ATOM   7450  N  NH2 . ARG B 1 427 ? 32.227  66.102  41.585  1.00 71.85 ? 430  ARG B NH2 1 
ATOM   7451  N  N   . ARG B 1 428 ? 30.140  60.292  43.104  1.00 65.42 ? 431  ARG B N   1 
ATOM   7452  C  CA  . ARG B 1 428 ? 29.966  59.940  41.709  1.00 65.12 ? 431  ARG B CA  1 
ATOM   7453  C  C   . ARG B 1 428 ? 30.370  61.101  40.819  1.00 64.98 ? 431  ARG B C   1 
ATOM   7454  O  O   . ARG B 1 428 ? 29.637  62.079  40.678  1.00 65.02 ? 431  ARG B O   1 
ATOM   7455  C  CB  . ARG B 1 428 ? 28.513  59.537  41.451  1.00 65.01 ? 431  ARG B CB  1 
ATOM   7456  C  CG  . ARG B 1 428 ? 28.030  58.415  42.364  1.00 64.67 ? 431  ARG B CG  1 
ATOM   7457  C  CD  . ARG B 1 428 ? 26.573  58.057  42.117  1.00 64.34 ? 431  ARG B CD  1 
ATOM   7458  N  NE  . ARG B 1 428 ? 26.064  57.098  43.096  1.00 64.13 ? 431  ARG B NE  1 
ATOM   7459  C  CZ  . ARG B 1 428 ? 26.354  55.799  43.102  1.00 64.08 ? 431  ARG B CZ  1 
ATOM   7460  N  NH1 . ARG B 1 428 ? 27.156  55.285  42.174  1.00 63.86 ? 431  ARG B NH1 1 
ATOM   7461  N  NH2 . ARG B 1 428 ? 25.868  55.018  44.059  1.00 63.83 ? 431  ARG B NH2 1 
ATOM   7462  N  N   . PHE B 1 429 ? 31.570  61.000  40.263  1.00 64.72 ? 432  PHE B N   1 
ATOM   7463  C  CA  . PHE B 1 429 ? 32.105  62.021  39.382  1.00 64.36 ? 432  PHE B CA  1 
ATOM   7464  C  C   . PHE B 1 429 ? 31.670  61.748  37.953  1.00 64.43 ? 432  PHE B C   1 
ATOM   7465  O  O   . PHE B 1 429 ? 32.039  60.730  37.362  1.00 64.68 ? 432  PHE B O   1 
ATOM   7466  C  CB  . PHE B 1 429 ? 33.624  62.026  39.464  1.00 64.06 ? 432  PHE B CB  1 
ATOM   7467  C  CG  . PHE B 1 429 ? 34.148  62.384  40.815  1.00 63.87 ? 432  PHE B CG  1 
ATOM   7468  C  CD1 . PHE B 1 429 ? 34.368  63.714  41.153  1.00 63.87 ? 432  PHE B CD1 1 
ATOM   7469  C  CD2 . PHE B 1 429 ? 34.418  61.398  41.754  1.00 63.97 ? 432  PHE B CD2 1 
ATOM   7470  C  CE1 . PHE B 1 429 ? 34.850  64.056  42.404  1.00 63.53 ? 432  PHE B CE1 1 
ATOM   7471  C  CE2 . PHE B 1 429 ? 34.903  61.733  43.013  1.00 63.65 ? 432  PHE B CE2 1 
ATOM   7472  C  CZ  . PHE B 1 429 ? 35.119  63.065  43.336  1.00 63.52 ? 432  PHE B CZ  1 
ATOM   7473  N  N   . ASN B 1 430 ? 30.901  62.667  37.382  1.00 64.34 ? 433  ASN B N   1 
ATOM   7474  C  CA  . ASN B 1 430 ? 30.441  62.479  36.022  1.00 64.34 ? 433  ASN B CA  1 
ATOM   7475  C  C   . ASN B 1 430 ? 31.579  62.525  35.016  1.00 64.42 ? 433  ASN B C   1 
ATOM   7476  O  O   . ASN B 1 430 ? 32.467  63.372  35.102  1.00 64.26 ? 433  ASN B O   1 
ATOM   7477  C  CB  . ASN B 1 430 ? 29.390  63.516  35.649  1.00 64.39 ? 433  ASN B CB  1 
ATOM   7478  C  CG  . ASN B 1 430 ? 28.724  63.210  34.317  1.00 64.75 ? 433  ASN B CG  1 
ATOM   7479  O  OD1 . ASN B 1 430 ? 28.656  62.051  33.887  1.00 65.30 ? 433  ASN B OD1 1 
ATOM   7480  N  ND2 . ASN B 1 430 ? 28.232  64.246  33.656  1.00 64.44 ? 433  ASN B ND2 1 
ATOM   7481  N  N   . THR B 1 431 ? 31.541  61.598  34.064  1.00 64.47 ? 434  THR B N   1 
ATOM   7482  C  CA  . THR B 1 431 ? 32.548  61.531  33.018  1.00 64.47 ? 434  THR B CA  1 
ATOM   7483  C  C   . THR B 1 431 ? 31.889  61.506  31.650  1.00 64.67 ? 434  THR B C   1 
ATOM   7484  O  O   . THR B 1 431 ? 32.563  61.331  30.636  1.00 64.84 ? 434  THR B O   1 
ATOM   7485  C  CB  . THR B 1 431 ? 33.437  60.301  33.161  1.00 64.32 ? 434  THR B CB  1 
ATOM   7486  O  OG1 . THR B 1 431 ? 32.624  59.125  33.178  1.00 64.12 ? 434  THR B OG1 1 
ATOM   7487  C  CG2 . THR B 1 431 ? 34.240  60.379  34.441  1.00 64.03 ? 434  THR B CG2 1 
ATOM   7488  N  N   . ALA B 1 432 ? 30.572  61.699  31.623  1.00 64.97 ? 435  ALA B N   1 
ATOM   7489  C  CA  . ALA B 1 432 ? 29.825  61.709  30.367  1.00 65.29 ? 435  ALA B CA  1 
ATOM   7490  C  C   . ALA B 1 432 ? 30.410  62.762  29.450  1.00 65.62 ? 435  ALA B C   1 
ATOM   7491  O  O   . ALA B 1 432 ? 30.534  62.564  28.246  1.00 65.70 ? 435  ALA B O   1 
ATOM   7492  C  CB  . ALA B 1 432 ? 28.363  62.022  30.627  1.00 65.29 ? 435  ALA B CB  1 
ATOM   7493  N  N   . ASN B 1 433 ? 30.838  63.860  30.049  1.00 66.07 ? 436  ASN B N   1 
ATOM   7494  C  CA  . ASN B 1 433 ? 31.384  64.962  29.289  1.00 66.73 ? 436  ASN B CA  1 
ATOM   7495  C  C   . ASN B 1 433 ? 32.888  65.005  29.004  1.00 67.08 ? 436  ASN B C   1 
ATOM   7496  O  O   . ASN B 1 433 ? 33.386  66.018  28.506  1.00 67.08 ? 436  ASN B O   1 
ATOM   7497  C  CB  . ASN B 1 433 ? 30.897  66.277  29.890  1.00 67.30 ? 436  ASN B CB  1 
ATOM   7498  C  CG  . ASN B 1 433 ? 29.404  66.476  29.702  1.00 67.51 ? 436  ASN B CG  1 
ATOM   7499  O  OD1 . ASN B 1 433 ? 28.915  66.497  28.574  1.00 68.13 ? 436  ASN B OD1 1 
ATOM   7500  N  ND2 . ASN B 1 433 ? 28.669  66.606  30.805  1.00 67.61 ? 436  ASN B ND2 1 
ATOM   7501  N  N   . ASP B 1 434 ? 33.619  63.928  29.292  1.00 67.28 ? 437  ASP B N   1 
ATOM   7502  C  CA  . ASP B 1 434 ? 35.050  63.921  28.972  1.00 67.37 ? 437  ASP B CA  1 
ATOM   7503  C  C   . ASP B 1 434 ? 35.157  64.041  27.452  1.00 67.22 ? 437  ASP B C   1 
ATOM   7504  O  O   . ASP B 1 434 ? 34.149  63.928  26.748  1.00 67.55 ? 437  ASP B O   1 
ATOM   7505  C  CB  . ASP B 1 434 ? 35.728  62.635  29.452  1.00 67.78 ? 437  ASP B CB  1 
ATOM   7506  C  CG  . ASP B 1 434 ? 35.963  62.623  30.955  1.00 68.48 ? 437  ASP B CG  1 
ATOM   7507  O  OD1 . ASP B 1 434 ? 36.737  61.763  31.437  1.00 68.52 ? 437  ASP B OD1 1 
ATOM   7508  O  OD2 . ASP B 1 434 ? 35.378  63.473  31.662  1.00 69.00 ? 437  ASP B OD2 1 
ATOM   7509  N  N   . ASP B 1 435 ? 36.355  64.280  26.931  1.00 66.89 ? 438  ASP B N   1 
ATOM   7510  C  CA  . ASP B 1 435 ? 36.495  64.425  25.485  1.00 66.30 ? 438  ASP B CA  1 
ATOM   7511  C  C   . ASP B 1 435 ? 35.977  63.192  24.768  1.00 65.82 ? 438  ASP B C   1 
ATOM   7512  O  O   . ASP B 1 435 ? 36.428  62.078  25.025  1.00 66.12 ? 438  ASP B O   1 
ATOM   7513  C  CB  . ASP B 1 435 ? 37.945  64.665  25.093  1.00 66.51 ? 438  ASP B CB  1 
ATOM   7514  C  CG  . ASP B 1 435 ? 38.082  65.089  23.654  1.00 66.81 ? 438  ASP B CG  1 
ATOM   7515  O  OD1 . ASP B 1 435 ? 38.535  66.224  23.432  1.00 66.70 ? 438  ASP B OD1 1 
ATOM   7516  O  OD2 . ASP B 1 435 ? 37.715  64.307  22.748  1.00 67.22 ? 438  ASP B OD2 1 
ATOM   7517  N  N   . ASN B 1 436 ? 35.041  63.393  23.851  1.00 64.88 ? 439  ASN B N   1 
ATOM   7518  C  CA  . ASN B 1 436 ? 34.479  62.265  23.136  1.00 63.89 ? 439  ASN B CA  1 
ATOM   7519  C  C   . ASN B 1 436 ? 34.737  62.332  21.652  1.00 63.31 ? 439  ASN B C   1 
ATOM   7520  O  O   . ASN B 1 436 ? 34.222  61.497  20.910  1.00 63.29 ? 439  ASN B O   1 
ATOM   7521  C  CB  . ASN B 1 436 ? 32.968  62.201  23.359  1.00 63.92 ? 439  ASN B CB  1 
ATOM   7522  C  CG  . ASN B 1 436 ? 32.596  62.036  24.818  1.00 63.99 ? 439  ASN B CG  1 
ATOM   7523  O  OD1 . ASN B 1 436 ? 33.111  61.153  25.513  1.00 64.18 ? 439  ASN B OD1 1 
ATOM   7524  N  ND2 . ASN B 1 436 ? 31.679  62.875  25.289  1.00 63.70 ? 439  ASN B ND2 1 
ATOM   7525  N  N   . VAL B 1 437 ? 35.565  63.271  21.208  1.00 62.69 ? 440  VAL B N   1 
ATOM   7526  C  CA  . VAL B 1 437 ? 35.787  63.403  19.772  1.00 62.01 ? 440  VAL B CA  1 
ATOM   7527  C  C   . VAL B 1 437 ? 37.204  63.511  19.226  1.00 61.91 ? 440  VAL B C   1 
ATOM   7528  O  O   . VAL B 1 437 ? 37.478  63.041  18.121  1.00 61.77 ? 440  VAL B O   1 
ATOM   7529  C  CB  . VAL B 1 437 ? 35.013  64.602  19.234  1.00 61.88 ? 440  VAL B CB  1 
ATOM   7530  C  CG1 . VAL B 1 437 ? 33.527  64.404  19.450  1.00 61.77 ? 440  VAL B CG1 1 
ATOM   7531  C  CG2 . VAL B 1 437 ? 35.475  65.861  19.935  1.00 61.65 ? 440  VAL B CG2 1 
ATOM   7532  N  N   . THR B 1 438 ? 38.095  64.150  19.975  1.00 61.65 ? 441  THR B N   1 
ATOM   7533  C  CA  . THR B 1 438 ? 39.465  64.346  19.519  1.00 61.32 ? 441  THR B CA  1 
ATOM   7534  C  C   . THR B 1 438 ? 40.132  63.108  18.948  1.00 61.69 ? 441  THR B C   1 
ATOM   7535  O  O   . THR B 1 438 ? 40.383  63.045  17.747  1.00 62.10 ? 441  THR B O   1 
ATOM   7536  C  CB  . THR B 1 438 ? 40.326  64.943  20.619  1.00 60.74 ? 441  THR B CB  1 
ATOM   7537  O  OG1 . THR B 1 438 ? 39.662  66.098  21.142  1.00 59.77 ? 441  THR B OG1 1 
ATOM   7538  C  CG2 . THR B 1 438 ? 41.681  65.363  20.065  1.00 59.76 ? 441  THR B CG2 1 
ATOM   7539  N  N   . GLN B 1 439 ? 40.390  62.112  19.787  1.00 61.96 ? 442  GLN B N   1 
ATOM   7540  C  CA  . GLN B 1 439 ? 41.031  60.891  19.317  1.00 62.07 ? 442  GLN B CA  1 
ATOM   7541  C  C   . GLN B 1 439 ? 40.228  60.215  18.224  1.00 62.40 ? 442  GLN B C   1 
ATOM   7542  O  O   . GLN B 1 439 ? 40.783  59.517  17.371  1.00 62.85 ? 442  GLN B O   1 
ATOM   7543  C  CB  . GLN B 1 439 ? 41.245  59.917  20.462  1.00 61.93 ? 442  GLN B CB  1 
ATOM   7544  C  CG  . GLN B 1 439 ? 42.264  60.376  21.460  1.00 61.20 ? 442  GLN B CG  1 
ATOM   7545  C  CD  . GLN B 1 439 ? 42.919  59.218  22.163  1.00 60.74 ? 442  GLN B CD  1 
ATOM   7546  O  OE1 . GLN B 1 439 ? 42.408  58.099  22.158  1.00 60.66 ? 442  GLN B OE1 1 
ATOM   7547  N  NE2 . GLN B 1 439 ? 44.069  59.472  22.758  1.00 61.01 ? 442  GLN B NE2 1 
ATOM   7548  N  N   . VAL B 1 440 ? 38.915  60.415  18.263  1.00 62.46 ? 443  VAL B N   1 
ATOM   7549  C  CA  . VAL B 1 440 ? 38.030  59.838  17.267  1.00 62.30 ? 443  VAL B CA  1 
ATOM   7550  C  C   . VAL B 1 440 ? 38.345  60.532  15.948  1.00 62.81 ? 443  VAL B C   1 
ATOM   7551  O  O   . VAL B 1 440 ? 38.457  59.885  14.908  1.00 63.00 ? 443  VAL B O   1 
ATOM   7552  C  CB  . VAL B 1 440 ? 36.557  60.078  17.629  1.00 61.67 ? 443  VAL B CB  1 
ATOM   7553  C  CG1 . VAL B 1 440 ? 35.659  59.288  16.720  1.00 61.25 ? 443  VAL B CG1 1 
ATOM   7554  C  CG2 . VAL B 1 440 ? 36.301  59.694  19.066  1.00 61.19 ? 443  VAL B CG2 1 
ATOM   7555  N  N   . ARG B 1 441 ? 38.544  61.847  16.008  1.00 63.08 ? 444  ARG B N   1 
ATOM   7556  C  CA  . ARG B 1 441 ? 38.860  62.634  14.823  1.00 63.12 ? 444  ARG B CA  1 
ATOM   7557  C  C   . ARG B 1 441 ? 40.172  62.166  14.213  1.00 62.96 ? 444  ARG B C   1 
ATOM   7558  O  O   . ARG B 1 441 ? 40.286  62.029  12.998  1.00 63.02 ? 444  ARG B O   1 
ATOM   7559  C  CB  . ARG B 1 441 ? 38.926  64.121  15.184  1.00 63.89 ? 444  ARG B CB  1 
ATOM   7560  C  CG  . ARG B 1 441 ? 39.288  65.058  14.027  1.00 64.69 ? 444  ARG B CG  1 
ATOM   7561  C  CD  . ARG B 1 441 ? 38.497  66.375  14.082  1.00 65.23 ? 444  ARG B CD  1 
ATOM   7562  N  NE  . ARG B 1 441 ? 38.647  67.081  15.352  1.00 66.08 ? 444  ARG B NE  1 
ATOM   7563  C  CZ  . ARG B 1 441 ? 37.634  67.577  16.056  1.00 66.41 ? 444  ARG B CZ  1 
ATOM   7564  N  NH1 . ARG B 1 441 ? 37.859  68.203  17.203  1.00 66.42 ? 444  ARG B NH1 1 
ATOM   7565  N  NH2 . ARG B 1 441 ? 36.391  67.441  15.618  1.00 66.63 ? 444  ARG B NH2 1 
ATOM   7566  N  N   . ALA B 1 442 ? 41.150  61.890  15.065  1.00 62.92 ? 445  ALA B N   1 
ATOM   7567  C  CA  . ALA B 1 442 ? 42.447  61.424  14.601  1.00 63.25 ? 445  ALA B CA  1 
ATOM   7568  C  C   . ALA B 1 442 ? 42.278  60.123  13.841  1.00 63.44 ? 445  ALA B C   1 
ATOM   7569  O  O   . ALA B 1 442 ? 42.819  59.946  12.753  1.00 63.59 ? 445  ALA B O   1 
ATOM   7570  C  CB  . ALA B 1 442 ? 43.373  61.210  15.779  1.00 63.24 ? 445  ALA B CB  1 
ATOM   7571  N  N   . PHE B 1 443 ? 41.515  59.214  14.425  1.00 63.60 ? 446  PHE B N   1 
ATOM   7572  C  CA  . PHE B 1 443 ? 41.265  57.919  13.819  1.00 63.95 ? 446  PHE B CA  1 
ATOM   7573  C  C   . PHE B 1 443 ? 40.636  58.030  12.437  1.00 64.68 ? 446  PHE B C   1 
ATOM   7574  O  O   . PHE B 1 443 ? 41.077  57.372  11.492  1.00 65.18 ? 446  PHE B O   1 
ATOM   7575  C  CB  . PHE B 1 443 ? 40.356  57.111  14.729  1.00 63.38 ? 446  PHE B CB  1 
ATOM   7576  C  CG  . PHE B 1 443 ? 39.989  55.768  14.185  1.00 62.86 ? 446  PHE B CG  1 
ATOM   7577  C  CD1 . PHE B 1 443 ? 40.902  54.727  14.200  1.00 62.75 ? 446  PHE B CD1 1 
ATOM   7578  C  CD2 . PHE B 1 443 ? 38.710  55.530  13.699  1.00 62.77 ? 446  PHE B CD2 1 
ATOM   7579  C  CE1 . PHE B 1 443 ? 40.547  53.464  13.743  1.00 62.55 ? 446  PHE B CE1 1 
ATOM   7580  C  CE2 . PHE B 1 443 ? 38.344  54.269  13.239  1.00 62.57 ? 446  PHE B CE2 1 
ATOM   7581  C  CZ  . PHE B 1 443 ? 39.264  53.235  13.263  1.00 62.44 ? 446  PHE B CZ  1 
ATOM   7582  N  N   . TYR B 1 444 ? 39.603  58.858  12.323  1.00 65.47 ? 447  TYR B N   1 
ATOM   7583  C  CA  . TYR B 1 444 ? 38.897  59.048  11.055  1.00 65.93 ? 447  TYR B CA  1 
ATOM   7584  C  C   . TYR B 1 444 ? 39.774  59.669  9.980   1.00 65.80 ? 447  TYR B C   1 
ATOM   7585  O  O   . TYR B 1 444 ? 39.922  59.139  8.876   1.00 65.88 ? 447  TYR B O   1 
ATOM   7586  C  CB  . TYR B 1 444 ? 37.678  59.947  11.272  1.00 66.74 ? 447  TYR B CB  1 
ATOM   7587  C  CG  . TYR B 1 444 ? 36.814  60.144  10.045  1.00 67.76 ? 447  TYR B CG  1 
ATOM   7588  C  CD1 . TYR B 1 444 ? 36.782  61.366  9.376   1.00 68.24 ? 447  TYR B CD1 1 
ATOM   7589  C  CD2 . TYR B 1 444 ? 36.012  59.112  9.565   1.00 68.29 ? 447  TYR B CD2 1 
ATOM   7590  C  CE1 . TYR B 1 444 ? 35.967  61.549  8.257   1.00 68.68 ? 447  TYR B CE1 1 
ATOM   7591  C  CE2 . TYR B 1 444 ? 35.198  59.283  8.450   1.00 68.65 ? 447  TYR B CE2 1 
ATOM   7592  C  CZ  . TYR B 1 444 ? 35.179  60.501  7.802   1.00 68.88 ? 447  TYR B CZ  1 
ATOM   7593  O  OH  . TYR B 1 444 ? 34.368  60.664  6.701   1.00 69.26 ? 447  TYR B OH  1 
ATOM   7594  N  N   . VAL B 1 445 ? 40.360  60.803  10.320  1.00 65.32 ? 448  VAL B N   1 
ATOM   7595  C  CA  . VAL B 1 445 ? 41.193  61.519  9.391   1.00 64.87 ? 448  VAL B CA  1 
ATOM   7596  C  C   . VAL B 1 445 ? 42.514  60.825  9.071   1.00 65.10 ? 448  VAL B C   1 
ATOM   7597  O  O   . VAL B 1 445 ? 42.852  60.634  7.897   1.00 65.21 ? 448  VAL B O   1 
ATOM   7598  C  CB  . VAL B 1 445 ? 41.452  62.936  9.919   1.00 64.51 ? 448  VAL B CB  1 
ATOM   7599  C  CG1 . VAL B 1 445 ? 42.290  63.737  8.927   1.00 64.31 ? 448  VAL B CG1 1 
ATOM   7600  C  CG2 . VAL B 1 445 ? 40.126  63.632  10.190  1.00 63.48 ? 448  VAL B CG2 1 
ATOM   7601  N  N   . ASN B 1 446 ? 43.225  60.386  10.105  1.00 65.02 ? 449  ASN B N   1 
ATOM   7602  C  CA  . ASN B 1 446 ? 44.533  59.777  9.899   1.00 65.21 ? 449  ASN B CA  1 
ATOM   7603  C  C   . ASN B 1 446 ? 44.689  58.273  9.830   1.00 65.19 ? 449  ASN B C   1 
ATOM   7604  O  O   . ASN B 1 446 ? 45.343  57.767  8.916   1.00 65.67 ? 449  ASN B O   1 
ATOM   7605  C  CB  . ASN B 1 446 ? 45.520  60.356  10.899  1.00 65.33 ? 449  ASN B CB  1 
ATOM   7606  C  CG  . ASN B 1 446 ? 45.597  61.863  10.809  1.00 65.75 ? 449  ASN B CG  1 
ATOM   7607  O  OD1 . ASN B 1 446 ? 45.520  62.567  11.818  1.00 66.17 ? 449  ASN B OD1 1 
ATOM   7608  N  ND2 . ASN B 1 446 ? 45.699  62.374  9.587   1.00 65.76 ? 449  ASN B ND2 1 
ATOM   7609  N  N   . VAL B 1 447 ? 44.150  57.550  10.803  1.00 65.07 ? 450  VAL B N   1 
ATOM   7610  C  CA  . VAL B 1 447 ? 44.278  56.096  10.792  1.00 64.78 ? 450  VAL B CA  1 
ATOM   7611  C  C   . VAL B 1 447 ? 43.602  55.487  9.566   1.00 65.11 ? 450  VAL B C   1 
ATOM   7612  O  O   . VAL B 1 447 ? 44.105  54.526  8.984   1.00 65.08 ? 450  VAL B O   1 
ATOM   7613  C  CB  . VAL B 1 447 ? 43.703  55.481  12.068  1.00 64.32 ? 450  VAL B CB  1 
ATOM   7614  C  CG1 . VAL B 1 447 ? 43.819  53.977  12.022  1.00 63.79 ? 450  VAL B CG1 1 
ATOM   7615  C  CG2 . VAL B 1 447 ? 44.445  56.029  13.276  1.00 63.81 ? 450  VAL B CG2 1 
ATOM   7616  N  N   . LEU B 1 448 ? 42.483  56.075  9.159   1.00 65.38 ? 451  LEU B N   1 
ATOM   7617  C  CA  . LEU B 1 448 ? 41.746  55.602  8.000   1.00 65.62 ? 451  LEU B CA  1 
ATOM   7618  C  C   . LEU B 1 448 ? 42.027  56.434  6.768   1.00 66.48 ? 451  LEU B C   1 
ATOM   7619  O  O   . LEU B 1 448 ? 42.250  57.642  6.863   1.00 67.07 ? 451  LEU B O   1 
ATOM   7620  C  CB  . LEU B 1 448 ? 40.253  55.661  8.271   1.00 64.69 ? 451  LEU B CB  1 
ATOM   7621  C  CG  . LEU B 1 448 ? 39.762  54.826  9.441   1.00 64.12 ? 451  LEU B CG  1 
ATOM   7622  C  CD1 . LEU B 1 448 ? 38.254  54.920  9.499   1.00 63.42 ? 451  LEU B CD1 1 
ATOM   7623  C  CD2 . LEU B 1 448 ? 40.202  53.382  9.262   1.00 63.92 ? 451  LEU B CD2 1 
ATOM   7624  N  N   . ASN B 1 449 ? 42.022  55.784  5.610   1.00 67.25 ? 452  ASN B N   1 
ATOM   7625  C  CA  . ASN B 1 449 ? 42.227  56.480  4.351   1.00 67.90 ? 452  ASN B CA  1 
ATOM   7626  C  C   . ASN B 1 449 ? 40.835  56.720  3.782   1.00 68.71 ? 452  ASN B C   1 
ATOM   7627  O  O   . ASN B 1 449 ? 39.838  56.396  4.431   1.00 69.00 ? 452  ASN B O   1 
ATOM   7628  C  CB  . ASN B 1 449 ? 43.086  55.657  3.392   1.00 67.65 ? 452  ASN B CB  1 
ATOM   7629  C  CG  . ASN B 1 449 ? 42.458  54.329  3.028   1.00 67.75 ? 452  ASN B CG  1 
ATOM   7630  O  OD1 . ASN B 1 449 ? 41.280  54.259  2.687   1.00 67.84 ? 452  ASN B OD1 1 
ATOM   7631  N  ND2 . ASN B 1 449 ? 43.253  53.264  3.084   1.00 67.37 ? 452  ASN B ND2 1 
ATOM   7632  N  N   . GLU B 1 450 ? 40.757  57.227  2.559   1.00 69.66 ? 453  GLU B N   1 
ATOM   7633  C  CA  . GLU B 1 450 ? 39.467  57.524  1.943   1.00 70.45 ? 453  GLU B CA  1 
ATOM   7634  C  C   . GLU B 1 450 ? 38.575  56.301  1.715   1.00 70.79 ? 453  GLU B C   1 
ATOM   7635  O  O   . GLU B 1 450 ? 37.383  56.350  2.005   1.00 70.83 ? 453  GLU B O   1 
ATOM   7636  C  CB  . GLU B 1 450 ? 39.680  58.308  0.647   1.00 71.29 ? 453  GLU B CB  1 
ATOM   7637  C  CG  . GLU B 1 450 ? 38.468  59.110  0.191   1.00 72.18 ? 453  GLU B CG  1 
ATOM   7638  C  CD  . GLU B 1 450 ? 38.783  60.058  -0.963  1.00 72.77 ? 453  GLU B CD  1 
ATOM   7639  O  OE1 . GLU B 1 450 ? 39.067  61.248  -0.692  1.00 73.15 ? 453  GLU B OE1 1 
ATOM   7640  O  OE2 . GLU B 1 450 ? 38.740  59.617  -2.135  1.00 72.76 ? 453  GLU B OE2 1 
ATOM   7641  N  N   . GLU B 1 451 ? 39.151  55.208  1.216   1.00 71.16 ? 454  GLU B N   1 
ATOM   7642  C  CA  . GLU B 1 451 ? 38.404  53.972  0.963   1.00 71.47 ? 454  GLU B CA  1 
ATOM   7643  C  C   . GLU B 1 451 ? 37.762  53.441  2.234   1.00 70.75 ? 454  GLU B C   1 
ATOM   7644  O  O   . GLU B 1 451 ? 36.590  53.063  2.246   1.00 70.99 ? 454  GLU B O   1 
ATOM   7645  C  CB  . GLU B 1 451 ? 39.327  52.890  0.387   1.00 73.00 ? 454  GLU B CB  1 
ATOM   7646  C  CG  . GLU B 1 451 ? 39.509  52.946  -1.123  1.00 75.63 ? 454  GLU B CG  1 
ATOM   7647  C  CD  . GLU B 1 451 ? 38.228  52.588  -1.876  1.00 77.54 ? 454  GLU B CD  1 
ATOM   7648  O  OE1 . GLU B 1 451 ? 37.384  53.486  -2.120  1.00 78.02 ? 454  GLU B OE1 1 
ATOM   7649  O  OE2 . GLU B 1 451 ? 38.061  51.394  -2.216  1.00 78.49 ? 454  GLU B OE2 1 
ATOM   7650  N  N   . GLN B 1 452 ? 38.545  53.422  3.304   1.00 69.73 ? 455  GLN B N   1 
ATOM   7651  C  CA  . GLN B 1 452 ? 38.095  52.935  4.597   1.00 68.63 ? 455  GLN B CA  1 
ATOM   7652  C  C   . GLN B 1 452 ? 37.030  53.824  5.206   1.00 68.35 ? 455  GLN B C   1 
ATOM   7653  O  O   . GLN B 1 452 ? 36.062  53.322  5.772   1.00 68.37 ? 455  GLN B O   1 
ATOM   7654  C  CB  . GLN B 1 452 ? 39.284  52.837  5.537   1.00 67.94 ? 455  GLN B CB  1 
ATOM   7655  C  CG  . GLN B 1 452 ? 40.445  52.100  4.920   1.00 66.96 ? 455  GLN B CG  1 
ATOM   7656  C  CD  . GLN B 1 452 ? 41.658  52.099  5.804   1.00 66.60 ? 455  GLN B CD  1 
ATOM   7657  O  OE1 . GLN B 1 452 ? 42.142  51.045  6.195   1.00 66.64 ? 455  GLN B OE1 1 
ATOM   7658  N  NE2 . GLN B 1 452 ? 42.161  53.281  6.129   1.00 66.61 ? 455  GLN B NE2 1 
ATOM   7659  N  N   . ARG B 1 453 ? 37.222  55.139  5.114   1.00 68.06 ? 456  ARG B N   1 
ATOM   7660  C  CA  . ARG B 1 453 ? 36.254  56.090  5.656   1.00 67.87 ? 456  ARG B CA  1 
ATOM   7661  C  C   . ARG B 1 453 ? 34.924  55.889  4.957   1.00 68.04 ? 456  ARG B C   1 
ATOM   7662  O  O   . ARG B 1 453 ? 33.861  55.971  5.577   1.00 68.05 ? 456  ARG B O   1 
ATOM   7663  C  CB  . ARG B 1 453 ? 36.703  57.535  5.427   1.00 67.53 ? 456  ARG B CB  1 
ATOM   7664  C  CG  . ARG B 1 453 ? 37.945  57.948  6.179   1.00 67.16 ? 456  ARG B CG  1 
ATOM   7665  C  CD  . ARG B 1 453 ? 38.292  59.402  5.921   1.00 66.71 ? 456  ARG B CD  1 
ATOM   7666  N  NE  . ARG B 1 453 ? 39.718  59.620  6.121   1.00 66.43 ? 456  ARG B NE  1 
ATOM   7667  C  CZ  . ARG B 1 453 ? 40.547  59.998  5.158   1.00 66.68 ? 456  ARG B CZ  1 
ATOM   7668  N  NH1 . ARG B 1 453 ? 40.084  60.214  3.934   1.00 66.18 ? 456  ARG B NH1 1 
ATOM   7669  N  NH2 . ARG B 1 453 ? 41.845  60.110  5.405   1.00 67.19 ? 456  ARG B NH2 1 
ATOM   7670  N  N   . LYS B 1 454 ? 34.995  55.650  3.652   1.00 68.26 ? 457  LYS B N   1 
ATOM   7671  C  CA  . LYS B 1 454 ? 33.799  55.431  2.863   1.00 68.43 ? 457  LYS B CA  1 
ATOM   7672  C  C   . LYS B 1 454 ? 33.073  54.215  3.415   1.00 68.20 ? 457  LYS B C   1 
ATOM   7673  O  O   . LYS B 1 454 ? 31.919  54.320  3.840   1.00 68.50 ? 457  LYS B O   1 
ATOM   7674  C  CB  . LYS B 1 454 ? 34.144  55.200  1.388   1.00 69.09 ? 457  LYS B CB  1 
ATOM   7675  C  CG  . LYS B 1 454 ? 32.909  55.169  0.497   1.00 69.88 ? 457  LYS B CG  1 
ATOM   7676  C  CD  . LYS B 1 454 ? 33.215  54.774  -0.931  1.00 70.51 ? 457  LYS B CD  1 
ATOM   7677  C  CE  . LYS B 1 454 ? 31.932  54.809  -1.747  1.00 71.02 ? 457  LYS B CE  1 
ATOM   7678  N  NZ  . LYS B 1 454 ? 32.105  54.180  -3.078  1.00 71.59 ? 457  LYS B NZ  1 
ATOM   7679  N  N   . ARG B 1 455 ? 33.768  53.077  3.451   1.00 67.67 ? 458  ARG B N   1 
ATOM   7680  C  CA  . ARG B 1 455 ? 33.187  51.835  3.953   1.00 66.83 ? 458  ARG B CA  1 
ATOM   7681  C  C   . ARG B 1 455 ? 32.559  51.987  5.336   1.00 66.47 ? 458  ARG B C   1 
ATOM   7682  O  O   . ARG B 1 455 ? 31.414  51.572  5.561   1.00 66.36 ? 458  ARG B O   1 
ATOM   7683  C  CB  . ARG B 1 455 ? 34.227  50.718  3.942   1.00 66.82 ? 458  ARG B CB  1 
ATOM   7684  C  CG  . ARG B 1 455 ? 34.463  50.146  2.546   1.00 66.99 ? 458  ARG B CG  1 
ATOM   7685  C  CD  . ARG B 1 455 ? 35.083  48.752  2.585   1.00 66.88 ? 458  ARG B CD  1 
ATOM   7686  N  NE  . ARG B 1 455 ? 36.503  48.797  2.911   1.00 67.35 ? 458  ARG B NE  1 
ATOM   7687  C  CZ  . ARG B 1 455 ? 37.453  49.193  2.064   1.00 67.88 ? 458  ARG B CZ  1 
ATOM   7688  N  NH1 . ARG B 1 455 ? 37.139  49.581  0.831   1.00 68.08 ? 458  ARG B NH1 1 
ATOM   7689  N  NH2 . ARG B 1 455 ? 38.723  49.216  2.453   1.00 67.84 ? 458  ARG B NH2 1 
ATOM   7690  N  N   . LEU B 1 456 ? 33.294  52.633  6.238   1.00 65.89 ? 459  LEU B N   1 
ATOM   7691  C  CA  . LEU B 1 456 ? 32.824  52.878  7.597   1.00 65.31 ? 459  LEU B CA  1 
ATOM   7692  C  C   . LEU B 1 456 ? 31.447  53.530  7.581   1.00 65.02 ? 459  LEU B C   1 
ATOM   7693  O  O   . LEU B 1 456 ? 30.514  53.045  8.223   1.00 65.40 ? 459  LEU B O   1 
ATOM   7694  C  CB  . LEU B 1 456 ? 33.814  53.780  8.337   1.00 65.03 ? 459  LEU B CB  1 
ATOM   7695  C  CG  . LEU B 1 456 ? 33.376  54.339  9.695   1.00 64.78 ? 459  LEU B CG  1 
ATOM   7696  C  CD1 . LEU B 1 456 ? 33.124  53.232  10.678  1.00 64.65 ? 459  LEU B CD1 1 
ATOM   7697  C  CD2 . LEU B 1 456 ? 34.446  55.256  10.237  1.00 64.66 ? 459  LEU B CD2 1 
ATOM   7698  N  N   . CYS B 1 457 ? 31.319  54.616  6.826   1.00 64.50 ? 460  CYS B N   1 
ATOM   7699  C  CA  . CYS B 1 457 ? 30.053  55.323  6.729   1.00 64.11 ? 460  CYS B CA  1 
ATOM   7700  C  C   . CYS B 1 457 ? 28.954  54.463  6.132   1.00 63.83 ? 460  CYS B C   1 
ATOM   7701  O  O   . CYS B 1 457 ? 27.807  54.544  6.553   1.00 63.75 ? 460  CYS B O   1 
ATOM   7702  C  CB  . CYS B 1 457 ? 30.218  56.588  5.903   1.00 64.27 ? 460  CYS B CB  1 
ATOM   7703  S  SG  . CYS B 1 457 ? 31.312  57.798  6.667   1.00 65.48 ? 460  CYS B SG  1 
ATOM   7704  N  N   . GLU B 1 458 ? 29.300  53.642  5.148   1.00 63.63 ? 461  GLU B N   1 
ATOM   7705  C  CA  . GLU B 1 458 ? 28.317  52.776  4.519   1.00 63.43 ? 461  GLU B CA  1 
ATOM   7706  C  C   . GLU B 1 458 ? 27.825  51.786  5.553   1.00 63.17 ? 461  GLU B C   1 
ATOM   7707  O  O   . GLU B 1 458 ? 26.622  51.640  5.762   1.00 63.44 ? 461  GLU B O   1 
ATOM   7708  C  CB  . GLU B 1 458 ? 28.932  52.048  3.329   1.00 63.54 ? 461  GLU B CB  1 
ATOM   7709  C  CG  . GLU B 1 458 ? 29.324  52.991  2.207   1.00 63.94 ? 461  GLU B CG  1 
ATOM   7710  C  CD  . GLU B 1 458 ? 30.053  52.313  1.054   1.00 64.26 ? 461  GLU B CD  1 
ATOM   7711  O  OE1 . GLU B 1 458 ? 30.600  51.200  1.229   1.00 64.36 ? 461  GLU B OE1 1 
ATOM   7712  O  OE2 . GLU B 1 458 ? 30.092  52.913  -0.040  1.00 64.77 ? 461  GLU B OE2 1 
ATOM   7713  N  N   . ASN B 1 459 ? 28.768  51.150  6.234   1.00 62.57 ? 462  ASN B N   1 
ATOM   7714  C  CA  . ASN B 1 459 ? 28.445  50.178  7.263   1.00 62.02 ? 462  ASN B CA  1 
ATOM   7715  C  C   . ASN B 1 459 ? 27.524  50.797  8.286   1.00 61.67 ? 462  ASN B C   1 
ATOM   7716  O  O   . ASN B 1 459 ? 26.468  50.262  8.589   1.00 61.81 ? 462  ASN B O   1 
ATOM   7717  C  CB  . ASN B 1 459 ? 29.724  49.711  7.935   1.00 62.12 ? 462  ASN B CB  1 
ATOM   7718  C  CG  . ASN B 1 459 ? 30.655  49.018  6.968   1.00 62.08 ? 462  ASN B CG  1 
ATOM   7719  O  OD1 . ASN B 1 459 ? 30.234  48.584  5.898   1.00 61.98 ? 462  ASN B OD1 1 
ATOM   7720  N  ND2 . ASN B 1 459 ? 31.927  48.917  7.330   1.00 62.12 ? 462  ASN B ND2 1 
ATOM   7721  N  N   . ILE B 1 460 ? 27.911  51.949  8.803   1.00 61.31 ? 463  ILE B N   1 
ATOM   7722  C  CA  . ILE B 1 460 ? 27.083  52.627  9.781   1.00 61.04 ? 463  ILE B CA  1 
ATOM   7723  C  C   . ILE B 1 460 ? 25.708  52.892  9.194   1.00 61.05 ? 463  ILE B C   1 
ATOM   7724  O  O   . ILE B 1 460 ? 24.697  52.484  9.759   1.00 61.35 ? 463  ILE B O   1 
ATOM   7725  C  CB  . ILE B 1 460 ? 27.715  53.954  10.209  1.00 60.93 ? 463  ILE B CB  1 
ATOM   7726  C  CG1 . ILE B 1 460 ? 28.999  53.674  10.979  1.00 60.73 ? 463  ILE B CG1 1 
ATOM   7727  C  CG2 . ILE B 1 460 ? 26.752  54.762  11.068  1.00 60.63 ? 463  ILE B CG2 1 
ATOM   7728  C  CD1 . ILE B 1 460 ? 29.661  54.910  11.520  1.00 60.71 ? 463  ILE B CD1 1 
ATOM   7729  N  N   . ALA B 1 461 ? 25.680  53.551  8.043   1.00 60.75 ? 464  ALA B N   1 
ATOM   7730  C  CA  . ALA B 1 461 ? 24.432  53.879  7.368   1.00 60.37 ? 464  ALA B CA  1 
ATOM   7731  C  C   . ALA B 1 461 ? 23.603  52.629  7.169   1.00 60.22 ? 464  ALA B C   1 
ATOM   7732  O  O   . ALA B 1 461 ? 22.430  52.576  7.541   1.00 60.27 ? 464  ALA B O   1 
ATOM   7733  C  CB  . ALA B 1 461 ? 24.725  54.514  6.029   1.00 60.10 ? 464  ALA B CB  1 
ATOM   7734  N  N   . GLY B 1 462 ? 24.241  51.612  6.608   1.00 60.29 ? 465  GLY B N   1 
ATOM   7735  C  CA  . GLY B 1 462 ? 23.560  50.363  6.351   1.00 60.50 ? 465  GLY B CA  1 
ATOM   7736  C  C   . GLY B 1 462 ? 22.788  49.865  7.550   1.00 60.87 ? 465  GLY B C   1 
ATOM   7737  O  O   . GLY B 1 462 ? 21.698  49.314  7.412   1.00 61.15 ? 465  GLY B O   1 
ATOM   7738  N  N   . HIS B 1 463 ? 23.326  50.081  8.741   1.00 60.87 ? 466  HIS B N   1 
ATOM   7739  C  CA  . HIS B 1 463 ? 22.638  49.617  9.925   1.00 60.94 ? 466  HIS B CA  1 
ATOM   7740  C  C   . HIS B 1 463 ? 21.755  50.669  10.562  1.00 61.41 ? 466  HIS B C   1 
ATOM   7741  O  O   . HIS B 1 463 ? 20.639  50.363  10.969  1.00 61.70 ? 466  HIS B O   1 
ATOM   7742  C  CB  . HIS B 1 463 ? 23.621  49.078  10.949  1.00 60.17 ? 466  HIS B CB  1 
ATOM   7743  C  CG  . HIS B 1 463 ? 22.960  48.466  12.140  1.00 59.61 ? 466  HIS B CG  1 
ATOM   7744  N  ND1 . HIS B 1 463 ? 22.572  49.204  13.233  1.00 59.50 ? 466  HIS B ND1 1 
ATOM   7745  C  CD2 . HIS B 1 463 ? 22.595  47.190  12.395  1.00 59.34 ? 466  HIS B CD2 1 
ATOM   7746  C  CE1 . HIS B 1 463 ? 21.993  48.409  14.116  1.00 59.28 ? 466  HIS B CE1 1 
ATOM   7747  N  NE2 . HIS B 1 463 ? 21.994  47.181  13.629  1.00 59.31 ? 466  HIS B NE2 1 
ATOM   7748  N  N   . LEU B 1 464 ? 22.241  51.907  10.641  1.00 61.84 ? 467  LEU B N   1 
ATOM   7749  C  CA  . LEU B 1 464 ? 21.485  53.005  11.257  1.00 62.00 ? 467  LEU B CA  1 
ATOM   7750  C  C   . LEU B 1 464 ? 20.191  53.373  10.532  1.00 62.40 ? 467  LEU B C   1 
ATOM   7751  O  O   . LEU B 1 464 ? 19.249  53.880  11.147  1.00 62.42 ? 467  LEU B O   1 
ATOM   7752  C  CB  . LEU B 1 464 ? 22.367  54.248  11.397  1.00 61.41 ? 467  LEU B CB  1 
ATOM   7753  C  CG  . LEU B 1 464 ? 21.698  55.486  12.002  1.00 60.91 ? 467  LEU B CG  1 
ATOM   7754  C  CD1 . LEU B 1 464 ? 21.245  55.231  13.420  1.00 60.61 ? 467  LEU B CD1 1 
ATOM   7755  C  CD2 . LEU B 1 464 ? 22.658  56.650  11.965  1.00 60.64 ? 467  LEU B CD2 1 
ATOM   7756  N  N   . LYS B 1 465 ? 20.146  53.111  9.231   1.00 62.80 ? 468  LYS B N   1 
ATOM   7757  C  CA  . LYS B 1 465 ? 18.971  53.424  8.433   1.00 63.34 ? 468  LYS B CA  1 
ATOM   7758  C  C   . LYS B 1 465 ? 17.698  52.870  9.050   1.00 63.76 ? 468  LYS B C   1 
ATOM   7759  O  O   . LYS B 1 465 ? 16.645  53.488  8.946   1.00 64.01 ? 468  LYS B O   1 
ATOM   7760  C  CB  . LYS B 1 465 ? 19.119  52.861  7.025   1.00 63.45 ? 468  LYS B CB  1 
ATOM   7761  C  CG  . LYS B 1 465 ? 19.110  51.345  6.988   1.00 64.01 ? 468  LYS B CG  1 
ATOM   7762  C  CD  . LYS B 1 465 ? 19.069  50.819  5.573   1.00 64.10 ? 468  LYS B CD  1 
ATOM   7763  C  CE  . LYS B 1 465 ? 19.132  49.300  5.563   1.00 64.31 ? 468  LYS B CE  1 
ATOM   7764  N  NZ  . LYS B 1 465 ? 17.967  48.707  6.266   1.00 64.33 ? 468  LYS B NZ  1 
ATOM   7765  N  N   . ASP B 1 466 ? 17.789  51.710  9.694   1.00 64.58 ? 469  ASP B N   1 
ATOM   7766  C  CA  . ASP B 1 466 ? 16.611  51.097  10.306  1.00 65.14 ? 469  ASP B CA  1 
ATOM   7767  C  C   . ASP B 1 466 ? 16.193  51.697  11.637  1.00 65.35 ? 469  ASP B C   1 
ATOM   7768  O  O   . ASP B 1 466 ? 15.263  51.200  12.274  1.00 65.59 ? 469  ASP B O   1 
ATOM   7769  C  CB  . ASP B 1 466 ? 16.786  49.589  10.446  1.00 65.70 ? 469  ASP B CB  1 
ATOM   7770  C  CG  . ASP B 1 466 ? 16.900  48.906  9.112   1.00 66.31 ? 469  ASP B CG  1 
ATOM   7771  O  OD1 . ASP B 1 466 ? 17.888  48.171  8.911   1.00 66.98 ? 469  ASP B OD1 1 
ATOM   7772  O  OD2 . ASP B 1 466 ? 16.012  49.123  8.259   1.00 66.44 ? 469  ASP B OD2 1 
ATOM   7773  N  N   . ALA B 1 467 ? 16.895  52.742  12.068  1.00 65.16 ? 470  ALA B N   1 
ATOM   7774  C  CA  . ALA B 1 467 ? 16.561  53.416  13.312  1.00 65.13 ? 470  ALA B CA  1 
ATOM   7775  C  C   . ALA B 1 467 ? 15.655  54.582  12.943  1.00 65.26 ? 470  ALA B C   1 
ATOM   7776  O  O   . ALA B 1 467 ? 15.674  55.037  11.799  1.00 65.61 ? 470  ALA B O   1 
ATOM   7777  C  CB  . ALA B 1 467 ? 17.813  53.910  13.993  1.00 64.90 ? 470  ALA B CB  1 
ATOM   7778  N  N   . GLN B 1 468 ? 14.840  55.043  13.889  1.00 65.28 ? 471  GLN B N   1 
ATOM   7779  C  CA  . GLN B 1 468 ? 13.933  56.157  13.631  1.00 65.21 ? 471  GLN B CA  1 
ATOM   7780  C  C   . GLN B 1 468 ? 14.701  57.417  13.267  1.00 65.41 ? 471  GLN B C   1 
ATOM   7781  O  O   . GLN B 1 468 ? 15.874  57.575  13.625  1.00 65.58 ? 471  GLN B O   1 
ATOM   7782  C  CB  . GLN B 1 468 ? 13.039  56.426  14.841  1.00 64.84 ? 471  GLN B CB  1 
ATOM   7783  C  CG  . GLN B 1 468 ? 12.095  55.286  15.179  1.00 64.15 ? 471  GLN B CG  1 
ATOM   7784  C  CD  . GLN B 1 468 ? 11.186  55.618  16.338  1.00 63.87 ? 471  GLN B CD  1 
ATOM   7785  O  OE1 . GLN B 1 468 ? 10.509  56.640  16.324  1.00 63.90 ? 471  GLN B OE1 1 
ATOM   7786  N  NE2 . GLN B 1 468 ? 11.175  54.765  17.357  1.00 63.43 ? 471  GLN B NE2 1 
ATOM   7787  N  N   . ILE B 1 469 ? 14.025  58.321  12.570  1.00 65.61 ? 472  ILE B N   1 
ATOM   7788  C  CA  . ILE B 1 469 ? 14.637  59.566  12.135  1.00 65.81 ? 472  ILE B CA  1 
ATOM   7789  C  C   . ILE B 1 469 ? 15.267  60.378  13.256  1.00 66.26 ? 472  ILE B C   1 
ATOM   7790  O  O   . ILE B 1 469 ? 16.419  60.794  13.140  1.00 66.82 ? 472  ILE B O   1 
ATOM   7791  C  CB  . ILE B 1 469 ? 13.635  60.438  11.373  1.00 65.50 ? 472  ILE B CB  1 
ATOM   7792  C  CG1 . ILE B 1 469 ? 13.169  59.698  10.124  1.00 65.25 ? 472  ILE B CG1 1 
ATOM   7793  C  CG2 . ILE B 1 469 ? 14.281  61.760  10.958  1.00 65.46 ? 472  ILE B CG2 1 
ATOM   7794  C  CD1 . ILE B 1 469 ? 14.298  59.399  9.150   1.00 64.81 ? 472  ILE B CD1 1 
ATOM   7795  N  N   . PHE B 1 470 ? 14.540  60.594  14.346  1.00 66.27 ? 473  PHE B N   1 
ATOM   7796  C  CA  . PHE B 1 470 ? 15.105  61.380  15.426  1.00 66.21 ? 473  PHE B CA  1 
ATOM   7797  C  C   . PHE B 1 470 ? 16.417  60.772  15.878  1.00 66.12 ? 473  PHE B C   1 
ATOM   7798  O  O   . PHE B 1 470 ? 17.413  61.480  16.022  1.00 66.62 ? 473  PHE B O   1 
ATOM   7799  C  CB  . PHE B 1 470 ? 14.117  61.553  16.586  1.00 66.58 ? 473  PHE B CB  1 
ATOM   7800  C  CG  . PHE B 1 470 ? 14.017  60.374  17.520  1.00 67.13 ? 473  PHE B CG  1 
ATOM   7801  C  CD1 . PHE B 1 470 ? 14.885  60.254  18.609  1.00 67.46 ? 473  PHE B CD1 1 
ATOM   7802  C  CD2 . PHE B 1 470 ? 12.998  59.435  17.371  1.00 67.54 ? 473  PHE B CD2 1 
ATOM   7803  C  CE1 . PHE B 1 470 ? 14.731  59.219  19.541  1.00 67.58 ? 473  PHE B CE1 1 
ATOM   7804  C  CE2 . PHE B 1 470 ? 12.833  58.393  18.299  1.00 67.61 ? 473  PHE B CE2 1 
ATOM   7805  C  CZ  . PHE B 1 470 ? 13.701  58.287  19.385  1.00 67.55 ? 473  PHE B CZ  1 
ATOM   7806  N  N   . ILE B 1 471 ? 16.444  59.449  15.995  1.00 65.82 ? 474  ILE B N   1 
ATOM   7807  C  CA  . ILE B 1 471 ? 17.655  58.766  16.412  1.00 65.39 ? 474  ILE B CA  1 
ATOM   7808  C  C   . ILE B 1 471 ? 18.736  59.002  15.376  1.00 65.73 ? 474  ILE B C   1 
ATOM   7809  O  O   . ILE B 1 471 ? 19.869  59.338  15.722  1.00 65.85 ? 474  ILE B O   1 
ATOM   7810  C  CB  . ILE B 1 471 ? 17.414  57.267  16.615  1.00 64.96 ? 474  ILE B CB  1 
ATOM   7811  C  CG1 . ILE B 1 471 ? 16.450  57.070  17.783  1.00 64.31 ? 474  ILE B CG1 1 
ATOM   7812  C  CG2 . ILE B 1 471 ? 18.727  56.550  16.912  1.00 64.71 ? 474  ILE B CG2 1 
ATOM   7813  C  CD1 . ILE B 1 471 ? 16.144  55.624  18.108  1.00 63.82 ? 474  ILE B CD1 1 
ATOM   7814  N  N   . GLN B 1 472 ? 18.377  58.880  14.104  1.00 65.82 ? 475  GLN B N   1 
ATOM   7815  C  CA  . GLN B 1 472 ? 19.338  59.118  13.039  1.00 66.21 ? 475  GLN B CA  1 
ATOM   7816  C  C   . GLN B 1 472 ? 19.923  60.519  13.213  1.00 66.55 ? 475  GLN B C   1 
ATOM   7817  O  O   . GLN B 1 472 ? 21.136  60.686  13.279  1.00 66.82 ? 475  GLN B O   1 
ATOM   7818  C  CB  . GLN B 1 472 ? 18.666  59.007  11.674  1.00 65.96 ? 475  GLN B CB  1 
ATOM   7819  C  CG  . GLN B 1 472 ? 18.124  57.624  11.345  1.00 65.57 ? 475  GLN B CG  1 
ATOM   7820  C  CD  . GLN B 1 472 ? 17.614  57.511  9.910   1.00 65.64 ? 475  GLN B CD  1 
ATOM   7821  O  OE1 . GLN B 1 472 ? 17.212  56.434  9.468   1.00 65.54 ? 475  GLN B OE1 1 
ATOM   7822  N  NE2 . GLN B 1 472 ? 17.631  58.624  9.176   1.00 65.43 ? 475  GLN B NE2 1 
ATOM   7823  N  N   . LYS B 1 473 ? 19.053  61.513  13.347  1.00 67.11 ? 476  LYS B N   1 
ATOM   7824  C  CA  . LYS B 1 473 ? 19.495  62.885  13.523  1.00 67.75 ? 476  LYS B CA  1 
ATOM   7825  C  C   . LYS B 1 473 ? 20.466  63.025  14.676  1.00 67.71 ? 476  LYS B C   1 
ATOM   7826  O  O   . LYS B 1 473 ? 21.589  63.490  14.485  1.00 67.80 ? 476  LYS B O   1 
ATOM   7827  C  CB  . LYS B 1 473 ? 18.301  63.807  13.728  1.00 68.62 ? 476  LYS B CB  1 
ATOM   7828  C  CG  . LYS B 1 473 ? 17.495  63.979  12.470  1.00 70.22 ? 476  LYS B CG  1 
ATOM   7829  C  CD  . LYS B 1 473 ? 18.431  64.299  11.306  1.00 71.78 ? 476  LYS B CD  1 
ATOM   7830  C  CE  . LYS B 1 473 ? 17.684  64.426  9.984   1.00 72.80 ? 476  LYS B CE  1 
ATOM   7831  N  NZ  . LYS B 1 473 ? 16.661  65.514  10.014  1.00 73.76 ? 476  LYS B NZ  1 
ATOM   7832  N  N   . LYS B 1 474 ? 20.054  62.581  15.860  1.00 67.62 ? 477  LYS B N   1 
ATOM   7833  C  CA  . LYS B 1 474 ? 20.905  62.662  17.043  1.00 67.43 ? 477  LYS B CA  1 
ATOM   7834  C  C   . LYS B 1 474 ? 22.262  62.033  16.772  1.00 66.91 ? 477  LYS B C   1 
ATOM   7835  O  O   . LYS B 1 474 ? 23.300  62.643  17.013  1.00 66.69 ? 477  LYS B O   1 
ATOM   7836  C  CB  . LYS B 1 474 ? 20.251  61.953  18.233  1.00 68.58 ? 477  LYS B CB  1 
ATOM   7837  C  CG  . LYS B 1 474 ? 20.953  62.190  19.572  1.00 69.51 ? 477  LYS B CG  1 
ATOM   7838  C  CD  . LYS B 1 474 ? 20.911  63.673  19.948  1.00 71.02 ? 477  LYS B CD  1 
ATOM   7839  C  CE  . LYS B 1 474 ? 21.540  63.956  21.314  1.00 72.00 ? 477  LYS B CE  1 
ATOM   7840  N  NZ  . LYS B 1 474 ? 23.010  63.664  21.372  1.00 72.83 ? 477  LYS B NZ  1 
ATOM   7841  N  N   . ALA B 1 475 ? 22.242  60.817  16.243  1.00 66.33 ? 478  ALA B N   1 
ATOM   7842  C  CA  . ALA B 1 475 ? 23.469  60.106  15.939  1.00 65.93 ? 478  ALA B CA  1 
ATOM   7843  C  C   . ALA B 1 475 ? 24.312  60.828  14.892  1.00 66.01 ? 478  ALA B C   1 
ATOM   7844  O  O   . ALA B 1 475 ? 25.537  60.863  15.005  1.00 66.32 ? 478  ALA B O   1 
ATOM   7845  C  CB  . ALA B 1 475 ? 23.158  58.706  15.491  1.00 65.76 ? 478  ALA B CB  1 
ATOM   7846  N  N   . VAL B 1 476 ? 23.671  61.417  13.883  1.00 65.83 ? 479  VAL B N   1 
ATOM   7847  C  CA  . VAL B 1 476 ? 24.409  62.133  12.840  1.00 65.41 ? 479  VAL B CA  1 
ATOM   7848  C  C   . VAL B 1 476 ? 25.058  63.382  13.405  1.00 65.70 ? 479  VAL B C   1 
ATOM   7849  O  O   . VAL B 1 476 ? 26.145  63.779  12.986  1.00 65.54 ? 479  VAL B O   1 
ATOM   7850  C  CB  . VAL B 1 476 ? 23.503  62.543  11.667  1.00 65.02 ? 479  VAL B CB  1 
ATOM   7851  C  CG1 . VAL B 1 476 ? 24.253  63.464  10.722  1.00 64.68 ? 479  VAL B CG1 1 
ATOM   7852  C  CG2 . VAL B 1 476 ? 23.049  61.318  10.911  1.00 64.41 ? 479  VAL B CG2 1 
ATOM   7853  N  N   . LYS B 1 477 ? 24.387  63.996  14.366  1.00 66.10 ? 480  LYS B N   1 
ATOM   7854  C  CA  . LYS B 1 477 ? 24.907  65.199  14.986  1.00 66.67 ? 480  LYS B CA  1 
ATOM   7855  C  C   . LYS B 1 477 ? 26.223  64.872  15.669  1.00 66.45 ? 480  LYS B C   1 
ATOM   7856  O  O   . LYS B 1 477 ? 27.177  65.635  15.593  1.00 66.65 ? 480  LYS B O   1 
ATOM   7857  C  CB  . LYS B 1 477 ? 23.912  65.734  16.010  1.00 67.77 ? 480  LYS B CB  1 
ATOM   7858  C  CG  . LYS B 1 477 ? 23.977  67.245  16.205  1.00 69.24 ? 480  LYS B CG  1 
ATOM   7859  C  CD  . LYS B 1 477 ? 23.354  67.654  17.525  1.00 70.33 ? 480  LYS B CD  1 
ATOM   7860  C  CE  . LYS B 1 477 ? 24.079  66.962  18.672  1.00 71.42 ? 480  LYS B CE  1 
ATOM   7861  N  NZ  . LYS B 1 477 ? 23.638  67.452  20.002  1.00 72.15 ? 480  LYS B NZ  1 
ATOM   7862  N  N   . ASN B 1 478 ? 26.278  63.718  16.317  1.00 66.45 ? 481  ASN B N   1 
ATOM   7863  C  CA  . ASN B 1 478 ? 27.491  63.302  16.997  1.00 66.64 ? 481  ASN B CA  1 
ATOM   7864  C  C   . ASN B 1 478 ? 28.639  63.120  16.015  1.00 66.57 ? 481  ASN B C   1 
ATOM   7865  O  O   . ASN B 1 478 ? 29.710  63.693  16.188  1.00 66.71 ? 481  ASN B O   1 
ATOM   7866  C  CB  . ASN B 1 478 ? 27.250  62.007  17.767  1.00 66.87 ? 481  ASN B CB  1 
ATOM   7867  C  CG  . ASN B 1 478 ? 26.282  62.188  18.920  1.00 67.27 ? 481  ASN B CG  1 
ATOM   7868  O  OD1 . ASN B 1 478 ? 26.007  63.312  19.344  1.00 67.75 ? 481  ASN B OD1 1 
ATOM   7869  N  ND2 . ASN B 1 478 ? 25.756  61.079  19.433  1.00 67.41 ? 481  ASN B ND2 1 
ATOM   7870  N  N   . PHE B 1 479 ? 28.416  62.332  14.975  1.00 66.58 ? 482  PHE B N   1 
ATOM   7871  C  CA  . PHE B 1 479 ? 29.461  62.100  13.991  1.00 66.59 ? 482  PHE B CA  1 
ATOM   7872  C  C   . PHE B 1 479 ? 29.960  63.405  13.402  1.00 66.49 ? 482  PHE B C   1 
ATOM   7873  O  O   . PHE B 1 479 ? 31.162  63.612  13.253  1.00 66.64 ? 482  PHE B O   1 
ATOM   7874  C  CB  . PHE B 1 479 ? 28.957  61.175  12.890  1.00 66.90 ? 482  PHE B CB  1 
ATOM   7875  C  CG  . PHE B 1 479 ? 28.795  59.752  13.334  1.00 67.14 ? 482  PHE B CG  1 
ATOM   7876  C  CD1 . PHE B 1 479 ? 29.901  58.998  13.707  1.00 67.24 ? 482  PHE B CD1 1 
ATOM   7877  C  CD2 . PHE B 1 479 ? 27.539  59.165  13.389  1.00 67.40 ? 482  PHE B CD2 1 
ATOM   7878  C  CE1 . PHE B 1 479 ? 29.762  57.674  14.131  1.00 67.23 ? 482  PHE B CE1 1 
ATOM   7879  C  CE2 . PHE B 1 479 ? 27.388  57.842  13.812  1.00 67.44 ? 482  PHE B CE2 1 
ATOM   7880  C  CZ  . PHE B 1 479 ? 28.503  57.095  14.183  1.00 67.28 ? 482  PHE B CZ  1 
ATOM   7881  N  N   . THR B 1 480 ? 29.029  64.297  13.103  1.00 66.42 ? 483  THR B N   1 
ATOM   7882  C  CA  . THR B 1 480 ? 29.375  65.588  12.541  1.00 66.56 ? 483  THR B CA  1 
ATOM   7883  C  C   . THR B 1 480 ? 30.375  66.295  13.443  1.00 66.98 ? 483  THR B C   1 
ATOM   7884  O  O   . THR B 1 480 ? 31.340  66.892  12.969  1.00 67.21 ? 483  THR B O   1 
ATOM   7885  C  CB  . THR B 1 480 ? 28.130  66.447  12.390  1.00 66.34 ? 483  THR B CB  1 
ATOM   7886  O  OG1 . THR B 1 480 ? 27.236  65.806  11.475  1.00 66.39 ? 483  THR B OG1 1 
ATOM   7887  C  CG2 . THR B 1 480 ? 28.484  67.822  11.874  1.00 66.15 ? 483  THR B CG2 1 
ATOM   7888  N  N   . GLU B 1 481 ? 30.157  66.193  14.749  1.00 67.11 ? 484  GLU B N   1 
ATOM   7889  C  CA  . GLU B 1 481 ? 31.044  66.813  15.725  1.00 67.32 ? 484  GLU B CA  1 
ATOM   7890  C  C   . GLU B 1 481 ? 32.448  66.230  15.575  1.00 67.11 ? 484  GLU B C   1 
ATOM   7891  O  O   . GLU B 1 481 ? 33.439  66.951  15.694  1.00 67.46 ? 484  GLU B O   1 
ATOM   7892  C  CB  . GLU B 1 481 ? 30.519  66.568  17.139  1.00 67.78 ? 484  GLU B CB  1 
ATOM   7893  C  CG  . GLU B 1 481 ? 30.443  67.802  18.024  1.00 68.32 ? 484  GLU B CG  1 
ATOM   7894  C  CD  . GLU B 1 481 ? 29.890  67.474  19.402  1.00 69.44 ? 484  GLU B CD  1 
ATOM   7895  O  OE1 . GLU B 1 481 ? 28.676  67.184  19.508  1.00 69.77 ? 484  GLU B OE1 1 
ATOM   7896  O  OE2 . GLU B 1 481 ? 30.668  67.486  20.383  1.00 69.59 ? 484  GLU B OE2 1 
ATOM   7897  N  N   . VAL B 1 482 ? 32.535  64.928  15.308  1.00 66.68 ? 485  VAL B N   1 
ATOM   7898  C  CA  . VAL B 1 482 ? 33.834  64.294  15.127  1.00 66.15 ? 485  VAL B CA  1 
ATOM   7899  C  C   . VAL B 1 482 ? 34.469  64.946  13.926  1.00 66.59 ? 485  VAL B C   1 
ATOM   7900  O  O   . VAL B 1 482 ? 35.632  65.318  13.963  1.00 66.69 ? 485  VAL B O   1 
ATOM   7901  C  CB  . VAL B 1 482 ? 33.713  62.819  14.810  1.00 65.55 ? 485  VAL B CB  1 
ATOM   7902  C  CG1 . VAL B 1 482 ? 35.086  62.214  14.686  1.00 65.04 ? 485  VAL B CG1 1 
ATOM   7903  C  CG2 . VAL B 1 482 ? 32.921  62.127  15.873  1.00 65.36 ? 485  VAL B CG2 1 
ATOM   7904  N  N   . HIS B 1 483 ? 33.686  65.070  12.858  1.00 67.09 ? 486  HIS B N   1 
ATOM   7905  C  CA  . HIS B 1 483 ? 34.135  65.698  11.622  1.00 67.69 ? 486  HIS B CA  1 
ATOM   7906  C  C   . HIS B 1 483 ? 32.947  65.903  10.695  1.00 68.36 ? 486  HIS B C   1 
ATOM   7907  O  O   . HIS B 1 483 ? 32.143  64.993  10.491  1.00 68.66 ? 486  HIS B O   1 
ATOM   7908  C  CB  . HIS B 1 483 ? 35.189  64.842  10.918  1.00 67.40 ? 486  HIS B CB  1 
ATOM   7909  C  CG  . HIS B 1 483 ? 35.840  65.522  9.753   1.00 67.37 ? 486  HIS B CG  1 
ATOM   7910  N  ND1 . HIS B 1 483 ? 37.183  65.836  9.727   1.00 67.65 ? 486  HIS B ND1 1 
ATOM   7911  C  CD2 . HIS B 1 483 ? 35.335  65.949  8.572   1.00 67.25 ? 486  HIS B CD2 1 
ATOM   7912  C  CE1 . HIS B 1 483 ? 37.475  66.426  8.581   1.00 67.01 ? 486  HIS B CE1 1 
ATOM   7913  N  NE2 . HIS B 1 483 ? 36.372  66.507  7.862   1.00 67.30 ? 486  HIS B NE2 1 
ATOM   7914  N  N   . PRO B 1 484 ? 32.823  67.107  10.115  1.00 68.97 ? 487  PRO B N   1 
ATOM   7915  C  CA  . PRO B 1 484 ? 31.726  67.437  9.203   1.00 69.49 ? 487  PRO B CA  1 
ATOM   7916  C  C   . PRO B 1 484 ? 31.525  66.407  8.090   1.00 70.03 ? 487  PRO B C   1 
ATOM   7917  O  O   . PRO B 1 484 ? 30.400  65.986  7.816   1.00 70.43 ? 487  PRO B O   1 
ATOM   7918  C  CB  . PRO B 1 484 ? 32.156  68.794  8.656   1.00 69.35 ? 487  PRO B CB  1 
ATOM   7919  C  CG  . PRO B 1 484 ? 32.820  69.416  9.845   1.00 68.91 ? 487  PRO B CG  1 
ATOM   7920  C  CD  . PRO B 1 484 ? 33.688  68.282  10.331  1.00 68.99 ? 487  PRO B CD  1 
ATOM   7921  N  N   . ASP B 1 485 ? 32.624  65.972  7.485   1.00 70.51 ? 488  ASP B N   1 
ATOM   7922  C  CA  . ASP B 1 485 ? 32.588  64.990  6.408   1.00 70.73 ? 488  ASP B CA  1 
ATOM   7923  C  C   . ASP B 1 485 ? 31.996  63.674  6.896   1.00 69.98 ? 488  ASP B C   1 
ATOM   7924  O  O   . ASP B 1 485 ? 31.210  63.038  6.201   1.00 69.86 ? 488  ASP B O   1 
ATOM   7925  C  CB  . ASP B 1 485 ? 34.006  64.768  5.867   1.00 72.58 ? 488  ASP B CB  1 
ATOM   7926  C  CG  . ASP B 1 485 ? 34.076  63.675  4.803   1.00 74.41 ? 488  ASP B CG  1 
ATOM   7927  O  OD1 . ASP B 1 485 ? 34.950  62.780  4.917   1.00 75.05 ? 488  ASP B OD1 1 
ATOM   7928  O  OD2 . ASP B 1 485 ? 33.267  63.716  3.843   1.00 75.71 ? 488  ASP B OD2 1 
ATOM   7929  N  N   . TYR B 1 486 ? 32.383  63.278  8.101   1.00 68.87 ? 489  TYR B N   1 
ATOM   7930  C  CA  . TYR B 1 486 ? 31.902  62.048  8.706   1.00 67.77 ? 489  TYR B CA  1 
ATOM   7931  C  C   . TYR B 1 486 ? 30.386  62.124  8.824   1.00 67.50 ? 489  TYR B C   1 
ATOM   7932  O  O   . TYR B 1 486 ? 29.674  61.262  8.319   1.00 67.51 ? 489  TYR B O   1 
ATOM   7933  C  CB  . TYR B 1 486 ? 32.521  61.916  10.092  1.00 67.23 ? 489  TYR B CB  1 
ATOM   7934  C  CG  . TYR B 1 486 ? 32.487  60.539  10.714  1.00 66.55 ? 489  TYR B CG  1 
ATOM   7935  C  CD1 . TYR B 1 486 ? 33.026  60.332  11.983  1.00 66.22 ? 489  TYR B CD1 1 
ATOM   7936  C  CD2 . TYR B 1 486 ? 31.960  59.439  10.035  1.00 66.15 ? 489  TYR B CD2 1 
ATOM   7937  C  CE1 . TYR B 1 486 ? 33.050  59.069  12.564  1.00 65.81 ? 489  TYR B CE1 1 
ATOM   7938  C  CE2 . TYR B 1 486 ? 31.979  58.162  10.615  1.00 65.84 ? 489  TYR B CE2 1 
ATOM   7939  C  CZ  . TYR B 1 486 ? 32.531  57.989  11.882  1.00 65.63 ? 489  TYR B CZ  1 
ATOM   7940  O  OH  . TYR B 1 486 ? 32.583  56.748  12.482  1.00 65.36 ? 489  TYR B OH  1 
ATOM   7941  N  N   . GLY B 1 487 ? 29.903  63.182  9.470   1.00 67.20 ? 490  GLY B N   1 
ATOM   7942  C  CA  . GLY B 1 487 ? 28.475  63.362  9.651   1.00 66.79 ? 490  GLY B CA  1 
ATOM   7943  C  C   . GLY B 1 487 ? 27.708  63.465  8.349   1.00 66.71 ? 490  GLY B C   1 
ATOM   7944  O  O   . GLY B 1 487 ? 26.700  62.792  8.176   1.00 66.69 ? 490  GLY B O   1 
ATOM   7945  N  N   . SER B 1 488 ? 28.204  64.269  7.415   1.00 66.67 ? 491  SER B N   1 
ATOM   7946  C  CA  . SER B 1 488 ? 27.525  64.451  6.135   1.00 66.73 ? 491  SER B CA  1 
ATOM   7947  C  C   . SER B 1 488 ? 27.465  63.189  5.292   1.00 66.57 ? 491  SER B C   1 
ATOM   7948  O  O   . SER B 1 488 ? 26.408  62.840  4.776   1.00 66.80 ? 491  SER B O   1 
ATOM   7949  C  CB  . SER B 1 488 ? 28.186  65.561  5.320   1.00 66.92 ? 491  SER B CB  1 
ATOM   7950  O  OG  . SER B 1 488 ? 29.434  65.134  4.800   1.00 67.70 ? 491  SER B OG  1 
ATOM   7951  N  N   . HIS B 1 489 ? 28.598  62.514  5.140   1.00 66.47 ? 492  HIS B N   1 
ATOM   7952  C  CA  . HIS B 1 489 ? 28.652  61.296  4.334   1.00 66.50 ? 492  HIS B CA  1 
ATOM   7953  C  C   . HIS B 1 489 ? 27.549  60.329  4.757   1.00 66.58 ? 492  HIS B C   1 
ATOM   7954  O  O   . HIS B 1 489 ? 26.789  59.826  3.927   1.00 66.71 ? 492  HIS B O   1 
ATOM   7955  C  CB  . HIS B 1 489 ? 30.020  60.622  4.465   1.00 66.23 ? 492  HIS B CB  1 
ATOM   7956  C  CG  . HIS B 1 489 ? 30.295  59.599  3.409   1.00 66.28 ? 492  HIS B CG  1 
ATOM   7957  N  ND1 . HIS B 1 489 ? 29.329  59.154  2.532   1.00 66.38 ? 492  HIS B ND1 1 
ATOM   7958  C  CD2 . HIS B 1 489 ? 31.430  58.940  3.077   1.00 66.22 ? 492  HIS B CD2 1 
ATOM   7959  C  CE1 . HIS B 1 489 ? 29.856  58.269  1.707   1.00 65.96 ? 492  HIS B CE1 1 
ATOM   7960  N  NE2 . HIS B 1 489 ? 31.131  58.120  2.016   1.00 66.05 ? 492  HIS B NE2 1 
ATOM   7961  N  N   . ILE B 1 490 ? 27.438  60.112  6.063   1.00 66.50 ? 493  ILE B N   1 
ATOM   7962  C  CA  . ILE B 1 490 ? 26.420  59.224  6.608   1.00 66.08 ? 493  ILE B CA  1 
ATOM   7963  C  C   . ILE B 1 490 ? 25.020  59.719  6.262   1.00 66.08 ? 493  ILE B C   1 
ATOM   7964  O  O   . ILE B 1 490 ? 24.211  58.965  5.722   1.00 66.16 ? 493  ILE B O   1 
ATOM   7965  C  CB  . ILE B 1 490 ? 26.578  59.083  8.134   1.00 65.79 ? 493  ILE B CB  1 
ATOM   7966  C  CG1 . ILE B 1 490 ? 27.875  58.336  8.441   1.00 65.46 ? 493  ILE B CG1 1 
ATOM   7967  C  CG2 . ILE B 1 490 ? 25.381  58.361  8.739   1.00 65.65 ? 493  ILE B CG2 1 
ATOM   7968  C  CD1 . ILE B 1 490 ? 28.163  58.192  9.903   1.00 65.28 ? 493  ILE B CD1 1 
ATOM   7969  N  N   . GLN B 1 491 ? 24.754  60.994  6.531   1.00 66.09 ? 494  GLN B N   1 
ATOM   7970  C  CA  . GLN B 1 491 ? 23.449  61.580  6.241   1.00 66.16 ? 494  GLN B CA  1 
ATOM   7971  C  C   . GLN B 1 491 ? 23.069  61.423  4.773   1.00 66.56 ? 494  GLN B C   1 
ATOM   7972  O  O   . GLN B 1 491 ? 21.918  61.120  4.451   1.00 66.57 ? 494  GLN B O   1 
ATOM   7973  C  CB  . GLN B 1 491 ? 23.439  63.056  6.603   1.00 65.85 ? 494  GLN B CB  1 
ATOM   7974  C  CG  . GLN B 1 491 ? 22.088  63.707  6.436   1.00 65.79 ? 494  GLN B CG  1 
ATOM   7975  C  CD  . GLN B 1 491 ? 21.084  63.198  7.440   1.00 66.03 ? 494  GLN B CD  1 
ATOM   7976  O  OE1 . GLN B 1 491 ? 21.233  63.407  8.647   1.00 66.17 ? 494  GLN B OE1 1 
ATOM   7977  N  NE2 . GLN B 1 491 ? 20.051  62.524  6.951   1.00 66.30 ? 494  GLN B NE2 1 
ATOM   7978  N  N   . ALA B 1 492 ? 24.037  61.638  3.886   1.00 66.94 ? 495  ALA B N   1 
ATOM   7979  C  CA  . ALA B 1 492 ? 23.809  61.509  2.450   1.00 67.47 ? 495  ALA B CA  1 
ATOM   7980  C  C   . ALA B 1 492 ? 23.268  60.119  2.192   1.00 68.12 ? 495  ALA B C   1 
ATOM   7981  O  O   . ALA B 1 492 ? 22.255  59.951  1.514   1.00 68.33 ? 495  ALA B O   1 
ATOM   7982  C  CB  . ALA B 1 492 ? 25.107  61.713  1.687   1.00 67.18 ? 495  ALA B CB  1 
ATOM   7983  N  N   . LEU B 1 493 ? 23.927  59.131  2.791   1.00 68.91 ? 496  LEU B N   1 
ATOM   7984  C  CA  . LEU B 1 493 ? 23.538  57.731  2.656   1.00 69.44 ? 496  LEU B CA  1 
ATOM   7985  C  C   . LEU B 1 493 ? 22.165  57.476  3.269   1.00 69.92 ? 496  LEU B C   1 
ATOM   7986  O  O   . LEU B 1 493 ? 21.332  56.779  2.687   1.00 70.20 ? 496  LEU B O   1 
ATOM   7987  C  CB  . LEU B 1 493 ? 24.590  56.831  3.310   1.00 69.11 ? 496  LEU B CB  1 
ATOM   7988  C  CG  . LEU B 1 493 ? 25.948  56.777  2.597   1.00 69.08 ? 496  LEU B CG  1 
ATOM   7989  C  CD1 . LEU B 1 493 ? 26.987  56.076  3.452   1.00 68.83 ? 496  LEU B CD1 1 
ATOM   7990  C  CD2 . LEU B 1 493 ? 25.797  56.077  1.251   1.00 69.05 ? 496  LEU B CD2 1 
ATOM   7991  N  N   . LEU B 1 494 ? 21.920  58.064  4.432   1.00 70.18 ? 497  LEU B N   1 
ATOM   7992  C  CA  . LEU B 1 494 ? 20.643  57.884  5.093   1.00 70.47 ? 497  LEU B CA  1 
ATOM   7993  C  C   . LEU B 1 494 ? 19.524  58.410  4.232   1.00 71.05 ? 497  LEU B C   1 
ATOM   7994  O  O   . LEU B 1 494 ? 18.484  57.771  4.103   1.00 71.43 ? 497  LEU B O   1 
ATOM   7995  C  CB  . LEU B 1 494 ? 20.633  58.589  6.439   1.00 69.90 ? 497  LEU B CB  1 
ATOM   7996  C  CG  . LEU B 1 494 ? 21.620  57.958  7.416   1.00 69.59 ? 497  LEU B CG  1 
ATOM   7997  C  CD1 . LEU B 1 494 ? 21.528  58.651  8.750   1.00 69.31 ? 497  LEU B CD1 1 
ATOM   7998  C  CD2 . LEU B 1 494 ? 21.331  56.474  7.566   1.00 69.22 ? 497  LEU B CD2 1 
ATOM   7999  N  N   . ASP B 1 495 ? 19.746  59.569  3.622   1.00 71.59 ? 498  ASP B N   1 
ATOM   8000  C  CA  . ASP B 1 495 ? 18.735  60.165  2.767   1.00 72.10 ? 498  ASP B CA  1 
ATOM   8001  C  C   . ASP B 1 495 ? 18.309  59.197  1.674   1.00 72.96 ? 498  ASP B C   1 
ATOM   8002  O  O   . ASP B 1 495 ? 17.113  58.972  1.482   1.00 72.98 ? 498  ASP B O   1 
ATOM   8003  C  CB  . ASP B 1 495 ? 19.243  61.473  2.164   1.00 71.32 ? 498  ASP B CB  1 
ATOM   8004  C  CG  . ASP B 1 495 ? 19.403  62.574  3.200   1.00 70.65 ? 498  ASP B CG  1 
ATOM   8005  O  OD1 . ASP B 1 495 ? 18.984  62.390  4.363   1.00 70.09 ? 498  ASP B OD1 1 
ATOM   8006  O  OD2 . ASP B 1 495 ? 19.949  63.635  2.846   1.00 70.63 ? 498  ASP B OD2 1 
ATOM   8007  N  N   . LYS B 1 496 ? 19.288  58.587  1.002   1.00 74.02 ? 499  LYS B N   1 
ATOM   8008  C  CA  . LYS B 1 496 ? 19.011  57.627  -0.069  1.00 75.16 ? 499  LYS B CA  1 
ATOM   8009  C  C   . LYS B 1 496 ? 18.204  56.444  0.442   1.00 75.74 ? 499  LYS B C   1 
ATOM   8010  O  O   . LYS B 1 496 ? 17.149  56.126  -0.109  1.00 75.81 ? 499  LYS B O   1 
ATOM   8011  C  CB  . LYS B 1 496 ? 20.305  57.131  -0.718  1.00 75.48 ? 499  LYS B CB  1 
ATOM   8012  C  CG  . LYS B 1 496 ? 20.990  58.165  -1.596  1.00 76.03 ? 499  LYS B CG  1 
ATOM   8013  C  CD  . LYS B 1 496 ? 22.368  57.692  -2.032  1.00 76.82 ? 499  LYS B CD  1 
ATOM   8014  C  CE  . LYS B 1 496 ? 23.169  58.833  -2.653  1.00 77.25 ? 499  LYS B CE  1 
ATOM   8015  N  NZ  . LYS B 1 496 ? 24.624  58.512  -2.754  1.00 77.58 ? 499  LYS B NZ  1 
ATOM   8016  N  N   . TYR B 1 497 ? 18.695  55.805  1.500   1.00 76.58 ? 500  TYR B N   1 
ATOM   8017  C  CA  . TYR B 1 497 ? 17.997  54.668  2.091   1.00 77.59 ? 500  TYR B CA  1 
ATOM   8018  C  C   . TYR B 1 497 ? 16.543  55.046  2.419   1.00 78.20 ? 500  TYR B C   1 
ATOM   8019  O  O   . TYR B 1 497 ? 15.610  54.290  2.134   1.00 78.59 ? 500  TYR B O   1 
ATOM   8020  C  CB  . TYR B 1 497 ? 18.708  54.206  3.368   1.00 77.73 ? 500  TYR B CB  1 
ATOM   8021  C  CG  . TYR B 1 497 ? 20.013  53.462  3.159   1.00 77.93 ? 500  TYR B CG  1 
ATOM   8022  C  CD1 . TYR B 1 497 ? 20.075  52.328  2.350   1.00 78.06 ? 500  TYR B CD1 1 
ATOM   8023  C  CD2 . TYR B 1 497 ? 21.178  53.868  3.806   1.00 78.09 ? 500  TYR B CD2 1 
ATOM   8024  C  CE1 . TYR B 1 497 ? 21.268  51.615  2.193   1.00 77.96 ? 500  TYR B CE1 1 
ATOM   8025  C  CE2 . TYR B 1 497 ? 22.372  53.164  3.655   1.00 77.98 ? 500  TYR B CE2 1 
ATOM   8026  C  CZ  . TYR B 1 497 ? 22.410  52.041  2.849   1.00 78.01 ? 500  TYR B CZ  1 
ATOM   8027  O  OH  . TYR B 1 497 ? 23.593  51.351  2.704   1.00 77.98 ? 500  TYR B OH  1 
ATOM   8028  N  N   . ASN B 1 498 ? 16.355  56.242  2.969   1.00 78.66 ? 501  ASN B N   1 
ATOM   8029  C  CA  . ASN B 1 498 ? 15.028  56.726  3.333   1.00 79.03 ? 501  ASN B CA  1 
ATOM   8030  C  C   . ASN B 1 498 ? 14.126  57.005  2.121   1.00 79.24 ? 501  ASN B C   1 
ATOM   8031  O  O   . ASN B 1 498 ? 12.912  57.208  2.336   1.00 79.42 ? 501  ASN B O   1 
ATOM   8032  C  CB  . ASN B 1 498 ? 15.152  57.975  4.217   1.00 79.21 ? 501  ASN B CB  1 
ATOM   8033  C  CG  . ASN B 1 498 ? 15.818  57.685  5.565   1.00 79.47 ? 501  ASN B CG  1 
ATOM   8034  O  OD1 . ASN B 1 498 ? 16.391  58.581  6.192   1.00 79.54 ? 501  ASN B OD1 1 
ATOM   8035  N  ND2 . ASN B 1 498 ? 15.734  56.435  6.018   1.00 79.25 ? 501  ASN B ND2 1 
ATOM   8036  O  OXT . ASN B 1 498 ? 14.620  56.994  0.970   1.00 79.42 ? 501  ASN B OXT 1 
ATOM   8037  N  N   . SER C 1 1   ? 47.266  15.221  77.854  1.00 86.08 ? 4    SER C N   1 
ATOM   8038  C  CA  . SER C 1 1   ? 46.485  15.211  76.576  1.00 85.93 ? 4    SER C CA  1 
ATOM   8039  C  C   . SER C 1 1   ? 45.157  14.439  76.714  1.00 85.24 ? 4    SER C C   1 
ATOM   8040  O  O   . SER C 1 1   ? 45.094  13.384  77.371  1.00 85.39 ? 4    SER C O   1 
ATOM   8041  C  CB  . SER C 1 1   ? 47.337  14.645  75.424  1.00 86.34 ? 4    SER C CB  1 
ATOM   8042  O  OG  . SER C 1 1   ? 48.411  15.520  75.091  1.00 86.70 ? 4    SER C OG  1 
ATOM   8043  N  N   . ARG C 1 2   ? 44.106  14.991  76.098  1.00 83.78 ? 5    ARG C N   1 
ATOM   8044  C  CA  . ARG C 1 2   ? 42.753  14.424  76.129  1.00 81.90 ? 5    ARG C CA  1 
ATOM   8045  C  C   . ARG C 1 2   ? 42.511  13.354  75.056  1.00 81.30 ? 5    ARG C C   1 
ATOM   8046  O  O   . ARG C 1 2   ? 43.458  12.790  74.500  1.00 81.60 ? 5    ARG C O   1 
ATOM   8047  C  CB  . ARG C 1 2   ? 41.714  15.541  75.962  1.00 80.82 ? 5    ARG C CB  1 
ATOM   8048  C  CG  . ARG C 1 2   ? 42.185  16.952  76.307  1.00 78.96 ? 5    ARG C CG  1 
ATOM   8049  C  CD  . ARG C 1 2   ? 42.900  17.609  75.139  1.00 77.37 ? 5    ARG C CD  1 
ATOM   8050  N  NE  . ARG C 1 2   ? 42.740  19.063  75.158  1.00 76.26 ? 5    ARG C NE  1 
ATOM   8051  C  CZ  . ARG C 1 2   ? 43.021  19.874  74.138  1.00 75.48 ? 5    ARG C CZ  1 
ATOM   8052  N  NH1 . ARG C 1 2   ? 43.487  19.391  72.994  1.00 74.99 ? 5    ARG C NH1 1 
ATOM   8053  N  NH2 . ARG C 1 2   ? 42.816  21.179  74.258  1.00 74.87 ? 5    ARG C NH2 1 
ATOM   8054  N  N   . ASP C 1 3   ? 41.237  13.079  74.769  1.00 80.16 ? 6    ASP C N   1 
ATOM   8055  C  CA  . ASP C 1 3   ? 40.872  12.095  73.753  1.00 78.85 ? 6    ASP C CA  1 
ATOM   8056  C  C   . ASP C 1 3   ? 41.426  12.531  72.400  1.00 77.87 ? 6    ASP C C   1 
ATOM   8057  O  O   . ASP C 1 3   ? 41.588  13.724  72.143  1.00 78.12 ? 6    ASP C O   1 
ATOM   8058  C  CB  . ASP C 1 3   ? 39.345  11.913  73.681  1.00 79.12 ? 6    ASP C CB  1 
ATOM   8059  C  CG  . ASP C 1 3   ? 38.605  13.180  73.259  1.00 79.47 ? 6    ASP C CG  1 
ATOM   8060  O  OD1 . ASP C 1 3   ? 39.033  14.294  73.627  1.00 79.92 ? 6    ASP C OD1 1 
ATOM   8061  O  OD2 . ASP C 1 3   ? 37.567  13.059  72.571  1.00 79.20 ? 6    ASP C OD2 1 
ATOM   8062  N  N   . PRO C 1 4   ? 41.735  11.571  71.522  1.00 76.83 ? 7    PRO C N   1 
ATOM   8063  C  CA  . PRO C 1 4   ? 42.283  11.821  70.185  1.00 76.09 ? 7    PRO C CA  1 
ATOM   8064  C  C   . PRO C 1 4   ? 41.503  12.843  69.363  1.00 75.40 ? 7    PRO C C   1 
ATOM   8065  O  O   . PRO C 1 4   ? 42.087  13.592  68.577  1.00 75.42 ? 7    PRO C O   1 
ATOM   8066  C  CB  . PRO C 1 4   ? 42.227  10.447  69.537  1.00 76.22 ? 7    PRO C CB  1 
ATOM   8067  C  CG  . PRO C 1 4   ? 42.435  9.531   70.698  1.00 76.45 ? 7    PRO C CG  1 
ATOM   8068  C  CD  . PRO C 1 4   ? 41.544  10.128  71.746  1.00 76.54 ? 7    PRO C CD  1 
ATOM   8069  N  N   . ALA C 1 5   ? 40.187  12.872  69.554  1.00 74.59 ? 8    ALA C N   1 
ATOM   8070  C  CA  . ALA C 1 5   ? 39.317  13.796  68.836  1.00 73.52 ? 8    ALA C CA  1 
ATOM   8071  C  C   . ALA C 1 5   ? 39.654  15.256  69.126  1.00 72.94 ? 8    ALA C C   1 
ATOM   8072  O  O   . ALA C 1 5   ? 39.718  16.079  68.219  1.00 73.00 ? 8    ALA C O   1 
ATOM   8073  C  CB  . ALA C 1 5   ? 37.873  13.516  69.186  1.00 73.44 ? 8    ALA C CB  1 
ATOM   8074  N  N   . SER C 1 6   ? 39.869  15.574  70.393  1.00 72.40 ? 9    SER C N   1 
ATOM   8075  C  CA  . SER C 1 6   ? 40.189  16.938  70.775  1.00 72.02 ? 9    SER C CA  1 
ATOM   8076  C  C   . SER C 1 6   ? 41.630  17.336  70.452  1.00 71.69 ? 9    SER C C   1 
ATOM   8077  O  O   . SER C 1 6   ? 41.970  18.513  70.509  1.00 71.68 ? 9    SER C O   1 
ATOM   8078  C  CB  . SER C 1 6   ? 39.909  17.149  72.261  1.00 72.17 ? 9    SER C CB  1 
ATOM   8079  O  OG  . SER C 1 6   ? 40.734  16.313  73.051  1.00 72.68 ? 9    SER C OG  1 
ATOM   8080  N  N   . ASP C 1 7   ? 42.479  16.364  70.132  1.00 71.16 ? 10   ASP C N   1 
ATOM   8081  C  CA  . ASP C 1 7   ? 43.873  16.660  69.804  1.00 70.51 ? 10   ASP C CA  1 
ATOM   8082  C  C   . ASP C 1 7   ? 44.133  16.773  68.305  1.00 69.74 ? 10   ASP C C   1 
ATOM   8083  O  O   . ASP C 1 7   ? 45.283  16.898  67.881  1.00 69.80 ? 10   ASP C O   1 
ATOM   8084  C  CB  . ASP C 1 7   ? 44.802  15.607  70.413  1.00 71.21 ? 10   ASP C CB  1 
ATOM   8085  C  CG  . ASP C 1 7   ? 44.968  15.773  71.912  1.00 71.99 ? 10   ASP C CG  1 
ATOM   8086  O  OD1 . ASP C 1 7   ? 44.733  16.898  72.409  1.00 72.60 ? 10   ASP C OD1 1 
ATOM   8087  O  OD2 . ASP C 1 7   ? 45.342  14.788  72.595  1.00 72.37 ? 10   ASP C OD2 1 
ATOM   8088  N  N   . GLN C 1 8   ? 43.060  16.779  67.518  1.00 68.83 ? 11   GLN C N   1 
ATOM   8089  C  CA  . GLN C 1 8   ? 43.152  16.862  66.062  1.00 67.93 ? 11   GLN C CA  1 
ATOM   8090  C  C   . GLN C 1 8   ? 44.201  17.863  65.574  1.00 67.72 ? 11   GLN C C   1 
ATOM   8091  O  O   . GLN C 1 8   ? 45.203  17.463  64.989  1.00 67.89 ? 11   GLN C O   1 
ATOM   8092  C  CB  . GLN C 1 8   ? 41.770  17.170  65.465  1.00 67.09 ? 11   GLN C CB  1 
ATOM   8093  C  CG  . GLN C 1 8   ? 41.650  16.956  63.957  1.00 65.99 ? 11   GLN C CG  1 
ATOM   8094  C  CD  . GLN C 1 8   ? 42.201  18.114  63.139  1.00 65.51 ? 11   GLN C CD  1 
ATOM   8095  O  OE1 . GLN C 1 8   ? 42.137  19.274  63.557  1.00 65.25 ? 11   GLN C OE1 1 
ATOM   8096  N  NE2 . GLN C 1 8   ? 42.736  17.804  61.964  1.00 64.72 ? 11   GLN C NE2 1 
ATOM   8097  N  N   . MET C 1 9   ? 44.004  19.150  65.848  1.00 67.30 ? 12   MET C N   1 
ATOM   8098  C  CA  . MET C 1 9   ? 44.958  20.164  65.405  1.00 67.03 ? 12   MET C CA  1 
ATOM   8099  C  C   . MET C 1 9   ? 46.368  19.912  65.911  1.00 67.38 ? 12   MET C C   1 
ATOM   8100  O  O   . MET C 1 9   ? 47.326  19.953  65.138  1.00 67.82 ? 12   MET C O   1 
ATOM   8101  C  CB  . MET C 1 9   ? 44.520  21.567  65.829  1.00 66.26 ? 12   MET C CB  1 
ATOM   8102  C  CG  . MET C 1 9   ? 43.218  22.034  65.214  1.00 65.38 ? 12   MET C CG  1 
ATOM   8103  S  SD  . MET C 1 9   ? 43.002  23.817  65.361  1.00 64.71 ? 12   MET C SD  1 
ATOM   8104  C  CE  . MET C 1 9   ? 42.802  24.003  67.108  1.00 64.16 ? 12   MET C CE  1 
ATOM   8105  N  N   . GLN C 1 10  ? 46.491  19.641  67.207  1.00 67.72 ? 13   GLN C N   1 
ATOM   8106  C  CA  . GLN C 1 10  ? 47.792  19.394  67.802  1.00 67.93 ? 13   GLN C CA  1 
ATOM   8107  C  C   . GLN C 1 10  ? 48.542  18.348  67.007  1.00 68.35 ? 13   GLN C C   1 
ATOM   8108  O  O   . GLN C 1 10  ? 49.660  18.601  66.560  1.00 68.44 ? 13   GLN C O   1 
ATOM   8109  C  CB  . GLN C 1 10  ? 47.651  18.938  69.247  1.00 67.80 ? 13   GLN C CB  1 
ATOM   8110  C  CG  . GLN C 1 10  ? 48.981  18.834  69.967  1.00 67.98 ? 13   GLN C CG  1 
ATOM   8111  C  CD  . GLN C 1 10  ? 49.804  20.096  69.828  1.00 68.16 ? 13   GLN C CD  1 
ATOM   8112  O  OE1 . GLN C 1 10  ? 49.358  21.186  70.180  1.00 68.32 ? 13   GLN C OE1 1 
ATOM   8113  N  NE2 . GLN C 1 10  ? 51.005  19.957  69.285  1.00 68.44 ? 13   GLN C NE2 1 
ATOM   8114  N  N   . HIS C 1 11  ? 47.900  17.200  66.785  1.00 68.70 ? 14   HIS C N   1 
ATOM   8115  C  CA  . HIS C 1 11  ? 48.507  16.104  66.027  1.00 69.27 ? 14   HIS C CA  1 
ATOM   8116  C  C   . HIS C 1 11  ? 48.913  16.573  64.647  1.00 69.03 ? 14   HIS C C   1 
ATOM   8117  O  O   . HIS C 1 11  ? 50.022  16.309  64.191  1.00 69.03 ? 14   HIS C O   1 
ATOM   8118  C  CB  . HIS C 1 11  ? 47.537  14.926  65.883  1.00 70.73 ? 14   HIS C CB  1 
ATOM   8119  C  CG  . HIS C 1 11  ? 47.340  14.137  67.143  1.00 72.58 ? 14   HIS C CG  1 
ATOM   8120  N  ND1 . HIS C 1 11  ? 48.311  14.033  68.121  1.00 73.57 ? 14   HIS C ND1 1 
ATOM   8121  C  CD2 . HIS C 1 11  ? 46.285  13.410  67.586  1.00 73.25 ? 14   HIS C CD2 1 
ATOM   8122  C  CE1 . HIS C 1 11  ? 47.861  13.280  69.110  1.00 73.63 ? 14   HIS C CE1 1 
ATOM   8123  N  NE2 . HIS C 1 11  ? 46.634  12.888  68.812  1.00 73.79 ? 14   HIS C NE2 1 
ATOM   8124  N  N   . TRP C 1 12  ? 48.003  17.288  63.996  1.00 68.90 ? 15   TRP C N   1 
ATOM   8125  C  CA  . TRP C 1 12  ? 48.234  17.808  62.657  1.00 68.77 ? 15   TRP C CA  1 
ATOM   8126  C  C   . TRP C 1 12  ? 49.472  18.690  62.629  1.00 69.41 ? 15   TRP C C   1 
ATOM   8127  O  O   . TRP C 1 12  ? 50.315  18.550  61.739  1.00 69.46 ? 15   TRP C O   1 
ATOM   8128  C  CB  . TRP C 1 12  ? 47.015  18.598  62.193  1.00 67.65 ? 15   TRP C CB  1 
ATOM   8129  C  CG  . TRP C 1 12  ? 47.049  18.971  60.753  1.00 66.30 ? 15   TRP C CG  1 
ATOM   8130  C  CD1 . TRP C 1 12  ? 46.555  18.251  59.710  1.00 65.84 ? 15   TRP C CD1 1 
ATOM   8131  C  CD2 . TRP C 1 12  ? 47.601  20.161  60.193  1.00 65.65 ? 15   TRP C CD2 1 
ATOM   8132  N  NE1 . TRP C 1 12  ? 46.762  18.919  58.531  1.00 65.43 ? 15   TRP C NE1 1 
ATOM   8133  C  CE2 . TRP C 1 12  ? 47.407  20.096  58.801  1.00 65.34 ? 15   TRP C CE2 1 
ATOM   8134  C  CE3 . TRP C 1 12  ? 48.245  21.275  60.733  1.00 65.45 ? 15   TRP C CE3 1 
ATOM   8135  C  CZ2 . TRP C 1 12  ? 47.832  21.100  57.939  1.00 65.30 ? 15   TRP C CZ2 1 
ATOM   8136  C  CZ3 . TRP C 1 12  ? 48.666  22.275  59.877  1.00 65.32 ? 15   TRP C CZ3 1 
ATOM   8137  C  CH2 . TRP C 1 12  ? 48.459  22.179  58.494  1.00 65.05 ? 15   TRP C CH2 1 
ATOM   8138  N  N   . LYS C 1 13  ? 49.565  19.602  63.594  1.00 70.20 ? 16   LYS C N   1 
ATOM   8139  C  CA  . LYS C 1 13  ? 50.707  20.499  63.698  1.00 71.20 ? 16   LYS C CA  1 
ATOM   8140  C  C   . LYS C 1 13  ? 51.958  19.664  63.856  1.00 72.16 ? 16   LYS C C   1 
ATOM   8141  O  O   . LYS C 1 13  ? 52.960  19.882  63.174  1.00 72.25 ? 16   LYS C O   1 
ATOM   8142  C  CB  . LYS C 1 13  ? 50.578  21.392  64.924  1.00 70.95 ? 16   LYS C CB  1 
ATOM   8143  C  CG  . LYS C 1 13  ? 51.793  22.271  65.161  1.00 70.61 ? 16   LYS C CG  1 
ATOM   8144  C  CD  . LYS C 1 13  ? 51.677  23.030  66.462  1.00 70.35 ? 16   LYS C CD  1 
ATOM   8145  C  CE  . LYS C 1 13  ? 52.818  24.009  66.611  1.00 70.26 ? 16   LYS C CE  1 
ATOM   8146  N  NZ  . LYS C 1 13  ? 52.596  24.866  67.802  1.00 70.25 ? 16   LYS C NZ  1 
ATOM   8147  N  N   . GLU C 1 14  ? 51.883  18.703  64.771  1.00 73.29 ? 17   GLU C N   1 
ATOM   8148  C  CA  . GLU C 1 14  ? 53.002  17.822  65.050  1.00 74.38 ? 17   GLU C CA  1 
ATOM   8149  C  C   . GLU C 1 14  ? 53.425  17.006  63.844  1.00 75.55 ? 17   GLU C C   1 
ATOM   8150  O  O   . GLU C 1 14  ? 54.611  16.782  63.644  1.00 75.90 ? 17   GLU C O   1 
ATOM   8151  C  CB  . GLU C 1 14  ? 52.705  16.940  66.263  1.00 73.78 ? 17   GLU C CB  1 
ATOM   8152  C  CG  . GLU C 1 14  ? 52.697  17.746  67.568  1.00 73.47 ? 17   GLU C CG  1 
ATOM   8153  C  CD  . GLU C 1 14  ? 52.230  16.966  68.794  1.00 73.38 ? 17   GLU C CD  1 
ATOM   8154  O  OE1 . GLU C 1 14  ? 51.664  15.858  68.644  1.00 73.53 ? 17   GLU C OE1 1 
ATOM   8155  O  OE2 . GLU C 1 14  ? 52.419  17.477  69.919  1.00 72.81 ? 17   GLU C OE2 1 
ATOM   8156  N  N   . GLN C 1 15  ? 52.476  16.616  63.002  1.00 76.98 ? 18   GLN C N   1 
ATOM   8157  C  CA  . GLN C 1 15  ? 52.826  15.846  61.816  1.00 78.50 ? 18   GLN C CA  1 
ATOM   8158  C  C   . GLN C 1 15  ? 53.644  16.662  60.817  1.00 79.17 ? 18   GLN C C   1 
ATOM   8159  O  O   . GLN C 1 15  ? 54.319  16.105  59.961  1.00 79.11 ? 18   GLN C O   1 
ATOM   8160  C  CB  . GLN C 1 15  ? 51.579  15.287  61.141  1.00 79.25 ? 18   GLN C CB  1 
ATOM   8161  C  CG  . GLN C 1 15  ? 51.142  13.932  61.681  1.00 80.46 ? 18   GLN C CG  1 
ATOM   8162  C  CD  . GLN C 1 15  ? 49.978  13.343  60.898  1.00 81.41 ? 18   GLN C CD  1 
ATOM   8163  O  OE1 . GLN C 1 15  ? 49.704  13.748  59.765  1.00 82.03 ? 18   GLN C OE1 1 
ATOM   8164  N  NE2 . GLN C 1 15  ? 49.284  12.380  61.501  1.00 81.64 ? 18   GLN C NE2 1 
ATOM   8165  N  N   . ARG C 1 16  ? 53.580  17.980  60.929  1.00 80.07 ? 19   ARG C N   1 
ATOM   8166  C  CA  . ARG C 1 16  ? 54.322  18.860  60.038  1.00 81.13 ? 19   ARG C CA  1 
ATOM   8167  C  C   . ARG C 1 16  ? 55.420  19.574  60.810  1.00 81.35 ? 19   ARG C C   1 
ATOM   8168  O  O   . ARG C 1 16  ? 55.677  20.762  60.601  1.00 81.36 ? 19   ARG C O   1 
ATOM   8169  C  CB  . ARG C 1 16  ? 53.387  19.901  59.459  1.00 82.19 ? 19   ARG C CB  1 
ATOM   8170  C  CG  . ARG C 1 16  ? 52.532  19.450  58.297  1.00 83.86 ? 19   ARG C CG  1 
ATOM   8171  C  CD  . ARG C 1 16  ? 51.789  20.664  57.735  1.00 85.17 ? 19   ARG C CD  1 
ATOM   8172  N  NE  . ARG C 1 16  ? 52.399  21.928  58.180  1.00 86.53 ? 19   ARG C NE  1 
ATOM   8173  C  CZ  . ARG C 1 16  ? 53.318  22.622  57.506  1.00 86.97 ? 19   ARG C CZ  1 
ATOM   8174  N  NH1 . ARG C 1 16  ? 53.752  22.199  56.321  1.00 87.06 ? 19   ARG C NH1 1 
ATOM   8175  N  NH2 . ARG C 1 16  ? 53.848  23.716  58.048  1.00 87.28 ? 19   ARG C NH2 1 
ATOM   8176  N  N   . ALA C 1 17  ? 56.066  18.838  61.702  1.00 81.63 ? 20   ALA C N   1 
ATOM   8177  C  CA  . ALA C 1 17  ? 57.120  19.380  62.550  1.00 81.84 ? 20   ALA C CA  1 
ATOM   8178  C  C   . ALA C 1 17  ? 58.184  20.151  61.799  1.00 81.86 ? 20   ALA C C   1 
ATOM   8179  O  O   . ALA C 1 17  ? 58.236  21.381  61.851  1.00 81.54 ? 20   ALA C O   1 
ATOM   8180  C  CB  . ALA C 1 17  ? 57.766  18.259  63.352  1.00 82.23 ? 20   ALA C CB  1 
ATOM   8181  N  N   . ALA C 1 18  ? 59.032  19.407  61.103  1.00 82.10 ? 21   ALA C N   1 
ATOM   8182  C  CA  . ALA C 1 18  ? 60.125  19.983  60.349  1.00 82.66 ? 21   ALA C CA  1 
ATOM   8183  C  C   . ALA C 1 18  ? 59.660  20.562  59.020  1.00 83.07 ? 21   ALA C C   1 
ATOM   8184  O  O   . ALA C 1 18  ? 60.424  20.600  58.052  1.00 83.57 ? 21   ALA C O   1 
ATOM   8185  C  CB  . ALA C 1 18  ? 61.205  18.925  60.121  1.00 82.61 ? 21   ALA C CB  1 
ATOM   8186  N  N   . GLN C 1 19  ? 58.422  21.038  58.972  1.00 83.07 ? 22   GLN C N   1 
ATOM   8187  C  CA  . GLN C 1 19  ? 57.911  21.591  57.733  1.00 82.73 ? 22   GLN C CA  1 
ATOM   8188  C  C   . GLN C 1 19  ? 57.603  23.077  57.765  1.00 81.67 ? 22   GLN C C   1 
ATOM   8189  O  O   . GLN C 1 19  ? 57.066  23.599  58.743  1.00 81.77 ? 22   GLN C O   1 
ATOM   8190  C  CB  . GLN C 1 19  ? 56.685  20.802  57.261  1.00 83.97 ? 22   GLN C CB  1 
ATOM   8191  C  CG  . GLN C 1 19  ? 56.939  19.992  55.998  1.00 85.68 ? 22   GLN C CG  1 
ATOM   8192  C  CD  . GLN C 1 19  ? 57.490  20.849  54.856  1.00 87.29 ? 22   GLN C CD  1 
ATOM   8193  O  OE1 . GLN C 1 19  ? 57.173  22.040  54.743  1.00 87.97 ? 22   GLN C OE1 1 
ATOM   8194  N  NE2 . GLN C 1 19  ? 58.326  20.246  54.008  1.00 87.91 ? 22   GLN C NE2 1 
ATOM   8195  N  N   . LYS C 1 20  ? 57.986  23.753  56.686  1.00 80.36 ? 23   LYS C N   1 
ATOM   8196  C  CA  . LYS C 1 20  ? 57.741  25.175  56.518  1.00 78.88 ? 23   LYS C CA  1 
ATOM   8197  C  C   . LYS C 1 20  ? 56.263  25.268  56.188  1.00 77.75 ? 23   LYS C C   1 
ATOM   8198  O  O   . LYS C 1 20  ? 55.728  24.390  55.515  1.00 77.69 ? 23   LYS C O   1 
ATOM   8199  C  CB  . LYS C 1 20  ? 58.530  25.692  55.322  1.00 79.18 ? 23   LYS C CB  1 
ATOM   8200  C  CG  . LYS C 1 20  ? 58.649  27.202  55.241  1.00 79.18 ? 23   LYS C CG  1 
ATOM   8201  C  CD  . LYS C 1 20  ? 59.966  27.643  55.858  1.00 79.65 ? 23   LYS C CD  1 
ATOM   8202  C  CE  . LYS C 1 20  ? 60.616  28.758  55.046  1.00 79.75 ? 23   LYS C CE  1 
ATOM   8203  N  NZ  . LYS C 1 20  ? 62.070  28.883  55.369  1.00 79.83 ? 23   LYS C NZ  1 
ATOM   8204  N  N   . ALA C 1 21  ? 55.598  26.312  56.666  1.00 76.28 ? 24   ALA C N   1 
ATOM   8205  C  CA  . ALA C 1 21  ? 54.177  26.486  56.382  1.00 74.74 ? 24   ALA C CA  1 
ATOM   8206  C  C   . ALA C 1 21  ? 53.963  26.922  54.931  1.00 73.52 ? 24   ALA C C   1 
ATOM   8207  O  O   . ALA C 1 21  ? 54.795  27.616  54.342  1.00 73.62 ? 24   ALA C O   1 
ATOM   8208  C  CB  . ALA C 1 21  ? 53.567  27.498  57.336  1.00 74.91 ? 24   ALA C CB  1 
ATOM   8209  N  N   . ASP C 1 22  ? 52.849  26.490  54.356  1.00 72.02 ? 25   ASP C N   1 
ATOM   8210  C  CA  . ASP C 1 22  ? 52.520  26.829  52.984  1.00 70.45 ? 25   ASP C CA  1 
ATOM   8211  C  C   . ASP C 1 22  ? 52.221  28.308  52.873  1.00 69.20 ? 25   ASP C C   1 
ATOM   8212  O  O   . ASP C 1 22  ? 51.813  28.949  53.844  1.00 68.82 ? 25   ASP C O   1 
ATOM   8213  C  CB  . ASP C 1 22  ? 51.289  26.049  52.517  1.00 71.14 ? 25   ASP C CB  1 
ATOM   8214  C  CG  . ASP C 1 22  ? 51.487  24.545  52.574  1.00 71.48 ? 25   ASP C CG  1 
ATOM   8215  O  OD1 . ASP C 1 22  ? 50.876  23.878  53.440  1.00 71.96 ? 25   ASP C OD1 1 
ATOM   8216  O  OD2 . ASP C 1 22  ? 52.253  24.026  51.744  1.00 71.45 ? 25   ASP C OD2 1 
ATOM   8217  N  N   . VAL C 1 23  ? 52.425  28.842  51.676  1.00 67.78 ? 26   VAL C N   1 
ATOM   8218  C  CA  . VAL C 1 23  ? 52.157  30.240  51.401  1.00 66.25 ? 26   VAL C CA  1 
ATOM   8219  C  C   . VAL C 1 23  ? 50.646  30.372  51.316  1.00 65.53 ? 26   VAL C C   1 
ATOM   8220  O  O   . VAL C 1 23  ? 49.981  29.553  50.679  1.00 65.47 ? 26   VAL C O   1 
ATOM   8221  C  CB  . VAL C 1 23  ? 52.759  30.661  50.052  1.00 66.00 ? 26   VAL C CB  1 
ATOM   8222  C  CG1 . VAL C 1 23  ? 52.502  32.129  49.799  1.00 65.39 ? 26   VAL C CG1 1 
ATOM   8223  C  CG2 . VAL C 1 23  ? 54.247  30.366  50.021  1.00 65.42 ? 26   VAL C CG2 1 
ATOM   8224  N  N   . LEU C 1 24  ? 50.099  31.362  52.010  1.00 64.50 ? 27   LEU C N   1 
ATOM   8225  C  CA  . LEU C 1 24  ? 48.661  31.598  51.985  1.00 63.35 ? 27   LEU C CA  1 
ATOM   8226  C  C   . LEU C 1 24  ? 48.330  32.196  50.621  1.00 62.93 ? 27   LEU C C   1 
ATOM   8227  O  O   . LEU C 1 24  ? 48.979  33.143  50.186  1.00 62.72 ? 27   LEU C O   1 
ATOM   8228  C  CB  . LEU C 1 24  ? 48.274  32.553  53.116  1.00 62.71 ? 27   LEU C CB  1 
ATOM   8229  C  CG  . LEU C 1 24  ? 46.831  33.033  53.252  1.00 61.82 ? 27   LEU C CG  1 
ATOM   8230  C  CD1 . LEU C 1 24  ? 45.882  31.904  52.997  1.00 61.89 ? 27   LEU C CD1 1 
ATOM   8231  C  CD2 . LEU C 1 24  ? 46.621  33.591  54.640  1.00 61.33 ? 27   LEU C CD2 1 
ATOM   8232  N  N   . THR C 1 25  ? 47.344  31.625  49.936  1.00 62.53 ? 28   THR C N   1 
ATOM   8233  C  CA  . THR C 1 25  ? 46.971  32.108  48.610  1.00 62.15 ? 28   THR C CA  1 
ATOM   8234  C  C   . THR C 1 25  ? 45.467  32.287  48.399  1.00 62.13 ? 28   THR C C   1 
ATOM   8235  O  O   . THR C 1 25  ? 44.654  31.908  49.243  1.00 61.99 ? 28   THR C O   1 
ATOM   8236  C  CB  . THR C 1 25  ? 47.479  31.146  47.499  1.00 62.28 ? 28   THR C CB  1 
ATOM   8237  O  OG1 . THR C 1 25  ? 46.774  29.898  47.577  1.00 61.74 ? 28   THR C OG1 1 
ATOM   8238  C  CG2 . THR C 1 25  ? 48.967  30.881  47.650  1.00 61.96 ? 28   THR C CG2 1 
ATOM   8239  N  N   . THR C 1 26  ? 45.116  32.888  47.263  1.00 62.08 ? 29   THR C N   1 
ATOM   8240  C  CA  . THR C 1 26  ? 43.721  33.094  46.877  1.00 61.95 ? 29   THR C CA  1 
ATOM   8241  C  C   . THR C 1 26  ? 43.272  31.812  46.195  1.00 62.34 ? 29   THR C C   1 
ATOM   8242  O  O   . THR C 1 26  ? 44.090  30.939  45.903  1.00 62.80 ? 29   THR C O   1 
ATOM   8243  C  CB  . THR C 1 26  ? 43.576  34.211  45.831  1.00 61.42 ? 29   THR C CB  1 
ATOM   8244  O  OG1 . THR C 1 26  ? 44.367  33.886  44.678  1.00 61.39 ? 29   THR C OG1 1 
ATOM   8245  C  CG2 . THR C 1 26  ? 44.013  35.544  46.400  1.00 60.80 ? 29   THR C CG2 1 
ATOM   8246  N  N   . GLY C 1 27  ? 41.988  31.726  45.875  1.00 62.52 ? 30   GLY C N   1 
ATOM   8247  C  CA  . GLY C 1 27  ? 41.487  30.541  45.207  1.00 62.48 ? 30   GLY C CA  1 
ATOM   8248  C  C   . GLY C 1 27  ? 42.191  30.298  43.885  1.00 62.62 ? 30   GLY C C   1 
ATOM   8249  O  O   . GLY C 1 27  ? 42.146  29.184  43.365  1.00 62.96 ? 30   GLY C O   1 
ATOM   8250  N  N   . ALA C 1 28  ? 42.853  31.327  43.351  1.00 62.38 ? 31   ALA C N   1 
ATOM   8251  C  CA  . ALA C 1 28  ? 43.565  31.217  42.076  1.00 61.83 ? 31   ALA C CA  1 
ATOM   8252  C  C   . ALA C 1 28  ? 45.057  30.983  42.241  1.00 61.62 ? 31   ALA C C   1 
ATOM   8253  O  O   . ALA C 1 28  ? 45.817  31.063  41.274  1.00 61.67 ? 31   ALA C O   1 
ATOM   8254  C  CB  . ALA C 1 28  ? 43.330  32.450  41.233  1.00 61.99 ? 31   ALA C CB  1 
ATOM   8255  N  N   . GLY C 1 29  ? 45.481  30.719  43.470  1.00 61.44 ? 32   GLY C N   1 
ATOM   8256  C  CA  . GLY C 1 29  ? 46.885  30.468  43.721  1.00 61.38 ? 32   GLY C CA  1 
ATOM   8257  C  C   . GLY C 1 29  ? 47.754  31.703  43.802  1.00 61.48 ? 32   GLY C C   1 
ATOM   8258  O  O   . GLY C 1 29  ? 48.977  31.595  43.791  1.00 61.40 ? 32   GLY C O   1 
ATOM   8259  N  N   . ASN C 1 30  ? 47.147  32.881  43.833  1.00 61.79 ? 33   ASN C N   1 
ATOM   8260  C  CA  . ASN C 1 30  ? 47.934  34.100  43.941  1.00 62.27 ? 33   ASN C CA  1 
ATOM   8261  C  C   . ASN C 1 30  ? 48.322  34.267  45.408  1.00 62.41 ? 33   ASN C C   1 
ATOM   8262  O  O   . ASN C 1 30  ? 47.485  34.121  46.290  1.00 62.69 ? 33   ASN C O   1 
ATOM   8263  C  CB  . ASN C 1 30  ? 47.120  35.308  43.471  1.00 62.56 ? 33   ASN C CB  1 
ATOM   8264  C  CG  . ASN C 1 30  ? 46.631  35.164  42.039  1.00 63.03 ? 33   ASN C CG  1 
ATOM   8265  O  OD1 . ASN C 1 30  ? 45.468  35.430  41.739  1.00 63.11 ? 33   ASN C OD1 1 
ATOM   8266  N  ND2 . ASN C 1 30  ? 47.520  34.746  41.147  1.00 63.60 ? 33   ASN C ND2 1 
ATOM   8267  N  N   . PRO C 1 31  ? 49.608  34.521  45.690  1.00 62.34 ? 34   PRO C N   1 
ATOM   8268  C  CA  . PRO C 1 31  ? 50.080  34.701  47.067  1.00 62.16 ? 34   PRO C CA  1 
ATOM   8269  C  C   . PRO C 1 31  ? 49.458  35.936  47.702  1.00 62.03 ? 34   PRO C C   1 
ATOM   8270  O  O   . PRO C 1 31  ? 49.266  36.942  47.021  1.00 62.04 ? 34   PRO C O   1 
ATOM   8271  C  CB  . PRO C 1 31  ? 51.582  34.896  46.881  1.00 62.12 ? 34   PRO C CB  1 
ATOM   8272  C  CG  . PRO C 1 31  ? 51.879  34.126  45.632  1.00 62.45 ? 34   PRO C CG  1 
ATOM   8273  C  CD  . PRO C 1 31  ? 50.737  34.536  44.749  1.00 62.49 ? 34   PRO C CD  1 
ATOM   8274  N  N   . VAL C 1 32  ? 49.143  35.847  48.998  1.00 62.12 ? 35   VAL C N   1 
ATOM   8275  C  CA  . VAL C 1 32  ? 48.550  36.950  49.760  1.00 62.05 ? 35   VAL C CA  1 
ATOM   8276  C  C   . VAL C 1 32  ? 49.578  37.578  50.696  1.00 62.07 ? 35   VAL C C   1 
ATOM   8277  O  O   . VAL C 1 32  ? 50.248  36.875  51.456  1.00 62.03 ? 35   VAL C O   1 
ATOM   8278  C  CB  . VAL C 1 32  ? 47.380  36.476  50.630  1.00 62.19 ? 35   VAL C CB  1 
ATOM   8279  C  CG1 . VAL C 1 32  ? 46.762  37.658  51.373  1.00 61.89 ? 35   VAL C CG1 1 
ATOM   8280  C  CG2 . VAL C 1 32  ? 46.346  35.773  49.781  1.00 62.21 ? 35   VAL C CG2 1 
ATOM   8281  N  N   . GLY C 1 33  ? 49.658  38.905  50.674  1.00 62.06 ? 36   GLY C N   1 
ATOM   8282  C  CA  . GLY C 1 33  ? 50.614  39.606  51.511  1.00 62.04 ? 36   GLY C CA  1 
ATOM   8283  C  C   . GLY C 1 33  ? 50.164  39.803  52.939  1.00 62.09 ? 36   GLY C C   1 
ATOM   8284  O  O   . GLY C 1 33  ? 50.951  39.664  53.880  1.00 62.06 ? 36   GLY C O   1 
ATOM   8285  N  N   . ASP C 1 34  ? 48.886  40.110  53.105  1.00 62.47 ? 37   ASP C N   1 
ATOM   8286  C  CA  . ASP C 1 34  ? 48.335  40.336  54.427  1.00 63.09 ? 37   ASP C CA  1 
ATOM   8287  C  C   . ASP C 1 34  ? 46.852  40.017  54.430  1.00 63.01 ? 37   ASP C C   1 
ATOM   8288  O  O   . ASP C 1 34  ? 46.041  40.814  53.965  1.00 63.26 ? 37   ASP C O   1 
ATOM   8289  C  CB  . ASP C 1 34  ? 48.575  41.793  54.836  1.00 63.29 ? 37   ASP C CB  1 
ATOM   8290  C  CG  . ASP C 1 34  ? 47.860  42.178  56.122  1.00 63.64 ? 37   ASP C CG  1 
ATOM   8291  O  OD1 . ASP C 1 34  ? 47.486  41.276  56.910  1.00 64.22 ? 37   ASP C OD1 1 
ATOM   8292  O  OD2 . ASP C 1 34  ? 47.674  43.397  56.343  1.00 63.48 ? 37   ASP C OD2 1 
ATOM   8293  N  N   . LYS C 1 35  ? 46.500  38.849  54.954  1.00 63.20 ? 38   LYS C N   1 
ATOM   8294  C  CA  . LYS C 1 35  ? 45.098  38.458  55.014  1.00 63.27 ? 38   LYS C CA  1 
ATOM   8295  C  C   . LYS C 1 35  ? 44.504  38.849  56.360  1.00 63.53 ? 38   LYS C C   1 
ATOM   8296  O  O   . LYS C 1 35  ? 43.470  38.314  56.772  1.00 63.85 ? 38   LYS C O   1 
ATOM   8297  C  CB  . LYS C 1 35  ? 44.925  36.950  54.789  1.00 62.74 ? 38   LYS C CB  1 
ATOM   8298  C  CG  . LYS C 1 35  ? 43.642  36.600  54.022  1.00 62.12 ? 38   LYS C CG  1 
ATOM   8299  C  CD  . LYS C 1 35  ? 43.251  35.141  54.146  1.00 61.17 ? 38   LYS C CD  1 
ATOM   8300  C  CE  . LYS C 1 35  ? 42.789  34.850  55.555  1.00 61.04 ? 38   LYS C CE  1 
ATOM   8301  N  NZ  . LYS C 1 35  ? 41.711  35.792  55.989  1.00 60.54 ? 38   LYS C NZ  1 
ATOM   8302  N  N   . LEU C 1 36  ? 45.149  39.787  57.043  1.00 63.47 ? 39   LEU C N   1 
ATOM   8303  C  CA  . LEU C 1 36  ? 44.660  40.218  58.342  1.00 63.51 ? 39   LEU C CA  1 
ATOM   8304  C  C   . LEU C 1 36  ? 44.088  41.621  58.352  1.00 63.72 ? 39   LEU C C   1 
ATOM   8305  O  O   . LEU C 1 36  ? 43.561  42.070  59.369  1.00 64.01 ? 39   LEU C O   1 
ATOM   8306  C  CB  . LEU C 1 36  ? 45.761  40.093  59.384  1.00 63.71 ? 39   LEU C CB  1 
ATOM   8307  C  CG  . LEU C 1 36  ? 46.167  38.645  59.625  1.00 63.85 ? 39   LEU C CG  1 
ATOM   8308  C  CD1 . LEU C 1 36  ? 47.293  38.579  60.641  1.00 63.87 ? 39   LEU C CD1 1 
ATOM   8309  C  CD2 . LEU C 1 36  ? 44.949  37.868  60.110  1.00 63.66 ? 39   LEU C CD2 1 
ATOM   8310  N  N   . ASN C 1 37  ? 44.194  42.317  57.225  1.00 63.39 ? 40   ASN C N   1 
ATOM   8311  C  CA  . ASN C 1 37  ? 43.674  43.674  57.114  1.00 62.68 ? 40   ASN C CA  1 
ATOM   8312  C  C   . ASN C 1 37  ? 43.168  43.913  55.706  1.00 62.51 ? 40   ASN C C   1 
ATOM   8313  O  O   . ASN C 1 37  ? 43.759  43.455  54.722  1.00 62.33 ? 40   ASN C O   1 
ATOM   8314  C  CB  . ASN C 1 37  ? 44.743  44.704  57.470  1.00 62.62 ? 40   ASN C CB  1 
ATOM   8315  C  CG  . ASN C 1 37  ? 45.224  44.574  58.898  1.00 62.61 ? 40   ASN C CG  1 
ATOM   8316  O  OD1 . ASN C 1 37  ? 46.281  44.003  59.161  1.00 62.88 ? 40   ASN C OD1 1 
ATOM   8317  N  ND2 . ASN C 1 37  ? 44.437  45.080  59.832  1.00 62.68 ? 40   ASN C ND2 1 
ATOM   8318  N  N   . VAL C 1 38  ? 42.067  44.644  55.625  1.00 62.22 ? 41   VAL C N   1 
ATOM   8319  C  CA  . VAL C 1 38  ? 41.421  44.962  54.364  1.00 61.75 ? 41   VAL C CA  1 
ATOM   8320  C  C   . VAL C 1 38  ? 41.985  46.259  53.771  1.00 61.49 ? 41   VAL C C   1 
ATOM   8321  O  O   . VAL C 1 38  ? 42.596  47.049  54.491  1.00 61.44 ? 41   VAL C O   1 
ATOM   8322  C  CB  . VAL C 1 38  ? 39.897  45.047  54.603  1.00 61.62 ? 41   VAL C CB  1 
ATOM   8323  C  CG1 . VAL C 1 38  ? 39.387  46.470  54.484  1.00 61.21 ? 41   VAL C CG1 1 
ATOM   8324  C  CG2 . VAL C 1 38  ? 39.172  44.091  53.694  1.00 61.42 ? 41   VAL C CG2 1 
ATOM   8325  N  N   . ILE C 1 39  ? 41.801  46.469  52.467  1.00 61.22 ? 42   ILE C N   1 
ATOM   8326  C  CA  . ILE C 1 39  ? 42.316  47.679  51.822  1.00 61.31 ? 42   ILE C CA  1 
ATOM   8327  C  C   . ILE C 1 39  ? 41.376  48.876  51.891  1.00 61.47 ? 42   ILE C C   1 
ATOM   8328  O  O   . ILE C 1 39  ? 40.315  48.880  51.258  1.00 61.97 ? 42   ILE C O   1 
ATOM   8329  C  CB  . ILE C 1 39  ? 42.636  47.463  50.333  1.00 60.90 ? 42   ILE C CB  1 
ATOM   8330  C  CG1 . ILE C 1 39  ? 43.689  46.378  50.156  1.00 60.64 ? 42   ILE C CG1 1 
ATOM   8331  C  CG2 . ILE C 1 39  ? 43.150  48.756  49.723  1.00 60.65 ? 42   ILE C CG2 1 
ATOM   8332  C  CD1 . ILE C 1 39  ? 44.085  46.162  48.704  1.00 60.36 ? 42   ILE C CD1 1 
ATOM   8333  N  N   . THR C 1 40  ? 41.780  49.908  52.621  1.00 61.38 ? 43   THR C N   1 
ATOM   8334  C  CA  . THR C 1 40  ? 40.967  51.108  52.716  1.00 61.21 ? 43   THR C CA  1 
ATOM   8335  C  C   . THR C 1 40  ? 41.759  52.286  52.218  1.00 61.38 ? 43   THR C C   1 
ATOM   8336  O  O   . THR C 1 40  ? 42.992  52.247  52.163  1.00 61.50 ? 43   THR C O   1 
ATOM   8337  C  CB  . THR C 1 40  ? 40.565  51.446  54.151  1.00 61.33 ? 43   THR C CB  1 
ATOM   8338  O  OG1 . THR C 1 40  ? 41.741  51.671  54.937  1.00 61.48 ? 43   THR C OG1 1 
ATOM   8339  C  CG2 . THR C 1 40  ? 39.742  50.337  54.754  1.00 61.40 ? 43   THR C CG2 1 
ATOM   8340  N  N   . VAL C 1 41  ? 41.039  53.330  51.836  1.00 61.66 ? 44   VAL C N   1 
ATOM   8341  C  CA  . VAL C 1 41  ? 41.669  54.552  51.375  1.00 61.89 ? 44   VAL C CA  1 
ATOM   8342  C  C   . VAL C 1 41  ? 41.935  55.349  52.649  1.00 62.12 ? 44   VAL C C   1 
ATOM   8343  O  O   . VAL C 1 41  ? 41.067  56.069  53.146  1.00 62.30 ? 44   VAL C O   1 
ATOM   8344  C  CB  . VAL C 1 41  ? 40.751  55.328  50.395  1.00 61.67 ? 44   VAL C CB  1 
ATOM   8345  C  CG1 . VAL C 1 41  ? 39.337  55.452  50.950  1.00 61.50 ? 44   VAL C CG1 1 
ATOM   8346  C  CG2 . VAL C 1 41  ? 41.331  56.693  50.106  1.00 61.59 ? 44   VAL C CG2 1 
ATOM   8347  N  N   . GLY C 1 42  ? 43.127  55.168  53.209  1.00 62.11 ? 45   GLY C N   1 
ATOM   8348  C  CA  . GLY C 1 42  ? 43.464  55.849  54.442  1.00 61.81 ? 45   GLY C CA  1 
ATOM   8349  C  C   . GLY C 1 42  ? 42.997  54.998  55.609  1.00 61.51 ? 45   GLY C C   1 
ATOM   8350  O  O   . GLY C 1 42  ? 42.080  54.189  55.457  1.00 61.51 ? 45   GLY C O   1 
ATOM   8351  N  N   . PRO C 1 43  ? 43.620  55.151  56.785  1.00 61.23 ? 46   PRO C N   1 
ATOM   8352  C  CA  . PRO C 1 43  ? 43.308  54.417  58.013  1.00 60.88 ? 46   PRO C CA  1 
ATOM   8353  C  C   . PRO C 1 43  ? 41.821  54.349  58.327  1.00 60.49 ? 46   PRO C C   1 
ATOM   8354  O  O   . PRO C 1 43  ? 41.307  53.294  58.690  1.00 60.59 ? 46   PRO C O   1 
ATOM   8355  C  CB  . PRO C 1 43  ? 44.054  55.218  59.075  1.00 60.95 ? 46   PRO C CB  1 
ATOM   8356  C  CG  . PRO C 1 43  ? 45.270  55.658  58.353  1.00 61.12 ? 46   PRO C CG  1 
ATOM   8357  C  CD  . PRO C 1 43  ? 44.704  56.121  57.023  1.00 61.30 ? 46   PRO C CD  1 
ATOM   8358  N  N   . ARG C 1 44  ? 41.131  55.476  58.201  1.00 59.96 ? 47   ARG C N   1 
ATOM   8359  C  CA  . ARG C 1 44  ? 39.707  55.509  58.499  1.00 59.44 ? 47   ARG C CA  1 
ATOM   8360  C  C   . ARG C 1 44  ? 38.854  55.798  57.272  1.00 59.31 ? 47   ARG C C   1 
ATOM   8361  O  O   . ARG C 1 44  ? 37.824  56.480  57.362  1.00 59.44 ? 47   ARG C O   1 
ATOM   8362  C  CB  . ARG C 1 44  ? 39.423  56.502  59.632  1.00 59.16 ? 47   ARG C CB  1 
ATOM   8363  C  CG  . ARG C 1 44  ? 40.209  56.178  60.896  1.00 58.74 ? 47   ARG C CG  1 
ATOM   8364  C  CD  . ARG C 1 44  ? 39.723  56.940  62.117  1.00 58.68 ? 47   ARG C CD  1 
ATOM   8365  N  NE  . ARG C 1 44  ? 40.490  56.554  63.300  1.00 58.64 ? 47   ARG C NE  1 
ATOM   8366  C  CZ  . ARG C 1 44  ? 40.464  57.191  64.468  1.00 58.76 ? 47   ARG C CZ  1 
ATOM   8367  N  NH1 . ARG C 1 44  ? 41.207  56.753  65.475  1.00 58.80 ? 47   ARG C NH1 1 
ATOM   8368  N  NH2 . ARG C 1 44  ? 39.692  58.252  64.642  1.00 59.00 ? 47   ARG C NH2 1 
ATOM   8369  N  N   . GLY C 1 45  ? 39.282  55.256  56.133  1.00 59.10 ? 48   GLY C N   1 
ATOM   8370  C  CA  . GLY C 1 45  ? 38.550  55.438  54.895  1.00 58.57 ? 48   GLY C CA  1 
ATOM   8371  C  C   . GLY C 1 45  ? 37.790  54.178  54.532  1.00 58.63 ? 48   GLY C C   1 
ATOM   8372  O  O   . GLY C 1 45  ? 38.027  53.122  55.119  1.00 58.78 ? 48   GLY C O   1 
ATOM   8373  N  N   . PRO C 1 46  ? 36.880  54.255  53.550  1.00 58.33 ? 49   PRO C N   1 
ATOM   8374  C  CA  . PRO C 1 46  ? 36.039  53.167  53.042  1.00 58.12 ? 49   PRO C CA  1 
ATOM   8375  C  C   . PRO C 1 46  ? 36.808  52.060  52.374  1.00 57.99 ? 49   PRO C C   1 
ATOM   8376  O  O   . PRO C 1 46  ? 37.932  52.251  51.916  1.00 57.98 ? 49   PRO C O   1 
ATOM   8377  C  CB  . PRO C 1 46  ? 35.158  53.865  52.022  1.00 58.16 ? 49   PRO C CB  1 
ATOM   8378  C  CG  . PRO C 1 46  ? 35.074  55.244  52.556  1.00 58.58 ? 49   PRO C CG  1 
ATOM   8379  C  CD  . PRO C 1 46  ? 36.496  55.525  52.927  1.00 58.35 ? 49   PRO C CD  1 
ATOM   8380  N  N   . LEU C 1 47  ? 36.145  50.919  52.255  1.00 57.78 ? 50   LEU C N   1 
ATOM   8381  C  CA  . LEU C 1 47  ? 36.717  49.729  51.656  1.00 57.57 ? 50   LEU C CA  1 
ATOM   8382  C  C   . LEU C 1 47  ? 36.787  49.842  50.146  1.00 57.76 ? 50   LEU C C   1 
ATOM   8383  O  O   . LEU C 1 47  ? 35.956  50.501  49.531  1.00 57.91 ? 50   LEU C O   1 
ATOM   8384  C  CB  . LEU C 1 47  ? 35.866  48.532  52.060  1.00 56.93 ? 50   LEU C CB  1 
ATOM   8385  C  CG  . LEU C 1 47  ? 36.111  47.167  51.445  1.00 56.23 ? 50   LEU C CG  1 
ATOM   8386  C  CD1 . LEU C 1 47  ? 37.557  46.762  51.563  1.00 56.22 ? 50   LEU C CD1 1 
ATOM   8387  C  CD2 . LEU C 1 47  ? 35.232  46.193  52.171  1.00 56.02 ? 50   LEU C CD2 1 
ATOM   8388  N  N   . LEU C 1 48  ? 37.777  49.191  49.551  1.00 58.19 ? 51   LEU C N   1 
ATOM   8389  C  CA  . LEU C 1 48  ? 37.930  49.237  48.109  1.00 58.78 ? 51   LEU C CA  1 
ATOM   8390  C  C   . LEU C 1 48  ? 37.619  47.941  47.415  1.00 59.25 ? 51   LEU C C   1 
ATOM   8391  O  O   . LEU C 1 48  ? 37.981  46.864  47.890  1.00 59.40 ? 51   LEU C O   1 
ATOM   8392  C  CB  . LEU C 1 48  ? 39.332  49.671  47.720  1.00 58.79 ? 51   LEU C CB  1 
ATOM   8393  C  CG  . LEU C 1 48  ? 39.522  51.174  47.848  1.00 59.04 ? 51   LEU C CG  1 
ATOM   8394  C  CD1 . LEU C 1 48  ? 39.717  51.542  49.299  1.00 59.26 ? 51   LEU C CD1 1 
ATOM   8395  C  CD2 . LEU C 1 48  ? 40.719  51.586  47.052  1.00 59.29 ? 51   LEU C CD2 1 
ATOM   8396  N  N   . VAL C 1 49  ? 36.976  48.061  46.260  1.00 59.96 ? 52   VAL C N   1 
ATOM   8397  C  CA  . VAL C 1 49  ? 36.624  46.905  45.454  1.00 60.70 ? 52   VAL C CA  1 
ATOM   8398  C  C   . VAL C 1 49  ? 37.895  46.161  45.046  1.00 61.39 ? 52   VAL C C   1 
ATOM   8399  O  O   . VAL C 1 49  ? 37.901  44.935  44.976  1.00 61.44 ? 52   VAL C O   1 
ATOM   8400  C  CB  . VAL C 1 49  ? 35.826  47.325  44.203  1.00 60.70 ? 52   VAL C CB  1 
ATOM   8401  C  CG1 . VAL C 1 49  ? 35.811  46.208  43.180  1.00 60.60 ? 52   VAL C CG1 1 
ATOM   8402  C  CG2 . VAL C 1 49  ? 34.399  47.675  44.593  1.00 60.35 ? 52   VAL C CG2 1 
ATOM   8403  N  N   . GLN C 1 50  ? 38.981  46.903  44.836  1.00 61.76 ? 53   GLN C N   1 
ATOM   8404  C  CA  . GLN C 1 50  ? 40.265  46.313  44.452  1.00 62.11 ? 53   GLN C CA  1 
ATOM   8405  C  C   . GLN C 1 50  ? 40.705  45.194  45.368  1.00 62.20 ? 53   GLN C C   1 
ATOM   8406  O  O   . GLN C 1 50  ? 41.547  44.383  44.981  1.00 62.55 ? 53   GLN C O   1 
ATOM   8407  C  CB  . GLN C 1 50  ? 41.374  47.353  44.471  1.00 62.60 ? 53   GLN C CB  1 
ATOM   8408  C  CG  . GLN C 1 50  ? 41.323  48.336  43.353  1.00 63.49 ? 53   GLN C CG  1 
ATOM   8409  C  CD  . GLN C 1 50  ? 42.436  49.357  43.437  1.00 64.00 ? 53   GLN C CD  1 
ATOM   8410  O  OE1 . GLN C 1 50  ? 43.374  49.224  44.235  1.00 63.63 ? 53   GLN C OE1 1 
ATOM   8411  N  NE2 . GLN C 1 50  ? 42.338  50.389  42.613  1.00 64.63 ? 53   GLN C NE2 1 
ATOM   8412  N  N   . ASP C 1 51  ? 40.207  45.193  46.603  1.00 61.81 ? 54   ASP C N   1 
ATOM   8413  C  CA  . ASP C 1 51  ? 40.594  44.151  47.532  1.00 61.43 ? 54   ASP C CA  1 
ATOM   8414  C  C   . ASP C 1 51  ? 39.905  42.849  47.180  1.00 61.40 ? 54   ASP C C   1 
ATOM   8415  O  O   . ASP C 1 51  ? 38.968  42.419  47.854  1.00 61.54 ? 54   ASP C O   1 
ATOM   8416  C  CB  . ASP C 1 51  ? 40.292  44.541  48.973  1.00 61.31 ? 54   ASP C CB  1 
ATOM   8417  C  CG  . ASP C 1 51  ? 41.016  43.652  49.972  1.00 61.07 ? 54   ASP C CG  1 
ATOM   8418  O  OD1 . ASP C 1 51  ? 41.176  44.078  51.130  1.00 61.43 ? 54   ASP C OD1 1 
ATOM   8419  O  OD2 . ASP C 1 51  ? 41.438  42.534  49.604  1.00 60.65 ? 54   ASP C OD2 1 
ATOM   8420  N  N   . VAL C 1 52  ? 40.405  42.212  46.129  1.00 61.25 ? 55   VAL C N   1 
ATOM   8421  C  CA  . VAL C 1 52  ? 39.865  40.949  45.645  1.00 61.00 ? 55   VAL C CA  1 
ATOM   8422  C  C   . VAL C 1 52  ? 40.213  39.797  46.578  1.00 60.82 ? 55   VAL C C   1 
ATOM   8423  O  O   . VAL C 1 52  ? 39.556  38.755  46.563  1.00 60.52 ? 55   VAL C O   1 
ATOM   8424  C  CB  . VAL C 1 52  ? 40.377  40.651  44.228  1.00 60.95 ? 55   VAL C CB  1 
ATOM   8425  C  CG1 . VAL C 1 52  ? 39.972  41.776  43.289  1.00 60.58 ? 55   VAL C CG1 1 
ATOM   8426  C  CG2 . VAL C 1 52  ? 41.881  40.514  44.237  1.00 60.91 ? 55   VAL C CG2 1 
ATOM   8427  N  N   . VAL C 1 53  ? 41.260  39.985  47.377  1.00 60.60 ? 56   VAL C N   1 
ATOM   8428  C  CA  . VAL C 1 53  ? 41.674  38.967  48.335  1.00 60.37 ? 56   VAL C CA  1 
ATOM   8429  C  C   . VAL C 1 53  ? 40.518  38.786  49.294  1.00 60.05 ? 56   VAL C C   1 
ATOM   8430  O  O   . VAL C 1 53  ? 40.094  37.674  49.598  1.00 60.16 ? 56   VAL C O   1 
ATOM   8431  C  CB  . VAL C 1 53  ? 42.892  39.432  49.163  1.00 60.90 ? 56   VAL C CB  1 
ATOM   8432  C  CG1 . VAL C 1 53  ? 43.185  38.438  50.296  1.00 60.73 ? 56   VAL C CG1 1 
ATOM   8433  C  CG2 . VAL C 1 53  ? 44.110  39.590  48.268  1.00 61.04 ? 56   VAL C CG2 1 
ATOM   8434  N  N   . PHE C 1 54  ? 40.017  39.911  49.770  1.00 59.66 ? 57   PHE C N   1 
ATOM   8435  C  CA  . PHE C 1 54  ? 38.913  39.918  50.693  1.00 59.34 ? 57   PHE C CA  1 
ATOM   8436  C  C   . PHE C 1 54  ? 37.682  39.303  50.054  1.00 59.44 ? 57   PHE C C   1 
ATOM   8437  O  O   . PHE C 1 54  ? 37.086  38.362  50.586  1.00 59.30 ? 57   PHE C O   1 
ATOM   8438  C  CB  . PHE C 1 54  ? 38.613  41.350  51.088  1.00 59.31 ? 57   PHE C CB  1 
ATOM   8439  C  CG  . PHE C 1 54  ? 37.311  41.504  51.770  1.00 59.13 ? 57   PHE C CG  1 
ATOM   8440  C  CD1 . PHE C 1 54  ? 37.175  41.144  53.102  1.00 59.17 ? 57   PHE C CD1 1 
ATOM   8441  C  CD2 . PHE C 1 54  ? 36.197  41.940  51.064  1.00 59.33 ? 57   PHE C CD2 1 
ATOM   8442  C  CE1 . PHE C 1 54  ? 35.950  41.210  53.724  1.00 59.07 ? 57   PHE C CE1 1 
ATOM   8443  C  CE2 . PHE C 1 54  ? 34.962  42.010  51.675  1.00 59.20 ? 57   PHE C CE2 1 
ATOM   8444  C  CZ  . PHE C 1 54  ? 34.835  41.643  53.010  1.00 59.15 ? 57   PHE C CZ  1 
ATOM   8445  N  N   . THR C 1 55  ? 37.283  39.872  48.923  1.00 59.44 ? 58   THR C N   1 
ATOM   8446  C  CA  . THR C 1 55  ? 36.117  39.398  48.198  1.00 59.64 ? 58   THR C CA  1 
ATOM   8447  C  C   . THR C 1 55  ? 36.230  37.914  47.921  1.00 59.54 ? 58   THR C C   1 
ATOM   8448  O  O   . THR C 1 55  ? 35.344  37.150  48.273  1.00 59.78 ? 58   THR C O   1 
ATOM   8449  C  CB  . THR C 1 55  ? 35.960  40.134  46.876  1.00 59.94 ? 58   THR C CB  1 
ATOM   8450  O  OG1 . THR C 1 55  ? 35.800  41.536  47.131  1.00 60.23 ? 58   THR C OG1 1 
ATOM   8451  C  CG2 . THR C 1 55  ? 34.750  39.612  46.127  1.00 59.96 ? 58   THR C CG2 1 
ATOM   8452  N  N   . ASP C 1 56  ? 37.337  37.506  47.314  1.00 59.56 ? 59   ASP C N   1 
ATOM   8453  C  CA  . ASP C 1 56  ? 37.554  36.103  47.006  1.00 59.62 ? 59   ASP C CA  1 
ATOM   8454  C  C   . ASP C 1 56  ? 37.316  35.207  48.218  1.00 59.69 ? 59   ASP C C   1 
ATOM   8455  O  O   . ASP C 1 56  ? 36.687  34.155  48.101  1.00 59.83 ? 59   ASP C O   1 
ATOM   8456  C  CB  . ASP C 1 56  ? 38.970  35.883  46.489  1.00 59.64 ? 59   ASP C CB  1 
ATOM   8457  C  CG  . ASP C 1 56  ? 39.272  34.426  46.253  1.00 59.75 ? 59   ASP C CG  1 
ATOM   8458  O  OD1 . ASP C 1 56  ? 39.977  33.809  47.080  1.00 59.92 ? 59   ASP C OD1 1 
ATOM   8459  O  OD2 . ASP C 1 56  ? 38.784  33.886  45.244  1.00 60.31 ? 59   ASP C OD2 1 
ATOM   8460  N  N   . GLU C 1 57  ? 37.833  35.604  49.377  1.00 59.71 ? 60   GLU C N   1 
ATOM   8461  C  CA  . GLU C 1 57  ? 37.649  34.797  50.574  1.00 59.67 ? 60   GLU C CA  1 
ATOM   8462  C  C   . GLU C 1 57  ? 36.224  34.879  51.077  1.00 59.76 ? 60   GLU C C   1 
ATOM   8463  O  O   . GLU C 1 57  ? 35.604  33.854  51.368  1.00 59.98 ? 60   GLU C O   1 
ATOM   8464  C  CB  . GLU C 1 57  ? 38.605  35.214  51.688  1.00 59.68 ? 60   GLU C CB  1 
ATOM   8465  C  CG  . GLU C 1 57  ? 38.365  34.441  52.982  1.00 59.94 ? 60   GLU C CG  1 
ATOM   8466  C  CD  . GLU C 1 57  ? 39.399  34.726  54.057  1.00 60.56 ? 60   GLU C CD  1 
ATOM   8467  O  OE1 . GLU C 1 57  ? 39.806  33.767  54.745  1.00 60.66 ? 60   GLU C OE1 1 
ATOM   8468  O  OE2 . GLU C 1 57  ? 39.800  35.898  54.226  1.00 60.93 ? 60   GLU C OE2 1 
ATOM   8469  N  N   . MET C 1 58  ? 35.701  36.097  51.168  1.00 59.72 ? 61   MET C N   1 
ATOM   8470  C  CA  . MET C 1 58  ? 34.342  36.293  51.658  1.00 59.71 ? 61   MET C CA  1 
ATOM   8471  C  C   . MET C 1 58  ? 33.315  35.586  50.786  1.00 59.47 ? 61   MET C C   1 
ATOM   8472  O  O   . MET C 1 58  ? 32.439  34.889  51.296  1.00 59.63 ? 61   MET C O   1 
ATOM   8473  C  CB  . MET C 1 58  ? 34.016  37.783  51.762  1.00 60.03 ? 61   MET C CB  1 
ATOM   8474  C  CG  . MET C 1 58  ? 32.708  38.088  52.489  1.00 60.23 ? 61   MET C CG  1 
ATOM   8475  S  SD  . MET C 1 58  ? 32.598  37.404  54.172  1.00 61.16 ? 61   MET C SD  1 
ATOM   8476  C  CE  . MET C 1 58  ? 33.819  38.386  55.046  1.00 60.66 ? 61   MET C CE  1 
ATOM   8477  N  N   . ALA C 1 59  ? 33.447  35.741  49.473  1.00 59.11 ? 62   ALA C N   1 
ATOM   8478  C  CA  . ALA C 1 59  ? 32.525  35.123  48.531  1.00 58.93 ? 62   ALA C CA  1 
ATOM   8479  C  C   . ALA C 1 59  ? 32.460  33.626  48.727  1.00 59.14 ? 62   ALA C C   1 
ATOM   8480  O  O   . ALA C 1 59  ? 31.402  33.015  48.552  1.00 59.33 ? 62   ALA C O   1 
ATOM   8481  C  CB  . ALA C 1 59  ? 32.933  35.440  47.118  1.00 58.97 ? 62   ALA C CB  1 
ATOM   8482  N  N   . HIS C 1 60  ? 33.592  33.017  49.062  1.00 59.33 ? 63   HIS C N   1 
ATOM   8483  C  CA  . HIS C 1 60  ? 33.574  31.585  49.273  1.00 59.40 ? 63   HIS C CA  1 
ATOM   8484  C  C   . HIS C 1 60  ? 32.883  31.299  50.582  1.00 59.28 ? 63   HIS C C   1 
ATOM   8485  O  O   . HIS C 1 60  ? 32.072  30.385  50.672  1.00 59.61 ? 63   HIS C O   1 
ATOM   8486  C  CB  . HIS C 1 60  ? 34.962  30.961  49.271  1.00 59.63 ? 63   HIS C CB  1 
ATOM   8487  C  CG  . HIS C 1 60  ? 34.920  29.477  49.126  1.00 60.28 ? 63   HIS C CG  1 
ATOM   8488  N  ND1 . HIS C 1 60  ? 34.580  28.640  50.169  1.00 60.71 ? 63   HIS C ND1 1 
ATOM   8489  C  CD2 . HIS C 1 60  ? 35.037  28.684  48.035  1.00 60.45 ? 63   HIS C CD2 1 
ATOM   8490  C  CE1 . HIS C 1 60  ? 34.482  27.400  49.725  1.00 60.67 ? 63   HIS C CE1 1 
ATOM   8491  N  NE2 . HIS C 1 60  ? 34.754  27.399  48.432  1.00 60.62 ? 63   HIS C NE2 1 
ATOM   8492  N  N   . PHE C 1 61  ? 33.205  32.088  51.599  1.00 59.08 ? 64   PHE C N   1 
ATOM   8493  C  CA  . PHE C 1 61  ? 32.584  31.933  52.908  1.00 58.88 ? 64   PHE C CA  1 
ATOM   8494  C  C   . PHE C 1 61  ? 31.066  32.060  52.773  1.00 59.00 ? 64   PHE C C   1 
ATOM   8495  O  O   . PHE C 1 61  ? 30.310  31.285  53.354  1.00 58.94 ? 64   PHE C O   1 
ATOM   8496  C  CB  . PHE C 1 61  ? 33.104  33.008  53.853  1.00 58.42 ? 64   PHE C CB  1 
ATOM   8497  C  CG  . PHE C 1 61  ? 32.402  33.042  55.172  1.00 58.04 ? 64   PHE C CG  1 
ATOM   8498  C  CD1 . PHE C 1 61  ? 32.649  32.072  56.126  1.00 57.91 ? 64   PHE C CD1 1 
ATOM   8499  C  CD2 . PHE C 1 61  ? 31.495  34.051  55.462  1.00 57.99 ? 64   PHE C CD2 1 
ATOM   8500  C  CE1 . PHE C 1 61  ? 32.003  32.103  57.358  1.00 57.82 ? 64   PHE C CE1 1 
ATOM   8501  C  CE2 . PHE C 1 61  ? 30.845  34.092  56.688  1.00 57.90 ? 64   PHE C CE2 1 
ATOM   8502  C  CZ  . PHE C 1 61  ? 31.102  33.114  57.639  1.00 57.81 ? 64   PHE C CZ  1 
ATOM   8503  N  N   . ASP C 1 62  ? 30.627  33.022  51.972  1.00 59.05 ? 65   ASP C N   1 
ATOM   8504  C  CA  . ASP C 1 62  ? 29.204  33.242  51.754  1.00 59.01 ? 65   ASP C CA  1 
ATOM   8505  C  C   . ASP C 1 62  ? 28.551  32.060  51.048  1.00 58.96 ? 65   ASP C C   1 
ATOM   8506  O  O   . ASP C 1 62  ? 27.328  32.025  50.901  1.00 59.15 ? 65   ASP C O   1 
ATOM   8507  C  CB  . ASP C 1 62  ? 28.983  34.505  50.912  1.00 59.24 ? 65   ASP C CB  1 
ATOM   8508  C  CG  . ASP C 1 62  ? 29.422  35.781  51.624  1.00 59.35 ? 65   ASP C CG  1 
ATOM   8509  O  OD1 . ASP C 1 62  ? 29.482  36.849  50.969  1.00 59.42 ? 65   ASP C OD1 1 
ATOM   8510  O  OD2 . ASP C 1 62  ? 29.698  35.727  52.842  1.00 59.62 ? 65   ASP C OD2 1 
ATOM   8511  N  N   . ARG C 1 63  ? 29.355  31.082  50.638  1.00 59.07 ? 66   ARG C N   1 
ATOM   8512  C  CA  . ARG C 1 63  ? 28.839  29.922  49.914  1.00 58.97 ? 66   ARG C CA  1 
ATOM   8513  C  C   . ARG C 1 63  ? 29.239  28.555  50.445  1.00 58.96 ? 66   ARG C C   1 
ATOM   8514  O  O   . ARG C 1 63  ? 29.177  27.581  49.702  1.00 58.84 ? 66   ARG C O   1 
ATOM   8515  C  CB  . ARG C 1 63  ? 29.267  30.001  48.445  1.00 58.81 ? 66   ARG C CB  1 
ATOM   8516  C  CG  . ARG C 1 63  ? 28.710  31.191  47.726  1.00 58.87 ? 66   ARG C CG  1 
ATOM   8517  C  CD  . ARG C 1 63  ? 29.300  31.359  46.351  1.00 59.09 ? 66   ARG C CD  1 
ATOM   8518  N  NE  . ARG C 1 63  ? 28.594  32.418  45.633  1.00 60.00 ? 66   ARG C NE  1 
ATOM   8519  C  CZ  . ARG C 1 63  ? 28.590  33.699  45.998  1.00 60.61 ? 66   ARG C CZ  1 
ATOM   8520  N  NH1 . ARG C 1 63  ? 29.273  34.091  47.069  1.00 60.63 ? 66   ARG C NH1 1 
ATOM   8521  N  NH2 . ARG C 1 63  ? 27.851  34.582  45.331  1.00 59.97 ? 66   ARG C NH2 1 
ATOM   8522  N  N   . GLU C 1 64  ? 29.632  28.440  51.707  1.00 59.08 ? 67   GLU C N   1 
ATOM   8523  C  CA  . GLU C 1 64  ? 30.025  27.114  52.158  1.00 59.70 ? 67   GLU C CA  1 
ATOM   8524  C  C   . GLU C 1 64  ? 28.914  26.149  52.546  1.00 59.62 ? 67   GLU C C   1 
ATOM   8525  O  O   . GLU C 1 64  ? 29.158  24.949  52.657  1.00 59.94 ? 67   GLU C O   1 
ATOM   8526  C  CB  . GLU C 1 64  ? 31.124  27.160  53.226  1.00 60.20 ? 67   GLU C CB  1 
ATOM   8527  C  CG  . GLU C 1 64  ? 31.245  28.438  54.022  1.00 60.66 ? 67   GLU C CG  1 
ATOM   8528  C  CD  . GLU C 1 64  ? 32.398  28.381  55.021  1.00 60.93 ? 67   GLU C CD  1 
ATOM   8529  O  OE1 . GLU C 1 64  ? 32.220  27.797  56.110  1.00 61.08 ? 67   GLU C OE1 1 
ATOM   8530  O  OE2 . GLU C 1 64  ? 33.485  28.920  54.720  1.00 60.90 ? 67   GLU C OE2 1 
ATOM   8531  N  N   . ARG C 1 65  ? 27.687  26.644  52.670  1.00 59.58 ? 68   ARG C N   1 
ATOM   8532  C  CA  . ARG C 1 65  ? 26.555  25.794  53.047  1.00 59.21 ? 68   ARG C CA  1 
ATOM   8533  C  C   . ARG C 1 65  ? 25.732  25.257  51.875  1.00 58.99 ? 68   ARG C C   1 
ATOM   8534  O  O   . ARG C 1 65  ? 25.394  25.991  50.946  1.00 59.03 ? 68   ARG C O   1 
ATOM   8535  C  CB  . ARG C 1 65  ? 25.609  26.552  53.979  1.00 59.19 ? 68   ARG C CB  1 
ATOM   8536  C  CG  . ARG C 1 65  ? 26.255  27.128  55.212  1.00 59.22 ? 68   ARG C CG  1 
ATOM   8537  C  CD  . ARG C 1 65  ? 26.650  26.050  56.198  1.00 59.47 ? 68   ARG C CD  1 
ATOM   8538  N  NE  . ARG C 1 65  ? 27.136  26.656  57.434  1.00 59.73 ? 68   ARG C NE  1 
ATOM   8539  C  CZ  . ARG C 1 65  ? 28.408  26.969  57.667  1.00 60.10 ? 68   ARG C CZ  1 
ATOM   8540  N  NH1 . ARG C 1 65  ? 29.342  26.715  56.755  1.00 60.02 ? 68   ARG C NH1 1 
ATOM   8541  N  NH2 . ARG C 1 65  ? 28.736  27.616  58.776  1.00 59.72 ? 68   ARG C NH2 1 
ATOM   8542  N  N   . ILE C 1 66  ? 25.378  23.978  51.952  1.00 58.51 ? 69   ILE C N   1 
ATOM   8543  C  CA  . ILE C 1 66  ? 24.550  23.331  50.944  1.00 58.33 ? 69   ILE C CA  1 
ATOM   8544  C  C   . ILE C 1 66  ? 23.328  22.797  51.693  1.00 58.33 ? 69   ILE C C   1 
ATOM   8545  O  O   . ILE C 1 66  ? 23.345  22.691  52.918  1.00 58.46 ? 69   ILE C O   1 
ATOM   8546  C  CB  . ILE C 1 66  ? 25.281  22.157  50.292  1.00 58.08 ? 69   ILE C CB  1 
ATOM   8547  C  CG1 . ILE C 1 66  ? 25.630  21.108  51.339  1.00 58.11 ? 69   ILE C CG1 1 
ATOM   8548  C  CG2 . ILE C 1 66  ? 26.545  22.633  49.633  1.00 58.11 ? 69   ILE C CG2 1 
ATOM   8549  C  CD1 . ILE C 1 66  ? 26.259  19.862  50.744  1.00 58.07 ? 69   ILE C CD1 1 
ATOM   8550  N  N   . PRO C 1 67  ? 22.251  22.452  50.980  1.00 58.19 ? 70   PRO C N   1 
ATOM   8551  C  CA  . PRO C 1 67  ? 21.081  21.940  51.697  1.00 58.40 ? 70   PRO C CA  1 
ATOM   8552  C  C   . PRO C 1 67  ? 21.439  20.661  52.448  1.00 58.64 ? 70   PRO C C   1 
ATOM   8553  O  O   . PRO C 1 67  ? 22.180  19.832  51.935  1.00 59.07 ? 70   PRO C O   1 
ATOM   8554  C  CB  . PRO C 1 67  ? 20.101  21.633  50.566  1.00 58.10 ? 70   PRO C CB  1 
ATOM   8555  C  CG  . PRO C 1 67  ? 20.527  22.563  49.478  1.00 58.11 ? 70   PRO C CG  1 
ATOM   8556  C  CD  . PRO C 1 67  ? 22.012  22.468  49.529  1.00 57.97 ? 70   PRO C CD  1 
ATOM   8557  N  N   . GLU C 1 68  ? 20.951  20.505  53.670  1.00 58.96 ? 71   GLU C N   1 
ATOM   8558  C  CA  . GLU C 1 68  ? 21.241  19.283  54.418  1.00 59.24 ? 71   GLU C CA  1 
ATOM   8559  C  C   . GLU C 1 68  ? 20.335  18.168  53.903  1.00 59.24 ? 71   GLU C C   1 
ATOM   8560  O  O   . GLU C 1 68  ? 19.329  18.436  53.248  1.00 59.42 ? 71   GLU C O   1 
ATOM   8561  C  CB  . GLU C 1 68  ? 20.985  19.490  55.915  1.00 59.55 ? 71   GLU C CB  1 
ATOM   8562  C  CG  . GLU C 1 68  ? 19.514  19.676  56.274  1.00 59.81 ? 71   GLU C CG  1 
ATOM   8563  C  CD  . GLU C 1 68  ? 19.258  19.772  57.773  1.00 60.06 ? 71   GLU C CD  1 
ATOM   8564  O  OE1 . GLU C 1 68  ? 20.137  20.260  58.521  1.00 60.51 ? 71   GLU C OE1 1 
ATOM   8565  O  OE2 . GLU C 1 68  ? 18.158  19.359  58.205  1.00 59.76 ? 71   GLU C OE2 1 
ATOM   8566  N  N   . ARG C 1 69  ? 20.692  16.920  54.183  1.00 59.03 ? 72   ARG C N   1 
ATOM   8567  C  CA  . ARG C 1 69  ? 19.870  15.790  53.764  1.00 58.91 ? 72   ARG C CA  1 
ATOM   8568  C  C   . ARG C 1 69  ? 18.457  16.059  54.280  1.00 59.04 ? 72   ARG C C   1 
ATOM   8569  O  O   . ARG C 1 69  ? 18.288  16.384  55.455  1.00 59.58 ? 72   ARG C O   1 
ATOM   8570  C  CB  . ARG C 1 69  ? 20.405  14.500  54.392  1.00 58.51 ? 72   ARG C CB  1 
ATOM   8571  C  CG  . ARG C 1 69  ? 21.777  14.100  53.897  1.00 58.04 ? 72   ARG C CG  1 
ATOM   8572  C  CD  . ARG C 1 69  ? 22.428  13.071  54.806  1.00 57.42 ? 72   ARG C CD  1 
ATOM   8573  N  NE  . ARG C 1 69  ? 23.609  12.481  54.179  1.00 57.66 ? 72   ARG C NE  1 
ATOM   8574  C  CZ  . ARG C 1 69  ? 24.748  13.129  53.941  1.00 57.64 ? 72   ARG C CZ  1 
ATOM   8575  N  NH1 . ARG C 1 69  ? 24.878  14.406  54.288  1.00 57.44 ? 72   ARG C NH1 1 
ATOM   8576  N  NH2 . ARG C 1 69  ? 25.748  12.511  53.318  1.00 57.48 ? 72   ARG C NH2 1 
ATOM   8577  N  N   . VAL C 1 70  ? 17.453  15.969  53.407  1.00 59.02 ? 73   VAL C N   1 
ATOM   8578  C  CA  . VAL C 1 70  ? 16.061  16.211  53.807  1.00 58.71 ? 73   VAL C CA  1 
ATOM   8579  C  C   . VAL C 1 70  ? 15.650  15.396  55.038  1.00 58.74 ? 73   VAL C C   1 
ATOM   8580  O  O   . VAL C 1 70  ? 14.750  15.785  55.772  1.00 58.75 ? 73   VAL C O   1 
ATOM   8581  C  CB  . VAL C 1 70  ? 15.088  15.954  52.643  1.00 58.59 ? 73   VAL C CB  1 
ATOM   8582  C  CG1 . VAL C 1 70  ? 15.131  14.502  52.240  1.00 58.73 ? 73   VAL C CG1 1 
ATOM   8583  C  CG2 . VAL C 1 70  ? 13.683  16.374  53.024  1.00 58.30 ? 73   VAL C CG2 1 
ATOM   8584  N  N   . VAL C 1 71  ? 16.299  14.254  55.235  1.00 58.43 ? 74   VAL C N   1 
ATOM   8585  C  CA  . VAL C 1 71  ? 16.070  13.398  56.395  1.00 58.45 ? 74   VAL C CA  1 
ATOM   8586  C  C   . VAL C 1 71  ? 17.423  12.791  56.691  1.00 58.63 ? 74   VAL C C   1 
ATOM   8587  O  O   . VAL C 1 71  ? 18.252  12.675  55.794  1.00 58.61 ? 74   VAL C O   1 
ATOM   8588  C  CB  . VAL C 1 71  ? 15.070  12.279  56.136  1.00 58.40 ? 74   VAL C CB  1 
ATOM   8589  C  CG1 . VAL C 1 71  ? 13.697  12.857  55.895  1.00 58.30 ? 74   VAL C CG1 1 
ATOM   8590  C  CG2 . VAL C 1 71  ? 15.513  11.442  54.971  1.00 58.52 ? 74   VAL C CG2 1 
ATOM   8591  N  N   . HIS C 1 72  ? 17.645  12.391  57.936  1.00 58.68 ? 75   HIS C N   1 
ATOM   8592  C  CA  . HIS C 1 72  ? 18.934  11.840  58.339  1.00 58.48 ? 75   HIS C CA  1 
ATOM   8593  C  C   . HIS C 1 72  ? 19.974  12.936  58.184  1.00 58.31 ? 75   HIS C C   1 
ATOM   8594  O  O   . HIS C 1 72  ? 21.110  12.682  57.770  1.00 58.65 ? 75   HIS C O   1 
ATOM   8595  C  CB  . HIS C 1 72  ? 19.331  10.660  57.465  1.00 59.04 ? 75   HIS C CB  1 
ATOM   8596  C  CG  . HIS C 1 72  ? 18.430  9.478   57.592  1.00 59.71 ? 75   HIS C CG  1 
ATOM   8597  N  ND1 . HIS C 1 72  ? 18.819  8.311   58.217  1.00 59.93 ? 75   HIS C ND1 1 
ATOM   8598  C  CD2 . HIS C 1 72  ? 17.180  9.257   57.122  1.00 59.95 ? 75   HIS C CD2 1 
ATOM   8599  C  CE1 . HIS C 1 72  ? 17.849  7.420   58.118  1.00 60.10 ? 75   HIS C CE1 1 
ATOM   8600  N  NE2 . HIS C 1 72  ? 16.846  7.968   57.458  1.00 60.10 ? 75   HIS C NE2 1 
ATOM   8601  N  N   . ALA C 1 73  ? 19.566  14.164  58.479  1.00 57.59 ? 76   ALA C N   1 
ATOM   8602  C  CA  . ALA C 1 73  ? 20.462  15.295  58.375  1.00 56.84 ? 76   ALA C CA  1 
ATOM   8603  C  C   . ALA C 1 73  ? 21.693  15.099  59.246  1.00 56.59 ? 76   ALA C C   1 
ATOM   8604  O  O   . ALA C 1 73  ? 22.814  15.126  58.744  1.00 56.88 ? 76   ALA C O   1 
ATOM   8605  C  CB  . ALA C 1 73  ? 19.746  16.547  58.781  1.00 56.82 ? 76   ALA C CB  1 
ATOM   8606  N  N   . LYS C 1 74  ? 21.475  14.853  60.538  1.00 56.02 ? 77   LYS C N   1 
ATOM   8607  C  CA  . LYS C 1 74  ? 22.557  14.678  61.513  1.00 55.26 ? 77   LYS C CA  1 
ATOM   8608  C  C   . LYS C 1 74  ? 23.233  13.325  61.427  1.00 55.38 ? 77   LYS C C   1 
ATOM   8609  O  O   . LYS C 1 74  ? 22.593  12.305  61.657  1.00 55.82 ? 77   LYS C O   1 
ATOM   8610  C  CB  . LYS C 1 74  ? 22.007  14.859  62.928  1.00 54.42 ? 77   LYS C CB  1 
ATOM   8611  C  CG  . LYS C 1 74  ? 23.070  14.867  64.007  1.00 53.51 ? 77   LYS C CG  1 
ATOM   8612  C  CD  . LYS C 1 74  ? 23.861  16.153  63.958  1.00 52.80 ? 77   LYS C CD  1 
ATOM   8613  C  CE  . LYS C 1 74  ? 25.063  16.088  64.867  1.00 52.42 ? 77   LYS C CE  1 
ATOM   8614  N  NZ  . LYS C 1 74  ? 24.653  15.870  66.277  1.00 52.76 ? 77   LYS C NZ  1 
ATOM   8615  N  N   . GLY C 1 75  ? 24.536  13.302  61.175  1.00 55.43 ? 78   GLY C N   1 
ATOM   8616  C  CA  . GLY C 1 75  ? 25.208  12.019  61.084  1.00 55.60 ? 78   GLY C CA  1 
ATOM   8617  C  C   . GLY C 1 75  ? 26.711  12.006  61.255  1.00 55.72 ? 78   GLY C C   1 
ATOM   8618  O  O   . GLY C 1 75  ? 27.341  13.040  61.479  1.00 55.61 ? 78   GLY C O   1 
ATOM   8619  N  N   . ALA C 1 76  ? 27.281  10.809  61.135  1.00 56.36 ? 79   ALA C N   1 
ATOM   8620  C  CA  . ALA C 1 76  ? 28.724  10.595  61.264  1.00 57.00 ? 79   ALA C CA  1 
ATOM   8621  C  C   . ALA C 1 76  ? 29.218  9.633   60.178  1.00 57.42 ? 79   ALA C C   1 
ATOM   8622  O  O   . ALA C 1 76  ? 28.417  8.916   59.571  1.00 57.74 ? 79   ALA C O   1 
ATOM   8623  C  CB  . ALA C 1 76  ? 29.045  10.032  62.641  1.00 56.90 ? 79   ALA C CB  1 
ATOM   8624  N  N   . GLY C 1 77  ? 30.532  9.597   59.953  1.00 57.60 ? 80   GLY C N   1 
ATOM   8625  C  CA  . GLY C 1 77  ? 31.071  8.712   58.936  1.00 57.83 ? 80   GLY C CA  1 
ATOM   8626  C  C   . GLY C 1 77  ? 32.422  8.086   59.233  1.00 58.25 ? 80   GLY C C   1 
ATOM   8627  O  O   . GLY C 1 77  ? 33.202  8.594   60.045  1.00 58.51 ? 80   GLY C O   1 
ATOM   8628  N  N   . ALA C 1 78  ? 32.695  6.970   58.557  1.00 58.52 ? 81   ALA C N   1 
ATOM   8629  C  CA  . ALA C 1 78  ? 33.951  6.243   58.708  1.00 58.59 ? 81   ALA C CA  1 
ATOM   8630  C  C   . ALA C 1 78  ? 34.154  5.379   57.475  1.00 58.70 ? 81   ALA C C   1 
ATOM   8631  O  O   . ALA C 1 78  ? 33.219  5.169   56.698  1.00 58.72 ? 81   ALA C O   1 
ATOM   8632  C  CB  . ALA C 1 78  ? 33.912  5.378   59.948  1.00 58.72 ? 81   ALA C CB  1 
ATOM   8633  N  N   . PHE C 1 79  ? 35.372  4.878   57.296  1.00 58.85 ? 82   PHE C N   1 
ATOM   8634  C  CA  . PHE C 1 79  ? 35.686  4.047   56.143  1.00 59.08 ? 82   PHE C CA  1 
ATOM   8635  C  C   . PHE C 1 79  ? 36.342  2.786   56.607  1.00 59.24 ? 82   PHE C C   1 
ATOM   8636  O  O   . PHE C 1 79  ? 36.832  2.714   57.731  1.00 59.53 ? 82   PHE C O   1 
ATOM   8637  C  CB  . PHE C 1 79  ? 36.638  4.777   55.217  1.00 59.53 ? 82   PHE C CB  1 
ATOM   8638  C  CG  . PHE C 1 79  ? 36.132  6.107   54.784  1.00 60.19 ? 82   PHE C CG  1 
ATOM   8639  C  CD1 . PHE C 1 79  ? 36.271  7.214   55.610  1.00 60.50 ? 82   PHE C CD1 1 
ATOM   8640  C  CD2 . PHE C 1 79  ? 35.460  6.248   53.574  1.00 60.35 ? 82   PHE C CD2 1 
ATOM   8641  C  CE1 . PHE C 1 79  ? 35.741  8.446   55.240  1.00 61.05 ? 82   PHE C CE1 1 
ATOM   8642  C  CE2 . PHE C 1 79  ? 34.925  7.473   53.192  1.00 60.56 ? 82   PHE C CE2 1 
ATOM   8643  C  CZ  . PHE C 1 79  ? 35.065  8.575   54.028  1.00 61.00 ? 82   PHE C CZ  1 
ATOM   8644  N  N   . GLY C 1 80  ? 36.376  1.795   55.731  1.00 59.05 ? 83   GLY C N   1 
ATOM   8645  C  CA  . GLY C 1 80  ? 36.994  0.537   56.087  1.00 58.78 ? 83   GLY C CA  1 
ATOM   8646  C  C   . GLY C 1 80  ? 36.804  -0.400  54.930  1.00 58.69 ? 83   GLY C C   1 
ATOM   8647  O  O   . GLY C 1 80  ? 36.941  0.010   53.775  1.00 58.75 ? 83   GLY C O   1 
ATOM   8648  N  N   . TYR C 1 81  ? 36.413  -1.634  55.221  1.00 58.69 ? 84   TYR C N   1 
ATOM   8649  C  CA  . TYR C 1 81  ? 36.217  -2.604  54.157  1.00 58.60 ? 84   TYR C CA  1 
ATOM   8650  C  C   . TYR C 1 81  ? 35.222  -3.703  54.464  1.00 58.52 ? 84   TYR C C   1 
ATOM   8651  O  O   . TYR C 1 81  ? 34.799  -3.910  55.605  1.00 58.43 ? 84   TYR C O   1 
ATOM   8652  C  CB  . TYR C 1 81  ? 37.545  -3.256  53.794  1.00 58.10 ? 84   TYR C CB  1 
ATOM   8653  C  CG  . TYR C 1 81  ? 38.128  -4.062  54.926  1.00 58.00 ? 84   TYR C CG  1 
ATOM   8654  C  CD1 . TYR C 1 81  ? 37.941  -5.445  55.000  1.00 57.82 ? 84   TYR C CD1 1 
ATOM   8655  C  CD2 . TYR C 1 81  ? 38.871  -3.446  55.924  1.00 57.84 ? 84   TYR C CD2 1 
ATOM   8656  C  CE1 . TYR C 1 81  ? 38.490  -6.192  56.045  1.00 57.80 ? 84   TYR C CE1 1 
ATOM   8657  C  CE2 . TYR C 1 81  ? 39.419  -4.180  56.971  1.00 57.76 ? 84   TYR C CE2 1 
ATOM   8658  C  CZ  . TYR C 1 81  ? 39.227  -5.548  57.026  1.00 57.68 ? 84   TYR C CZ  1 
ATOM   8659  O  OH  . TYR C 1 81  ? 39.778  -6.250  58.072  1.00 57.58 ? 84   TYR C OH  1 
ATOM   8660  N  N   . PHE C 1 82  ? 34.848  -4.394  53.401  1.00 58.52 ? 85   PHE C N   1 
ATOM   8661  C  CA  . PHE C 1 82  ? 33.946  -5.508  53.492  1.00 58.54 ? 85   PHE C CA  1 
ATOM   8662  C  C   . PHE C 1 82  ? 34.776  -6.705  53.117  1.00 58.63 ? 85   PHE C C   1 
ATOM   8663  O  O   . PHE C 1 82  ? 35.527  -6.662  52.143  1.00 58.77 ? 85   PHE C O   1 
ATOM   8664  C  CB  . PHE C 1 82  ? 32.832  -5.379  52.482  1.00 58.37 ? 85   PHE C CB  1 
ATOM   8665  C  CG  . PHE C 1 82  ? 32.052  -6.635  52.313  1.00 58.43 ? 85   PHE C CG  1 
ATOM   8666  C  CD1 . PHE C 1 82  ? 31.246  -7.105  53.343  1.00 58.32 ? 85   PHE C CD1 1 
ATOM   8667  C  CD2 . PHE C 1 82  ? 32.138  -7.366  51.136  1.00 58.43 ? 85   PHE C CD2 1 
ATOM   8668  C  CE1 . PHE C 1 82  ? 30.532  -8.288  53.204  1.00 58.38 ? 85   PHE C CE1 1 
ATOM   8669  C  CE2 . PHE C 1 82  ? 31.429  -8.551  50.983  1.00 58.46 ? 85   PHE C CE2 1 
ATOM   8670  C  CZ  . PHE C 1 82  ? 30.622  -9.014  52.020  1.00 58.50 ? 85   PHE C CZ  1 
ATOM   8671  N  N   . GLU C 1 83  ? 34.629  -7.784  53.865  1.00 58.63 ? 86   GLU C N   1 
ATOM   8672  C  CA  . GLU C 1 83  ? 35.392  -8.968  53.560  1.00 58.87 ? 86   GLU C CA  1 
ATOM   8673  C  C   . GLU C 1 83  ? 34.497  -10.185 53.500  1.00 59.02 ? 86   GLU C C   1 
ATOM   8674  O  O   . GLU C 1 83  ? 33.697  -10.424 54.399  1.00 59.27 ? 86   GLU C O   1 
ATOM   8675  C  CB  . GLU C 1 83  ? 36.482  -9.173  54.599  1.00 59.23 ? 86   GLU C CB  1 
ATOM   8676  C  CG  . GLU C 1 83  ? 37.428  -10.304 54.247  1.00 60.05 ? 86   GLU C CG  1 
ATOM   8677  C  CD  . GLU C 1 83  ? 38.483  -10.536 55.308  1.00 60.63 ? 86   GLU C CD  1 
ATOM   8678  O  OE1 . GLU C 1 83  ? 39.488  -11.220 55.011  1.00 60.67 ? 86   GLU C OE1 1 
ATOM   8679  O  OE2 . GLU C 1 83  ? 38.302  -10.048 56.443  1.00 60.78 ? 86   GLU C OE2 1 
ATOM   8680  N  N   . VAL C 1 84  ? 34.632  -10.954 52.429  1.00 58.92 ? 87   VAL C N   1 
ATOM   8681  C  CA  . VAL C 1 84  ? 33.833  -12.156 52.251  1.00 58.86 ? 87   VAL C CA  1 
ATOM   8682  C  C   . VAL C 1 84  ? 34.376  -13.257 53.143  1.00 58.96 ? 87   VAL C C   1 
ATOM   8683  O  O   . VAL C 1 84  ? 35.566  -13.567 53.090  1.00 58.82 ? 87   VAL C O   1 
ATOM   8684  C  CB  . VAL C 1 84  ? 33.903  -12.643 50.795  1.00 59.10 ? 87   VAL C CB  1 
ATOM   8685  C  CG1 . VAL C 1 84  ? 33.000  -13.842 50.590  1.00 59.04 ? 87   VAL C CG1 1 
ATOM   8686  C  CG2 . VAL C 1 84  ? 33.512  -11.528 49.848  1.00 59.17 ? 87   VAL C CG2 1 
ATOM   8687  N  N   . THR C 1 85  ? 33.508  -13.840 53.963  1.00 59.35 ? 88   THR C N   1 
ATOM   8688  C  CA  . THR C 1 85  ? 33.904  -14.929 54.852  1.00 59.69 ? 88   THR C CA  1 
ATOM   8689  C  C   . THR C 1 85  ? 33.257  -16.242 54.426  1.00 60.55 ? 88   THR C C   1 
ATOM   8690  O  O   . THR C 1 85  ? 33.744  -17.318 54.774  1.00 60.53 ? 88   THR C O   1 
ATOM   8691  C  CB  . THR C 1 85  ? 33.492  -14.664 56.304  1.00 59.28 ? 88   THR C CB  1 
ATOM   8692  O  OG1 . THR C 1 85  ? 32.075  -14.477 56.368  1.00 59.27 ? 88   THR C OG1 1 
ATOM   8693  C  CG2 . THR C 1 85  ? 34.169  -13.437 56.838  1.00 58.99 ? 88   THR C CG2 1 
ATOM   8694  N  N   . HIS C 1 86  ? 32.146  -16.155 53.697  1.00 61.30 ? 89   HIS C N   1 
ATOM   8695  C  CA  . HIS C 1 86  ? 31.433  -17.345 53.243  1.00 61.92 ? 89   HIS C CA  1 
ATOM   8696  C  C   . HIS C 1 86  ? 31.010  -17.310 51.786  1.00 62.29 ? 89   HIS C C   1 
ATOM   8697  O  O   . HIS C 1 86  ? 30.778  -16.248 51.216  1.00 62.31 ? 89   HIS C O   1 
ATOM   8698  C  CB  . HIS C 1 86  ? 30.211  -17.586 54.120  1.00 62.49 ? 89   HIS C CB  1 
ATOM   8699  C  CG  . HIS C 1 86  ? 30.549  -17.896 55.542  1.00 63.17 ? 89   HIS C CG  1 
ATOM   8700  N  ND1 . HIS C 1 86  ? 31.082  -16.958 56.400  1.00 63.15 ? 89   HIS C ND1 1 
ATOM   8701  C  CD2 . HIS C 1 86  ? 30.457  -19.048 56.249  1.00 63.34 ? 89   HIS C CD2 1 
ATOM   8702  C  CE1 . HIS C 1 86  ? 31.303  -17.519 57.576  1.00 63.61 ? 89   HIS C CE1 1 
ATOM   8703  N  NE2 . HIS C 1 86  ? 30.934  -18.786 57.513  1.00 63.65 ? 89   HIS C NE2 1 
ATOM   8704  N  N   . ASP C 1 87  ? 30.861  -18.498 51.214  1.00 62.61 ? 90   ASP C N   1 
ATOM   8705  C  CA  . ASP C 1 87  ? 30.473  -18.668 49.826  1.00 62.66 ? 90   ASP C CA  1 
ATOM   8706  C  C   . ASP C 1 87  ? 28.961  -18.627 49.667  1.00 62.94 ? 90   ASP C C   1 
ATOM   8707  O  O   . ASP C 1 87  ? 28.252  -19.471 50.208  1.00 63.27 ? 90   ASP C O   1 
ATOM   8708  C  CB  . ASP C 1 87  ? 31.006  -20.010 49.311  1.00 62.41 ? 90   ASP C CB  1 
ATOM   8709  C  CG  . ASP C 1 87  ? 30.815  -20.192 47.813  1.00 62.60 ? 90   ASP C CG  1 
ATOM   8710  O  OD1 . ASP C 1 87  ? 29.774  -19.765 47.266  1.00 62.62 ? 90   ASP C OD1 1 
ATOM   8711  O  OD2 . ASP C 1 87  ? 31.711  -20.787 47.177  1.00 62.56 ? 90   ASP C OD2 1 
ATOM   8712  N  N   . ILE C 1 88  ? 28.475  -17.641 48.923  1.00 62.97 ? 91   ILE C N   1 
ATOM   8713  C  CA  . ILE C 1 88  ? 27.048  -17.517 48.641  1.00 62.96 ? 91   ILE C CA  1 
ATOM   8714  C  C   . ILE C 1 88  ? 26.864  -17.341 47.134  1.00 63.61 ? 91   ILE C C   1 
ATOM   8715  O  O   . ILE C 1 88  ? 25.844  -16.826 46.670  1.00 63.83 ? 91   ILE C O   1 
ATOM   8716  C  CB  . ILE C 1 88  ? 26.377  -16.339 49.397  1.00 62.12 ? 91   ILE C CB  1 
ATOM   8717  C  CG1 . ILE C 1 88  ? 27.001  -15.004 49.005  1.00 61.45 ? 91   ILE C CG1 1 
ATOM   8718  C  CG2 . ILE C 1 88  ? 26.472  -16.550 50.894  1.00 61.89 ? 91   ILE C CG2 1 
ATOM   8719  C  CD1 . ILE C 1 88  ? 26.314  -13.813 49.640  1.00 60.51 ? 91   ILE C CD1 1 
ATOM   8720  N  N   . THR C 1 89  ? 27.847  -17.820 46.373  1.00 64.13 ? 92   THR C N   1 
ATOM   8721  C  CA  . THR C 1 89  ? 27.827  -17.723 44.919  1.00 64.61 ? 92   THR C CA  1 
ATOM   8722  C  C   . THR C 1 89  ? 26.672  -18.484 44.287  1.00 65.22 ? 92   THR C C   1 
ATOM   8723  O  O   . THR C 1 89  ? 26.358  -18.270 43.118  1.00 65.36 ? 92   THR C O   1 
ATOM   8724  C  CB  . THR C 1 89  ? 29.134  -18.238 44.314  1.00 64.48 ? 92   THR C CB  1 
ATOM   8725  O  OG1 . THR C 1 89  ? 29.354  -19.590 44.727  1.00 64.34 ? 92   THR C OG1 1 
ATOM   8726  C  CG2 . THR C 1 89  ? 30.292  -17.393 44.774  1.00 64.50 ? 92   THR C CG2 1 
ATOM   8727  N  N   . LYS C 1 90  ? 26.070  -19.400 45.045  1.00 65.89 ? 93   LYS C N   1 
ATOM   8728  C  CA  . LYS C 1 90  ? 24.939  -20.184 44.553  1.00 66.36 ? 93   LYS C CA  1 
ATOM   8729  C  C   . LYS C 1 90  ? 23.671  -19.336 44.558  1.00 66.01 ? 93   LYS C C   1 
ATOM   8730  O  O   . LYS C 1 90  ? 22.624  -19.763 44.068  1.00 66.23 ? 93   LYS C O   1 
ATOM   8731  C  CB  . LYS C 1 90  ? 24.736  -21.435 45.405  1.00 67.44 ? 93   LYS C CB  1 
ATOM   8732  C  CG  . LYS C 1 90  ? 24.578  -21.143 46.881  1.00 69.47 ? 93   LYS C CG  1 
ATOM   8733  C  CD  . LYS C 1 90  ? 24.329  -22.415 47.690  1.00 71.27 ? 93   LYS C CD  1 
ATOM   8734  C  CE  . LYS C 1 90  ? 22.898  -22.954 47.525  1.00 72.12 ? 93   LYS C CE  1 
ATOM   8735  N  NZ  . LYS C 1 90  ? 22.575  -23.375 46.125  1.00 72.85 ? 93   LYS C NZ  1 
ATOM   8736  N  N   . TYR C 1 91  ? 23.769  -18.138 45.123  1.00 65.26 ? 94   TYR C N   1 
ATOM   8737  C  CA  . TYR C 1 91  ? 22.637  -17.231 45.172  1.00 64.53 ? 94   TYR C CA  1 
ATOM   8738  C  C   . TYR C 1 91  ? 22.914  -15.978 44.365  1.00 64.05 ? 94   TYR C C   1 
ATOM   8739  O  O   . TYR C 1 91  ? 22.052  -15.504 43.624  1.00 64.42 ? 94   TYR C O   1 
ATOM   8740  C  CB  . TYR C 1 91  ? 22.343  -16.844 46.608  1.00 64.70 ? 94   TYR C CB  1 
ATOM   8741  C  CG  . TYR C 1 91  ? 21.969  -18.009 47.475  1.00 64.85 ? 94   TYR C CG  1 
ATOM   8742  C  CD1 . TYR C 1 91  ? 22.692  -18.304 48.621  1.00 64.92 ? 94   TYR C CD1 1 
ATOM   8743  C  CD2 . TYR C 1 91  ? 20.865  -18.797 47.175  1.00 65.12 ? 94   TYR C CD2 1 
ATOM   8744  C  CE1 . TYR C 1 91  ? 22.321  -19.351 49.457  1.00 65.08 ? 94   TYR C CE1 1 
ATOM   8745  C  CE2 . TYR C 1 91  ? 20.485  -19.849 48.006  1.00 65.33 ? 94   TYR C CE2 1 
ATOM   8746  C  CZ  . TYR C 1 91  ? 21.217  -20.119 49.145  1.00 65.28 ? 94   TYR C CZ  1 
ATOM   8747  O  OH  . TYR C 1 91  ? 20.839  -21.149 49.978  1.00 65.50 ? 94   TYR C OH  1 
ATOM   8748  N  N   . SER C 1 92  ? 24.125  -15.450 44.492  1.00 63.46 ? 95   SER C N   1 
ATOM   8749  C  CA  . SER C 1 92  ? 24.484  -14.235 43.781  1.00 63.02 ? 95   SER C CA  1 
ATOM   8750  C  C   . SER C 1 92  ? 25.789  -14.308 43.032  1.00 62.85 ? 95   SER C C   1 
ATOM   8751  O  O   . SER C 1 92  ? 26.791  -14.815 43.542  1.00 62.66 ? 95   SER C O   1 
ATOM   8752  C  CB  . SER C 1 92  ? 24.554  -13.059 44.743  1.00 62.99 ? 95   SER C CB  1 
ATOM   8753  O  OG  . SER C 1 92  ? 25.102  -11.934 44.085  1.00 63.36 ? 95   SER C OG  1 
ATOM   8754  N  N   . LYS C 1 93  ? 25.780  -13.743 41.831  1.00 62.67 ? 96   LYS C N   1 
ATOM   8755  C  CA  . LYS C 1 93  ? 26.970  -13.727 41.003  1.00 62.49 ? 96   LYS C CA  1 
ATOM   8756  C  C   . LYS C 1 93  ? 27.764  -12.448 41.209  1.00 62.86 ? 96   LYS C C   1 
ATOM   8757  O  O   . LYS C 1 93  ? 28.806  -12.257 40.588  1.00 63.11 ? 96   LYS C O   1 
ATOM   8758  C  CB  . LYS C 1 93  ? 26.610  -13.902 39.525  1.00 61.89 ? 96   LYS C CB  1 
ATOM   8759  C  CG  . LYS C 1 93  ? 25.876  -12.748 38.854  1.00 61.02 ? 96   LYS C CG  1 
ATOM   8760  C  CD  . LYS C 1 93  ? 25.850  -13.021 37.350  1.00 60.72 ? 96   LYS C CD  1 
ATOM   8761  C  CE  . LYS C 1 93  ? 25.352  -11.859 36.525  1.00 60.37 ? 96   LYS C CE  1 
ATOM   8762  N  NZ  . LYS C 1 93  ? 23.879  -11.800 36.507  1.00 60.48 ? 96   LYS C NZ  1 
ATOM   8763  N  N   . ALA C 1 94  ? 27.294  -11.601 42.122  1.00 63.02 ? 97   ALA C N   1 
ATOM   8764  C  CA  . ALA C 1 94  ? 27.944  -10.323 42.416  1.00 63.18 ? 97   ALA C CA  1 
ATOM   8765  C  C   . ALA C 1 94  ? 29.421  -10.459 42.718  1.00 63.52 ? 97   ALA C C   1 
ATOM   8766  O  O   . ALA C 1 94  ? 29.809  -11.167 43.647  1.00 63.59 ? 97   ALA C O   1 
ATOM   8767  C  CB  . ALA C 1 94  ? 27.252  -9.646  43.570  1.00 63.17 ? 97   ALA C CB  1 
ATOM   8768  N  N   . LYS C 1 95  ? 30.240  -9.732  41.964  1.00 63.82 ? 98   LYS C N   1 
ATOM   8769  C  CA  . LYS C 1 95  ? 31.686  -9.781  42.137  1.00 64.29 ? 98   LYS C CA  1 
ATOM   8770  C  C   . LYS C 1 95  ? 32.134  -9.550  43.572  1.00 64.03 ? 98   LYS C C   1 
ATOM   8771  O  O   . LYS C 1 95  ? 33.131  -10.118 44.023  1.00 63.93 ? 98   LYS C O   1 
ATOM   8772  C  CB  . LYS C 1 95  ? 32.377  -8.767  41.225  1.00 65.30 ? 98   LYS C CB  1 
ATOM   8773  C  CG  . LYS C 1 95  ? 32.563  -9.219  39.790  1.00 66.87 ? 98   LYS C CG  1 
ATOM   8774  C  CD  . LYS C 1 95  ? 33.599  -8.346  39.088  1.00 68.50 ? 98   LYS C CD  1 
ATOM   8775  C  CE  . LYS C 1 95  ? 33.812  -8.772  37.641  1.00 69.54 ? 98   LYS C CE  1 
ATOM   8776  N  NZ  . LYS C 1 95  ? 32.550  -8.643  36.850  1.00 70.75 ? 98   LYS C NZ  1 
ATOM   8777  N  N   . VAL C 1 96  ? 31.381  -8.732  44.294  1.00 63.77 ? 99   VAL C N   1 
ATOM   8778  C  CA  . VAL C 1 96  ? 31.713  -8.420  45.677  1.00 63.35 ? 99   VAL C CA  1 
ATOM   8779  C  C   . VAL C 1 96  ? 31.669  -9.666  46.561  1.00 62.96 ? 99   VAL C C   1 
ATOM   8780  O  O   . VAL C 1 96  ? 32.196  -9.665  47.670  1.00 62.69 ? 99   VAL C O   1 
ATOM   8781  C  CB  . VAL C 1 96  ? 30.779  -7.307  46.230  1.00 63.58 ? 99   VAL C CB  1 
ATOM   8782  C  CG1 . VAL C 1 96  ? 29.349  -7.796  46.278  1.00 63.56 ? 99   VAL C CG1 1 
ATOM   8783  C  CG2 . VAL C 1 96  ? 31.247  -6.825  47.595  1.00 63.44 ? 99   VAL C CG2 1 
ATOM   8784  N  N   . PHE C 1 97  ? 31.100  -10.745 46.033  1.00 62.70 ? 100  PHE C N   1 
ATOM   8785  C  CA  . PHE C 1 97  ? 30.987  -11.999 46.773  1.00 62.66 ? 100  PHE C CA  1 
ATOM   8786  C  C   . PHE C 1 97  ? 31.808  -13.147 46.188  1.00 62.84 ? 100  PHE C C   1 
ATOM   8787  O  O   . PHE C 1 97  ? 32.012  -14.161 46.856  1.00 62.73 ? 100  PHE C O   1 
ATOM   8788  C  CB  . PHE C 1 97  ? 29.534  -12.468 46.771  1.00 62.53 ? 100  PHE C CB  1 
ATOM   8789  C  CG  . PHE C 1 97  ? 28.564  -11.487 47.354  1.00 62.15 ? 100  PHE C CG  1 
ATOM   8790  C  CD1 . PHE C 1 97  ? 28.773  -10.940 48.612  1.00 62.07 ? 100  PHE C CD1 1 
ATOM   8791  C  CD2 . PHE C 1 97  ? 27.401  -11.163 46.671  1.00 61.92 ? 100  PHE C CD2 1 
ATOM   8792  C  CE1 . PHE C 1 97  ? 27.833  -10.086 49.187  1.00 61.68 ? 100  PHE C CE1 1 
ATOM   8793  C  CE2 . PHE C 1 97  ? 26.461  -10.313 47.235  1.00 61.81 ? 100  PHE C CE2 1 
ATOM   8794  C  CZ  . PHE C 1 97  ? 26.678  -9.775  48.499  1.00 61.60 ? 100  PHE C CZ  1 
ATOM   8795  N  N   . GLU C 1 98  ? 32.259  -12.998 44.945  1.00 63.03 ? 101  GLU C N   1 
ATOM   8796  C  CA  . GLU C 1 98  ? 32.983  -14.059 44.249  1.00 63.18 ? 101  GLU C CA  1 
ATOM   8797  C  C   . GLU C 1 98  ? 33.967  -14.964 44.987  1.00 63.11 ? 101  GLU C C   1 
ATOM   8798  O  O   . GLU C 1 98  ? 34.032  -16.156 44.687  1.00 63.40 ? 101  GLU C O   1 
ATOM   8799  C  CB  . GLU C 1 98  ? 33.597  -13.549 42.946  1.00 63.39 ? 101  GLU C CB  1 
ATOM   8800  C  CG  . GLU C 1 98  ? 34.742  -12.583 43.095  1.00 63.93 ? 101  GLU C CG  1 
ATOM   8801  C  CD  . GLU C 1 98  ? 35.259  -12.101 41.753  1.00 64.41 ? 101  GLU C CD  1 
ATOM   8802  O  OE1 . GLU C 1 98  ? 36.301  -11.420 41.741  1.00 64.95 ? 101  GLU C OE1 1 
ATOM   8803  O  OE2 . GLU C 1 98  ? 34.629  -12.390 40.709  1.00 64.57 ? 101  GLU C OE2 1 
ATOM   8804  N  N   . HIS C 1 99  ? 34.721  -14.440 45.948  1.00 62.92 ? 102  HIS C N   1 
ATOM   8805  C  CA  . HIS C 1 99  ? 35.670  -15.292 46.671  1.00 62.42 ? 102  HIS C CA  1 
ATOM   8806  C  C   . HIS C 1 99  ? 35.817  -14.997 48.153  1.00 62.08 ? 102  HIS C C   1 
ATOM   8807  O  O   . HIS C 1 99  ? 35.821  -13.837 48.572  1.00 62.16 ? 102  HIS C O   1 
ATOM   8808  C  CB  . HIS C 1 99  ? 37.058  -15.238 46.027  1.00 62.27 ? 102  HIS C CB  1 
ATOM   8809  C  CG  . HIS C 1 99  ? 37.176  -16.039 44.771  1.00 62.23 ? 102  HIS C CG  1 
ATOM   8810  N  ND1 . HIS C 1 99  ? 37.537  -15.478 43.563  1.00 62.29 ? 102  HIS C ND1 1 
ATOM   8811  C  CD2 . HIS C 1 99  ? 36.979  -17.355 44.531  1.00 61.81 ? 102  HIS C CD2 1 
ATOM   8812  C  CE1 . HIS C 1 99  ? 37.555  -16.417 42.633  1.00 62.02 ? 102  HIS C CE1 1 
ATOM   8813  N  NE2 . HIS C 1 99  ? 37.221  -17.565 43.195  1.00 62.15 ? 102  HIS C NE2 1 
ATOM   8814  N  N   . ILE C 1 100 ? 35.971  -16.057 48.940  1.00 61.42 ? 103  ILE C N   1 
ATOM   8815  C  CA  . ILE C 1 100 ? 36.153  -15.920 50.376  1.00 60.75 ? 103  ILE C CA  1 
ATOM   8816  C  C   . ILE C 1 100 ? 37.508  -15.264 50.590  1.00 60.80 ? 103  ILE C C   1 
ATOM   8817  O  O   . ILE C 1 100 ? 38.510  -15.699 50.018  1.00 60.93 ? 103  ILE C O   1 
ATOM   8818  C  CB  . ILE C 1 100 ? 36.118  -17.290 51.075  1.00 60.16 ? 103  ILE C CB  1 
ATOM   8819  C  CG1 . ILE C 1 100 ? 34.725  -17.904 50.920  1.00 59.74 ? 103  ILE C CG1 1 
ATOM   8820  C  CG2 . ILE C 1 100 ? 36.478  -17.141 52.538  1.00 59.94 ? 103  ILE C CG2 1 
ATOM   8821  C  CD1 . ILE C 1 100 ? 34.513  -19.213 51.653  1.00 59.28 ? 103  ILE C CD1 1 
ATOM   8822  N  N   . GLY C 1 101 ? 37.535  -14.201 51.387  1.00 60.70 ? 104  GLY C N   1 
ATOM   8823  C  CA  . GLY C 1 101 ? 38.782  -13.501 51.632  1.00 60.30 ? 104  GLY C CA  1 
ATOM   8824  C  C   . GLY C 1 101 ? 38.863  -12.224 50.820  1.00 60.18 ? 104  GLY C C   1 
ATOM   8825  O  O   . GLY C 1 101 ? 39.739  -11.390 51.043  1.00 60.06 ? 104  GLY C O   1 
ATOM   8826  N  N   . LYS C 1 102 ? 37.946  -12.073 49.869  1.00 60.06 ? 105  LYS C N   1 
ATOM   8827  C  CA  . LYS C 1 102 ? 37.906  -10.887 49.028  1.00 59.86 ? 105  LYS C CA  1 
ATOM   8828  C  C   . LYS C 1 102 ? 37.474  -9.658  49.814  1.00 59.58 ? 105  LYS C C   1 
ATOM   8829  O  O   . LYS C 1 102 ? 36.420  -9.659  50.463  1.00 59.63 ? 105  LYS C O   1 
ATOM   8830  C  CB  . LYS C 1 102 ? 36.949  -11.087 47.854  1.00 60.33 ? 105  LYS C CB  1 
ATOM   8831  C  CG  . LYS C 1 102 ? 36.787  -9.829  47.030  1.00 60.75 ? 105  LYS C CG  1 
ATOM   8832  C  CD  . LYS C 1 102 ? 36.251  -10.110 45.658  1.00 61.19 ? 105  LYS C CD  1 
ATOM   8833  C  CE  . LYS C 1 102 ? 36.425  -8.877  44.804  1.00 61.61 ? 105  LYS C CE  1 
ATOM   8834  N  NZ  . LYS C 1 102 ? 36.253  -9.236  43.382  1.00 62.26 ? 105  LYS C NZ  1 
ATOM   8835  N  N   . LYS C 1 103 ? 38.282  -8.605  49.729  1.00 59.11 ? 106  LYS C N   1 
ATOM   8836  C  CA  . LYS C 1 103 ? 37.985  -7.363  50.422  1.00 58.57 ? 106  LYS C CA  1 
ATOM   8837  C  C   . LYS C 1 103 ? 37.566  -6.281  49.443  1.00 58.51 ? 106  LYS C C   1 
ATOM   8838  O  O   . LYS C 1 103 ? 38.136  -6.155  48.350  1.00 58.57 ? 106  LYS C O   1 
ATOM   8839  C  CB  . LYS C 1 103 ? 39.201  -6.893  51.213  1.00 58.13 ? 106  LYS C CB  1 
ATOM   8840  C  CG  . LYS C 1 103 ? 39.584  -7.819  52.351  1.00 57.74 ? 106  LYS C CG  1 
ATOM   8841  C  CD  . LYS C 1 103 ? 40.837  -7.325  53.052  1.00 57.36 ? 106  LYS C CD  1 
ATOM   8842  C  CE  . LYS C 1 103 ? 41.304  -8.300  54.116  1.00 57.16 ? 106  LYS C CE  1 
ATOM   8843  N  NZ  . LYS C 1 103 ? 42.738  -8.092  54.467  1.00 57.03 ? 106  LYS C NZ  1 
ATOM   8844  N  N   . THR C 1 104 ? 36.538  -5.529  49.827  1.00 58.24 ? 107  THR C N   1 
ATOM   8845  C  CA  . THR C 1 104 ? 36.037  -4.435  49.018  1.00 58.05 ? 107  THR C CA  1 
ATOM   8846  C  C   . THR C 1 104 ? 35.939  -3.226  49.933  1.00 57.91 ? 107  THR C C   1 
ATOM   8847  O  O   . THR C 1 104 ? 35.401  -3.320  51.033  1.00 57.89 ? 107  THR C O   1 
ATOM   8848  C  CB  . THR C 1 104 ? 34.655  -4.752  48.430  1.00 58.27 ? 107  THR C CB  1 
ATOM   8849  O  OG1 . THR C 1 104 ? 34.758  -5.868  47.543  1.00 58.69 ? 107  THR C OG1 1 
ATOM   8850  C  CG2 . THR C 1 104 ? 34.132  -3.580  47.638  1.00 58.78 ? 107  THR C CG2 1 
ATOM   8851  N  N   . PRO C 1 105 ? 36.489  -2.078  49.498  1.00 57.68 ? 108  PRO C N   1 
ATOM   8852  C  CA  . PRO C 1 105 ? 36.489  -0.819  50.246  1.00 57.50 ? 108  PRO C CA  1 
ATOM   8853  C  C   . PRO C 1 105 ? 35.073  -0.363  50.481  1.00 57.81 ? 108  PRO C C   1 
ATOM   8854  O  O   . PRO C 1 105 ? 34.219  -0.498  49.598  1.00 58.27 ? 108  PRO C O   1 
ATOM   8855  C  CB  . PRO C 1 105 ? 37.184  0.142   49.288  1.00 57.27 ? 108  PRO C CB  1 
ATOM   8856  C  CG  . PRO C 1 105 ? 38.057  -0.740  48.490  1.00 57.37 ? 108  PRO C CG  1 
ATOM   8857  C  CD  . PRO C 1 105 ? 37.161  -1.899  48.206  1.00 57.39 ? 108  PRO C CD  1 
ATOM   8858  N  N   . ILE C 1 106 ? 34.825  0.204   51.656  1.00 57.77 ? 109  ILE C N   1 
ATOM   8859  C  CA  . ILE C 1 106 ? 33.491  0.686   51.990  1.00 57.38 ? 109  ILE C CA  1 
ATOM   8860  C  C   . ILE C 1 106 ? 33.515  2.040   52.677  1.00 57.39 ? 109  ILE C C   1 
ATOM   8861  O  O   . ILE C 1 106 ? 34.501  2.431   53.315  1.00 57.17 ? 109  ILE C O   1 
ATOM   8862  C  CB  . ILE C 1 106 ? 32.746  -0.288  52.918  1.00 57.07 ? 109  ILE C CB  1 
ATOM   8863  C  CG1 . ILE C 1 106 ? 33.440  -0.334  54.284  1.00 56.86 ? 109  ILE C CG1 1 
ATOM   8864  C  CG2 . ILE C 1 106 ? 32.673  -1.668  52.277  1.00 57.12 ? 109  ILE C CG2 1 
ATOM   8865  C  CD1 . ILE C 1 106 ? 32.779  -1.229  55.309  1.00 56.56 ? 109  ILE C CD1 1 
ATOM   8866  N  N   . ALA C 1 107 ? 32.403  2.743   52.544  1.00 57.46 ? 110  ALA C N   1 
ATOM   8867  C  CA  . ALA C 1 107 ? 32.227  4.046   53.158  1.00 57.65 ? 110  ALA C CA  1 
ATOM   8868  C  C   . ALA C 1 107 ? 30.901  3.943   53.891  1.00 57.75 ? 110  ALA C C   1 
ATOM   8869  O  O   . ALA C 1 107 ? 29.924  3.424   53.342  1.00 58.00 ? 110  ALA C O   1 
ATOM   8870  C  CB  . ALA C 1 107 ? 32.163  5.129   52.093  1.00 58.05 ? 110  ALA C CB  1 
ATOM   8871  N  N   . VAL C 1 108 ? 30.861  4.423   55.128  1.00 57.82 ? 111  VAL C N   1 
ATOM   8872  C  CA  . VAL C 1 108 ? 29.641  4.343   55.919  1.00 57.78 ? 111  VAL C CA  1 
ATOM   8873  C  C   . VAL C 1 108 ? 29.304  5.662   56.569  1.00 58.03 ? 111  VAL C C   1 
ATOM   8874  O  O   . VAL C 1 108 ? 30.195  6.451   56.889  1.00 57.98 ? 111  VAL C O   1 
ATOM   8875  C  CB  . VAL C 1 108 ? 29.793  3.312   57.055  1.00 57.86 ? 111  VAL C CB  1 
ATOM   8876  C  CG1 . VAL C 1 108 ? 28.551  3.284   57.926  1.00 57.42 ? 111  VAL C CG1 1 
ATOM   8877  C  CG2 . VAL C 1 108 ? 30.064  1.937   56.488  1.00 57.59 ? 111  VAL C CG2 1 
ATOM   8878  N  N   . ARG C 1 109 ? 28.007  5.893   56.752  1.00 58.21 ? 112  ARG C N   1 
ATOM   8879  C  CA  . ARG C 1 109 ? 27.519  7.086   57.419  1.00 58.43 ? 112  ARG C CA  1 
ATOM   8880  C  C   . ARG C 1 109 ? 26.339  6.707   58.303  1.00 58.79 ? 112  ARG C C   1 
ATOM   8881  O  O   . ARG C 1 109 ? 25.346  6.154   57.829  1.00 58.87 ? 112  ARG C O   1 
ATOM   8882  C  CB  . ARG C 1 109 ? 27.106  8.177   56.433  1.00 58.16 ? 112  ARG C CB  1 
ATOM   8883  C  CG  . ARG C 1 109 ? 26.682  9.467   57.137  1.00 57.76 ? 112  ARG C CG  1 
ATOM   8884  C  CD  . ARG C 1 109 ? 26.362  10.586  56.162  1.00 57.57 ? 112  ARG C CD  1 
ATOM   8885  N  NE  . ARG C 1 109 ? 25.854  11.772  56.845  1.00 57.53 ? 112  ARG C NE  1 
ATOM   8886  C  CZ  . ARG C 1 109 ? 24.611  11.897  57.306  1.00 57.91 ? 112  ARG C CZ  1 
ATOM   8887  N  NH1 . ARG C 1 109 ? 23.735  10.909  57.164  1.00 57.66 ? 112  ARG C NH1 1 
ATOM   8888  N  NH2 . ARG C 1 109 ? 24.229  13.021  57.897  1.00 57.58 ? 112  ARG C NH2 1 
ATOM   8889  N  N   . PHE C 1 110 ? 26.497  6.933   59.600  1.00 59.14 ? 113  PHE C N   1 
ATOM   8890  C  CA  . PHE C 1 110 ? 25.453  6.647   60.570  1.00 59.64 ? 113  PHE C CA  1 
ATOM   8891  C  C   . PHE C 1 110 ? 24.678  7.932   60.770  1.00 59.85 ? 113  PHE C C   1 
ATOM   8892  O  O   . PHE C 1 110 ? 25.244  9.011   60.600  1.00 60.61 ? 113  PHE C O   1 
ATOM   8893  C  CB  . PHE C 1 110 ? 26.082  6.242   61.887  1.00 59.56 ? 113  PHE C CB  1 
ATOM   8894  C  CG  . PHE C 1 110 ? 26.922  5.013   61.799  1.00 59.66 ? 113  PHE C CG  1 
ATOM   8895  C  CD1 . PHE C 1 110 ? 28.306  5.103   61.790  1.00 59.56 ? 113  PHE C CD1 1 
ATOM   8896  C  CD2 . PHE C 1 110 ? 26.333  3.756   61.763  1.00 59.83 ? 113  PHE C CD2 1 
ATOM   8897  C  CE1 . PHE C 1 110 ? 29.093  3.955   61.752  1.00 59.39 ? 113  PHE C CE1 1 
ATOM   8898  C  CE2 . PHE C 1 110 ? 27.112  2.599   61.724  1.00 59.49 ? 113  PHE C CE2 1 
ATOM   8899  C  CZ  . PHE C 1 110 ? 28.491  2.701   61.719  1.00 59.44 ? 113  PHE C CZ  1 
ATOM   8900  N  N   . SER C 1 111 ? 23.412  7.837   61.176  1.00 59.93 ? 114  SER C N   1 
ATOM   8901  C  CA  . SER C 1 111 ? 22.620  9.047   61.365  1.00 59.89 ? 114  SER C CA  1 
ATOM   8902  C  C   . SER C 1 111 ? 21.272  8.840   62.043  1.00 60.21 ? 114  SER C C   1 
ATOM   8903  O  O   . SER C 1 111 ? 20.728  7.736   62.061  1.00 60.39 ? 114  SER C O   1 
ATOM   8904  C  CB  . SER C 1 111 ? 22.353  9.680   60.003  1.00 59.80 ? 114  SER C CB  1 
ATOM   8905  O  OG  . SER C 1 111 ? 21.520  8.826   59.231  1.00 59.68 ? 114  SER C OG  1 
ATOM   8906  N  N   . THR C 1 112 ? 20.737  9.924   62.599  1.00 60.14 ? 115  THR C N   1 
ATOM   8907  C  CA  . THR C 1 112 ? 19.416  9.898   63.212  1.00 60.26 ? 115  THR C CA  1 
ATOM   8908  C  C   . THR C 1 112 ? 18.501  10.213  62.038  1.00 60.26 ? 115  THR C C   1 
ATOM   8909  O  O   . THR C 1 112 ? 18.967  10.264  60.900  1.00 60.75 ? 115  THR C O   1 
ATOM   8910  C  CB  . THR C 1 112 ? 19.253  10.984  64.274  1.00 60.41 ? 115  THR C CB  1 
ATOM   8911  O  OG1 . THR C 1 112 ? 19.639  12.251  63.725  1.00 60.69 ? 115  THR C OG1 1 
ATOM   8912  C  CG2 . THR C 1 112 ? 20.094  10.659  65.494  1.00 60.63 ? 115  THR C CG2 1 
ATOM   8913  N  N   . VAL C 1 113 ? 17.232  10.509  62.290  1.00 60.11 ? 116  VAL C N   1 
ATOM   8914  C  CA  . VAL C 1 113 ? 16.338  10.777  61.176  1.00 59.75 ? 116  VAL C CA  1 
ATOM   8915  C  C   . VAL C 1 113 ? 15.675  12.132  61.126  1.00 59.82 ? 116  VAL C C   1 
ATOM   8916  O  O   . VAL C 1 113 ? 15.745  12.815  60.110  1.00 59.87 ? 116  VAL C O   1 
ATOM   8917  C  CB  . VAL C 1 113 ? 15.244  9.715   61.089  1.00 59.69 ? 116  VAL C CB  1 
ATOM   8918  C  CG1 . VAL C 1 113 ? 14.250  10.072  60.007  1.00 59.54 ? 116  VAL C CG1 1 
ATOM   8919  C  CG2 . VAL C 1 113 ? 15.858  8.363   60.798  1.00 59.81 ? 116  VAL C CG2 1 
ATOM   8920  N  N   . ALA C 1 114 ? 15.004  12.507  62.205  1.00 59.85 ? 117  ALA C N   1 
ATOM   8921  C  CA  . ALA C 1 114 ? 14.272  13.767  62.243  1.00 60.35 ? 117  ALA C CA  1 
ATOM   8922  C  C   . ALA C 1 114 ? 15.073  15.071  62.341  1.00 60.71 ? 117  ALA C C   1 
ATOM   8923  O  O   . ALA C 1 114 ? 14.924  15.973  61.505  1.00 61.10 ? 117  ALA C O   1 
ATOM   8924  C  CB  . ALA C 1 114 ? 13.224  13.714  63.348  1.00 60.20 ? 117  ALA C CB  1 
ATOM   8925  N  N   . GLY C 1 115 ? 15.906  15.176  63.371  1.00 60.74 ? 118  GLY C N   1 
ATOM   8926  C  CA  . GLY C 1 115 ? 16.682  16.387  63.587  1.00 60.69 ? 118  GLY C CA  1 
ATOM   8927  C  C   . GLY C 1 115 ? 17.528  16.931  62.456  1.00 60.51 ? 118  GLY C C   1 
ATOM   8928  O  O   . GLY C 1 115 ? 17.977  16.193  61.575  1.00 60.79 ? 118  GLY C O   1 
ATOM   8929  N  N   . GLU C 1 116 ? 17.725  18.246  62.476  1.00 60.49 ? 119  GLU C N   1 
ATOM   8930  C  CA  . GLU C 1 116 ? 18.541  18.916  61.477  1.00 60.22 ? 119  GLU C CA  1 
ATOM   8931  C  C   . GLU C 1 116 ? 19.975  18.728  61.894  1.00 59.91 ? 119  GLU C C   1 
ATOM   8932  O  O   . GLU C 1 116 ? 20.282  17.932  62.786  1.00 60.19 ? 119  GLU C O   1 
ATOM   8933  C  CB  . GLU C 1 116 ? 18.280  20.413  61.435  1.00 60.41 ? 119  GLU C CB  1 
ATOM   8934  C  CG  . GLU C 1 116 ? 16.891  20.805  61.021  1.00 61.34 ? 119  GLU C CG  1 
ATOM   8935  C  CD  . GLU C 1 116 ? 15.892  20.739  62.164  1.00 62.31 ? 119  GLU C CD  1 
ATOM   8936  O  OE1 . GLU C 1 116 ? 16.308  20.638  63.341  1.00 62.33 ? 119  GLU C OE1 1 
ATOM   8937  O  OE2 . GLU C 1 116 ? 14.675  20.807  61.885  1.00 62.59 ? 119  GLU C OE2 1 
ATOM   8938  N  N   A SER C 1 117 ? 20.871  19.455  61.247  0.50 59.68 ? 120  SER C N   1 
ATOM   8939  N  N   B SER C 1 117 ? 20.846  19.472  61.253  0.50 60.00 ? 120  SER C N   1 
ATOM   8940  C  CA  A SER C 1 117 ? 22.305  19.349  61.515  0.50 59.32 ? 120  SER C CA  1 
ATOM   8941  C  CA  B SER C 1 117 ? 22.254  19.435  61.613  0.50 59.82 ? 120  SER C CA  1 
ATOM   8942  C  C   A SER C 1 117 ? 22.842  19.752  62.892  0.50 59.57 ? 120  SER C C   1 
ATOM   8943  C  C   B SER C 1 117 ? 22.232  20.394  62.810  0.50 59.93 ? 120  SER C C   1 
ATOM   8944  O  O   A SER C 1 117 ? 23.953  19.363  63.249  0.50 59.46 ? 120  SER C O   1 
ATOM   8945  O  O   B SER C 1 117 ? 21.587  21.454  62.752  0.50 59.93 ? 120  SER C O   1 
ATOM   8946  C  CB  A SER C 1 117 ? 23.062  20.116  60.436  0.50 58.88 ? 120  SER C CB  1 
ATOM   8947  C  CB  B SER C 1 117 ? 23.078  20.023  60.483  0.50 59.78 ? 120  SER C CB  1 
ATOM   8948  O  OG  A SER C 1 117 ? 22.693  19.644  59.148  0.50 58.07 ? 120  SER C OG  1 
ATOM   8949  O  OG  B SER C 1 117 ? 22.801  19.385  59.244  0.50 59.46 ? 120  SER C OG  1 
ATOM   8950  N  N   A GLY C 1 118 ? 22.068  20.504  63.670  0.50 59.62 ? 121  GLY C N   1 
ATOM   8951  N  N   B GLY C 1 118 ? 22.780  19.987  63.940  0.50 60.05 ? 121  GLY C N   1 
ATOM   8952  C  CA  A GLY C 1 118 ? 22.554  20.927  64.974  0.50 59.98 ? 121  GLY C CA  1 
ATOM   8953  C  CA  B GLY C 1 118 ? 22.695  20.879  65.081  0.50 59.79 ? 121  GLY C CA  1 
ATOM   8954  C  C   A GLY C 1 118 ? 21.951  20.183  66.151  0.50 60.19 ? 121  GLY C C   1 
ATOM   8955  C  C   B GLY C 1 118 ? 22.005  20.121  66.198  0.50 59.90 ? 121  GLY C C   1 
ATOM   8956  O  O   A GLY C 1 118 ? 22.296  20.430  67.306  0.50 60.18 ? 121  GLY C O   1 
ATOM   8957  O  O   B GLY C 1 118 ? 22.297  20.346  67.375  0.50 60.18 ? 121  GLY C O   1 
ATOM   8958  N  N   . SER C 1 119 ? 21.069  19.236  65.833  1.00 60.44 ? 122  SER C N   1 
ATOM   8959  C  CA  . SER C 1 119 ? 20.367  18.422  66.826  1.00 59.80 ? 122  SER C CA  1 
ATOM   8960  C  C   . SER C 1 119 ? 21.329  17.433  67.456  1.00 60.30 ? 122  SER C C   1 
ATOM   8961  O  O   . SER C 1 119 ? 22.404  17.183  66.916  1.00 60.71 ? 122  SER C O   1 
ATOM   8962  C  CB  . SER C 1 119 ? 19.210  17.666  66.176  1.00 59.39 ? 122  SER C CB  1 
ATOM   8963  O  OG  . SER C 1 119 ? 19.698  16.880  65.112  1.00 59.22 ? 122  SER C OG  1 
ATOM   8964  N  N   . ALA C 1 120 ? 20.922  16.848  68.577  1.00 60.72 ? 123  ALA C N   1 
ATOM   8965  C  CA  . ALA C 1 120 ? 21.751  15.902  69.313  1.00 61.11 ? 123  ALA C CA  1 
ATOM   8966  C  C   . ALA C 1 120 ? 21.716  14.490  68.761  1.00 61.44 ? 123  ALA C C   1 
ATOM   8967  O  O   . ALA C 1 120 ? 20.793  14.123  68.032  1.00 61.72 ? 123  ALA C O   1 
ATOM   8968  C  CB  . ALA C 1 120 ? 21.350  15.891  70.773  1.00 61.31 ? 123  ALA C CB  1 
ATOM   8969  N  N   . ASP C 1 121 ? 22.712  13.695  69.147  1.00 61.83 ? 124  ASP C N   1 
ATOM   8970  C  CA  . ASP C 1 121 ? 22.828  12.311  68.706  1.00 61.86 ? 124  ASP C CA  1 
ATOM   8971  C  C   . ASP C 1 121 ? 22.047  11.352  69.586  1.00 62.38 ? 124  ASP C C   1 
ATOM   8972  O  O   . ASP C 1 121 ? 21.432  10.406  69.093  1.00 62.77 ? 124  ASP C O   1 
ATOM   8973  C  CB  . ASP C 1 121 ? 24.290  11.864  68.724  1.00 62.11 ? 124  ASP C CB  1 
ATOM   8974  C  CG  . ASP C 1 121 ? 25.125  12.514  67.646  1.00 61.95 ? 124  ASP C CG  1 
ATOM   8975  O  OD1 . ASP C 1 121 ? 24.552  13.068  66.687  1.00 61.83 ? 124  ASP C OD1 1 
ATOM   8976  O  OD2 . ASP C 1 121 ? 26.369  12.450  67.757  1.00 61.95 ? 124  ASP C OD2 1 
ATOM   8977  N  N   . THR C 1 122 ? 22.106  11.574  70.893  1.00 62.32 ? 125  THR C N   1 
ATOM   8978  C  CA  . THR C 1 122 ? 21.437  10.693  71.843  1.00 62.29 ? 125  THR C CA  1 
ATOM   8979  C  C   . THR C 1 122 ? 19.947  10.920  72.055  1.00 62.45 ? 125  THR C C   1 
ATOM   8980  O  O   . THR C 1 122 ? 19.502  11.165  73.176  1.00 62.49 ? 125  THR C O   1 
ATOM   8981  C  CB  . THR C 1 122 ? 22.151  10.719  73.195  1.00 62.05 ? 125  THR C CB  1 
ATOM   8982  O  OG1 . THR C 1 122 ? 22.224  12.066  73.675  1.00 62.22 ? 125  THR C OG1 1 
ATOM   8983  C  CG2 . THR C 1 122 ? 23.546  10.182  73.035  1.00 62.13 ? 125  THR C CG2 1 
ATOM   8984  N  N   . VAL C 1 123 ? 19.174  10.817  70.979  1.00 62.13 ? 126  VAL C N   1 
ATOM   8985  C  CA  . VAL C 1 123 ? 17.730  10.992  71.060  1.00 61.77 ? 126  VAL C CA  1 
ATOM   8986  C  C   . VAL C 1 123 ? 17.038  9.773   70.454  1.00 61.88 ? 126  VAL C C   1 
ATOM   8987  O  O   . VAL C 1 123 ? 17.632  9.032   69.658  1.00 62.28 ? 126  VAL C O   1 
ATOM   8988  C  CB  . VAL C 1 123 ? 17.270  12.255  70.312  1.00 61.30 ? 126  VAL C CB  1 
ATOM   8989  C  CG1 . VAL C 1 123 ? 17.973  13.475  70.871  1.00 60.87 ? 126  VAL C CG1 1 
ATOM   8990  C  CG2 . VAL C 1 123 ? 17.536  12.116  68.824  1.00 60.72 ? 126  VAL C CG2 1 
ATOM   8991  N  N   . ARG C 1 124 ? 15.797  9.537   70.864  1.00 61.80 ? 127  ARG C N   1 
ATOM   8992  C  CA  . ARG C 1 124 ? 15.047  8.417   70.332  1.00 61.49 ? 127  ARG C CA  1 
ATOM   8993  C  C   . ARG C 1 124 ? 14.740  8.740   68.882  1.00 61.20 ? 127  ARG C C   1 
ATOM   8994  O  O   . ARG C 1 124 ? 14.218  9.810   68.564  1.00 61.24 ? 127  ARG C O   1 
ATOM   8995  C  CB  . ARG C 1 124 ? 13.753  8.211   71.108  1.00 61.73 ? 127  ARG C CB  1 
ATOM   8996  C  CG  . ARG C 1 124 ? 13.060  6.894   70.767  1.00 62.46 ? 127  ARG C CG  1 
ATOM   8997  C  CD  . ARG C 1 124 ? 11.727  6.730   71.502  1.00 62.38 ? 127  ARG C CD  1 
ATOM   8998  N  NE  . ARG C 1 124 ? 11.887  6.707   72.954  1.00 62.22 ? 127  ARG C NE  1 
ATOM   8999  C  CZ  . ARG C 1 124 ? 12.465  5.717   73.623  1.00 62.08 ? 127  ARG C CZ  1 
ATOM   9000  N  NH1 . ARG C 1 124 ? 12.566  5.787   74.942  1.00 62.07 ? 127  ARG C NH1 1 
ATOM   9001  N  NH2 . ARG C 1 124 ? 12.932  4.655   72.975  1.00 61.98 ? 127  ARG C NH2 1 
ATOM   9002  N  N   . ASP C 1 125 ? 15.096  7.817   68.005  1.00 60.77 ? 128  ASP C N   1 
ATOM   9003  C  CA  . ASP C 1 125 ? 14.886  7.989   66.583  1.00 60.19 ? 128  ASP C CA  1 
ATOM   9004  C  C   . ASP C 1 125 ? 15.569  6.790   65.977  1.00 59.66 ? 128  ASP C C   1 
ATOM   9005  O  O   . ASP C 1 125 ? 16.511  6.261   66.559  1.00 60.23 ? 128  ASP C O   1 
ATOM   9006  C  CB  . ASP C 1 125 ? 15.615  9.250   66.111  1.00 60.45 ? 128  ASP C CB  1 
ATOM   9007  C  CG  . ASP C 1 125 ? 14.835  10.025  65.072  1.00 60.79 ? 128  ASP C CG  1 
ATOM   9008  O  OD1 . ASP C 1 125 ? 15.429  10.894  64.401  1.00 60.57 ? 128  ASP C OD1 1 
ATOM   9009  O  OD2 . ASP C 1 125 ? 13.620  9.783   64.930  1.00 61.12 ? 128  ASP C OD2 1 
ATOM   9010  N  N   . PRO C 1 126 ? 15.062  6.281   64.850  1.00 58.75 ? 129  PRO C N   1 
ATOM   9011  C  CA  . PRO C 1 126 ? 15.774  5.129   64.294  1.00 58.08 ? 129  PRO C CA  1 
ATOM   9012  C  C   . PRO C 1 126 ? 17.127  5.651   63.821  1.00 57.59 ? 129  PRO C C   1 
ATOM   9013  O  O   . PRO C 1 126 ? 17.375  6.862   63.867  1.00 57.67 ? 129  PRO C O   1 
ATOM   9014  C  CB  . PRO C 1 126 ? 14.881  4.704   63.130  1.00 57.88 ? 129  PRO C CB  1 
ATOM   9015  C  CG  . PRO C 1 126 ? 14.156  5.954   62.773  1.00 58.14 ? 129  PRO C CG  1 
ATOM   9016  C  CD  . PRO C 1 126 ? 13.838  6.567   64.095  1.00 58.37 ? 129  PRO C CD  1 
ATOM   9017  N  N   . ARG C 1 127 ? 18.026  4.757   63.429  1.00 56.91 ? 130  ARG C N   1 
ATOM   9018  C  CA  . ARG C 1 127 ? 19.333  5.206   62.980  1.00 56.13 ? 130  ARG C CA  1 
ATOM   9019  C  C   . ARG C 1 127 ? 19.647  4.731   61.582  1.00 56.14 ? 130  ARG C C   1 
ATOM   9020  O  O   . ARG C 1 127 ? 19.344  3.597   61.219  1.00 56.27 ? 130  ARG C O   1 
ATOM   9021  C  CB  . ARG C 1 127 ? 20.420  4.736   63.935  1.00 55.29 ? 130  ARG C CB  1 
ATOM   9022  C  CG  . ARG C 1 127 ? 20.297  5.275   65.359  1.00 54.56 ? 130  ARG C CG  1 
ATOM   9023  C  CD  . ARG C 1 127 ? 20.606  6.760   65.467  1.00 53.55 ? 130  ARG C CD  1 
ATOM   9024  N  NE  . ARG C 1 127 ? 20.732  7.156   66.868  1.00 53.22 ? 130  ARG C NE  1 
ATOM   9025  C  CZ  . ARG C 1 127 ? 19.711  7.505   67.645  1.00 53.04 ? 130  ARG C CZ  1 
ATOM   9026  N  NH1 . ARG C 1 127 ? 18.479  7.523   67.161  1.00 53.14 ? 130  ARG C NH1 1 
ATOM   9027  N  NH2 . ARG C 1 127 ? 19.913  7.799   68.921  1.00 52.84 ? 130  ARG C NH2 1 
ATOM   9028  N  N   . GLY C 1 128 ? 20.224  5.626   60.789  1.00 56.34 ? 131  GLY C N   1 
ATOM   9029  C  CA  . GLY C 1 128 ? 20.591  5.291   59.428  1.00 56.52 ? 131  GLY C CA  1 
ATOM   9030  C  C   . GLY C 1 128 ? 21.926  4.582   59.442  1.00 56.59 ? 131  GLY C C   1 
ATOM   9031  O  O   . GLY C 1 128 ? 22.800  4.906   60.246  1.00 56.40 ? 131  GLY C O   1 
ATOM   9032  N  N   . PHE C 1 129 ? 22.095  3.627   58.538  1.00 56.87 ? 132  PHE C N   1 
ATOM   9033  C  CA  . PHE C 1 129 ? 23.327  2.852   58.467  1.00 57.05 ? 132  PHE C CA  1 
ATOM   9034  C  C   . PHE C 1 129 ? 23.588  2.529   57.004  1.00 56.61 ? 132  PHE C C   1 
ATOM   9035  O  O   . PHE C 1 129 ? 23.370  1.406   56.543  1.00 56.67 ? 132  PHE C O   1 
ATOM   9036  C  CB  . PHE C 1 129 ? 23.147  1.571   59.274  1.00 57.83 ? 132  PHE C CB  1 
ATOM   9037  C  CG  . PHE C 1 129 ? 24.421  0.870   59.623  1.00 58.56 ? 132  PHE C CG  1 
ATOM   9038  C  CD1 . PHE C 1 129 ? 25.544  0.969   58.818  1.00 58.75 ? 132  PHE C CD1 1 
ATOM   9039  C  CD2 . PHE C 1 129 ? 24.479  0.075   60.758  1.00 58.76 ? 132  PHE C CD2 1 
ATOM   9040  C  CE1 . PHE C 1 129 ? 26.704  0.281   59.140  1.00 59.27 ? 132  PHE C CE1 1 
ATOM   9041  C  CE2 . PHE C 1 129 ? 25.630  -0.617  61.091  1.00 59.24 ? 132  PHE C CE2 1 
ATOM   9042  C  CZ  . PHE C 1 129 ? 26.745  -0.517  60.282  1.00 59.58 ? 132  PHE C CZ  1 
ATOM   9043  N  N   . ALA C 1 130 ? 24.067  3.536   56.286  1.00 55.94 ? 133  ALA C N   1 
ATOM   9044  C  CA  . ALA C 1 130 ? 24.341  3.413   54.872  1.00 55.40 ? 133  ALA C CA  1 
ATOM   9045  C  C   . ALA C 1 130 ? 25.731  2.887   54.606  1.00 55.31 ? 133  ALA C C   1 
ATOM   9046  O  O   . ALA C 1 130 ? 26.702  3.329   55.218  1.00 55.61 ? 133  ALA C O   1 
ATOM   9047  C  CB  . ALA C 1 130 ? 24.155  4.746   54.212  1.00 55.76 ? 133  ALA C CB  1 
ATOM   9048  N  N   . VAL C 1 131 ? 25.826  1.981   53.641  1.00 55.35 ? 134  VAL C N   1 
ATOM   9049  C  CA  . VAL C 1 131 ? 27.096  1.370   53.273  1.00 55.37 ? 134  VAL C CA  1 
ATOM   9050  C  C   . VAL C 1 131 ? 27.375  1.490   51.779  1.00 55.53 ? 134  VAL C C   1 
ATOM   9051  O  O   . VAL C 1 131 ? 26.528  1.118   50.955  1.00 55.74 ? 134  VAL C O   1 
ATOM   9052  C  CB  . VAL C 1 131 ? 27.082  -0.132  53.588  1.00 55.67 ? 134  VAL C CB  1 
ATOM   9053  C  CG1 . VAL C 1 131 ? 28.464  -0.720  53.397  1.00 55.58 ? 134  VAL C CG1 1 
ATOM   9054  C  CG2 . VAL C 1 131 ? 26.575  -0.379  54.989  1.00 55.28 ? 134  VAL C CG2 1 
ATOM   9055  N  N   . LYS C 1 132 ? 28.569  1.959   51.426  1.00 55.26 ? 135  LYS C N   1 
ATOM   9056  C  CA  . LYS C 1 132 ? 28.934  2.085   50.021  1.00 55.08 ? 135  LYS C CA  1 
ATOM   9057  C  C   . LYS C 1 132 ? 30.093  1.166   49.694  1.00 55.59 ? 135  LYS C C   1 
ATOM   9058  O  O   . LYS C 1 132 ? 31.193  1.334   50.222  1.00 55.64 ? 135  LYS C O   1 
ATOM   9059  C  CB  . LYS C 1 132 ? 29.322  3.514   49.683  1.00 54.55 ? 135  LYS C CB  1 
ATOM   9060  C  CG  . LYS C 1 132 ? 29.707  3.700   48.233  1.00 53.87 ? 135  LYS C CG  1 
ATOM   9061  C  CD  . LYS C 1 132 ? 30.110  5.136   47.947  1.00 53.58 ? 135  LYS C CD  1 
ATOM   9062  C  CE  . LYS C 1 132 ? 28.946  6.096   48.129  1.00 53.38 ? 135  LYS C CE  1 
ATOM   9063  N  NZ  . LYS C 1 132 ? 27.835  5.838   47.174  1.00 53.16 ? 135  LYS C NZ  1 
ATOM   9064  N  N   . PHE C 1 133 ? 29.829  0.184   48.838  1.00 56.30 ? 136  PHE C N   1 
ATOM   9065  C  CA  . PHE C 1 133 ? 30.841  -0.780  48.424  1.00 56.92 ? 136  PHE C CA  1 
ATOM   9066  C  C   . PHE C 1 133 ? 31.397  -0.352  47.082  1.00 57.36 ? 136  PHE C C   1 
ATOM   9067  O  O   . PHE C 1 133 ? 30.672  -0.338  46.084  1.00 57.70 ? 136  PHE C O   1 
ATOM   9068  C  CB  . PHE C 1 133 ? 30.225  -2.164  48.227  1.00 57.09 ? 136  PHE C CB  1 
ATOM   9069  C  CG  . PHE C 1 133 ? 29.562  -2.731  49.445  1.00 57.16 ? 136  PHE C CG  1 
ATOM   9070  C  CD1 . PHE C 1 133 ? 28.276  -2.333  49.807  1.00 57.23 ? 136  PHE C CD1 1 
ATOM   9071  C  CD2 . PHE C 1 133 ? 30.187  -3.730  50.181  1.00 57.12 ? 136  PHE C CD2 1 
ATOM   9072  C  CE1 . PHE C 1 133 ? 27.622  -2.932  50.883  1.00 56.94 ? 136  PHE C CE1 1 
ATOM   9073  C  CE2 . PHE C 1 133 ? 29.541  -4.330  51.251  1.00 56.95 ? 136  PHE C CE2 1 
ATOM   9074  C  CZ  . PHE C 1 133 ? 28.258  -3.934  51.603  1.00 56.79 ? 136  PHE C CZ  1 
ATOM   9075  N  N   . TYR C 1 134 ? 32.681  -0.046  47.032  1.00 57.39 ? 137  TYR C N   1 
ATOM   9076  C  CA  . TYR C 1 134 ? 33.265  0.360   45.772  1.00 57.78 ? 137  TYR C CA  1 
ATOM   9077  C  C   . TYR C 1 134 ? 33.749  -0.890  45.059  1.00 58.21 ? 137  TYR C C   1 
ATOM   9078  O  O   . TYR C 1 134 ? 34.914  -1.262  45.190  1.00 58.54 ? 137  TYR C O   1 
ATOM   9079  C  CB  . TYR C 1 134 ? 34.430  1.301   46.033  1.00 57.70 ? 137  TYR C CB  1 
ATOM   9080  C  CG  . TYR C 1 134 ? 34.071  2.547   46.814  1.00 57.18 ? 137  TYR C CG  1 
ATOM   9081  C  CD1 . TYR C 1 134 ? 33.722  3.727   46.158  1.00 57.05 ? 137  TYR C CD1 1 
ATOM   9082  C  CD2 . TYR C 1 134 ? 34.146  2.567   48.206  1.00 57.23 ? 137  TYR C CD2 1 
ATOM   9083  C  CE1 . TYR C 1 134 ? 33.472  4.900   46.866  1.00 56.74 ? 137  TYR C CE1 1 
ATOM   9084  C  CE2 . TYR C 1 134 ? 33.896  3.736   48.923  1.00 56.85 ? 137  TYR C CE2 1 
ATOM   9085  C  CZ  . TYR C 1 134 ? 33.560  4.897   48.245  1.00 56.77 ? 137  TYR C CZ  1 
ATOM   9086  O  OH  . TYR C 1 134 ? 33.330  6.060   48.946  1.00 56.82 ? 137  TYR C OH  1 
ATOM   9087  N  N   . THR C 1 135 ? 32.866  -1.543  44.307  1.00 58.60 ? 138  THR C N   1 
ATOM   9088  C  CA  . THR C 1 135 ? 33.239  -2.774  43.612  1.00 59.11 ? 138  THR C CA  1 
ATOM   9089  C  C   . THR C 1 135 ? 33.678  -2.552  42.182  1.00 59.73 ? 138  THR C C   1 
ATOM   9090  O  O   . THR C 1 135 ? 33.477  -1.480  41.625  1.00 59.99 ? 138  THR C O   1 
ATOM   9091  C  CB  . THR C 1 135 ? 32.089  -3.772  43.574  1.00 58.99 ? 138  THR C CB  1 
ATOM   9092  O  OG1 . THR C 1 135 ? 31.349  -3.601  42.358  1.00 59.18 ? 138  THR C OG1 1 
ATOM   9093  C  CG2 . THR C 1 135 ? 31.162  -3.552  44.755  1.00 59.20 ? 138  THR C CG2 1 
ATOM   9094  N  N   . GLU C 1 136 ? 34.226  -3.599  41.575  1.00 60.52 ? 139  GLU C N   1 
ATOM   9095  C  CA  . GLU C 1 136 ? 34.682  -3.532  40.192  1.00 61.65 ? 139  GLU C CA  1 
ATOM   9096  C  C   . GLU C 1 136 ? 33.489  -3.433  39.256  1.00 61.89 ? 139  GLU C C   1 
ATOM   9097  O  O   . GLU C 1 136 ? 33.637  -3.072  38.088  1.00 61.94 ? 139  GLU C O   1 
ATOM   9098  C  CB  . GLU C 1 136 ? 35.504  -4.762  39.811  1.00 62.39 ? 139  GLU C CB  1 
ATOM   9099  C  CG  . GLU C 1 136 ? 36.511  -5.195  40.836  1.00 64.09 ? 139  GLU C CG  1 
ATOM   9100  C  CD  . GLU C 1 136 ? 35.922  -6.192  41.794  1.00 65.37 ? 139  GLU C CD  1 
ATOM   9101  O  OE1 . GLU C 1 136 ? 35.903  -7.390  41.437  1.00 65.82 ? 139  GLU C OE1 1 
ATOM   9102  O  OE2 . GLU C 1 136 ? 35.464  -5.783  42.886  1.00 66.22 ? 139  GLU C OE2 1 
ATOM   9103  N  N   . ASP C 1 137 ? 32.318  -3.828  39.742  1.00 62.05 ? 140  ASP C N   1 
ATOM   9104  C  CA  . ASP C 1 137 ? 31.119  -3.745  38.927  1.00 62.19 ? 140  ASP C CA  1 
ATOM   9105  C  C   . ASP C 1 137 ? 30.334  -2.507  39.305  1.00 62.08 ? 140  ASP C C   1 
ATOM   9106  O  O   . ASP C 1 137 ? 29.124  -2.422  39.101  1.00 61.96 ? 140  ASP C O   1 
ATOM   9107  C  CB  . ASP C 1 137 ? 30.280  -5.013  39.047  1.00 62.63 ? 140  ASP C CB  1 
ATOM   9108  C  CG  . ASP C 1 137 ? 30.701  -6.081  38.049  1.00 62.92 ? 140  ASP C CG  1 
ATOM   9109  O  OD1 . ASP C 1 137 ? 29.990  -7.099  37.925  1.00 63.47 ? 140  ASP C OD1 1 
ATOM   9110  O  OD2 . ASP C 1 137 ? 31.741  -5.902  37.376  1.00 63.21 ? 140  ASP C OD2 1 
ATOM   9111  N  N   . GLY C 1 138 ? 31.070  -1.519  39.802  1.00 62.30 ? 141  GLY C N   1 
ATOM   9112  C  CA  . GLY C 1 138 ? 30.468  -0.265  40.203  1.00 62.14 ? 141  GLY C CA  1 
ATOM   9113  C  C   . GLY C 1 138 ? 30.233  -0.216  41.692  1.00 61.93 ? 141  GLY C C   1 
ATOM   9114  O  O   . GLY C 1 138 ? 30.632  -1.124  42.432  1.00 62.25 ? 141  GLY C O   1 
ATOM   9115  N  N   . ASN C 1 139 ? 29.604  0.859   42.143  1.00 61.33 ? 142  ASN C N   1 
ATOM   9116  C  CA  . ASN C 1 139 ? 29.327  0.995   43.553  1.00 61.03 ? 142  ASN C CA  1 
ATOM   9117  C  C   . ASN C 1 139 ? 28.015  0.328   43.908  1.00 61.05 ? 142  ASN C C   1 
ATOM   9118  O  O   . ASN C 1 139 ? 27.059  0.379   43.135  1.00 61.22 ? 142  ASN C O   1 
ATOM   9119  C  CB  . ASN C 1 139 ? 29.290  2.468   43.946  1.00 60.74 ? 142  ASN C CB  1 
ATOM   9120  C  CG  . ASN C 1 139 ? 30.657  3.116   43.894  1.00 60.53 ? 142  ASN C CG  1 
ATOM   9121  O  OD1 . ASN C 1 139 ? 30.777  4.341   43.899  1.00 60.48 ? 142  ASN C OD1 1 
ATOM   9122  N  ND2 . ASN C 1 139 ? 31.702  2.291   43.845  1.00 60.67 ? 142  ASN C ND2 1 
ATOM   9123  N  N   . TRP C 1 140 ? 27.999  -0.362  45.045  1.00 60.87 ? 143  TRP C N   1 
ATOM   9124  C  CA  . TRP C 1 140 ? 26.793  -1.010  45.532  1.00 60.41 ? 143  TRP C CA  1 
ATOM   9125  C  C   . TRP C 1 140 ? 26.452  -0.294  46.819  1.00 60.24 ? 143  TRP C C   1 
ATOM   9126  O  O   . TRP C 1 140 ? 27.240  -0.295  47.765  1.00 60.12 ? 143  TRP C O   1 
ATOM   9127  C  CB  . TRP C 1 140 ? 27.023  -2.493  45.822  1.00 60.51 ? 143  TRP C CB  1 
ATOM   9128  C  CG  . TRP C 1 140 ? 25.849  -3.151  46.521  1.00 60.63 ? 143  TRP C CG  1 
ATOM   9129  C  CD1 . TRP C 1 140 ? 24.522  -2.854  46.366  1.00 60.62 ? 143  TRP C CD1 1 
ATOM   9130  C  CD2 . TRP C 1 140 ? 25.913  -4.186  47.511  1.00 60.55 ? 143  TRP C CD2 1 
ATOM   9131  N  NE1 . TRP C 1 140 ? 23.759  -3.636  47.202  1.00 60.52 ? 143  TRP C NE1 1 
ATOM   9132  C  CE2 . TRP C 1 140 ? 24.587  -4.462  47.914  1.00 60.48 ? 143  TRP C CE2 1 
ATOM   9133  C  CE3 . TRP C 1 140 ? 26.960  -4.909  48.096  1.00 60.57 ? 143  TRP C CE3 1 
ATOM   9134  C  CZ2 . TRP C 1 140 ? 24.282  -5.427  48.875  1.00 60.56 ? 143  TRP C CZ2 1 
ATOM   9135  C  CZ3 . TRP C 1 140 ? 26.658  -5.871  49.055  1.00 60.42 ? 143  TRP C CZ3 1 
ATOM   9136  C  CH2 . TRP C 1 140 ? 25.327  -6.119  49.433  1.00 60.41 ? 143  TRP C CH2 1 
ATOM   9137  N  N   . ASP C 1 141 ? 25.288  0.342   46.838  1.00 60.18 ? 144  ASP C N   1 
ATOM   9138  C  CA  . ASP C 1 141 ? 24.851  1.065   48.013  1.00 60.02 ? 144  ASP C CA  1 
ATOM   9139  C  C   . ASP C 1 141 ? 23.771  0.331   48.753  1.00 60.07 ? 144  ASP C C   1 
ATOM   9140  O  O   . ASP C 1 141 ? 22.682  0.115   48.224  1.00 59.94 ? 144  ASP C O   1 
ATOM   9141  C  CB  . ASP C 1 141 ? 24.348  2.450   47.635  1.00 60.02 ? 144  ASP C CB  1 
ATOM   9142  C  CG  . ASP C 1 141 ? 25.473  3.419   47.359  1.00 60.09 ? 144  ASP C CG  1 
ATOM   9143  O  OD1 . ASP C 1 141 ? 25.244  4.398   46.620  1.00 60.56 ? 144  ASP C OD1 1 
ATOM   9144  O  OD2 . ASP C 1 141 ? 26.586  3.208   47.883  1.00 60.00 ? 144  ASP C OD2 1 
ATOM   9145  N  N   . LEU C 1 142 ? 24.099  -0.089  49.967  1.00 59.96 ? 145  LEU C N   1 
ATOM   9146  C  CA  . LEU C 1 142 ? 23.150  -0.781  50.813  1.00 60.16 ? 145  LEU C CA  1 
ATOM   9147  C  C   . LEU C 1 142 ? 22.777  0.258   51.842  1.00 60.26 ? 145  LEU C C   1 
ATOM   9148  O  O   . LEU C 1 142 ? 23.436  0.398   52.869  1.00 60.35 ? 145  LEU C O   1 
ATOM   9149  C  CB  . LEU C 1 142 ? 23.801  -1.984  51.488  1.00 60.50 ? 145  LEU C CB  1 
ATOM   9150  C  CG  . LEU C 1 142 ? 22.849  -2.864  52.297  1.00 60.55 ? 145  LEU C CG  1 
ATOM   9151  C  CD1 . LEU C 1 142 ? 21.674  -3.273  51.428  1.00 60.69 ? 145  LEU C CD1 1 
ATOM   9152  C  CD2 . LEU C 1 142 ? 23.579  -4.086  52.823  1.00 60.50 ? 145  LEU C CD2 1 
ATOM   9153  N  N   . VAL C 1 143 ? 21.754  1.037   51.524  1.00 60.85 ? 146  VAL C N   1 
ATOM   9154  C  CA  . VAL C 1 143 ? 21.312  2.102   52.404  1.00 61.22 ? 146  VAL C CA  1 
ATOM   9155  C  C   . VAL C 1 143 ? 20.333  1.563   53.427  1.00 61.66 ? 146  VAL C C   1 
ATOM   9156  O  O   . VAL C 1 143 ? 19.114  1.696   53.269  1.00 61.77 ? 146  VAL C O   1 
ATOM   9157  C  CB  . VAL C 1 143 ? 20.644  3.223   51.602  1.00 61.33 ? 146  VAL C CB  1 
ATOM   9158  C  CG1 . VAL C 1 143 ? 20.408  4.430   52.489  1.00 60.93 ? 146  VAL C CG1 1 
ATOM   9159  C  CG2 . VAL C 1 143 ? 21.502  3.583   50.397  1.00 61.00 ? 146  VAL C CG2 1 
ATOM   9160  N  N   . GLY C 1 144 ? 20.871  0.987   54.496  1.00 61.87 ? 147  GLY C N   1 
ATOM   9161  C  CA  . GLY C 1 144 ? 20.017  0.421   55.520  1.00 62.16 ? 147  GLY C CA  1 
ATOM   9162  C  C   . GLY C 1 144 ? 19.768  1.256   56.765  1.00 62.24 ? 147  GLY C C   1 
ATOM   9163  O  O   . GLY C 1 144 ? 20.193  2.415   56.863  1.00 62.49 ? 147  GLY C O   1 
ATOM   9164  N  N   . ASN C 1 145 ? 19.043  0.651   57.704  1.00 61.87 ? 148  ASN C N   1 
ATOM   9165  C  CA  . ASN C 1 145 ? 18.717  1.271   58.980  1.00 61.35 ? 148  ASN C CA  1 
ATOM   9166  C  C   . ASN C 1 145 ? 19.065  0.305   60.094  1.00 61.02 ? 148  ASN C C   1 
ATOM   9167  O  O   . ASN C 1 145 ? 19.440  -0.844  59.840  1.00 61.21 ? 148  ASN C O   1 
ATOM   9168  C  CB  . ASN C 1 145 ? 17.229  1.596   59.057  1.00 61.13 ? 148  ASN C CB  1 
ATOM   9169  C  CG  . ASN C 1 145 ? 16.906  2.978   58.541  1.00 61.05 ? 148  ASN C CG  1 
ATOM   9170  O  OD1 . ASN C 1 145 ? 17.789  3.830   58.397  1.00 61.44 ? 148  ASN C OD1 1 
ATOM   9171  N  ND2 . ASN C 1 145 ? 15.628  3.219   58.275  1.00 60.60 ? 148  ASN C ND2 1 
ATOM   9172  N  N   . ASN C 1 146 ? 18.943  0.772   61.331  1.00 60.78 ? 149  ASN C N   1 
ATOM   9173  C  CA  . ASN C 1 146 ? 19.225  -0.071  62.478  1.00 60.38 ? 149  ASN C CA  1 
ATOM   9174  C  C   . ASN C 1 146 ? 18.005  -0.941  62.782  1.00 60.17 ? 149  ASN C C   1 
ATOM   9175  O  O   . ASN C 1 146 ? 17.960  -1.613  63.809  1.00 60.15 ? 149  ASN C O   1 
ATOM   9176  C  CB  . ASN C 1 146 ? 19.615  0.776   63.698  1.00 60.29 ? 149  ASN C CB  1 
ATOM   9177  C  CG  . ASN C 1 146 ? 18.492  1.689   64.173  1.00 60.27 ? 149  ASN C CG  1 
ATOM   9178  O  OD1 . ASN C 1 146 ? 17.653  2.128   63.388  1.00 60.69 ? 149  ASN C OD1 1 
ATOM   9179  N  ND2 . ASN C 1 146 ? 18.483  1.987   65.467  1.00 60.25 ? 149  ASN C ND2 1 
ATOM   9180  N  N   . THR C 1 147 ? 17.021  -0.926  61.882  1.00 59.67 ? 150  THR C N   1 
ATOM   9181  C  CA  . THR C 1 147 ? 15.804  -1.720  62.037  1.00 59.11 ? 150  THR C CA  1 
ATOM   9182  C  C   . THR C 1 147 ? 15.497  -2.459  60.750  1.00 58.80 ? 150  THR C C   1 
ATOM   9183  O  O   . THR C 1 147 ? 15.683  -1.927  59.659  1.00 58.80 ? 150  THR C O   1 
ATOM   9184  C  CB  . THR C 1 147 ? 14.585  -0.854  62.380  1.00 59.18 ? 150  THR C CB  1 
ATOM   9185  O  OG1 . THR C 1 147 ? 13.389  -1.606  62.136  1.00 58.77 ? 150  THR C OG1 1 
ATOM   9186  C  CG2 . THR C 1 147 ? 14.569  0.410   61.534  1.00 59.24 ? 150  THR C CG2 1 
ATOM   9187  N  N   . PRO C 1 148 ? 14.996  -3.693  60.864  1.00 58.46 ? 151  PRO C N   1 
ATOM   9188  C  CA  . PRO C 1 148 ? 14.661  -4.508  59.697  1.00 58.47 ? 151  PRO C CA  1 
ATOM   9189  C  C   . PRO C 1 148 ? 13.355  -4.079  59.061  1.00 58.62 ? 151  PRO C C   1 
ATOM   9190  O  O   . PRO C 1 148 ? 13.012  -4.535  57.976  1.00 58.83 ? 151  PRO C O   1 
ATOM   9191  C  CB  . PRO C 1 148 ? 14.515  -5.893  60.300  1.00 58.36 ? 151  PRO C CB  1 
ATOM   9192  C  CG  . PRO C 1 148 ? 13.887  -5.583  61.619  1.00 58.12 ? 151  PRO C CG  1 
ATOM   9193  C  CD  . PRO C 1 148 ? 14.724  -4.433  62.108  1.00 58.38 ? 151  PRO C CD  1 
ATOM   9194  N  N   . ILE C 1 149 ? 12.625  -3.200  59.731  1.00 58.64 ? 152  ILE C N   1 
ATOM   9195  C  CA  . ILE C 1 149 ? 11.337  -2.757  59.219  1.00 58.89 ? 152  ILE C CA  1 
ATOM   9196  C  C   . ILE C 1 149 ? 11.206  -1.245  59.232  1.00 59.15 ? 152  ILE C C   1 
ATOM   9197  O  O   . ILE C 1 149 ? 12.128  -0.541  59.649  1.00 59.44 ? 152  ILE C O   1 
ATOM   9198  C  CB  . ILE C 1 149 ? 10.203  -3.313  60.081  1.00 58.85 ? 152  ILE C CB  1 
ATOM   9199  C  CG1 . ILE C 1 149 ? 10.417  -2.879  61.534  1.00 58.77 ? 152  ILE C CG1 1 
ATOM   9200  C  CG2 . ILE C 1 149 ? 10.141  -4.828  59.968  1.00 58.67 ? 152  ILE C CG2 1 
ATOM   9201  C  CD1 . ILE C 1 149 ? 9.335   -3.326  62.478  1.00 59.19 ? 152  ILE C CD1 1 
ATOM   9202  N  N   . PHE C 1 150 ? 10.042  -0.756  58.805  1.00 59.37 ? 153  PHE C N   1 
ATOM   9203  C  CA  . PHE C 1 150 ? 9.778   0.679   58.785  1.00 59.46 ? 153  PHE C CA  1 
ATOM   9204  C  C   . PHE C 1 150 ? 8.323   0.979   59.136  1.00 59.54 ? 153  PHE C C   1 
ATOM   9205  O  O   . PHE C 1 150 ? 7.481   0.078   59.164  1.00 59.77 ? 153  PHE C O   1 
ATOM   9206  C  CB  . PHE C 1 150 ? 10.128  1.276   57.425  1.00 59.72 ? 153  PHE C CB  1 
ATOM   9207  C  CG  . PHE C 1 150 ? 10.386  2.758   57.460  1.00 59.48 ? 153  PHE C CG  1 
ATOM   9208  C  CD1 . PHE C 1 150 ? 9.483   3.649   56.890  1.00 59.41 ? 153  PHE C CD1 1 
ATOM   9209  C  CD2 . PHE C 1 150 ? 11.541  3.262   58.050  1.00 59.49 ? 153  PHE C CD2 1 
ATOM   9210  C  CE1 . PHE C 1 150 ? 9.728   5.014   56.908  1.00 59.10 ? 153  PHE C CE1 1 
ATOM   9211  C  CE2 . PHE C 1 150 ? 11.793  4.629   58.072  1.00 59.16 ? 153  PHE C CE2 1 
ATOM   9212  C  CZ  . PHE C 1 150 ? 10.885  5.504   57.500  1.00 59.12 ? 153  PHE C CZ  1 
ATOM   9213  N  N   . PHE C 1 151 ? 8.046   2.254   59.392  1.00 59.34 ? 154  PHE C N   1 
ATOM   9214  C  CA  . PHE C 1 151 ? 6.722   2.735   59.782  1.00 58.86 ? 154  PHE C CA  1 
ATOM   9215  C  C   . PHE C 1 151 ? 5.610   2.571   58.764  1.00 58.96 ? 154  PHE C C   1 
ATOM   9216  O  O   . PHE C 1 151 ? 4.447   2.452   59.143  1.00 59.11 ? 154  PHE C O   1 
ATOM   9217  C  CB  . PHE C 1 151 ? 6.810   4.205   60.171  1.00 58.48 ? 154  PHE C CB  1 
ATOM   9218  C  CG  . PHE C 1 151 ? 7.855   4.490   61.203  1.00 58.22 ? 154  PHE C CG  1 
ATOM   9219  C  CD1 . PHE C 1 151 ? 9.165   4.748   60.827  1.00 57.99 ? 154  PHE C CD1 1 
ATOM   9220  C  CD2 . PHE C 1 151 ? 7.533   4.489   62.553  1.00 58.14 ? 154  PHE C CD2 1 
ATOM   9221  C  CE1 . PHE C 1 151 ? 10.138  4.999   61.780  1.00 57.77 ? 154  PHE C CE1 1 
ATOM   9222  C  CE2 . PHE C 1 151 ? 8.500   4.738   63.513  1.00 57.85 ? 154  PHE C CE2 1 
ATOM   9223  C  CZ  . PHE C 1 151 ? 9.806   4.995   63.125  1.00 57.71 ? 154  PHE C CZ  1 
ATOM   9224  N  N   . ILE C 1 152 ? 5.949   2.610   57.480  1.00 58.58 ? 155  ILE C N   1 
ATOM   9225  C  CA  . ILE C 1 152 ? 4.943   2.476   56.432  1.00 57.77 ? 155  ILE C CA  1 
ATOM   9226  C  C   . ILE C 1 152 ? 5.339   1.460   55.372  1.00 57.29 ? 155  ILE C C   1 
ATOM   9227  O  O   . ILE C 1 152 ? 6.491   1.034   55.307  1.00 57.48 ? 155  ILE C O   1 
ATOM   9228  C  CB  . ILE C 1 152 ? 4.661   3.829   55.770  1.00 57.70 ? 155  ILE C CB  1 
ATOM   9229  C  CG1 . ILE C 1 152 ? 5.968   4.466   55.293  1.00 57.49 ? 155  ILE C CG1 1 
ATOM   9230  C  CG2 . ILE C 1 152 ? 3.955   4.739   56.753  1.00 57.76 ? 155  ILE C CG2 1 
ATOM   9231  C  CD1 . ILE C 1 152 ? 5.790   5.810   54.608  1.00 57.15 ? 155  ILE C CD1 1 
ATOM   9232  N  N   . ARG C 1 153 ? 4.379   1.083   54.538  1.00 56.82 ? 156  ARG C N   1 
ATOM   9233  C  CA  . ARG C 1 153 ? 4.620   0.106   53.495  1.00 56.23 ? 156  ARG C CA  1 
ATOM   9234  C  C   . ARG C 1 153 ? 4.389   0.643   52.086  1.00 56.29 ? 156  ARG C C   1 
ATOM   9235  O  O   . ARG C 1 153 ? 4.370   -0.124  51.137  1.00 56.30 ? 156  ARG C O   1 
ATOM   9236  C  CB  . ARG C 1 153 ? 3.764   -1.143  53.745  1.00 55.44 ? 156  ARG C CB  1 
ATOM   9237  C  CG  . ARG C 1 153 ? 2.270   -0.860  53.871  1.00 54.33 ? 156  ARG C CG  1 
ATOM   9238  C  CD  . ARG C 1 153 ? 1.475   -2.123  54.176  1.00 53.43 ? 156  ARG C CD  1 
ATOM   9239  N  NE  . ARG C 1 153 ? 1.777   -2.669  55.498  1.00 52.96 ? 156  ARG C NE  1 
ATOM   9240  C  CZ  . ARG C 1 153 ? 0.868   -2.861  56.450  1.00 52.63 ? 156  ARG C CZ  1 
ATOM   9241  N  NH1 . ARG C 1 153 ? -0.401  -2.558  56.224  1.00 52.11 ? 156  ARG C NH1 1 
ATOM   9242  N  NH2 . ARG C 1 153 ? 1.231   -3.329  57.639  1.00 52.63 ? 156  ARG C NH2 1 
ATOM   9243  N  N   . ASP C 1 154 ? 4.226   1.953   51.941  1.00 56.55 ? 157  ASP C N   1 
ATOM   9244  C  CA  . ASP C 1 154 ? 4.018   2.546   50.620  1.00 56.97 ? 157  ASP C CA  1 
ATOM   9245  C  C   . ASP C 1 154 ? 4.700   3.914   50.574  1.00 57.37 ? 157  ASP C C   1 
ATOM   9246  O  O   . ASP C 1 154 ? 4.371   4.815   51.347  1.00 57.85 ? 157  ASP C O   1 
ATOM   9247  C  CB  . ASP C 1 154 ? 2.529   2.666   50.307  1.00 56.86 ? 157  ASP C CB  1 
ATOM   9248  C  CG  . ASP C 1 154 ? 2.270   3.071   48.873  1.00 57.21 ? 157  ASP C CG  1 
ATOM   9249  O  OD1 . ASP C 1 154 ? 1.677   2.263   48.120  1.00 56.85 ? 157  ASP C OD1 1 
ATOM   9250  O  OD2 . ASP C 1 154 ? 2.667   4.197   48.496  1.00 57.69 ? 157  ASP C OD2 1 
ATOM   9251  N  N   . PRO C 1 155 ? 5.601   4.112   49.603  1.00 57.50 ? 158  PRO C N   1 
ATOM   9252  C  CA  . PRO C 1 155 ? 6.373   5.341   49.399  1.00 57.50 ? 158  PRO C CA  1 
ATOM   9253  C  C   . PRO C 1 155 ? 5.609   6.652   49.360  1.00 57.95 ? 158  PRO C C   1 
ATOM   9254  O  O   . PRO C 1 155 ? 6.058   7.652   49.921  1.00 57.85 ? 158  PRO C O   1 
ATOM   9255  C  CB  . PRO C 1 155 ? 7.074   5.070   48.077  1.00 57.32 ? 158  PRO C CB  1 
ATOM   9256  C  CG  . PRO C 1 155 ? 6.098   4.225   47.369  1.00 57.31 ? 158  PRO C CG  1 
ATOM   9257  C  CD  . PRO C 1 155 ? 5.726   3.242   48.427  1.00 57.34 ? 158  PRO C CD  1 
ATOM   9258  N  N   . ILE C 1 156 ? 4.436   6.646   48.747  1.00 58.32 ? 159  ILE C N   1 
ATOM   9259  C  CA  . ILE C 1 156 ? 3.664   7.873   48.633  1.00 58.69 ? 159  ILE C CA  1 
ATOM   9260  C  C   . ILE C 1 156 ? 3.278   8.548   49.962  1.00 58.85 ? 159  ILE C C   1 
ATOM   9261  O  O   . ILE C 1 156 ? 2.814   9.691   49.972  1.00 59.13 ? 159  ILE C O   1 
ATOM   9262  C  CB  . ILE C 1 156 ? 2.431   7.664   47.721  1.00 58.56 ? 159  ILE C CB  1 
ATOM   9263  C  CG1 . ILE C 1 156 ? 2.063   8.983   47.039  1.00 58.34 ? 159  ILE C CG1 1 
ATOM   9264  C  CG2 . ILE C 1 156 ? 1.255   7.111   48.516  1.00 58.90 ? 159  ILE C CG2 1 
ATOM   9265  C  CD1 . ILE C 1 156 ? 1.153   8.826   45.839  1.00 58.01 ? 159  ILE C CD1 1 
ATOM   9266  N  N   . LEU C 1 157 ? 3.486   7.861   51.081  1.00 58.78 ? 160  LEU C N   1 
ATOM   9267  C  CA  . LEU C 1 157 ? 3.159   8.444   52.381  1.00 58.53 ? 160  LEU C CA  1 
ATOM   9268  C  C   . LEU C 1 157 ? 4.392   8.917   53.109  1.00 58.21 ? 160  LEU C C   1 
ATOM   9269  O  O   . LEU C 1 157 ? 4.300   9.524   54.173  1.00 58.39 ? 160  LEU C O   1 
ATOM   9270  C  CB  . LEU C 1 157 ? 2.462   7.439   53.277  1.00 58.92 ? 160  LEU C CB  1 
ATOM   9271  C  CG  . LEU C 1 157 ? 1.089   6.958   52.840  1.00 59.41 ? 160  LEU C CG  1 
ATOM   9272  C  CD1 . LEU C 1 157 ? 1.238   5.870   51.790  1.00 59.75 ? 160  LEU C CD1 1 
ATOM   9273  C  CD2 . LEU C 1 157 ? 0.372   6.417   54.053  1.00 59.70 ? 160  LEU C CD2 1 
ATOM   9274  N  N   . PHE C 1 158 ? 5.553   8.603   52.560  1.00 57.70 ? 161  PHE C N   1 
ATOM   9275  C  CA  . PHE C 1 158 ? 6.791   8.998   53.195  1.00 57.14 ? 161  PHE C CA  1 
ATOM   9276  C  C   . PHE C 1 158 ? 6.892   10.495  53.450  1.00 56.96 ? 161  PHE C C   1 
ATOM   9277  O  O   . PHE C 1 158 ? 7.174   10.912  54.569  1.00 57.32 ? 161  PHE C O   1 
ATOM   9278  C  CB  . PHE C 1 158 ? 7.971   8.524   52.370  1.00 56.97 ? 161  PHE C CB  1 
ATOM   9279  C  CG  . PHE C 1 158 ? 9.285   8.679   53.056  1.00 56.73 ? 161  PHE C CG  1 
ATOM   9280  C  CD1 . PHE C 1 158 ? 10.130  9.729   52.734  1.00 56.91 ? 161  PHE C CD1 1 
ATOM   9281  C  CD2 . PHE C 1 158 ? 9.697   7.758   54.002  1.00 56.68 ? 161  PHE C CD2 1 
ATOM   9282  C  CE1 . PHE C 1 158 ? 11.375  9.858   53.340  1.00 56.80 ? 161  PHE C CE1 1 
ATOM   9283  C  CE2 . PHE C 1 158 ? 10.937  7.875   54.614  1.00 56.68 ? 161  PHE C CE2 1 
ATOM   9284  C  CZ  . PHE C 1 158 ? 11.779  8.928   54.281  1.00 56.81 ? 161  PHE C CZ  1 
ATOM   9285  N  N   . PRO C 1 159 ? 6.615   11.328  52.431  1.00 56.61 ? 162  PRO C N   1 
ATOM   9286  C  CA  . PRO C 1 159 ? 6.710   12.777  52.652  1.00 56.42 ? 162  PRO C CA  1 
ATOM   9287  C  C   . PRO C 1 159 ? 5.839   13.206  53.818  1.00 56.54 ? 162  PRO C C   1 
ATOM   9288  O  O   . PRO C 1 159 ? 6.288   13.934  54.709  1.00 56.91 ? 162  PRO C O   1 
ATOM   9289  C  CB  . PRO C 1 159 ? 6.187   13.354  51.345  1.00 56.15 ? 162  PRO C CB  1 
ATOM   9290  C  CG  . PRO C 1 159 ? 6.518   12.303  50.357  1.00 56.00 ? 162  PRO C CG  1 
ATOM   9291  C  CD  . PRO C 1 159 ? 6.146   11.044  51.069  1.00 56.44 ? 162  PRO C CD  1 
ATOM   9292  N  N   . SER C 1 160 ? 4.606   12.706  53.833  1.00 56.42 ? 163  SER C N   1 
ATOM   9293  C  CA  . SER C 1 160 ? 3.669   13.038  54.898  1.00 56.24 ? 163  SER C CA  1 
ATOM   9294  C  C   . SER C 1 160 ? 4.192   12.544  56.234  1.00 56.31 ? 163  SER C C   1 
ATOM   9295  O  O   . SER C 1 160 ? 4.178   13.277  57.227  1.00 56.44 ? 163  SER C O   1 
ATOM   9296  C  CB  . SER C 1 160 ? 2.304   12.422  54.622  1.00 56.03 ? 163  SER C CB  1 
ATOM   9297  O  OG  . SER C 1 160 ? 1.720   12.979  53.462  1.00 55.99 ? 163  SER C OG  1 
ATOM   9298  N  N   . PHE C 1 161 ? 4.664   11.301  56.249  1.00 56.35 ? 164  PHE C N   1 
ATOM   9299  C  CA  . PHE C 1 161 ? 5.197   10.713  57.467  1.00 56.44 ? 164  PHE C CA  1 
ATOM   9300  C  C   . PHE C 1 161 ? 6.308   11.592  57.976  1.00 56.78 ? 164  PHE C C   1 
ATOM   9301  O  O   . PHE C 1 161 ? 6.305   12.001  59.130  1.00 57.25 ? 164  PHE C O   1 
ATOM   9302  C  CB  . PHE C 1 161 ? 5.747   9.308   57.227  1.00 56.02 ? 164  PHE C CB  1 
ATOM   9303  C  CG  . PHE C 1 161 ? 6.514   8.769   58.397  1.00 55.37 ? 164  PHE C CG  1 
ATOM   9304  C  CD1 . PHE C 1 161 ? 7.848   8.444   58.281  1.00 55.03 ? 164  PHE C CD1 1 
ATOM   9305  C  CD2 . PHE C 1 161 ? 5.913   8.660   59.643  1.00 55.15 ? 164  PHE C CD2 1 
ATOM   9306  C  CE1 . PHE C 1 161 ? 8.577   8.023   59.396  1.00 54.85 ? 164  PHE C CE1 1 
ATOM   9307  C  CE2 . PHE C 1 161 ? 6.634   8.240   60.760  1.00 54.70 ? 164  PHE C CE2 1 
ATOM   9308  C  CZ  . PHE C 1 161 ? 7.964   7.925   60.634  1.00 54.59 ? 164  PHE C CZ  1 
ATOM   9309  N  N   . ILE C 1 162 ? 7.253   11.902  57.103  1.00 57.06 ? 165  ILE C N   1 
ATOM   9310  C  CA  . ILE C 1 162 ? 8.357   12.747  57.495  1.00 57.50 ? 165  ILE C CA  1 
ATOM   9311  C  C   . ILE C 1 162 ? 7.845   14.095  57.957  1.00 57.79 ? 165  ILE C C   1 
ATOM   9312  O  O   . ILE C 1 162 ? 8.321   14.637  58.953  1.00 58.24 ? 165  ILE C O   1 
ATOM   9313  C  CB  . ILE C 1 162 ? 9.337   12.936  56.354  1.00 57.45 ? 165  ILE C CB  1 
ATOM   9314  C  CG1 . ILE C 1 162 ? 9.922   11.580  55.970  1.00 57.30 ? 165  ILE C CG1 1 
ATOM   9315  C  CG2 . ILE C 1 162 ? 10.455  13.883  56.773  1.00 57.54 ? 165  ILE C CG2 1 
ATOM   9316  C  CD1 . ILE C 1 162 ? 10.541  10.832  57.146  1.00 56.84 ? 165  ILE C CD1 1 
ATOM   9317  N  N   . HIS C 1 163 ? 6.852   14.626  57.255  1.00 58.01 ? 166  HIS C N   1 
ATOM   9318  C  CA  . HIS C 1 163 ? 6.294   15.908  57.644  1.00 58.20 ? 166  HIS C CA  1 
ATOM   9319  C  C   . HIS C 1 163 ? 5.770   15.819  59.066  1.00 58.60 ? 166  HIS C C   1 
ATOM   9320  O  O   . HIS C 1 163 ? 6.075   16.672  59.899  1.00 58.56 ? 166  HIS C O   1 
ATOM   9321  C  CB  . HIS C 1 163 ? 5.187   16.329  56.682  1.00 57.96 ? 166  HIS C CB  1 
ATOM   9322  C  CG  . HIS C 1 163 ? 5.696   16.905  55.399  1.00 57.63 ? 166  HIS C CG  1 
ATOM   9323  N  ND1 . HIS C 1 163 ? 4.867   17.435  54.434  1.00 57.63 ? 166  HIS C ND1 1 
ATOM   9324  C  CD2 . HIS C 1 163 ? 6.958   17.051  54.928  1.00 57.66 ? 166  HIS C CD2 1 
ATOM   9325  C  CE1 . HIS C 1 163 ? 5.593   17.881  53.425  1.00 57.51 ? 166  HIS C CE1 1 
ATOM   9326  N  NE2 . HIS C 1 163 ? 6.865   17.661  53.701  1.00 57.53 ? 166  HIS C NE2 1 
ATOM   9327  N  N   . SER C 1 164 ? 5.068   14.733  59.374  1.00 59.09 ? 167  SER C N   1 
ATOM   9328  C  CA  . SER C 1 164 ? 4.518   14.558  60.715  1.00 59.50 ? 167  SER C CA  1 
ATOM   9329  C  C   . SER C 1 164 ? 5.598   14.435  61.790  1.00 60.01 ? 167  SER C C   1 
ATOM   9330  O  O   . SER C 1 164 ? 5.410   14.884  62.917  1.00 60.43 ? 167  SER C O   1 
ATOM   9331  C  CB  . SER C 1 164 ? 3.572   13.353  60.767  1.00 59.27 ? 167  SER C CB  1 
ATOM   9332  O  OG  . SER C 1 164 ? 4.274   12.137  60.602  1.00 58.91 ? 167  SER C OG  1 
ATOM   9333  N  N   . GLN C 1 165 ? 6.742   13.869  61.424  1.00 60.31 ? 168  GLN C N   1 
ATOM   9334  C  CA  . GLN C 1 165 ? 7.841   13.687  62.366  1.00 60.49 ? 168  GLN C CA  1 
ATOM   9335  C  C   . GLN C 1 165 ? 8.647   14.953  62.594  1.00 60.75 ? 168  GLN C C   1 
ATOM   9336  O  O   . GLN C 1 165 ? 9.352   15.069  63.601  1.00 60.99 ? 168  GLN C O   1 
ATOM   9337  C  CB  . GLN C 1 165 ? 8.771   12.588  61.867  1.00 60.74 ? 168  GLN C CB  1 
ATOM   9338  C  CG  . GLN C 1 165 ? 8.162   11.212  61.914  1.00 60.77 ? 168  GLN C CG  1 
ATOM   9339  C  CD  . GLN C 1 165 ? 8.066   10.683  63.328  1.00 61.26 ? 168  GLN C CD  1 
ATOM   9340  O  OE1 . GLN C 1 165 ? 6.984   10.352  63.815  1.00 61.49 ? 168  GLN C OE1 1 
ATOM   9341  N  NE2 . GLN C 1 165 ? 9.207   10.596  63.999  1.00 61.60 ? 168  GLN C NE2 1 
ATOM   9342  N  N   . LYS C 1 166 ? 8.551   15.897  61.660  1.00 60.90 ? 169  LYS C N   1 
ATOM   9343  C  CA  . LYS C 1 166 ? 9.306   17.143  61.766  1.00 60.70 ? 169  LYS C CA  1 
ATOM   9344  C  C   . LYS C 1 166 ? 8.622   18.309  62.461  1.00 60.88 ? 169  LYS C C   1 
ATOM   9345  O  O   . LYS C 1 166 ? 7.907   18.110  63.444  1.00 61.32 ? 169  LYS C O   1 
ATOM   9346  C  CB  . LYS C 1 166 ? 9.885   17.548  60.411  1.00 60.21 ? 169  LYS C CB  1 
ATOM   9347  C  CG  . LYS C 1 166 ? 11.070  16.684  60.035  1.00 59.48 ? 169  LYS C CG  1 
ATOM   9348  C  CD  . LYS C 1 166 ? 11.613  16.997  58.666  1.00 59.14 ? 169  LYS C CD  1 
ATOM   9349  C  CE  . LYS C 1 166 ? 12.849  16.150  58.356  1.00 58.55 ? 169  LYS C CE  1 
ATOM   9350  N  NZ  . LYS C 1 166 ? 14.090  16.570  59.074  1.00 57.75 ? 169  LYS C NZ  1 
ATOM   9351  N  N   . ARG C 1 167 ? 8.840   19.523  61.969  1.00 60.53 ? 170  ARG C N   1 
ATOM   9352  C  CA  . ARG C 1 167 ? 8.273   20.688  62.622  1.00 60.21 ? 170  ARG C CA  1 
ATOM   9353  C  C   . ARG C 1 167 ? 6.957   21.169  62.078  1.00 59.91 ? 170  ARG C C   1 
ATOM   9354  O  O   . ARG C 1 167 ? 6.650   20.976  60.908  1.00 59.69 ? 170  ARG C O   1 
ATOM   9355  C  CB  . ARG C 1 167 ? 9.280   21.828  62.604  1.00 60.49 ? 170  ARG C CB  1 
ATOM   9356  C  CG  . ARG C 1 167 ? 10.562  21.506  63.341  1.00 60.78 ? 170  ARG C CG  1 
ATOM   9357  C  CD  . ARG C 1 167 ? 11.640  22.509  63.011  1.00 61.08 ? 170  ARG C CD  1 
ATOM   9358  N  NE  . ARG C 1 167 ? 12.905  22.158  63.644  1.00 61.75 ? 170  ARG C NE  1 
ATOM   9359  C  CZ  . ARG C 1 167 ? 13.307  22.624  64.820  1.00 61.93 ? 170  ARG C CZ  1 
ATOM   9360  N  NH1 . ARG C 1 167 ? 12.545  23.470  65.501  1.00 61.91 ? 170  ARG C NH1 1 
ATOM   9361  N  NH2 . ARG C 1 167 ? 14.469  22.232  65.323  1.00 62.24 ? 170  ARG C NH2 1 
ATOM   9362  N  N   . ASN C 1 168 ? 6.175   21.794  62.955  1.00 59.99 ? 171  ASN C N   1 
ATOM   9363  C  CA  . ASN C 1 168 ? 4.877   22.348  62.594  1.00 60.14 ? 171  ASN C CA  1 
ATOM   9364  C  C   . ASN C 1 168 ? 5.178   23.470  61.610  1.00 60.05 ? 171  ASN C C   1 
ATOM   9365  O  O   . ASN C 1 168 ? 5.930   24.383  61.923  1.00 60.38 ? 171  ASN C O   1 
ATOM   9366  C  CB  . ASN C 1 168 ? 4.190   22.898  63.847  1.00 60.38 ? 171  ASN C CB  1 
ATOM   9367  C  CG  . ASN C 1 168 ? 2.926   23.661  63.533  1.00 60.64 ? 171  ASN C CG  1 
ATOM   9368  O  OD1 . ASN C 1 168 ? 2.977   24.793  63.055  1.00 61.35 ? 171  ASN C OD1 1 
ATOM   9369  N  ND2 . ASN C 1 168 ? 1.779   23.051  63.808  1.00 60.51 ? 171  ASN C ND2 1 
ATOM   9370  N  N   . PRO C 1 169 ? 4.568   23.435  60.421  1.00 59.85 ? 172  PRO C N   1 
ATOM   9371  C  CA  . PRO C 1 169 ? 4.758   24.429  59.357  1.00 59.68 ? 172  PRO C CA  1 
ATOM   9372  C  C   . PRO C 1 169 ? 4.629   25.892  59.757  1.00 59.83 ? 172  PRO C C   1 
ATOM   9373  O  O   . PRO C 1 169 ? 5.132   26.785  59.062  1.00 59.83 ? 172  PRO C O   1 
ATOM   9374  C  CB  . PRO C 1 169 ? 3.699   24.030  58.331  1.00 59.59 ? 172  PRO C CB  1 
ATOM   9375  C  CG  . PRO C 1 169 ? 2.632   23.402  59.176  1.00 59.60 ? 172  PRO C CG  1 
ATOM   9376  C  CD  . PRO C 1 169 ? 3.449   22.540  60.093  1.00 59.60 ? 172  PRO C CD  1 
ATOM   9377  N  N   . GLN C 1 170 ? 3.966   26.145  60.877  1.00 59.64 ? 173  GLN C N   1 
ATOM   9378  C  CA  . GLN C 1 170 ? 3.792   27.510  61.330  1.00 59.54 ? 173  GLN C CA  1 
ATOM   9379  C  C   . GLN C 1 170 ? 4.616   27.881  62.551  1.00 59.57 ? 173  GLN C C   1 
ATOM   9380  O  O   . GLN C 1 170 ? 5.287   28.906  62.552  1.00 59.63 ? 173  GLN C O   1 
ATOM   9381  C  CB  . GLN C 1 170 ? 2.324   27.793  61.601  1.00 59.55 ? 173  GLN C CB  1 
ATOM   9382  C  CG  . GLN C 1 170 ? 2.099   29.185  62.133  1.00 59.75 ? 173  GLN C CG  1 
ATOM   9383  C  CD  . GLN C 1 170 ? 0.639   29.567  62.206  1.00 59.89 ? 173  GLN C CD  1 
ATOM   9384  O  OE1 . GLN C 1 170 ? -0.250  28.729  62.025  1.00 60.35 ? 173  GLN C OE1 1 
ATOM   9385  N  NE2 . GLN C 1 170 ? 0.378   30.843  62.474  1.00 59.70 ? 173  GLN C NE2 1 
ATOM   9386  N  N   . THR C 1 171 ? 4.544   27.063  63.597  1.00 59.85 ? 174  THR C N   1 
ATOM   9387  C  CA  . THR C 1 171 ? 5.269   27.313  64.846  1.00 59.95 ? 174  THR C CA  1 
ATOM   9388  C  C   . THR C 1 171 ? 6.720   26.887  64.775  1.00 60.64 ? 174  THR C C   1 
ATOM   9389  O  O   . THR C 1 171 ? 7.543   27.315  65.581  1.00 60.62 ? 174  THR C O   1 
ATOM   9390  C  CB  . THR C 1 171 ? 4.654   26.530  66.001  1.00 59.51 ? 174  THR C CB  1 
ATOM   9391  O  OG1 . THR C 1 171 ? 4.745   25.128  65.719  1.00 59.19 ? 174  THR C OG1 1 
ATOM   9392  C  CG2 . THR C 1 171 ? 3.209   26.908  66.183  1.00 58.84 ? 174  THR C CG2 1 
ATOM   9393  N  N   . HIS C 1 172 ? 7.005   25.985  63.849  1.00 61.37 ? 175  HIS C N   1 
ATOM   9394  C  CA  . HIS C 1 172 ? 8.346   25.449  63.659  1.00 62.21 ? 175  HIS C CA  1 
ATOM   9395  C  C   . HIS C 1 172 ? 8.714   24.609  64.875  1.00 62.62 ? 175  HIS C C   1 
ATOM   9396  O  O   . HIS C 1 172 ? 9.887   24.469  65.222  1.00 63.16 ? 175  HIS C O   1 
ATOM   9397  C  CB  . HIS C 1 172 ? 9.373   26.571  63.442  1.00 62.13 ? 175  HIS C CB  1 
ATOM   9398  C  CG  . HIS C 1 172 ? 10.639  26.111  62.783  1.00 61.80 ? 175  HIS C CG  1 
ATOM   9399  N  ND1 . HIS C 1 172 ? 10.693  25.740  61.457  1.00 61.52 ? 175  HIS C ND1 1 
ATOM   9400  C  CD2 . HIS C 1 172 ? 11.895  25.946  63.270  1.00 61.50 ? 175  HIS C CD2 1 
ATOM   9401  C  CE1 . HIS C 1 172 ? 11.922  25.363  61.155  1.00 61.27 ? 175  HIS C CE1 1 
ATOM   9402  N  NE2 . HIS C 1 172 ? 12.671  25.479  62.238  1.00 61.36 ? 175  HIS C NE2 1 
ATOM   9403  N  N   . LEU C 1 173 ? 7.701   24.037  65.513  1.00 62.81 ? 176  LEU C N   1 
ATOM   9404  C  CA  . LEU C 1 173 ? 7.935   23.214  66.682  1.00 62.75 ? 176  LEU C CA  1 
ATOM   9405  C  C   . LEU C 1 173 ? 7.544   21.783  66.424  1.00 62.78 ? 176  LEU C C   1 
ATOM   9406  O  O   . LEU C 1 173 ? 6.686   21.506  65.583  1.00 62.60 ? 176  LEU C O   1 
ATOM   9407  C  CB  . LEU C 1 173 ? 7.107   23.709  67.859  1.00 62.92 ? 176  LEU C CB  1 
ATOM   9408  C  CG  . LEU C 1 173 ? 7.220   25.184  68.216  1.00 62.90 ? 176  LEU C CG  1 
ATOM   9409  C  CD1 . LEU C 1 173 ? 6.321   25.473  69.409  1.00 62.88 ? 176  LEU C CD1 1 
ATOM   9410  C  CD2 . LEU C 1 173 ? 8.657   25.528  68.529  1.00 62.82 ? 176  LEU C CD2 1 
ATOM   9411  N  N   . LYS C 1 174 ? 8.184   20.877  67.158  1.00 62.68 ? 177  LYS C N   1 
ATOM   9412  C  CA  . LYS C 1 174 ? 7.863   19.463  67.071  1.00 62.64 ? 177  LYS C CA  1 
ATOM   9413  C  C   . LYS C 1 174 ? 6.418   19.477  67.530  1.00 62.41 ? 177  LYS C C   1 
ATOM   9414  O  O   . LYS C 1 174 ? 6.071   20.243  68.423  1.00 62.37 ? 177  LYS C O   1 
ATOM   9415  C  CB  . LYS C 1 174 ? 8.730   18.664  68.035  1.00 63.45 ? 177  LYS C CB  1 
ATOM   9416  C  CG  . LYS C 1 174 ? 10.191  18.622  67.636  1.00 64.29 ? 177  LYS C CG  1 
ATOM   9417  C  CD  . LYS C 1 174 ? 10.356  17.967  66.267  1.00 65.90 ? 177  LYS C CD  1 
ATOM   9418  C  CE  . LYS C 1 174 ? 11.825  17.688  65.934  1.00 66.84 ? 177  LYS C CE  1 
ATOM   9419  N  NZ  . LYS C 1 174 ? 12.615  18.939  65.763  1.00 67.56 ? 177  LYS C NZ  1 
ATOM   9420  N  N   . ASP C 1 175 ? 5.569   18.671  66.912  1.00 61.95 ? 178  ASP C N   1 
ATOM   9421  C  CA  . ASP C 1 175 ? 4.159   18.704  67.248  1.00 61.55 ? 178  ASP C CA  1 
ATOM   9422  C  C   . ASP C 1 175 ? 3.552   17.331  67.464  1.00 61.30 ? 178  ASP C C   1 
ATOM   9423  O  O   . ASP C 1 175 ? 3.082   16.694  66.525  1.00 61.64 ? 178  ASP C O   1 
ATOM   9424  C  CB  . ASP C 1 175 ? 3.428   19.432  66.119  1.00 61.79 ? 178  ASP C CB  1 
ATOM   9425  C  CG  . ASP C 1 175 ? 2.005   19.772  66.458  1.00 62.16 ? 178  ASP C CG  1 
ATOM   9426  O  OD1 . ASP C 1 175 ? 1.369   19.028  67.222  1.00 62.29 ? 178  ASP C OD1 1 
ATOM   9427  O  OD2 . ASP C 1 175 ? 1.510   20.792  65.943  1.00 62.75 ? 178  ASP C OD2 1 
ATOM   9428  N  N   . PRO C 1 176 ? 3.507   16.879  68.716  1.00 60.96 ? 179  PRO C N   1 
ATOM   9429  C  CA  . PRO C 1 176 ? 2.948   15.573  69.078  1.00 60.63 ? 179  PRO C CA  1 
ATOM   9430  C  C   . PRO C 1 176 ? 1.584   15.248  68.469  1.00 60.19 ? 179  PRO C C   1 
ATOM   9431  O  O   . PRO C 1 176 ? 1.249   14.078  68.283  1.00 60.07 ? 179  PRO C O   1 
ATOM   9432  C  CB  . PRO C 1 176 ? 2.915   15.619  70.609  1.00 60.84 ? 179  PRO C CB  1 
ATOM   9433  C  CG  . PRO C 1 176 ? 3.315   17.057  70.973  1.00 60.98 ? 179  PRO C CG  1 
ATOM   9434  C  CD  . PRO C 1 176 ? 4.199   17.474  69.863  1.00 60.84 ? 179  PRO C CD  1 
ATOM   9435  N  N   . ASP C 1 177 ? 0.800   16.269  68.154  1.00 59.89 ? 180  ASP C N   1 
ATOM   9436  C  CA  . ASP C 1 177 ? -0.502  16.045  67.523  1.00 59.50 ? 180  ASP C CA  1 
ATOM   9437  C  C   . ASP C 1 177 ? -0.225  15.512  66.117  1.00 58.97 ? 180  ASP C C   1 
ATOM   9438  O  O   . ASP C 1 177 ? -0.855  14.556  65.669  1.00 59.41 ? 180  ASP C O   1 
ATOM   9439  C  CB  . ASP C 1 177 ? -1.306  17.355  67.416  1.00 59.83 ? 180  ASP C CB  1 
ATOM   9440  C  CG  . ASP C 1 177 ? -2.383  17.499  68.492  1.00 59.67 ? 180  ASP C CG  1 
ATOM   9441  O  OD1 . ASP C 1 177 ? -3.319  18.310  68.290  1.00 59.58 ? 180  ASP C OD1 1 
ATOM   9442  O  OD2 . ASP C 1 177 ? -2.302  16.818  69.536  1.00 60.29 ? 180  ASP C OD2 1 
ATOM   9443  N  N   . MET C 1 178 ? 0.713   16.152  65.424  1.00 58.15 ? 181  MET C N   1 
ATOM   9444  C  CA  . MET C 1 178 ? 1.082   15.741  64.078  1.00 57.62 ? 181  MET C CA  1 
ATOM   9445  C  C   . MET C 1 178 ? 1.634   14.328  64.129  1.00 57.37 ? 181  MET C C   1 
ATOM   9446  O  O   . MET C 1 178 ? 1.167   13.448  63.410  1.00 57.61 ? 181  MET C O   1 
ATOM   9447  C  CB  . MET C 1 178 ? 2.128   16.696  63.496  1.00 57.37 ? 181  MET C CB  1 
ATOM   9448  C  CG  . MET C 1 178 ? 1.584   18.097  63.233  1.00 58.04 ? 181  MET C CG  1 
ATOM   9449  S  SD  . MET C 1 178 ? 2.807   19.350  62.824  1.00 58.22 ? 181  MET C SD  1 
ATOM   9450  C  CE  . MET C 1 178 ? 3.473   18.636  61.352  1.00 57.68 ? 181  MET C CE  1 
ATOM   9451  N  N   . VAL C 1 179 ? 2.586   14.103  65.029  1.00 57.09 ? 182  VAL C N   1 
ATOM   9452  C  CA  . VAL C 1 179 ? 3.210   12.795  65.186  1.00 56.61 ? 182  VAL C CA  1 
ATOM   9453  C  C   . VAL C 1 179 ? 2.205   11.670  65.402  1.00 57.22 ? 182  VAL C C   1 
ATOM   9454  O  O   . VAL C 1 179 ? 2.207   10.674  64.672  1.00 57.47 ? 182  VAL C O   1 
ATOM   9455  C  CB  . VAL C 1 179 ? 4.183   12.790  66.377  1.00 55.81 ? 182  VAL C CB  1 
ATOM   9456  C  CG1 . VAL C 1 179 ? 4.742   11.403  66.609  1.00 55.18 ? 182  VAL C CG1 1 
ATOM   9457  C  CG2 . VAL C 1 179 ? 5.307   13.749  66.129  1.00 55.39 ? 182  VAL C CG2 1 
ATOM   9458  N  N   . TRP C 1 180 ? 1.337   11.837  66.396  1.00 57.60 ? 183  TRP C N   1 
ATOM   9459  C  CA  . TRP C 1 180 ? 0.363   10.807  66.728  1.00 57.78 ? 183  TRP C CA  1 
ATOM   9460  C  C   . TRP C 1 180 ? -0.926  10.767  65.931  1.00 58.08 ? 183  TRP C C   1 
ATOM   9461  O  O   . TRP C 1 180 ? -1.609  9.738   65.913  1.00 58.26 ? 183  TRP C O   1 
ATOM   9462  C  CB  . TRP C 1 180 ? 0.097   10.813  68.222  1.00 57.36 ? 183  TRP C CB  1 
ATOM   9463  C  CG  . TRP C 1 180 ? 1.256   10.273  68.973  1.00 56.98 ? 183  TRP C CG  1 
ATOM   9464  C  CD1 . TRP C 1 180 ? 2.193   10.983  69.657  1.00 56.68 ? 183  TRP C CD1 1 
ATOM   9465  C  CD2 . TRP C 1 180 ? 1.623   8.893   69.099  1.00 56.54 ? 183  TRP C CD2 1 
ATOM   9466  N  NE1 . TRP C 1 180 ? 3.128   10.133  70.204  1.00 56.41 ? 183  TRP C NE1 1 
ATOM   9467  C  CE2 . TRP C 1 180 ? 2.799   8.845   69.874  1.00 56.32 ? 183  TRP C CE2 1 
ATOM   9468  C  CE3 . TRP C 1 180 ? 1.072   7.695   68.631  1.00 56.05 ? 183  TRP C CE3 1 
ATOM   9469  C  CZ2 . TRP C 1 180 ? 3.435   7.643   70.193  1.00 56.14 ? 183  TRP C CZ2 1 
ATOM   9470  C  CZ3 . TRP C 1 180 ? 1.705   6.500   68.947  1.00 55.66 ? 183  TRP C CZ3 1 
ATOM   9471  C  CH2 . TRP C 1 180 ? 2.873   6.484   69.720  1.00 55.66 ? 183  TRP C CH2 1 
ATOM   9472  N  N   . ASP C 1 181 ? -1.281  11.875  65.288  1.00 58.21 ? 184  ASP C N   1 
ATOM   9473  C  CA  . ASP C 1 181 ? -2.480  11.882  64.464  1.00 58.55 ? 184  ASP C CA  1 
ATOM   9474  C  C   . ASP C 1 181 ? -2.154  10.926  63.327  1.00 58.57 ? 184  ASP C C   1 
ATOM   9475  O  O   . ASP C 1 181 ? -2.877  9.960   63.070  1.00 58.87 ? 184  ASP C O   1 
ATOM   9476  C  CB  . ASP C 1 181 ? -2.758  13.280  63.907  1.00 58.51 ? 184  ASP C CB  1 
ATOM   9477  C  CG  . ASP C 1 181 ? -4.036  13.342  63.080  1.00 58.48 ? 184  ASP C CG  1 
ATOM   9478  O  OD1 . ASP C 1 181 ? -4.970  12.546  63.317  1.00 58.54 ? 184  ASP C OD1 1 
ATOM   9479  O  OD2 . ASP C 1 181 ? -4.112  14.198  62.182  1.00 58.59 ? 184  ASP C OD2 1 
ATOM   9480  N  N   . PHE C 1 182 ? -0.997  11.150  62.718  1.00 58.44 ? 185  PHE C N   1 
ATOM   9481  C  CA  . PHE C 1 182 ? -0.549  10.314  61.626  1.00 58.23 ? 185  PHE C CA  1 
ATOM   9482  C  C   . PHE C 1 182 ? -0.403  8.874   62.060  1.00 58.05 ? 185  PHE C C   1 
ATOM   9483  O  O   . PHE C 1 182 ? -0.936  7.982   61.413  1.00 58.41 ? 185  PHE C O   1 
ATOM   9484  C  CB  . PHE C 1 182 ? 0.785   10.799  61.083  1.00 58.35 ? 185  PHE C CB  1 
ATOM   9485  C  CG  . PHE C 1 182 ? 1.254   10.023  59.902  1.00 58.45 ? 185  PHE C CG  1 
ATOM   9486  C  CD1 . PHE C 1 182 ? 2.094   8.933   60.064  1.00 58.63 ? 185  PHE C CD1 1 
ATOM   9487  C  CD2 . PHE C 1 182 ? 0.808   10.346  58.626  1.00 58.64 ? 185  PHE C CD2 1 
ATOM   9488  C  CE1 . PHE C 1 182 ? 2.480   8.169   58.974  1.00 58.52 ? 185  PHE C CE1 1 
ATOM   9489  C  CE2 . PHE C 1 182 ? 1.187   9.590   57.530  1.00 58.42 ? 185  PHE C CE2 1 
ATOM   9490  C  CZ  . PHE C 1 182 ? 2.024   8.497   57.703  1.00 58.45 ? 185  PHE C CZ  1 
ATOM   9491  N  N   . TRP C 1 183 ? 0.319   8.640   63.150  1.00 58.11 ? 186  TRP C N   1 
ATOM   9492  C  CA  . TRP C 1 183 ? 0.531   7.275   63.631  1.00 58.34 ? 186  TRP C CA  1 
ATOM   9493  C  C   . TRP C 1 183 ? -0.752  6.522   63.996  1.00 58.50 ? 186  TRP C C   1 
ATOM   9494  O  O   . TRP C 1 183 ? -0.883  5.329   63.703  1.00 58.55 ? 186  TRP C O   1 
ATOM   9495  C  CB  . TRP C 1 183 ? 1.534   7.251   64.797  1.00 58.20 ? 186  TRP C CB  1 
ATOM   9496  C  CG  . TRP C 1 183 ? 3.000   7.173   64.368  1.00 57.94 ? 186  TRP C CG  1 
ATOM   9497  C  CD1 . TRP C 1 183 ? 3.481   6.858   63.124  1.00 57.63 ? 186  TRP C CD1 1 
ATOM   9498  C  CD2 . TRP C 1 183 ? 4.151   7.417   65.187  1.00 57.80 ? 186  TRP C CD2 1 
ATOM   9499  N  NE1 . TRP C 1 183 ? 4.857   6.897   63.121  1.00 57.56 ? 186  TRP C NE1 1 
ATOM   9500  C  CE2 . TRP C 1 183 ? 5.292   7.237   64.372  1.00 57.61 ? 186  TRP C CE2 1 
ATOM   9501  C  CE3 . TRP C 1 183 ? 4.330   7.769   66.528  1.00 57.69 ? 186  TRP C CE3 1 
ATOM   9502  C  CZ2 . TRP C 1 183 ? 6.588   7.400   64.856  1.00 57.87 ? 186  TRP C CZ2 1 
ATOM   9503  C  CZ3 . TRP C 1 183 ? 5.621   7.930   67.008  1.00 57.75 ? 186  TRP C CZ3 1 
ATOM   9504  C  CH2 . TRP C 1 183 ? 6.732   7.746   66.174  1.00 57.73 ? 186  TRP C CH2 1 
ATOM   9505  N  N   . SER C 1 184 ? -1.696  7.213   64.627  1.00 58.76 ? 187  SER C N   1 
ATOM   9506  C  CA  . SER C 1 184 ? -2.949  6.578   64.998  1.00 59.06 ? 187  SER C CA  1 
ATOM   9507  C  C   . SER C 1 184 ? -3.768  6.312   63.742  1.00 59.39 ? 187  SER C C   1 
ATOM   9508  O  O   . SER C 1 184 ? -4.400  5.268   63.611  1.00 59.69 ? 187  SER C O   1 
ATOM   9509  C  CB  . SER C 1 184 ? -3.734  7.454   65.972  1.00 59.30 ? 187  SER C CB  1 
ATOM   9510  O  OG  . SER C 1 184 ? -4.055  8.702   65.395  1.00 59.56 ? 187  SER C OG  1 
ATOM   9511  N  N   . LEU C 1 185 ? -3.734  7.250   62.803  1.00 59.68 ? 188  LEU C N   1 
ATOM   9512  C  CA  . LEU C 1 185 ? -4.477  7.095   61.557  1.00 59.99 ? 188  LEU C CA  1 
ATOM   9513  C  C   . LEU C 1 185 ? -3.892  6.018   60.667  1.00 60.39 ? 188  LEU C C   1 
ATOM   9514  O  O   . LEU C 1 185 ? -4.600  5.418   59.864  1.00 60.16 ? 188  LEU C O   1 
ATOM   9515  C  CB  . LEU C 1 185 ? -4.515  8.412   60.792  1.00 59.95 ? 188  LEU C CB  1 
ATOM   9516  C  CG  . LEU C 1 185 ? -5.403  9.466   61.444  1.00 59.96 ? 188  LEU C CG  1 
ATOM   9517  C  CD1 . LEU C 1 185 ? -5.298  10.771  60.680  1.00 60.23 ? 188  LEU C CD1 1 
ATOM   9518  C  CD2 . LEU C 1 185 ? -6.842  8.966   61.489  1.00 59.90 ? 188  LEU C CD2 1 
ATOM   9519  N  N   . ARG C 1 186 ? -2.591  5.791   60.794  1.00 60.89 ? 189  ARG C N   1 
ATOM   9520  C  CA  . ARG C 1 186 ? -1.911  4.790   59.991  1.00 61.38 ? 189  ARG C CA  1 
ATOM   9521  C  C   . ARG C 1 186 ? -1.243  3.753   60.882  1.00 62.04 ? 189  ARG C C   1 
ATOM   9522  O  O   . ARG C 1 186 ? -0.039  3.814   61.133  1.00 62.25 ? 189  ARG C O   1 
ATOM   9523  C  CB  . ARG C 1 186 ? -0.879  5.450   59.076  1.00 60.93 ? 189  ARG C CB  1 
ATOM   9524  C  CG  . ARG C 1 186 ? -1.460  6.498   58.145  1.00 60.53 ? 189  ARG C CG  1 
ATOM   9525  C  CD  . ARG C 1 186 ? -2.591  5.939   57.306  1.00 60.35 ? 189  ARG C CD  1 
ATOM   9526  N  NE  . ARG C 1 186 ? -2.132  4.953   56.333  1.00 60.11 ? 189  ARG C NE  1 
ATOM   9527  C  CZ  . ARG C 1 186 ? -2.853  4.550   55.292  1.00 60.00 ? 189  ARG C CZ  1 
ATOM   9528  N  NH1 . ARG C 1 186 ? -4.069  5.044   55.093  1.00 60.08 ? 189  ARG C NH1 1 
ATOM   9529  N  NH2 . ARG C 1 186 ? -2.352  3.666   54.438  1.00 59.75 ? 189  ARG C NH2 1 
ATOM   9530  N  N   . PRO C 1 187 ? -2.007  2.737   61.304  1.00 62.52 ? 190  PRO C N   1 
ATOM   9531  C  CA  . PRO C 1 187 ? -1.542  1.652   62.172  1.00 62.96 ? 190  PRO C CA  1 
ATOM   9532  C  C   . PRO C 1 187 ? -0.496  0.659   61.645  1.00 63.48 ? 190  PRO C C   1 
ATOM   9533  O  O   . PRO C 1 187 ? -0.092  -0.243  62.377  1.00 63.84 ? 190  PRO C O   1 
ATOM   9534  C  CB  . PRO C 1 187 ? -2.845  0.954   62.562  1.00 62.81 ? 190  PRO C CB  1 
ATOM   9535  C  CG  . PRO C 1 187 ? -3.702  1.163   61.363  1.00 62.50 ? 190  PRO C CG  1 
ATOM   9536  C  CD  . PRO C 1 187 ? -3.452  2.607   61.038  1.00 62.51 ? 190  PRO C CD  1 
ATOM   9537  N  N   . GLU C 1 188 ? -0.043  0.797   60.403  1.00 63.77 ? 191  GLU C N   1 
ATOM   9538  C  CA  . GLU C 1 188 ? 0.967   -0.139  59.903  1.00 64.19 ? 191  GLU C CA  1 
ATOM   9539  C  C   . GLU C 1 188 ? 2.234   0.162   60.666  1.00 64.02 ? 191  GLU C C   1 
ATOM   9540  O  O   . GLU C 1 188 ? 3.100   -0.690  60.827  1.00 64.28 ? 191  GLU C O   1 
ATOM   9541  C  CB  . GLU C 1 188 ? 1.263   0.062   58.422  1.00 64.77 ? 191  GLU C CB  1 
ATOM   9542  C  CG  . GLU C 1 188 ? 0.111   0.541   57.598  1.00 66.05 ? 191  GLU C CG  1 
ATOM   9543  C  CD  . GLU C 1 188 ? -0.153  2.018   57.794  1.00 66.79 ? 191  GLU C CD  1 
ATOM   9544  O  OE1 . GLU C 1 188 ? 0.643   2.841   57.293  1.00 67.06 ? 191  GLU C OE1 1 
ATOM   9545  O  OE2 . GLU C 1 188 ? -1.158  2.353   58.449  1.00 66.93 ? 191  GLU C OE2 1 
ATOM   9546  N  N   . SER C 1 189 ? 2.339   1.414   61.089  1.00 63.77 ? 192  SER C N   1 
ATOM   9547  C  CA  . SER C 1 189 ? 3.474   1.910   61.843  1.00 63.33 ? 192  SER C CA  1 
ATOM   9548  C  C   . SER C 1 189 ? 3.685   1.133   63.135  1.00 62.99 ? 192  SER C C   1 
ATOM   9549  O  O   . SER C 1 189 ? 4.812   0.994   63.617  1.00 63.20 ? 192  SER C O   1 
ATOM   9550  C  CB  . SER C 1 189 ? 3.253   3.390   62.158  1.00 63.37 ? 192  SER C CB  1 
ATOM   9551  O  OG  . SER C 1 189 ? 1.955   3.621   62.693  1.00 63.49 ? 192  SER C OG  1 
ATOM   9552  N  N   . LEU C 1 190 ? 2.591   0.608   63.673  1.00 62.40 ? 193  LEU C N   1 
ATOM   9553  C  CA  . LEU C 1 190 ? 2.619   -0.136  64.919  1.00 62.21 ? 193  LEU C CA  1 
ATOM   9554  C  C   . LEU C 1 190 ? 3.838   -1.012  65.146  1.00 61.89 ? 193  LEU C C   1 
ATOM   9555  O  O   . LEU C 1 190 ? 4.375   -1.059  66.256  1.00 62.24 ? 193  LEU C O   1 
ATOM   9556  C  CB  . LEU C 1 190 ? 1.356   -0.972  65.052  1.00 62.55 ? 193  LEU C CB  1 
ATOM   9557  C  CG  . LEU C 1 190 ? 0.118   -0.164  65.445  1.00 62.83 ? 193  LEU C CG  1 
ATOM   9558  C  CD1 . LEU C 1 190 ? -1.135  -1.045  65.394  1.00 62.67 ? 193  LEU C CD1 1 
ATOM   9559  C  CD2 . LEU C 1 190 ? 0.320   0.438   66.836  1.00 62.71 ? 193  LEU C CD2 1 
ATOM   9560  N  N   . HIS C 1 191 ? 4.303   -1.682  64.103  1.00 60.96 ? 194  HIS C N   1 
ATOM   9561  C  CA  . HIS C 1 191 ? 5.454   -2.536  64.284  1.00 60.07 ? 194  HIS C CA  1 
ATOM   9562  C  C   . HIS C 1 191 ? 6.703   -1.734  64.608  1.00 59.83 ? 194  HIS C C   1 
ATOM   9563  O  O   . HIS C 1 191 ? 7.312   -1.924  65.658  1.00 59.83 ? 194  HIS C O   1 
ATOM   9564  C  CB  . HIS C 1 191 ? 5.681   -3.420  63.066  1.00 59.49 ? 194  HIS C CB  1 
ATOM   9565  C  CG  . HIS C 1 191 ? 6.373   -4.703  63.392  1.00 58.99 ? 194  HIS C CG  1 
ATOM   9566  N  ND1 . HIS C 1 191 ? 6.688   -5.647  62.438  1.00 58.85 ? 194  HIS C ND1 1 
ATOM   9567  C  CD2 . HIS C 1 191 ? 6.812   -5.200  64.574  1.00 58.50 ? 194  HIS C CD2 1 
ATOM   9568  C  CE1 . HIS C 1 191 ? 7.292   -6.670  63.020  1.00 58.57 ? 194  HIS C CE1 1 
ATOM   9569  N  NE2 . HIS C 1 191 ? 7.379   -6.423  64.314  1.00 58.54 ? 194  HIS C NE2 1 
ATOM   9570  N  N   . GLN C 1 192 ? 7.059   -0.803  63.735  1.00 59.81 ? 195  GLN C N   1 
ATOM   9571  C  CA  . GLN C 1 192 ? 8.253   0.007   63.950  1.00 59.69 ? 195  GLN C CA  1 
ATOM   9572  C  C   . GLN C 1 192 ? 8.169   0.909   65.167  1.00 59.78 ? 195  GLN C C   1 
ATOM   9573  O  O   . GLN C 1 192 ? 9.174   1.163   65.828  1.00 59.96 ? 195  GLN C O   1 
ATOM   9574  C  CB  . GLN C 1 192 ? 8.579   0.841   62.715  1.00 59.36 ? 195  GLN C CB  1 
ATOM   9575  C  CG  . GLN C 1 192 ? 9.802   1.726   62.874  1.00 59.04 ? 195  GLN C CG  1 
ATOM   9576  C  CD  . GLN C 1 192 ? 11.036  0.968   63.321  1.00 59.19 ? 195  GLN C CD  1 
ATOM   9577  O  OE1 . GLN C 1 192 ? 11.128  -0.248  63.166  1.00 59.48 ? 195  GLN C OE1 1 
ATOM   9578  N  NE2 . GLN C 1 192 ? 11.994  1.688   63.885  1.00 58.92 ? 195  GLN C NE2 1 
ATOM   9579  N  N   . VAL C 1 193 ? 6.979   1.403   65.463  1.00 59.56 ? 196  VAL C N   1 
ATOM   9580  C  CA  . VAL C 1 193 ? 6.823   2.271   66.614  1.00 59.76 ? 196  VAL C CA  1 
ATOM   9581  C  C   . VAL C 1 193 ? 7.216   1.522   67.870  1.00 59.76 ? 196  VAL C C   1 
ATOM   9582  O  O   . VAL C 1 193 ? 7.876   2.061   68.754  1.00 59.76 ? 196  VAL C O   1 
ATOM   9583  C  CB  . VAL C 1 193 ? 5.385   2.761   66.744  1.00 60.20 ? 196  VAL C CB  1 
ATOM   9584  C  CG1 . VAL C 1 193 ? 5.213   3.546   68.028  1.00 60.09 ? 196  VAL C CG1 1 
ATOM   9585  C  CG2 . VAL C 1 193 ? 5.029   3.635   65.557  1.00 60.05 ? 196  VAL C CG2 1 
ATOM   9586  N  N   . SER C 1 194 ? 6.823   0.260   67.930  1.00 59.99 ? 197  SER C N   1 
ATOM   9587  C  CA  . SER C 1 194 ? 7.144   -0.558  69.080  1.00 60.37 ? 197  SER C CA  1 
ATOM   9588  C  C   . SER C 1 194 ? 8.652   -0.676  69.191  1.00 60.76 ? 197  SER C C   1 
ATOM   9589  O  O   . SER C 1 194 ? 9.210   -0.547  70.279  1.00 61.10 ? 197  SER C O   1 
ATOM   9590  C  CB  . SER C 1 194 ? 6.502   -1.930  68.942  1.00 60.27 ? 197  SER C CB  1 
ATOM   9591  O  OG  . SER C 1 194 ? 5.092   -1.803  68.855  1.00 60.42 ? 197  SER C OG  1 
ATOM   9592  N  N   . PHE C 1 195 ? 9.314   -0.891  68.059  1.00 60.89 ? 198  PHE C N   1 
ATOM   9593  C  CA  . PHE C 1 195 ? 10.768  -0.991  68.042  1.00 60.91 ? 198  PHE C CA  1 
ATOM   9594  C  C   . PHE C 1 195 ? 11.328  0.333   68.499  1.00 60.50 ? 198  PHE C C   1 
ATOM   9595  O  O   . PHE C 1 195 ? 12.202  0.400   69.359  1.00 60.63 ? 198  PHE C O   1 
ATOM   9596  C  CB  . PHE C 1 195 ? 11.269  -1.245  66.626  1.00 62.03 ? 198  PHE C CB  1 
ATOM   9597  C  CG  . PHE C 1 195 ? 11.263  -2.685  66.228  1.00 63.79 ? 198  PHE C CG  1 
ATOM   9598  C  CD1 . PHE C 1 195 ? 12.219  -3.179  65.340  1.00 64.55 ? 198  PHE C CD1 1 
ATOM   9599  C  CD2 . PHE C 1 195 ? 10.311  -3.562  66.744  1.00 64.35 ? 198  PHE C CD2 1 
ATOM   9600  C  CE1 . PHE C 1 195 ? 12.225  -4.537  64.966  1.00 64.73 ? 198  PHE C CE1 1 
ATOM   9601  C  CE2 . PHE C 1 195 ? 10.306  -4.915  66.379  1.00 64.63 ? 198  PHE C CE2 1 
ATOM   9602  C  CZ  . PHE C 1 195 ? 11.267  -5.403  65.490  1.00 64.63 ? 198  PHE C CZ  1 
ATOM   9603  N  N   . LEU C 1 196 ? 10.785  1.393   67.921  1.00 59.86 ? 199  LEU C N   1 
ATOM   9604  C  CA  . LEU C 1 196 ? 11.216  2.738   68.224  1.00 59.08 ? 199  LEU C CA  1 
ATOM   9605  C  C   . LEU C 1 196 ? 11.192  3.050   69.708  1.00 59.28 ? 199  LEU C C   1 
ATOM   9606  O  O   . LEU C 1 196 ? 12.199  3.442   70.283  1.00 59.31 ? 199  LEU C O   1 
ATOM   9607  C  CB  . LEU C 1 196 ? 10.345  3.730   67.470  1.00 58.14 ? 199  LEU C CB  1 
ATOM   9608  C  CG  . LEU C 1 196 ? 10.744  5.178   67.699  1.00 57.41 ? 199  LEU C CG  1 
ATOM   9609  C  CD1 . LEU C 1 196 ? 12.199  5.404   67.327  1.00 56.72 ? 199  LEU C CD1 1 
ATOM   9610  C  CD2 . LEU C 1 196 ? 9.845   6.059   66.887  1.00 57.39 ? 199  LEU C CD2 1 
ATOM   9611  N  N   . PHE C 1 197 ? 10.047  2.852   70.340  1.00 59.77 ? 200  PHE C N   1 
ATOM   9612  C  CA  . PHE C 1 197 ? 9.932   3.152   71.755  1.00 60.30 ? 200  PHE C CA  1 
ATOM   9613  C  C   . PHE C 1 197 ? 10.513  2.137   72.712  1.00 60.97 ? 200  PHE C C   1 
ATOM   9614  O  O   . PHE C 1 197 ? 10.382  2.294   73.925  1.00 61.03 ? 200  PHE C O   1 
ATOM   9615  C  CB  . PHE C 1 197 ? 8.483   3.431   72.113  1.00 59.98 ? 200  PHE C CB  1 
ATOM   9616  C  CG  . PHE C 1 197 ? 8.007   4.759   71.640  1.00 59.47 ? 200  PHE C CG  1 
ATOM   9617  C  CD1 . PHE C 1 197 ? 7.384   4.886   70.407  1.00 59.38 ? 200  PHE C CD1 1 
ATOM   9618  C  CD2 . PHE C 1 197 ? 8.212   5.897   72.414  1.00 59.15 ? 200  PHE C CD2 1 
ATOM   9619  C  CE1 . PHE C 1 197 ? 6.968   6.134   69.944  1.00 59.22 ? 200  PHE C CE1 1 
ATOM   9620  C  CE2 . PHE C 1 197 ? 7.803   7.142   71.965  1.00 58.85 ? 200  PHE C CE2 1 
ATOM   9621  C  CZ  . PHE C 1 197 ? 7.179   7.261   70.724  1.00 58.98 ? 200  PHE C CZ  1 
ATOM   9622  N  N   . SER C 1 198 ? 11.149  1.099   72.183  1.00 61.90 ? 201  SER C N   1 
ATOM   9623  C  CA  . SER C 1 198 ? 11.742  0.077   73.036  1.00 62.92 ? 201  SER C CA  1 
ATOM   9624  C  C   . SER C 1 198 ? 13.081  0.578   73.544  1.00 63.46 ? 201  SER C C   1 
ATOM   9625  O  O   . SER C 1 198 ? 13.381  1.766   73.446  1.00 63.58 ? 201  SER C O   1 
ATOM   9626  C  CB  . SER C 1 198 ? 11.943  -1.228  72.264  1.00 63.16 ? 201  SER C CB  1 
ATOM   9627  O  OG  . SER C 1 198 ? 13.080  -1.156  71.417  1.00 64.21 ? 201  SER C OG  1 
ATOM   9628  N  N   . ASP C 1 199 ? 13.889  -0.336  74.071  1.00 64.18 ? 202  ASP C N   1 
ATOM   9629  C  CA  . ASP C 1 199 ? 15.211  0.007   74.580  1.00 64.82 ? 202  ASP C CA  1 
ATOM   9630  C  C   . ASP C 1 199 ? 16.164  0.388   73.456  1.00 64.90 ? 202  ASP C C   1 
ATOM   9631  O  O   . ASP C 1 199 ? 17.049  1.224   73.641  1.00 65.23 ? 202  ASP C O   1 
ATOM   9632  C  CB  . ASP C 1 199 ? 15.800  -1.166  75.360  1.00 65.47 ? 202  ASP C CB  1 
ATOM   9633  C  CG  . ASP C 1 199 ? 15.037  -1.458  76.629  1.00 66.21 ? 202  ASP C CG  1 
ATOM   9634  O  OD1 . ASP C 1 199 ? 14.438  -0.517  77.190  1.00 66.81 ? 202  ASP C OD1 1 
ATOM   9635  O  OD2 . ASP C 1 199 ? 15.028  -2.626  77.068  1.00 66.55 ? 202  ASP C OD2 1 
ATOM   9636  N  N   . ARG C 1 200 ? 15.976  -0.209  72.285  1.00 64.51 ? 203  ARG C N   1 
ATOM   9637  C  CA  . ARG C 1 200 ? 16.849  0.079   71.159  1.00 64.12 ? 203  ARG C CA  1 
ATOM   9638  C  C   . ARG C 1 200 ? 16.565  1.407   70.465  1.00 63.84 ? 203  ARG C C   1 
ATOM   9639  O  O   . ARG C 1 200 ? 17.199  1.741   69.457  1.00 64.01 ? 203  ARG C O   1 
ATOM   9640  C  CB  . ARG C 1 200 ? 16.820  -1.081  70.173  1.00 64.34 ? 203  ARG C CB  1 
ATOM   9641  C  CG  . ARG C 1 200 ? 17.263  -2.378  70.819  1.00 64.76 ? 203  ARG C CG  1 
ATOM   9642  C  CD  . ARG C 1 200 ? 17.616  -3.457  69.814  1.00 64.95 ? 203  ARG C CD  1 
ATOM   9643  N  NE  . ARG C 1 200 ? 18.099  -4.645  70.506  1.00 65.43 ? 203  ARG C NE  1 
ATOM   9644  C  CZ  . ARG C 1 200 ? 18.331  -5.814  69.924  1.00 66.00 ? 203  ARG C CZ  1 
ATOM   9645  N  NH1 . ARG C 1 200 ? 18.767  -6.842  70.643  1.00 66.26 ? 203  ARG C NH1 1 
ATOM   9646  N  NH2 . ARG C 1 200 ? 18.114  -5.964  68.628  1.00 66.12 ? 203  ARG C NH2 1 
ATOM   9647  N  N   . GLY C 1 201 ? 15.647  2.184   71.035  1.00 63.43 ? 204  GLY C N   1 
ATOM   9648  C  CA  . GLY C 1 201 ? 15.308  3.476   70.465  1.00 62.62 ? 204  GLY C CA  1 
ATOM   9649  C  C   . GLY C 1 201 ? 16.447  4.478   70.558  1.00 62.15 ? 204  GLY C C   1 
ATOM   9650  O  O   . GLY C 1 201 ? 16.507  5.443   69.783  1.00 62.34 ? 204  GLY C O   1 
ATOM   9651  N  N   . ILE C 1 202 ? 17.344  4.266   71.518  1.00 61.28 ? 205  ILE C N   1 
ATOM   9652  C  CA  . ILE C 1 202 ? 18.480  5.157   71.694  1.00 60.55 ? 205  ILE C CA  1 
ATOM   9653  C  C   . ILE C 1 202 ? 19.728  4.325   71.950  1.00 60.36 ? 205  ILE C C   1 
ATOM   9654  O  O   . ILE C 1 202 ? 20.077  4.045   73.089  1.00 60.41 ? 205  ILE C O   1 
ATOM   9655  C  CB  . ILE C 1 202 ? 18.278  6.114   72.875  1.00 59.91 ? 205  ILE C CB  1 
ATOM   9656  C  CG1 . ILE C 1 202 ? 16.894  6.751   72.820  1.00 59.32 ? 205  ILE C CG1 1 
ATOM   9657  C  CG2 . ILE C 1 202 ? 19.314  7.206   72.819  1.00 59.96 ? 205  ILE C CG2 1 
ATOM   9658  C  CD1 . ILE C 1 202 ? 16.570  7.582   74.028  1.00 58.75 ? 205  ILE C CD1 1 
ATOM   9659  N  N   . PRO C 1 203 ? 20.419  3.925   70.879  1.00 60.24 ? 206  PRO C N   1 
ATOM   9660  C  CA  . PRO C 1 203 ? 21.641  3.121   70.934  1.00 60.31 ? 206  PRO C CA  1 
ATOM   9661  C  C   . PRO C 1 203 ? 22.772  3.887   71.587  1.00 60.55 ? 206  PRO C C   1 
ATOM   9662  O  O   . PRO C 1 203 ? 22.819  5.118   71.504  1.00 60.57 ? 206  PRO C O   1 
ATOM   9663  C  CB  . PRO C 1 203 ? 21.969  2.898   69.459  1.00 60.04 ? 206  PRO C CB  1 
ATOM   9664  C  CG  . PRO C 1 203 ? 20.649  3.048   68.776  1.00 60.24 ? 206  PRO C CG  1 
ATOM   9665  C  CD  . PRO C 1 203 ? 20.040  4.204   69.487  1.00 60.25 ? 206  PRO C CD  1 
ATOM   9666  N  N   . ASP C 1 204 ? 23.686  3.156   72.227  1.00 60.94 ? 207  ASP C N   1 
ATOM   9667  C  CA  . ASP C 1 204 ? 24.850  3.763   72.873  1.00 60.91 ? 207  ASP C CA  1 
ATOM   9668  C  C   . ASP C 1 204 ? 25.918  3.901   71.801  1.00 60.83 ? 207  ASP C C   1 
ATOM   9669  O  O   . ASP C 1 204 ? 26.835  3.080   71.702  1.00 60.72 ? 207  ASP C O   1 
ATOM   9670  C  CB  . ASP C 1 204 ? 25.371  2.889   74.019  1.00 61.12 ? 207  ASP C CB  1 
ATOM   9671  C  CG  . ASP C 1 204 ? 26.398  3.608   74.886  1.00 61.42 ? 207  ASP C CG  1 
ATOM   9672  O  OD1 . ASP C 1 204 ? 26.800  3.042   75.925  1.00 61.96 ? 207  ASP C OD1 1 
ATOM   9673  O  OD2 . ASP C 1 204 ? 26.797  4.742   74.543  1.00 61.46 ? 207  ASP C OD2 1 
ATOM   9674  N  N   . GLY C 1 205 ? 25.781  4.947   70.996  1.00 60.76 ? 208  GLY C N   1 
ATOM   9675  C  CA  . GLY C 1 205 ? 26.717  5.176   69.917  1.00 60.70 ? 208  GLY C CA  1 
ATOM   9676  C  C   . GLY C 1 205 ? 26.279  4.361   68.720  1.00 60.66 ? 208  GLY C C   1 
ATOM   9677  O  O   . GLY C 1 205 ? 25.287  3.637   68.795  1.00 61.03 ? 208  GLY C O   1 
ATOM   9678  N  N   . HIS C 1 206 ? 27.039  4.433   67.635  1.00 60.44 ? 209  HIS C N   1 
ATOM   9679  C  CA  . HIS C 1 206 ? 26.699  3.712   66.416  1.00 60.21 ? 209  HIS C CA  1 
ATOM   9680  C  C   . HIS C 1 206 ? 27.261  2.304   66.380  1.00 60.30 ? 209  HIS C C   1 
ATOM   9681  O  O   . HIS C 1 206 ? 26.748  1.439   65.678  1.00 60.24 ? 209  HIS C O   1 
ATOM   9682  C  CB  . HIS C 1 206 ? 27.203  4.493   65.213  1.00 59.87 ? 209  HIS C CB  1 
ATOM   9683  C  CG  . HIS C 1 206 ? 26.708  5.903   65.162  1.00 59.69 ? 209  HIS C CG  1 
ATOM   9684  N  ND1 . HIS C 1 206 ? 25.366  6.224   65.181  1.00 59.79 ? 209  HIS C ND1 1 
ATOM   9685  C  CD2 . HIS C 1 206 ? 27.372  7.080   65.084  1.00 59.67 ? 209  HIS C CD2 1 
ATOM   9686  C  CE1 . HIS C 1 206 ? 25.228  7.535   65.113  1.00 59.63 ? 209  HIS C CE1 1 
ATOM   9687  N  NE2 . HIS C 1 206 ? 26.429  8.078   65.053  1.00 59.65 ? 209  HIS C NE2 1 
ATOM   9688  N  N   . ARG C 1 207 ? 28.309  2.078   67.157  1.00 60.54 ? 210  ARG C N   1 
ATOM   9689  C  CA  . ARG C 1 207 ? 28.971  0.781   67.210  1.00 60.78 ? 210  ARG C CA  1 
ATOM   9690  C  C   . ARG C 1 207 ? 28.165  -0.274  67.959  1.00 61.30 ? 210  ARG C C   1 
ATOM   9691  O  O   . ARG C 1 207 ? 28.455  -1.473  67.868  1.00 61.05 ? 210  ARG C O   1 
ATOM   9692  C  CB  . ARG C 1 207 ? 30.341  0.933   67.882  1.00 60.29 ? 210  ARG C CB  1 
ATOM   9693  C  CG  . ARG C 1 207 ? 31.248  1.970   67.240  1.00 59.53 ? 210  ARG C CG  1 
ATOM   9694  C  CD  . ARG C 1 207 ? 32.569  2.113   67.985  1.00 59.16 ? 210  ARG C CD  1 
ATOM   9695  N  NE  . ARG C 1 207 ? 32.401  2.686   69.318  1.00 59.16 ? 210  ARG C NE  1 
ATOM   9696  C  CZ  . ARG C 1 207 ? 32.631  2.030   70.452  1.00 59.22 ? 210  ARG C CZ  1 
ATOM   9697  N  NH1 . ARG C 1 207 ? 33.035  0.766   70.423  1.00 59.05 ? 210  ARG C NH1 1 
ATOM   9698  N  NH2 . ARG C 1 207 ? 32.486  2.646   71.619  1.00 58.72 ? 210  ARG C NH2 1 
ATOM   9699  N  N   . HIS C 1 208 ? 27.144  0.161   68.686  1.00 61.74 ? 211  HIS C N   1 
ATOM   9700  C  CA  . HIS C 1 208 ? 26.362  -0.774  69.469  1.00 62.24 ? 211  HIS C CA  1 
ATOM   9701  C  C   . HIS C 1 208 ? 24.966  -1.031  68.961  1.00 62.32 ? 211  HIS C C   1 
ATOM   9702  O  O   . HIS C 1 208 ? 24.047  -1.266  69.745  1.00 62.76 ? 211  HIS C O   1 
ATOM   9703  C  CB  . HIS C 1 208 ? 26.324  -0.314  70.918  1.00 63.06 ? 211  HIS C CB  1 
ATOM   9704  C  CG  . HIS C 1 208 ? 27.646  -0.415  71.610  1.00 63.65 ? 211  HIS C CG  1 
ATOM   9705  N  ND1 . HIS C 1 208 ? 28.271  -1.621  71.842  1.00 64.05 ? 211  HIS C ND1 1 
ATOM   9706  C  CD2 . HIS C 1 208 ? 28.462  0.538   72.118  1.00 63.79 ? 211  HIS C CD2 1 
ATOM   9707  C  CE1 . HIS C 1 208 ? 29.418  -1.410  72.465  1.00 63.92 ? 211  HIS C CE1 1 
ATOM   9708  N  NE2 . HIS C 1 208 ? 29.557  -0.108  72.644  1.00 64.33 ? 211  HIS C NE2 1 
ATOM   9709  N  N   . MET C 1 209 ? 24.814  -1.037  67.645  1.00 62.10 ? 212  MET C N   1 
ATOM   9710  C  CA  . MET C 1 209 ? 23.511  -1.276  67.045  1.00 61.77 ? 212  MET C CA  1 
ATOM   9711  C  C   . MET C 1 209 ? 23.685  -2.136  65.813  1.00 61.84 ? 212  MET C C   1 
ATOM   9712  O  O   . MET C 1 209 ? 24.775  -2.221  65.253  1.00 62.27 ? 212  MET C O   1 
ATOM   9713  C  CB  . MET C 1 209 ? 22.872  0.047   66.647  1.00 60.88 ? 212  MET C CB  1 
ATOM   9714  C  CG  . MET C 1 209 ? 23.664  0.781   65.608  1.00 59.88 ? 212  MET C CG  1 
ATOM   9715  S  SD  . MET C 1 209 ? 23.041  2.410   65.360  1.00 59.23 ? 212  MET C SD  1 
ATOM   9716  C  CE  . MET C 1 209 ? 23.545  2.692   63.701  1.00 58.66 ? 212  MET C CE  1 
ATOM   9717  N  N   . ASN C 1 210 ? 22.609  -2.785  65.399  1.00 61.64 ? 213  ASN C N   1 
ATOM   9718  C  CA  . ASN C 1 210 ? 22.659  -3.624  64.220  1.00 61.33 ? 213  ASN C CA  1 
ATOM   9719  C  C   . ASN C 1 210 ? 22.315  -2.800  62.992  1.00 60.96 ? 213  ASN C C   1 
ATOM   9720  O  O   . ASN C 1 210 ? 21.891  -1.646  63.099  1.00 60.87 ? 213  ASN C O   1 
ATOM   9721  C  CB  . ASN C 1 210 ? 21.663  -4.778  64.343  1.00 61.62 ? 213  ASN C CB  1 
ATOM   9722  C  CG  . ASN C 1 210 ? 22.040  -5.766  65.420  1.00 61.77 ? 213  ASN C CG  1 
ATOM   9723  O  OD1 . ASN C 1 210 ? 23.212  -5.924  65.763  1.00 62.37 ? 213  ASN C OD1 1 
ATOM   9724  N  ND2 . ASN C 1 210 ? 21.045  -6.460  65.945  1.00 61.95 ? 213  ASN C ND2 1 
ATOM   9725  N  N   . GLY C 1 211 ? 22.498  -3.414  61.828  1.00 60.75 ? 214  GLY C N   1 
ATOM   9726  C  CA  . GLY C 1 211 ? 22.177  -2.771  60.569  1.00 60.34 ? 214  GLY C CA  1 
ATOM   9727  C  C   . GLY C 1 211 ? 21.365  -3.752  59.740  1.00 60.28 ? 214  GLY C C   1 
ATOM   9728  O  O   . GLY C 1 211 ? 21.547  -4.975  59.856  1.00 60.06 ? 214  GLY C O   1 
ATOM   9729  N  N   . TYR C 1 212 ? 20.445  -3.236  58.930  1.00 60.06 ? 215  TYR C N   1 
ATOM   9730  C  CA  . TYR C 1 212 ? 19.623  -4.093  58.093  1.00 59.77 ? 215  TYR C CA  1 
ATOM   9731  C  C   . TYR C 1 212 ? 19.344  -3.415  56.782  1.00 60.02 ? 215  TYR C C   1 
ATOM   9732  O  O   . TYR C 1 212 ? 19.317  -2.189  56.699  1.00 60.04 ? 215  TYR C O   1 
ATOM   9733  C  CB  . TYR C 1 212 ? 18.275  -4.363  58.747  1.00 59.65 ? 215  TYR C CB  1 
ATOM   9734  C  CG  . TYR C 1 212 ? 18.362  -4.906  60.140  1.00 59.52 ? 215  TYR C CG  1 
ATOM   9735  C  CD1 . TYR C 1 212 ? 18.477  -6.273  60.370  1.00 59.44 ? 215  TYR C CD1 1 
ATOM   9736  C  CD2 . TYR C 1 212 ? 18.313  -4.053  61.236  1.00 59.54 ? 215  TYR C CD2 1 
ATOM   9737  C  CE1 . TYR C 1 212 ? 18.541  -6.779  61.661  1.00 59.42 ? 215  TYR C CE1 1 
ATOM   9738  C  CE2 . TYR C 1 212 ? 18.376  -4.545  62.533  1.00 59.55 ? 215  TYR C CE2 1 
ATOM   9739  C  CZ  . TYR C 1 212 ? 18.488  -5.910  62.738  1.00 59.54 ? 215  TYR C CZ  1 
ATOM   9740  O  OH  . TYR C 1 212 ? 18.545  -6.409  64.020  1.00 59.81 ? 215  TYR C OH  1 
ATOM   9741  N  N   . GLY C 1 213 ? 19.140  -4.222  55.752  1.00 60.12 ? 216  GLY C N   1 
ATOM   9742  C  CA  . GLY C 1 213 ? 18.802  -3.668  54.461  1.00 60.31 ? 216  GLY C CA  1 
ATOM   9743  C  C   . GLY C 1 213 ? 17.313  -3.384  54.512  1.00 60.38 ? 216  GLY C C   1 
ATOM   9744  O  O   . GLY C 1 213 ? 16.807  -2.524  53.790  1.00 60.80 ? 216  GLY C O   1 
ATOM   9745  N  N   . SER C 1 214 ? 16.628  -4.101  55.405  1.00 60.09 ? 217  SER C N   1 
ATOM   9746  C  CA  . SER C 1 214 ? 15.185  -3.991  55.621  1.00 59.35 ? 217  SER C CA  1 
ATOM   9747  C  C   . SER C 1 214 ? 14.356  -4.584  54.488  1.00 59.32 ? 217  SER C C   1 
ATOM   9748  O  O   . SER C 1 214 ? 13.706  -5.614  54.661  1.00 59.54 ? 217  SER C O   1 
ATOM   9749  C  CB  . SER C 1 214 ? 14.780  -2.539  55.886  1.00 59.01 ? 217  SER C CB  1 
ATOM   9750  O  OG  . SER C 1 214 ? 15.396  -2.059  57.069  1.00 58.39 ? 217  SER C OG  1 
ATOM   9751  N  N   . HIS C 1 215 ? 14.388  -3.941  53.328  1.00 59.03 ? 218  HIS C N   1 
ATOM   9752  C  CA  . HIS C 1 215 ? 13.632  -4.415  52.180  1.00 58.77 ? 218  HIS C CA  1 
ATOM   9753  C  C   . HIS C 1 215 ? 14.084  -5.791  51.804  1.00 58.72 ? 218  HIS C C   1 
ATOM   9754  O  O   . HIS C 1 215 ? 15.161  -6.228  52.191  1.00 58.84 ? 218  HIS C O   1 
ATOM   9755  C  CB  . HIS C 1 215 ? 13.908  -3.552  50.961  1.00 58.83 ? 218  HIS C CB  1 
ATOM   9756  C  CG  . HIS C 1 215 ? 13.657  -2.096  51.170  1.00 59.11 ? 218  HIS C CG  1 
ATOM   9757  N  ND1 . HIS C 1 215 ? 12.389  -1.555  51.185  1.00 59.41 ? 218  HIS C ND1 1 
ATOM   9758  C  CD2 . HIS C 1 215 ? 14.515  -1.058  51.304  1.00 59.09 ? 218  HIS C CD2 1 
ATOM   9759  C  CE1 . HIS C 1 215 ? 12.477  -0.242  51.313  1.00 59.44 ? 218  HIS C CE1 1 
ATOM   9760  N  NE2 . HIS C 1 215 ? 13.755  0.085   51.386  1.00 59.51 ? 218  HIS C NE2 1 
ATOM   9761  N  N   . THR C 1 216 ? 13.253  -6.470  51.033  1.00 58.77 ? 219  THR C N   1 
ATOM   9762  C  CA  . THR C 1 216 ? 13.606  -7.781  50.523  1.00 58.73 ? 219  THR C CA  1 
ATOM   9763  C  C   . THR C 1 216 ? 14.294  -7.450  49.199  1.00 58.81 ? 219  THR C C   1 
ATOM   9764  O  O   . THR C 1 216 ? 13.886  -6.522  48.499  1.00 58.75 ? 219  THR C O   1 
ATOM   9765  C  CB  . THR C 1 216 ? 12.353  -8.649  50.234  1.00 58.77 ? 219  THR C CB  1 
ATOM   9766  O  OG1 . THR C 1 216 ? 11.740  -9.051  51.468  1.00 58.51 ? 219  THR C OG1 1 
ATOM   9767  C  CG2 . THR C 1 216 ? 12.733  -9.885  49.434  1.00 58.23 ? 219  THR C CG2 1 
ATOM   9768  N  N   . PHE C 1 217 ? 15.370  -8.158  48.881  1.00 58.52 ? 220  PHE C N   1 
ATOM   9769  C  CA  . PHE C 1 217 ? 16.080  -7.922  47.635  1.00 57.98 ? 220  PHE C CA  1 
ATOM   9770  C  C   . PHE C 1 217 ? 16.127  -9.215  46.852  1.00 58.00 ? 220  PHE C C   1 
ATOM   9771  O  O   . PHE C 1 217 ? 15.764  -10.267 47.372  1.00 58.38 ? 220  PHE C O   1 
ATOM   9772  C  CB  . PHE C 1 217 ? 17.498  -7.448  47.913  1.00 57.48 ? 220  PHE C CB  1 
ATOM   9773  C  CG  . PHE C 1 217 ? 17.571  -6.077  48.496  1.00 57.04 ? 220  PHE C CG  1 
ATOM   9774  C  CD1 . PHE C 1 217 ? 17.732  -4.970  47.677  1.00 56.48 ? 220  PHE C CD1 1 
ATOM   9775  C  CD2 . PHE C 1 217 ? 17.512  -5.891  49.868  1.00 56.79 ? 220  PHE C CD2 1 
ATOM   9776  C  CE1 . PHE C 1 217 ? 17.837  -3.700  48.213  1.00 56.34 ? 220  PHE C CE1 1 
ATOM   9777  C  CE2 . PHE C 1 217 ? 17.617  -4.621  50.416  1.00 56.54 ? 220  PHE C CE2 1 
ATOM   9778  C  CZ  . PHE C 1 217 ? 17.781  -3.524  49.587  1.00 56.38 ? 220  PHE C CZ  1 
ATOM   9779  N  N   . LYS C 1 218 ? 16.577  -9.142  45.605  1.00 57.73 ? 221  LYS C N   1 
ATOM   9780  C  CA  . LYS C 1 218 ? 16.661  -10.327 44.771  1.00 57.59 ? 221  LYS C CA  1 
ATOM   9781  C  C   . LYS C 1 218 ? 18.115  -10.615 44.417  1.00 57.77 ? 221  LYS C C   1 
ATOM   9782  O  O   . LYS C 1 218 ? 18.864  -9.699  44.069  1.00 58.34 ? 221  LYS C O   1 
ATOM   9783  C  CB  . LYS C 1 218 ? 15.839  -10.132 43.498  1.00 57.42 ? 221  LYS C CB  1 
ATOM   9784  C  CG  . LYS C 1 218 ? 15.818  -11.353 42.605  1.00 57.79 ? 221  LYS C CG  1 
ATOM   9785  C  CD  . LYS C 1 218 ? 14.811  -11.224 41.478  1.00 57.91 ? 221  LYS C CD  1 
ATOM   9786  C  CE  . LYS C 1 218 ? 15.157  -10.075 40.545  1.00 58.21 ? 221  LYS C CE  1 
ATOM   9787  N  NZ  . LYS C 1 218 ? 14.312  -10.091 39.312  1.00 58.57 ? 221  LYS C NZ  1 
ATOM   9788  N  N   . LEU C 1 219 ? 18.521  -11.876 44.548  1.00 57.26 ? 222  LEU C N   1 
ATOM   9789  C  CA  . LEU C 1 219 ? 19.882  -12.287 44.228  1.00 56.66 ? 222  LEU C CA  1 
ATOM   9790  C  C   . LEU C 1 219 ? 19.798  -13.218 43.043  1.00 56.58 ? 222  LEU C C   1 
ATOM   9791  O  O   . LEU C 1 219 ? 18.967  -14.121 43.031  1.00 56.85 ? 222  LEU C O   1 
ATOM   9792  C  CB  . LEU C 1 219 ? 20.510  -13.040 45.397  1.00 56.56 ? 222  LEU C CB  1 
ATOM   9793  C  CG  . LEU C 1 219 ? 20.714  -12.286 46.709  1.00 56.66 ? 222  LEU C CG  1 
ATOM   9794  C  CD1 . LEU C 1 219 ? 21.377  -13.207 47.718  1.00 56.26 ? 222  LEU C CD1 1 
ATOM   9795  C  CD2 . LEU C 1 219 ? 21.576  -11.048 46.474  1.00 56.67 ? 222  LEU C CD2 1 
ATOM   9796  N  N   . VAL C 1 220 ? 20.646  -12.998 42.046  1.00 56.59 ? 223  VAL C N   1 
ATOM   9797  C  CA  . VAL C 1 220 ? 20.654  -13.843 40.856  1.00 56.77 ? 223  VAL C CA  1 
ATOM   9798  C  C   . VAL C 1 220 ? 22.021  -14.473 40.728  1.00 57.42 ? 223  VAL C C   1 
ATOM   9799  O  O   . VAL C 1 220 ? 23.036  -13.807 40.954  1.00 57.43 ? 223  VAL C O   1 
ATOM   9800  C  CB  . VAL C 1 220 ? 20.399  -13.036 39.577  1.00 56.44 ? 223  VAL C CB  1 
ATOM   9801  C  CG1 . VAL C 1 220 ? 20.417  -13.956 38.369  1.00 56.04 ? 223  VAL C CG1 1 
ATOM   9802  C  CG2 . VAL C 1 220 ? 19.077  -12.304 39.669  1.00 56.01 ? 223  VAL C CG2 1 
ATOM   9803  N  N   . ASN C 1 221 ? 22.061  -15.754 40.384  1.00 58.09 ? 224  ASN C N   1 
ATOM   9804  C  CA  . ASN C 1 221 ? 23.345  -16.413 40.243  1.00 58.94 ? 224  ASN C CA  1 
ATOM   9805  C  C   . ASN C 1 221 ? 23.749  -16.499 38.789  1.00 59.92 ? 224  ASN C C   1 
ATOM   9806  O  O   . ASN C 1 221 ? 22.974  -16.152 37.898  1.00 59.92 ? 224  ASN C O   1 
ATOM   9807  C  CB  . ASN C 1 221 ? 23.335  -17.800 40.884  1.00 58.52 ? 224  ASN C CB  1 
ATOM   9808  C  CG  . ASN C 1 221 ? 22.349  -18.729 40.241  1.00 58.53 ? 224  ASN C CG  1 
ATOM   9809  O  OD1 . ASN C 1 221 ? 21.851  -18.465 39.152  1.00 59.35 ? 224  ASN C OD1 1 
ATOM   9810  N  ND2 . ASN C 1 221 ? 22.050  -19.827 40.917  1.00 58.11 ? 224  ASN C ND2 1 
ATOM   9811  N  N   . ALA C 1 222 ? 24.960  -16.994 38.567  1.00 61.10 ? 225  ALA C N   1 
ATOM   9812  C  CA  . ALA C 1 222 ? 25.532  -17.140 37.236  1.00 62.40 ? 225  ALA C CA  1 
ATOM   9813  C  C   . ALA C 1 222 ? 24.626  -17.868 36.263  1.00 63.60 ? 225  ALA C C   1 
ATOM   9814  O  O   . ALA C 1 222 ? 24.573  -17.511 35.091  1.00 64.23 ? 225  ALA C O   1 
ATOM   9815  C  CB  . ALA C 1 222 ? 26.870  -17.843 37.320  1.00 62.20 ? 225  ALA C CB  1 
ATOM   9816  N  N   . ASN C 1 223 ? 23.931  -18.898 36.731  1.00 64.70 ? 226  ASN C N   1 
ATOM   9817  C  CA  . ASN C 1 223 ? 23.031  -19.643 35.858  1.00 65.72 ? 226  ASN C CA  1 
ATOM   9818  C  C   . ASN C 1 223 ? 21.752  -18.855 35.630  1.00 66.24 ? 226  ASN C C   1 
ATOM   9819  O  O   . ASN C 1 223 ? 20.850  -19.304 34.923  1.00 66.54 ? 226  ASN C O   1 
ATOM   9820  C  CB  . ASN C 1 223 ? 22.695  -21.000 36.461  1.00 66.63 ? 226  ASN C CB  1 
ATOM   9821  C  CG  . ASN C 1 223 ? 23.922  -21.841 36.706  1.00 67.46 ? 226  ASN C CG  1 
ATOM   9822  O  OD1 . ASN C 1 223 ? 24.019  -22.530 37.723  1.00 68.08 ? 226  ASN C OD1 1 
ATOM   9823  N  ND2 . ASN C 1 223 ? 24.878  -21.781 35.782  1.00 67.78 ? 226  ASN C ND2 1 
ATOM   9824  N  N   . GLY C 1 224 ? 21.666  -17.685 36.249  1.00 66.32 ? 227  GLY C N   1 
ATOM   9825  C  CA  . GLY C 1 224 ? 20.492  -16.859 36.077  1.00 66.26 ? 227  GLY C CA  1 
ATOM   9826  C  C   . GLY C 1 224 ? 19.370  -17.119 37.060  1.00 66.36 ? 227  GLY C C   1 
ATOM   9827  O  O   . GLY C 1 224 ? 18.382  -16.384 37.065  1.00 66.71 ? 227  GLY C O   1 
ATOM   9828  N  N   . GLU C 1 225 ? 19.482  -18.156 37.882  1.00 65.81 ? 228  GLU C N   1 
ATOM   9829  C  CA  . GLU C 1 225 ? 18.429  -18.425 38.851  1.00 65.22 ? 228  GLU C CA  1 
ATOM   9830  C  C   . GLU C 1 225 ? 18.386  -17.272 39.825  1.00 64.50 ? 228  GLU C C   1 
ATOM   9831  O  O   . GLU C 1 225 ? 19.401  -16.602 40.047  1.00 64.39 ? 228  GLU C O   1 
ATOM   9832  C  CB  . GLU C 1 225 ? 18.718  -19.698 39.617  1.00 65.93 ? 228  GLU C CB  1 
ATOM   9833  C  CG  . GLU C 1 225 ? 18.810  -20.920 38.760  1.00 66.60 ? 228  GLU C CG  1 
ATOM   9834  C  CD  . GLU C 1 225 ? 19.536  -22.011 39.482  1.00 67.14 ? 228  GLU C CD  1 
ATOM   9835  O  OE1 . GLU C 1 225 ? 18.895  -22.715 40.295  1.00 67.82 ? 228  GLU C OE1 1 
ATOM   9836  O  OE2 . GLU C 1 225 ? 20.762  -22.130 39.273  1.00 67.45 ? 228  GLU C OE2 1 
ATOM   9837  N  N   . ALA C 1 226 ? 17.221  -17.065 40.429  1.00 63.77 ? 229  ALA C N   1 
ATOM   9838  C  CA  . ALA C 1 226 ? 17.056  -15.978 41.381  1.00 62.97 ? 229  ALA C CA  1 
ATOM   9839  C  C   . ALA C 1 226 ? 16.269  -16.345 42.625  1.00 62.50 ? 229  ALA C C   1 
ATOM   9840  O  O   . ALA C 1 226 ? 15.338  -17.144 42.579  1.00 62.59 ? 229  ALA C O   1 
ATOM   9841  C  CB  . ALA C 1 226 ? 16.402  -14.804 40.701  1.00 63.09 ? 229  ALA C CB  1 
ATOM   9842  N  N   . VAL C 1 227 ? 16.657  -15.742 43.740  1.00 61.79 ? 230  VAL C N   1 
ATOM   9843  C  CA  . VAL C 1 227 ? 15.990  -15.953 45.012  1.00 61.24 ? 230  VAL C CA  1 
ATOM   9844  C  C   . VAL C 1 227 ? 15.881  -14.593 45.659  1.00 61.32 ? 230  VAL C C   1 
ATOM   9845  O  O   . VAL C 1 227 ? 16.587  -13.662 45.268  1.00 61.05 ? 230  VAL C O   1 
ATOM   9846  C  CB  . VAL C 1 227 ? 16.795  -16.860 45.949  1.00 61.03 ? 230  VAL C CB  1 
ATOM   9847  C  CG1 . VAL C 1 227 ? 16.899  -18.254 45.370  1.00 60.65 ? 230  VAL C CG1 1 
ATOM   9848  C  CG2 . VAL C 1 227 ? 18.173  -16.277 46.194  1.00 60.88 ? 230  VAL C CG2 1 
ATOM   9849  N  N   . TYR C 1 228 ? 14.957  -14.461 46.605  1.00 61.72 ? 231  TYR C N   1 
ATOM   9850  C  CA  . TYR C 1 228 ? 14.776  -13.203 47.319  1.00 61.78 ? 231  TYR C CA  1 
ATOM   9851  C  C   . TYR C 1 228 ? 15.618  -13.275 48.584  1.00 61.55 ? 231  TYR C C   1 
ATOM   9852  O  O   . TYR C 1 228 ? 15.879  -14.368 49.107  1.00 61.61 ? 231  TYR C O   1 
ATOM   9853  C  CB  . TYR C 1 228 ? 13.298  -12.949 47.653  1.00 62.01 ? 231  TYR C CB  1 
ATOM   9854  C  CG  . TYR C 1 228 ? 12.436  -12.557 46.460  1.00 62.57 ? 231  TYR C CG  1 
ATOM   9855  C  CD1 . TYR C 1 228 ? 12.785  -11.484 45.641  1.00 62.75 ? 231  TYR C CD1 1 
ATOM   9856  C  CD2 . TYR C 1 228 ? 11.272  -13.261 46.152  1.00 62.60 ? 231  TYR C CD2 1 
ATOM   9857  C  CE1 . TYR C 1 228 ? 11.994  -11.125 44.541  1.00 63.16 ? 231  TYR C CE1 1 
ATOM   9858  C  CE2 . TYR C 1 228 ? 10.478  -12.909 45.056  1.00 62.94 ? 231  TYR C CE2 1 
ATOM   9859  C  CZ  . TYR C 1 228 ? 10.845  -11.843 44.256  1.00 63.13 ? 231  TYR C CZ  1 
ATOM   9860  O  OH  . TYR C 1 228 ? 10.064  -11.498 43.172  1.00 63.33 ? 231  TYR C OH  1 
ATOM   9861  N  N   . CYS C 1 229 ? 16.038  -12.115 49.076  1.00 61.57 ? 232  CYS C N   1 
ATOM   9862  C  CA  . CYS C 1 229 ? 16.880  -12.079 50.256  1.00 61.60 ? 232  CYS C CA  1 
ATOM   9863  C  C   . CYS C 1 229 ? 16.668  -10.859 51.135  1.00 61.44 ? 232  CYS C C   1 
ATOM   9864  O  O   . CYS C 1 229 ? 16.015  -9.889  50.745  1.00 61.54 ? 232  CYS C O   1 
ATOM   9865  C  CB  . CYS C 1 229 ? 18.349  -12.121 49.840  1.00 61.91 ? 232  CYS C CB  1 
ATOM   9866  S  SG  . CYS C 1 229 ? 18.934  -10.567 49.116  1.00 62.77 ? 232  CYS C SG  1 
ATOM   9867  N  N   . LYS C 1 230 ? 17.255  -10.934 52.324  1.00 61.01 ? 233  LYS C N   1 
ATOM   9868  C  CA  . LYS C 1 230 ? 17.214  -9.879  53.320  1.00 60.70 ? 233  LYS C CA  1 
ATOM   9869  C  C   . LYS C 1 230 ? 18.663  -9.749  53.754  1.00 60.57 ? 233  LYS C C   1 
ATOM   9870  O  O   . LYS C 1 230 ? 19.386  -10.744 53.777  1.00 60.71 ? 233  LYS C O   1 
ATOM   9871  C  CB  . LYS C 1 230 ? 16.388  -10.324 54.528  1.00 61.10 ? 233  LYS C CB  1 
ATOM   9872  C  CG  . LYS C 1 230 ? 14.883  -10.378 54.326  1.00 60.66 ? 233  LYS C CG  1 
ATOM   9873  C  CD  . LYS C 1 230 ? 14.274  -8.990  54.325  1.00 60.45 ? 233  LYS C CD  1 
ATOM   9874  C  CE  . LYS C 1 230 ? 12.764  -9.067  54.426  1.00 60.42 ? 233  LYS C CE  1 
ATOM   9875  N  NZ  . LYS C 1 230 ? 12.131  -7.733  54.245  1.00 60.15 ? 233  LYS C NZ  1 
ATOM   9876  N  N   . PHE C 1 231 ? 19.096  -8.534  54.079  1.00 60.29 ? 234  PHE C N   1 
ATOM   9877  C  CA  . PHE C 1 231 ? 20.470  -8.312  54.519  1.00 59.65 ? 234  PHE C CA  1 
ATOM   9878  C  C   . PHE C 1 231 ? 20.488  -7.943  55.984  1.00 59.48 ? 234  PHE C C   1 
ATOM   9879  O  O   . PHE C 1 231 ? 19.692  -7.118  56.430  1.00 59.37 ? 234  PHE C O   1 
ATOM   9880  C  CB  . PHE C 1 231 ? 21.123  -7.191  53.716  1.00 59.23 ? 234  PHE C CB  1 
ATOM   9881  C  CG  . PHE C 1 231 ? 21.329  -7.522  52.274  1.00 59.11 ? 234  PHE C CG  1 
ATOM   9882  C  CD1 . PHE C 1 231 ? 22.290  -8.440  51.895  1.00 58.97 ? 234  PHE C CD1 1 
ATOM   9883  C  CD2 . PHE C 1 231 ? 20.568  -6.907  51.292  1.00 58.96 ? 234  PHE C CD2 1 
ATOM   9884  C  CE1 . PHE C 1 231 ? 22.493  -8.742  50.559  1.00 59.12 ? 234  PHE C CE1 1 
ATOM   9885  C  CE2 . PHE C 1 231 ? 20.765  -7.201  49.954  1.00 59.07 ? 234  PHE C CE2 1 
ATOM   9886  C  CZ  . PHE C 1 231 ? 21.732  -8.121  49.587  1.00 59.16 ? 234  PHE C CZ  1 
ATOM   9887  N  N   . HIS C 1 232 ? 21.394  -8.556  56.733  1.00 59.23 ? 235  HIS C N   1 
ATOM   9888  C  CA  . HIS C 1 232 ? 21.510  -8.265  58.151  1.00 59.24 ? 235  HIS C CA  1 
ATOM   9889  C  C   . HIS C 1 232 ? 22.968  -8.109  58.528  1.00 59.21 ? 235  HIS C C   1 
ATOM   9890  O  O   . HIS C 1 232 ? 23.812  -8.893  58.094  1.00 59.31 ? 235  HIS C O   1 
ATOM   9891  C  CB  . HIS C 1 232 ? 20.967  -9.412  58.997  1.00 59.57 ? 235  HIS C CB  1 
ATOM   9892  C  CG  . HIS C 1 232 ? 19.533  -9.756  58.743  1.00 59.71 ? 235  HIS C CG  1 
ATOM   9893  N  ND1 . HIS C 1 232 ? 18.597  -9.797  59.752  1.00 59.74 ? 235  HIS C ND1 1 
ATOM   9894  C  CD2 . HIS C 1 232 ? 18.901  -10.186 57.624  1.00 60.04 ? 235  HIS C CD2 1 
ATOM   9895  C  CE1 . HIS C 1 232 ? 17.452  -10.249 59.271  1.00 60.11 ? 235  HIS C CE1 1 
ATOM   9896  N  NE2 . HIS C 1 232 ? 17.610  -10.493 57.981  1.00 60.13 ? 235  HIS C NE2 1 
ATOM   9897  N  N   . TYR C 1 233 ? 23.270  -7.091  59.324  1.00 59.19 ? 236  TYR C N   1 
ATOM   9898  C  CA  . TYR C 1 233 ? 24.629  -6.907  59.791  1.00 59.28 ? 236  TYR C CA  1 
ATOM   9899  C  C   . TYR C 1 233 ? 24.649  -6.604  61.281  1.00 59.86 ? 236  TYR C C   1 
ATOM   9900  O  O   . TYR C 1 233 ? 24.423  -5.471  61.713  1.00 60.03 ? 236  TYR C O   1 
ATOM   9901  C  CB  . TYR C 1 233 ? 25.431  -5.888  58.964  1.00 58.53 ? 236  TYR C CB  1 
ATOM   9902  C  CG  . TYR C 1 233 ? 24.704  -4.706  58.343  1.00 57.60 ? 236  TYR C CG  1 
ATOM   9903  C  CD1 . TYR C 1 233 ? 25.001  -3.402  58.735  1.00 57.05 ? 236  TYR C CD1 1 
ATOM   9904  C  CD2 . TYR C 1 233 ? 23.836  -4.877  57.266  1.00 57.19 ? 236  TYR C CD2 1 
ATOM   9905  C  CE1 . TYR C 1 233 ? 24.463  -2.303  58.064  1.00 56.44 ? 236  TYR C CE1 1 
ATOM   9906  C  CE2 . TYR C 1 233 ? 23.291  -3.776  56.588  1.00 56.55 ? 236  TYR C CE2 1 
ATOM   9907  C  CZ  . TYR C 1 233 ? 23.615  -2.498  56.993  1.00 56.32 ? 236  TYR C CZ  1 
ATOM   9908  O  OH  . TYR C 1 233 ? 23.107  -1.412  56.312  1.00 56.19 ? 236  TYR C OH  1 
ATOM   9909  N  N   . LYS C 1 234 ? 24.878  -7.660  62.055  1.00 60.45 ? 237  LYS C N   1 
ATOM   9910  C  CA  . LYS C 1 234 ? 24.913  -7.600  63.510  1.00 60.97 ? 237  LYS C CA  1 
ATOM   9911  C  C   . LYS C 1 234 ? 26.185  -6.995  64.058  1.00 60.95 ? 237  LYS C C   1 
ATOM   9912  O  O   . LYS C 1 234 ? 27.273  -7.319  63.598  1.00 61.06 ? 237  LYS C O   1 
ATOM   9913  C  CB  . LYS C 1 234 ? 24.782  -9.008  64.078  1.00 61.91 ? 237  LYS C CB  1 
ATOM   9914  C  CG  . LYS C 1 234 ? 23.559  -9.786  63.606  1.00 62.91 ? 237  LYS C CG  1 
ATOM   9915  C  CD  . LYS C 1 234 ? 22.269  -9.129  64.074  1.00 64.03 ? 237  LYS C CD  1 
ATOM   9916  C  CE  . LYS C 1 234 ? 21.124  -10.129 64.161  1.00 64.30 ? 237  LYS C CE  1 
ATOM   9917  N  NZ  . LYS C 1 234 ? 21.305  -11.068 65.305  1.00 64.50 ? 237  LYS C NZ  1 
ATOM   9918  N  N   . THR C 1 235 ? 26.049  -6.141  65.065  1.00 60.83 ? 238  THR C N   1 
ATOM   9919  C  CA  . THR C 1 235 ? 27.209  -5.519  65.696  1.00 60.74 ? 238  THR C CA  1 
ATOM   9920  C  C   . THR C 1 235 ? 28.037  -6.553  66.422  1.00 61.05 ? 238  THR C C   1 
ATOM   9921  O  O   . THR C 1 235 ? 27.515  -7.372  67.168  1.00 60.86 ? 238  THR C O   1 
ATOM   9922  C  CB  . THR C 1 235 ? 26.823  -4.457  66.739  1.00 60.41 ? 238  THR C CB  1 
ATOM   9923  O  OG1 . THR C 1 235 ? 27.933  -4.223  67.617  1.00 59.84 ? 238  THR C OG1 1 
ATOM   9924  C  CG2 . THR C 1 235 ? 25.655  -4.924  67.564  1.00 59.74 ? 238  THR C CG2 1 
ATOM   9925  N  N   . ASP C 1 236 ? 29.340  -6.496  66.215  1.00 61.29 ? 239  ASP C N   1 
ATOM   9926  C  CA  . ASP C 1 236 ? 30.221  -7.416  66.890  1.00 61.47 ? 239  ASP C CA  1 
ATOM   9927  C  C   . ASP C 1 236 ? 30.574  -6.842  68.250  1.00 61.77 ? 239  ASP C C   1 
ATOM   9928  O  O   . ASP C 1 236 ? 31.196  -7.508  69.073  1.00 61.83 ? 239  ASP C O   1 
ATOM   9929  C  CB  . ASP C 1 236 ? 31.468  -7.660  66.055  1.00 61.61 ? 239  ASP C CB  1 
ATOM   9930  C  CG  . ASP C 1 236 ? 31.170  -8.425  64.786  1.00 61.88 ? 239  ASP C CG  1 
ATOM   9931  O  OD1 . ASP C 1 236 ? 31.938  -8.285  63.814  1.00 62.66 ? 239  ASP C OD1 1 
ATOM   9932  O  OD2 . ASP C 1 236 ? 30.165  -9.170  64.755  1.00 61.82 ? 239  ASP C OD2 1 
ATOM   9933  N  N   . GLN C 1 237 ? 30.179  -5.595  68.485  1.00 62.00 ? 240  GLN C N   1 
ATOM   9934  C  CA  . GLN C 1 237 ? 30.449  -4.956  69.763  1.00 62.07 ? 240  GLN C CA  1 
ATOM   9935  C  C   . GLN C 1 237 ? 29.297  -5.262  70.706  1.00 62.38 ? 240  GLN C C   1 
ATOM   9936  O  O   . GLN C 1 237 ? 29.372  -4.984  71.903  1.00 62.49 ? 240  GLN C O   1 
ATOM   9937  C  CB  . GLN C 1 237 ? 30.611  -3.446  69.597  1.00 61.90 ? 240  GLN C CB  1 
ATOM   9938  C  CG  . GLN C 1 237 ? 31.835  -3.032  68.792  1.00 61.58 ? 240  GLN C CG  1 
ATOM   9939  C  CD  . GLN C 1 237 ? 31.716  -3.392  67.326  1.00 61.56 ? 240  GLN C CD  1 
ATOM   9940  O  OE1 . GLN C 1 237 ? 32.501  -4.179  66.797  1.00 61.68 ? 240  GLN C OE1 1 
ATOM   9941  N  NE2 . GLN C 1 237 ? 30.718  -2.828  66.663  1.00 61.58 ? 240  GLN C NE2 1 
ATOM   9942  N  N   . GLY C 1 238 ? 28.235  -5.846  70.159  1.00 62.39 ? 241  GLY C N   1 
ATOM   9943  C  CA  . GLY C 1 238 ? 27.083  -6.188  70.968  1.00 62.27 ? 241  GLY C CA  1 
ATOM   9944  C  C   . GLY C 1 238 ? 26.148  -5.011  71.128  1.00 62.34 ? 241  GLY C C   1 
ATOM   9945  O  O   . GLY C 1 238 ? 26.581  -3.858  71.066  1.00 62.15 ? 241  GLY C O   1 
ATOM   9946  N  N   . ILE C 1 239 ? 24.861  -5.302  71.309  1.00 62.71 ? 242  ILE C N   1 
ATOM   9947  C  CA  . ILE C 1 239 ? 23.843  -4.268  71.479  1.00 62.97 ? 242  ILE C CA  1 
ATOM   9948  C  C   . ILE C 1 239 ? 23.931  -3.639  72.858  1.00 62.99 ? 242  ILE C C   1 
ATOM   9949  O  O   . ILE C 1 239 ? 23.931  -4.332  73.877  1.00 63.17 ? 242  ILE C O   1 
ATOM   9950  C  CB  . ILE C 1 239 ? 22.414  -4.818  71.260  1.00 63.17 ? 242  ILE C CB  1 
ATOM   9951  C  CG1 . ILE C 1 239 ? 22.105  -4.914  69.766  1.00 63.69 ? 242  ILE C CG1 1 
ATOM   9952  C  CG2 . ILE C 1 239 ? 21.375  -3.909  71.912  1.00 63.18 ? 242  ILE C CG2 1 
ATOM   9953  C  CD1 . ILE C 1 239 ? 22.765  -6.083  69.060  1.00 64.93 ? 242  ILE C CD1 1 
ATOM   9954  N  N   . LYS C 1 240 ? 23.953  -2.315  72.878  1.00 62.97 ? 243  LYS C N   1 
ATOM   9955  C  CA  . LYS C 1 240 ? 24.050  -1.573  74.117  1.00 63.15 ? 243  LYS C CA  1 
ATOM   9956  C  C   . LYS C 1 240 ? 23.200  -0.321  73.921  1.00 62.92 ? 243  LYS C C   1 
ATOM   9957  O  O   . LYS C 1 240 ? 23.309  0.355   72.893  1.00 62.87 ? 243  LYS C O   1 
ATOM   9958  C  CB  . LYS C 1 240 ? 25.517  -1.231  74.353  1.00 63.82 ? 243  LYS C CB  1 
ATOM   9959  C  CG  . LYS C 1 240 ? 25.878  -0.801  75.747  1.00 65.25 ? 243  LYS C CG  1 
ATOM   9960  C  CD  . LYS C 1 240 ? 27.390  -0.678  75.845  1.00 66.75 ? 243  LYS C CD  1 
ATOM   9961  C  CE  . LYS C 1 240 ? 27.818  -0.062  77.165  1.00 67.85 ? 243  LYS C CE  1 
ATOM   9962  N  NZ  . LYS C 1 240 ? 29.302  0.095   77.240  1.00 68.62 ? 243  LYS C NZ  1 
ATOM   9963  N  N   . ASN C 1 241 ? 22.316  -0.041  74.874  1.00 62.51 ? 244  ASN C N   1 
ATOM   9964  C  CA  . ASN C 1 241 ? 21.442  1.114   74.756  1.00 62.25 ? 244  ASN C CA  1 
ATOM   9965  C  C   . ASN C 1 241 ? 21.585  2.098   75.895  1.00 62.63 ? 244  ASN C C   1 
ATOM   9966  O  O   . ASN C 1 241 ? 22.073  1.748   76.972  1.00 63.08 ? 244  ASN C O   1 
ATOM   9967  C  CB  . ASN C 1 241 ? 19.995  0.658   74.665  1.00 61.74 ? 244  ASN C CB  1 
ATOM   9968  C  CG  . ASN C 1 241 ? 19.766  -0.295  73.524  1.00 61.44 ? 244  ASN C CG  1 
ATOM   9969  O  OD1 . ASN C 1 241 ? 20.307  -0.106  72.437  1.00 61.40 ? 244  ASN C OD1 1 
ATOM   9970  N  ND2 . ASN C 1 241 ? 18.970  -1.334  73.762  1.00 60.99 ? 244  ASN C ND2 1 
ATOM   9971  N  N   . LEU C 1 242 ? 21.138  3.330   75.643  1.00 62.75 ? 245  LEU C N   1 
ATOM   9972  C  CA  . LEU C 1 242 ? 21.180  4.415   76.618  1.00 62.60 ? 245  LEU C CA  1 
ATOM   9973  C  C   . LEU C 1 242 ? 19.826  4.620   77.294  1.00 63.27 ? 245  LEU C C   1 
ATOM   9974  O  O   . LEU C 1 242 ? 18.788  4.694   76.625  1.00 63.41 ? 245  LEU C O   1 
ATOM   9975  C  CB  . LEU C 1 242 ? 21.589  5.728   75.945  1.00 61.63 ? 245  LEU C CB  1 
ATOM   9976  C  CG  . LEU C 1 242 ? 23.034  5.922   75.487  1.00 60.85 ? 245  LEU C CG  1 
ATOM   9977  C  CD1 . LEU C 1 242 ? 23.129  7.170   74.643  1.00 60.04 ? 245  LEU C CD1 1 
ATOM   9978  C  CD2 . LEU C 1 242 ? 23.980  6.006   76.687  1.00 60.37 ? 245  LEU C CD2 1 
ATOM   9979  N  N   . SER C 1 243 ? 19.850  4.730   78.622  1.00 63.32 ? 246  SER C N   1 
ATOM   9980  C  CA  . SER C 1 243 ? 18.645  4.955   79.400  1.00 63.53 ? 246  SER C CA  1 
ATOM   9981  C  C   . SER C 1 243 ? 18.162  6.333   79.012  1.00 64.47 ? 246  SER C C   1 
ATOM   9982  O  O   . SER C 1 243 ? 18.973  7.217   78.726  1.00 64.62 ? 246  SER C O   1 
ATOM   9983  C  CB  . SER C 1 243 ? 18.978  4.969   80.884  1.00 63.00 ? 246  SER C CB  1 
ATOM   9984  O  OG  . SER C 1 243 ? 19.750  6.114   81.202  1.00 62.24 ? 246  SER C OG  1 
ATOM   9985  N  N   . VAL C 1 244 ? 16.850  6.526   79.034  1.00 65.74 ? 247  VAL C N   1 
ATOM   9986  C  CA  . VAL C 1 244 ? 16.260  7.809   78.688  1.00 67.19 ? 247  VAL C CA  1 
ATOM   9987  C  C   . VAL C 1 244 ? 16.934  8.953   79.438  1.00 68.16 ? 247  VAL C C   1 
ATOM   9988  O  O   . VAL C 1 244 ? 17.202  10.008  78.863  1.00 68.73 ? 247  VAL C O   1 
ATOM   9989  C  CB  . VAL C 1 244 ? 14.756  7.824   78.992  1.00 67.06 ? 247  VAL C CB  1 
ATOM   9990  C  CG1 . VAL C 1 244 ? 14.177  9.195   78.719  1.00 67.38 ? 247  VAL C CG1 1 
ATOM   9991  C  CG2 . VAL C 1 244 ? 14.049  6.795   78.139  1.00 67.25 ? 247  VAL C CG2 1 
ATOM   9992  N  N   . GLU C 1 245 ? 17.245  8.728   80.709  1.00 69.01 ? 248  GLU C N   1 
ATOM   9993  C  CA  . GLU C 1 245 ? 17.888  9.754   81.516  1.00 69.79 ? 248  GLU C CA  1 
ATOM   9994  C  C   . GLU C 1 245 ? 19.262  10.123  80.990  1.00 69.18 ? 248  GLU C C   1 
ATOM   9995  O  O   . GLU C 1 245 ? 19.575  11.302  80.825  1.00 69.27 ? 248  GLU C O   1 
ATOM   9996  C  CB  . GLU C 1 245 ? 18.013  9.292   82.955  1.00 71.47 ? 248  GLU C CB  1 
ATOM   9997  C  CG  . GLU C 1 245 ? 16.690  9.031   83.623  1.00 74.10 ? 248  GLU C CG  1 
ATOM   9998  C  CD  . GLU C 1 245 ? 16.876  8.394   84.973  1.00 76.03 ? 248  GLU C CD  1 
ATOM   9999  O  OE1 . GLU C 1 245 ? 16.313  7.299   85.190  1.00 77.23 ? 248  GLU C OE1 1 
ATOM   10000 O  OE2 . GLU C 1 245 ? 17.607  8.976   85.810  1.00 76.81 ? 248  GLU C OE2 1 
ATOM   10001 N  N   . ASP C 1 246 ? 20.090  9.121   80.731  1.00 68.50 ? 249  ASP C N   1 
ATOM   10002 C  CA  . ASP C 1 246 ? 21.416  9.408   80.230  1.00 67.79 ? 249  ASP C CA  1 
ATOM   10003 C  C   . ASP C 1 246 ? 21.357  10.020  78.843  1.00 67.20 ? 249  ASP C C   1 
ATOM   10004 O  O   . ASP C 1 246 ? 22.047  11.001  78.568  1.00 67.33 ? 249  ASP C O   1 
ATOM   10005 C  CB  . ASP C 1 246 ? 22.285  8.159   80.258  1.00 68.04 ? 249  ASP C CB  1 
ATOM   10006 C  CG  . ASP C 1 246 ? 22.573  7.688   81.673  1.00 68.42 ? 249  ASP C CG  1 
ATOM   10007 O  OD1 . ASP C 1 246 ? 23.198  6.622   81.824  1.00 69.03 ? 249  ASP C OD1 1 
ATOM   10008 O  OD2 . ASP C 1 246 ? 22.175  8.375   82.639  1.00 68.49 ? 249  ASP C OD2 1 
ATOM   10009 N  N   . ALA C 1 247 ? 20.486  9.488   77.992  1.00 66.18 ? 250  ALA C N   1 
ATOM   10010 C  CA  . ALA C 1 247 ? 20.337  10.009  76.638  1.00 65.36 ? 250  ALA C CA  1 
ATOM   10011 C  C   . ALA C 1 247 ? 20.019  11.496  76.724  1.00 65.04 ? 250  ALA C C   1 
ATOM   10012 O  O   . ALA C 1 247 ? 20.647  12.324  76.069  1.00 65.10 ? 250  ALA C O   1 
ATOM   10013 C  CB  . ALA C 1 247 ? 19.224  9.279   75.914  1.00 65.21 ? 250  ALA C CB  1 
ATOM   10014 N  N   . ALA C 1 248 ? 19.072  11.830  77.588  1.00 64.43 ? 251  ALA C N   1 
ATOM   10015 C  CA  . ALA C 1 248 ? 18.665  13.208  77.786  1.00 64.01 ? 251  ALA C CA  1 
ATOM   10016 C  C   . ALA C 1 248 ? 19.838  14.061  78.257  1.00 64.05 ? 251  ALA C C   1 
ATOM   10017 O  O   . ALA C 1 248 ? 20.096  15.140  77.716  1.00 64.31 ? 251  ALA C O   1 
ATOM   10018 C  CB  . ALA C 1 248 ? 17.539  13.264  78.802  1.00 63.73 ? 251  ALA C CB  1 
ATOM   10019 N  N   . ARG C 1 249 ? 20.562  13.559  79.251  1.00 63.99 ? 252  ARG C N   1 
ATOM   10020 C  CA  . ARG C 1 249 ? 21.693  14.285  79.806  1.00 64.00 ? 252  ARG C CA  1 
ATOM   10021 C  C   . ARG C 1 249 ? 22.777  14.516  78.767  1.00 63.77 ? 252  ARG C C   1 
ATOM   10022 O  O   . ARG C 1 249 ? 23.268  15.636  78.610  1.00 63.75 ? 252  ARG C O   1 
ATOM   10023 C  CB  . ARG C 1 249 ? 22.269  13.531  80.992  1.00 64.45 ? 252  ARG C CB  1 
ATOM   10024 C  CG  . ARG C 1 249 ? 23.133  14.387  81.873  1.00 65.46 ? 252  ARG C CG  1 
ATOM   10025 C  CD  . ARG C 1 249 ? 23.866  13.539  82.881  1.00 66.38 ? 252  ARG C CD  1 
ATOM   10026 N  NE  . ARG C 1 249 ? 24.856  12.680  82.236  1.00 67.36 ? 252  ARG C NE  1 
ATOM   10027 C  CZ  . ARG C 1 249 ? 24.816  11.352  82.250  1.00 67.90 ? 252  ARG C CZ  1 
ATOM   10028 N  NH1 . ARG C 1 249 ? 23.829  10.718  82.876  1.00 68.54 ? 252  ARG C NH1 1 
ATOM   10029 N  NH2 . ARG C 1 249 ? 25.768  10.658  81.642  1.00 68.02 ? 252  ARG C NH2 1 
ATOM   10030 N  N   . LEU C 1 250 ? 23.140  13.457  78.050  1.00 63.38 ? 253  LEU C N   1 
ATOM   10031 C  CA  . LEU C 1 250 ? 24.167  13.551  77.017  1.00 63.06 ? 253  LEU C CA  1 
ATOM   10032 C  C   . LEU C 1 250 ? 23.769  14.480  75.877  1.00 63.18 ? 253  LEU C C   1 
ATOM   10033 O  O   . LEU C 1 250 ? 24.606  15.203  75.338  1.00 63.22 ? 253  LEU C O   1 
ATOM   10034 C  CB  . LEU C 1 250 ? 24.481  12.167  76.459  1.00 62.46 ? 253  LEU C CB  1 
ATOM   10035 C  CG  . LEU C 1 250 ? 25.247  11.224  77.389  1.00 61.68 ? 253  LEU C CG  1 
ATOM   10036 C  CD1 . LEU C 1 250 ? 25.199  9.812   76.851  1.00 61.37 ? 253  LEU C CD1 1 
ATOM   10037 C  CD2 . LEU C 1 250 ? 26.683  11.685  77.528  1.00 61.28 ? 253  LEU C CD2 1 
ATOM   10038 N  N   . SER C 1 251 ? 22.486  14.466  75.521  1.00 63.63 ? 254  SER C N   1 
ATOM   10039 C  CA  . SER C 1 251 ? 21.992  15.311  74.441  1.00 64.13 ? 254  SER C CA  1 
ATOM   10040 C  C   . SER C 1 251 ? 22.264  16.760  74.805  1.00 64.77 ? 254  SER C C   1 
ATOM   10041 O  O   . SER C 1 251 ? 22.222  17.653  73.957  1.00 64.88 ? 254  SER C O   1 
ATOM   10042 C  CB  . SER C 1 251 ? 20.496  15.097  74.226  1.00 63.61 ? 254  SER C CB  1 
ATOM   10043 O  OG  . SER C 1 251 ? 19.761  15.576  75.328  1.00 63.11 ? 254  SER C OG  1 
ATOM   10044 N  N   . GLN C 1 252 ? 22.561  16.973  76.079  1.00 65.33 ? 255  GLN C N   1 
ATOM   10045 C  CA  . GLN C 1 252 ? 22.856  18.290  76.597  1.00 66.08 ? 255  GLN C CA  1 
ATOM   10046 C  C   . GLN C 1 252 ? 24.366  18.474  76.749  1.00 66.21 ? 255  GLN C C   1 
ATOM   10047 O  O   . GLN C 1 252 ? 24.917  19.493  76.342  1.00 66.35 ? 255  GLN C O   1 
ATOM   10048 C  CB  . GLN C 1 252 ? 22.153  18.467  77.941  1.00 66.81 ? 255  GLN C CB  1 
ATOM   10049 C  CG  . GLN C 1 252 ? 22.197  19.880  78.497  1.00 67.63 ? 255  GLN C CG  1 
ATOM   10050 C  CD  . GLN C 1 252 ? 23.562  20.256  79.030  1.00 68.04 ? 255  GLN C CD  1 
ATOM   10051 O  OE1 . GLN C 1 252 ? 24.149  21.255  78.611  1.00 68.27 ? 255  GLN C OE1 1 
ATOM   10052 N  NE2 . GLN C 1 252 ? 24.089  19.440  79.937  1.00 68.31 ? 255  GLN C NE2 1 
ATOM   10053 N  N   . GLU C 1 253 ? 25.030  17.490  77.344  1.00 66.42 ? 256  GLU C N   1 
ATOM   10054 C  CA  . GLU C 1 253 ? 26.473  17.562  77.554  1.00 66.23 ? 256  GLU C CA  1 
ATOM   10055 C  C   . GLU C 1 253 ? 27.291  17.350  76.281  1.00 65.56 ? 256  GLU C C   1 
ATOM   10056 O  O   . GLU C 1 253 ? 28.398  17.873  76.162  1.00 65.25 ? 256  GLU C O   1 
ATOM   10057 C  CB  . GLU C 1 253 ? 26.895  16.570  78.640  1.00 67.52 ? 256  GLU C CB  1 
ATOM   10058 C  CG  . GLU C 1 253 ? 26.199  16.817  79.977  1.00 69.37 ? 256  GLU C CG  1 
ATOM   10059 C  CD  . GLU C 1 253 ? 26.718  15.939  81.106  1.00 70.60 ? 256  GLU C CD  1 
ATOM   10060 O  OE1 . GLU C 1 253 ? 27.049  14.756  80.855  1.00 71.30 ? 256  GLU C OE1 1 
ATOM   10061 O  OE2 . GLU C 1 253 ? 26.786  16.438  82.254  1.00 71.21 ? 256  GLU C OE2 1 
ATOM   10062 N  N   . ASP C 1 254 ? 26.760  16.571  75.342  1.00 64.60 ? 257  ASP C N   1 
ATOM   10063 C  CA  . ASP C 1 254 ? 27.444  16.319  74.079  1.00 63.64 ? 257  ASP C CA  1 
ATOM   10064 C  C   . ASP C 1 254 ? 26.471  15.880  72.999  1.00 63.06 ? 257  ASP C C   1 
ATOM   10065 O  O   . ASP C 1 254 ? 26.228  14.692  72.793  1.00 63.11 ? 257  ASP C O   1 
ATOM   10066 C  CB  . ASP C 1 254 ? 28.566  15.289  74.240  1.00 63.63 ? 257  ASP C CB  1 
ATOM   10067 C  CG  . ASP C 1 254 ? 29.393  15.110  72.971  1.00 63.51 ? 257  ASP C CG  1 
ATOM   10068 O  OD1 . ASP C 1 254 ? 29.155  15.810  71.964  1.00 63.96 ? 257  ASP C OD1 1 
ATOM   10069 O  OD2 . ASP C 1 254 ? 30.296  14.256  72.978  1.00 63.72 ? 257  ASP C OD2 1 
ATOM   10070 N  N   . PRO C 1 255 ? 25.929  16.850  72.261  1.00 62.42 ? 258  PRO C N   1 
ATOM   10071 C  CA  . PRO C 1 255 ? 24.979  16.609  71.182  1.00 62.16 ? 258  PRO C CA  1 
ATOM   10072 C  C   . PRO C 1 255 ? 25.629  15.748  70.116  1.00 62.10 ? 258  PRO C C   1 
ATOM   10073 O  O   . PRO C 1 255 ? 24.949  15.096  69.331  1.00 62.20 ? 258  PRO C O   1 
ATOM   10074 C  CB  . PRO C 1 255 ? 24.732  18.011  70.637  1.00 62.01 ? 258  PRO C CB  1 
ATOM   10075 C  CG  . PRO C 1 255 ? 24.973  18.884  71.824  1.00 61.82 ? 258  PRO C CG  1 
ATOM   10076 C  CD  . PRO C 1 255 ? 26.200  18.288  72.408  1.00 61.98 ? 258  PRO C CD  1 
ATOM   10077 N  N   . ASP C 1 256 ? 26.957  15.745  70.104  1.00 62.14 ? 259  ASP C N   1 
ATOM   10078 C  CA  . ASP C 1 256 ? 27.704  14.987  69.110  1.00 62.04 ? 259  ASP C CA  1 
ATOM   10079 C  C   . ASP C 1 256 ? 28.320  13.701  69.627  1.00 62.01 ? 259  ASP C C   1 
ATOM   10080 O  O   . ASP C 1 256 ? 29.178  13.100  68.975  1.00 62.02 ? 259  ASP C O   1 
ATOM   10081 C  CB  . ASP C 1 256 ? 28.770  15.881  68.492  1.00 61.92 ? 259  ASP C CB  1 
ATOM   10082 C  CG  . ASP C 1 256 ? 28.181  17.131  67.868  1.00 62.10 ? 259  ASP C CG  1 
ATOM   10083 O  OD1 . ASP C 1 256 ? 27.068  17.060  67.294  1.00 62.11 ? 259  ASP C OD1 1 
ATOM   10084 O  OD2 . ASP C 1 256 ? 28.824  18.195  67.964  1.00 62.28 ? 259  ASP C OD2 1 
ATOM   10085 N  N   . TYR C 1 257 ? 27.813  13.247  70.764  1.00 61.56 ? 260  TYR C N   1 
ATOM   10086 C  CA  . TYR C 1 257 ? 28.279  12.033  71.410  1.00 61.09 ? 260  TYR C CA  1 
ATOM   10087 C  C   . TYR C 1 257 ? 28.609  10.917  70.425  1.00 60.87 ? 260  TYR C C   1 
ATOM   10088 O  O   . TYR C 1 257 ? 29.662  10.287  70.521  1.00 60.91 ? 260  TYR C O   1 
ATOM   10089 C  CB  . TYR C 1 257 ? 27.207  11.561  72.383  1.00 61.01 ? 260  TYR C CB  1 
ATOM   10090 C  CG  . TYR C 1 257 ? 27.531  10.278  73.105  1.00 61.14 ? 260  TYR C CG  1 
ATOM   10091 C  CD1 . TYR C 1 257 ? 27.039  9.058   72.653  1.00 61.25 ? 260  TYR C CD1 1 
ATOM   10092 C  CD2 . TYR C 1 257 ? 28.309  10.281  74.255  1.00 61.20 ? 260  TYR C CD2 1 
ATOM   10093 C  CE1 . TYR C 1 257 ? 27.314  7.866   73.334  1.00 61.24 ? 260  TYR C CE1 1 
ATOM   10094 C  CE2 . TYR C 1 257 ? 28.588  9.094   74.939  1.00 61.28 ? 260  TYR C CE2 1 
ATOM   10095 C  CZ  . TYR C 1 257 ? 28.086  7.896   74.472  1.00 61.24 ? 260  TYR C CZ  1 
ATOM   10096 O  OH  . TYR C 1 257 ? 28.365  6.727   75.139  1.00 61.32 ? 260  TYR C OH  1 
ATOM   10097 N  N   . GLY C 1 258 ? 27.722  10.716  69.454  1.00 60.80 ? 261  GLY C N   1 
ATOM   10098 C  CA  . GLY C 1 258 ? 27.900  9.664   68.464  1.00 60.37 ? 261  GLY C CA  1 
ATOM   10099 C  C   . GLY C 1 258 ? 29.091  9.869   67.559  1.00 60.20 ? 261  GLY C C   1 
ATOM   10100 O  O   . GLY C 1 258 ? 29.813  8.921   67.241  1.00 59.93 ? 261  GLY C O   1 
ATOM   10101 N  N   . ILE C 1 259 ? 29.291  11.110  67.133  1.00 60.27 ? 262  ILE C N   1 
ATOM   10102 C  CA  . ILE C 1 259 ? 30.409  11.445  66.266  1.00 60.26 ? 262  ILE C CA  1 
ATOM   10103 C  C   . ILE C 1 259 ? 31.691  11.217  67.044  1.00 60.70 ? 262  ILE C C   1 
ATOM   10104 O  O   . ILE C 1 259 ? 32.568  10.474  66.607  1.00 60.70 ? 262  ILE C O   1 
ATOM   10105 C  CB  . ILE C 1 259 ? 30.338  12.910  65.825  1.00 60.01 ? 262  ILE C CB  1 
ATOM   10106 C  CG1 . ILE C 1 259 ? 29.045  13.141  65.042  1.00 59.44 ? 262  ILE C CG1 1 
ATOM   10107 C  CG2 . ILE C 1 259 ? 31.564  13.276  64.996  1.00 59.68 ? 262  ILE C CG2 1 
ATOM   10108 C  CD1 . ILE C 1 259 ? 28.852  14.555  64.579  1.00 59.43 ? 262  ILE C CD1 1 
ATOM   10109 N  N   . ARG C 1 260 ? 31.756  11.809  68.232  1.00 61.08 ? 263  ARG C N   1 
ATOM   10110 C  CA  . ARG C 1 260 ? 32.921  11.683  69.100  1.00 61.65 ? 263  ARG C CA  1 
ATOM   10111 C  C   . ARG C 1 260 ? 33.277  10.228  69.415  1.00 61.89 ? 263  ARG C C   1 
ATOM   10112 O  O   . ARG C 1 260 ? 34.435  9.820   69.279  1.00 61.99 ? 263  ARG C O   1 
ATOM   10113 C  CB  . ARG C 1 260 ? 32.681  12.440  70.405  1.00 61.88 ? 263  ARG C CB  1 
ATOM   10114 C  CG  . ARG C 1 260 ? 33.847  12.389  71.376  1.00 62.28 ? 263  ARG C CG  1 
ATOM   10115 C  CD  . ARG C 1 260 ? 33.558  13.236  72.593  1.00 62.61 ? 263  ARG C CD  1 
ATOM   10116 N  NE  . ARG C 1 260 ? 33.156  14.589  72.220  1.00 63.60 ? 263  ARG C NE  1 
ATOM   10117 C  CZ  . ARG C 1 260 ? 34.001  15.599  72.017  1.00 63.96 ? 263  ARG C CZ  1 
ATOM   10118 N  NH1 . ARG C 1 260 ? 35.312  15.418  72.148  1.00 64.14 ? 263  ARG C NH1 1 
ATOM   10119 N  NH2 . ARG C 1 260 ? 33.530  16.800  71.695  1.00 63.82 ? 263  ARG C NH2 1 
ATOM   10120 N  N   . ASP C 1 261 ? 32.283  9.446   69.829  1.00 61.95 ? 264  ASP C N   1 
ATOM   10121 C  CA  . ASP C 1 261 ? 32.510  8.047   70.166  1.00 61.67 ? 264  ASP C CA  1 
ATOM   10122 C  C   . ASP C 1 261 ? 33.189  7.280   69.047  1.00 61.46 ? 264  ASP C C   1 
ATOM   10123 O  O   . ASP C 1 261 ? 34.206  6.617   69.261  1.00 61.58 ? 264  ASP C O   1 
ATOM   10124 C  CB  . ASP C 1 261 ? 31.198  7.359   70.503  1.00 61.81 ? 264  ASP C CB  1 
ATOM   10125 C  CG  . ASP C 1 261 ? 31.378  5.877   70.757  1.00 62.27 ? 264  ASP C CG  1 
ATOM   10126 O  OD1 . ASP C 1 261 ? 31.838  5.518   71.860  1.00 62.43 ? 264  ASP C OD1 1 
ATOM   10127 O  OD2 . ASP C 1 261 ? 31.085  5.073   69.847  1.00 62.72 ? 264  ASP C OD2 1 
ATOM   10128 N  N   . LEU C 1 262 ? 32.610  7.372   67.856  1.00 61.19 ? 265  LEU C N   1 
ATOM   10129 C  CA  . LEU C 1 262 ? 33.132  6.682   66.692  1.00 60.91 ? 265  LEU C CA  1 
ATOM   10130 C  C   . LEU C 1 262 ? 34.557  7.084   66.345  1.00 60.96 ? 265  LEU C C   1 
ATOM   10131 O  O   . LEU C 1 262 ? 35.435  6.235   66.189  1.00 61.29 ? 265  LEU C O   1 
ATOM   10132 C  CB  . LEU C 1 262 ? 32.225  6.928   65.486  1.00 60.82 ? 265  LEU C CB  1 
ATOM   10133 C  CG  . LEU C 1 262 ? 32.661  6.243   64.182  1.00 60.81 ? 265  LEU C CG  1 
ATOM   10134 C  CD1 . LEU C 1 262 ? 32.755  4.738   64.376  1.00 60.76 ? 265  LEU C CD1 1 
ATOM   10135 C  CD2 . LEU C 1 262 ? 31.684  6.561   63.072  1.00 60.52 ? 265  LEU C CD2 1 
ATOM   10136 N  N   . PHE C 1 263 ? 34.789  8.382   66.235  1.00 60.65 ? 266  PHE C N   1 
ATOM   10137 C  CA  . PHE C 1 263 ? 36.104  8.865   65.874  1.00 60.57 ? 266  PHE C CA  1 
ATOM   10138 C  C   . PHE C 1 263 ? 37.194  8.358   66.800  1.00 60.90 ? 266  PHE C C   1 
ATOM   10139 O  O   . PHE C 1 263 ? 38.250  7.927   66.337  1.00 60.97 ? 266  PHE C O   1 
ATOM   10140 C  CB  . PHE C 1 263 ? 36.111  10.385  65.842  1.00 60.28 ? 266  PHE C CB  1 
ATOM   10141 C  CG  . PHE C 1 263 ? 37.332  10.962  65.210  1.00 60.18 ? 266  PHE C CG  1 
ATOM   10142 C  CD1 . PHE C 1 263 ? 38.487  11.169  65.956  1.00 60.16 ? 266  PHE C CD1 1 
ATOM   10143 C  CD2 . PHE C 1 263 ? 37.338  11.279  63.860  1.00 60.23 ? 266  PHE C CD2 1 
ATOM   10144 C  CE1 . PHE C 1 263 ? 39.638  11.682  65.367  1.00 60.09 ? 266  PHE C CE1 1 
ATOM   10145 C  CE2 . PHE C 1 263 ? 38.483  11.794  63.257  1.00 60.25 ? 266  PHE C CE2 1 
ATOM   10146 C  CZ  . PHE C 1 263 ? 39.636  11.995  64.011  1.00 60.19 ? 266  PHE C CZ  1 
ATOM   10147 N  N   . ASN C 1 264 ? 36.935  8.405   68.105  1.00 61.37 ? 267  ASN C N   1 
ATOM   10148 C  CA  . ASN C 1 264 ? 37.911  7.959   69.100  1.00 61.68 ? 267  ASN C CA  1 
ATOM   10149 C  C   . ASN C 1 264 ? 38.085  6.452   69.104  1.00 61.90 ? 267  ASN C C   1 
ATOM   10150 O  O   . ASN C 1 264 ? 39.158  5.952   69.429  1.00 62.20 ? 267  ASN C O   1 
ATOM   10151 C  CB  . ASN C 1 264 ? 37.527  8.441   70.499  1.00 61.81 ? 267  ASN C CB  1 
ATOM   10152 C  CG  . ASN C 1 264 ? 37.696  9.939   70.662  1.00 62.06 ? 267  ASN C CG  1 
ATOM   10153 O  OD1 . ASN C 1 264 ? 38.619  10.531  70.101  1.00 62.23 ? 267  ASN C OD1 1 
ATOM   10154 N  ND2 . ASN C 1 264 ? 36.799  10.563  71.422  1.00 62.18 ? 267  ASN C ND2 1 
ATOM   10155 N  N   . ALA C 1 265 ? 37.029  5.726   68.761  1.00 61.96 ? 268  ALA C N   1 
ATOM   10156 C  CA  . ALA C 1 265 ? 37.107  4.272   68.714  1.00 62.14 ? 268  ALA C CA  1 
ATOM   10157 C  C   . ALA C 1 265 ? 38.108  3.879   67.640  1.00 62.27 ? 268  ALA C C   1 
ATOM   10158 O  O   . ALA C 1 265 ? 38.987  3.047   67.864  1.00 62.29 ? 268  ALA C O   1 
ATOM   10159 C  CB  . ALA C 1 265 ? 35.752  3.683   68.398  1.00 62.29 ? 268  ALA C CB  1 
ATOM   10160 N  N   . ILE C 1 266 ? 37.972  4.497   66.474  1.00 62.35 ? 269  ILE C N   1 
ATOM   10161 C  CA  . ILE C 1 266 ? 38.864  4.221   65.365  1.00 62.58 ? 269  ILE C CA  1 
ATOM   10162 C  C   . ILE C 1 266 ? 40.217  4.842   65.636  1.00 63.08 ? 269  ILE C C   1 
ATOM   10163 O  O   . ILE C 1 266 ? 41.250  4.215   65.411  1.00 63.34 ? 269  ILE C O   1 
ATOM   10164 C  CB  . ILE C 1 266 ? 38.313  4.790   64.057  1.00 62.32 ? 269  ILE C CB  1 
ATOM   10165 C  CG1 . ILE C 1 266 ? 37.006  4.087   63.705  1.00 62.07 ? 269  ILE C CG1 1 
ATOM   10166 C  CG2 . ILE C 1 266 ? 39.323  4.621   62.932  1.00 62.11 ? 269  ILE C CG2 1 
ATOM   10167 C  CD1 . ILE C 1 266 ? 36.344  4.630   62.461  1.00 62.10 ? 269  ILE C CD1 1 
ATOM   10168 N  N   . ALA C 1 267 ? 40.205  6.077   66.130  1.00 63.60 ? 270  ALA C N   1 
ATOM   10169 C  CA  . ALA C 1 267 ? 41.438  6.799   66.425  1.00 64.05 ? 270  ALA C CA  1 
ATOM   10170 C  C   . ALA C 1 267 ? 42.346  6.046   67.393  1.00 64.51 ? 270  ALA C C   1 
ATOM   10171 O  O   . ALA C 1 267 ? 43.565  6.193   67.335  1.00 65.04 ? 270  ALA C O   1 
ATOM   10172 C  CB  . ALA C 1 267 ? 41.127  8.182   66.957  1.00 63.50 ? 270  ALA C CB  1 
ATOM   10173 N  N   . THR C 1 268 ? 41.763  5.249   68.283  1.00 64.68 ? 271  THR C N   1 
ATOM   10174 C  CA  . THR C 1 268 ? 42.560  4.483   69.235  1.00 64.87 ? 271  THR C CA  1 
ATOM   10175 C  C   . THR C 1 268 ? 42.721  3.038   68.801  1.00 65.08 ? 271  THR C C   1 
ATOM   10176 O  O   . THR C 1 268 ? 43.246  2.220   69.548  1.00 65.39 ? 271  THR C O   1 
ATOM   10177 C  CB  . THR C 1 268 ? 41.955  4.494   70.641  1.00 65.04 ? 271  THR C CB  1 
ATOM   10178 O  OG1 . THR C 1 268 ? 40.618  3.982   70.598  1.00 65.67 ? 271  THR C OG1 1 
ATOM   10179 C  CG2 . THR C 1 268 ? 41.944  5.896   71.197  1.00 65.30 ? 271  THR C CG2 1 
ATOM   10180 N  N   . GLY C 1 269 ? 42.225  2.708   67.616  1.00 65.45 ? 272  GLY C N   1 
ATOM   10181 C  CA  . GLY C 1 269 ? 42.374  1.352   67.127  1.00 65.73 ? 272  GLY C CA  1 
ATOM   10182 C  C   . GLY C 1 269 ? 41.273  0.370   67.464  1.00 66.21 ? 272  GLY C C   1 
ATOM   10183 O  O   . GLY C 1 269 ? 41.336  -0.782  67.037  1.00 66.51 ? 272  GLY C O   1 
ATOM   10184 N  N   . LYS C 1 270 ? 40.284  0.785   68.250  1.00 66.20 ? 273  LYS C N   1 
ATOM   10185 C  CA  . LYS C 1 270 ? 39.178  -0.111  68.586  1.00 66.26 ? 273  LYS C CA  1 
ATOM   10186 C  C   . LYS C 1 270 ? 38.203  -0.082  67.404  1.00 65.87 ? 273  LYS C C   1 
ATOM   10187 O  O   . LYS C 1 270 ? 37.108  0.476   67.494  1.00 66.13 ? 273  LYS C O   1 
ATOM   10188 C  CB  . LYS C 1 270 ? 38.500  0.356   69.877  1.00 67.23 ? 273  LYS C CB  1 
ATOM   10189 C  CG  . LYS C 1 270 ? 39.402  0.270   71.107  1.00 68.56 ? 273  LYS C CG  1 
ATOM   10190 C  CD  . LYS C 1 270 ? 39.063  1.344   72.153  1.00 69.43 ? 273  LYS C CD  1 
ATOM   10191 C  CE  . LYS C 1 270 ? 39.959  1.234   73.392  1.00 69.80 ? 273  LYS C CE  1 
ATOM   10192 N  NZ  . LYS C 1 270 ? 41.422  1.270   73.078  1.00 70.22 ? 273  LYS C NZ  1 
ATOM   10193 N  N   . TYR C 1 271 ? 38.633  -0.664  66.286  1.00 65.00 ? 274  TYR C N   1 
ATOM   10194 C  CA  . TYR C 1 271 ? 37.848  -0.693  65.055  1.00 63.90 ? 274  TYR C CA  1 
ATOM   10195 C  C   . TYR C 1 271 ? 36.599  -1.544  65.189  1.00 63.03 ? 274  TYR C C   1 
ATOM   10196 O  O   . TYR C 1 271 ? 36.679  -2.725  65.501  1.00 63.17 ? 274  TYR C O   1 
ATOM   10197 C  CB  . TYR C 1 271 ? 38.699  -1.229  63.898  1.00 63.96 ? 274  TYR C CB  1 
ATOM   10198 C  CG  . TYR C 1 271 ? 40.073  -0.603  63.796  1.00 64.17 ? 274  TYR C CG  1 
ATOM   10199 C  CD1 . TYR C 1 271 ? 41.223  -1.390  63.808  1.00 64.12 ? 274  TYR C CD1 1 
ATOM   10200 C  CD2 . TYR C 1 271 ? 40.227  0.780   63.705  1.00 64.42 ? 274  TYR C CD2 1 
ATOM   10201 C  CE1 . TYR C 1 271 ? 42.498  -0.813  63.737  1.00 64.16 ? 274  TYR C CE1 1 
ATOM   10202 C  CE2 . TYR C 1 271 ? 41.498  1.367   63.632  1.00 64.28 ? 274  TYR C CE2 1 
ATOM   10203 C  CZ  . TYR C 1 271 ? 42.626  0.565   63.650  1.00 64.18 ? 274  TYR C CZ  1 
ATOM   10204 O  OH  . TYR C 1 271 ? 43.875  1.141   63.600  1.00 63.97 ? 274  TYR C OH  1 
ATOM   10205 N  N   . PRO C 1 272 ? 35.424  -0.947  64.978  1.00 62.05 ? 275  PRO C N   1 
ATOM   10206 C  CA  . PRO C 1 272 ? 34.161  -1.674  65.077  1.00 61.40 ? 275  PRO C CA  1 
ATOM   10207 C  C   . PRO C 1 272 ? 33.923  -2.536  63.848  1.00 60.83 ? 275  PRO C C   1 
ATOM   10208 O  O   . PRO C 1 272 ? 34.421  -2.242  62.762  1.00 60.97 ? 275  PRO C O   1 
ATOM   10209 C  CB  . PRO C 1 272 ? 33.139  -0.550  65.171  1.00 61.36 ? 275  PRO C CB  1 
ATOM   10210 C  CG  . PRO C 1 272 ? 33.742  0.510   64.338  1.00 61.49 ? 275  PRO C CG  1 
ATOM   10211 C  CD  . PRO C 1 272 ? 35.180  0.488   64.775  1.00 61.67 ? 275  PRO C CD  1 
ATOM   10212 N  N   . SER C 1 273 ? 33.141  -3.593  64.018  1.00 59.97 ? 276  SER C N   1 
ATOM   10213 C  CA  . SER C 1 273 ? 32.856  -4.477  62.915  1.00 58.95 ? 276  SER C CA  1 
ATOM   10214 C  C   . SER C 1 273 ? 31.489  -5.092  63.088  1.00 58.59 ? 276  SER C C   1 
ATOM   10215 O  O   . SER C 1 273 ? 30.944  -5.134  64.190  1.00 58.53 ? 276  SER C O   1 
ATOM   10216 C  CB  . SER C 1 273 ? 33.907  -5.579  62.845  1.00 59.06 ? 276  SER C CB  1 
ATOM   10217 O  OG  . SER C 1 273 ? 33.905  -6.346  64.035  1.00 59.17 ? 276  SER C OG  1 
ATOM   10218 N  N   . TRP C 1 274 ? 30.926  -5.540  61.977  1.00 58.14 ? 277  TRP C N   1 
ATOM   10219 C  CA  . TRP C 1 274 ? 29.627  -6.175  61.973  1.00 57.77 ? 277  TRP C CA  1 
ATOM   10220 C  C   . TRP C 1 274 ? 29.717  -7.427  61.136  1.00 57.98 ? 277  TRP C C   1 
ATOM   10221 O  O   . TRP C 1 274 ? 30.464  -7.476  60.157  1.00 58.15 ? 277  TRP C O   1 
ATOM   10222 C  CB  . TRP C 1 274 ? 28.594  -5.263  61.337  1.00 57.16 ? 277  TRP C CB  1 
ATOM   10223 C  CG  . TRP C 1 274 ? 28.164  -4.138  62.189  1.00 56.63 ? 277  TRP C CG  1 
ATOM   10224 C  CD1 . TRP C 1 274 ? 26.981  -4.024  62.858  1.00 56.33 ? 277  TRP C CD1 1 
ATOM   10225 C  CD2 . TRP C 1 274 ? 28.893  -2.930  62.447  1.00 56.45 ? 277  TRP C CD2 1 
ATOM   10226 N  NE1 . TRP C 1 274 ? 26.926  -2.820  63.517  1.00 56.28 ? 277  TRP C NE1 1 
ATOM   10227 C  CE2 . TRP C 1 274 ? 28.086  -2.128  63.281  1.00 56.20 ? 277  TRP C CE2 1 
ATOM   10228 C  CE3 . TRP C 1 274 ? 30.147  -2.445  62.054  1.00 56.22 ? 277  TRP C CE3 1 
ATOM   10229 C  CZ2 . TRP C 1 274 ? 28.496  -0.866  63.728  1.00 55.99 ? 277  TRP C CZ2 1 
ATOM   10230 C  CZ3 . TRP C 1 274 ? 30.552  -1.192  62.499  1.00 55.43 ? 277  TRP C CZ3 1 
ATOM   10231 C  CH2 . TRP C 1 274 ? 29.729  -0.419  63.327  1.00 55.45 ? 277  TRP C CH2 1 
ATOM   10232 N  N   . THR C 1 275 ? 28.974  -8.452  61.531  1.00 58.20 ? 278  THR C N   1 
ATOM   10233 C  CA  . THR C 1 275 ? 28.959  -9.687  60.773  1.00 58.42 ? 278  THR C CA  1 
ATOM   10234 C  C   . THR C 1 275 ? 27.793  -9.593  59.817  1.00 58.46 ? 278  THR C C   1 
ATOM   10235 O  O   . THR C 1 275 ? 26.652  -9.353  60.220  1.00 58.70 ? 278  THR C O   1 
ATOM   10236 C  CB  . THR C 1 275 ? 28.793  -10.891 61.667  1.00 58.57 ? 278  THR C CB  1 
ATOM   10237 O  OG1 . THR C 1 275 ? 29.769  -10.828 62.714  1.00 59.13 ? 278  THR C OG1 1 
ATOM   10238 C  CG2 . THR C 1 275 ? 29.001  -12.170 60.859  1.00 58.55 ? 278  THR C CG2 1 
ATOM   10239 N  N   . PHE C 1 276 ? 28.097  -9.780  58.542  1.00 58.33 ? 279  PHE C N   1 
ATOM   10240 C  CA  . PHE C 1 276 ? 27.121  -9.674  57.474  1.00 58.36 ? 279  PHE C CA  1 
ATOM   10241 C  C   . PHE C 1 276 ? 26.442  -10.994 57.122  1.00 58.92 ? 279  PHE C C   1 
ATOM   10242 O  O   . PHE C 1 276 ? 27.103  -11.942 56.701  1.00 59.30 ? 279  PHE C O   1 
ATOM   10243 C  CB  . PHE C 1 276 ? 27.850  -9.144  56.254  1.00 57.70 ? 279  PHE C CB  1 
ATOM   10244 C  CG  . PHE C 1 276 ? 26.973  -8.488  55.262  1.00 57.21 ? 279  PHE C CG  1 
ATOM   10245 C  CD1 . PHE C 1 276 ? 26.674  -7.142  55.381  1.00 57.18 ? 279  PHE C CD1 1 
ATOM   10246 C  CD2 . PHE C 1 276 ? 26.492  -9.189  54.176  1.00 57.04 ? 279  PHE C CD2 1 
ATOM   10247 C  CE1 . PHE C 1 276 ? 25.912  -6.498  54.424  1.00 57.02 ? 279  PHE C CE1 1 
ATOM   10248 C  CE2 . PHE C 1 276 ? 25.730  -8.556  53.215  1.00 57.04 ? 279  PHE C CE2 1 
ATOM   10249 C  CZ  . PHE C 1 276 ? 25.439  -7.206  53.338  1.00 57.02 ? 279  PHE C CZ  1 
ATOM   10250 N  N   . TYR C 1 277 ? 25.120  -11.048 57.255  1.00 59.25 ? 280  TYR C N   1 
ATOM   10251 C  CA  . TYR C 1 277 ? 24.374  -12.259 56.925  1.00 59.47 ? 280  TYR C CA  1 
ATOM   10252 C  C   . TYR C 1 277 ? 23.268  -11.919 55.934  1.00 59.90 ? 280  TYR C C   1 
ATOM   10253 O  O   . TYR C 1 277 ? 22.966  -10.744 55.696  1.00 60.11 ? 280  TYR C O   1 
ATOM   10254 C  CB  . TYR C 1 277 ? 23.670  -12.841 58.153  1.00 59.35 ? 280  TYR C CB  1 
ATOM   10255 C  CG  . TYR C 1 277 ? 24.481  -13.026 59.411  1.00 59.12 ? 280  TYR C CG  1 
ATOM   10256 C  CD1 . TYR C 1 277 ? 24.914  -14.290 59.799  1.00 59.06 ? 280  TYR C CD1 1 
ATOM   10257 C  CD2 . TYR C 1 277 ? 24.694  -11.967 60.285  1.00 59.04 ? 280  TYR C CD2 1 
ATOM   10258 C  CE1 . TYR C 1 277 ? 25.526  -14.498 61.036  1.00 59.03 ? 280  TYR C CE1 1 
ATOM   10259 C  CE2 . TYR C 1 277 ? 25.302  -12.162 61.523  1.00 58.98 ? 280  TYR C CE2 1 
ATOM   10260 C  CZ  . TYR C 1 277 ? 25.710  -13.430 61.893  1.00 58.99 ? 280  TYR C CZ  1 
ATOM   10261 O  OH  . TYR C 1 277 ? 26.265  -13.633 63.136  1.00 58.80 ? 280  TYR C OH  1 
ATOM   10262 N  N   . ILE C 1 278 ? 22.637  -12.961 55.394  1.00 60.29 ? 281  ILE C N   1 
ATOM   10263 C  CA  . ILE C 1 278 ? 21.511  -12.805 54.477  1.00 60.39 ? 281  ILE C CA  1 
ATOM   10264 C  C   . ILE C 1 278 ? 20.479  -13.869 54.803  1.00 60.70 ? 281  ILE C C   1 
ATOM   10265 O  O   . ILE C 1 278 ? 20.792  -14.868 55.455  1.00 60.98 ? 281  ILE C O   1 
ATOM   10266 C  CB  . ILE C 1 278 ? 21.891  -12.994 52.984  1.00 59.94 ? 281  ILE C CB  1 
ATOM   10267 C  CG1 . ILE C 1 278 ? 22.439  -14.400 52.738  1.00 59.60 ? 281  ILE C CG1 1 
ATOM   10268 C  CG2 . ILE C 1 278 ? 22.858  -11.928 52.543  1.00 59.92 ? 281  ILE C CG2 1 
ATOM   10269 C  CD1 . ILE C 1 278 ? 22.602  -14.742 51.271  1.00 58.90 ? 281  ILE C CD1 1 
ATOM   10270 N  N   . GLN C 1 279 ? 19.242  -13.615 54.398  1.00 61.00 ? 282  GLN C N   1 
ATOM   10271 C  CA  . GLN C 1 279 ? 18.147  -14.563 54.573  1.00 61.10 ? 282  GLN C CA  1 
ATOM   10272 C  C   . GLN C 1 279 ? 17.715  -14.888 53.149  1.00 61.35 ? 282  GLN C C   1 
ATOM   10273 O  O   . GLN C 1 279 ? 17.645  -13.994 52.305  1.00 61.44 ? 282  GLN C O   1 
ATOM   10274 C  CB  . GLN C 1 279 ? 16.981  -13.938 55.341  1.00 60.78 ? 282  GLN C CB  1 
ATOM   10275 C  CG  . GLN C 1 279 ? 17.136  -13.956 56.850  1.00 59.85 ? 282  GLN C CG  1 
ATOM   10276 C  CD  . GLN C 1 279 ? 15.950  -13.336 57.558  1.00 59.42 ? 282  GLN C CD  1 
ATOM   10277 O  OE1 . GLN C 1 279 ? 15.572  -12.198 57.274  1.00 58.96 ? 282  GLN C OE1 1 
ATOM   10278 N  NE2 . GLN C 1 279 ? 15.354  -14.081 58.484  1.00 58.90 ? 282  GLN C NE2 1 
ATOM   10279 N  N   . VAL C 1 280 ? 17.457  -16.162 52.868  1.00 61.64 ? 283  VAL C N   1 
ATOM   10280 C  CA  . VAL C 1 280 ? 17.058  -16.562 51.524  1.00 61.57 ? 283  VAL C CA  1 
ATOM   10281 C  C   . VAL C 1 280 ? 15.639  -17.112 51.475  1.00 62.20 ? 283  VAL C C   1 
ATOM   10282 O  O   . VAL C 1 280 ? 15.214  -17.851 52.367  1.00 62.55 ? 283  VAL C O   1 
ATOM   10283 C  CB  . VAL C 1 280 ? 18.013  -17.635 50.957  1.00 61.17 ? 283  VAL C CB  1 
ATOM   10284 C  CG1 . VAL C 1 280 ? 17.708  -17.892 49.500  1.00 60.45 ? 283  VAL C CG1 1 
ATOM   10285 C  CG2 . VAL C 1 280 ? 19.444  -17.190 51.100  1.00 60.66 ? 283  VAL C CG2 1 
ATOM   10286 N  N   . MET C 1 281 ? 14.913  -16.754 50.422  1.00 62.42 ? 284  MET C N   1 
ATOM   10287 C  CA  . MET C 1 281 ? 13.555  -17.238 50.238  1.00 62.61 ? 284  MET C CA  1 
ATOM   10288 C  C   . MET C 1 281 ? 13.393  -17.502 48.758  1.00 62.81 ? 284  MET C C   1 
ATOM   10289 O  O   . MET C 1 281 ? 13.475  -16.586 47.950  1.00 62.56 ? 284  MET C O   1 
ATOM   10290 C  CB  . MET C 1 281 ? 12.541  -16.186 50.684  1.00 62.94 ? 284  MET C CB  1 
ATOM   10291 C  CG  . MET C 1 281 ? 11.088  -16.621 50.550  1.00 63.02 ? 284  MET C CG  1 
ATOM   10292 S  SD  . MET C 1 281 ? 9.933   -15.235 50.705  1.00 63.44 ? 284  MET C SD  1 
ATOM   10293 C  CE  . MET C 1 281 ? 9.764   -15.107 52.461  1.00 63.03 ? 284  MET C CE  1 
ATOM   10294 N  N   . THR C 1 282 ? 13.212  -18.765 48.397  1.00 63.44 ? 285  THR C N   1 
ATOM   10295 C  CA  . THR C 1 282 ? 13.036  -19.126 46.998  1.00 64.25 ? 285  THR C CA  1 
ATOM   10296 C  C   . THR C 1 282 ? 11.689  -18.618 46.519  1.00 65.13 ? 285  THR C C   1 
ATOM   10297 O  O   . THR C 1 282 ? 10.808  -18.334 47.333  1.00 65.68 ? 285  THR C O   1 
ATOM   10298 C  CB  . THR C 1 282 ? 13.074  -20.643 46.794  1.00 63.92 ? 285  THR C CB  1 
ATOM   10299 O  OG1 . THR C 1 282 ? 11.988  -21.256 47.502  1.00 63.67 ? 285  THR C OG1 1 
ATOM   10300 C  CG2 . THR C 1 282 ? 14.385  -21.202 47.297  1.00 63.64 ? 285  THR C CG2 1 
ATOM   10301 N  N   . PHE C 1 283 ? 11.520  -18.514 45.205  1.00 65.68 ? 286  PHE C N   1 
ATOM   10302 C  CA  . PHE C 1 283 ? 10.257  -18.050 44.651  1.00 66.22 ? 286  PHE C CA  1 
ATOM   10303 C  C   . PHE C 1 283 ? 9.099   -18.912 45.138  1.00 66.37 ? 286  PHE C C   1 
ATOM   10304 O  O   . PHE C 1 283 ? 8.021   -18.400 45.432  1.00 66.36 ? 286  PHE C O   1 
ATOM   10305 C  CB  . PHE C 1 283 ? 10.316  -18.023 43.125  1.00 66.85 ? 286  PHE C CB  1 
ATOM   10306 C  CG  . PHE C 1 283 ? 11.039  -16.829 42.568  1.00 67.66 ? 286  PHE C CG  1 
ATOM   10307 C  CD1 . PHE C 1 283 ? 11.729  -15.963 43.408  1.00 67.96 ? 286  PHE C CD1 1 
ATOM   10308 C  CD2 . PHE C 1 283 ? 11.004  -16.552 41.209  1.00 68.10 ? 286  PHE C CD2 1 
ATOM   10309 C  CE1 . PHE C 1 283 ? 12.371  -14.840 42.909  1.00 68.04 ? 286  PHE C CE1 1 
ATOM   10310 C  CE2 . PHE C 1 283 ? 11.643  -15.432 40.700  1.00 68.34 ? 286  PHE C CE2 1 
ATOM   10311 C  CZ  . PHE C 1 283 ? 12.328  -14.572 41.558  1.00 68.25 ? 286  PHE C CZ  1 
ATOM   10312 N  N   . ASN C 1 284 ? 9.336   -20.213 45.266  1.00 66.62 ? 287  ASN C N   1 
ATOM   10313 C  CA  . ASN C 1 284 ? 8.297   -21.109 45.742  1.00 66.89 ? 287  ASN C CA  1 
ATOM   10314 C  C   . ASN C 1 284 ? 7.962   -20.808 47.189  1.00 67.11 ? 287  ASN C C   1 
ATOM   10315 O  O   . ASN C 1 284 ? 6.790   -20.727 47.539  1.00 67.54 ? 287  ASN C O   1 
ATOM   10316 C  CB  . ASN C 1 284 ? 8.723   -22.558 45.591  1.00 67.01 ? 287  ASN C CB  1 
ATOM   10317 C  CG  . ASN C 1 284 ? 8.847   -22.962 44.151  1.00 67.47 ? 287  ASN C CG  1 
ATOM   10318 O  OD1 . ASN C 1 284 ? 9.948   -23.183 43.650  1.00 67.90 ? 287  ASN C OD1 1 
ATOM   10319 N  ND2 . ASN C 1 284 ? 7.716   -23.021 43.456  1.00 67.25 ? 287  ASN C ND2 1 
ATOM   10320 N  N   . GLN C 1 285 ? 8.983   -20.631 48.024  1.00 67.03 ? 288  GLN C N   1 
ATOM   10321 C  CA  . GLN C 1 285 ? 8.761   -20.322 49.432  1.00 67.08 ? 288  GLN C CA  1 
ATOM   10322 C  C   . GLN C 1 285 ? 7.954   -19.049 49.557  1.00 67.97 ? 288  GLN C C   1 
ATOM   10323 O  O   . GLN C 1 285 ? 6.985   -18.984 50.314  1.00 68.01 ? 288  GLN C O   1 
ATOM   10324 C  CB  . GLN C 1 285 ? 10.081  -20.116 50.158  1.00 66.33 ? 288  GLN C CB  1 
ATOM   10325 C  CG  . GLN C 1 285 ? 10.886  -21.370 50.388  1.00 65.29 ? 288  GLN C CG  1 
ATOM   10326 C  CD  . GLN C 1 285 ? 12.066  -21.111 51.292  1.00 64.83 ? 288  GLN C CD  1 
ATOM   10327 O  OE1 . GLN C 1 285 ? 12.975  -20.358 50.945  1.00 64.67 ? 288  GLN C OE1 1 
ATOM   10328 N  NE2 . GLN C 1 285 ? 12.039  -21.702 52.479  1.00 64.58 ? 288  GLN C NE2 1 
ATOM   10329 N  N   . ALA C 1 286 ? 8.369   -18.034 48.809  1.00 68.93 ? 289  ALA C N   1 
ATOM   10330 C  CA  . ALA C 1 286 ? 7.698   -16.743 48.817  1.00 70.08 ? 289  ALA C CA  1 
ATOM   10331 C  C   . ALA C 1 286 ? 6.218   -16.895 48.512  1.00 70.95 ? 289  ALA C C   1 
ATOM   10332 O  O   . ALA C 1 286 ? 5.372   -16.296 49.170  1.00 71.42 ? 289  ALA C O   1 
ATOM   10333 C  CB  . ALA C 1 286 ? 8.342   -15.819 47.802  1.00 70.01 ? 289  ALA C CB  1 
ATOM   10334 N  N   . GLU C 1 287 ? 5.910   -17.725 47.527  1.00 71.94 ? 290  GLU C N   1 
ATOM   10335 C  CA  . GLU C 1 287 ? 4.534   -17.952 47.124  1.00 72.70 ? 290  GLU C CA  1 
ATOM   10336 C  C   . GLU C 1 287 ? 3.612   -18.306 48.286  1.00 72.57 ? 290  GLU C C   1 
ATOM   10337 O  O   . GLU C 1 287 ? 2.468   -17.865 48.322  1.00 72.82 ? 290  GLU C O   1 
ATOM   10338 C  CB  . GLU C 1 287 ? 4.483   -19.078 46.103  1.00 73.79 ? 290  GLU C CB  1 
ATOM   10339 C  CG  . GLU C 1 287 ? 3.140   -19.226 45.451  1.00 75.61 ? 290  GLU C CG  1 
ATOM   10340 C  CD  . GLU C 1 287 ? 3.103   -18.566 44.104  1.00 76.74 ? 290  GLU C CD  1 
ATOM   10341 O  OE1 . GLU C 1 287 ? 3.410   -17.354 44.020  1.00 77.14 ? 290  GLU C OE1 1 
ATOM   10342 O  OE2 . GLU C 1 287 ? 2.786   -19.275 43.125  1.00 77.50 ? 290  GLU C OE2 1 
ATOM   10343 N  N   . THR C 1 288 ? 4.130   -19.078 49.241  1.00 72.15 ? 291  THR C N   1 
ATOM   10344 C  CA  . THR C 1 288 ? 3.356   -19.542 50.396  1.00 71.54 ? 291  THR C CA  1 
ATOM   10345 C  C   . THR C 1 288 ? 3.662   -18.878 51.734  1.00 70.86 ? 291  THR C C   1 
ATOM   10346 O  O   . THR C 1 288 ? 3.274   -19.384 52.791  1.00 70.53 ? 291  THR C O   1 
ATOM   10347 C  CB  . THR C 1 288 ? 3.545   -21.046 50.587  1.00 72.02 ? 291  THR C CB  1 
ATOM   10348 O  OG1 . THR C 1 288 ? 4.950   -21.336 50.643  1.00 72.31 ? 291  THR C OG1 1 
ATOM   10349 C  CG2 . THR C 1 288 ? 2.898   -21.816 49.435  1.00 71.90 ? 291  THR C CG2 1 
ATOM   10350 N  N   . PHE C 1 289 ? 4.393   -17.774 51.696  1.00 70.12 ? 292  PHE C N   1 
ATOM   10351 C  CA  . PHE C 1 289 ? 4.734   -17.051 52.909  1.00 69.22 ? 292  PHE C CA  1 
ATOM   10352 C  C   . PHE C 1 289 ? 3.453   -16.501 53.522  1.00 68.80 ? 292  PHE C C   1 
ATOM   10353 O  O   . PHE C 1 289 ? 2.634   -15.900 52.827  1.00 68.84 ? 292  PHE C O   1 
ATOM   10354 C  CB  . PHE C 1 289 ? 5.687   -15.911 52.574  1.00 68.63 ? 292  PHE C CB  1 
ATOM   10355 C  CG  . PHE C 1 289 ? 6.235   -15.206 53.772  1.00 67.85 ? 292  PHE C CG  1 
ATOM   10356 C  CD1 . PHE C 1 289 ? 6.047   -13.840 53.933  1.00 67.49 ? 292  PHE C CD1 1 
ATOM   10357 C  CD2 . PHE C 1 289 ? 6.970   -15.900 54.721  1.00 67.29 ? 292  PHE C CD2 1 
ATOM   10358 C  CE1 . PHE C 1 289 ? 6.585   -13.169 55.016  1.00 67.04 ? 292  PHE C CE1 1 
ATOM   10359 C  CE2 . PHE C 1 289 ? 7.514   -15.240 55.809  1.00 67.15 ? 292  PHE C CE2 1 
ATOM   10360 C  CZ  . PHE C 1 289 ? 7.323   -13.867 55.958  1.00 67.06 ? 292  PHE C CZ  1 
ATOM   10361 N  N   . PRO C 1 290 ? 3.264   -16.705 54.832  1.00 68.45 ? 293  PRO C N   1 
ATOM   10362 C  CA  . PRO C 1 290 ? 2.093   -16.252 55.587  1.00 68.16 ? 293  PRO C CA  1 
ATOM   10363 C  C   . PRO C 1 290 ? 1.764   -14.774 55.429  1.00 67.99 ? 293  PRO C C   1 
ATOM   10364 O  O   . PRO C 1 290 ? 0.664   -14.344 55.772  1.00 68.10 ? 293  PRO C O   1 
ATOM   10365 C  CB  . PRO C 1 290 ? 2.476   -16.582 57.020  1.00 68.21 ? 293  PRO C CB  1 
ATOM   10366 C  CG  . PRO C 1 290 ? 3.278   -17.816 56.855  1.00 68.39 ? 293  PRO C CG  1 
ATOM   10367 C  CD  . PRO C 1 290 ? 4.179   -17.448 55.710  1.00 68.35 ? 293  PRO C CD  1 
ATOM   10368 N  N   . PHE C 1 291 ? 2.720   -13.988 54.947  1.00 67.56 ? 294  PHE C N   1 
ATOM   10369 C  CA  . PHE C 1 291 ? 2.484   -12.564 54.747  1.00 66.87 ? 294  PHE C CA  1 
ATOM   10370 C  C   . PHE C 1 291 ? 3.005   -12.150 53.390  1.00 66.17 ? 294  PHE C C   1 
ATOM   10371 O  O   . PHE C 1 291 ? 3.406   -12.991 52.589  1.00 66.00 ? 294  PHE C O   1 
ATOM   10372 C  CB  . PHE C 1 291 ? 3.213   -11.746 55.801  1.00 67.54 ? 294  PHE C CB  1 
ATOM   10373 C  CG  . PHE C 1 291 ? 2.968   -12.202 57.197  1.00 68.18 ? 294  PHE C CG  1 
ATOM   10374 C  CD1 . PHE C 1 291 ? 1.971   -11.612 57.970  1.00 68.55 ? 294  PHE C CD1 1 
ATOM   10375 C  CD2 . PHE C 1 291 ? 3.746   -13.215 57.751  1.00 68.20 ? 294  PHE C CD2 1 
ATOM   10376 C  CE1 . PHE C 1 291 ? 1.749   -12.026 59.283  1.00 68.85 ? 294  PHE C CE1 1 
ATOM   10377 C  CE2 . PHE C 1 291 ? 3.537   -13.637 59.057  1.00 68.50 ? 294  PHE C CE2 1 
ATOM   10378 C  CZ  . PHE C 1 291 ? 2.535   -13.043 59.828  1.00 68.75 ? 294  PHE C CZ  1 
ATOM   10379 N  N   . ASN C 1 292 ? 2.965   -10.852 53.118  1.00 65.23 ? 295  ASN C N   1 
ATOM   10380 C  CA  . ASN C 1 292 ? 3.488   -10.341 51.868  1.00 64.28 ? 295  ASN C CA  1 
ATOM   10381 C  C   . ASN C 1 292 ? 4.991   -10.220 52.091  1.00 63.59 ? 295  ASN C C   1 
ATOM   10382 O  O   . ASN C 1 292 ? 5.455   -9.328  52.799  1.00 63.73 ? 295  ASN C O   1 
ATOM   10383 C  CB  . ASN C 1 292 ? 2.895   -8.974  51.548  1.00 64.40 ? 295  ASN C CB  1 
ATOM   10384 C  CG  . ASN C 1 292 ? 3.503   -8.357  50.312  1.00 64.46 ? 295  ASN C CG  1 
ATOM   10385 O  OD1 . ASN C 1 292 ? 4.434   -8.909  49.719  1.00 64.81 ? 295  ASN C OD1 1 
ATOM   10386 N  ND2 . ASN C 1 292 ? 2.983   -7.206  49.912  1.00 64.45 ? 295  ASN C ND2 1 
ATOM   10387 N  N   . PRO C 1 293 ? 5.770   -11.105 51.464  1.00 62.78 ? 296  PRO C N   1 
ATOM   10388 C  CA  . PRO C 1 293 ? 7.225   -11.110 51.595  1.00 62.43 ? 296  PRO C CA  1 
ATOM   10389 C  C   . PRO C 1 293 ? 7.893   -9.794  51.224  1.00 62.28 ? 296  PRO C C   1 
ATOM   10390 O  O   . PRO C 1 293 ? 9.096   -9.624  51.433  1.00 62.51 ? 296  PRO C O   1 
ATOM   10391 C  CB  . PRO C 1 293 ? 7.638   -12.240 50.652  1.00 62.19 ? 296  PRO C CB  1 
ATOM   10392 C  CG  . PRO C 1 293 ? 6.591   -12.202 49.617  1.00 61.86 ? 296  PRO C CG  1 
ATOM   10393 C  CD  . PRO C 1 293 ? 5.349   -12.064 50.433  1.00 62.41 ? 296  PRO C CD  1 
ATOM   10394 N  N   . PHE C 1 294 ? 7.120   -8.857  50.691  1.00 62.05 ? 297  PHE C N   1 
ATOM   10395 C  CA  . PHE C 1 294 ? 7.681   -7.574  50.298  1.00 61.60 ? 297  PHE C CA  1 
ATOM   10396 C  C   . PHE C 1 294 ? 7.122   -6.430  51.125  1.00 61.26 ? 297  PHE C C   1 
ATOM   10397 O  O   . PHE C 1 294 ? 7.404   -5.261  50.850  1.00 61.32 ? 297  PHE C O   1 
ATOM   10398 C  CB  . PHE C 1 294 ? 7.428   -7.326  48.814  1.00 61.71 ? 297  PHE C CB  1 
ATOM   10399 C  CG  . PHE C 1 294 ? 7.686   -8.529  47.945  1.00 61.78 ? 297  PHE C CG  1 
ATOM   10400 C  CD1 . PHE C 1 294 ? 8.917   -9.180  47.977  1.00 61.87 ? 297  PHE C CD1 1 
ATOM   10401 C  CD2 . PHE C 1 294 ? 6.690   -9.019  47.107  1.00 61.65 ? 297  PHE C CD2 1 
ATOM   10402 C  CE1 . PHE C 1 294 ? 9.148   -10.302 47.185  1.00 61.68 ? 297  PHE C CE1 1 
ATOM   10403 C  CE2 . PHE C 1 294 ? 6.912   -10.139 46.313  1.00 61.61 ? 297  PHE C CE2 1 
ATOM   10404 C  CZ  . PHE C 1 294 ? 8.142   -10.781 46.352  1.00 61.68 ? 297  PHE C CZ  1 
ATOM   10405 N  N   . ASP C 1 295 ? 6.304   -6.764  52.117  1.00 60.67 ? 298  ASP C N   1 
ATOM   10406 C  CA  . ASP C 1 295 ? 5.726   -5.758  52.987  1.00 60.20 ? 298  ASP C CA  1 
ATOM   10407 C  C   . ASP C 1 295 ? 6.821   -5.352  53.967  1.00 60.04 ? 298  ASP C C   1 
ATOM   10408 O  O   . ASP C 1 295 ? 7.267   -6.152  54.786  1.00 60.60 ? 298  ASP C O   1 
ATOM   10409 C  CB  . ASP C 1 295 ? 4.517   -6.341  53.717  1.00 60.19 ? 298  ASP C CB  1 
ATOM   10410 C  CG  . ASP C 1 295 ? 3.938   -5.399  54.764  1.00 60.29 ? 298  ASP C CG  1 
ATOM   10411 O  OD1 . ASP C 1 295 ? 3.026   -5.833  55.493  1.00 60.10 ? 298  ASP C OD1 1 
ATOM   10412 O  OD2 . ASP C 1 295 ? 4.378   -4.234  54.877  1.00 60.62 ? 298  ASP C OD2 1 
ATOM   10413 N  N   . LEU C 1 296 ? 7.226   -4.091  53.895  1.00 59.43 ? 299  LEU C N   1 
ATOM   10414 C  CA  . LEU C 1 296 ? 8.282   -3.562  54.749  1.00 58.64 ? 299  LEU C CA  1 
ATOM   10415 C  C   . LEU C 1 296 ? 7.953   -3.530  56.240  1.00 58.71 ? 299  LEU C C   1 
ATOM   10416 O  O   . LEU C 1 296 ? 8.833   -3.286  57.063  1.00 58.59 ? 299  LEU C O   1 
ATOM   10417 C  CB  . LEU C 1 296 ? 8.676   -2.165  54.268  1.00 58.06 ? 299  LEU C CB  1 
ATOM   10418 C  CG  . LEU C 1 296 ? 9.910   -1.509  54.887  1.00 57.27 ? 299  LEU C CG  1 
ATOM   10419 C  CD1 . LEU C 1 296 ? 11.096  -2.447  54.799  1.00 57.24 ? 299  LEU C CD1 1 
ATOM   10420 C  CD2 . LEU C 1 296 ? 10.211  -0.222  54.168  1.00 56.81 ? 299  LEU C CD2 1 
ATOM   10421 N  N   . THR C 1 297 ? 6.697   -3.766  56.599  1.00 58.72 ? 300  THR C N   1 
ATOM   10422 C  CA  . THR C 1 297 ? 6.332   -3.750  58.007  1.00 58.83 ? 300  THR C CA  1 
ATOM   10423 C  C   . THR C 1 297 ? 6.417   -5.147  58.588  1.00 59.31 ? 300  THR C C   1 
ATOM   10424 O  O   . THR C 1 297 ? 6.055   -5.364  59.744  1.00 59.41 ? 300  THR C O   1 
ATOM   10425 C  CB  . THR C 1 297 ? 4.913   -3.227  58.225  1.00 58.46 ? 300  THR C CB  1 
ATOM   10426 O  OG1 . THR C 1 297 ? 3.982   -4.103  57.582  1.00 58.36 ? 300  THR C OG1 1 
ATOM   10427 C  CG2 . THR C 1 297 ? 4.767   -1.836  57.663  1.00 57.88 ? 300  THR C CG2 1 
ATOM   10428 N  N   . LYS C 1 298 ? 6.895   -6.093  57.780  1.00 59.91 ? 301  LYS C N   1 
ATOM   10429 C  CA  . LYS C 1 298 ? 7.025   -7.493  58.206  1.00 60.46 ? 301  LYS C CA  1 
ATOM   10430 C  C   . LYS C 1 298 ? 8.463   -8.000  58.130  1.00 61.05 ? 301  LYS C C   1 
ATOM   10431 O  O   . LYS C 1 298 ? 9.263   -7.507  57.339  1.00 61.30 ? 301  LYS C O   1 
ATOM   10432 C  CB  . LYS C 1 298 ? 6.165   -8.406  57.320  1.00 60.13 ? 301  LYS C CB  1 
ATOM   10433 C  CG  . LYS C 1 298 ? 4.697   -8.033  57.210  1.00 59.42 ? 301  LYS C CG  1 
ATOM   10434 C  CD  . LYS C 1 298 ? 3.937   -8.312  58.480  1.00 58.75 ? 301  LYS C CD  1 
ATOM   10435 C  CE  . LYS C 1 298 ? 2.518   -7.793  58.351  1.00 58.60 ? 301  LYS C CE  1 
ATOM   10436 N  NZ  . LYS C 1 298 ? 2.508   -6.329  58.053  1.00 58.00 ? 301  LYS C NZ  1 
ATOM   10437 N  N   . VAL C 1 299 ? 8.773   -9.015  58.933  1.00 61.61 ? 302  VAL C N   1 
ATOM   10438 C  CA  . VAL C 1 299 ? 10.103  -9.625  58.940  1.00 62.24 ? 302  VAL C CA  1 
ATOM   10439 C  C   . VAL C 1 299 ? 9.952   -11.106 58.598  1.00 63.32 ? 302  VAL C C   1 
ATOM   10440 O  O   . VAL C 1 299 ? 8.844   -11.646 58.610  1.00 63.84 ? 302  VAL C O   1 
ATOM   10441 C  CB  . VAL C 1 299 ? 10.779  -9.532  60.329  1.00 61.58 ? 302  VAL C CB  1 
ATOM   10442 C  CG1 . VAL C 1 299 ? 10.950  -8.100  60.735  1.00 61.30 ? 302  VAL C CG1 1 
ATOM   10443 C  CG2 . VAL C 1 299 ? 9.958   -10.271 61.370  1.00 61.04 ? 302  VAL C CG2 1 
ATOM   10444 N  N   . TRP C 1 300 ? 11.060  -11.758 58.262  1.00 64.21 ? 303  TRP C N   1 
ATOM   10445 C  CA  . TRP C 1 300 ? 11.032  -13.181 57.960  1.00 64.82 ? 303  TRP C CA  1 
ATOM   10446 C  C   . TRP C 1 300 ? 11.535  -13.865 59.212  1.00 65.41 ? 303  TRP C C   1 
ATOM   10447 O  O   . TRP C 1 300 ? 12.692  -13.704 59.593  1.00 65.77 ? 303  TRP C O   1 
ATOM   10448 C  CB  . TRP C 1 300 ? 11.973  -13.512 56.811  1.00 64.68 ? 303  TRP C CB  1 
ATOM   10449 C  CG  . TRP C 1 300 ? 11.648  -12.844 55.513  1.00 64.33 ? 303  TRP C CG  1 
ATOM   10450 C  CD1 . TRP C 1 300 ? 10.577  -12.040 55.235  1.00 64.08 ? 303  TRP C CD1 1 
ATOM   10451 C  CD2 . TRP C 1 300 ? 12.397  -12.950 54.301  1.00 63.94 ? 303  TRP C CD2 1 
ATOM   10452 N  NE1 . TRP C 1 300 ? 10.617  -11.645 53.919  1.00 63.96 ? 303  TRP C NE1 1 
ATOM   10453 C  CE2 . TRP C 1 300 ? 11.723  -12.191 53.326  1.00 63.78 ? 303  TRP C CE2 1 
ATOM   10454 C  CE3 . TRP C 1 300 ? 13.577  -13.617 53.946  1.00 63.72 ? 303  TRP C CE3 1 
ATOM   10455 C  CZ2 . TRP C 1 300 ? 12.188  -12.081 52.016  1.00 63.69 ? 303  TRP C CZ2 1 
ATOM   10456 C  CZ3 . TRP C 1 300 ? 14.041  -13.508 52.645  1.00 63.33 ? 303  TRP C CZ3 1 
ATOM   10457 C  CH2 . TRP C 1 300 ? 13.346  -12.746 51.696  1.00 63.48 ? 303  TRP C CH2 1 
ATOM   10458 N  N   . PRO C 1 301 ? 10.666  -14.613 59.887  1.00 65.99 ? 304  PRO C N   1 
ATOM   10459 C  CA  . PRO C 1 301 ? 11.004  -15.334 61.117  1.00 66.74 ? 304  PRO C CA  1 
ATOM   10460 C  C   . PRO C 1 301 ? 12.250  -16.210 60.976  1.00 67.51 ? 304  PRO C C   1 
ATOM   10461 O  O   . PRO C 1 301 ? 12.310  -17.081 60.111  1.00 67.30 ? 304  PRO C O   1 
ATOM   10462 C  CB  . PRO C 1 301 ? 9.755   -16.168 61.360  1.00 66.76 ? 304  PRO C CB  1 
ATOM   10463 C  CG  . PRO C 1 301 ? 8.667   -15.287 60.814  1.00 66.50 ? 304  PRO C CG  1 
ATOM   10464 C  CD  . PRO C 1 301 ? 9.261   -14.825 59.515  1.00 65.84 ? 304  PRO C CD  1 
ATOM   10465 N  N   . HIS C 1 302 ? 13.234  -15.968 61.843  1.00 68.40 ? 305  HIS C N   1 
ATOM   10466 C  CA  . HIS C 1 302 ? 14.505  -16.696 61.844  1.00 69.36 ? 305  HIS C CA  1 
ATOM   10467 C  C   . HIS C 1 302 ? 14.318  -18.194 61.835  1.00 69.88 ? 305  HIS C C   1 
ATOM   10468 O  O   . HIS C 1 302 ? 15.024  -18.929 61.139  1.00 70.12 ? 305  HIS C O   1 
ATOM   10469 C  CB  . HIS C 1 302 ? 15.326  -16.315 63.074  1.00 69.51 ? 305  HIS C CB  1 
ATOM   10470 C  CG  . HIS C 1 302 ? 15.761  -14.886 63.087  1.00 70.02 ? 305  HIS C CG  1 
ATOM   10471 N  ND1 . HIS C 1 302 ? 15.545  -14.052 64.163  1.00 70.40 ? 305  HIS C ND1 1 
ATOM   10472 C  CD2 . HIS C 1 302 ? 16.389  -14.137 62.150  1.00 70.09 ? 305  HIS C CD2 1 
ATOM   10473 C  CE1 . HIS C 1 302 ? 16.022  -12.850 63.887  1.00 70.44 ? 305  HIS C CE1 1 
ATOM   10474 N  NE2 . HIS C 1 302 ? 16.539  -12.875 62.671  1.00 70.43 ? 305  HIS C NE2 1 
ATOM   10475 N  N   . LYS C 1 303 ? 13.373  -18.636 62.649  1.00 70.82 ? 306  LYS C N   1 
ATOM   10476 C  CA  . LYS C 1 303 ? 13.040  -20.038 62.772  1.00 71.61 ? 306  LYS C CA  1 
ATOM   10477 C  C   . LYS C 1 303 ? 12.802  -20.623 61.377  1.00 71.41 ? 306  LYS C C   1 
ATOM   10478 O  O   . LYS C 1 303 ? 13.315  -21.686 61.049  1.00 71.43 ? 306  LYS C O   1 
ATOM   10479 C  CB  . LYS C 1 303 ? 11.780  -20.161 63.633  1.00 72.97 ? 306  LYS C CB  1 
ATOM   10480 C  CG  . LYS C 1 303 ? 11.291  -21.568 63.889  1.00 74.36 ? 306  LYS C CG  1 
ATOM   10481 C  CD  . LYS C 1 303 ? 12.227  -22.343 64.793  1.00 75.74 ? 306  LYS C CD  1 
ATOM   10482 C  CE  . LYS C 1 303 ? 11.673  -23.750 65.009  1.00 76.85 ? 306  LYS C CE  1 
ATOM   10483 N  NZ  . LYS C 1 303 ? 12.656  -24.658 65.671  1.00 77.58 ? 306  LYS C NZ  1 
ATOM   10484 N  N   . ASP C 1 304 ? 12.098  -19.870 60.538  1.00 70.94 ? 307  ASP C N   1 
ATOM   10485 C  CA  . ASP C 1 304 ? 11.768  -20.311 59.185  1.00 70.48 ? 307  ASP C CA  1 
ATOM   10486 C  C   . ASP C 1 304 ? 12.804  -19.950 58.119  1.00 69.77 ? 307  ASP C C   1 
ATOM   10487 O  O   . ASP C 1 304 ? 12.967  -20.669 57.133  1.00 69.43 ? 307  ASP C O   1 
ATOM   10488 C  CB  . ASP C 1 304 ? 10.393  -19.763 58.798  1.00 71.22 ? 307  ASP C CB  1 
ATOM   10489 C  CG  . ASP C 1 304 ? 9.315   -20.138 59.810  1.00 71.75 ? 307  ASP C CG  1 
ATOM   10490 O  OD1 . ASP C 1 304 ? 8.777   -19.232 60.494  1.00 71.90 ? 307  ASP C OD1 1 
ATOM   10491 O  OD2 . ASP C 1 304 ? 9.015   -21.348 59.929  1.00 72.39 ? 307  ASP C OD2 1 
ATOM   10492 N  N   . TYR C 1 305 ? 13.479  -18.818 58.309  1.00 68.73 ? 308  TYR C N   1 
ATOM   10493 C  CA  . TYR C 1 305 ? 14.500  -18.349 57.381  1.00 67.29 ? 308  TYR C CA  1 
ATOM   10494 C  C   . TYR C 1 305 ? 15.729  -17.991 58.184  1.00 66.80 ? 308  TYR C C   1 
ATOM   10495 O  O   . TYR C 1 305 ? 15.917  -16.850 58.595  1.00 66.73 ? 308  TYR C O   1 
ATOM   10496 C  CB  . TYR C 1 305 ? 13.991  -17.147 56.597  1.00 66.58 ? 308  TYR C CB  1 
ATOM   10497 C  CG  . TYR C 1 305 ? 12.747  -17.478 55.827  1.00 66.04 ? 308  TYR C CG  1 
ATOM   10498 C  CD1 . TYR C 1 305 ? 12.822  -17.957 54.523  1.00 65.73 ? 308  TYR C CD1 1 
ATOM   10499 C  CD2 . TYR C 1 305 ? 11.495  -17.385 56.425  1.00 65.65 ? 308  TYR C CD2 1 
ATOM   10500 C  CE1 . TYR C 1 305 ? 11.677  -18.340 53.836  1.00 65.61 ? 308  TYR C CE1 1 
ATOM   10501 C  CE2 . TYR C 1 305 ? 10.349  -17.764 55.750  1.00 65.55 ? 308  TYR C CE2 1 
ATOM   10502 C  CZ  . TYR C 1 305 ? 10.443  -18.240 54.457  1.00 65.65 ? 308  TYR C CZ  1 
ATOM   10503 O  OH  . TYR C 1 305 ? 9.300   -18.608 53.779  1.00 65.66 ? 308  TYR C OH  1 
ATOM   10504 N  N   . PRO C 1 306 ? 16.569  -18.990 58.451  1.00 66.39 ? 309  PRO C N   1 
ATOM   10505 C  CA  . PRO C 1 306 ? 17.813  -18.885 59.210  1.00 66.26 ? 309  PRO C CA  1 
ATOM   10506 C  C   . PRO C 1 306 ? 18.817  -17.924 58.587  1.00 66.17 ? 309  PRO C C   1 
ATOM   10507 O  O   . PRO C 1 306 ? 18.868  -17.776 57.363  1.00 66.40 ? 309  PRO C O   1 
ATOM   10508 C  CB  . PRO C 1 306 ? 18.331  -20.317 59.186  1.00 66.41 ? 309  PRO C CB  1 
ATOM   10509 C  CG  . PRO C 1 306 ? 17.066  -21.130 59.092  1.00 66.13 ? 309  PRO C CG  1 
ATOM   10510 C  CD  . PRO C 1 306 ? 16.321  -20.382 58.047  1.00 66.26 ? 309  PRO C CD  1 
ATOM   10511 N  N   . LEU C 1 307 ? 19.617  -17.281 59.437  1.00 65.92 ? 310  LEU C N   1 
ATOM   10512 C  CA  . LEU C 1 307 ? 20.631  -16.334 58.989  1.00 65.57 ? 310  LEU C CA  1 
ATOM   10513 C  C   . LEU C 1 307 ? 21.822  -17.046 58.384  1.00 65.40 ? 310  LEU C C   1 
ATOM   10514 O  O   . LEU C 1 307 ? 22.405  -17.948 58.985  1.00 65.39 ? 310  LEU C O   1 
ATOM   10515 C  CB  . LEU C 1 307 ? 21.090  -15.442 60.139  1.00 65.43 ? 310  LEU C CB  1 
ATOM   10516 C  CG  . LEU C 1 307 ? 20.101  -14.336 60.507  1.00 65.23 ? 310  LEU C CG  1 
ATOM   10517 C  CD1 . LEU C 1 307 ? 20.629  -13.510 61.672  1.00 65.13 ? 310  LEU C CD1 1 
ATOM   10518 C  CD2 . LEU C 1 307 ? 19.860  -13.457 59.292  1.00 64.92 ? 310  LEU C CD2 1 
ATOM   10519 N  N   . ILE C 1 308 ? 22.191  -16.607 57.189  1.00 65.27 ? 311  ILE C N   1 
ATOM   10520 C  CA  . ILE C 1 308 ? 23.298  -17.195 56.464  1.00 64.70 ? 311  ILE C CA  1 
ATOM   10521 C  C   . ILE C 1 308 ? 24.474  -16.235 56.400  1.00 64.62 ? 311  ILE C C   1 
ATOM   10522 O  O   . ILE C 1 308 ? 24.444  -15.246 55.661  1.00 64.85 ? 311  ILE C O   1 
ATOM   10523 C  CB  . ILE C 1 308 ? 22.853  -17.557 55.055  1.00 64.47 ? 311  ILE C CB  1 
ATOM   10524 C  CG1 . ILE C 1 308 ? 21.653  -18.505 55.141  1.00 64.29 ? 311  ILE C CG1 1 
ATOM   10525 C  CG2 . ILE C 1 308 ? 24.013  -18.151 54.273  1.00 64.28 ? 311  ILE C CG2 1 
ATOM   10526 C  CD1 . ILE C 1 308 ? 21.023  -18.832 53.814  1.00 64.02 ? 311  ILE C CD1 1 
ATOM   10527 N  N   . PRO C 1 309 ? 25.537  -16.532 57.168  1.00 63.91 ? 312  PRO C N   1 
ATOM   10528 C  CA  . PRO C 1 309 ? 26.744  -15.703 57.217  1.00 63.25 ? 312  PRO C CA  1 
ATOM   10529 C  C   . PRO C 1 309 ? 27.331  -15.449 55.834  1.00 62.85 ? 312  PRO C C   1 
ATOM   10530 O  O   . PRO C 1 309 ? 27.349  -16.339 54.989  1.00 62.45 ? 312  PRO C O   1 
ATOM   10531 C  CB  . PRO C 1 309 ? 27.677  -16.517 58.116  1.00 63.26 ? 312  PRO C CB  1 
ATOM   10532 C  CG  . PRO C 1 309 ? 27.193  -17.926 57.952  1.00 63.15 ? 312  PRO C CG  1 
ATOM   10533 C  CD  . PRO C 1 309 ? 25.710  -17.750 57.976  1.00 63.72 ? 312  PRO C CD  1 
ATOM   10534 N  N   . VAL C 1 310 ? 27.766  -14.210 55.608  1.00 62.70 ? 313  VAL C N   1 
ATOM   10535 C  CA  . VAL C 1 310 ? 28.347  -13.781 54.339  1.00 62.33 ? 313  VAL C CA  1 
ATOM   10536 C  C   . VAL C 1 310 ? 29.745  -13.170 54.496  1.00 62.17 ? 313  VAL C C   1 
ATOM   10537 O  O   . VAL C 1 310 ? 30.668  -13.528 53.760  1.00 62.06 ? 313  VAL C O   1 
ATOM   10538 C  CB  . VAL C 1 310 ? 27.428  -12.764 53.638  1.00 62.30 ? 313  VAL C CB  1 
ATOM   10539 C  CG1 . VAL C 1 310 ? 28.056  -12.272 52.355  1.00 62.00 ? 313  VAL C CG1 1 
ATOM   10540 C  CG2 . VAL C 1 310 ? 26.086  -13.394 53.358  1.00 62.16 ? 313  VAL C CG2 1 
ATOM   10541 N  N   . GLY C 1 311 ? 29.907  -12.252 55.444  1.00 61.94 ? 314  GLY C N   1 
ATOM   10542 C  CA  . GLY C 1 311 ? 31.212  -11.640 55.632  1.00 61.73 ? 314  GLY C CA  1 
ATOM   10543 C  C   . GLY C 1 311 ? 31.332  -10.666 56.792  1.00 61.65 ? 314  GLY C C   1 
ATOM   10544 O  O   . GLY C 1 311 ? 30.546  -10.710 57.744  1.00 61.89 ? 314  GLY C O   1 
ATOM   10545 N  N   . LYS C 1 312 ? 32.309  -9.769  56.700  1.00 61.35 ? 315  LYS C N   1 
ATOM   10546 C  CA  . LYS C 1 312 ? 32.548  -8.784  57.743  1.00 60.98 ? 315  LYS C CA  1 
ATOM   10547 C  C   . LYS C 1 312 ? 32.638  -7.380  57.213  1.00 60.59 ? 315  LYS C C   1 
ATOM   10548 O  O   . LYS C 1 312 ? 33.179  -7.140  56.135  1.00 60.73 ? 315  LYS C O   1 
ATOM   10549 C  CB  . LYS C 1 312 ? 33.864  -9.073  58.458  1.00 61.22 ? 315  LYS C CB  1 
ATOM   10550 C  CG  . LYS C 1 312 ? 33.837  -10.255 59.391  1.00 61.69 ? 315  LYS C CG  1 
ATOM   10551 C  CD  . LYS C 1 312 ? 33.196  -9.895  60.717  1.00 61.64 ? 315  LYS C CD  1 
ATOM   10552 C  CE  . LYS C 1 312 ? 33.213  -11.097 61.630  1.00 61.51 ? 315  LYS C CE  1 
ATOM   10553 N  NZ  . LYS C 1 312 ? 32.610  -10.797 62.943  1.00 61.56 ? 315  LYS C NZ  1 
ATOM   10554 N  N   . LEU C 1 313 ? 32.115  -6.452  57.996  1.00 60.18 ? 316  LEU C N   1 
ATOM   10555 C  CA  . LEU C 1 313 ? 32.180  -5.041  57.664  1.00 59.79 ? 316  LEU C CA  1 
ATOM   10556 C  C   . LEU C 1 313 ? 33.096  -4.469  58.725  1.00 59.80 ? 316  LEU C C   1 
ATOM   10557 O  O   . LEU C 1 313 ? 32.859  -4.655  59.924  1.00 59.68 ? 316  LEU C O   1 
ATOM   10558 C  CB  . LEU C 1 313 ? 30.811  -4.388  57.769  1.00 59.47 ? 316  LEU C CB  1 
ATOM   10559 C  CG  . LEU C 1 313 ? 29.845  -4.674  56.627  1.00 58.95 ? 316  LEU C CG  1 
ATOM   10560 C  CD1 . LEU C 1 313 ? 28.537  -3.984  56.940  1.00 59.05 ? 316  LEU C CD1 1 
ATOM   10561 C  CD2 . LEU C 1 313 ? 30.414  -4.174  55.304  1.00 58.42 ? 316  LEU C CD2 1 
ATOM   10562 N  N   . VAL C 1 314 ? 34.156  -3.798  58.293  1.00 59.62 ? 317  VAL C N   1 
ATOM   10563 C  CA  . VAL C 1 314 ? 35.102  -3.236  59.238  1.00 59.16 ? 317  VAL C CA  1 
ATOM   10564 C  C   . VAL C 1 314 ? 35.432  -1.782  58.948  1.00 59.28 ? 317  VAL C C   1 
ATOM   10565 O  O   . VAL C 1 314 ? 35.758  -1.418  57.819  1.00 59.06 ? 317  VAL C O   1 
ATOM   10566 C  CB  . VAL C 1 314 ? 36.396  -4.062  59.257  1.00 59.17 ? 317  VAL C CB  1 
ATOM   10567 C  CG1 . VAL C 1 314 ? 37.358  -3.498  60.275  1.00 58.65 ? 317  VAL C CG1 1 
ATOM   10568 C  CG2 . VAL C 1 314 ? 36.085  -5.524  59.561  1.00 58.42 ? 317  VAL C CG2 1 
ATOM   10569 N  N   . LEU C 1 315 ? 35.312  -0.954  59.983  1.00 59.33 ? 318  LEU C N   1 
ATOM   10570 C  CA  . LEU C 1 315 ? 35.598  0.469   59.888  1.00 59.34 ? 318  LEU C CA  1 
ATOM   10571 C  C   . LEU C 1 315 ? 36.869  0.767   60.646  1.00 59.62 ? 318  LEU C C   1 
ATOM   10572 O  O   . LEU C 1 315 ? 36.900  0.749   61.874  1.00 59.64 ? 318  LEU C O   1 
ATOM   10573 C  CB  . LEU C 1 315 ? 34.450  1.281   60.464  1.00 58.80 ? 318  LEU C CB  1 
ATOM   10574 C  CG  . LEU C 1 315 ? 33.182  1.064   59.655  1.00 58.46 ? 318  LEU C CG  1 
ATOM   10575 C  CD1 . LEU C 1 315 ? 32.041  1.808   60.291  1.00 58.30 ? 318  LEU C CD1 1 
ATOM   10576 C  CD2 . LEU C 1 315 ? 33.411  1.523   58.223  1.00 58.56 ? 318  LEU C CD2 1 
ATOM   10577 N  N   . ASN C 1 316 ? 37.915  1.077   59.899  1.00 59.98 ? 319  ASN C N   1 
ATOM   10578 C  CA  . ASN C 1 316 ? 39.211  1.349   60.490  1.00 60.11 ? 319  ASN C CA  1 
ATOM   10579 C  C   . ASN C 1 316 ? 39.771  2.712   60.128  1.00 59.98 ? 319  ASN C C   1 
ATOM   10580 O  O   . ASN C 1 316 ? 40.902  3.026   60.489  1.00 60.09 ? 319  ASN C O   1 
ATOM   10581 C  CB  . ASN C 1 316 ? 40.196  0.276   60.029  1.00 60.56 ? 319  ASN C CB  1 
ATOM   10582 C  CG  . ASN C 1 316 ? 40.327  0.222   58.512  1.00 60.84 ? 319  ASN C CG  1 
ATOM   10583 O  OD1 . ASN C 1 316 ? 39.876  1.127   57.800  1.00 61.35 ? 319  ASN C OD1 1 
ATOM   10584 N  ND2 . ASN C 1 316 ? 40.945  -0.842  58.010  1.00 60.67 ? 319  ASN C ND2 1 
ATOM   10585 N  N   . ARG C 1 317 ? 38.992  3.521   59.419  1.00 59.94 ? 320  ARG C N   1 
ATOM   10586 C  CA  . ARG C 1 317 ? 39.477  4.827   59.007  1.00 59.79 ? 320  ARG C CA  1 
ATOM   10587 C  C   . ARG C 1 317 ? 38.486  5.958   59.192  1.00 59.50 ? 320  ARG C C   1 
ATOM   10588 O  O   . ARG C 1 317 ? 37.372  5.919   58.667  1.00 59.62 ? 320  ARG C O   1 
ATOM   10589 C  CB  . ARG C 1 317 ? 39.906  4.774   57.543  1.00 60.15 ? 320  ARG C CB  1 
ATOM   10590 C  CG  . ARG C 1 317 ? 40.846  5.891   57.140  1.00 60.80 ? 320  ARG C CG  1 
ATOM   10591 C  CD  . ARG C 1 317 ? 41.258  5.766   55.683  1.00 61.55 ? 320  ARG C CD  1 
ATOM   10592 N  NE  . ARG C 1 317 ? 40.238  6.291   54.780  1.00 62.60 ? 320  ARG C NE  1 
ATOM   10593 C  CZ  . ARG C 1 317 ? 39.701  5.611   53.768  1.00 63.30 ? 320  ARG C CZ  1 
ATOM   10594 N  NH1 . ARG C 1 317 ? 40.076  4.361   53.519  1.00 63.24 ? 320  ARG C NH1 1 
ATOM   10595 N  NH2 . ARG C 1 317 ? 38.795  6.191   52.987  1.00 63.65 ? 320  ARG C NH2 1 
ATOM   10596 N  N   . ASN C 1 318 ? 38.912  6.972   59.936  1.00 59.06 ? 321  ASN C N   1 
ATOM   10597 C  CA  . ASN C 1 318 ? 38.100  8.151   60.183  1.00 58.62 ? 321  ASN C CA  1 
ATOM   10598 C  C   . ASN C 1 318 ? 38.219  9.059   58.978  1.00 58.21 ? 321  ASN C C   1 
ATOM   10599 O  O   . ASN C 1 318 ? 39.160  8.963   58.202  1.00 58.14 ? 321  ASN C O   1 
ATOM   10600 C  CB  . ASN C 1 318 ? 38.616  8.906   61.409  1.00 58.93 ? 321  ASN C CB  1 
ATOM   10601 C  CG  . ASN C 1 318 ? 38.148  8.299   62.707  1.00 59.19 ? 321  ASN C CG  1 
ATOM   10602 O  OD1 . ASN C 1 318 ? 37.007  7.858   62.814  1.00 59.89 ? 321  ASN C OD1 1 
ATOM   10603 N  ND2 . ASN C 1 318 ? 39.021  8.287   63.710  1.00 59.06 ? 321  ASN C ND2 1 
ATOM   10604 N  N   . PRO C 1 319 ? 37.252  9.951   58.795  1.00 57.90 ? 322  PRO C N   1 
ATOM   10605 C  CA  . PRO C 1 319 ? 37.346  10.847  57.646  1.00 57.69 ? 322  PRO C CA  1 
ATOM   10606 C  C   . PRO C 1 319 ? 38.477  11.806  57.949  1.00 57.67 ? 322  PRO C C   1 
ATOM   10607 O  O   . PRO C 1 319 ? 38.908  11.908  59.096  1.00 57.68 ? 322  PRO C O   1 
ATOM   10608 C  CB  . PRO C 1 319 ? 36.013  11.581  57.684  1.00 57.68 ? 322  PRO C CB  1 
ATOM   10609 C  CG  . PRO C 1 319 ? 35.108  10.632  58.438  1.00 57.76 ? 322  PRO C CG  1 
ATOM   10610 C  CD  . PRO C 1 319 ? 35.993  10.146  59.523  1.00 57.85 ? 322  PRO C CD  1 
ATOM   10611 N  N   . VAL C 1 320 ? 38.985  12.483  56.933  1.00 57.50 ? 323  VAL C N   1 
ATOM   10612 C  CA  . VAL C 1 320 ? 40.051  13.452  57.140  1.00 57.26 ? 323  VAL C CA  1 
ATOM   10613 C  C   . VAL C 1 320 ? 39.413  14.831  57.110  1.00 57.36 ? 323  VAL C C   1 
ATOM   10614 O  O   . VAL C 1 320 ? 39.859  15.751  57.791  1.00 57.29 ? 323  VAL C O   1 
ATOM   10615 C  CB  . VAL C 1 320 ? 41.110  13.373  56.039  1.00 57.28 ? 323  VAL C CB  1 
ATOM   10616 C  CG1 . VAL C 1 320 ? 42.229  14.350  56.330  1.00 56.64 ? 323  VAL C CG1 1 
ATOM   10617 C  CG2 . VAL C 1 320 ? 41.648  11.954  55.936  1.00 57.08 ? 323  VAL C CG2 1 
ATOM   10618 N  N   . ASN C 1 321 ? 38.383  14.970  56.280  1.00 57.45 ? 324  ASN C N   1 
ATOM   10619 C  CA  . ASN C 1 321 ? 37.649  16.216  56.156  1.00 57.37 ? 324  ASN C CA  1 
ATOM   10620 C  C   . ASN C 1 321 ? 36.203  15.808  56.113  1.00 57.45 ? 324  ASN C C   1 
ATOM   10621 O  O   . ASN C 1 321 ? 35.739  15.250  55.127  1.00 57.64 ? 324  ASN C O   1 
ATOM   10622 C  CB  . ASN C 1 321 ? 38.005  16.950  54.869  1.00 57.45 ? 324  ASN C CB  1 
ATOM   10623 C  CG  . ASN C 1 321 ? 37.315  18.288  54.767  1.00 57.29 ? 324  ASN C CG  1 
ATOM   10624 O  OD1 . ASN C 1 321 ? 36.157  18.373  54.364  1.00 57.63 ? 324  ASN C OD1 1 
ATOM   10625 N  ND2 . ASN C 1 321 ? 38.011  19.341  55.161  1.00 57.53 ? 324  ASN C ND2 1 
ATOM   10626 N  N   . TYR C 1 322 ? 35.498  16.087  57.196  1.00 57.46 ? 325  TYR C N   1 
ATOM   10627 C  CA  . TYR C 1 322 ? 34.101  15.727  57.324  1.00 57.56 ? 325  TYR C CA  1 
ATOM   10628 C  C   . TYR C 1 322 ? 33.178  16.174  56.183  1.00 57.73 ? 325  TYR C C   1 
ATOM   10629 O  O   . TYR C 1 322 ? 32.395  15.376  55.662  1.00 57.95 ? 325  TYR C O   1 
ATOM   10630 C  CB  . TYR C 1 322 ? 33.586  16.237  58.663  1.00 57.41 ? 325  TYR C CB  1 
ATOM   10631 C  CG  . TYR C 1 322 ? 32.176  15.827  58.946  1.00 57.48 ? 325  TYR C CG  1 
ATOM   10632 C  CD1 . TYR C 1 322 ? 31.902  14.664  59.651  1.00 57.40 ? 325  TYR C CD1 1 
ATOM   10633 C  CD2 . TYR C 1 322 ? 31.105  16.591  58.490  1.00 57.44 ? 325  TYR C CD2 1 
ATOM   10634 C  CE1 . TYR C 1 322 ? 30.593  14.267  59.896  1.00 57.58 ? 325  TYR C CE1 1 
ATOM   10635 C  CE2 . TYR C 1 322 ? 29.794  16.203  58.728  1.00 57.58 ? 325  TYR C CE2 1 
ATOM   10636 C  CZ  . TYR C 1 322 ? 29.547  15.041  59.428  1.00 57.53 ? 325  TYR C CZ  1 
ATOM   10637 O  OH  . TYR C 1 322 ? 28.254  14.646  59.649  1.00 57.56 ? 325  TYR C OH  1 
ATOM   10638 N  N   . PHE C 1 323 ? 33.251  17.446  55.807  1.00 57.58 ? 326  PHE C N   1 
ATOM   10639 C  CA  . PHE C 1 323 ? 32.403  17.976  54.745  1.00 57.37 ? 326  PHE C CA  1 
ATOM   10640 C  C   . PHE C 1 323 ? 32.601  17.230  53.440  1.00 57.97 ? 326  PHE C C   1 
ATOM   10641 O  O   . PHE C 1 323 ? 31.633  16.816  52.806  1.00 58.39 ? 326  PHE C O   1 
ATOM   10642 C  CB  . PHE C 1 323 ? 32.688  19.460  54.515  1.00 56.69 ? 326  PHE C CB  1 
ATOM   10643 C  CG  . PHE C 1 323 ? 31.824  20.090  53.448  1.00 56.09 ? 326  PHE C CG  1 
ATOM   10644 C  CD1 . PHE C 1 323 ? 32.217  20.078  52.111  1.00 55.90 ? 326  PHE C CD1 1 
ATOM   10645 C  CD2 . PHE C 1 323 ? 30.606  20.677  53.776  1.00 55.72 ? 326  PHE C CD2 1 
ATOM   10646 C  CE1 . PHE C 1 323 ? 31.406  20.639  51.119  1.00 55.13 ? 326  PHE C CE1 1 
ATOM   10647 C  CE2 . PHE C 1 323 ? 29.793  21.238  52.791  1.00 54.89 ? 326  PHE C CE2 1 
ATOM   10648 C  CZ  . PHE C 1 323 ? 30.196  21.217  51.462  1.00 54.67 ? 326  PHE C CZ  1 
ATOM   10649 N  N   . ALA C 1 324 ? 33.862  17.073  53.047  1.00 58.48 ? 327  ALA C N   1 
ATOM   10650 C  CA  . ALA C 1 324 ? 34.227  16.401  51.803  1.00 58.90 ? 327  ALA C CA  1 
ATOM   10651 C  C   . ALA C 1 324 ? 33.948  14.906  51.774  1.00 59.57 ? 327  ALA C C   1 
ATOM   10652 O  O   . ALA C 1 324 ? 33.569  14.371  50.735  1.00 60.02 ? 327  ALA C O   1 
ATOM   10653 C  CB  . ALA C 1 324 ? 35.701  16.649  51.489  1.00 58.47 ? 327  ALA C CB  1 
ATOM   10654 N  N   . GLU C 1 325 ? 34.137  14.234  52.908  1.00 60.03 ? 328  GLU C N   1 
ATOM   10655 C  CA  . GLU C 1 325 ? 33.956  12.786  52.983  1.00 60.30 ? 328  GLU C CA  1 
ATOM   10656 C  C   . GLU C 1 325 ? 32.657  12.290  53.584  1.00 60.54 ? 328  GLU C C   1 
ATOM   10657 O  O   . GLU C 1 325 ? 32.228  11.169  53.299  1.00 60.44 ? 328  GLU C O   1 
ATOM   10658 C  CB  . GLU C 1 325 ? 35.117  12.160  53.752  1.00 60.82 ? 328  GLU C CB  1 
ATOM   10659 C  CG  . GLU C 1 325 ? 36.445  12.292  53.058  1.00 61.21 ? 328  GLU C CG  1 
ATOM   10660 C  CD  . GLU C 1 325 ? 37.585  11.816  53.917  1.00 61.83 ? 328  GLU C CD  1 
ATOM   10661 O  OE1 . GLU C 1 325 ? 37.775  10.585  54.030  1.00 62.07 ? 328  GLU C OE1 1 
ATOM   10662 O  OE2 . GLU C 1 325 ? 38.293  12.677  54.475  1.00 62.07 ? 328  GLU C OE2 1 
ATOM   10663 N  N   . VAL C 1 326 ? 32.041  13.100  54.434  1.00 60.54 ? 329  VAL C N   1 
ATOM   10664 C  CA  . VAL C 1 326 ? 30.809  12.672  55.063  1.00 60.62 ? 329  VAL C CA  1 
ATOM   10665 C  C   . VAL C 1 326 ? 29.577  13.443  54.620  1.00 60.65 ? 329  VAL C C   1 
ATOM   10666 O  O   . VAL C 1 326 ? 28.615  12.849  54.122  1.00 60.67 ? 329  VAL C O   1 
ATOM   10667 C  CB  . VAL C 1 326 ? 30.938  12.711  56.591  1.00 60.78 ? 329  VAL C CB  1 
ATOM   10668 C  CG1 . VAL C 1 326 ? 29.681  12.157  57.240  1.00 60.74 ? 329  VAL C CG1 1 
ATOM   10669 C  CG2 . VAL C 1 326 ? 32.146  11.898  57.021  1.00 60.26 ? 329  VAL C CG2 1 
ATOM   10670 N  N   . GLU C 1 327 ? 29.598  14.760  54.784  1.00 60.62 ? 330  GLU C N   1 
ATOM   10671 C  CA  . GLU C 1 327 ? 28.443  15.557  54.399  1.00 60.79 ? 330  GLU C CA  1 
ATOM   10672 C  C   . GLU C 1 327 ? 28.078  15.326  52.939  1.00 60.60 ? 330  GLU C C   1 
ATOM   10673 O  O   . GLU C 1 327 ? 26.933  14.993  52.615  1.00 60.85 ? 330  GLU C O   1 
ATOM   10674 C  CB  . GLU C 1 327 ? 28.707  17.038  54.654  1.00 61.29 ? 330  GLU C CB  1 
ATOM   10675 C  CG  . GLU C 1 327 ? 27.494  17.942  54.423  1.00 62.02 ? 330  GLU C CG  1 
ATOM   10676 C  CD  . GLU C 1 327 ? 26.297  17.594  55.302  1.00 62.71 ? 330  GLU C CD  1 
ATOM   10677 O  OE1 . GLU C 1 327 ? 25.150  17.859  54.876  1.00 63.09 ? 330  GLU C OE1 1 
ATOM   10678 O  OE2 . GLU C 1 327 ? 26.495  17.066  56.421  1.00 62.97 ? 330  GLU C OE2 1 
ATOM   10679 N  N   . GLN C 1 328 ? 29.073  15.440  52.070  1.00 59.96 ? 331  GLN C N   1 
ATOM   10680 C  CA  . GLN C 1 328 ? 28.859  15.253  50.647  1.00 59.39 ? 331  GLN C CA  1 
ATOM   10681 C  C   . GLN C 1 328 ? 28.585  13.823  50.203  1.00 59.12 ? 331  GLN C C   1 
ATOM   10682 O  O   . GLN C 1 328 ? 28.230  13.594  49.045  1.00 59.28 ? 331  GLN C O   1 
ATOM   10683 C  CB  . GLN C 1 328 ? 30.048  15.791  49.856  1.00 59.34 ? 331  GLN C CB  1 
ATOM   10684 C  CG  . GLN C 1 328 ? 30.173  17.286  49.893  1.00 59.53 ? 331  GLN C CG  1 
ATOM   10685 C  CD  . GLN C 1 328 ? 31.075  17.818  48.801  1.00 59.98 ? 331  GLN C CD  1 
ATOM   10686 O  OE1 . GLN C 1 328 ? 30.777  18.841  48.176  1.00 60.27 ? 331  GLN C OE1 1 
ATOM   10687 N  NE2 . GLN C 1 328 ? 32.183  17.126  48.560  1.00 59.98 ? 331  GLN C NE2 1 
ATOM   10688 N  N   . ILE C 1 329 ? 28.727  12.852  51.092  1.00 58.65 ? 332  ILE C N   1 
ATOM   10689 C  CA  . ILE C 1 329 ? 28.501  11.495  50.634  1.00 58.03 ? 332  ILE C CA  1 
ATOM   10690 C  C   . ILE C 1 329 ? 27.062  11.281  50.222  1.00 57.78 ? 332  ILE C C   1 
ATOM   10691 O  O   . ILE C 1 329 ? 26.142  11.870  50.791  1.00 57.57 ? 332  ILE C O   1 
ATOM   10692 C  CB  . ILE C 1 329 ? 28.934  10.440  51.649  1.00 58.01 ? 332  ILE C CB  1 
ATOM   10693 C  CG1 . ILE C 1 329 ? 29.224  9.140   50.898  1.00 57.65 ? 332  ILE C CG1 1 
ATOM   10694 C  CG2 . ILE C 1 329 ? 27.837  10.218  52.688  1.00 57.84 ? 332  ILE C CG2 1 
ATOM   10695 C  CD1 . ILE C 1 329 ? 29.990  8.116   51.691  1.00 57.53 ? 332  ILE C CD1 1 
ATOM   10696 N  N   . ALA C 1 330 ? 26.891  10.451  49.200  1.00 57.45 ? 333  ALA C N   1 
ATOM   10697 C  CA  . ALA C 1 330 ? 25.578  10.141  48.656  1.00 57.28 ? 333  ALA C CA  1 
ATOM   10698 C  C   . ALA C 1 330 ? 25.418  8.648   48.375  1.00 57.55 ? 333  ALA C C   1 
ATOM   10699 O  O   . ALA C 1 330 ? 26.271  8.046   47.711  1.00 57.88 ? 333  ALA C O   1 
ATOM   10700 C  CB  . ALA C 1 330 ? 25.365  10.922  47.381  1.00 56.80 ? 333  ALA C CB  1 
ATOM   10701 N  N   . PHE C 1 331 ? 24.331  8.060   48.885  1.00 57.73 ? 334  PHE C N   1 
ATOM   10702 C  CA  . PHE C 1 331 ? 24.027  6.640   48.683  1.00 57.64 ? 334  PHE C CA  1 
ATOM   10703 C  C   . PHE C 1 331 ? 22.750  6.518   47.869  1.00 58.10 ? 334  PHE C C   1 
ATOM   10704 O  O   . PHE C 1 331 ? 21.784  7.233   48.111  1.00 57.90 ? 334  PHE C O   1 
ATOM   10705 C  CB  . PHE C 1 331 ? 23.806  5.935   50.016  1.00 56.91 ? 334  PHE C CB  1 
ATOM   10706 C  CG  . PHE C 1 331 ? 24.943  6.076   50.971  1.00 56.38 ? 334  PHE C CG  1 
ATOM   10707 C  CD1 . PHE C 1 331 ? 25.899  5.074   51.088  1.00 56.25 ? 334  PHE C CD1 1 
ATOM   10708 C  CD2 . PHE C 1 331 ? 25.059  7.210   51.764  1.00 56.06 ? 334  PHE C CD2 1 
ATOM   10709 C  CE1 . PHE C 1 331 ? 26.959  5.198   51.987  1.00 55.97 ? 334  PHE C CE1 1 
ATOM   10710 C  CE2 . PHE C 1 331 ? 26.111  7.343   52.662  1.00 55.81 ? 334  PHE C CE2 1 
ATOM   10711 C  CZ  . PHE C 1 331 ? 27.064  6.332   52.774  1.00 55.76 ? 334  PHE C CZ  1 
ATOM   10712 N  N   . ASP C 1 332 ? 22.744  5.605   46.908  1.00 58.52 ? 335  ASP C N   1 
ATOM   10713 C  CA  . ASP C 1 332 ? 21.577  5.393   46.068  1.00 58.85 ? 335  ASP C CA  1 
ATOM   10714 C  C   . ASP C 1 332 ? 21.251  3.913   46.070  1.00 59.05 ? 335  ASP C C   1 
ATOM   10715 O  O   . ASP C 1 332 ? 22.011  3.099   45.539  1.00 59.32 ? 335  ASP C O   1 
ATOM   10716 C  CB  . ASP C 1 332 ? 21.858  5.845   44.636  1.00 59.06 ? 335  ASP C CB  1 
ATOM   10717 C  CG  . ASP C 1 332 ? 22.170  7.325   44.541  1.00 59.39 ? 335  ASP C CG  1 
ATOM   10718 O  OD1 . ASP C 1 332 ? 23.258  7.669   44.036  1.00 59.38 ? 335  ASP C OD1 1 
ATOM   10719 O  OD2 . ASP C 1 332 ? 21.321  8.145   44.957  1.00 59.72 ? 335  ASP C OD2 1 
ATOM   10720 N  N   . PRO C 1 333 ? 20.123  3.538   46.687  1.00 59.00 ? 336  PRO C N   1 
ATOM   10721 C  CA  . PRO C 1 333 ? 19.718  2.133   46.742  1.00 58.89 ? 336  PRO C CA  1 
ATOM   10722 C  C   . PRO C 1 333 ? 19.678  1.558   45.342  1.00 58.86 ? 336  PRO C C   1 
ATOM   10723 O  O   . PRO C 1 333 ? 19.927  0.369   45.147  1.00 59.03 ? 336  PRO C O   1 
ATOM   10724 C  CB  . PRO C 1 333 ? 18.323  2.209   47.346  1.00 58.84 ? 336  PRO C CB  1 
ATOM   10725 C  CG  . PRO C 1 333 ? 18.434  3.369   48.272  1.00 58.84 ? 336  PRO C CG  1 
ATOM   10726 C  CD  . PRO C 1 333 ? 19.167  4.385   47.417  1.00 59.16 ? 336  PRO C CD  1 
ATOM   10727 N  N   . SER C 1 334 ? 19.403  2.420   44.365  1.00 58.69 ? 337  SER C N   1 
ATOM   10728 C  CA  . SER C 1 334 ? 19.340  2.000   42.973  1.00 58.63 ? 337  SER C CA  1 
ATOM   10729 C  C   . SER C 1 334 ? 20.702  1.576   42.435  1.00 58.77 ? 337  SER C C   1 
ATOM   10730 O  O   . SER C 1 334 ? 20.802  1.100   41.305  1.00 58.80 ? 337  SER C O   1 
ATOM   10731 C  CB  . SER C 1 334 ? 18.747  3.101   42.101  1.00 58.54 ? 337  SER C CB  1 
ATOM   10732 O  OG  . SER C 1 334 ? 19.521  4.280   42.189  1.00 58.66 ? 337  SER C OG  1 
ATOM   10733 N  N   . ASN C 1 335 ? 21.752  1.773   43.227  1.00 59.02 ? 338  ASN C N   1 
ATOM   10734 C  CA  . ASN C 1 335 ? 23.083  1.363   42.811  1.00 59.48 ? 338  ASN C CA  1 
ATOM   10735 C  C   . ASN C 1 335 ? 23.268  -0.112  43.128  1.00 60.11 ? 338  ASN C C   1 
ATOM   10736 O  O   . ASN C 1 335 ? 23.622  -0.482  44.250  1.00 60.48 ? 338  ASN C O   1 
ATOM   10737 C  CB  . ASN C 1 335 ? 24.155  2.186   43.507  1.00 59.21 ? 338  ASN C CB  1 
ATOM   10738 C  CG  . ASN C 1 335 ? 24.302  3.552   42.911  1.00 59.20 ? 338  ASN C CG  1 
ATOM   10739 O  OD1 . ASN C 1 335 ? 24.734  4.485   43.581  1.00 59.84 ? 338  ASN C OD1 1 
ATOM   10740 N  ND2 . ASN C 1 335 ? 23.955  3.685   41.637  1.00 58.66 ? 338  ASN C ND2 1 
ATOM   10741 N  N   . MET C 1 336 ? 22.996  -0.955  42.139  1.00 60.70 ? 339  MET C N   1 
ATOM   10742 C  CA  . MET C 1 336 ? 23.121  -2.394  42.299  1.00 60.94 ? 339  MET C CA  1 
ATOM   10743 C  C   . MET C 1 336 ? 23.878  -3.002  41.138  1.00 61.02 ? 339  MET C C   1 
ATOM   10744 O  O   . MET C 1 336 ? 23.573  -2.747  39.969  1.00 61.04 ? 339  MET C O   1 
ATOM   10745 C  CB  . MET C 1 336 ? 21.742  -3.038  42.386  1.00 61.50 ? 339  MET C CB  1 
ATOM   10746 C  CG  . MET C 1 336 ? 21.094  -2.932  43.738  1.00 62.23 ? 339  MET C CG  1 
ATOM   10747 S  SD  . MET C 1 336 ? 19.408  -3.532  43.688  1.00 63.38 ? 339  MET C SD  1 
ATOM   10748 C  CE  . MET C 1 336 ? 18.625  -2.257  44.619  1.00 62.68 ? 339  MET C CE  1 
ATOM   10749 N  N   . PRO C 1 337 ? 24.900  -3.805  41.446  1.00 60.79 ? 340  PRO C N   1 
ATOM   10750 C  CA  . PRO C 1 337 ? 25.725  -4.468  40.438  1.00 60.79 ? 340  PRO C CA  1 
ATOM   10751 C  C   . PRO C 1 337 ? 25.041  -5.745  39.989  1.00 60.68 ? 340  PRO C C   1 
ATOM   10752 O  O   . PRO C 1 337 ? 24.098  -6.207  40.628  1.00 60.99 ? 340  PRO C O   1 
ATOM   10753 C  CB  . PRO C 1 337 ? 26.981  -4.802  41.223  1.00 60.74 ? 340  PRO C CB  1 
ATOM   10754 C  CG  . PRO C 1 337 ? 26.408  -5.183  42.558  1.00 60.57 ? 340  PRO C CG  1 
ATOM   10755 C  CD  . PRO C 1 337 ? 25.400  -4.085  42.804  1.00 60.67 ? 340  PRO C CD  1 
ATOM   10756 N  N   . PRO C 1 338 ? 25.483  -6.317  38.866  1.00 60.59 ? 341  PRO C N   1 
ATOM   10757 C  CA  . PRO C 1 338 ? 24.858  -7.556  38.408  1.00 60.65 ? 341  PRO C CA  1 
ATOM   10758 C  C   . PRO C 1 338 ? 24.940  -8.541  39.571  1.00 60.55 ? 341  PRO C C   1 
ATOM   10759 O  O   . PRO C 1 338 ? 25.943  -8.573  40.275  1.00 60.61 ? 341  PRO C O   1 
ATOM   10760 C  CB  . PRO C 1 338 ? 25.767  -7.972  37.256  1.00 60.59 ? 341  PRO C CB  1 
ATOM   10761 C  CG  . PRO C 1 338 ? 26.183  -6.648  36.678  1.00 60.23 ? 341  PRO C CG  1 
ATOM   10762 C  CD  . PRO C 1 338 ? 26.506  -5.852  37.913  1.00 60.52 ? 341  PRO C CD  1 
ATOM   10763 N  N   . GLY C 1 339 ? 23.862  -9.273  39.829  1.00 60.60 ? 342  GLY C N   1 
ATOM   10764 C  CA  . GLY C 1 339 ? 23.863  -10.226 40.928  1.00 60.41 ? 342  GLY C CA  1 
ATOM   10765 C  C   . GLY C 1 339 ? 22.949  -9.788  42.056  1.00 60.32 ? 342  GLY C C   1 
ATOM   10766 O  O   . GLY C 1 339 ? 22.446  -10.607 42.834  1.00 60.31 ? 342  GLY C O   1 
ATOM   10767 N  N   . ILE C 1 340 ? 22.756  -8.481  42.162  1.00 60.20 ? 343  ILE C N   1 
ATOM   10768 C  CA  . ILE C 1 340 ? 21.890  -7.919  43.180  1.00 60.14 ? 343  ILE C CA  1 
ATOM   10769 C  C   . ILE C 1 340 ? 20.860  -7.095  42.441  1.00 60.54 ? 343  ILE C C   1 
ATOM   10770 O  O   . ILE C 1 340 ? 21.205  -6.276  41.583  1.00 60.99 ? 343  ILE C O   1 
ATOM   10771 C  CB  . ILE C 1 340 ? 22.669  -7.009  44.124  1.00 60.01 ? 343  ILE C CB  1 
ATOM   10772 C  CG1 . ILE C 1 340 ? 23.781  -7.806  44.799  1.00 59.71 ? 343  ILE C CG1 1 
ATOM   10773 C  CG2 . ILE C 1 340 ? 21.745  -6.411  45.169  1.00 59.72 ? 343  ILE C CG2 1 
ATOM   10774 C  CD1 . ILE C 1 340 ? 24.668  -6.973  45.681  1.00 59.68 ? 343  ILE C CD1 1 
ATOM   10775 N  N   . GLU C 1 341 ? 19.591  -7.321  42.749  1.00 60.81 ? 344  GLU C N   1 
ATOM   10776 C  CA  . GLU C 1 341 ? 18.532  -6.587  42.080  1.00 60.91 ? 344  GLU C CA  1 
ATOM   10777 C  C   . GLU C 1 341 ? 17.405  -6.192  43.016  1.00 60.74 ? 344  GLU C C   1 
ATOM   10778 O  O   . GLU C 1 341 ? 17.392  -6.573  44.184  1.00 60.90 ? 344  GLU C O   1 
ATOM   10779 C  CB  . GLU C 1 341 ? 17.980  -7.410  40.924  1.00 61.31 ? 344  GLU C CB  1 
ATOM   10780 C  CG  . GLU C 1 341 ? 18.920  -7.548  39.750  1.00 61.88 ? 344  GLU C CG  1 
ATOM   10781 C  CD  . GLU C 1 341 ? 18.305  -8.353  38.625  1.00 62.64 ? 344  GLU C CD  1 
ATOM   10782 O  OE1 . GLU C 1 341 ? 19.056  -9.063  37.926  1.00 63.26 ? 344  GLU C OE1 1 
ATOM   10783 O  OE2 . GLU C 1 341 ? 17.067  -8.289  38.437  1.00 63.05 ? 344  GLU C OE2 1 
ATOM   10784 N  N   . ALA C 1 342 ? 16.443  -5.448  42.476  1.00 60.62 ? 345  ALA C N   1 
ATOM   10785 C  CA  . ALA C 1 342 ? 15.292  -4.971  43.231  1.00 60.41 ? 345  ALA C CA  1 
ATOM   10786 C  C   . ALA C 1 342 ? 14.160  -5.979  43.332  1.00 60.27 ? 345  ALA C C   1 
ATOM   10787 O  O   . ALA C 1 342 ? 14.031  -6.865  42.489  1.00 60.51 ? 345  ALA C O   1 
ATOM   10788 C  CB  . ALA C 1 342 ? 14.775  -3.696  42.606  1.00 60.53 ? 345  ALA C CB  1 
ATOM   10789 N  N   . SER C 1 343 ? 13.332  -5.819  44.363  1.00 59.99 ? 346  SER C N   1 
ATOM   10790 C  CA  . SER C 1 343 ? 12.175  -6.680  44.589  1.00 59.76 ? 346  SER C CA  1 
ATOM   10791 C  C   . SER C 1 343 ? 10.948  -5.791  44.441  1.00 59.49 ? 346  SER C C   1 
ATOM   10792 O  O   . SER C 1 343 ? 11.047  -4.570  44.572  1.00 59.89 ? 346  SER C O   1 
ATOM   10793 C  CB  . SER C 1 343 ? 12.197  -7.246  46.008  1.00 59.83 ? 346  SER C CB  1 
ATOM   10794 O  OG  . SER C 1 343 ? 11.765  -6.269  46.946  1.00 60.06 ? 346  SER C OG  1 
ATOM   10795 N  N   . PRO C 1 344 ? 9.775   -6.383  44.181  1.00 59.23 ? 347  PRO C N   1 
ATOM   10796 C  CA  . PRO C 1 344 ? 8.569   -5.565  44.035  1.00 58.99 ? 347  PRO C CA  1 
ATOM   10797 C  C   . PRO C 1 344 ? 8.121   -4.777  45.273  1.00 58.89 ? 347  PRO C C   1 
ATOM   10798 O  O   . PRO C 1 344 ? 7.037   -4.195  45.264  1.00 59.10 ? 347  PRO C O   1 
ATOM   10799 C  CB  . PRO C 1 344 ? 7.516   -6.579  43.580  1.00 59.14 ? 347  PRO C CB  1 
ATOM   10800 C  CG  . PRO C 1 344 ? 8.050   -7.891  44.056  1.00 58.97 ? 347  PRO C CG  1 
ATOM   10801 C  CD  . PRO C 1 344 ? 9.511   -7.775  43.780  1.00 59.21 ? 347  PRO C CD  1 
ATOM   10802 N  N   . ASP C 1 345 ? 8.946   -4.736  46.321  1.00 58.56 ? 348  ASP C N   1 
ATOM   10803 C  CA  . ASP C 1 345 ? 8.600   -3.989  47.532  1.00 57.97 ? 348  ASP C CA  1 
ATOM   10804 C  C   . ASP C 1 345 ? 8.339   -2.542  47.143  1.00 57.79 ? 348  ASP C C   1 
ATOM   10805 O  O   . ASP C 1 345 ? 9.256   -1.817  46.769  1.00 57.98 ? 348  ASP C O   1 
ATOM   10806 C  CB  . ASP C 1 345 ? 9.751   -4.056  48.543  1.00 58.07 ? 348  ASP C CB  1 
ATOM   10807 C  CG  . ASP C 1 345 ? 9.504   -3.212  49.806  1.00 58.35 ? 348  ASP C CG  1 
ATOM   10808 O  OD1 . ASP C 1 345 ? 8.655   -2.295  49.807  1.00 58.93 ? 348  ASP C OD1 1 
ATOM   10809 O  OD2 . ASP C 1 345 ? 10.194  -3.454  50.819  1.00 58.08 ? 348  ASP C OD2 1 
ATOM   10810 N  N   . LYS C 1 346 ? 7.102   -2.098  47.310  1.00 57.56 ? 349  LYS C N   1 
ATOM   10811 C  CA  . LYS C 1 346 ? 6.737   -0.730  46.956  1.00 57.68 ? 349  LYS C CA  1 
ATOM   10812 C  C   . LYS C 1 346 ? 7.659   0.335   47.549  1.00 57.68 ? 349  LYS C C   1 
ATOM   10813 O  O   . LYS C 1 346 ? 8.063   1.269   46.855  1.00 57.84 ? 349  LYS C O   1 
ATOM   10814 C  CB  . LYS C 1 346 ? 5.289   -0.438  47.354  1.00 57.70 ? 349  LYS C CB  1 
ATOM   10815 C  CG  . LYS C 1 346 ? 4.240   -1.242  46.589  1.00 57.51 ? 349  LYS C CG  1 
ATOM   10816 C  CD  . LYS C 1 346 ? 2.828   -0.834  47.009  1.00 57.64 ? 349  LYS C CD  1 
ATOM   10817 C  CE  . LYS C 1 346 ? 1.793   -1.760  46.391  1.00 58.15 ? 349  LYS C CE  1 
ATOM   10818 N  NZ  . LYS C 1 346 ? 0.404   -1.506  46.894  1.00 58.38 ? 349  LYS C NZ  1 
ATOM   10819 N  N   . MET C 1 347 ? 8.001   0.192   48.826  1.00 57.59 ? 350  MET C N   1 
ATOM   10820 C  CA  . MET C 1 347 ? 8.873   1.155   49.488  1.00 57.32 ? 350  MET C CA  1 
ATOM   10821 C  C   . MET C 1 347 ? 10.200  1.228   48.758  1.00 57.00 ? 350  MET C C   1 
ATOM   10822 O  O   . MET C 1 347 ? 10.680  2.313   48.413  1.00 57.33 ? 350  MET C O   1 
ATOM   10823 C  CB  . MET C 1 347 ? 9.094   0.763   50.947  1.00 57.72 ? 350  MET C CB  1 
ATOM   10824 C  CG  . MET C 1 347 ? 7.883   0.989   51.850  1.00 57.91 ? 350  MET C CG  1 
ATOM   10825 S  SD  . MET C 1 347 ? 7.431   2.738   52.025  1.00 59.01 ? 350  MET C SD  1 
ATOM   10826 C  CE  . MET C 1 347 ? 8.586   3.216   53.303  1.00 57.77 ? 350  MET C CE  1 
ATOM   10827 N  N   . LEU C 1 348 ? 10.775  0.064   48.487  1.00 56.52 ? 351  LEU C N   1 
ATOM   10828 C  CA  . LEU C 1 348 ? 12.042  -0.008  47.774  1.00 55.92 ? 351  LEU C CA  1 
ATOM   10829 C  C   . LEU C 1 348 ? 11.884  0.708   46.443  1.00 56.24 ? 351  LEU C C   1 
ATOM   10830 O  O   . LEU C 1 348 ? 12.567  1.703   46.178  1.00 56.26 ? 351  LEU C O   1 
ATOM   10831 C  CB  . LEU C 1 348 ? 12.432  -1.471  47.544  1.00 55.19 ? 351  LEU C CB  1 
ATOM   10832 C  CG  . LEU C 1 348 ? 13.738  -1.763  46.805  1.00 54.30 ? 351  LEU C CG  1 
ATOM   10833 C  CD1 . LEU C 1 348 ? 14.860  -0.924  47.356  1.00 53.86 ? 351  LEU C CD1 1 
ATOM   10834 C  CD2 . LEU C 1 348 ? 14.072  -3.230  46.937  1.00 53.95 ? 351  LEU C CD2 1 
ATOM   10835 N  N   . GLN C 1 349 ? 10.918  0.242   45.653  1.00 55.97 ? 352  GLN C N   1 
ATOM   10836 C  CA  . GLN C 1 349 ? 10.620  0.807   44.343  1.00 55.64 ? 352  GLN C CA  1 
ATOM   10837 C  C   . GLN C 1 349 ? 10.610  2.328   44.388  1.00 55.64 ? 352  GLN C C   1 
ATOM   10838 O  O   . GLN C 1 349 ? 11.085  2.994   43.465  1.00 55.96 ? 352  GLN C O   1 
ATOM   10839 C  CB  . GLN C 1 349 ? 9.269   0.291   43.862  1.00 55.36 ? 352  GLN C CB  1 
ATOM   10840 C  CG  . GLN C 1 349 ? 9.255   -1.190  43.541  1.00 55.02 ? 352  GLN C CG  1 
ATOM   10841 C  CD  . GLN C 1 349 ? 9.889   -1.493  42.205  1.00 55.05 ? 352  GLN C CD  1 
ATOM   10842 O  OE1 . GLN C 1 349 ? 9.569   -0.866  41.197  1.00 55.09 ? 352  GLN C OE1 1 
ATOM   10843 N  NE2 . GLN C 1 349 ? 10.779  -2.472  42.184  1.00 54.84 ? 352  GLN C NE2 1 
ATOM   10844 N  N   . GLY C 1 350 ? 10.075  2.874   45.472  1.00 55.45 ? 353  GLY C N   1 
ATOM   10845 C  CA  . GLY C 1 350 ? 10.037  4.312   45.619  1.00 55.00 ? 353  GLY C CA  1 
ATOM   10846 C  C   . GLY C 1 350 ? 11.438  4.868   45.753  1.00 55.01 ? 353  GLY C C   1 
ATOM   10847 O  O   . GLY C 1 350 ? 11.840  5.741   44.984  1.00 55.11 ? 353  GLY C O   1 
ATOM   10848 N  N   . ARG C 1 351 ? 12.205  4.327   46.693  1.00 54.93 ? 354  ARG C N   1 
ATOM   10849 C  CA  . ARG C 1 351 ? 13.568  4.786   46.919  1.00 54.96 ? 354  ARG C CA  1 
ATOM   10850 C  C   . ARG C 1 351 ? 14.436  4.711   45.664  1.00 55.28 ? 354  ARG C C   1 
ATOM   10851 O  O   . ARG C 1 351 ? 15.413  5.458   45.532  1.00 55.35 ? 354  ARG C O   1 
ATOM   10852 C  CB  . ARG C 1 351 ? 14.208  3.982   48.047  1.00 54.73 ? 354  ARG C CB  1 
ATOM   10853 C  CG  . ARG C 1 351 ? 13.424  4.030   49.339  1.00 54.53 ? 354  ARG C CG  1 
ATOM   10854 C  CD  . ARG C 1 351 ? 14.050  3.159   50.406  1.00 54.07 ? 354  ARG C CD  1 
ATOM   10855 N  NE  . ARG C 1 351 ? 15.267  3.759   50.941  1.00 54.43 ? 354  ARG C NE  1 
ATOM   10856 C  CZ  . ARG C 1 351 ? 16.284  3.060   51.433  1.00 54.39 ? 354  ARG C CZ  1 
ATOM   10857 N  NH1 . ARG C 1 351 ? 16.219  1.737   51.450  1.00 54.86 ? 354  ARG C NH1 1 
ATOM   10858 N  NH2 . ARG C 1 351 ? 17.359  3.680   51.911  1.00 53.73 ? 354  ARG C NH2 1 
ATOM   10859 N  N   . LEU C 1 352 ? 14.081  3.819   44.741  1.00 55.31 ? 355  LEU C N   1 
ATOM   10860 C  CA  . LEU C 1 352 ? 14.839  3.669   43.502  1.00 55.40 ? 355  LEU C CA  1 
ATOM   10861 C  C   . LEU C 1 352 ? 14.996  4.988   42.770  1.00 55.74 ? 355  LEU C C   1 
ATOM   10862 O  O   . LEU C 1 352 ? 16.047  5.274   42.204  1.00 55.94 ? 355  LEU C O   1 
ATOM   10863 C  CB  . LEU C 1 352 ? 14.149  2.681   42.576  1.00 54.82 ? 355  LEU C CB  1 
ATOM   10864 C  CG  . LEU C 1 352 ? 14.279  1.232   43.014  1.00 54.50 ? 355  LEU C CG  1 
ATOM   10865 C  CD1 . LEU C 1 352 ? 13.576  0.313   42.040  1.00 54.35 ? 355  LEU C CD1 1 
ATOM   10866 C  CD2 . LEU C 1 352 ? 15.737  0.895   43.080  1.00 54.15 ? 355  LEU C CD2 1 
ATOM   10867 N  N   . PHE C 1 353 ? 13.939  5.786   42.794  1.00 55.97 ? 356  PHE C N   1 
ATOM   10868 C  CA  . PHE C 1 353 ? 13.920  7.081   42.133  1.00 56.05 ? 356  PHE C CA  1 
ATOM   10869 C  C   . PHE C 1 353 ? 14.414  8.216   43.011  1.00 56.13 ? 356  PHE C C   1 
ATOM   10870 O  O   . PHE C 1 353 ? 15.273  8.994   42.615  1.00 56.50 ? 356  PHE C O   1 
ATOM   10871 C  CB  . PHE C 1 353 ? 12.489  7.390   41.694  1.00 55.97 ? 356  PHE C CB  1 
ATOM   10872 C  CG  . PHE C 1 353 ? 12.195  8.859   41.558  1.00 55.60 ? 356  PHE C CG  1 
ATOM   10873 C  CD1 . PHE C 1 353 ? 12.659  9.578   40.462  1.00 55.67 ? 356  PHE C CD1 1 
ATOM   10874 C  CD2 . PHE C 1 353 ? 11.463  9.526   42.532  1.00 55.42 ? 356  PHE C CD2 1 
ATOM   10875 C  CE1 . PHE C 1 353 ? 12.397  10.941  40.344  1.00 55.18 ? 356  PHE C CE1 1 
ATOM   10876 C  CE2 . PHE C 1 353 ? 11.199  10.887  42.421  1.00 54.83 ? 356  PHE C CE2 1 
ATOM   10877 C  CZ  . PHE C 1 353 ? 11.666  11.594  41.327  1.00 54.83 ? 356  PHE C CZ  1 
ATOM   10878 N  N   . ALA C 1 354 ? 13.829  8.312   44.196  1.00 56.08 ? 357  ALA C N   1 
ATOM   10879 C  CA  . ALA C 1 354 ? 14.119  9.367   45.149  1.00 56.04 ? 357  ALA C CA  1 
ATOM   10880 C  C   . ALA C 1 354 ? 15.565  9.751   45.444  1.00 56.20 ? 357  ALA C C   1 
ATOM   10881 O  O   . ALA C 1 354 ? 15.918  10.939  45.424  1.00 56.48 ? 357  ALA C O   1 
ATOM   10882 C  CB  . ALA C 1 354 ? 13.393  9.077   46.447  1.00 55.97 ? 357  ALA C CB  1 
ATOM   10883 N  N   . TYR C 1 355 ? 16.401  8.765   45.735  1.00 56.32 ? 358  TYR C N   1 
ATOM   10884 C  CA  . TYR C 1 355 ? 17.783  9.062   46.092  1.00 56.27 ? 358  TYR C CA  1 
ATOM   10885 C  C   . TYR C 1 355 ? 18.657  9.800   45.060  1.00 56.68 ? 358  TYR C C   1 
ATOM   10886 O  O   . TYR C 1 355 ? 19.274  10.818  45.398  1.00 56.69 ? 358  TYR C O   1 
ATOM   10887 C  CB  . TYR C 1 355 ? 18.448  7.820   46.682  1.00 55.80 ? 358  TYR C CB  1 
ATOM   10888 C  CG  . TYR C 1 355 ? 17.851  7.422   48.025  1.00 55.26 ? 358  TYR C CG  1 
ATOM   10889 C  CD1 . TYR C 1 355 ? 18.600  7.508   49.187  1.00 54.93 ? 358  TYR C CD1 1 
ATOM   10890 C  CD2 . TYR C 1 355 ? 16.543  6.952   48.128  1.00 55.18 ? 358  TYR C CD2 1 
ATOM   10891 C  CE1 . TYR C 1 355 ? 18.073  7.135   50.420  1.00 54.91 ? 358  TYR C CE1 1 
ATOM   10892 C  CE2 . TYR C 1 355 ? 16.007  6.575   49.364  1.00 55.15 ? 358  TYR C CE2 1 
ATOM   10893 C  CZ  . TYR C 1 355 ? 16.786  6.671   50.507  1.00 55.04 ? 358  TYR C CZ  1 
ATOM   10894 O  OH  . TYR C 1 355 ? 16.305  6.290   51.741  1.00 54.90 ? 358  TYR C OH  1 
ATOM   10895 N  N   . PRO C 1 356 ? 18.740  9.308   43.804  1.00 56.96 ? 359  PRO C N   1 
ATOM   10896 C  CA  . PRO C 1 356 ? 19.564  10.030  42.822  1.00 57.16 ? 359  PRO C CA  1 
ATOM   10897 C  C   . PRO C 1 356 ? 18.940  11.402  42.589  1.00 57.38 ? 359  PRO C C   1 
ATOM   10898 O  O   . PRO C 1 356 ? 19.639  12.401  42.406  1.00 57.89 ? 359  PRO C O   1 
ATOM   10899 C  CB  . PRO C 1 356 ? 19.439  9.169   41.568  1.00 57.13 ? 359  PRO C CB  1 
ATOM   10900 C  CG  . PRO C 1 356 ? 19.274  7.801   42.117  1.00 57.27 ? 359  PRO C CG  1 
ATOM   10901 C  CD  . PRO C 1 356 ? 18.282  8.023   43.245  1.00 57.36 ? 359  PRO C CD  1 
ATOM   10902 N  N   . ASP C 1 357 ? 17.611  11.436  42.638  1.00 57.43 ? 360  ASP C N   1 
ATOM   10903 C  CA  . ASP C 1 357 ? 16.855  12.662  42.447  1.00 57.29 ? 360  ASP C CA  1 
ATOM   10904 C  C   . ASP C 1 357 ? 17.281  13.711  43.463  1.00 57.26 ? 360  ASP C C   1 
ATOM   10905 O  O   . ASP C 1 357 ? 17.797  14.770  43.096  1.00 57.40 ? 360  ASP C O   1 
ATOM   10906 C  CB  . ASP C 1 357 ? 15.355  12.388  42.590  1.00 57.03 ? 360  ASP C CB  1 
ATOM   10907 C  CG  . ASP C 1 357 ? 14.506  13.600  42.241  1.00 57.03 ? 360  ASP C CG  1 
ATOM   10908 O  OD1 . ASP C 1 357 ? 14.754  14.210  41.183  1.00 56.57 ? 360  ASP C OD1 1 
ATOM   10909 O  OD2 . ASP C 1 357 ? 13.590  13.948  43.020  1.00 57.17 ? 360  ASP C OD2 1 
ATOM   10910 N  N   . THR C 1 358 ? 17.104  13.401  44.744  1.00 56.92 ? 361  THR C N   1 
ATOM   10911 C  CA  . THR C 1 358 ? 17.463  14.347  45.792  1.00 56.56 ? 361  THR C CA  1 
ATOM   10912 C  C   . THR C 1 358 ? 18.935  14.737  45.749  1.00 56.58 ? 361  THR C C   1 
ATOM   10913 O  O   . THR C 1 358 ? 19.281  15.891  46.000  1.00 57.04 ? 361  THR C O   1 
ATOM   10914 C  CB  . THR C 1 358 ? 17.102  13.819  47.188  1.00 56.23 ? 361  THR C CB  1 
ATOM   10915 O  OG1 . THR C 1 358 ? 17.304  14.857  48.151  1.00 55.64 ? 361  THR C OG1 1 
ATOM   10916 C  CG2 . THR C 1 358 ? 17.951  12.625  47.547  1.00 55.77 ? 361  THR C CG2 1 
ATOM   10917 N  N   . HIS C 1 359 ? 19.798  13.792  45.398  1.00 56.40 ? 362  HIS C N   1 
ATOM   10918 C  CA  . HIS C 1 359 ? 21.222  14.085  45.326  1.00 55.87 ? 362  HIS C CA  1 
ATOM   10919 C  C   . HIS C 1 359 ? 21.508  15.140  44.276  1.00 55.87 ? 362  HIS C C   1 
ATOM   10920 O  O   . HIS C 1 359 ? 22.285  16.074  44.514  1.00 55.91 ? 362  HIS C O   1 
ATOM   10921 C  CB  . HIS C 1 359 ? 22.001  12.818  45.025  1.00 55.78 ? 362  HIS C CB  1 
ATOM   10922 C  CG  . HIS C 1 359 ? 22.011  11.848  46.161  1.00 55.88 ? 362  HIS C CG  1 
ATOM   10923 N  ND1 . HIS C 1 359 ? 21.958  10.482  45.978  1.00 55.86 ? 362  HIS C ND1 1 
ATOM   10924 C  CD2 . HIS C 1 359 ? 22.043  12.050  47.498  1.00 55.83 ? 362  HIS C CD2 1 
ATOM   10925 C  CE1 . HIS C 1 359 ? 21.954  9.884   47.158  1.00 55.83 ? 362  HIS C CE1 1 
ATOM   10926 N  NE2 . HIS C 1 359 ? 22.006  10.816  48.097  1.00 55.85 ? 362  HIS C NE2 1 
ATOM   10927 N  N   . ARG C 1 360 ? 20.841  15.013  43.130  1.00 55.44 ? 363  ARG C N   1 
ATOM   10928 C  CA  . ARG C 1 360 ? 21.013  15.962  42.044  1.00 55.20 ? 363  ARG C CA  1 
ATOM   10929 C  C   . ARG C 1 360 ? 20.701  17.360  42.544  1.00 55.53 ? 363  ARG C C   1 
ATOM   10930 O  O   . ARG C 1 360 ? 21.258  18.334  42.050  1.00 55.56 ? 363  ARG C O   1 
ATOM   10931 C  CB  . ARG C 1 360 ? 20.127  15.576  40.862  1.00 54.93 ? 363  ARG C CB  1 
ATOM   10932 C  CG  . ARG C 1 360 ? 20.617  14.308  40.166  1.00 54.65 ? 363  ARG C CG  1 
ATOM   10933 C  CD  . ARG C 1 360 ? 19.605  13.681  39.208  1.00 54.33 ? 363  ARG C CD  1 
ATOM   10934 N  NE  . ARG C 1 360 ? 20.044  12.337  38.831  1.00 54.58 ? 363  ARG C NE  1 
ATOM   10935 C  CZ  . ARG C 1 360 ? 19.269  11.253  38.830  1.00 54.64 ? 363  ARG C CZ  1 
ATOM   10936 N  NH1 . ARG C 1 360 ? 17.994  11.337  39.176  1.00 54.84 ? 363  ARG C NH1 1 
ATOM   10937 N  NH2 . ARG C 1 360 ? 19.786  10.065  38.533  1.00 54.30 ? 363  ARG C NH2 1 
ATOM   10938 N  N   . HIS C 1 361 ? 19.859  17.440  43.573  1.00 55.89 ? 364  HIS C N   1 
ATOM   10939 C  CA  . HIS C 1 361 ? 19.482  18.713  44.191  1.00 56.29 ? 364  HIS C CA  1 
ATOM   10940 C  C   . HIS C 1 361 ? 20.445  19.086  45.305  1.00 56.64 ? 364  HIS C C   1 
ATOM   10941 O  O   . HIS C 1 361 ? 21.103  20.119  45.239  1.00 56.81 ? 364  HIS C O   1 
ATOM   10942 C  CB  . HIS C 1 361 ? 18.053  18.649  44.763  1.00 56.28 ? 364  HIS C CB  1 
ATOM   10943 C  CG  . HIS C 1 361 ? 17.710  19.769  45.711  1.00 56.41 ? 364  HIS C CG  1 
ATOM   10944 N  ND1 . HIS C 1 361 ? 17.490  21.065  45.296  1.00 56.44 ? 364  HIS C ND1 1 
ATOM   10945 C  CD2 . HIS C 1 361 ? 17.517  19.772